'VDfD0NetBSD/earmv6hf ramdisk 08F?f<  F?f!t tF?f@@<@T 08F?f<  F?f!t tF?f@@<@TU F?fthh`AF?fF?fF?fAF?fF?fF?fA.F?fF?fF?f AF?fF?fF?f?AF?fF?fF?f5AF?fF?fF?f7AF?fF?fF?fSAF?fF?fF?fTAF?fF?fF?fUAF?fF?fF?fWCF?fF?fF?f`AF?fF?fF?faAF?fF?fF?fg$ F?fF?fF?fmC!F?fF?fF?f (08@HPX`hpx$QF?fF?fF?f (08G$@F?fF?fF?f@HPX`hpxH$OF?fF?fF?f@$QF?fF?fF?fF!F?fF?fF?f aF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?faF?fF?fF?f aF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?f!F?fF?fF?f4!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f B!F?fF?fF?f B!F?fF?fF?f!F?fF?fF?f"!F?fF?fF?f"!F?fF?fF?f"aF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?faF?fF?fF?f aF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f!F?fF?fF?f !F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f!F?fF?fF?f !F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f !F?fF?fF?f!F?fF?fF?f !F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f?\!F?fF?fF?f>\!F?fF?fF?f=\!F?fF?fF?f<\!F?fF?fF?f;\!F?fF?fF?f:\!F?fF?fF?f9\!F?fF?fF?f8\!F?fF?fF?f?\!F?fF?fF?f>\!F?fF?fF?f=\!F?fF?fF?f<\!F?fF?fF?f;\!F?fF?fF?f:\!F?fF?fF?f9\!F?fF?fF?f8\!F?fF?fF?f:\!F?fF?fF?f7\!F?fF?fF?f6\!F?fF?fF?f5\!F?fF?fF?f4\!F?fF?fF?f3\!F?fF?fF?f2\!F?fF?fF?f1\!F?fF?fF?f0\!F?fF?fF?f7\!F?fF?fF?f6\!F?fF?fF?f5\!F?fF?fF?f4\!F?fF?fF?f3\!F?fF?fF?f2\!F?fF?fF?f1\!F?fF?fF?f0\!F?fF?fF?f2\!F?fF?fF?f/\!F?fF?fF?f.\!F?fF?fF?f-\!F?fF?fF?f,\!F?fF?fF?f+\!F?fF?fF?f*\!F?fF?fF?f)\!F?fF?fF?f(\!F?fF?fF?f/\!F?fF?fF?f.\!F?fF?fF?f-\!F?fF?fF?f,\!F?fF?fF?f+\!F?fF?fF?f*\!F?fF?fF?f)\!F?fF?fF?f(\!F?fF?fF?f*\!F?fF?fF?f'\!F?fF?fF?f&\!F?fF?fF?f%\!F?fF?fF?f$\!F?fF?fF?f#\!F?fF?fF?f"\!F?fF?fF?f!\!F?fF?fF?f \!F?fF?fF?f'\!F?fF?fF?f&\!F?fF?fF?f%\!F?fF?fF?f$\!F?fF?fF?f#\!F?fF?fF?f"\!F?fF?fF?f!\!F?fF?fF?f \!F?fF?fF?f"\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f \!F?fF?fF?f \!F?fF?fF?f \!F?fF?fF?f \!F?fF?fF?f \!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f \!F?fF?fF?f \!F?fF?fF?f \!F?fF?fF?f \!F?fF?fF?f \!F?fF?fF?f\!F?fF?fF?f \!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f\!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f!F?fF?fF?f !F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f !F?fF?fF?f!F?fF?fF?f !F?fF?fF?f!F?fF?fF?f!F?fF?fF?f$!F?fF?fF?f4!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f !F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?faF?fF?fF?faF?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?faF?fF?fF?f aF?fF?fF?faF?fF?fF?f aF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?f?\aF?fF?fF?f>\aF?fF?fF?f=\aF?fF?fF?f<\aF?fF?fF?f;\aF?fF?fF?f:\aF?fF?fF?f9\aF?fF?fF?f8\aF?fF?fF?f?\aF?fF?fF?f>\aF?fF?fF?f=\aF?fF?fF?f<\aF?fF?fF?f;\aF?fF?fF?f:\aF?fF?fF?f9\aF?fF?fF?f8\aF?fF?fF?f:\aF?fF?fF?f7\aF?fF?fF?f6\aF?fF?fF?f5\aF?fF?fF?f4\aF?fF?fF?f3\aF?fF?fF?f2\aF?fF?fF?f1\aF?fF?fF?f0\aF?fF?fF?f7\aF?fF?fF?f6\aF?fF?fF?f5\aF?fF?fF?f4\aF?fF?fF?f3\aF?fF?fF?f2\aF?fF?fF?f1\aF?fF?fF?f0\aF?fF?fF?f2\aF?fF?fF?f/\aF?fF?fF?f.\aF?fF?fF?f-\aF?fF?fF?f,\aF?fF?fF?f+\aF?fF?fF?f*\aF?fF?fF?f)\aF?fF?fF?f(\aF?fF?fF?f/\aF?fF?fF?f.\aF?fF?fF?f-\aF?fF?fF?f,\aF?fF?fF?f+\aF?fF?fF?f*\aF?fF?fF?f)\aF?fF?fF?f(\aF?fF?fF?f*\aF?fF?fF?f'\aF?fF?fF?f&\aF?fF?fF?f%\aF?fF?fF?f$\aF?fF?fF?f#\aF?fF?fF?f"\aF?fF?fF?f!\aF?fF?fF?f \aF?fF?fF?f'\aF?fF?fF?f&\aF?fF?fF?f%\aF?fF?fF?f$\aF?fF?fF?f#\aF?fF?fF?f"\aF?fF?fF?f!\aF?fF?fF?f \aF?fF?fF?f"\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f \aF?fF?fF?f \aF?fF?fF?f \aF?fF?fF?f \aF?fF?fF?f \aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f \aF?fF?fF?f \aF?fF?fF?f \aF?fF?fF?f \aF?fF?fF?f \aF?fF?fF?f\aF?fF?fF?f \aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\aF?fF?fF?f\ !F?fF?fF?fi!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f aF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?f aF?fF?fF?faF?fF?fF?f aF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?f!F?fF?fF?f!F?fF?fF?faF?fF?fF?faF?fF?fF?f!F?fF?fF?f!F?fF?fF?f!F?fF?fF?f B!F?fF?fF?f B!F?fF?fF?f!F?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?faF?fF?fF?f!F?fF?fF?f!F?fF?fF?faF?fF?fF?f aF?fF?fF?faF?fF?fF?f aF?fF?fF?faF?fF?fF?faF?fF?fF?fF?fF?fF?fbpf!F?fF?fF?f $F?fF?fF?f'$F?fF?fF?f($F?fF?fF?f$sF?fF?fF?f+$F?fF?fF?f0$F?fF?fF?f2AF?fF?fF?f6mF?fF?fF?f8@$2F?fF?fF?fHP $F?fF?fF?fXAF?fF?fF?fbAF?fF?fF?fcAF?fF?fF?fdAF?fF?fF?feAF?fF?fF?ffAF?fF?fF?fhAF?fF?fF?fiAF?fF?fF?fjAF?fF?fF?fkAF?fF?fF?fl_1D+VT/F$}kr[=5|9NaZYBp=Czo9ǯIHR%,q}9;OQ}1V[ 1:M=k(Z ms֫}OLJ4]Y |SQdqe[Ql(59eag۾@jP54 f4}Q%coM77rvaX^8LO 1YEaie;lP /Cg΂ CSz+c [1ap,0s&|H>woeNx\$PzS07K.$/ ew}" Tn^p"B Hځb{9>|n^4]m/Rzy6>K 3t . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.2.102.1 2020/01/28 10:20:24 msaitoh Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=vt100 export TERM HOME=/ export HOME umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? echo '' # mount the ramdisk read write mount -u $ROOTDEV / # mount the kern_fs so that we can examine the dmesg state mount -t kernfs /kern /kern # run the installation or upgrade script. sysinst || stty sane fi  . .. catchmod cp dd df ed ln lsmkdir mv pax pwd rmrmdir shsttysyncchgrpELF(4T!4 (N N  %%t L8 %%NetBSD5 NetBSDearmv6hf9 0-D D0 @@0@TL0(P0PEPP03/T0p$,$ -l ll0 @0LT( R@ppGppP`03/T0@S H $ -pL M`QK \1 T1`p0\0: 81 0S  /S 0SP X00S5 0@0@T*P0PEPP03/T@0@0T*P0PEPP03/U ʊlL d0 00 P0 0 ~$$Xt$,$ܔ%Ē | -xLtPl@d`hPP O;YTpPOU EP @do&<u P-L@ KhyH0`  BR` pRp RX Xp/h&& -pP  b L00CS0w`p@ ZE0S TX 0S7  0T0R0S p ||5x16@' 0@ LA\?000`00816@0/ 0S !16@ 0S $p @ T T 0S ^p Ip0S TMwp -sp @000 ^ip T@?0 @P&l&&h&Doƨ -@Pp`0L M00S 00 TP 00P@P p0 P00S(K @0 P0:T0`00 ch&P&WcD -LM1Vu. @uP$0S(0SKSP<0 S(0(` VP$Vz$0S;(00$0( $`P  \q00 KH.p$ P`Vph&P&|&Do -LMPLqLa@H1tDDt@00SC 0 ]TP0@tt@) 8 R y@PKp0: S y0 P00S(K\@P0 P0f0s s0T eT |.h&P&WDř -L0 z& 000/ሬ' --LM` l0@  2 A'2  A{{`z$$(K KЫ Y@'& -L$M@4K00@K P K%  d1-000`QzL@ 5 5PP V0SP P0V;0' %P xP W+ 0X'ptVV pkV0-S t`P`PPL@p ,PP0SV  &2<'F -LM5  R  @P (K ppp |!@p5X`0S `50ST50S D50S,50S+ U%@E00CS0P줟 Pp  PYU O@0 P00CS0 0 YKL {ps8\/00 dp 4 pPe 0 K \@P0@@ K K 00 30 -KP0 00 0 \00Sk 00 0 p  =0p ]  p@T T1#0 C0 P< |@P s@肟0S  ,P fT\10: S200 HHT/ l+  T+ pP.K ?.K0@DS .KKQTT&@ 0 Pp  0S00S tt-K ?-K0S -KK.( S0P  0T-K8@T \@@0 00R0S 0  0 0RKP @CP ll@0S LP@ 0Rt0l00mP ꠬'&D'''''&Rh&''a'&'' 0-LMPAK@A p  0K0U4@ h.P XXK0AK<@PAKA,(0P X&' Q0-L@ XP HHl00P$($0P0K0h&' Q0-L@ \P LLJ0"0MP$($0P0K0h&' -L0 &0$/'0$/ ' -L+뜟 -L+벟 -L+ɟ -Lx+ߟQ 1-LM  0L 0 KЬ' 1-LM  0: 0 K ' 1-LM  0( 0 K' 0-LM  0 0 Kx' 0-LM  000 K0 '' 0-LM $ 0 P. K3& 1-LM (0 00 K>p' -LM800 0 0 0 Kج'J ' -LM800 0 0 0 Kج'\' ,0-`LM!A!qPU0 x! R0B=00 B  Pu0H!@!7 Q8A 40100 KjP *=AP 000PS  $K 0p P4  04 00003/Q ! 7000@080LQ*D0 ''ج'#='TmHǠ/ 0-LP@|P00!QP800 ` p0 A R0SR ꄭ'' '0  /' '  - L*ZD -L  - L)XD -L -L M@K5PKh KPK -(PLU@𨝈80 03/`P)8003/(`苡 -LM80@0K(3/P $ )08 : S( 0p K3/P   00 0K00 0 1/0 QP%R0S 00Dm8@ p-@P`LM, KL;80 (0(3/@ R P,K.RPKp`' -L$MdCP` $KPS$KZ#K@30F 0 # p8p (1/0 QP$ P)! 0P܃KR K0 <0`Mr<  ?P#K0#K0$ T)Q0S$ < 0#K0 r# 0#1!B#! 0 ԃK40`# 0ԃK#$K SRtq!ԄK SR !$KDq P0!YX(:$Kq!! 0!#KKSR 0 0S0$0t 0$ #KKR 0K 0  A5 000L0! PAa B0 4(KoB(K ''ج'D'ʡ -LMt2 @  `) 0  D"K@G0}S% b@@GHD0}S% ?@XP0!!!! d K !@PK}LK " StRp d!dKKiLK " S$R  !dKKULK # SR  dKKALK ?8p<` !0A/0K0 /KX dp`KK LK $KЬ'b'ǢڢQ @-LL -LMa P00@4p1!%@08@ (1/0 QP$ , $K`尀T 80 $0(3/P 0 PUP@Dd 0S0C0P'0  Y$$ ''ج'D&+ -LMpQ 004@ !#08 (1/0 QP$ g'=  (0 80"K0, K(3/P$K80 $0(3/P`p#SR $ 0P2K80(P 0, Kl(3/pTP #SR !QP` p `p 'Dm P-0@0 LM 00 0K0m K KƨU -LMp K`P @PD&KLPKPNV@\ -\@LP`UPE  cGPoQح' -ML M01` Q Q  Q 0S&(KoPP@╦&` 0S00S 0  P 0啦'S D G`N@T(KK@G B>K0CKKZ P K Aح' 1-PL@ 1 QP p 1 ޱP NJt pld1P `R3P000@1U@@@@PN+ 00CS000   9 0@0CS000l00 $0U0 N< 8sL şȰ''''&'<'4'\ 0-LR RS 0S Rs0Ȱ'V 0-<<@L000(!S& PPP P100 PU0P0SU0T@'00 q 0LPPP 0Pp0P P0CPU0P  0<''&4'Ȱ'4' 0-DP@L00 00@0@000000踳'4' -`LEPP@ MK< 84@0p S@Dt0S  弰PM( 20000 <0T0?x` 0 M < 8L  @ &''' 0 -0 L?0MP AP@@IP  0P/S哈0 @P^s0p` `O\0PH I@','ݧק'''D -`LP P|@ @.M 0`` \7P PP   P@P 00@''PS&0'' D0P-PL ,@ P  0 0''  -DL@fP(0( 00000 S0'h&Ȱ''@-44@@00  AR   ''//// -P`0LSp.@l000PL 00CS000  #0`0CS0P000 '''<'&4'A- px0x `t0PF@0P\0U00VXUp00'''H0-D @00^P0 0Q0''' -L M2PP 0p#K20Kt2t>IP4@K 0K)@P(K@8b P PUT  PtP00 :  R R1S7IP 0KP 00SYA嘑S@ @@  P?KJ\ XT00CS0<10) 0`00SHPT 0@0@00S P P  QP 000CS0\00@0  2D1v$'b''h&$'<'&4'G^a -@xPx`0L00h0@`0@\0@X0@C0@0CS0800 <''''''4' -L M@p0P U UZ(K `P 0崀 尐RP00@P0S1P 0S 0 J0 0 CoP P@TP$'u@',''`@-`0 @CT`@ pT00 P0S@XuX0X h& -L M@r崂0SX pP_0`^ `Vx000l2Tpp`2pp00 P00] 0p0CS0 20d Ub10P 10 10Sd 10S` V`F]Z 40`0CS010?uPU0 Pd1@ 00CS0 {0 P U !Q00 000T````NP0 lJ Lv00CS000 0@ UJl h5h_`(KT (0`0   0 ꄯ' '<''4',''& -LM$R< r000 040 200010S O@1a0<@0 0P80 @0(<0I?oT20SU 400 SRP u0S RY@T  Y 0 0  4 00$10S@@ @0 1 P@000CS000 (K VS  p0P  BR p 8 @0S Y04 0(','4'''<'&'4' -0L!S@` PPI 0h{yEpP0!S  P mI 0HHLH<00S ,@$0@cPS&ʨh'' -P@lpL`V0S vP 9I$ Cȕꄯ'& -L MpP0` 00 R O@ȐȠU00U0S 000S D@@P(K 0R R L R  0 40 P40P@`ꄯ'4','' -p0L!SP`@A P`H9 0@' P0!S  P H 0LLLZ@00S 0T@G@脹PS&(h' -PL M@b00CS05wp \ @T࡟A܁00 001UppppMP0 #kH Ku00CS0Jt10 P0@P@0 6 0p0CS010r0S00 R 000 0 0 (K0@ !H h|+ 0`00\0 @`0T00T  h&8''<'&4',''$'AL -L M$p0 P0 SPEUP(KE P 0"00@S0 Ub  PG6  00C0S.h20 & D00CS0$200 F@ 0 C00S P䡟PEP  R R  `V' V ,x4 ^P4  |GD @\< 00C0  BR  !  @Y PFP 00 C00SPF V0000VPPPPP 0P0CS0<00tv00`A$','<'&4''G -@LP`p |@`U / 0@Sz@ @^R00\P0S \Z l5P h0 @@P*0@00^&c&{l -LMT @0D KP 1[S( 0C01[S 0C0 K4'ht@& `0` 0-SP0 R0LRP$ S ''@'4'V -LMPpP@ `X 0S@ @0S @T@@DT 0 rP 00S 0 0 0 P(K踳','4'u -PPLpa t0t0S`@T>P 0 PP@ PV4'' T0-0L0083 ,0aA!R   l&~H'D' @0-0L00 $0a@ Kh l&H'~ -L M䂟Pr0 ` R  36㤂嬢 @-T @%T[ . T $T T-00  R ,#U\ 4 E4  吽@q J4 E4 "QD  (K``+T ('Tc V YB! R=9T0T7*.TI /TQ3 X /DoP Q  ?T ^T ;TQ 0;T000 0!0,^T-T b @^T-T  Q]E0 0'!@rRE "RQ  .T  <0Q 00-P$'l&''4'@'V 0-@p0P0`娀L00*P 000000 ,R;R 0S  S   0;SRp''@''$'p@- 0 P@@ SR@@\ paVQ B0D'H' 0-LP>@P DE, ($ 0 00& Q-L 0Q\SAo 0- LR,  @0`S! P28pP F@PP @P 0 S@/R/    B0 y4'4' ,0-LQ  @4' 80- LR\ @d4'' -`q匁L10SPW h1P00S S L!`0`00P0S00 S@P0.S0 S 䐟@ 0007PP 00CS0$0 \ V  T d0 00CS00 `P踳'$'(''h&4'' -L M 0`R`FppVRQ0 0@00wtp00 1 10S M l1 00CS0M=?(K cP00CS0+  R  SP A R#;`8p p  R000`00C0@\0@0  p`@'4''4''('' -@DQL81 0R``S`qVPBP@PD`B@PU.000]P 00CS0)0 {" .Y P  h0 00CS00PU*P`'@''4'' -Q 0L0@0P` 00CS010 5* {PpH0SӉ00S c 0@D@@C\0pT0 0@0CS04'4'(''' -L M2`0pSROP|B U$p0 @Sl000L2XPPPPsPRB r00CS00& s0P  R/ R 00 MP00kB |Kxu00CS00    BR   :0P0 P0CS00 0  !P0P0`F`06P  P  X0 00CS0(K4'4'&b'' -ALpXP `0C AR1 0 C000`PAK 00CS00  Z00CS`00 \R pR p4'& -L M0D00 0@S 0S $0KePp(K00$S/T SPPP ( ePA d00CS00  0$P0CS(00! P(0( 0 S- R0003U````&P0 0`0CS00 (9#0P  !@o!S? %S $ Z)0(0043UPA} 00CS00 k0$0CS(000( 000\Q0 0 PR$ $ R0(002UP 0$0CS(00WY0 (0 0S 0S꜁p0$pS Sp|  ( P 0$p0CS(00*,0(0P E S:p00  ,0S p+<$0 P (00PE0 BR0    P00(0GPQ 0$0CS(00 4'$'& ''<'aͩ`' ,0-LQ  @4' \00-0LS@ 0!S 8E=P /.P 9004'h -LMA00 S1"Q,q`WX0|000PC@o 00CS00. 8000 @P R8 R  KPK0!S #P @  { 0 Sڼ Q0,q0CS00000 0 0  \00mP 0  00$'l&4'& ' -P?L0@ @T@ "C`hV  1QVB EVO !Va =VE V??P? HV PV GV cV WV aV VVeV :fVx gVqV 9lVb jV1 (o Pp  @ 0n\O p\H l\I 00 SnV f:pV|>rP 0nP pP lP 00 S ? quV1 2sV8  >VPvn NPo>0SH pW=0W@ 0nQ  pQ lQ 00 SCh=0Sd wJwV /:xVs zVs<=$=P<0010CSx 0nP pP lP 00 S<<00S@0 0nQ pQ lQ 00 S   @@<<0S \<3PP@NlP 0nQ pQ lQ 00 S;0S ;;eP@0@@pkP@ 0nQ! pQ lQ 00 S;0S <;;<P$+0 S00@0@@* R *4!R@ * R4 000@ `P @ 0nQ, pQ% lQ& 00 SmH:Px Pt}P@0S!S  60S i,0S,`\ N@0@@LPRf t9 0)0)0t) R000@ P< 0!S( @ 0nP pP lP 00 S0S 5xq@0@@|x@TD8PG@oGFCoP㨂VVP 0nQ pQ lQ 00 S000D@0@@70SH 0nQ pQ lQ 00 S@'0S! 44D@0@@h70S( 0nQ pQ lQ 00 S,'810cS81@0@@0S@@0 0nQ pQ lQ 00 S\60S@@@06_P 0nQ pQ lQ 00 Sa50S55P ;c@0@@@0@@x51PQ 0nQ pQ lQ 00 S 2X505wP@:@0@@4 P-tdP&40SXz40Xv X@@ X@TH 0nQ pQ lQ 00 S 40S@0@@3P 0nQ pQ lQ 00 S  @0@@ 0B  30S3@ 0nQ pQ lQ 00 S3 R" R#  @0@@30S0 nR pR lR 0 S20S@ 241SqV@@000@ t20Sd2 X2 `P~ @ 0nQ1 pQ* lQ+ 00 S_10SR,0S0!S ,40S,0S a1MPS 10S l1 @0@@la0 9R'0Rf* RU T( 8130   \  R]\0 -LM⤁`Pp0 SS(1PG(!RJt,000d1U````s@P.94 0r,00CS010 [S@ \S @p@P0 S|@ 0(a0CS,A0t00,A 1 P0 0pS 0(Koi$''<'&4'S.,' -(!L0 PB@ P00!@R60A0S S f`P@ P0P 00S@0@00 P0A p0\ 0c00AYP@08^0 ,($'u'E|'''& -L M"R0%Q Q0Q0(K O`AQhu Q@%PoA2 Ry 0001T````rP\8 q00C0>\QK@ Q10S xxaP2 00P S,00 S 0S00  T````3P00Q8 1[00C0S{00z 0`00@hp@X0`00CS0400cH 0@  V$'г'4''<'&(''h&ȳ' -@䀟@0@L Y0Pp`@ P" 0 R00 R000 1BQ7@ @X幯@p70"S,@gR000$'ȳ' -LM@40 3s`0 80 80#0 夃0FSP Tc000|3T00PP 0P0CS0@30?A 30 10&SM 0AQ 00CR@:` QP\@0 < YP< @0v7 |Vx00C0S @(K@20  PAQ \S0F 01BQA40 BR=  AQ 0J R@)` QP\Da$K$KP 7 '00C0PAQ T`<0  T  PP<0 P P  BR D   `@Pг'ij'ȳ'̳'<'4'& -LM2 @" 0P2 40S 0 0 $2 00 ?KPP (K@b4R 042S PS202 2pW 2 3   W ,(" hP("6 f  B R30  X3  BR L3030S 0 | ".0 K|@P"2Q Q 000""2 0 0?K ZP 2$"Pd"PEp0ZnL" LWppp22 P2"N6 !00C0S pW,ڸ1 (2   W , " P "(22 5]l hd2  B k8  BR ,10eg00S 0  m.@|0p0CS000HJU ڃ?K 02 T00S 0  D.D 0 @ 2S,'ij'̳'<'&4'Yb -pLM`ḁA0Q0C4 8 0< 1< 0 0C SWQOp  80 4P(K5 PP!000 000 cP00CS000  X  00 S00CS0x00pP   P''<'@'uij'4' -LM2B b@ prD0  0s(KQ0S 1 !0 000 PP@# L:*8PK ^ J 0Gt10S W0D 00p0@0@!000CS0B,1: X ܓ,,     "     B   @  CL 4' &'t''<'('4' -PL` 0 C#r 0h 0 `0 \   BP 0C @pT Y+@꼰'' &4' -P0 LRp@` d00@P P0@ 0@4$0@ 4$ "4, ($,@@꼰'& -L0 넫& -GMLM\5p PR@`<%QGK454A03/P (K:K,0C1: S300W K+ @+tPD3?0GK4AlP:K,0C1: S 0S GK4AQP:K,0C1: S 0S 0S 0/S.GK4A<P ?GK4A@G-K0P8 B00S0P0 ^VK @P  K0#,@PJK,@DK+ @+K @/ 0P KD#P @tGKK4A @P ]/XVPp/pRVPg00P="GZ9HY6U.0B~K pG0 G-K< B0 +,0K G=K<0C04JEKAǾPT.00 +,0K ICKAᶾP K,LL)LQP!LSR G=K80C0 ?oR2  R 0S= :K,0C1: S7P6   R0S/ Tg#XpH DX00CS0 Pp  YX PX0 X 00CS0 0 V0S .ppWP 0 h R;c 00,Գ'HD>cW&h&&\\/\0\/X X0-dDT V H H0R\\//0X X-dDT V HH Q\\v//X X0-cCT V 8 80R\\]//0X X-cCT V 88 Q\\C//X X0-eET V X X0R\\*//0X X-eET V XX Q\\//X00-GX0'RT00\\.0/X -gX 0GT V \\./5S %R R S R0 S%S D\L\S R 00/0/0,'' -LMQ | 50S50S50ppP 0@.K.K-K/K/KP P P P P P P T0SY \0 0Wt X0 s /K&K/K&KL50S0T0 NK45 B@_?,%KdK-4T 0SD0@D?ET 0P0 0KL0 .K $NK,0H $KFK,x4D 0S0@0 -K KT$7K,H4@ 0S$ e3<&mد*S00CS0 㮶0 / -LLMDPp 000d$t000 0000SUd4d$P p P4Q !0SJ^,$<P%0$3U0#03 p 3Q  #P0 0%0#2U0l#0P3 P#P %0<#2 3,# F$3PiP%20"20 0(Kkp 0: S|2 S2 S"d KGP000PQ+(0pUUyU00u U!424"00,"000 S0 0 00`0 QPY%0S0 00 01Q>~, 4Up! R   `B^ PQU 00 $1~,s*~<~lp00 ;0  K0 lVp0YU 0W,U (U&Kሀ|0`V K ?g 0\0``<&' a( &H<(H&L<(P&ʰY&Xa(ȴ'm8@@a((a(h&} -~MLM@00S 4@0S~K~,A PK谴'<& -0L Mx@$0t00S K0 000P $, 1P<&'H P0- LR<Y1P 0 0 M1갴'hb((a( -p`P@L ᵮPPEU`@T@ -p`P@L ီPPEU`@T@ 0-@LT `ڤP0 S@P 0 Q @;;S q@P00T@ +$(0( F1( 0<&'(a(ر -LM(Rp@`TQ W0q@$00F P000S S1TIT 0$0Pڀ;;S 0 00P0 P?5P@@00* #0S@@#0ES#0SP#0 S@0@K#0S #0S #0S $0STڄ00Q Q`c0T( L\0#(00 0$<&'D;(yҲ -LM\1 R*PA R& D!  BR8 RQ:QQ6R   K $ KP000S&0% Q`PV Q0P l?P0 0 V0P3P0  $/K谴'<& &m3c -pP0 PL M` (K@PڼAQP0 0QP 0pp0P0"< 0P 0S<&' -LMA`pPP:x10S8 SV0\A00,V00 P0"!/ P0R(0S 0P0" / K Pڌ0V 0?0 dC/0( , KL2K6Ps"(0, /<&'dz#H(a(Smi -ML 0d崰hAL<& a(' b(b(Pb(db(b(*ȴ'H<( &Tb(Z;(aHa(f8a( -LMM.K BhҪP T#-3K AŪP $#-S0S c$0S 3@T0S2-r P  P| 0 y S( .--2x00CS,|,x,t,p,Kh@,PKT@cP0@80@, (2 $K,(<[S ',[R KA6YS. )SS,|,,K@,PK@.P (<[S K@$Pt K@ P\,sS ySP0,0S ,@(,K@PP K@-P0@0@,KAi, b(s'<&8<(b(b(H<(P&H&۵ &bq  /Pb(&G=zٷh,M\l 400-L@`p0np`0 & -L MlL!0SPU#0V`@TP@% P PV 0$@ P qUP9 vP6T00S ",L s#00 3/P0  1ST00S x,@ETd Ad 14s'@0p(K(+x &p&h'| & &i';(Ƹ -LMQ0@p`0ᐡ0@ G80 80S P`V4PX+.PT-810S0 ,+`0@"0$0 3/0P& 0 R T @ AT0 0800 K3/P0P0t00Sx t+ Q < 480 2/P80 <  (K;(h'P<( &:i'` a( -LAM`/A@PKpA^K PEp P/0P0 V`0` +L0o"/0P0 0PP0 +T<(h'ȹ00CS0 ݮ0 / -L,M0C80 0PY P(K: P0,03/P000@0 DT3K0S DsDcPQP PP 080 30SJY # P U!P#P ꤂4 CSR P8Kl dj <P8 7<"+ HZ 0/SP  ATX 8K 10S 8 P0S !S$K !x000@03/`P 8KT X `1  0S DQ0S ,1;008K Ph04 KD083/8KP 0S ؀0S 0 `U0403/Z 㪧00S !"*KP0h0CP0{PwP;(\b( b(P<(Xb(P\(-T<(U<(|b(db( a(Pb( b(0b(a( 0-D@LPM( i*00h'G 0-L◨p@ K0h5 Q*0d 0-L@Tp&0 A*K0hx p-LM`Შp@0S  S S  KPᛨp 0: S PKpS NS@ -LMXP KQ0H03/P0 03/P`plAPB 0AS0, K@0a3/P,1 C"K.P)3P/P cP0/SPN A0 0006@ t )0(03/ X㶦$0 CP;(P<(a(T<(U<(&h& b( -LMP(KTE0H03/P0 03/P Pd5 K0S 5P R$n)40STjE$P 0(03/ g 1%P 0AS0 K@0ad3/PX4؀C,Ke8P (4Ѐ C5P 40S K嬧P s0S30S K埧P 3R0 S =(KR03'KR0`PLP 8JS@3(K0/SPu A>s0S20S K`P0SU 20S =(KR02'KR00S "SA-K< 4S P P20Sd@20S Pp4S S/ 0CS)K 0S%q  GX G0S% q0S! 100=(KH4 l1 $ L0Sp-pP 1p Ѐ G G0 K@03/0S 0S p0S 000ZX0؀C,Ke4S 0S 0;(a( &\b(P\( b(P<(a(8b(T<(Xb(Db(`(`(U<(4b(b( b(db(b( &Pb( -bL@aPP@T  T 0 'H03/P0 03/Pq0S0 X P0S t1t p1尪 d1 |PL10S@aMP P0  DP0(03/@PC.P0S00S @0S 0h 000P@_ tᯤ0S PX P;(Xb( b(b(db(Pb(b(P<(Z b( \0-0LSiPP$00H03/P KhXb(;( -MLM0TÎK$< O P`10[/S &p0W3MK/S/000p @D0`P#0P$>'(K<: S ,P PsP40S$;f< Sn PԜ P30S30S P= y/ P`+f/Q  <P 4&l0P0"2 0RŸ S "P0%R0S$\P x dPp0S'd20S#X0S L20e  <2 8"000(20S, MP+0Sw Q0Ss 1 00mP0S 10S $]R01%R0U]$dQ4S S  , 0CSD EP E,~P 67 Q& E E PKA E  E  EKA E 0S `P0S L0<lb( /V\b(P<(Xb(Db( b(T<(x`(4b(b( b(db(Pb( a(Hb(`(P\(- 00-P@L00S0000 ~ R~<Ôʂ;;S <|%0l0 h0 d0P L0 0 000P|'@a(l';(ʻ(a(h&H<(8a( 00-@L000S0 R ~ R~<Èʂ;;S K P7P:8!P$[?K_K R0 d!R MP0(K=]K!SR 0*(#WKȢP:8P "$G?K(KSR *0( b(l'h&=b -@L 0SP`pPP 0|000 `` 0S0 0P$0 0P l'h&;(Ha(Lb( 0- @PLM"K0$KDa B?P 0P0 1p_0 1!'@0, KPmP"K@TP@@P 0 0X0 @P0P00 P  00Xl'(a(Ha( -P`lpLV @PZPPEUPP@@  `Fl' -LM=Ё0`QP 0 AKߡP?D@TL0 q 0@ 0 X0 @PPRX00K0 0KVP$0V R =P0 X040 0SP(K 0 "L 0 R   SQ0XZ4 S <"V0 0 l'|b(½ -L M10 P0p㴑a}Q9 @_0 Z p0-  * 000 SJ P08?" 0P  1p 0 @00000Tp(K00C0P @_0 0 0PBp  00t00Q ៾Q 0 P0   0 SB0a(8a(h&l'Lb(;( 0-8@L0P0P E0PK0hll'h& -pPp`LU @PL0YP U@@0 00pPEl'h& -`pကLV0 @PX04P_V0@@0 P`V00pl'h& -LMP =@a  UK^ X10S UKrP:8(!! V00" J(f!8 @P0P`$K?V  ɞP0`VK=PJ|8X E?K'KQP J(@ Jl8, !`b(l'/h&P -LMPKP\0@T@ K [bWV *KQP ! K@8b(| 0-LMPK@ПPK000S0: S|4PPU 0D /!᝟P 0}0 8b(db(ƾ 0-LM@ K+K 0 S 1 PR 00SKᄟP#0S'Kt,K 00S&Kd+K KҞP 0NS 0T  K008 0SK~p & &׾ -L@P`jP  &P $0 0  db( 0-!L@P0$0~0 K0h db(< -LMP0p/S`/#@P: 0K0P/00 8p /00KP&  P!0S  ĞP KٞP[0 KD/00`v (Kb( -PLP 00/S ,AP 00Q ,KoG`JP00  `0S 먀娐p0 9P0S@$<cPPH0J4< PT|;(Y Pa(ƿa(db(п -LM`PK@pVP210S K+KQP *KQP c0: SP ጝP0 PW P z P W@0 8b( -LM:(4P: S=!R `V000K @0Kp 0: S ,K00 Ku*:P/  0 g -LM`QHZDT@xP0H!4@1P @$<b$10SP-(u00S00S 0 00! "4S `fP`0 p0p 40 K(S(LpP囜000(Yb(b( & &|Pa(|;( -KMLMZ#Q30`@ (tp; 04 40CS񟗯\ ""#"""3Pp30S KA,0P4 4: S cZ!P |Y Y30S 0" vBK" AᣛpVe0"Z 2P @$<댒P ?o20Sn(4`S42TWP ĜPuKA؜P`40 "O0 + 0S10S 4m0C?o2 000! "(K,0K4BNK4@ @Dxz=0 Cz~z 0bp P@@$<lPl84S(4R0(4 $dRX00>0S4(40S0SD00S 0b(xb(a(пb(b( &a &/ -p`@LM0 V00DP 0S0 0000SPP0C00`F0S 0S * 0R 0 0 w w0   P; r 0 W5@?@ gP0,b 0 }0堀0唐S /P0 p(K\\0ꢼ 40 K400000@J,b(b(<b(b( p-RL M`P @0@ !P00@ Kph5 (1P0 Kpb;(J 0-LM@PPX00800S =J"K00b( -j@ML,MpQ'T U [# ;K,0C K@0  P =K0C0 P=! SR J(|(KKAmPJ8| ==K<0C#QPJ(HP0P P0ȤJ8 y -ALP 000pPU*`00CS0bpU 0 0S U 0 )P 0` PS0SP 0S0 0 S P ;( &h&;( 0 00-S00@L000S000x00S0@000S X{P H0P,0P00xb(;(b(tb( 0b( -PPL` 0S| R@Pd  @P0/S0080`f R P`@@@@;(h0 RX R  H R/< R/ $R/Q/ ;(Tb(b(@b( l0-0LS T0TP@0L`T R S0c သ0@0b(;(&: -L,MR@ 0S0Sܢ/@(K0 0P50C S=----------t20S X<K!4KP#K`p #K` W6P`P   0!$a$!\ 0!0 㓝 Iz X B(4 : S@  S:  S  S05 S7  SG  S04=! 0410S ̈́!!" # "0  0 J  0 @P@h 0 ac040+04 P 0 00  0;(0b(g b(a -`p`L'P9S+ 8  Y b(ƨ %, -L\M@="TKp:hK(0T KhKK- 0-LM@Ppp*P QK00 KbKYY0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//@-Pp@`UVUQ/0C\`p0S*0~ ^0W0C& Ό' `p0 0CΌ `p S*CS*`p PC-a*0 @X`t0?p S YXJ T(\D\0A  Q R 0 S* 0 Br^QA^Ÿ 0B~@ T RB(^Ο\AB~@T RB(^ Οa Br^ RB(^ ŸR0@- 0C\0!S*00P@Ut T0W0C  Ό! 0 0CΌ  S*CS* 800-@LT@@  0b(6 -PP @0 ` @h/h00儠 删 PP?PL/ ap8?4?0s S  R/ CRY0I@zP񟗳B@\=@B@@@@@B@BBBB@@@@B@@@@@@@@@@@@@@@@@@@@@@@@@@@@BLB@@XBdB@pB|B@@@@@@@@@\=pA@@@@AAA@@@@BB@@\=A@B@B@4B@@@@@@@?@@ @,@@h@@t@@@@@@@AA$A K0 T@Rb0d0?o0cs00CS0 {H(K G8c(K (Kg1P 6 l2 (K 2 2 (K ,2 1 (K % 1 (K 2h!  \1 (K@  1 (K  H1 (K, (K,(K42uP2p0`A R(K+ a@BT~pL,N,N,NxL,N,N,N,N,N,N,NL,NN$Np!00000p nb(;(b(p& D& &&db(&@a(H<(8b( &b(;(b( &Tb(\b(Xa(Z & & & & & &@b(a(p&b(8;Wh&cϘ &T QB Px00R?  C@ 0 fHKPH 0S0 @+SmRRtRtRR@0Yd PG00000YOI 0DPP00000 S <0 = G 0.&;(&D&lb(l&0P  /;( p00-LP0\0\0 L@LPP@0@P ᑔ;(;(I&b( -` PL @*R7 R Q. %?R& [RS\ !^@@]P2!NoT^ 0S/S RP PS\ PS0*S S 0PS 0 P0P p-W p]WW \\ @\ @b( 0-L@ /TN@@N P0H0\A\*0C0S*0Sa p-ML M1P@`KP-K P K P <[SKp.SL[TxuKh`o.K\ P @Kb( Pr h{ -cML Mc=K(0CKK3K#4@Dp`^KW: 000c=K0C ⹗Pc=K0Cc-K0 B00 ;RS@X 0cK$A0cK; A 0c=K 0C0T*cKA00Q DXOH(K&Q< \Q401CP)cK A c-K$ B 00CRc-K B2P ! R0BSc-K B  BScK ,L0!c=K,0C0@&S\ScKA  @c=K0C c=K0C dc=Kc-K 0C B0 0CP;TG 0S 0fX 0TP* R00;T 0S X 0 pD JKX,@D 0 8TS llÒ8TSo 1 @  c=K(0C0(0 ( 尒K;( 8[&q -LMPP R`p wg\Sp RI p0S "00p0SIq\Sp RK pSS) GS PS! 5] 0,0E5pS sS gS0000S00 R @@@$K0000㿮@P"  *`P B.K; BᴚB.K0 BX `呫 P {;( -`PLp 0Slの@PP P`P80 PP p@ @@ @1F;( X0-@0LPL`LT  S, ّ0@;(&s L1- LRD jDT@ (PU: P7\Q Q 0T+ᝰ04#P 0S/  00P0S/  0P0Q @0/S000 0DP0 Q\;(Tb(@b( 0-j40L@PTp 00S 00S0 00/S @Tt0oiPL0D0S pP040 ;(Tb(_ !P:$0BRSR;  P H0P 000S @ኴPb( b(!Pa(0b( -@p P1L0S"ᤋU`( P  0 P00C0 B##0@P@ UffffpffC 0C0 0 B0@"0l& -|ALpPW :K@Ih`pQU 0 R 0SOP @ ;(=H{ -PL 0S@ /!PP000P H`V+%@P U 0S;00u0S NP 000YU 0SR  ?P: hb '0F P,VY 0 0#.V00S K 0`PE R MR CR 09 IcR mR000000  `V00 \ ,D0 R @ @@ @Mi,;( -0LP`Up@ MX@ Y @ ㆪ@P L @T SR0` 0 A;(= 0-@@L0S 0$偫P 0;(  -LMp1pX< Z4S1 84S80 - k##K44Y1 @<0 !KQP"QP 0@<0 T '@P P " #K!800 Aጬ|w (K d  4 S0 0400CS00< 0qo;( ) 0-@LT:8$R𫝘4 CSR𫝘 clX!WV@"UT Q?$Kk;;( X0-@LT`D'L@PU p'%PWV;( 0-@L0S&弪P @0x x0 S0\P0}P0p@"04 = 嬈@;(GGpb(rhb( & 0-@@L 0S 0$傪P  0;( 0-@@L0S 0$kP 0;(= -L o` -L$M,2@0Sw  ;KЃbYXK4  K H0 yPP H01#K0W VZS  gPPP 400 000 WV0S PB 0 " 00 KcKQP7  Rp` 0  5P#K0 QP *P a0 P #K 0 K0`$K b#(K , $ K;(C 0-@@L0S 0$嵩P0;(=y -LMd`0S PPp0@T ! (@TPU$K;( -LM` #K!$K00 @T% PZ 0QP QP (0S0E0P40  0.40P KKa(1(Kᨪ(Ko;(= -0L@`Tp AT ! SR( SR (@00wu;(=/ -LM`0P0pS 0/S AK APP EK(ۧ@P  p;T KhGỤP 000 00$` @ ;(;( -LMP`@pTK000S$0S 0Sh00S ! 5<00S @;(b( & & & @Q0-L@A0 0@M@!QT\1   K S:0K0^@K^K^K^K -ML M1`@8< T/ pP!AT t0S" @T 1@PM 0D0 0P0? UP1m" 8<P0! A$!!QP   KP   KPmb R0`ı(KD ]( $D;(G &+C[{ -1L `Vp/P. DX@ 㾦@P) ᨣPP! ᢣP  A@T  ^PP`XP ኣP8   P;( h0- @LTP`pH AT+P @;(C-p`QX@@Q@T*0C\`p \N@ P\@NPNNP N@N\*00000L1>`p000\:0L0  - R 0R$ -MLM0A R0\p.@0X!XaP^*K$ B0  C0/S+:K40C$!$K⥈KP6 K *R K$H0@C:K$0C 0 C?R*K$ B0@C 0ꂀಀK$H0pC:K40C| tKyKP:K40CX LKoKP:K40C0 KdKl&+ 3>L 0- L W -L@Q`e\ 1e #KhD BP   500S  /<(x0-@^\Q 4PP<(b(  Q0-LP 0S   pPd @t L @ @T@000@ & -`pL@PPP@P 0 X{H0@ Hv8000CS0 $ 0  &<( -`LMPP$K4"?:0J840K0CS2"`40 !01 +  d` (lY <tT @ |0 Q}P  D=-0B0C2P0 1P) (5P/\+ $ (8$K@QaKP  v⸀ B` $($ *($ /R00C0 $ 8$($)Ёpx0`(B$b(b( b(b( -LMZ@0@S'0Hdt30S $KJ(J(J(J(Kd T3i/K00 0P J( SiK"L01K3 0b JK"K0A 000 Q:0A Q*J(R S70001K=!t`rp JK"K0A 000 Qo:0A Q*`0m/K<.PJ6`0k/K@$PJ,!0 ` 0`f/KP J=<n@TqYEK  @sX Ks}"K.`0c/K `PJ}"KP P@ PP P P0 ``\ s 00bR cPb(k F<(.`a(2ƨ8 0-L@X PP oK0h? -L M0P-S0S) ᔃ`P% 0Q K(0p S0 E(P(K@P,0V "`p cUh&h --L M(@P   jK,<( -PAUL`<0 R 4P @ @P@,<( --P LM00 |0 x00Sl00S `@0S T ?00D0D 4 $% ?KLb(b( b(Pb(&b(=8 0-|LG}PPlh@P \P 0墭K}000S  0,<(c\b( -0-P  LM00 0@ 00S00S P0S t ^?00d0d `壂 PɔT < 0嗂( H?K0Lb(b( b(Pb(&b(=8&]( -L: 偂!& 0-LM!@P@K00/Sx]PlXPQ_K~p K@ ~p *KQP)KQP  000/b( -L =& -L 1& 0V -@LTP 0QQ0P0T`0000000CS000S  f(f( x0-`P@ dp L 0SP'U00CS0(00SKhf(e(f( -@PD`L0S@'T QPe( -4QL0@00p6 `1S 'RT P10@00CS000S 0 UPp吀AT$Kk 70/V0W00CS00 U 0 f(e(`f(r & -0PL2 R' 0e( -Lp`PU@ z@P` 0-\PL>@P _DP0P 0@00aT,@0hR ?R%|R ~R$ #000=S& >S 0|S0 0=S0   +R0' &)"0 0l&pf(lf(`f(hf( p-L M0P0`0X0`~0@S P 0R@P@ K "@P0S 00S 0ST P0 0 0 R  Kphf(`q(| &&< 7 -L@Ԁ`p\ , 8`ԩxlLlf 0d W R@@| < ^ 0 0 7!(0 0 R 0? @L<4 l2>,? @l2,$ \S.QS<R 0 X0 0X0R 0 SR   SR   0  (0) 0[gx -L Mp`렠@0P%SG000 0&S `:X0 500 S00 0 @P@P(Kb(`f( -L0M0@ p$KT` 0 DK@PK0@P SW@PV D@ 0 F$@P@ 8K} 8KDlV`f( 0-LP@0)S0b( -PL(MP`p[ P2 P82 ; 0*P(2[ P 0 @P$P[ ܑ"P0@#SP $K'0@SRO LS @P'0G\SpX o@P'W 0 !@K7} @KU0 o0  p0@ c0 000@0Pt0 S0 t 0JX4`,'U@@PP 0@Pb(`f( -`L$MPq80 ( ,K a@< "0 <C@0DS )00S^^* PU @ 0 1 0DSL0800S Q` (KUU `f(b( -L Mp0@ PB\`0@P0SX0` P00 0@@U@Pt@ Kb(`f( -L`h0@0PSP0p 000  00@@Pb(`f( -PLMp0K2`pLP 0IS0NS@@ P@G@T0T@PPm0`Sp ,0K2Klf(pf(b( P-LA7P@4 p!a 0 P Q B Y Rp0 R ԥ å%3 0 P @30pR å3 B2@@0P@ 0$XQ0ƨl &t &(o(`q(;@ -P 0/SSS00xf( 0-LMPPK00/SQOKL/xp K*xp *KQP)KQP -`LL1PP 1H0Kh11p0"S@ ViҜtb( -\@L PRH0Q < `P q1Khb( & -L MX0c 0S+ SP C000000000CS020S @T  S SU(K61t2ilh2hR0dr00@/SJLL9PQ0S /00CS0ĥ@'2@X0020001A  P P 000 |S pS00CS0L10S 00CS00X0ĥ@10X@00 R0S/S0@D00 P  R*0000t/S0S P 00CS0/00ĥ@00 100@0H0S 00CS00إ0ĥ@10@0b(tf(f(f(xf(l &(o(t &h -PL0p0@0vP 00CS000S 30`0CS0X00S $X @06 R0S V$0$pO&f(f(| &b( -LMp2BP7pP'0@T#S@P% 1R@0.S00.S000/SSB10 K_ `PA|ePpZ% `PUT`P@ P 0P Fu0F2kr~k@P0-S0S0@T0@SP 0KCvP0: SU 9P(K| &m@0 000CS0(00S 8K( K| &f(f( -LiM@? 0A 01 ? 0SK1 x?! 0xA 1 h?p@0(\?K@T?`P!l  !@Tvl1$o@1 ZKP1d @T 000Ps0d!1 0p1Sr'p1 S!n01 >60S >0S1S10ń1 Ť!11C1 T>0S]1S phA8nT.0^VOKx!1H0S6P1Sx10x1 1p Q `-X-XP A0S !\ B! !11   1S W0 0p@{/P  @}!0 !  0@=p0ShAX F4800!P1 4(@00CS0 C080S IKDP 80S'0xlS777 h! I/K K`70!K1101 0!#0hG01S 7 70SU zS60S `j\<&060S h1 @1 @Ft U>NK0 0<01 0C01P00<30S P1$0S01 1S  3 @  101 01 301 3 0IK1 0|1 @PX3I/K 3!00Rf1 {=1Sx1 V?K hH3V?K0SG1 3 1#00 3 0#0#0!2 P13/2!x2 D2" L2" C|1S 7I!82 x2 1S !\2 1}1s>42P!RQ1S 2!   B 1SVSK$ KP1!SS|1 @0! |1 @xIp101 1S`1  1SL1 @1 1S (1 1S 1SV?K0S 0 00S f;CF@T1SQ`1!\0Di1! 0H)Fo(Te(`e(b(f(`q(| &f(`p(| &o(f(Hp(f(f(HB f(f(b(!@o( f( &f(f( DR~  P 0 b(f(}l -LM @P`Rm@`1$K0p00( ?<"pWZU l^A 6A Q T1AP/AQ<OA 04AS 00CS00 @ 0* 00CS00 @ 0 $KQ @"AU P000KK00CS0P00S c@@K@4,o( "+D &4f(f(>DH -`@HPLpP 0S%ShP @ -`@@PLpP 0RSP@- H0H1S RQ QP 0 &f( 0-pP` 刀 L |@@ 0S0 S0S00ۊPP|U00CS0$Kk8@f( &f( -pP@0` L 0S S:Q `:SQ`u00Q %Q00S  $PPP0W :S@  <@/P R00SPo('g & 0-`@ 儀 L p 0Sp002LnPU`|V00CS000S$Kklf(f(f( 0-pPSL R.τ0AaT'oWQ p000 r 0 @0 0 [00CS0L00S 3<0`XP `@f(f(f(f( 0-P(@L@P0 0P0 0-D@L000400 00CS00K0hWf(f( -LMP/`@0 P @@@o KfP00š0 0S 0S 000Z300P@ P @\P R R R     ,Q R 0 #"  " /R0  QpP=Z0 R"000  KpPZ w 2 @( 0h?00(KH2Q  0S/R30SZ U#P pP 1 @ RؠK R ؠK pV1#P] R Y R UKeP * RF01 R$ @ 1@Dj P R  > 0  00 @ RؠK R ؠK   BR D R To(f &| &PSf(gf(ot &tf( -PLM@p`p2@0 &P@0Z 000@<2 p`Z@0 m)2 1S*Z(KbIY ,$,4`p@PQ\T QQ D @0 $K0VXWT V0 08K0 fU 3[s  P ~>V 0SX@0@0 Y  P 0S(W01KhI K 00CS000S K0f(| &f( -LyP 0SI -pL$MP@`ሃ%P0cS   \pPp vP@ VP`` ,( R\cS# T*=0S@0 P@0 W,P 03K000 3[S񟗌D0@P QPTf\<&TP H< IP% 0<P=U 00S R00CS00 ~< 0 0P U (K<P/P!00W@0 t1 ,0K# H0 D @00S@0 H0ZT1Z<D<cPT<T~`)咈T T TT<`0 8K`@00040 40S@, @0040 40S0S$ SPP`0P P@P040 P 40T DoPQ0 @P@p`Lg(`p( &Pg(E -`P`@LPP00`000`0CS000S Pg(f(Lg(f( 0-LP>@rU90@ 0dg( -QLMp `0P 0S*00G@P `KPP `R@ K P0P@@0`SP0S0 0-@LDMP0 X0 `[Xo *XI ?X; XZ 0S0S@0S X0S (KX \X Z0 S@0S@#0HS Z0 S@ 0R R@`Z0 S@ 0Z0 S@0 S @0*SS x r SR?S[S R S0S P@ X` 0Z R R @@0^S!S  00x|\Q ]QR0d  d0 R 0B?oZ20S0`0 `@ `0p0T0 0x r RW~  [W\  :R@\h0 \0PPPh09PU)\WWP \Pp -R^0]Qo \QQ0 PT0@KH0 0HKh D0 @p <0 \0 P T0h H0 \0@KHKD0 $KP 0]RRd  R` `@b( R\  PQ  @K U, K\P*@Kh0 pPh0 T}h0Q U  ,K\5 2T0WPP00S P0X`0P0 @R=TWp` -LMP@ 0?S*SL [SA0^S!S00x|\5]P> [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR6@P0P/P 0S xpPS@ R0$Bx r RP 0S 0\(KK^PX;P 0U0/S 00EP 0S/00E0S``0`@ xqQP 00 10S" qV/00D0x r RP000Q:0 p R /  70 GpP 0.Bo.SQ 0 0 P V 0SHg(f( @-0s0 S 0 @^C\B@x r R ^ @ ^0  -@QLT0S0@@@?S*S  [S00S `0p000S P V0000CS0P00S 0S Z0S dg(f(Hg(f( 0-@$PLT00@@@dg(A- 0s0 S@QA0 p`^   S. RxPuPU!^  ^p0 ^S PS =^^ TR pS @0C  0-PL M $`KG0fCK {0F ј@FP Tp X-00D@FL`@DPU$K`00CS0PP(o( -LM R@@0P*Sp #S $S !S<8 ?S @S. -Sz 8Pp8H(K777@A0S 'g00CS00  PW0000Q00S l7tw `Rd'0S00 0@S00 W0CS00 w 00CS00 v 0S &V00CS0^0 O00w00I00v00 000S 0DV 0CS 00CS0$0 ~ 00CS0 0 000 0 U0 0S 00CS0000 0 00~0000 0  0000 0  000000s05 0$50P50S00 7 0``W`V80 ԔA̤帔0  R? 80S  r R  BR d ~  BR `0 0 <4$ BR  BR 7 ~  BR 30 0 0  R0S U@ V㜣c 30 0CS 00CS0,0 ~ 00C0S60 Pr ~ l0 0  c ~ ]0 0  {T00~00A RWb0S_ "lb00C0S@00PS00C S0 00KGP0S000S=S{U20 v1 Rr0QE1@00 00WppW" aQ000S` 0A 0CS 00CS060 ~ 00CS020 000 0 a Q000S= T 0s0 S 00CS0!0 ~ 00CS00 000 0 00~0000 0  0000~0000 0  00h & l(`g(f(@o(| &(o(b(`p( &Xo( -L4M0 @0 6p04 = 6 88 `H0 @ 600F: P Z  3PP00@S <6 0 70P P " R PP 0&U%  A0 %~ R *R@R   " X R H R F APXU PD ) Z= T740  _pAQ!W@DTZ JJ X6$00C@0C0$000D0S240@@@9L0 < L0W<  @|$h4 X BQ@ @CR<@ <($<0@T<0 S0 S$ <0@T<0 0@S30S@@40@040 0H S/D.<.h/h/.....3 AQ AQT~AQ(@P L L~P P L LP @D P @P~@P@P L yP ~LP L oP L@|r_T?0e_oRUV40}800SN PX(KUE !A00CS0)0 tp0 pG@0000P  00BpC0 ,!p0pp01D 000A&0000U 00 qP 0i~꯼PTR ` R0 R` R` B\U   R0Sp(b(`g(t &| &(o(@o(Dg( - L$M< 0p % % 0 D$8 @@ ~Q 0 Pd崤4 QLQ*=Q "Q :Q Q00000CS00  0P 800 AA P0Q (Q< R  r R  BR ~ 00CS00 RNQ Q QY  R(KQ1 L:Q00CS0?0  R  R @R0=S P2P P 00CS00 w #00w00  00CS00 u 000 00u0000 00y10S 8 0 @ CR SR0C0g Ye 00CS00 v PY00v00D0  ~ D0 dD D 00 h &<1 D0 D0 0  BR  " 0~S=Q40S 040 pH0 D @ DH0D D004`p( &`g(t &(o(`q(b(Dg( -pP`1倁^0|Sx1Pp l1lA 0 0\1L00L1pD1 p<1 V0 SZ000`0`0CS0!0 p0@@4p@ E 0 @  0 R 0*00pN0p| &t &`g(b(Dg((o(l &Pg(Lg(`q(dg( 800-4PL@0 K0h/x &t & -L,M\A\q0H@Q00CS0@0``A@K0@0KK@KI 0 0C 0S0$K 00` R"Z 0C 0`F`F000`C`(K00000`g(t &(o(`q( -LM,Q80 (q0R00 0A40 0`0Q< |<00040P080ZP Z 2 0 E0CP0(K0S P L/&0< F40A0, x &Dg((o(`g(t & &0o( -LM c80 s000 040 000BSPչ0B0SJ̢Q< <00040080Yp> Yf Y`0*0`HV(: 000 P00W BUW#*VQ  000 PD偐IoU㩒Y`00`V:(KPQ: F``HV: P6FUW * VR P  R:F` PU R``V:`pH F  0B0C 0pGHV00 `F  B BR  0 B0 0v x &Dg((o(`g(t & -pLM8K`P 0@ 0嘀00000py00CS00 p0@6 <@8K$K<00pt &Dg(`g((o(l &Lg( -L`p@}.A00CS00 - 0 P Ue.00CS00 - 0 P UcP".00CS00 - 0PE &w -L -L00S/ R &T0QH0 0Scq o/P0//pk( & 000 00C0/pk(lg( -@帀0P000` LRp$ j0 t 0U0d0P p T 0 0C `  S0(00S$Kkf( &lg(pk(tk(f( 0-`P @0p0WL0 P 0X S S0 000 00 0 p0$`  d0 \0 00T w00CS0,00S$Kk &f(X &lg(pk(tk(f( -XBLpPR 0 Qcr 0S ((,$, 0bSA0@@0/ SP3b000r0Sh00CS0!00S 0Z #R  R P   RP$ - 0 00@0 P   PDR@ S @  BR 00D0CS0000P0`00S ,L0U,P0 Qpk( &h &tk( &lg(| &| & 0-X@L00CS0@ 00Lp000CS0K0hBpk(lg( d 0-`@ 0L P 8  D    2 00000 0$000pk( &tk(lg( -pP`L000$ VRU @0P$P0pS  0L 0H 00000CS0(00SKhf(d@ &pk(tk(f( -LM0ap00P0R@P KSP(0: S$0 ὿0 KQP K␎PR0 00㤿0 Qda$TQL00CS0,00S pKf("'D^f( 0-` Q LP @ @T0PH0D0@0`00CS0(00SKhDf(lg(pk(tk( &f( -@0P  PL `H$P v 0S00v0d X 0L 000CS0000SKh  &f(pk(tk(lg(f(0/ & -P0`0@L0SSU &|k(v 0-P@L0S0 &|k( 0-PPL0 @0P0#0P0 & 0 R/ & @-@1 0@ T P@   U` p W@ Q Q 00 r "@T 0s $PU 0   b(5rO & - bL0pS 20SPAT p #PpPᗹPPU* 1F )Qp A#g#FxQPQ0P ㊢&&&P(1PP BQpVv  Ep,Jv TP0PP %Qp9v Ep/v (#00&&&pk((l( &| &Kk( l( -0LSP`Ѐp@0000W p 0WV]vV0S `p` l0S *00CS0P00S$Kk pGo PQ`f(f( 0-@h0 P L P t@00CS0000S0K0hf(f( -LTM@pP 0 *(KؐY PY   0SPs  0 S S S PQ 00SЀ0S@0S}22 G!0R+  q  !R -  "lK)lK` l0Kl"0 ) `0l KsT< El0K`lKx) 00CS0/)0` V f)i p0S 00CS0)0 00CS0 )0 | 00CS0)0Ѐ p0Yp0 Z(000v!lK) #40  v)  q)P S#4s@u  0 il0K`@ ft  =)p0`0Csp0 0㓉(ЀH`0Rb( &5rO */*7@ET@-0  R"R0 B 0.^0\Q #4s0 Bo4SQ#4s0000@ -L MPPp1@ 0%SY P @@T!1 R 04$0S (K0S  R+S -S %S @H1@XZT(W@>10s; ! ##@0S 0S 0?R0  00 P00 T"@` 5 Pb P 8 \0@  RJ0S 0S#0S @ &Zyb(i -(QL$0Sq`0e0@S0@  S(А㼠0Sʰ00CS00 ' 0 )0 R  0 S !)(b(ƨp 0Sbo !#`PpP000E0@0CS0<00S b(DT & &f(f( -Lv 00 Khƨ"0K+P@<0,$@PbU0SK0S P 0S  {uqtpl `cL0Da04qPU, T P0 SPA > Pg Pd Pa P^ P[ PX @/k(EWV5Kޓiv$  -@PD`LTUHU 0S ?@ -x0`t `6LPP@F0S@2@Hp@0S. @D0   0 k(| &k( -P0L0@S`p R 0F0S P 0S0uGWX0HPT  000P000V0 (l(| & & -LP`pp@ P 0 Kh^li0  -P 0LMQ00S @K1ԁ 100 000 0S KpPK@(K0SH  0 Q S/R CKGP 0%K%KaP000Y0S)  Rp 0CP:PZp"00SPp<` p00CS00  0 %K @ 0 SH0 pr0 0k(tp(k( p(0o(f($l &(o(2| &t & -LMLap8K5@P810S `6W0@?o20S 1uQ0V0l 0P!1T00W0SV0SP60S .0S @8KP P8K0 KP VX8 0@0C?o20| &o(| & &X &Ac( -0LS@000EPP>00CS000S .U𨝸@PU` `PV0`0U0P0p0S V00U00Khf(f(| & 0-t@L00P0[EP 00CS0 JK0h00S f(f( 0-LP@DPU(0 -LHgP -LhP 0-L@}7;0 -@0`SLP~Vp~0000  00p0CS0h00S 0p00000`C0`0CS000S l &f(f( P-L (Du 00C00l &40  0 000 00  /l &(o(,o( 0-@` xP L 0S0 000H0 00CS0000SKh700$if(l &(o(f( 0-L@ 0L0080 00CS0000S0K0hf(,o(f( -$a$A0000I?o!2W0SPkPLP, 00.0 000E0000PS W 00CS0t00S$Kk E P 0 ሲ0PPf(l &,m((o(,o(f(T 000@0A00CS0/00S/f(l &f( -TPL@ H`P T @D@00C0C0l &(o( -,P,`@L@Dn00C0l &(o(( A00C 00 0C0/l &(o( --@PL,M p`Hp PVP u T$0K1 H0P @H @Hp `p@PU KT $0K1 @9H0p H P -@L$MSc8@ 0P@0 h3`0SXC@0pS0@80 T 5P !P30D0 3P@"r `p 80 BS \TR @ɥ@G P@  BR ɥ@  6p@_ &l &t &(o(X & -L@M0P0` R@0 Pl l "LKLK L0KVL 0U<0< 1 0LK01 0 X &BZu -P@LM0K0k 9 0`0SڬPp@T*wp`T @T_PL` @0 Ἡ`0KK@l &t & c( |00-0L0S d0P@U U L0UH0@0P 00P0 0 0X &xk(ƨp( &4p( 0-L KhIxk( 0-l@lPL\P0 P 00008  P8 K RK0hk &X &j -8RL0@T @ 9 0S 0 @ 0q8 쁟0 葟00CS00 `#V4  V v v^ $Kk` V' V )V< &V' (V0@@\V3 |V% ;V&P0 @ ;P0 @ @0 Pp0@000 t&P0@ @0k|P0@ @00@p P  00P000G 0 X & &lg(pk( - L M pa0P0 U U.`,0S,@0% `P @ᤫ >P@P  \00 P00@DDAPPU 0 (KX &| - QL0$` P O 0R', (@R   R`!PT    Q  00000S@0 R@ BR Kh=080@ X & -Li0 000X & -L^P 0-L@VP0 -L @KP P <0 000P ` PPPX & -L M Q`P0 # p @%P" BQ  R  0 d0 @WP'V/ (K10S @W Z H@@pY %; @  PP    VfH0 RpwV k 000X & -LKM@1 H5@0< 0P! L1 001 (50D1 5H 0KK0D81 >P H01S 0]< 40 D!4 :$000810 Sp48!p0 Cd4K/K `$00CS0 @1S#PAPU4@!0RPPT `+@1SP P| 30S Y3cP3 3儓 0 0S } 0 `P@D P; \P p+03L00 P0@000  #\0@0 $P <1<021#20#"T0"@ 0AS0\00ťPj\0P0"00CS0@ťP^P@0000 P"00CS0 0 ťJ 0 "CPn1 i@h100@1S 10 A08!SKڐ!堁W@0 8!ღ818!@00C0P000\001 00CS0(10S 1L!0 0D! <1Y`,V`>P0 |P000`$@ 0(K P70 ,  0`0 &P00 0=<Po >P9 &P00 &X &l &t &pk(lg(I`x&l& c((o(0@00 ((0 @ -P 0(0   0R@0/{PA@`   } {S D@ A@Y_#P0`" Y}P0N  P``= I}P00 ` 0   `0A封. sAQɥB'0=AQ@ɥ0 10@Vk%S` :S/ #S0[ 0 m``0C Ps@AQ@ɥ@V0 0@ Q A007`0 qP j 02!R1S `0IS0@`0 `Y`p 0Y2 P !dڤ!!_0 0S Fo}S㪢Z `'S02 4P w000@"0 P!}$00 00C0"000$2  P!Q 1 00C0v00XP@Y -@L00S``0PU ` 0S ? 0 0  B/o"j0p 0S 0  0 0 0X & 0-L^M1 0! l1 p 1t 0< x1 10K|1 垧1EK01 0h1 YPI@1E/K 1Q!@p>K0R dP 0S Q. 4QG hQ d \! h!X1 0` T! h!YKm00h1 !0 0x! t0l! 0|! h1p!S0h1 hK0ph !p0 `0x! tsH0l! D0|! H00Sl S,0@ 0f(| &f(X &t &f(ƨ -L M F,`K0 00&D P" 000=P1X0$00`cfP P 0 R 0Jp     50P0S 0 00~ P0, RgP 000P0 0\0 R, RP1 00300 0000    BR   00p P 400000CS  0 P Pp &4pKpFx 0 0008 P0C 0 00p0 Sp嗣P \X0 R   L000p0SC0 R Ӻ004 5P 0 R000 0  #P 0@S P 000 apPp0P00p P0 0000000S$ U 0S >0(P000Po|00SP00S 0000P(K0$00`X &.\ &| & -Q@LMQ$`Kp0 0pK@&0 P0 0!X@` 0PP R$@@pR(" V0 R`20 4 /epP ?0 08 00C0)04p$K Q  00SPPP0( 00 000 @P 0X & &D  -P`@0L LP/ 000@CP p@@@/Pp 00@ U000 p00@0SU PX &| &V 0-@PP0L>0 @P P 00000S0 00X &i P/0S/ -@L `P00`P p-L M@$K0P0S 0`ᅠ P P  1/$KpP Z`P$%/eb_\ Y0S 0  e0   0/c(RQ%G// -LMrP0 U00000@0CS񟗌D$` .@PV . .UL20S| T |X`,",.@P 2N0S' `.p@! K 0pMP.IP 1 Dλ `0: S.600`\!l`L!` P P U0S00  uP @T 0 j.00CS000S $K@ M.@0@  xT  BP`=.JT 0f(| & b( Ef(Ui P-LP@ !. P `.$T ź. -Pp@\`LT@Q00C0W P-mR@c( -`@``0P0L000XR00CS000SKh\f(o(f( -`L0L@TVP @P-PUo( 0-@h0L R 0C T D-P -_j P 00@d &c( -PL0@ S ~-`PT -"0S 0 S j-`0S c( 0-LP @P0@  0o( H00-@LP  Q QK0hJ-0o(00S  R/o( -L@PP Q0 ߹-p`U Ƣ/S -pU #S 005p -LPp`p@V`   0ẀPȐȠ 0S WT  ,Ko    0@  W  T0S@@ PW &ZƨDUэb^ -PPL` 0R ,p@ / ,p@  ,p@ ,p@ ,p@,:P03/~,@c( -LMpP 08 K0S*070K0@0  0`01 쁟U70[S!1 60[S1! (K`1@ R@00CS 0S  2,PQܡER L@0S> P90$000 Sl ,p R R R R U +P  +P 00CS0\00S {T< 8K000 Po(f( & &| &|f(c(f( -P0@#cLMs< 4P 0P 00 <)p 0U80 @D:TR] ;psP vP fUP0+S -S 4K0`K 0TrQ D<K0K4`K S,: @0 4P@0%  000"PT <08 `V Pp`00S0SᴜPt p0 U@0S(KU= 40`p0      r % 5S -+pנ@Q 80 +p80Ƞ1Q dҷX0  T00 /D&m/э|f(Ar -PQL@T 00CSPDa10SK R 0rp0CS00 p01L00<S0S  0aL00CS$00$>S0Sp R 00CS0f0 - Eh 0-@LBTP0 R  R 00S 01S0 $ +P00S|0!R ! RT  1@DOoT!0B00@060S@T 00S0 o( c(f(f(o(| & 0-@PL ^P00 . 00E$e(J Q-L@ 00CS00 Pt`tp X?U UP@U00CS00 Db 0-Pp @ L l0S 00S |Np@T: 80 00CS0 00SKhyf( c(o(f(L0P @0,Q Q0S:///o( c( -LM02@0pS21S 0SPP20S WUT: T T5 P PT T1F0SPPTP 16 R'! R#0SPPdaQ4 K|{p 40S(!FQ DTQ56 R2K060SPPPQ0 Q U0 U0 U0ᨏp WPU]0@D>T40 00 ,0 (0 00 4K)2 K1 @D@o( c((l(| &To(o( P-Lp@4`\PPL:H44ۛPP#@ d t1S 000MT ;00CS030S @@T 3 P6岛`P@PPGU@ t奛`P]PEU@YX @4SDs 0F0 1ST$x@ T@`@VT @rP`1S 10STW@ T|@P@UT \@XRXr1S 10S {7@@TPdX10S oP `@DP㜑$`0-S0S`U@GnP D?ZX# \q01 !Rk 4pW+$ENP Q\P1 oP & 0J000V0S0V00 `hp 1S LZ a  P00CS0(00S =,J &Wf( c(f(o(uObYdNm| & -`P 0@PL pD0S 00S Fo0D0@000CS0<00S l,0@T:VKho($c(f(f( d( -D@L0PS`00CS𨝘V00o(00P,00SP/0S// c(o( -`LM@p1Ȑ010!Q0@S10C1(KaQ< !R8 4K2倾8 TPJ<8 (80KpP 40S 4Ks c(o(o(f(@ 0P/!!R / c( 0-<@L2PS0}R0 c( -0LJM01 1"R !R "R0! 0! 1 1"1"1 10S CKHPl1C/K yCK@P P!CK0008@P,1C/K .0AT0h(0C/K 0PU`@T 0S شP奶00CS0 KK w'001 1 1 1 0D>S 00GK &G(&" K!031 c(f(o(f(f(o(  0-L"t c( T0-LP'@P0 @P?T00 d00-`P  PL @ K0 0000CS0000S0K0hf(h &f( -p@PL`U @&PPEUp` VD0S 0-QL@0 Q0P0 BP1Ա01ı 00000 1-sL@ 000010100C0 RP0000 000CS0h00S sDP`0000 0C0o(f(f( 0-@LP@0SL00S0K0h00CS00  h &0h &0h & -L M@KP吲SJK --L M  K --LM0  Kh & -0-@P LMd0 (K0 , BK$00CS$0 (KV(0 ( 1[0@0DK0 -L@'PP$ 0S! p`0S00CS000 "  i00CS0!0 " 0S mpW `Pp 00CS00p ' `' 0'X0C! S00 XV 00CS00 ' 10S$KkV S00 00CS00 \ 00CS00W ` `V :`P 00CS00 h &0Oh & 0-@LzK0hvh & -0rSL%E 0-`0 @L0R.0pP0=00 =H@X@`@DS0ԥ0ťP0P0 0=RR0CX0Sť| @$Kk@t &(o(l & -L M D00 4@ 0C00 0 0')K`q(@e(j0@-P 0S SR 0T 00@PU U 00R0C000 0-L pAT0'S`QU @'TP@Q  0S 0S   3/P `P00p( -0LS@KhDPUU x`xp0S'S4P@'[PP8Kh' E#arƭD -P0LS`p@    3/@PP@X W p0@=SPP00 00CS00 \ 0 00CS00 K 0 T  & -L MA0Sp 007`P 01S `'V0 ᾃ@PU*(KX   R Qʁ#K#K1P00 g@e(p( @0S =0C?oP2/=S/ -P`L0S=SRPEP'`0VqApT 0S  _PVpPp@p( -LM1P0@S @ K$KpPU   `nG J `塯  `BKh`GP/:> 000/de( 0P00/de(0 0f(| & -LM@PaTp`@5 7T0TJ*"T. 'T, T RT学 L1` \@ ETJ \T R 垦 1 nT @ eT9 fT @ bT@tT @ rT @@KvT @ xT0$PKS$0K0 #0K0 K"0K/p@ @`0 S#0K0 K"0K0$K$@K!0K 0# K0Cp@`@de( -L M@P`$qP \P 5/@ 0cR 0< 0 K0R@ "! "7Q 0A T05/@MR0-S@5/^S0  %KH@%[^R@0?S0l&de( -Lp%@@T@@8P`D rj0`00@07de( -@pPLP0` VP  V t@00CS00 Y 0@P000CS00 G 0`de( & 0- LR@ Q@< 40 0""P0> 嗥Mhde(}l p-L Mh 0@T 00P P K=` VuKpde( -LMx 0PU 00 'R"R@@`  @ KP`p K`pde( --0PdL,MPP@ 0%}|P#p30PEAU\PE@0曟 T L0 0TP`@V 3L R R \V @KE@3@00CS00 3 0@ [ P%V0%S@200CS00 v2 0`0`*S0H0 C`H00.SH0@0*SH00H0 5@H0Z0H0 `0H0 @H0cZ0X0 H0  GZEZ*AZ BZ; %Z NVBT8K(KaZ XZ `iZ dZ  gZTq0QI 'R"R000:Hv$ t  sZ oZuZ xZpTP ;ᅈ:9P T  \^d\s0H0v t 0 TƨD& &­l&8)(-De(de( \= , \@ \5 \b 0p00 M0 0p\?00 \-0@Ǖ0Dž \ \v0"\  \ \e '\ \\ afnrt 4P XP :;\X P 4; xP\~0\0 8Pp\ \0x \0H s0v0 t p0 fpm AX0P P0ZP0 ,Tt0  PKX0 R00 KH0X @ 2    :t  vv t   0t 0x0@K\0@ @ +Set+S^-ۈ -LM0$PK\ %p` 0 D@P 0 (@PB 0 pW( PuY <YᮈPP0' 0ES4K ^P X~ Ð400S00H lI^YPH0?S0 -S00H0,$K76<Dp P-L bb  p-L M0@0 0 \XPX` PQ % P  ,Kph00 IP -LM`8 :yP8 0䡟80 80S(K8KPP 0S =yP@@0 K knpcWpP000 X!5iWLP000 4P0 K Mn00$0lWP00 0oWP000 ݇P@0 K-n00(0 @Q P< ȇP<   BR0 K<n 0 0Seigo"vz|0K00M00P0D0 0C0D080;800,0/(#Q00<00,,8 8 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@( R 8 ", 8 <  < D ,-D  , /f -0ML0$ 0d8 K 0-@L40000 0-@L40000 -L M@(0S00 K0 0,0K`t -L@X`P딪듫8呫<叫@卫HPD\`≫V\僫`, 87PRU0,0 0-@L4m8 0,00 0-@L4a8 0,00&;M 8-L  Kh0U (00-SL@ K0hD8 @0<<@00,00 -LM K "lP a Kt -L]Pant  -LPPaot  p-LM0`@K0P-S00(0(0@0 @  0| 0OP 0( RT  0 0 S40(,R03/Kpp= -Pp`@LQ`-VPQRP 000 0 `EP-V0 00p 00- PL@0@P ,0T 80$P< D0TP$ <0<P0 0-(@L0PS 00P0dq( Q-0L&  BR Mt 0-`   S^0? sS00^@ Elq(dq(< -l@LP`U PPHP4 ,0dq(}lDu -LM`p@sPnU % TP" XP PW PU p PkT X8 T88T 8 T7T 7T 7wT 7nT x7eT@ X7@\T  87 ST  7 JTUU@BT 69T 60T 6'T |6T  \6 PH T<p g eSo @qvZ~  Y X W0S PT0pS X W P`T;S < S S4 05 Ty W   T`lt P@Td(K$ 0 T0S|Tp4@TX4TZ<8~T|,4 wTwY pTrXiTmdTj0S\Te3UT`3NT[3GWDT_Xlh=TZ\36TUW@</TP0W)TLW#I SL S  SLJ2  TIWTD2 T?2 T:x2T5`2T0H2,0@0 dKK%PTq쁟 0SU! KKT   WQ K  w00P~0K  l UKKP pP0 P[U$UDW   nv|% , [3 B: A  %$,+4=<DKScbiqpxNFJJ  -L/ O & -LM,0, P 0 0stq( &  p-L M@`߅000 #S@ KPԅ0S  4F] 00S 0 3]KpDT  0-0LSP0#S,@(0$P 000tq(庂 -PRL PKM@ p`p 0R"K莅0"S0SO 0 RRP 0000@Ol& 0-h@L0PS 0S 0SS 888 U   S$,P0q(p -@pLM`P p0SD;$ K, P 0S  -(K@"[0R 0S 0n KP P0P P  .KRS V`T:0S  PЧ4" 02 :/PUP4"02Pq(6LUm -LM 0S S@ < KhS S$ Kh衧DJr0/ 0-PPL000S <}0@S 0@0 0R -L M?.PD@D D`Dp@ 0S!00x &ou -L MTxPL0 Kp@z0"S[Kq( -L MTwPL0 Kp@\0"S[Kq( -`@pLPQ l[TP @ L0   , P   Kh /q(xs( 0-LMlP@ R\[; H0S p ,[ t[K0脗(H|s(n -LM@`P 0S忦00*P$0KP( K/?P$(/Qp$ X0P$0 ( K 0K/P$  L0P##($0 ( K 0K"P"K0$0 (0$0K q(q( -@L M0X T HRD2D!<#<( 4 , (0 ~8 z4 v84 <0R! l!4S e!4S ^!4S dW!4S HPl!P0S p,IP!T0S XB`qH唐8V (Kos2S/ aPuP2 &0 ! 0S Sx 13   0S 3 0 #  0 p`& 6]#*18ƨAJS\enBBw -L M(@Q ,Qt 0Qd彥P(K4QP@峥PQ,孥80S"80<0S408 <0P;圥PP;啥P1 Q0B"8勥`㨡8X0apSwp R xz <0R sP)0< S<jP0S;`(Q ](Q V0CSP BP a` 0pDh  R  R * P*a 00 /00(Y<0Dxs(.TX -LM@P4$;@P?K@ 0K ᄢ儒@P4$;@P?K SR( d3HRqOK`f/z02f/00R@1!S R!R "SS0q1 @1 10S 4 P" P ?K  K0 K q P8 P@@ @oP ?K P婤8?s0LEP\48`#P4`F 2Fa`Loz`Dd 0SD4 "0D4 0S P4 `0 S HSL Sh SH寮뼂D4S P H奮D4@ S ({`|2ST4D  `2000!0@4  0 0=KP pJ@@4 S B@0@4 P4@$ 2 S S SHfP4a D4S Pv HZD4@ S zHPD4 SeHH D4S| PZ H>D4@ Ss zH4D4 SH-D4 Sq( _6  )!)&) !+q(Cxs(R8q((q(o|G :Zq(Dl&{ 0-`LQqU V B*@P0d宠`!!0V<0 yhPpW,D P 00-0LS Khy }00 & !0-1LSP@4 0S&P K0hIP00S 1S 1S T7P01S X `P0@ LP0  $P0Tq(q(bedArdA! -010AL M 000 p`:kQ U5 1S PI}0S E}0S 0(0 1S ( KtPT-0` 1S P K\ \_PL3P 4UPWEVq(fd2mdC &rq(gdT 0-@ LP f/uK0hq( 0 4 &ls(md0S/!   -0-PL M P bP 0S S@@ ɟP@K0h& 0-<@` K0h!    &!! -MLMt@t0AKQh h @P4[SS CS <շcS sS000Kps(xGG!! -MLM\@\0AKQP P @P 4[nS yS0 $嬷00Kps(z0Ħ"A" 0-LM@AK\@PrP 4[0YSUP (匷K0@PP"`"r" 0 |(& -LMM@AK0 (@GPAK AK"5 0-P,@L$ 0 K0hx&(|(b, -LYM M@Z.K BhBp\Kp5< S AK<@ P4[0YSp5<0T rdA""" -LM0*gj zgzz'z'&z'z{zgzzz {   K5" 0-@PLM0 0$S0SG K50S TQE GQ Q' CQ8   /MQ SQ KQ2{ zg{{(kQ cQ gQ%{ sQ tQ mQ{  QWl00S 8@0 v0 0!K0zg{{' Q{ @##ps(`@-`0 @CT`@ pT00 P0S@X X0X h& -L MAPp'`P R @FvT@X @0 @eHABPGwPᐠ U(Ko) 1  00 W 00v0S00 00 00 P~pv& -@MLM  fp%&0BKS0#!@pn P BK@wPP BKA+P,PPBK0 t@pP PBK A s8U8eBK(@p< P B>K0C C ^P BKA PUBK@PBKA^(48TdBK( @p P B>K0C C]P BKAT (4(0DT,dBK, @}p P B>K0C C]P BKA (4,0ScBK0 @cp P B>K0C C]P BKA (400S\cBK8 @Ip P B>K0C C]P BKA4 (480$SbBK4 @/p P B>K0C C|]P BKAq (440RbBK< @p P B>K0C Cb]P BKATW (4<0\R$bBK$@pw P B>K0C CH]P BKA = (44QaBK$@p] P B>K0C C.]P BKA# (44QTaBK$@pC P B>K0C C]P BKAL (44K0C C\P BKA(4P0P`BKT @PB>K0C C\P BKA(4T0$KW#(&i#Bnz######$,$O$o$$$$$%=%`%%%%%& &?&\& -ML M@\@ |TTK @Qp  P P0t`V;+<[S,<[`S:,\[`P8apEbWWnF `F`0E8ġ0K L 0S 0嘃!S0#K1`  @p P) Kh @vP`0! Ht K @pP P0S K@, A3/K @D< /)PD<, 0̂RBKx% AB.KK B @p P" +8[SA,8[`S>|:,8[`P92a0C" 20< S :K4 A0!SK Ax5BK|% AB.KK B  @pU P6 x5< K B A00 QPK AK0 AP0P0<0PK ADxP0x5< 0R 0K A|K  @9?P 0 000S 0`p尀P(V R s  S 00  0`PK AP(Kz&& &&Bn&&%'&P'~'6''|(&ps(' - BR0 R  -PL@ R1!0 0 bX0 \X0 VX0 pP` n( X, L0 @8 44 (< $$$$P T l0 R`V*\ } p㔀\P ptWp$Kkg(^-(())) )%).)@)S)h)~))))))))"*)hC -LM─@Y`pR a S 8Q ,Z pt  kt  sl"0@KL080 [t0,   Tt  slK0"@ 40Ka    R1!`  0 S` ISM SK S^1 0 8QU st <0P+8tQ* 80A0|s @2<0P+8sQ *O(K0a 0 0S S S0 0 | h X( H H.*7*S*[*ƨ`***`{E*s**** -PL`p(H{@ @8SKhg 0@**0/p/ 00-L  R( R((,,004488<<DDPPTTXX\ \@pPRp@PRh @ 0T00  QCQCQ|C xs( 0-L@p40Pp080f/nWEV 0P -PL VPS P KhWEVxs( <00-0LS@ B080f/Ynꀓ(* RP0// -L@P0 H@@<@p  Xr  p@t{d!R0!(P(PJ (E@D  @0P`p00 0Ak0 QP0 1@Plpp, i PXXbTcą(wdh-|--xd -E---&-%.>.X.m.]t6& -PLM@ ] KkP L DK kP ,dJr K 岅0p0`S r0"S0 VQPV0r K 0P0S r 0"Rsl/JHP `P K\eKL xp0 <*JK0 K.... /%/=/(yd}lW/ -PL M@ P 00 @0 K<Ppᷢ$oP0K舗(vdq/ 0-PLM@ PXoP HoP80 K"0'pᎢK0Ħz0(wd 0-PLMP 0@ K,puK0舗(d@w/ 0-PLM@ `P K\p HI0KT KK440K0K$K #KK0舗(zd@/// -PLM@ i KjP 0xI(0 K$p+K/({dЀ -LMp`@PQ YInP @03/$Kk7@@ P; :p DIh &/(D -LM](0  >0& -0L,MQPp`D0 @0 <0 80 40 00 V'D@K \pI DKi0 P4  Ip 00 S 0Z@㬐00S#4P (K H0 H00SW d4H 埬XH 4000 @0D}1ͩ1 0-@PLP" 1P) 1P/ 8>0P  H0P 0PY 0PK0h\& 0K0h@hzK0hU@@C[P0tcidyara1rbmngnts;D1L P0@-@ 3@5C!14!8!<@P0(p@-π@Q BaVp(a  …?@@  \P\ @0`0 P#3pa  …?@ P@ @ @D P H ̄ @ꐛ(L0 R !R "R3S////L( -PX0pbLm@m, T @@DA??@@@萛( ?00-@@L204 20kP0200P20萛(> 0R// -PLbB0p kHCm@`T W 20CS20CS  $Kky0萛(88 p-L MP`p K 0@SKp 00So0"S1Ds@ -L M@k00 0 0 ^ƨ8& -LM䐟p0|5G`?! @0P0 f 0 0g0 QP  0 R$KkH 0S `F@,;h $K( &5;( -@P00L``pph{!14P S ?oD 2"R0S 0 ;|QK;U(i; -QLM0P@/K`p؀pPI K\ Kg0 2 !6P \ nt02S 0S "`  H !SR KL0P;;;(; 0-<@L0PS( n0 10(( -LTM$K0#80 0H0 30@Pc< L0 H0S< 2r03 0 MjK 5$K ? %K5 ?K>jK 0 7j$K  0.j%K<%r"d?P #F$K< ! 0p  0 R00 $R0 S p2000#1-R0" 0K0S0p@P0gP8000S vP pP jP+ 0pѨ000 0 SA  j02L pi5$;%@PD1r5?9#D|"P0 i@P|2CP080PB80 2@P80 2@TP80 2@TP p0p T000P 00S  0t  0xDK(KAFD<(( & <(h&c><l&E^<Ĝa<e<< -L MHRp`0P0 \E R40 0 V00 40LJ B $CR,mU0X U@#$sO(@, "!"",!0 00     $ 0  0 0 04 8 < 0@000(KJ 0s@s/ PT "`F`F &)$aڑ&!&l)()a!ݑ(<( -p-L M@  O00CS0 <(P|` Pp plD0 P00CS0%(0 Y@oKph&<c -LMA|DP?!`0ep K0 e0 QP(K  R(Ko| 30S#Kd0 QP PE ` ,e 0S ( &<( -L M0ㄡ00  0xqP 2S0 K`PTD!p@8 2S  0`0S"@ R`\EU$|p@000 0P 2S0 KPP(K @ᆔ ]p@Xw0` 111 0( &(mdI<((<= -LM@p2S*n+^   2" E 2"0Khz"2pdmE"2L"|8Khꐛ(( &(=1=Z=(====$>8>> 00-"LRP  @"n/d0!$!"$!U !U0X@U00 @Dk 0Dk  Dk DK0hkꐛ((( -h@PL4sπ 2P@` R` < B B$>P00C0( -LMQ`@P p5 0  ԀLğ R 0*LV$ 21S 0   Z 0 0 $ 0( 0,0 T02SS W=OPß20SQPX & QP 0 2S W PPBW20  0@P@0`A0Q W 02 R R01S 2SxPp(K`b0<0 0 QP  0#KX(ZW 1`WV   B`F RD1aSR148<$wO00C0x1@@PAl`d1S 0P0K!14!8!>&?d? -QLM@(KQP pxx R0#K `KP0N #K 0#KK!R0B 0専0#X00SP PUJT 04!@0 R `cK@0U!!!!!!  AV cK\ X R t !H?((@&@ p-LMP P ؁YX 0 RYX ތ Kp`T Kb/K $b b p!S40R00\ i0(J@;y@ -pLMK `Q @P(K 0 K QPƁ  0K 5,K 00RP0d!`?K ?K  @@%?K 04 ,50H2 0?KЀH20  ?d4"R2P?KЀX G-?K?K P 9)2Q QH 42S P!1?  !<0 #!1?  !< 0#<"281   S R h#"Ra RS# HP2SL#` P?K⋯K Qp,[0S0#Q,30$"i?K wb1 RS3b2S2 0S+ RU("b?K/Kep 0<8rpP倒@0  N@p?K KPU 002?K ?K N 5d R0 S!Q10Ѽ!% "d12Sʤ"[1R 8l!h1Q08!X [l 2S"R00Y0S 002S~00/K  R S2[)S 1[)Sk f0K0 0j0L ?!P?됛(@3 @@ƨ( &@@ABAvA@@AA(pBBAAUAA*BMBCBB? -LMl`BpT@P@@F KP@41R@1@@$$DS  Ki1 }1 `p`u1 p1!1<0 g1 b1 ?0\1!1<0 dS1 TN 1D?0 KiFꐛ((ƨBBBBBBCC%C6CHC -LLMԀ0P`@80 ` qh < RlPTpoK,00P0S4   $Kf40Z“ \VԄK 0 4 @8 < 000 0 8  0L0 00R0S +0T0 ؀0p#KPT0SYʠ;! R 0#KR0o 夢@(Kh[ 2o0pX$Kp 00$KPp 0$KP`0 t@YXԄK 04 8 < 040K0 QP 0 00 0 0h:P 1S #K 0R0!14!8!<!14!8!<p\#K 0L08 r20X0KL ]ԅKp 21S 0 $0 P( 0T,0 X\X000X 00S\8*.X :RU6JL021S" L0240  0$400(40 0,0X0K40 p P T p%KX 0X0L00L0 L0 S00R0S 0 72SiT@p0 p p?h P\ 7BT 80Sl \7K0DK 0A 0TQ P 0 X0K 0  R 0%K80S P6p@WN#KDK@TP0 KT0P 000T 0SEKK6r|"0aS0KR pSW 0A %KPԃK\@80S 00  0m5P"P RBT f=5 $K0V. 1S+ #KR0$KP000 S#KR0!14!8!<!14!8!<#KR0#K$KKPLz8ğV, 21S( 0 P$0( 0,@#KR0࠳$KࠣT0ࠣ^#KR0 @  @  0CKT0PG 0$K pp܀m800  0oꯠ R80S00  0 P fTZ 0  0  e80S d@+80S v Y `p WV`  704o4KD00H#$0 #(#< 0 0 0 0 #4 0 0#80 0@#<00 0 0@2Sf BT80gP^ `p040 !0, 20C0`?@@20C 0`0@@40? 20@0@d040 !0, H2??0C 0`?@@20C0`4 0@@`2? 0@@0H??`80SH02P SN ,0P@@TIJ041S((YCzCƨ0(CCcC,DCCDD#D3D?D -LMX"pP2@jS<够P4r(b2S 0PU2aS 0S- 功Pؑء0"S'R It 0댂X2S 0p5 0:P0S2S 2S<1!$1(1,(Kou~PAj"R Sa0 R(Ko-@D 0(KoSPI 0(K萛(MDZ(^DDDDDDDDEE 0-SL@4 P`P `P `P$0`PU0000`P p00?o2S \0`PUP`P P@@uk+uZ(D &( -PLUp` $_!_@ &0P wP%P -CML4MKLK A ,K B0:K,0CP5@TE c`P'@ZK,PE[` P40:K,0C 4QTJK,@D0 0%C]K(PE0$30P0S @@C K4@C K4@0@`P0@ t C K,@t0PE:K,0CPPjK,K,`F B0 !01P30 3Q# K 0CC"[8="[<@004 0"T40 0QP bK H,P P7[O  5K"P 4[ `㴑 0R  R `eVXZ  0H}X *#;;S`DY 4 $ R,0T T0,0T0 R C_XD0P20Q 0L0L0 S s&a 0`c0\00Q`\`\0P  dH`b`````aa aIRRaArrAaU,aCacaaaaab7bpb -MMLP@00 P0`}S00 0QP KAK+ A Pp<0P#$42K3"K#(#<12K@02"K#$02K/"K#(#<."K-2K 000RS00 0QP (AK Ac P`,a -L M@ L0 R0!0!0% Rl00l0 rp00p0KRP0R3# rࠃ^ L rH00L 4o 0zP000-bb -LMXp0 PPP0 X (K0`0g&j  0RQP DG X0  X 0Pb c -PL,M<0 pPlP00K`8 P P@BP 0 P` ^Z0@0 LR0#S!QŸ P\@:p.\F\C\@\= \9P$\ P (Ÿ P? pD  P@PPL0!0@S s@@pP0S'0+ <0 % 0< 0(K^\\\\  L0 Q$ 0 q(@," 8 P p"8 @P*"* 8 P0P S "!"0 8 0P@c?caccccP p 0 p// /cc- -P`p@LM0 00P0S (KX  H r0A8 B40 40 s-8  r q`  TP0@ q x 0pP 220 P 220 p P s 0pP pP00 Pp<P cIc)d;dNdddde1eFe00@-S0P^0BPU02 -LpPx`@P  LP 0PR*"0R R 0eb -L M`0pPPPP0S(K† R q  Q R 00Q P@T "Q  PP QA BTS tD q  $ 0 TS0000  Q  0  0 g t0 P ZP  F BPTR2 Q PEee+f]fe -LMpX0@`PPd (K X0Wl0L 4 0R00 000 r 000 PP! p 0STRp rppH 00K/ 6P0 P  L2 Y#t ySl0l#2#>p0 Sll0p Sl0l0P0  ^lp20Bp.20Blp0X` 7&0##K00#KO#KQP 0Lp  Pbf -@pP`㨑娡LP0S00S <q.`@q8VO"0S 2S 0S 0  0 P0S P  DP`l Q P l0`<0P0Q*l0S 2Sp  l\PP 0 RQ@0P 0fffIgnp@-XP UࠓࠃPࠣ^p@^`V @T?( -LM`<  H1p!0  8 VP0S0V 0S (K1 080  `0@F4$00C0 00OQP 0D P4 08 X:0 000NQP TP` 0 0 40S0V <0b(agHg -P/t0L%A?k@0Sp psR0FS `C fO@P0U?  C0(0PK %/( -LM P@LOo U`B \p @ ŗ 0C F00ZP 5U@T  K V( -LcM@ 1Tp d! `1  SP0`!S@0Ppt1 A 1 l1 h1 xA D0! R 0X`#baK# 10#1 pRNe?K0 aKSR g`1 ``0C#= pvP0V`=" e|! 嘡 1|!SD00S"   |1p2|1 00a?K Na?K QP D (100  RR R0(1`1xa 1 1 `01 H  YdP3  (10(1 ptdP 1^ 80 080#40L0s3[050[003 s0Qs t1RD Uh1pl1 0pP<5 50S0SSK2QP0S 0S VK5rSP Rd!"R R R d!VK2S,VK8 R K/VK%L2PPPP00"5"5P0&U UP0U*d1R0dP40SVK04 tP %44P P0%8%\0P @Ih00h02PEd0U3:VK_`\P dP08 4dSr" : 0d!0802PP0`1l1 0pPPp@1|! p/|1PI`!d12S`1 P0`!SWU Uh1 Pl1 TWbP l10`0d!p5@ D00S|!0e?Kbp Je?K SR,0 pPI Hg(ag{ggg]gb(gghAhHhlhh?ic[ihhhhhiiiiij9j]jwj -0pPRUPL`@dP T PY,QPM KK/#RD8QP0Q:" 0PS00 Q PP 80"8 B 00 00 ! pS80(jj(jkDkkmkk 0-@L5%SQ% 0Ŕ%SPRP ńU UQ0  0Q Q0(( x0-0L`pg@TP @0% V@%R(( -LQM`p:P> R5S2嘢005ET/  NP05ET TT5d 05 !dP$(K RR4 @ST 5" R %P0S0 B2"0 0 0}I JQP d d0PEd d0PDh0K/0h0VKQ 0! SK`0 rd <0 SK4 `1 8 I j  P`1  P80080#40L0s3[050[040040#403[010[0 0@@0 000 D%I DQP (|k(( l+l(kkkl $00-LP@ 050(0/(0/(0/( --,@LM   ㆝r& -@LPq0 R ?P0S 0`V4`  T0\)W<@0S 0SQ@ 7(=8(\](\ --LM  K --LM  K --LM  K --LM   -@L]M^KMa HpH@P(KBK! Ap@P,0KD@hBNKd @DU.K B% P%8T5: S"HQP0 00'PPKAP4: SpP% S00S BK  @80Px6#PPU BK @0P  5 s5P@(?\(DN\^\x\\ -L0KMc0PD@  04   K!K (\\ 0-0LS 3/ p( 0-LO0 @( 0 \@O@0]( 0-LO@jSM@J@O@0 -pLMnKM `F@P,~ :Put=(~ : Sw/r0P  rR O00d K0C P<#@K @,^ WF(>S T@ KA $N pPVt=: SI^KPE$>"a$^ @PT PW0 KASR000: PF,P U $T@zKKA>LP( PP@^pP S(^  S$UP@p-p$MP@ pKA$BP(!0#K PU00`q> K0 @K @(@P.K BPN0S2`Y K@PPx^K PE E`PH|P},P X% (KS->CM-->C4X1X\.\+9><-9>:>C7-?n:>CF2-?>CC>*-}C>G%-mF!-EnF-E~G-XJ>X ` p 0S  $$((,S>,,}S>G,mF,HHLLPPTTXX\\ -L M@Pp  $$((,,0`04 4T0S\%0 R L%rTpԀ}  z R S`,1i(KTdT`X`X\\\`Y`dVdhShlOlpLptItxFxX, Z =`: 7  0$P\50 S 0` Q0P%@PRڲ0 0TU 0/0+P0sC@p/ p-MLM@R0 ANK4 @D8 PK0C Z 0pH8 aZ@ tZ< Y \6KP L ? :0 0EZ`pI `p ?:81#  08 0 >K0C >K0C CK8>K0C@Z0 X`luP0 c0 C1318 >K┘ 0C R0Z 1'0 (K`p ?V:81#P `8 01S !0 8:>K0C 00 >K0C K 0 LX p 剑''qn0 jgɔ c`  >K0C K 0 L ᘨP<ᜨ L, l9P:>00 X85   @5 L0 +0S,0 KA00 >K0C0pS KA 䒟r'000 Sc:0 02^e ЁP0嘨 Cpᜨ p c7X0^85   @5 L0 0pSL !-CK( 20S= ߃0 0 0 1"]K0 PE0 $? <8@(=; 08 ( (0(0(0 hh(븈  V  ,!0 ؀ 4P0p00@8Q '' 0'PDP>K0C8 )7 t0 !8( 0(xPuh@~h(=x(0(T &]p(qp}p( -LP@\7P0S V70S a WVPK7P0S E70S!WVP@P@ -Lp`@ba0 0@$Kk -ML MH@Q '#0b2PE ? 00 ş 0  C 1#Xr 04PI`P0t  "`R(K20S%  1pVW0 2/  p P 0 0"RP0```00rdQ"R0 PB~K pG +0S10S%4[&$[&4K%$K@p03/`. 0ܠS 00S0S%4[&$[&4K%$K m00@ 44 + 44xp 04*+`070S .0 0{px(0(h(l((((H( -@P`pLAMH' %@ 0BK]6UTp0 SR*BK\&':@;3P ,00  P(B.K 'K(pl  -LM0 K -LXMpP`@X tKqF0,0KT0fKp0 &KD00P RpR( ttK$ Kd=(QP-D`WVSRWV\/( -L$Mp )[ QP@PE 0 b04 $? 0 9  Br  20S04 0  D280 Q 0004 k 0R w @P+(~  <0 *40弡 rk<0``0  4 V:  \UTU`N5 `0N(K  <0 o*40 <0` 850S  250S 00 p p$!5`50050S `5 ` 5000  p0(T &x(l(( -P@LKGM M A K@ X XE:4 $5 Ru%0eSJ 0SE !000SpGt廀=K 0C 0 =K 0C4000@5 0(5 H0@4 0<4K 54 G>K 0CQpQ8 tK4 A G>K0C 4 0]|% 1Ppt4p(Kdy%0S$ < L000 0  H}P $0000S O0  0#1PIKA SR M B@p?I>K0C5 0 0S 5+  P2 %V1P `ؒ L000G0 H   00GK<4K2 I4 `3I300$b30SD`@2BK H00pH0HBK J W#000 S 0000pP$H 0w5  0q50  g  0j5300C04 S p+Lq   4$ 0001 p  pP3000 T 0$0 K AQP 0 00S O lp((p(T &rpp(p(ppq=qHq(iqbhqq -L M@PV`KpYp1`V t10S h10S 00 08 P`0(KoC1`@DT; SR0H 0  P$P I ,0S"00S T #0S ~0S Gpp(KoX 0P H0 (KT((@(q(T &l qqqqr(0/ 0-TP@0L84 0 0@ 00 +20@0 *C00(00S/p/( 00S/( 00S/"(P000 R0-SL4M@P (KL2ЀX0`BXP0b0K80@` R C Ÿ Sß Q 0C0 0 0@0pἀ ?%K> #K\5S`9 0#K ?#KK܄K T0)#K ?R 0;00S  0T @0\5S A0 ?!@P ?  0=#K%KcK 0R 0P00Sw  0H*@0 0800 0"ih(0(`(rTBrZrzrr -QLMP1 SR* 0"Q@ x` SRQcK QPH ? y3K`$K0040!#4 b\%p,1R K00?1# `p#KKZ3` l<, L:0>  `00S   0 000x@ 0 :31#D00 x ?.3400,00S(K(r0((T@(( -L,MK @P@KSR3 SR*#K!3K SR$KKd3pppX3` ?2K@0040!#4 B\%P3R K00?1# @Px ? 2` L< l80>00 <40 #K ?d0 cc C3H0 l2a8bQX2X2P2P2,$K ?KP 0C  00Q3P0`S' 30S6S 0<(8,"<0✀K L8 8( 凁pW0 03- 3R袟0t0S=r䂟H8S;000p Qo   X|"KT8 \KI.PP"T8 R! p t R1W-p1 0R7 H(!0:D8H@( 0A?oR20SQ 00CK ~.CKO|+PB`D1@0S/ !=K0C  P0$9z 1 HP  P8S L83/ 000!=K0C Pt!=K0C  P0l>K!K 0CA  P0!KA H80H8 KpG0(4((((}ssss( -RMLM0 S000#45@Z@5 & 9`pb&:  P T S$(?V04<V 000R0SQZ !0h0S RnK `F  F7Z RnK `F ,F70 `B ?Q/S>K 0CS>K 0C SK R0 A @5R~K 0 pGZ 85-}  LT ? a Q2SQ S>KZ0CHn 10u85SX!04#40CK -CKR*Pd@50S00T By 2 ` V`80 0@50SS 00`xPßS>K 0C\@5 RC 0S.K B(#0C zS>K 0C h+0t 7#bpS>K 0C SK R0 AX H{080 01(P NPMX 03/ (K0SKA#dP3S>K 0CP000H R00S 0 0CK ,CK)P@5@0S S>K 0C  P0 px h0 q S>K 0C  P0(0(((sss( -L M@@a#YP"KR0"K 0# KЫ D 5 0-@@LPU D9:P P 0 QP00(C-A؃p@W`VX0 0#00 0-P@ L0$[UT01 SR089@M0P0S 0Spq%P0Spg6Z100S )0S X 0` 0S(I<K0hs(s(()t(=8 tt -LMp@`WP 0  P  0p`W( 0S w `RpH0`S 0 0 $/p00Sdd, 5+00Kha<(P 00pKl  ($t((P(h(t( 0-P@MLh @ s _{+0AS v v(vvv00K00 /t>t -L,M`p<5@ @0`p Y+0S 0#KcKePp KSR% KSR Ф0帐 ?,q`D H DSR/:0 S 0 S bPP `#K!+0PS #K 0#KH0!C D0 0 S:R H0K30 P+P3#0\œ\    s0Ÿ0 0$*0t @40HSX30i Si H0S 3S ,0S *0 00KS0\p ?pq,0 " 00C 0 RL3b0*0C0b2+d20S e@0 : S) S-  S;00000`Bl*K `2@pWJ ,0K`K(K0bS 00h10800@0s0X04KK ! T @` `a8b  `p`00S@0C600h,P(` @0stdp4K4vX  T @` `a8bl bhP((0(T(UtT(((U t(H(((l( -L|MR2p@ K?+ "\P  ? b ?)0 73`2`0` S0 S Dr0S 3S (@X K2:20 (K'K` RpR8 tR4 Xd  K< K R, 2]K)00<0[S K 0 0 #K,@ R 0T 2 K0S0\p ?p(+0 " 00 0 @PL3@0@00*0z*0S P@ P3)0 P(KSx 0 r0(P(T(((U t(P(h(((H( -L$M"@P0`40 nZZ8 40 40 t Z0 U0p 40 (K g@_ T DK c8C SBYAQYS T0Z AO0  `(08000 @< 160 $K T0PR#K0I0CK᐀ T0R#K 0I#K R 0#K  #KR 0@$Kha 0  *(@ܠ$K 40 L0 0K4pL `R0 0 04p 00800` 00 (PU@0PԄKZ0PP0((t -LK0C 0Sc ß3 X 0  0SN P`, Q?!.0d4 0p0L `a8` ?ᔓ)D>K0CP  0@P3  R0 V0  B0S R@TU AB0S |R@TN 5@|2R@2b@t2@0S pTBC~*l<2Y'020S 0 0B0pS 1 m'0,0W00810S 0S  1 0S(K +@ &@P p0 PR<0S ,P >K 0CCs*P( 00>K 0C 0C(P 0S((0(uuu\(v@(4vWv{vvvvt(v((w`(;w(qw(wwwd(ww(D((H((((T(w(!`,xLx -x@L`P.d00S 0S L"p P0S vKh.(`(exox -LM!#KH0@S#K R0SRK pP #K X"TŸ  R0 4T020Sa $EqP(KP܃K b<000CSW-0/  1!. 1 R#K0 #K R0  00#K40Q l!H  R0 @  jP P  004 " #P0""P 0 -&'0 S0\ YXYX P{ ([y(uyD((y((yy\(00S/p/(00S/0/( 00S/( -LM4M8KD0CP08KD0C@$l(Kp:H BW0( 8K<0C: SWW ` HpP5 48K(K<0C8 B0 000PP#!0 00(K0 (P X8K(K<0C8 B0 000PPh0S 8KD0C ` 4\ t!P 8KD0CD0S,4 0- ; ;(KD B;W1 S> K<ASR:0  R0K<A0 K<ASR:0!K<AQP00*  R00S \:0S[ 8KL <0C U 0xK04pG (K0 B?0000?0  R09* 0yS R !P8KD0C0`@4VE 0408K<0Cx }K0 <AB``?_%8K40C0P0 '90S 0 8K<0C 8KD0C 00 P8KD0Cl80S,x t,E  Z8K40C K 04A 8KH0C0 Sk7QG480SC 8K<0C  R0S:R;h0S8 7(7d 0K,H0"0 h!P 70S 8K<0C008K<0C 8KD0C xW8KD0C<@8K<0C (Y60Sh0 0!66(PjK? !0S H68K40C R08K40Cp8K@f40C P`P01WPH 4 `p0 pPuP5 P$ h0S`pK8K4@<0C` K 4L"0#1\ `pK8K4@<0C` K 4L01(K0 B08K40C R0`p8K40C0 CP K04A t@?7#lp1(000A8K40C 0l XpZ 1'000S 30S Z 08K40C  pt p?o.YZ    R0 h30S Z pT!X  A { 0X1p88KD0C <3 8KH0C0 S008K<0C 00008KD0C  "0008KH0C0#600S!|20S 92 P3P 8KD0C@*1p\&#*t@18KD0C RpRLtRPXd 00H08K40C004<0$81# 0S+ YX 8KD0C L00S 8m8KD0C0@S OH0S#  0 # $KDA$hP 80 8h(( (((ytP(h(((0(`(y(yy"{((d(z#z((zypzJzzzd((z{u -LM@P6f0Ɵ0 6p,0S+4E>@C0A ?`pƟT0ZX K1 h6h0 0 \(K T@V@0, Rd 46 (K 1!$0\Q  ?ZK )KX0@P 0 p1 R(K0p (K R0  00(K00/ !.1 R(K0(K R0  00(K0 @" P 0 KAl4\%Rc 0 \d ?0 )040S(40W SW 4d0S00x00ß0S pd0,P0E0P 0030SH 30SD 00 S 03 S pD00 S0 \0?0X!. 0 )  sRX 00 $,0S s0r h`pX`|010 x2 0p 000[ 0! SRQ  080P0 9 c000jKWVB}*K`p V0YX 0QP*KD10? S\^.! K0QP 303:  P? q@ F0 `00(K 0(K KYX QPq)K1)K`P YX* G/`P(T(0(((U 4(((((8(;{&(@(c{T(|{{({ -LM @p 0P̐00 00 00CS(K Pp`0V QP p @40 40@ R0Sp` 0R @P(D(0/ -pLlMX K/0\`<0KL10 H1 D1 0,0SG0A0S  d0,P0P 堿00@ P 0D R`pUT@PP 0GK0Q pR Q8 tR 4  R K  (K0(\((8({&(( 0000@/00S/p/(00S/0/( 00S/( -ML M9P@@XH9 90S P d9 QP*00#0_`00SD9 ) $I,P$D9QP (SP80S= 0S: (A00P./(50~KS069K0 pG< ,@59K '0S<80S69[5)[59K6)K5i[0``S`  +P  7 #R0hgf0哮KS069K0 J< ,59K&0Sl70S69[5)[59K6)K59[000D9 #0#000 9D90P9r@p1.000C0! G.00  R0k L +pPL9d 00$pS 0S T&0,0P 6pQ cP.\V0P% .P%PPP5P|z PgP  ,@ #`t0 0C0-yP4`ASa 0H9 ++P 40 C 0" p4 !D9Px40 h/0 L4b0 0D) 0[_P#P m00C0(K 0#`0pß `SP` 3006P@3 0 0`D V PQ`448p0AS񟗧꼰HQŸ20S40000P2 d2 #R0~`2 0#R0sQ# 0ST20SH" 0 QP`    P000 !0 #R0  CK K 0p@>K0C`!CK\m 810 S) H^h#R0 š!ʡD90S  0R %KA 0 0 00p0P`000C0V& BxsP`< (((l(*|C|(G|^|(hj||K}[}|||}l}{} |(}~@(|}}}}} -ML M 0AS񟗃Գpt̵p 1P 7 <6 $P 7 00QP  7P 70S p70lglWMKh7  @D*X 2,0D5K<75 0015 唅 e 5%R2:7 Rp5SH5@`aVPU:4(K tPP |& F`" \f0S   5 C5pB15 G5p   005`5 (0S S䕟u%@p((P* H5 0  B, ! CKa50S\ 0C.K0(0d00\0' 0S H%gp(0Gs(0(SK -pQ(FqSK,@+0R~KS5 pG" 5 @QG\5 S1 #%0R+ S04 04 04 ! !!5S 0;5@ S,5< SK@)  (  C.K )SKL( G5 S1 # 0R S),)-*-SKL؀ RK 0 J5 pJ5%S5( 5 R ,+" 0`Y"5   5S!Y!0Y@ ,< |(  5S  @0 (0S "QP r  0M"0`!vP 1 |!O00C0cP *00000C0!" !pp0Sp@0o !SRk 00@f! !!! !! }?q(/~=q~yl(((بD(h(~C|F~_~8({~&(x(~@(k~qr|h0/ -LM"P܂1EP Q" 2@T(K0S Z `d2@EpDAG@D0p hhP00@!SR !0 Q(2Y 2Y Ao2婒0SY QP000Q0a } R R@0 S "qP T1d00C<Q 8P cX K) <"K/K 募K" tb  Q pRpr @ dQ8 tR ]4 K :" !2P] p02 /K) 000((8(~&((@(((pq((;xr -L4Md0p<0 张|4 P@<? %` \@` P  ? ( ? @00 8"30S30] S] 3 H0 R 3H S  @ 0 pL0 2D0 0<`圣80 L0< 00CSG80TS! L3 80R000 A`pD L3`A0 00?$` a2! Q,S Q0 @0B* 220S IP PB^8 P(KS @0  P080 0/ !0. 1R R  \"n 1Q^0T+ 0H S`? 040 x10 ?^$40P0K P0  00#K04 "  R 0 H0ȐS 0 04 $ b? $i 80RT $0A0$0 @ 0 @L3D 0  SR 0< 0s`p 0(P(T(((U c((H(\((0/ -pLlMX K6(2̒0 0,0S(KB0S R`d0,P0P ttK00T2`0@10 _H2 00SpUTI`2"0 SpRGK S8  R4 tR4  S4  XR   < K @RN`,`@hd`V" c'P $10S  0m@PP 00S  0KQ SR 00 KAS !000S \ T  0<봿0(8(&d(T(((`(q  -MLMX^}@0hK0,`F ]'0t0=0S5X0S+$5S/p= R ` 0S 0 $5崍= * ==0S 0 0 PX0S$X\XXĜY<P0U\0 T0P5! X \  B' 00B(K1/B08K?C\ 0K00BL100$Ŕ`\d0@h0<0Sh`h0QBQ00h0 1l01d0dKA~@(<KzAU008=S;Lqo QT00B/ l hS0 BB$51`R  B Q1- 00Q  :$: R( 0S  -봀0- 倀B$00B1Q1 `R(B!!@L0PH D >PT :pz *㠀+ \:P:0S 0 0<8K?C0(KA?~/B08Kz?C0(K3A?/B0 =(K{/B0T0P(K}/B0(K>F/B08K?C.<&L9 0KLUHRKLX0S8K(K,0C>C.B08K>C@ &8=`C Xa08Ku?C8Ku?C V0u 0KwA 8Kw?C0(Ku/B0(Kw/B,0 S}8K>C?^ PO L80S KAA> CKA˄KALKA|8K?CP7# 8K>C(K, B0B  R0P000h7`G*i T7VH70S 0 0(K0(K{/B00K8K{?CP0/ !. 1R0 X 0`( pjDV0S `d8Kw?C0,p8Kpw?C0 咵008Kw?CP8Kv?C %Ky@ !8K>C0(K0.B0\5Q 8Ku?C08Ky?C  ?KyA 8Key?C  ?  50SD50 S 450S(Kz/B0 S (Kz/B3 S 8Ku?Cd0S tw0 0040S 4 0S0Sy X4Hdt4p4 .%0\^ KuN`` ?`d  B2h b9"6>KeyA`?ᕃ(KAKLKyA``p 0`AKAR`KA 3`V=S(K,A(0xK,pG08Ku?C0(K 08K?Cy/B0 VPCP(K,0u/B 0CS=S.Sb 2  Z\2KyL %  8K>C0(K0.B0\2P 8Ku?C08K y?C ?Ky@ h8Kay?C ?0S 8Ku?C1a10S Kx@|P1U`p1Pq0h \10S }1P0`11 .%0\^ KuN`` ?`d  B2h b9"6>P(D((8R}p((Ā2i(m8(&T(((/Y(}(`(Ձ(0(H(((U (@(R(2/@+8K ,0C! t $5S88K,0Cp 8K,0C $  ( RU ( , RUPP0 PRQ V ,P0 x` x Qxx XK,PE 4#(Kz/B0 ST8K{?C T|#K(K,@z/B0 S\08K~?C m#V =SL5s(Kz/B8K ,0C#8Ku?C0帐 `XK(K,PE?!.B0 0R(8Ku?C0S!8KK,0CzA R\ ?0 K 8K,0C zA B  R\ ?0  (K, B 00C 0P(K/B08K?C A0R\PPP\    8K Bz?C0  R8K\ !>C  `pS %0/ 8K!>C!0. 1R R Q"0#S(K/B 8K`0?C00^  ~aR`p(Ky/B 80 FSSuhK,`F0008K{?C0S1 d0$ST0T00! !8K,0C PRPu2XppppXd4`00 0 *000$5S`0U3S  K,Al!s00`R3080(Ky/BP8KKy?CA R046(K0!.B08Ky?C`0(K0E/BK0,L(K?/B0P(K, B$0c$dQ`UuaRQ0\04 0l$5S(K, Bl0P0hp`VS $%S0! !K,@$0(Ky/BK0yL@! `a(K0/BK0L ``! `Ɵ pǟ8Kw?C0LP P: 70S p0 `00K08K?C0uA00<08Ky?C0 t8K,0CCdPP8 8K,0C rX8*l8Y80S 0 08hK0,`FS  b8K}?C PY0ST0TST8K{?CT P! LFPX9 8K}?C  00K,AST0TST0i8K{?C T0 090ShK,`F0S\0S\8K~?C sP BFP 0S\0S8K\~?C dZ0 08Kw?C  0" `0S $uS0qpq0`VPS8K\0?C000S\0?000+ (K1y/B0p04+ Q\QKA0K8Ku?Cy@0!8K!>C q8K(K?C!.B0 pW`(K/B 0R`K(K,H?/B0(K/B 0VlS`0?00S8K`0?C0000+ (K1y/B0p0l, Q\QKA0K8Ku?Cy@0!8K!>C "8K(K?C!.B0 pW`K(K,H?/B`0 -p`@HHLT(%P P U @گ`긂 -AL0 5 Pq 3S5(r`1 0" 0SV 0S 10a0  la*`1T10S 0 0U2031 PR5 0S [@ 5*< 5000S c0 0@TPNUKhHP\0UX PH0@ P,00(( &(H((%ق‚( 0/(0/(0/( --,@LM   l㐭& -@L q0 R ]P0S 0`VR`  TN\GW<@0S 0So@ 6U(=8(\](\ --LM  K --LM  K --LM  K --LM   -@L]M^KMa HpH@P(KBK! Aḩp@P,0KD@hBNKd @DU.K B% P%8T5: S"HQP0 00EPPKAP4: SpP% S00S BK  @V0PxTPPU BK @0P  5 s5P@(?\(DN\^\x\\ -L0KMcឪ0PD@  04   K!K (\\ 0-0LS 3/ 㠪<( 0-L0 @( 0 z@0`l( 0-L@"kh@00/1Q0@?o-2 P  R2 P0S 00CoS00S00 \x PPP TH LQHH  0000TTTx((h(4((T P0-L@0,00S LѭK0h(=8N 0-@P0L000 0 0022=p 000=000X0X0<0<0@0@0\0\0H3H3L3u/L3P3P3T3T3 h K0h 0-@P0L000 0 0022=p 000=000X0X0<0<000@0@0\0\0tH3H3L3u/L3P3P3T3T3h dEEP  ^4K44K44h 4R 5 5d0d00000P5P5H5H5 @ A H5h H5S>S>K0h0 \\L5SPPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//( -LM@8 @T 0T0t0؀ YX+8  ?#K:S0#K @P @(K0\kPc0S0 30S30S  ? :K LcL00o P0\CP,3,#0S$ #S*t P S0S 60rS B*Z0S @崂\hp I/o2" W ڔ8Y(R00 41# K0 4000 d0? K#:Q00S8,00CY  0  AŸp 0  0pS_0S |A吁0h X10S P L10S @88AqJ 0S * 00S p0 0 0@0@"Whp帠ppHQ*0 R A ᭫ (l(((c((v(x(̓(0(T(((`(3H((p -@?ML M@0_0K?A`姧P4X w ho(KX0S B@?P88 a Y 7: S "bP@>^0SQ 04(00S ; > > > ?   ,8 @ X0  ,8Oo,  ,0(QB@R  P >R0(  P @T ץP  剒Υ48P0St=0S| 88 hMR r>K 0C0>K0C p8<.00 P @=0Sw0St@Tqe>K 0C80>K0C p 5[S  ZK @UP ZK @OP Z.K Bh k)YP d"7S,8 8  4Z$  X  pW   KV. @  0  (5 RISH ?Ѐ X` ` dP `5, S0<$Q( p,t (5`# sP `5,(S>:*0:0: 0:" 0'0p5 Q$0Qp5 0Bp5@0  p5 3T0H.,8t (!KA ,(0G  ?00 :  P`tI)0`\Q=S.0P 5` ' 9RV0 S @\l S\ ^i 5*< 59 90S X0 0`8:0S 0妩9 0 S` V <80S(8Qm 0g xȟ=C,0D 90t0Nß` .`p.>K B0S R0S q*1|10S 0! 0 0 P 0(0S& xQ* $0S< x 0(%0S R0S Pr*L2<20S U0x" 0 0<QP H= CSR( u0H  ? A0S `aR0S s*3 30S !0H# 0 0P L= SR( C0L  ? 0S (/R0S s*`3M30S 0$ 0 0dTP  ,4 0S6`40S20,5S.0S  $0 000.K BЀH ,5S> <0(5? @L t ? *4 40S 0% 0 00SJH50SF0L5sB0S pt%0000L50P5?T5V>X50$ő-00  B00B1\!`0 P0BQ@5F00L 000*$660S _0P& 0 0\6 PR |60SF*660S B0h 48IP@PL p,x 0x _H   ? @L  ? 87;@PG%PP| ,8LS@D00ET@A,8d P80 Bß28 b>@"8<NP 08S 008 70S   80EAd ß B2( b>@"8<H80S  0,(00p0,8 ,8@TPD8O@ 0@P?`@8P< ,@ 9P 2  9 Q,@_ UT@X9 @`9d9p9PoUrp9W @9P @9@N  Ph90( ԢO0 5 : p:0S 6[S gK4 @NP  : KP:PዾQ GtZ @ 0P@@048 L:P :Q B P 0  0 C0  0 04 8 %P  l *X; R h P0S 00 0 0 00  0 4?s0 S ; R O0S 0 0 000  00 4?s0Sp d< R O0S 0  0q0000  00 4?s0Z%: A/oQ" /Q Rz , (= R D O0Si 0z*000  0000 4000 P = R {O0SE 0@000  0 $> ,>Q0>+,@>HN 0S X>X 兣d^ 5<00Qd.00t.@0.0P,:PIV{PewvPvoP 0 40#400#0`p RW !D0Bs00P \?@PUPx?`JPV?pSsW0QY R  $08 08Yz @D  Kʼn 0-0LS q: S  S  S  S <0P0 S  S  S(`(c 1-0LSp lh@ 㛢T L10S@10S0Ϣ(1 10ST00S 徢P`巢00CS0 9p@ T @YT eYT0 @00CS0" P 0  0 0 SNT(vy((((h&^& -pH0L0@S` / 0<|Pㆠ(y -PL M<1P81P4100pLP1 P P?P 0` P P`` P 0(00 *@'oTP00 UT X P(K PY` @@  0H(@(0((P(( -L4M#K14 00_5#NCK8 p080 #K  H  P #K`<j  1( X 㚡#K `P(K?P#K 0  H PP ! 00L0 s#K ?$K%KSR 04 ,@P? $K 04墡`0$K嚡(؍ݍd( w -LMp0P`80 @ ?#K00#.&#K00000 #K  ᒐX 0 (K 0jPxX (Ko!#K ?  8uP   ? Q0P((lw -L M 0`S@ PU 01 U P0 PP0 0Tp/ (Kܠ0 @DLc0T@S`  0 80EAd ß B2 b>@8<"l0S  <0P000p(00@T(EƨP((0(( -LM`pdQ A\ a2PAl 000 SR P0D D000p 0@pK0((((( -LM0P@T@T&d `L l0` WV @   00P00@@000$K(0(v -`p@L\MX tKtKeKT@ EKШ 00-L@S""#"0H0S  T00S H(L0004+,^P000(D -D`D@0L Pn (00S KhS0(P(( 0 /8( 0-LT @UT0*<80@400 ?1Q0(T(0( & -LdM`SR00WV0S@ d `Q 0S  BR 0(KT K0 $ 0Y,R(b7PUU00 Q A? ?@q  ֽpӽP!XQ0!00S1 \1 ` +<1 pR? `)0S! 0P0E>0*X4I0600S 0 00SI00S d0P0` 0 40$KkxP((((((((\0(((H((AP(((zH(@(_`(((_ -PL$M43p00 8Q 3A @R _ 3CK40 ܃K_R 0a@ Vd`@ 0^ PŁPXU@TP l| \P  ?PPR  ?000 2 1p0Ap(׏80 0 1S/0 R/p(`00@- 5< ÒH0\ 9>@UT :. BSR0000(^F -QLMPp` "K< P9 P40P0 Ȁ0S 0S  BK @P@ @@P0 0S 0S T0 sBK @P@ @@P 0 $Kt(H(X(Q/0/ -L M@8尐 笠0 4 8Q(K0PaqP@4Q Pdt`pP8Qlon `0-LS 4433@o10 0s00000s0B!00s0! 0`-LQ444x4o0! 2B1   P" 0`-LQP5455 5BBA 0`-LQ5555BBg -$LQ` ElAhRpraRqSpP$eZ!U P*BQ  P@  AόN\$ AV`R @U@ Y N B -LM`R@p bPP \q_K, K4"D4eP`(KP(  Up` 0S 冂<08 (00,0 000040!04 04$0D0(0`P \nW `h |`w`h20   Xf Lif @ef 4af (]f  p p   K ϖp 42`#fs0`9`a8SyPb 0  *0*0P0 ( 0* *ꍐd@edAŐ֐zd@ -PLCM M`B.KpP; B p@P E>K P0C0PDULT$P!0#  K -pLMnKM `F@P,~ nPut=(~ : Sw/-0P  rR 00d K0C P<#@⹙K @,^ WF(>S T@ KA $N /pPVt=: SI^KPE$>"ᕙ$^ @PT@PW0 KASR000: ΔPF,P CU $T@zKKArP( PP@^pP S(^  S$剔P@p-p$偔P@ pKA$P(!0#PU00`q> K0 @%K @\@P.K BҕP 0Sf`Y K@PPPxἕ^K PE E`ᵕPHᰕP},P X% (Kp30 00 \30DX0,@KD0$0h 4oP0 0 R.0b00 00D S44 000T @ X0@!L0 #L0T  Q00  0!43Pq00000 S@00 @0  B1##3\0 0$K\ 00T4 1 1S2L `10S! AK00@ S S40K80  0 80K0?`000P800S X(~ P000000 y80 `0 T0  00 %K ?4 `0S     $K` 0@$K j0(HCA(R($tuŒ p(^FF^t(p(T(?:SRC| -L$M!0PQ崁P!a` P` S@r010 4` -80K0 0p000P8 0S <RP DpU P U8 000/ 40K8WP&P00弐ZP  0S @ 8 APLP@0(Kj0(CHA(t(X(C(m( 0-0L @ -  PQ 0S 0# 9> 0|0# :> C0T0S0P8Pʒ00(^F(ѓyR/ -LMԀ#K@ 0K`pX0P` `0 X(Kf  ecK`p 80 80 -@LM pP`0W 0(0r0W00 dL !<04080? K?s0 :F^^F: -@LP`   ~ z -`P@L ((UX0 3?X0C-bAYXQPYX QP#P00@-P40@00 P0 SR0 -LM`p02#W 010!00 0 4 CKTK 4 I W4 c>0 S QR Q0 R @P@  %P$!#K pG04 c>0 S Q\Q0 R @P@  P CK!@PbT  0 (K,o/ = 0-`L3S t0t tt ATpAS`0C`pX0,偲0,0080S $0$ $$Z 0K0hpX(qco = ,00-SL@ ,0, ,,D TP ZK0hVꡔvo = -LdMd Xp`P (88S0P P84PE2PE1PESPE50  00 0帒5X  /\Z㦯PE` %0P@0 D5Q <坒O0@0 ?U 0XR P(00,0,0$%K! 0HL(0#$K#%K0@p ` $$K0@ 4$ 0IKeK`Pp 0g840  %K %K $K(D SD, 001"SRS 3S`4$`V::001V#%K 0`F34`D0 ccK#KKQPd0@ #K,<0KD JPP,``3Q 0Q+ 0CQ܃K 0PpS #KT$PPP zTPP! P0TPU !5hPP !T,0PPP 0p ?&K0U 4 KeK#KQP L=v 0R3`0 0$KL `0SPp&K܄K#K%K 0P YX1!?%K!< K 1$K 0㝮%K!4000!R 800800 p2K0U0XZPp$K~ 0P 80S0ո ո0C800S   0հ`OP:^@P @(K0@0 X(LBAWo= ^o NBAWro[o  -LM0@,0S0  #`p40S* ᓰ(K00QUp! #K40K :`P  o`PPꢔo= -Pp0LS,0S`@d0d ddH Q L0< H 0P@DT袔o: =ŕ; -LM@p0C,0S`P0  ᴪQ x0h t 0P ! "K,0K P`PEpU$K袔oK =ŕM p-L MH0P0` 8@ 000 ዐ `KpX((ە p-L MH0P0` 8@ 000 p `eKpX((  -0LPQ P p(lhPr.@L`Lp0P R   T0! ?@((<yX(\ 0-0@LP0,0S /000( -LM,P ,\  ? K( 0-L@Ph00S`0X0dS 00@006.4 Q= SR00((0( 0-LM20S S+,|2 xR0 EL% `Q0 \XPD`C$$00 p00`E؀E$T0  P0`p 04S `P 0 07p P$0KP#0 0vp P 0p~  V0pXvթd@d@1Gc -L M@P 4B BR KDЃp 4\4 g^Kd@ 0-LPP@p P@ T 4PS  04 0C - @P0TLP p` X`p@0 p@@]s$$ QR "( / 0T 02 /$4 0T1 / $4 0T1 / -LM`PP@ p ԀԐqT! 0 00 H0 o`吐P  `0 00l0T00X:(K 10 00`0( 0 -&ƨ C-$$L0AP p-LM@ЀX P`00 0Xe Kp,K%P 4"KR 0 Q/ܫ -L|MP_o!R0`@R(0S00S "R0oU (KP PU 0SMpWJ (0WSFP0 QP>P0 QP6pG)00S$00 P0 ွP! 9/p  9/p 40 8 m0 K$8K0P P -L@pP`sP 5/p 4 5/p 4   -LM`0PS 0$K$D0  0  0P@z 0@ 0V 0*c - 0LM 00 Pv`pZ(K0  80 4 P 804 0S L0>`4v@  0 /э0 -p@,P,`L0 0@?T0 -逐L` pPp@ 0 0 <0P8  @T0ƨZ -LM`PQ@#K  00 (KP P0S* 0E8 mP8   ` pKp Ec` pԃKp  Ь  p-L M0`SPL@ KAo 00SP Kp/ܫ -L iR sR aR  p`B=q+ 0-LP@P $0P0\0/T -@LT`P,0IPG/e bR0-0L LR aR 3 sR tR iR(} 0Sڈ$0000p`00B @P 0ꉭw/ -@ LM\$Kp`wP0 $0K0,$0[S $K 㶃KШƨ]( -QLM@` Q  (KA^p P$P tB^dp0 00 ` 0P  +ꪭŭ; -L4M @#KP L 0#KK(KP 0  0 00`p $V!9# SR 8Q`p `p 0`p#K 00b VR`p0SL V0 SR( `Rp 0bp $gP 000 0` 0pPᮢ\4! 00004 !#K"4 #K R0$K R0#8Jpt $ $&#K807#80 <0#80,0RP PP PT0PP0 S&Z]#K pT 4 0 00`0$KPD 4$$  # 4  !4 "4 $8pP/ /Jh;Ǯ 0-LM0@0S K0C^ E$市E$$0 0.P{. @tq !ែ"`#X80P K K@呂P8厂D&& 1HfzE0$ 8 -pLLMPdK4 h 1夡00 ! G{p h0S# |! Rp!dK(KfR lRI dKHh0`S ,P ڂ@P  '[h娡@ +Ph Ԁ h嚡T p0 F 0@  T p ]p0@h  @hcP@hKp꼰/D&`Wc^,&h&eʰ -L`p(@PP0 `@00! 0$0 0-@PL0$0S FK0hB -L,M PDT KX*`` pPcK%` SR#KSR00S& Q UQ 4 04  0y0P 00P$0 @TPzK e(KQ UQ000 Q1!!U111 O[P  tPPH 0 Q 00P$0 #K0@S0PT#K P KP`p`#K 0cKWV0@S0PP0 X00DP `` 0K؀ #K X0 00P0@SP=< 4$ PɱpWa -L0M@Tp0`" 00 0 d1!p 00  01!$ 000XC P_ R#K0Z0; #KV05#K V0#K KR 0K 0R0B"KR0> 08T0 K 00 4!$"K(00(0 0K0 000"K #K 0 $KT0K 0#K0 K 04##K P0cK "K -LMԀp` @PEJCV?@P(K0Sl@ #K 0P 0@@000Spe 0D H8!#KPR0@#K @K T R0 0  "0  0   H8!P؀T 0%V@ Q  X0P Va  R0 X0V Q #KK T 0Px qԃKX  T0 0 0000Sp@^-Qr۲P/0S//P/0S/C-؂ Đ\ @ `pR0\ @P  0  0V0@@ P Ѝ R0P@P -@(MLP@`pvP8QK`$ <KP0  4 -L⇙X@P HHH0H@@W<@8`8P@`T\}Ƴ& R-L R R 8R Ri R0-0L@P# R" +:R! R! !S 1 @~0  0R R 0R R00000000D ( - LM0Pc@P(K0!S R *p(` ^P4S 0h0$$0KDD00 80 S4S00r 00!S1!@-~00  p 003/p 8 H0 0($P 0 0 KR 0"`p V0"က00000 0S 0 R0`pȴWEVܴD ( 0-L4M00 0@`pt@0 80 <0  wpPL30S0`KsP 0" fU AU :P(KpU sU080 0KHp0@0 0<0 0D0 @$KE0 QP 4 `D0}p0ᴐ0P0 0T0 4S 0S200  R RR*R 7:R W R!@d}1 R : RRRR*R :0BS<0SPR R2 R80S$1 +10` 0`Xp}pu |pq D0o_P@ @00$Kq 5pPP^^Z8 H00$0P T0 (  R0"`&D&,H&̜DFL(_{ -LM@pQA^p  PP`|t`iP `P KpP 00 P;ŵ -L@`!pP* tV0Anp `Bn $$ 90 P ! p" $ppP 0 0 P; -LM@`pԂ upP920S7,`pPk 4S $R4T QyP N S$ 0"SR ˖ q(KrU (KoQ P` $ 4R  4S  0P  0SS P P 0Kp 0 0 0  0P,, ?o  040 00 0cpPth%SP V0pcD&=T`&{U -L8M@P`4 TKRp0pp 0  tp P00S 0@ TKTKp Ko!D&شx&0 S/( 0-p LLM$K#K#K0@`ȂH0  tpP=20SG#KR0 cKP 0SBQ? SR;H #K H00$K0 QP`p) ԄKH0P0 3P" P00CT0  ` PP dbU<KP40KH KDKpP(K$$0 mKZ8>0P R  WV 0 X0 %KP0%PV0%K   00 QP ` 0`Rp`0bp T 3bp 0  P gD&(&p -LTM@C~,`K G f$ spP 50S P(KsU P0GpP#K  0!0 QP  0t#K$$0G P0R#K 0#K8  00PX0  $K0 X0 0\0 P 4 "$K  4PS 00$Kp$KXfP 8 P`  KYXĔNPxPpT `Kg'آV :`K X0P0 0 d ͱPd %KR0K`#K RK0P0T$KR 0KKX000X K$KP000 SK$KR0J 4Sp K P0p``0`4 ` 4 "004 R\ 4 !4 "4 R$p \01S$?#KR0\0r/s?¡á[±< "( ñXpPo)X0܃K 0p 004 X 0 00`00Ph 4$$  7]D&&0lϸ(=nڹ -`p0@PL$M,KcK`hh@0 urp&#KR0ԃKP 0SEQB SR>@ T 00S#KQ `@YbP NP" aP iP lP| (KT <KpT T @K`pD&& -LMԀp`Pb꼿ȿ&yT 0 !y|xtp 0 HyXy G?Kq?0GK XH`p``p WV- \0x $m0E/K8EKx00  K-Kx1S1St $Kd ‚P0QP  HxMTw^m|ECƨ p-LM@5!"`0 T$K P0 $0K0,x$0[S $Kx LxKpƨӺ]( -WMLM`p@T XWQ0S@8 Pox , $$0$$0 QK0! @IK0  @IKQK A @PQK  @I.KQK B AExIK0  @IK A;x-Km0 B$8*K A\1xX/x#L AK @#KDE ܺĻC`@-`0 @CT`@ pT00 P0S@XyX0X h& -ML MP `"`w\" PwP#;@@r@T K w w `Vl w   `RK0!@JK0!@ JKRKA@dPRK x@WRKAhwJKA\wJK0@!@JKA8w4w$ !0# YK @P$ !0#w jY.Km0 B$8qYKAxwvw# BK@3A#@YK ALgwdw  " Dc%,+=*EDE Kvλƨ" 0-p @P`LM"K,0@  pp20SwP"p( ) gP aP bP <p$KlP uP iP0KKp@@,Kw@@"KR0J܂KP 0S Q SR0 0Q ] v v"(`ᰀ尐V v v Q lv  { ` vPD&Y&c%,+=* -LLM@`p4 \Kl KP 10S 0耟(0  gop T$  P 00S0 \KTR lRxs KTpT8{\Kp(D&,&0 Q / 0-L M`00 0@P"K"KXq op!"KR0}bKP 0SBQ? SR;0 T 00S"K0  0*a@ P \ddddddddTt,KnpT $KbT 0K& KD&&00000000 0 0 0 S / -L(M0$00 0 00 00 00 00 0 00000000 Ru$ KE -LMP `< p#K <@K#K 4 K 3 K  R0sS08)  @0 P@0 *p0lSPh噥( P p (KXPUt -LDMpP<@K 0S  n (K-0K 0.0K0/0K000K010K020K 030K040K060K0 80K7 P40[ R 0S P0L哥&@0 P@09PUvt p-LDM`P 8@ ] @\K6@ \K6/TKpt -`@(p(PL !@t Tt -@P`,0L0$U Kht -LMpPP 4  0440 00 ,0 (0 2[:#:92K,0[4K@0<<@,0K op@`4K K zo PXo@@ R00p`Voֽ -L8M@P`4 TK0p 0  Tmp T 00S0| TK0PT0S 0X TK{T@w0KTKp !D&D<& 0-@RL j08 S0( 0-@RL Y0 S0( -@PX7LAMPgPw  $1  lp ,70S , (KoZ0$1 OpP 1$1J P hPP C@TQPP jG|$PF $wt@P $!hH00CS4$\$,$$4aOP PZ P  0PP 0KK o_P0S IO`P K?KI P PP I Pz PPu I Pp dPPk I Pf @OPa I P\ OPW I PR OPM I PH OPC I P> OP9 I P4 OP/ I P* hOP% I P DOP I P OP vI P OX^P _PF FK?K  0KK SRP\X  x ~OP F \vOP 0 `NP_6MVan|wEcp7|H -LM@`p[ jp :0S * (K0FS iSPC>`C$?P Y4P/P YP 00(8:P;P0P0  NP$$0HPDENPP NP (0HP0EMP VH$   TQ0`00 MP [?KP30P ]  P0-K0AK0 0 0 -K R0.K R0/KMP M0P0 ]P⬨ WFP* WF0$xPP| 00 QPT 0S$H0#<#0 QP0 `K'MPh >K`PP   Pᛐd K⟨P fMPO G`_MPpG G/KR000A/KV 0S < k$4P $$k$4P`0V2M`P .MP X&$MP \P 0唦#81 E`PEt&?  0`b0 QPvD8MPfG pLP _GrLP VGLP OGLP HGpLP AGLP :GLP 3GhLP ,GpHLP $Gq?,LP Gr1S -KR0 ࣴ-[r? ñ! ás?s? LP GLP Fsu$$k$4PW\pPq 쓟+E`P+E$$0` 00 QPX KthLPe =KP t XLPU =KP<MLPJ FK ELPB FKX=LP: FK<5LP =$ tK+,LP) F0S* $4@ K$ jPp$0#`0#]0 QPp|$ pjW$ 08"\ 800!-K"08(0/K#0K ,` 0$0P00 T0vXr$$0`0 QP>$$3j$4P-K! 0".K`$S$0#`0#0 QP$$j$4P` %W/D&p&=;](_6xcp7wnU&&1>MVan|S|H/o; -LRM`p, K_0 K! .K! -K/K! .K/K@P 1 1 1 1 0 x0K0 p0NK0 h00 `0 0 X0  0 P0A 0 @ P 8 4.KKi@i!i -@LM $K $K 0K 0-@LM PK  Ky 0K 0SJp@ @㺶 K4jp(㲶0K0'i  p-ML M1@0S1`0`S` B.KH0x14P h!hBKBK\snP 0`0?o0c Pc U %P PP ^n0 0B.K00`0 P BKBKInujBn0 0B.K00``0P P PBKBKT-n000@ 0KEK0"nKp((ƨ0l9@M[ p-L M?PP  K:P  ` @T KpP  00SYV k m@0 R ! -LM@@ Ppkp`#ڵP"  f bIP1 T< IP>IpP TpI0P T0/ Kp80 8P/[80) h  <D0 8 . K@pD0! / K8Pr /0[SohQl @ ipal T"[ R R RS 0PW l S \[X (m<RW 0d80S, @ hiP@ `ipd HQ L 40R !g01Sp0S 3/p\ R 8 Xrip \ Y </@ `eip (Kc]D -L`H@P@HPU ApP J@I P _@@AT HEIP -LM KF9P K\ -LMPp K8@P00Pp` KP K K` K0hp *[0 8i 0-L@p K0h0 -LP`HpP00lSP@ ?0S  F -LP`HpP00LSP@:?0S  F -LM K$+8P00 KS -L8M@\ K(P8P1!zfHP# WSTK܅K@0X 0`xpeKX0TK@0 RPP"  uH@?$p`$K< KlTKiG?K  K4iB?Kh0Q -i h8i(iEoiv() i8iiil&U 0-@PL8ML KDCK4@ 0@ ,@ (@ $@ @ @ @ pK0i8 -@LM ,K3, K$pKi -LM KP@4P@0@ @@( K8hp(ѰKYNiV -L$M, K@Qpp㺰- Kd'3PT0T TT-0[, KD0 ;p@@,%PKihxYi -@L,M! 8K 07 KPp@ @y8K8 K0.p yKi -L$M4 Kt@D4Pd0d q`\, KpL 40, K@0 p,PKYihi -L4M0, Kt@pd d,,K0P, KL D K4 083Kp$#Ki -PL`d@g=P`U<PEg@pPE0Sg@T>Khg-gDZ p-PL$M@` 8K(RKP8 K,bK P vp@@`OKpi -L M K8@B2P(0( $ [KY# -L M K8@)2P(0( $ [KY/ 0-LMP "c@P|OK0 P ^KPE+QbP8 Oib8[S8[S1iS -L M KP@s2P@0@ @@![Inp$aKY;A& -L M KP@R2P@0@ M<![ Mp @KwYEB -PLMM`K @h0K(K,J B WJl 7JP(K7Z B00'S0P(K B0 0K`PE( 0R p@P8K0C0(KS8K0C00 B'U0 P:(K0H: B0@:@ 0<:08:04:0 ,:f(@K!0 !@ ⩃0P /@ BRj      -B$ B9##   0A^ E0y|900Ipp0cpp0Cpp0Ppp0 Spp0@Bpp0A/0 P`8(K0`P B 8K0Ctf!0(K@"0 B08K0C0SF &f(K B 00B(K B00'S(K 0(K B0o<(P  BP.@ B(P  7Q00)F B 7##%7P@7.@##yN @@ޝt00R s0S S s:S \' R} #SL S@ S4 0S( $0S, *S60Sb 2Sh SPU0&Se60SM 0e{e 0 `pdv`v0xYK1v Aa  pdv`PEvu0P(K B0( 6Y(K B 1`(K B cfav`V31e-50S K0 p@8K p0Ce(K0 B 0K BA @(% R `%S\P,eLuLLP`0FU>6e0( 0 oe40S fe40S P`0 Xe 4 B#༄弔pWP0  B Fe`P @eU030S T ,(K B0 0,e8K0C0I0RP $ $P$ ğP# K@0e8K0CPI0O#S0S 4e30Sg  dbSxd20SY `dP`Tr  0 "   #0 `dVPZl`d820S4 0Ld8d 0P pTh2`X1 p 0F`(K B0`2Y`(K B P1%&(K B 0] d8K0C0HP! !P! P! K@0|d8K0C`Ih0 S Sk  6!Sx "Sp `'Sd %SX TT)SL H5:S@ S8 Ji"fTk=o (t $(PDl]dƨ@эd^DUqP~PBn,P:i  0-LM KTPp@@KK09[$T@in p-L M`Pp@$ K@/P0 $$4@PlثeJ P@ LϫD,@P 4 $KpYPVh p-LM`?P70@0KpJ@@TtቀPP`㞫0 D!p<㊫4 KIK!@P i -L Mp?P00KVJ`VPPp 0 \pPY@8 K@(@ $` P p$VᲂDi -@L,M( <K< K0p $0 K8i( S-L,R( Mc Kƨ' 0-LM(0 $0 0 ( K`Y_p (@PP|( KBKI_pp @(0$ `pR$0 $0bS bO`T bb@xi 3LrD p-L M@`PP  Kp Ϊ~` -L -LM K@.P0  KxAp ܋K:[X 0`xpkKX0 K8:K/p` KЫY_:ii -LM KT@c.PD0D DD0 K80 p$IKYji -LM KT@@.PD0D DD0 K80 p$IKYvi 0-LM K$0 0 P ; Ki 0-L@8d> P,0, ,,n(> p`0 0-LM KP@>p` `X?> PH08 DDI1[<80^> p`K0$c] 0-LM KP@ph h1[TөL > P<0( 88$0> p`K0 00@ S-La0@SW@A0@S=@800 -L$M@ 0K00 K( 0 0 p㙩Ki p-L$M`P@=P HKp< K\ DY;HQf P  g0V -PLM \@@KRKZ {G 4 K ,`K  ?ƨ Z -L M KX@,PX0@0K w p@@  BHD -LMz@;<`P 㯨mpPLPP0P0 at0@PUm`ٿ` PT0d0@ @@@@@`3^03/P2p&ƨ&,M&////0 L0L0/p&0 T0T0/p&0 \0\0/p&0 D0D0/p&0 d00d0/p& 0-L@t}P 00000D S 0A0CS0(PR0>S 0@0p& -LQp0($0`0S/ R 0p& -LK 0C Cpt&p T :@:PT`H'H<:e>K 0CC_ P :dVp x U 70S ^22d6]^K @^^K @ɑ  R]>K 0C>t6pS PBx6S P:  <X+P4 0x6 $6 R  + R  % R   0Sp60p6 5pWp|  | ^ pp|%|ͦ}P Pp6S o^HeK I IP% 0 YBK % @⺗B.K B^UK @NU.K BZp!UKAFUK @>U.K BZp DQ |t^cK I/^ Ip($LDQ <b^ 0(4XY[UK @b>K0C@5 @0U.K BD5 ZP@F^  fKf.KP L H ZpJ L*{0P6 6|:BK d# @גBKX I0S:00c>K 0CBK! @#ƒBK I0S  ^ I ^ A03/6f.KH6 P JZp H]Y}Hp2p0S0S |6Sn2`pW 0 3/p K @≐Q20-K BZKKp I!1QqPp"% & # |' thu' \]p#Pl% & b$ [$ T 4]0PpW 03/p|6 03/(\(&"i/~iKS@p&iia4L((iisgZcZmx -L(MpPa`P q9P@( DKtD Kp0S h+ L'P400@ @0 (Kl(8i( -@L99`P0 CP@p W㜀DC v`P$ ᰌpT ?|@00  . l(Q p-@L M|8PPI00KpC@Chv`P <@ K儌P |u aMl( p-@L MO8PP0 |C@pC00KY5 l( 0-LMP:8P 0@ K@ @ @6 Kh@ pTL 8P<8P,8PK0al(7i8M p-L M@ h[  ?P L[HPH` KL P ! ,[Kp[@D^э -L,MP@Ph" Lp+pPD"D㚣( LK LK>L KWp} ,P@# y@PっL K(@ Wp <妊b[<0 <0R Y[0)[ [4PP) pM[hahqhP < X1 \^ 0\4   Q0 -[Q'[ ZmP  Kiz! RSV[[F Z0P, R ` V 0P `PpP K8i(~ZƨD^   0-@LP `. K0h' -P@p`L0U0S! 8wP$P$P 40S040 0S 0S(0p(P8`0S$0(Pz P-LP`@ ,6P VT ."6 6`P.`- 00 -LMPpP@`00K 0K #  KP K@0P 0 p 0 `P0 -L M@PP00( 0KE0 `PpQP00Z!V0"R0 "00"S(KK00P 0, np 0 @0 -LM0 00 0pS 00@Q_ Qb0 K%PPP K.U YU UsP ,K⬀ \`4@V`T /Z@P00@ K 00 0P 0 0K KKP30 R F00T` K B0`S 0SV3"00yUZ6 ZQ05P05P Up U0 0 KP!>T:KᬠKxt "10#Z 00 `@0K0 K0KYP]0"CQX BQTQO?\:KK K嬠KPP2vPC ` nP ?PxU1 0 p* 0STc  PPG` 0!" KZ0 C0PK@T 0CS ,0K0 r xC00K K`:T 0CS,0K0xC0 xRaD\W@DAD\7@Dt@S q00@Dt@ TSS0m?@8xTl pԠ 05P<,U< D 0p 0 00(KSэ< hPph -PL,M@`K@H  L0 pX) P W0 HL0P 00p0 HL0P0,0XL9K7P0,0T9K%=KV0C.K(@0C BzU K(Ki< 8 - L.pyIiR p0- LR@PX` r PFP pQp@@P@@&( -LM`pV 00Sp1000xS` `P 0 <14!@T Z  #Kr#KP P pHR B]pV    hP(K0X:VVP@H P0@D@UW@DB0At@WAq@@Hh&l&n Q-L@P 00S0 000xS 00Q Q0 ddKhT   @04T`,p0FUTh&l&-Z p-P`L$M@ 8KV V' 0P0Kp080K04PKT7`K1S:T@ ! 1Q218`[_qPP  @8K⛽8PK00PK -Lp`Pp@@ |P,Z  KhP p-@P`LM K K` Kp -MLMpSPP!0p`h!l UKGpP!X  KF/ @Z K  @⯼,PE(TP(KP8 0 R4 X5 =K 0C ')X5<% 0-K1 B85 :Pp  <5#70S0 S0C.K00T0P 04[S <0W8C.K0S@i(zh p-LM`@GpP @0+SKp㰛 K KT R #K˼ K@Op "01S 0/S ; [}* i (0-0LS KhnS( -`@pLTP P @ 0SP ^& -P@L` npP  dֻPX0 000  <p`V+yl&:i -L,M (K@p !8 KP00K 8(K⧻800S 4 KHP401K ( K,p0A9iI -LM(@K p [(0[QS S  RKU\ -L$M (K@vph hΚ4 K\PN00K40( K,1Klp㶚:rA9iI 0 /&/ -0-@L M000 0PK0%00 P0 K0P00 (@ $@ @ @ 0 \ --LM  ss K -L@wsN  -0LS( --LM  ises K -LMd00S@  0K #  K $ KKp@$@K( -LpMPP2P 0S 0@P 0 00KK0 04Kʫp dP@L KdK`P \P XP TP PP d@ ؞4 KdKԞ#`P  N@P tKt@ p@ l@ h@ L1 |0 x@ |KgX#NvP P LK㢞 4K㞞dAdqP`Q |K pJ0S 8V4V | 0A?oR20S G}L0S PU LKq 4KmK|0SS  Q  R S0t0 p0 l0 h0 tK3LT LKN (HU٘b4c`&? [Y -p-P`L M0@ 0 0 0 SKp0C>S`!031 -LmkP0@ ,Q A QKO&C5 0-LM0K hܪPP \( nL@P @ PP0KɪP020K0&]i(~婾PC-!Pp@` @|#@h,P$SPL080t$60\ 000 0@0P(P-`0\ q H ^@0 6p 0Q (0000(P-4s00#q^,<\0000(P 4qs00#\,s0Q00/00(P@- @< :# T0 0^ 0000(P@- @< 9# T0 0^ 0000(P 4 <# \,4Q00/00(P@- @ :# T 0^0P@d|0:0# TDD#^<s0\ ,00$00AU( -(0ML 00`NP Kh`& -L Mp(K⌐P(@U` KK}P` wNP@ P 0-LM@PT0  (K=$oK0ᜂ -0LnS@0oS@` `㌂Pp`APo0nS0oStpPPopPP&э -LMi0 OM& -`@K~MMLⴐ─p 0 4aOP(oXU  Vc0E Ÿ " P`0 LO0S 1PPAO"`P9OQ0S 'P`| ,O0SL \1PL\"O& X%O%DO0S;00(!NK @D @00 FPP ,8[S VPP N(K 0  Q Q 48 008 P0PP tN048P `}\0PX(N:ƨZMbDE(p5^b`{ -LSM`CK K4M @(JԀ @p P尪PT 0JK,@DY4 S K <@X̄ S K<@ YXS K<@4S  4PPxI UG  K),K0P B0Ԅ86(K0 dP0 0,K B0,K0 B0Z PPPK 0CC ᄲpnK@=4S}KS(pGi  ᧶Pc?4p4SP @Pd< K@P[d,K B4 !$4  0 0\d?o 2R0SP0S PMH4 MU M0S S K0@IpX5p` Ph P *m(m0SPpPE4SK Ap:5MP0x#x#KM@D0C.K B0@0D00>K 0C(hFpܻ0S SH ջ>l80,00(6MI랚 0-L@P#P82+ᴳP0|K0hw -L;e K"I & -L M0@00 0000`pP 嘠00 Cp0@DTQ oP0 T{PDo{A0(Ko;D&//. -LMNKA>KM@D0C.K B0@0D00>K 0C(hEFpA0S SH :k80,00(㛒H 0-L@PሦP82+P0K0h -L{H& -0@`LpP0 6Cp00@DT oP0 zPTz  \HA+޲5P T?@+IJP,$,Ko/D&. @-L;K[KM 0C PE (>K`@0( Ep H/ -L(d oJH& -P@`LM P r0 (P x" Bp,d2 0S00(0x`0&`0x01p0 )00`&0#0`e KEpS 㸑lP3 MP> 9P0 GP$ UP. gP0t0 sP mP$ oP0 @.zP%0㒑tP" uPp|00|0|00|00|00|0 0`xyuP|Y0p00S0t0X0;;0x0UK0K,E$00|00|000(K//D&$. -LKK[KM @D PE>K.K 0C B@P800>K0C,|Dp0 h(< ,KK? @D < *<@0<$,0( <IGAdA 0-@LM PKZ1 0 B/oS" ? 0 K0} 0-L@WPK0h0 0-L@zYPK0h0j -L M@ K#1 0R R0?S  㴐K 0-L@PᥤP820+6P0K0h -LMb40 0,0,0(0(0$00 0HFtZ&$ 0-L@ P\0 㴸0(0GbPP0nPwFK0hg(  -@L MH `p0 吸H y똧嘗 Ap70`FVQ 2@FP̄l$tLXd̄T \<60S 0 $6 60S 5 0<0U 4K20400S0?S Ə08:%000x0000tU 4K040P 00R0S H0@90;U 4K/40P 00R0S 0(80@00800K !xPPㅏ00       +  @  B ($ Rz$  $ Rq# , @ (     )            w300  {w0$0000 lqw0 0000 Hgw0$8000 $]w0<:000 Sw08:000 Iw0@9000 ?w0,0000 5w0000000 yw0909 R 4K9/40P 00R0S 2Q 4K&/40P 00R0S 0$0000 0kXQ 4K /40P 00R0S p0,0Q 4K.40P 00R0S $0 0P 4K.40P 00R0S 00007000'+ (K0&|&D&( (/%(<S. (jpy& -LJKRM$@D[KQ=KM`D(PE$0CQ-K00C`P0 Bq唁H00Q=K00Cp$ApO0KSF04 C R@Q K< p0@040$nK?`F  ! HP 0 Q=K$0C,PC.KP0 BDP' T 4`$04<$ 04@04040 40$4 0(40,4044E K0 HݍpCKD4 A Ew(8CSA 0-L@PᴡP8A-+EP0 K0h - LR R 㙍\ -LM0@`Pp 0 v@000 APPK0P0 0 0KwA0 V@0P j_ p-L M`/P0@$0 0$K  '@P0 ZKp0/ p-L M`P@ҵ00   P0d RPPP @ᵵ@峵 0E0Kp(y(0P0'0P0&0P0%0P02P0/ -@LCMP& $ $0!K0 00K000$0K 0 0P |e< 8DuH00KKho꠆}l -LM`p@ Pp(K0pp00 D00 D< D c00<804 40\0Y,V0(00t0@E0@0Jdp P"H00@?P; PD yD(X$ -L$Mp@ D ` ,K@PKLP0IT0<000(K @0D3/X0p @" P*0 @D0@ 3/p0< δ<0P+ 0KK R0T#K#K 9^+#K P0R 0@ P#K@P#K0/ -LM_K`p/K; P@1L# ( K,D0@@ 0@?K0@P0 |py KPBT  Ki8KHꥆh( -pL4M[ Pa@ @P :C@Pp(K` `LK 0L KD0 \\0K0@P P <@0   T \  X X R X0S\0X0 X  X  XKnp` XKaP@0S`X0vqD0D0X0X 0 000F@@@ 000<0(wh( -Lq] CXAX & --0LM K 0"0K0@@P 04K% zg ӏK K   -`@LM$ 0 W0 0@"R0"@ 0@ @ " ;p2 0pBWQ g@P $T 00 "0@0 K{p ׊,K 0 fsPʊTsp MPpK#0S Q  㩊  l㢊Mz a K,K! D+PpK0S Q    /z ' K"p 00 k+ K>p x 0S0娐S0夀S@ @(K?B//D&   .  2 a f     -LMANK>K M@D0C.K B0@!=K(00>K 0C@(=p /@8 <B>K 0C B>K0C B$R0P$(hB !Q0P  (PAHAK4A(AH   ( 9 W u I g  0-@LM PKG* 0 B/oS" ? 0 ؉K0} 0-L@PPK0h0 0-L@gRPK0h0j -L M@ K* 0R R0?S  㡉K 0-L@PᒝP8)+#P0K0h0/p/ 0-PL@f $(0$( XS X  \  ` ddhhllpptt0 0-@LP  DD@@HHLLPPTTX}X\z`\`0p Qp` $P0@ S 0 00-@L"!R0]0 0-@LPҐϐ̐ɐ0 -@P AL0@>S->C᷐->C4X1X\.\+9>ᦐ9>:>Cᡐ?n:>CFᜐ?>CC>ᔐ}C>GᏐmFዐEnFᇐE~GაXJ>X ` p 0S  $$((,S>,a}S>G\mFXHHLLPPTTXX\\ -L M@Pp  $$((,,0`04 4T0S\%0 R L%rTpԀ}  z R S`,i(KTdT`X`X\\\`Y`dVdhShlOlpLptItxFx Z =`: 7  0$P\50 S 0` Q0P%@PRڲ0 0TU 0/0+P0sC@p/ p-MLM@R0 ANK4 @D8 Ppp0h`SPP\@Lp0S<D0D,[>  T>@T(&I  0-0LS;x(0/ -L M`0p0S 00S  Ki0001! Ki豒h0_5#FP@P0,X .^ 0$="; KT(`(P(p((rPꬮth00/1000/0B10B1/101/ =&R/b p-L MP@`Q"Q  KpkR ,L0V,V ѭ:^ 0$1=$P; Kp`(P(T(p(( -LM@oX10SP.@q0S41 04(! ##0a Pt 1 P000?>C?T00S Ut 00KtzKpG*0p 0S P\ U 01t0*`(H(((P(h((  -LMC`p P ?#Kd00 @̓ ` 0<0S  ` 3 R l0  B  R\ ?0!.0S  ? d ?#K00 @ `0 < R2 00C00, ?SR 0Y<  ?Kἀ#K0040!#4 嘂\% 82R K00?1# x K?` @L<4 l0>00 <40 #K d@? D 0dᜁ0D00  T\!|04 \x P?(,1傃0S ( (X07SX dP0U~l 40 00 (Ko m00S ppp0`<0 Ջ<0VpP͋U}P,((t(U (T(T -L$MdfH < d_ @Dv `0 <(60S  U0 8 R 0Su 䥟 ?X0T08 S` `0 b8 ?0 RYQ4 4 UY0 4R0`<̶4@oP' Rк4  4p 4  4pL4 4p ;080ß4 0 0$5SCK00/0 @P!.CK@lQT0 @T@@ 0D@p`00C0 A@RP3@A00C0<0  0?00 @P@00030SYd 0@ `?808 ST0T00  B 08 SP5X@40 4000<0 40S/ڨ0 Kd 0@ `8?ὦ$KṦ_!@P1#@P$Kᦦ44# ?ᜦ<0< 00C000H R410S 1 1D1 dP 0E1 e0 < (K  >A! A!7! !1H8:-4H0A r80An C 00 0 FA@_0 F$0`0$0q4004000080P08 S`0/0 ό@P!. 1@R0 T@ @ @0`$ p,((t(U ;&(&e -`pP0LS  @   2@00S.0?00S0?0&t( x0-0`SLKPL %L00S000000B0D0D(& -LHKM,@DKMDP`, pl&l60Q`S iDYP0\D00S000\D48KM?CPv /D͎` L ?Ġˌ(K8KO?CM/B d004 0  00 0K Cr NL #p R0S000(KN/B P2(Ks0Q/B00(KM/B055@0S5 4t0K00,H08KPN?C0 - 0 `8K=C8KR?Cp%&` eV c8KO?CX V  004#8KQ?C0@K@,HA %8K=C8KR?C LH,MϠ3 \ß0 ^/H.H.H9 1? 7P H3= `pL04;095430d0 0nKMA ?`p2 r018KM?C0(K0M/B0U P4_8KM?C 20 548KM?C SJ oDYP .D-D-D,D0?D0\DD48KM?C 0)D0f D= ` pLd? $+4.D8KO?C (K.B 0@(KM/B `4 KML0KML<$104U400009 ( 0 8 $,4<1?!0! 0= `pL04;$0 4*4L00tdp 0@ `Ì 0>JP(K&T((&&<(t(TA --GMLMx  K @4 4=m0S@ =pW<=@0 = 6R0@@ 0`@ = PP 0 d=  3x3 0 D = pP =UP U]P@ U<P C*04p8@G  ?᳢D ?ୢ `?YnVn` t EKN 00P咃 h 0CpP@1!f p 0S ] E RDt6(48@F.Kx B-BE.K B 0t$ t$8`PS H n EK?A E>K0C 0 0EKA  K?A З P0E>K0C QP * ?6 P0EKA T4h$P4!T4(0SR? 㪗E>K0C0FK- 00p4 $5h$Sd4 p4 N T4P4!T4(01>`1pE>K 0C FK 0 A h4F>K 0C 01>l4 1ph4  0d4SW`\4 a3aX4 QnS`QX4 Sq0`pd41`p0FK J A0B P`p0APP X4E.K? BP4T$ 4b,pt ?`*U*PP1P#0EKAST4UPEKE A``p 0ᇡI  ?ၡ `BQE>K0C EK R0A ` 0`됈 p4  B!00B!d4S0`0V3Bd411 Z B!FEKB A``? LEKA P0Ж됈 0p$B BQd$Rp` S2 0B0Qd$qqZ $5V@s@帠``x Ql0̈́ L0E HPPXŸL ,P-  BQ  B!ʡ$%R`Sf`B `Q!a@ŔL     \" R| հPՒЬ0ը0Մ0E>C 0R4 0 0l1Ap'Sx0<0(5001 0,%S00 5 \2P0\3tPPT``0 S|1\5?>C00!#4t x00T Pl0,% L1.1< 0 አE>K0C/ 0`pT(P(`(h(p((((&&((0(,X,(/TX((D(pT(((((&$(|(8(&<(\((^F04 P ᖤ0X H\ dR 4  B| @%LV.  R*h  <  X  \  E.?.XT+BA.B,-L$HU P>v0@40IP kEKA= C  , B PE>K`P 0C`` \ bK+0CB X`p`E 0FK Al A.B  Q0 0? E>K 0C H R? L4Ą0\ H4 000d4( 00A0l402b RR 5#< 5230S.E>K0C됚z z'z {' 00P$0d0T C# c FT(h(P(@(׺h&ht@((((t(((T&U D(.&((`(ƨ(TL\( @00Sy 0 =K 0CCK  @ jC>K 0C+iV.00S 0=S,0S40S0ӈ4 ,\ A ^"   ?d A a!1<80 !,2 1CNK @Dpp .PP0T$0 x4 R0 Sx$ Bx$ Sx4 84 0,p4 jp 0 EK A 0T4  QLpQ  jC>K 0C+CK A xPCK+ @╢v-ᴠR㰡 , l BQ 4 -L400T0 10⊠ಁX0\C ddR\ ?0  0  B  R\ ?0  00C 0T308 0B0 PB 4 B4R0ʠs布0``Tf8 0 RT 33 $5S%44 @@\40T\40S t44 DD4 dT04 j404 Tt00@d TJ 50S  l0ep0 W8%p@x0 @UW\ |4_ t4,#0L P l ?崅@_d% 0@Ì `0 45@5\%R 50S7E>K 0C EK 0 A \4Fl4 0\$,0S{HmP\4`t4 X4Ɵ|4 \4FK!#@ `4ͅ0`4 LKL 0Ṟ\ud4W\l@@Da&4 l4S @40Ah@W ? R 0p(DXwpW0 WPpl$$ $7BY0d4 `0XpQL4H$帀0x0 0Sx0xŨ0t\000B\Á0`  BYd Hh P( Rhh   h ` lS2 0B0QÑdd 0Rڤ%x圈0  l$R $40C04 4 S d4`R`   $%R l !P`   t) R2d=h d4RT T  d4 RP%RXPP%PR$ d04 ^J  UJ$h  8 d P`?0Tt lR@Ό$00$0<0d$`S`0 0$5S V00 l1vaRP0008;0S1dg0d$ST0T00! !0d$SP5RXPP5PS4 dI먐 I   I4g00080`@0C40,0400 T dR` ?0T  taR@ $00$0l0P0@hp`TS $S0`0S $uS0qpq0`VP@Pql@pGqPt08` @=g`0xQ7g`d 億 匔 d4Sd40CWp4@ @q4$l0 @ T:- @|t !t@P(\Q l@_08 04 $ f$4d@_Ɵ L l 8 `p4S>0ST4p$0T4 T4S..T48CT$?R?|4  t4_,#0\Ő\ l  ?d @_ @0 `>4< $.T40T4 x4P?0Sʠ2l$0,00C0Sp4  20S x.T4S .X20S pfp .0T4 _]K PE P20S AC 10S30304040043HVX*vQV.ޗpaV.HV0S p=S,ܞ81?~ G?ጚ 0 '0qS 04  dLĒH 0@ `Ì014 00S0S 04 0 d04 p0*04*8K(KSmf(`(hT(U&m(t(P(((((( -LM`R@p yvPP \.vq_K, K4"DKP`(KP(  l*p`0S <08 (00,0 000040!04 04$0D0(0`P sW `h |`/ `h20 2 X L @| 4x (t $*p *p u  K )p 42`#fs0`9`a8SڐhPb 0  *0*0P0a ? 0* *ꍐd@edAŐ֐zd@ -PLCM M`B.KpP; B#gp@P E>K P0C0P[(ULT$P!0#  K 0-L@PVP8+P0K0hR/?} -LMԀ#K@ 0K὎`pX0P` 㵎`0 X(Kf  ecK`p 80 80 -@LM pP`O0W 0(0r0W00 dL !<04080? K?s0 :F^^F: -@LP`   ~ z -`P@L ((UX0 3?X0C-bAYXQPYX QP#P0 -L,M#KP `0 00K ԯ0 0SC Q 0 rtSS9 GS BS: 0XKS3 MS@kS- #bS, gS @ @ @V00 0Dt dsD0 8r@ ݜd"Q T@ D0U6WWQ QP 0 mS sS@V@@@@#KV0#K 0 `L!t R0 ` ( 0 (K7Z{ -L5F,@ ({, *& I 00- @   L 0 -0@vL t!P``@D TB㐄 ᴐ000000`IB_)(P  /P P00P0S!bP P00P0S/ -X@LL`(VVP d0 P 6V0P \0<P) 0P-L  C  {sco`@ l! p-L M@LP`!00yV P@ fsKp)(F ! p-L M@\P`QH!40UV P@ DsKp))(K ! -LML1@0 PS)8P(aP6Qp 81` P00 00T :0S $ 0$KB>K0C+Q 0$ K1 $ ^ 2/ \ `$ K0dB>K0C+)()))(\  -L$M@` pGPP @"rW V3( 0 @,6"4  R`!r0 00C `!r00,6&0<,64 0  B 00C0( QP`͑! V0K,#K$&`?Kp 0#K06s4 C cq0rc&0K$&?0ᰐL0Y)S%  ᆓ0: S (0( dXjl0d&(KoI) !!"1"& -\QL,p0S@FT:G`P  0 @1@T@T {IQ @C1@  RfI1 S p pq21,6&0QI,6   B ! ! 00C 00@) U" -@PLGM, K%\?P@`>@0D PL>P0E1 01   0q?U*0 q T;3 15: T8 T0 =01 =尠1SZ  t~ 0@`0 @Da>0d 6fFPPE V'a T$p `$ eЀX0` 0eq e8el UY`Q0FH1 a x1|Pr0 S 008eS05<01 c1: ^1SE  wP  110CQ1 0F 1 1D  @ P 1lC 71 ! 001 6 V*;( 1+20 0,0@T TQ<00! 0L\`d0B%$ 0T0:0KK50S:K <:@T  P.  j00400L0 S1 , \@)  0L0B#`0 QPp`p 0-0H•(aV`i`iE1CP`1:V@\@l9pz@}EP,  ˘ 01 d0 01 \00 1 1s0$1 21 0Cs0(1 01 `p041 1UP8Y9 `R p` 1$"ʠƌ 1 01 H80@ 087,D(d( 0 ("*:( 6 !0I 0 0x8hsPp h  `Hq0ST8ЀX0A 00pL00,1S 1S QP 1S 1S411EQV1C!(1Rp`01 1 x@$1'X0 w0S; 0S0S0 1 1  0C##0&W'  6 Kpp$PP0 ?[R1 0 S10C1 M SK1ÔpP1`81 Fh SbɌ0 01 Z1: 8务! Z!:,6 6(01 1 嵗1 HௗUㅢ 0! !0 S,6 0 x5&d啗(6X:40USL0S d0 P Wڐ40Sa`VvP1S 5L0S d0 fP&  0娄%#S 0+  1 UG1&,"@ 0 B5(6 @4! ! 0! =60CU 00C0CSP: B (㤓0P1 11S0|! #1 h1!d$6Y:,6 0&03jpP".q&hF 0V%#0002 !&1`Pr,20SBvpGpW> 20S6 <&V K&1QhRL0@S \0 K˖1pK P0C0PULT$P!0#  K 0-@0-L  0k0C: {T]p A 8KK0 eA0 Q/0 #0 #< D0/0)-@=B'*0/p/ -L= -$!&& -@L0MP U0 0  P@ $Kk~P\0  0Lj0S 4j0U000 0)/J(c( -Lqpj@)}( p-L MP@ 0  048 aAp 0ll3"dKp P ` $( KA0  "0)DP)( -LM0 $0$04S  K _" K(CH@- 0 R* 0s# p@0P*`@-`0 @CT`@ pT00 P0S@XE#X0X h& -L`ῒ@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hd`0蘒P <10C <1$0 810S810)0%&&&p) 0--@L0MT !A`!d!hQ !`"R d2RM! !d2SB > hM[0:{k{PP K'ΞkE{7Ik@1 > ?* +)+S PPP! 0 @@@ " zj{ k{[+S[!4KK00B:k{{'*k{h+Sq! ?@@-C6?Y@)(0)((()0%&:)))r)')k -L⇂c0d2Sh0) D00-0LS0@d2So`2"R200%&0) 0-@L 0081 QPp@4 20<4ᾓ4PK%0  Ph00?0 0<P 0 _000 8 PXT0<024 0 a PPXeXDPHPUPPᾃH0 ܒ Qu  "$ 00 XUp bW=嘁 2 `"R009: TŸ^P`" 0 (' x{ Z @ `` 0 + 0 0K(K0 I岳W ;Za({Ѐ 0အ |nF 0+ R+ +4@ < @Jz@ k{{*;`2# ; SR ;0 {{A `p( `lQ 0 T00𿚙0)*))))0)*&0%&))X**P*ɚ;6e@*`* -L M耟@ PpP` 0S+  !0S%  @0K R 0#[2R0 P 0%  0Px  P$K0))"* -P-Lp@`@^ 0# 0 T ~{ 0|  {{(+S\o 0@$@7 @,K$Kk,K$K@@0)5*S*Y*a*& 80- 00RL(@@90 f+ƨ.m 3& -Lp9PT@ P D 8 , E&L444P55 -@L 0 R R p`  RQ\RP RPX0'R"R @00S SkP8&7 0-L@Q P l00S\ 0@ !0R3 @00SP P99000,+:,<+ -P0L000`@?< 0S-0@ 1 0S !0 0C!0R3^0 1P 0*0 00 R***************P 0C^SBXX 0@00=0#0%0NP/0<+,+:,8& -@P`L P0 SR 0SP0B0Q3 00@ 0  Bs<+,+:,P+`@-0 @CT@ T00 P0S@.0 h& -L`P@ịP  <ᣆP:,N0 R4S /Q C0p R@P /QQ- ER .R@P ERuP @D T0t/SP00/S00 /R/\ Pƨh 0-LJKSM,@DM<484@0(4?K4?0A4?4>4 4R=K0C@KP R=K0C0<4SI0.3.00N3R=K0C084S3SE7`Ox^ th^~ 00 0>3 S ᦉ@@ 0T S S00 0=NK8R=K0C0D0S=R=K0C0K0ACEl0R-K B Q K<4R-K B @84Xd]O0S3/SaR=K0C0CQ=K K 0C @0@kXPPR-K BL :K00C$u  u  u  R=K0C044S&  RKA<$84R=K0C0R-K8DR=K0C0 B 44$$0CR=K0C0C R-K B0D S84R-K B Q K @<4iX0<[hS ;aS ?S DS .KK0AK KKR=K0C0KCdS eS cSKx KKPR=K0C0C0 R=K0C0P C0  KC0@ sS `pS` qSr lSKΈ K&R-K0P B0R=K0C0C @P :0S*0 0C!0R3 :0S0S  K0@ PPR=K 0C@R-K K B0@ K0@♈@ K0@╈R=K0C0@L4PR=K0C0P :K00CB R=K0C0P倈R=K0C0LR=K0CRMKpP@D3wS- xS vS`Kmx KńPPX\I 0ST T 3 0PK[< KⳄPFR=K0C0C@P0q QP 8 80S 8 00RKAA ^R=K0C0CK1 K≄P K0@ P 0R=K0C0d C[@T  K0@K8 Kk@P 70S 7 &K KUP7'<07807H407007,07(07$07 0707070707 07070707@* PI 8@PPR=K0C0C) PP% *K0 B$dK+0ACK 4CK CK⫇R=K 0CpR=K0CLP@`P  WS :0S%0 0C!0R3 0S0S 0R-K0 B<0P R=K00C0ވP ,0K0$C 0 Q+ C.KCKR=K0C0R-K04 B0R=K0C CKMR=K40CR-K0 Bp0p5 Cv0G#R-K B0R=K 0C0R-K B0R=K 0CR-K0 B0R=K 0C0 SBR=K0C0SR=K0C0S84`V R=K 0C`PJR-K$ B00Q0P0R-K B00@vRR=K(0C0R-K, B0R=K 0CpR=K(0C0S+U R=K0C0PCTME PE QP1 01X10R-K SR=K0C00 B00R-K SR=K0C00 B0 `;R0G(R=K 0C2 R  <d   R=K0C0S :  $uR=K0C0S ,  R=K,0C0R=K 0C0S p R=K$0C0 SR=K0C0 SR=K80C R=K80C Kq$ KɂP\R=K0C04SS  +K/ B@K] KⵂPH(KKS KN K⦂P9jKC K⛂P.g`K9` K⑂PP$@P0S<8000LK_*\_(`+P+H+&38 :,98V8 g8B8;!w8,+:,<+;;M;oD+T%&?g8A_9898;9W9w99999,:P:p:X::::8:;h;*[8;y$^;g;l;r;; -@0L0iS03S !+GP0+P+; p00-l@L{    L  @0  0   0h +;;;;;i + -LMp0B@|0`0@P@P T00S D D0P@Q` 0( KP%&:,<+S<& < -LpMp@1`0B4! !0R3@P  10S $KWV00iS00S 00S ` dKU@K 0K`9 P ᚆP000 PP 0 U@J000P%&:,,+<&0+<+T%&)< d00-@\0 B0@1 S"@L W P 00000S b 0P%&:, -t1L PR ``@P 0S 484a4q0 0P0C!R! 1S1 3 @U`pP̀ SR@P 0F!0R3唠0S G  X0Sa @T`p00 @$ <+&0<M<:,:, :,,+_<h + -LM0B@%` pQ0U3PP0  yPP;000  o@PP 70 C/o T" R 00S1  P   R  R PU PHXEEE$H -L M!1 RR0aS I@Pll SR:(KS 8D5 BdpP 0~ 0000@ SRP 0| Q :pPV0t0 0000000+<+H+&+>0:, :,N>c>t>&>>> -LM820S ,,0$b0 HU2K RkqJ@PKFK ^#KSRc SR @@~ {" SR SR*0S+ 8 k80 S Z SR!00 UT00S 0P80 8080 BU80  0Z B8 780Px80 8080 (` \80  @P(K<+&>0:, :,H+k<t>& -LMo@PQ 0S  00 000@T0S `p㼀 SR$KHPP@`p0 BK@Y  BK@o000@T <+&>? :, 0-0LS `p|P| SR𫝘 @T`p0  RF000S @<+&? :,(? -LP`p:@P PPD_oRP 0L 0A?oR20S $TP >?&l?X? /0-0L@Pv 0P0 SR0 + -0|@00/000 SLPXp ڤ? ;c0?+s0?o Ti0o0? +:, -0 ML@0 0|0@0K p-L M@P`P @TZ TT0/  0?|!Q + Kp?& 0-@LpP@ (0@P0P00^%&  -LBM1`PUk ܁KK Vh*@T B/)0S Ot@ IK,A UIKp%K``T1@Q 0 ?2/ 0,10S 0S Q0000 {00'{{gW0S0000R&*0S 0 0S 0 000R*Q hX0S D PY$K0PS  $+<+>,>,&??? -L]MX3`0S HHmDsDS0@#0040#00RSC 0#00/Rp"& =?S"F[V 0"0000RSA 0"00tlRp\"`D=P`@" 0,K1(A?40KK 0$R$00PS : S B>P3 lV 3>PJ(Kt|u㰯0pP= eK /0^t1V0e?Kq " cKeKe?K " ""#e?K #!@08l1 0\K>4 8 < 0S 000<00#K!0P(K|0 @ \;<+&A0+:,y@:,^)&^%&A&Bc=BHB4+8+D+bBB -MLM@pP@ 0|!|\ PP hh`qx1P D$K8A 8?$ `@TS Q  Tp{BK A) p0P0 00߀H1 _0SBK A p\0P0 080DÀ,18 KDB=8&#O +4+0:,BBG -LP 0-4@L4#S  0 0#S0K0h) ^%& 0S 0 0/ R  /0SC -@P0L` 0 SR 0t@pp ?bq0@$aH00S$`K0CPPp/UU`   |P @T@ KU` @ /0-LPʢ@P@000/00@P 0S C -P/p`0L@oC 0T@z@DdQU pDP@DD+C -PLb9{pP04@Sp+`P`R@0@0C0 VP4 $d`C@+(:,C -Qp6LS`+@Pp'0&(0C0T%Q&F( $06~00nPPWVP z @$  (@/z 0P0 @ PP\0`0@0 P $ @+(:,CCD1D 0-L@z04D00@+ 0-SL@ 0S 0S  0S  `0 |P T R 6!@0&F$ S 0S00BDUDrDDD@+ -L@`PP0S  0P0 @/ᅡP*z {0P 0 00D -LlM2P0 S 20SIta@P `~.X T@L%0D`00`0p QP0*`p SR@*`qQgʔ0T \0 #K10 $K1\K $K1 0X 40 0Am0@ '~. p 8(K0 Y0`p  0 0/mY`p$ Kjb0儠 00 0 0(p0 0KS0h0 0S0l0  0S0d0 $0S0`0 0l0 1S0K0 0l`<+&D4+=B&D :,@+:,:,:,EE -LM2`0S (Vؒr 0n#+Pn 0 00.000$K P }-\ Xn PS K? P }-, _ D L@0@D*PP;  Pf}- F + 1RQ rQQ K1 QP P0` 0 KP X1H -K -KD @10S~,K !D(@0 (C ^ ((00(CR((0P< <8P 84P 40P 0,P ,t \,<+&AE :,@+[E>B&vEEEEBE0+:,F(F0:,:, +CF/1G921+_1K1}*E3 0-P L W 0:,hF&p/0/ -LMx 0 RS T0R H0P88  K S >,I0:,F& -LMH0  Q0 0P ((s   Kh<P +0:,F& -L M0Q 0@T0$R ||  4ASAK  >KH0 KDP[|,( ; X%&H+P +&F`-&m G -LM0P0S 0 003/00S@x@ ?p2t0 QPP0`PP(|,P 0,,  K(+>,`$+4+P +0:,G& 0-lPLt4d@S 0SP LLk H0P00080 t4S0t8P +0:,QG{GG :,$+ p-L M0@0PS 0 00x3/t00Sh0 ppP0@P`{6,` 0,, J Kp(+>,`$+4+P +0:,G& -p@0`LPPP +P@ 4 h0-`0L PR@𨝨H0x`P k*'Px   P:,`-&P +&G -@1QL0|51q0aS :`-jP 0 D0P&P@&txPX PV{+ 05 ltJ PH{+T 0H' 4040Kh:,P + + :,h&WcG%+ -LMdA,pK gP L  @#K0`4!  $A$ 83実S1徏?" 0P / Z, ,#K  F#K0`  ~  8"@Ql000D  Dp dO00@ PIR(K9,!H& H6,2HHCH&8+ H1H89,BHaHmHH 0P/0 4S '`-&P + -MPLM0E`9t44S P tl p50SP8X (K988 HuX 4500RSP 50SPP+9S3404$0404V ܔ ЄjBK  @00 ,4[ S BK @ڻPX80S" 9ဉ BK@ @49S8 B.K 0 B BK @ X k  # 렓jBK  @⛻0弐 BK @"wPq,4[ S BK AXgPu $HR ,S y # Y-ꘒb2K0 @0|5P p 20S ) HH009  \ 0 00.J>Kx 0C SRIK A؀ATYX K @ `?4  9    9a<98890S 4)z ,8S H10S10SV 4 =KU 0C CW) RYPER0PES L!UH1H0Ѩ N PUJBK @LBK @HPEU,8S F!t4S 0t4Q64W UBK @-PEP +HH+&0+0:,I I8 IH>IH`II :,IZII%+Jv`-&GJ:,,+WJ&xJJ:,:,JJJ6KƨK6,$+ -sL@M0 |5 xSX0㐣 R_PP) 4xSZ | 4`S Q00P0S 30S \09$R U00V0SPV[05SJ R6 HXPU>2 RR RH RI t|3x20SLlHPH9 |%+0]909909(K02 +"+R ! R  s?V0`Fei0+x0|5\909909PXxP pDV `0QPU xx 4S % P Zx(  :00 ?MppU00S x4S 90$;#;S %Px+X\P +:,,+&QK&K0:,K@+;`-&<+nKKKKLLH+)+ p-MLM6@0S&6PP 3P P Kp6 PR60S b00P h60Sb  /W004488<<HHLLWWWxx|]|V9^EVEV:^EVET0AS꼋؋ $̋ A^K PEVPo 4PF Ph`4 `RP40S DD00    |  vv s mjgdd a ^ [ X U +v0$#$9? A $4 0? 1#04K0222020?"#3H0?%#?&3,0o20o0 0%?"p200S" " l" R \bR@TSP"P :NH D 8,$ `!0 x30000 1R 9? |#:? @  ?  ? A0 ?%8 ?&0 %0L0<040pe0!QP! PQ=0CSȌ\l$ 0 _9-0CS W  R0 R R00=0- 9 0 Tx^0Q$+lT>,<+&4L>,k,+`-&i&oLLOLP +LLL$MLM -2BMLMP0000 00 Qa0S 0ASl0(܏q封=0=P SR =0=00S BK@p0WP 0 $ R  p  (K0ppp000S40S  D 40S  P*K0 |KD1KA1 30S `0 |H# R  84#Y(# R i :0 ?P s5$ 0 *K0 |K0K0 ee20S#  \0 `oZ*K0 |K0K0 EE020S`0 0==10S  d10S  10 Y-1Ppjs# 0꜑0S 1003/0S!00S*K0 |KpKp pp00S! `0 pܠXK0 03/)Y 0 gX0K0 0$p0:,<+N&4+>,N.N&INT%&\NvNP +\sHtNT +8+zNN3OO(+>,`$+u wH;O -LM10 ( 0, , S( !9 1 1R t4S1 !,t4q0t41@00ta000S) Pl0S, R$, RS&P& 0!07(010000z 0t$vG/P KPk,0P;C,0 Pa0S05,0 (,000d 00(@, (0@0(0 0( Q! P 00P@6,0:,TMP + :,MIO[OvO -LMc0S Ӿ|C|S 4S  0SMr"D#0@@,$R0  3s 0|54S20SxN Pr|5"0C|590C990C9000Pxq 剾4S l2t"p2Q09090 T0 S R;00C90S$20tS A A2K|P5qM" ŀ0R 4|S% WP q9" P;#;S ; 0``1r0@%S ) <40+C? R0 0B 0S XP 00S )\y_\0SX@00S 000K<+&OP +`-&%+PS&H+:, +6,$+P7PkT)+0+9,:,:,^POOOPqPP,+WJPP:,:,>, --LM   ^ K& 0-LMt0@0PS P =q!0 <<K0000S 0 K0h4+P&<+Q& |00-@LTP 0P q|! 0880,00S  @4+)Q&<+QQ& -@PT`L SRP 0S 0@P :, 0-@PLUT0~P 0S 0@TP 00-@L"  l0  xhf0 dP`0 P8Z0 < T0@ (N 0-,;eQnQwQQQQ-, -L`^P 0P@ @ 0C 0Q3 @P  V:,Q& -p̀`L PG`00CS0 J+p@ T yTnTyDo0 @00CS04+ P 00  0 0 S^& :, --L M L 7D00S 8P@(P_K&@+-Q -RLMp`P0@T$tP!pi 0 KR0@TwP oT 0 \T@H00S <U8 p 0,,@4+Q&Q!R<+QQ:R& 0-@L   P   P  P  l$P p Lx`0Q\ \ ,p Ll8K0hM&QRxR`RpRRRRg?RRR 0-LM@PPPP< P $0$ $bK0PRS S1, -MLM0@  d~0 00AK@@jvAK@KS 0-0LS@ [d|0P0SlP 0@00o| 0@@K0h400S0 $$K0h3S4+GS&<+XS& -L M/`]P@@p/ K/SpPP 0 00oP0000S 0-0LS@  0S 0 000p0@0S P n 0@@K0h400S0 $$K0hfS}S4+GS&<+S& 0-0LS@ 0 000l0@0S P n 0<<K0h]000S0  K0hSS4+GS&<+S& 0-0LS@ 0 000l0@0S P Nn 0<<K0h+000S0  K0h!S4+S&<+T& -LM0`.SpP0A/QQ 嘺!0 U 剺  僺        p  xX  d ~00@ @VE$K8+(TMTƨUTэ\TcTlTuT|TTH -L6ET -L MP`@tp %KP X#E%0[ S000 K00CS00KH5,TTT p-LBMCNKM @DP`<4[E CRAK @V A.K B(mP<4[FS `0 AS iP0P S00@$ DKp}l5,TT -LP@`h@0 ophW DKh5,T -LM RP@D ] 0SYP  n PD0h`P P@[PS 001 E0S= 0 00d1d00PU&@1@q0 -QLBM0 CK! CK KU0/ 0-PLU@ U  0@g. (`$K0hl\ \Y@Y&NYP 7P P// /JjYwYY -L`PY0@ R |0000!S `\3C uk!.0T  d DoB-xB-YY -L0P0000 P ?P P P * P*0 P*0{ v0 CSR#3\Q0C000P:P1:P*24 p0S p0S0040xB-4`00CS`0X  X0 X /h& -LMM? K @  3 K  @ⱷ K& -LDM`QpV |x@ PPKV201 0B?oR20t0@S00C00qp RpaV+ W1X. T T    lKj lKch"0 .  lKj lKc.0\ dK$L Bp W|4L[(KYUB-uD0?-& 0-LPM3@0S Q K0h |31Qlld00CS\\\\\\\\\ľ\\\"<K0hK !0S SL )  d0AS&<LTd\T HD@< 0S$K0h臥  4Kb1g0CS$44/[20[0[3 [1[4[ K0hI'[20[(([3 [$)[4[ *[+[,[-[.[ /[0[1[$o1jS!K "KgcQ Q \YP!QPK(F xSK0hB-YU=8Z ZƨZV*ZUUIZ[ZXZeZrZZZZZ]`ZZ[;[_WC[e[n[ -LDM@rb,PKX @%@H0K0 0 @ "K@@P0K DK<@ 8@ 4 0@ RP\p 4PPPp pP@@@P0K DKRPPPP܁0S 媤0S HPP @㤡T:6(K0S 0L  /> 0:X #:0( 0S y S"010S00\0 Zp.6i07S 2iC(00SQ [0@x0 `0 x`0P@EXrTD0S@ӋlB-B-w[~[hB-[[B-hE-\tB-\[ P-L 廋0 k9\WM\& -L MP3 `R#|P0p00* P P@ LP" P# P @@0 0ePW W W"0000 (K@@@00Z= "Z? ?h P0`F0L~p W aL^WLAL^7L\Qp0D`XX 0"U 0 00C0 Y0K/W0G?o P2 0 S H10 S p # (KoP>Mp/00P W00S `aPW bmMpP PP0 00   iL _?B-/&xB-x\sxE-Y -p@,PL`P dP@t-& -0LS $  R R Kh  Khj0  Y`j?-  -00ML 0$0 0 0 K` ^a`m`P P P```` -L,M80KD K\S@3@#:@$KR 0X` 0-PLM   Q ,Xo_PK0  K@P .VPP ddPsj?-j@- 0-LMP0QX@ 0@H4OTd@Oo@5_0 ! "U  R P Q ,/_K0T%<@ |%(Tr d T%Tq < (uP" @ j?-s````Q @-.`pt0Pp@"/?0B!B`BBGQ R:0 0j?-XjA- p-L M0@ `R  \P.rUP ,^0S ,^Kp t0!PU U 0H <0KphKph(/&j@-sj?-` -L M@T T 0, (z KKh#Kh`j?-Q"!   0-RL@P TPK0h  (K0h0 K0hD ' -@p"LTMKp @@l0K hK`@ \ X T@ NOPlP ~`P =@@l0K hK;OPlPPGV@|O(KP`0p  DX y R?x   :y0P t Ky3t  PK\101 0!S00C00  QPP p0 Hh0 Lpb 8t t*l`00CS`0 X 40@T:(KoX0 X w[``(/&Wah& -LM006 K -LM0  + K -pL MP@aU QE4 0 -\P0 4 P Pp@@PE`FQ@@0S@p(Ka 0-@ LM 0K K0  K -L $a& -Lb -AMLMa1p0W 0 0@P0qaBK0x!x@ BKl@'0P(4 0 L(1 0RC  a0$q00!1 /0R0 (!R (4GS!@PU?( (?wU<T0 <+U<Tl0 0d(0(PP;KE-(/1b?bEbƨ*b^bbJ-bbb -L!J- 0-6LS 0$E-c 0-L'1U.U+U|(Um/pd@P0" \X  @8`0 K0hc$cF-hCF- -L  Ce&-  p0000@0\0C0S @C l& -@PL00S8PU``840#U:0X 00rX0X40P80 0X0`P -0- LM0@P 0 P0S* 0C 0K0 -LdMPpP |Kc@PET |0[ S |KE(K`∠K |0 B0K/0K 0 .`KK!| vK0  , K00([$CT 0  .0, K V0B|KP |Kdc@XhZ]hl& -@`PL Mp尀(@ "!023 U 0 (K⼞pp p; (KⲞ\(P@T(0S0 P(    ( Kwjheqhƨvh -L(M  808"404!00!,0 (0 $0@hhh&hhh{h -0-LM `@ PX*P0 R D0D0!  F$ 000K08/&=8t:t 0IpS4   H  L   >80S4 5 R"V 0@ 000@0@84/40S40S ,40S0 !S$  40,pK34'0 104 ,NP `0``  Bp+ X X0 S `tࣟ`40S0$00  R R 0      ``p0 ,404 404 4V `0 8pv'4S` 0R 00C0 0( 0R RX $ P $ $Q=KB.K 0Cpp B App0Gw=KB.K 0Cpp B App0 B.K B|d;,KB~K`4( pG0 yAp`MX0 S``P 0 fAp 0 04+V5 3`p,0KB.K`t# B`` JAp`0z@P1T `=K`` 0C 2Ap 0$DM-M-x/&ƨ^p/&M-,O-=8elllK-lэllllllmDmmAm&m0mll$O-L-9mJmM-am|m8/&m -`LqMX? =P`F@P U#*0T?SD0@0DBP.0p0.80>9p 80S"  0P>0Sr ` KRW00 SK0 帡 KWc?K,ᬡ 尡 ǡKJFP 0 p`1 VXW p T=6F@P01 00A ATP  Ta  ,$F0P1 00001 pTP,Z =z-  =0S=T` CW mKy1pT ( 0S2W0Sa>TPZp4TP,T -TP (TP01   TP01  tTP dTP01  H TP  0 ,T PT ! V!mK 1 T  0SV0S S P$T ! V!mK iw?K1T l i0SV0Sw?K0!QP10 ySP:TX A 1 Rm aBQ'  01 <  ! p   31/XT W 0HS񟗤  D  X LV mK  i1`Tp  0S:V0S0!QP >K0 1` Sa 00  x 0H0u8X(  V mK h1`Tp 0SV0SWV 01Kq?K0C0 1` S01 aV@ Q QV*, U mK 1coKT ~0SU0S `  +K1S0 uW<X 1Sxl  01 X0S@]AT 0H?oT20S0H?oT20S0H?oT20X0S @X< 1sXp0 ;p01 ?P.00%800% 9018@ _xP  KmM1nOKU01 1Sh&1 01Z, K10   !`01 00K0 K0SK h>p=U  ! c/! 4SK @5k/K3>4p8 1 450S (50S5"x 5 (K 0PP40S 0 GKT 0t1 c?joK1 p`4i/KGK=pV30SX KT, K0A1 @K  `0@1 0 0GKp =pT9 x30S30S000CS##1" = pC@P ,3porlc0S tm00d3_oK1 01 c?1 40q?K0o?K0-K\3 =p9X|f RT=00D@ LP0=S "8 R0  rLP 0=S] !8 R 0Y  |dLP 0=S !8 R  HD!TPPW@210@0W1@2@,,q0S 00SU( P X- p 0xq 01P01 0D08/00PEU  T  0  1000!M-8/&8O-mbmmK *<p X(KoR0S0 0180 0L 0100001s_[ -LoP@   x l ` T H < 04&uuuu v%v8vYvv x00-@LTP`O P  ep@00@! P-Qvv -LMM @AK@P ()AK@PKD p-LIM M PAK` @PLKpKKAKA @P4 u4 | ux@0S0S AK @0S0 0S AK APDvvP- -LMM @AK@PHK40 R AK APDP- -3MLMpNK@D$PPXYl mP0(8K N`PP ) NP EPP  EPx2  d E`P_ L2P DNP ,`@PP0 0U,00P`)0S_tdW K1!P@K@QPP KtK@1!@{P`10S T< N0z <`yNPPqWP! P 0 V_3KAPh\`ZZE_oR0 !P  (8[S K@P ts50 `PDjwmwP-ww<ww2ww www&Cw@xx --LdM @|0 PP0@K(KBL0Pl0   l 0Ph0 X(h0U  lsTb Te Th;LLTd0 00 pL` |0 ?oR20Sx0  l0h@`@T\*3P03# 03 030`00募pl`t0 h00Csh0 I|0S  4h0 0kS?'Kᇄ  PCP@h 0TK^pz p004 ;\KTpp \ KTK lL~6d0 R1袟d0 R0SdK`K(!ȢP0آd0 RLY1Bn0S 0 S5@t0p0t0 x0S, Z竸J0S相%d @D?K`0 d0?K(KK?@(KK {{'0 {0Bnq 0 1 0\K0pt& t?TK4 $; p  @D0?4 $;LKp \0K0 `0 H {{'0L K0{TKd@p0_ 0:K 0h4K 0 p+K Y@py~yy[yyyyyyyGzbyiyz zU&z0zYzƨpzz0SP 4h0 0kS?ሔ'KpG%  PT@P@h 0\Kbp~ p004 ;TKXpt ?40$;LKNpj L0KT K\Kd@p0_ 0 J 0hJ?` 0J 0 Pt0Sڐ竸z4h0 0kS4Tt0 相/  P@AP@$0\K p( ?4T`K0$;p 0GLK$0;p {{' {\0K@0 `0x {{'d@pG?_ 0{nJ? 0fJ 0h`J`0  Y@ƨzzz -L f{& -PL0`Sp P@Px@PE$UXKKP 00KP0K0NDPE@DP- 0-MLMQ@4KA:P6 KK A@&P38: S7  S-.KK B@P5 NK@DA^KPE 800X S08 >K0CCc@lN0S a0ppW.KK B@xP.KK B@p@PKA qK0M{P-+W{D3{ -`PpL@Q0  0 >KPP RX%0S D %P 0#F0( 0$ 0/&,-|D-||--- -LD5400S (0 0 pp  -,-bQ- @T0-L@)5@00S(,0 $0R  ( 뤲----w- -MpQL MB>K0CBK0C+A?P @0($@0 K0$$[000nS ?S aS pS qS@x0 |@t@h0 d@l P0L 0 8_|,-|h&`-|h&i-|؅- }8}$00S 00S/؅-- d0- LR L00S 08P8@p`0Pp`00`- -؅-- -RLpM@  Td \ R Q ğ@ R@S1 4P @ @@   R0TdTt@D^ Q 0 R R\* 0BS0@00S 0@ K0 S 3^ \000lPU5P0S@K $\ \\!\ 0P0U`^ 1EK $Pl P$PV^K H 0\ \0\ 0K0$0[U " \U $U``` 0\D 1LK$\0 lH` PCQy A0'\0" P $Q  \,\Q ]\(A  0\ D R \? ]\B} `K1L $`VJ lPH` CR B0 pp\\ $\PPP 0QD K1A$\ lH` PCQ A0Qpp0\0兘C\\\ QppP0,\ ]\ l&h&4-0-0-p-,-} P-@@P@TL @/|`| |P2S@dK \0 TP P00@ <$0@Kh~/&,-AD-^-~ P  -PL0S0@0`x0Qh #pW 0L 0S @"Pp`R y"--$-/&:~d-|| P-L. 0 Kh3D-V~ P-L. 0 Kh#D-: P-L~. 0 KhD-]~ P0-L(@ m.0000 'D-,-`-c~ P0-L(@ Y.0000 D-,--~ P0-L(@ E.0000 D-,-@-~ p-AMPLM0  4 0@0 4@S$ &. 81 KpS@ 4SA>K 0C!CC=P 4S$4f@PP $4T00aS` 0` 0R`T0 0 0@00@@AK @ @$4 Q000S0S(A>K 0C4 CC<P D-~~-~~--~ -1ML MX P\ - <4 KP>K0C $CC<P @4@1` hPY30S Sc \ 7@PQ`13 @cX<S0S 3PUd30S5 \<P/ T3\0K0D3 0@ ,3,(3Q\<RQ300?o2'Q20S  2p \<P0002p@\< \<R R00 R P 42L"0K0$2 0@ 2 2QT100?o2'\,Qw10Ss 1@P0001@f, KI\ >K PQP<S\<TlK@\qU Q 0S 0S1 \<QP, 0BK0 000@r 00QQ000?o28'Q|00S  d0 \<(P000<0PD-~`-. Q---,----~~؅- -L-~ -KMPLM4 0 4 0@04@S , p 2 (KS5 4SK K! A@w;P 4S4>PP T0  1 1 0 00BK @Z`' P1 pW D1D塕K K0! A@D;PKK HHZp$PI0S  p)04 R000S04 (0t0P4$70 QP #R0p|D-~L---H-,-~N\-K0 0 00 P-Ph0 0 00 E-P -KML M P + 2 KP=K0Cl"CC:P @L2@H204 48EP (2 0SD 2 / hP4 !aQ0S 10S 00 5@P/p1@0S 7PX1 lB4P H1H!0BK0<1 0@ 4pS KKHHP,00 0 00T   /o" (l0Q00S 0@4P000`0@\ D-S`--`H-,-. Q---4-g-L--P؅-K -N\ -PLAM@ + 0 KpP0 A^K PE `E |?x0` 0l0l``0+9Pz4[S P0 CD-c,-c-P 0P/ۦ P0-L0@*0000 0D-,- P-L@PS/o" P`P0U0 p0d0dPU @0<0*$0 Q00 Fۦ,- 0- L 0|-D- P-Lm* ,0 $00S0 Kh賓D-$-,- 0- L 0-D- P-L` Q!0?o20@0`Q  0S 0 傓0S P %*00@xKP T0 LBP80 7P400 0D-l-,-ۦA-W-  0- L8 0m$-D- 0- L, 0z-D- 0-,@,0 L 00S 0 0-D-l- 0- L 0蝀؅-D- P00P0-SL MP(a )00 KAP0q?oѣ2P%P00\0 Q R000P ,o>P9`0P0 0R0@00,\  ,/D---ۦ,-R-(- 0- L 0,-D- 0- L 0,-D-P00P0 S-Lp@ <)00PP-`_P 0 `0 S   S  0S00hCPL06P < 0?o20D-,-ۦ--N4 P00P0-SLM   ( 0 KP KK7P 0Pd00}S`00S T0T!0HP 40 0, 0( 0D-h$-,-y-(-- 0P0-L P000:@P0p luK0hMP K0h(u4@ 0S80 0N00ڑD-(-4-,-Ձ P00P0-SLM   p( L0 KP8 KKc7P 0 +P0 D-~- p-LM P$ M( D1 KpP0!$K K@7P @1@l,( P$0 @` $%2PP(Z,0P0$ S0 0S P P l0 Q\00S  L0P $0pP000$0PD-S`-. Q-- -؅- -LM P ' 0 KP 0Sx KK6P 0S0TP0@P00 ( KK6PD- - -L MP@ppGoᩒ PAPK10Sc1(KoQPQNpW|)PPtQ h1RP@p7|0@ 0m<P0 001,$fAP 0|S 9@P 0 T% (KoP @T GA 0P`0`TT TP0 TD' <0 (KT08` ꫉H-,-.WaD-g[M)$ -L M( P, #' 2 KPN(0S!,K(K6P (0, 1C  0  @P 00|S X9P jP ,0t@@h1$ d@+4 PP @4Q sBU 0S$0 @ʴ@P@KPT> ^BU |0|U 0S $0L @=> GB ,0 .D-Ăׂ̂߂,-- 0P0-L P K0h%`0`@0S 0S~1D00S0K0h܎ G000D--(-,-& x0P0-L P K0hp%T0 @RK1@00S,K0h贎 000D-4-,-Ձ< P00P0-SLM   G% 0 KP KK:4P 0hPL00}SH00S <0<|00P 0 D-Q$-,-`- P00P0-SLM   % 0 KP KK3P 0hPL00}SH00S <0<>00P 0 D-Q$-,-- -LMPAK` @+9@xpTAK AhPAK+ @+0ESAK+ @+@ 0 KD- -LM P $ <0 KP( KK3P   D-ăƨ -LM P $ <0 KP( KKv3P   D-ك -LM P e$ p0 KP 0SP KKU3P 0S0, KKG3PD-~Q P0-L<$ @0 0 40PP@  P0D-$-  0@S0-L$ @0 0 40PP@  P0D-$-#- P0-L$ @0 0 40PP@  P0D-$-:?P P-L # (0 00S Kh,-D--GP Q0-L # H0 0@0 @R m0S D-- -L  0-PL M0K00P0S # L0 KP@ 4Y@P@K$U < @D-L p-L$M0 P4 v# 1 KpP!4K0Ki2P 40$p8 `1`峌80SD1H 80 0S(10 $ P{'`80 0S 0@T 0厌g'@>9PP; e v$80(@K  84800@ 0@3/P00S L0H  0>'D-,-Uj}w- / -h-- 0- L< 0覄L-D- 0- L0 0賄\-D- P-@@P@TLPp "00Pl`h0h@!00 0D007U00@ $Kk7D--,-̈́0-4- 0-PLMA  0P0000K0P"0P%0S0P 00&.0@0S 0 S  @.@00+Td70 S +<]74 KKk1PD--ڄ,-Ȳ--0-p- P0-LP 0?o20 0P P"000@vP 0 00x@0t tS00Pd \0D[P(0 4TP0 D-܅-4-ۦ,- 40-0, SL$00T 00 $- -D-- 40-0, SL$00? 00 $-p-.D-$- 0-@PLK0h 0- L# 0@-D- 0- L 0M-D- -PL M@PpoRZPY`TPQ .PbTJ .@PP[%% UL1H1@W <10S 01$!1 0S ! P U10@W 00S 0 0 0S  6 % %`PKP`pP `P LP` S!(K -P-$-,-ۦ\--mc -Lp0D- P-L4! x0 pP \00}ST00S H0Ht@P 00 0( 0$ 0D-ԅ$-,-م-(-- P00P0p-SL M` 0 Kp0@ 0S PP KPP0 00S  L 0, D-H-,-- 'B P0-L $0 00@P0P0D-$-r -LM0 P4  T2 qLR0S@2@P:00S 20S 2@b40 ` v50衟S Cb"c! !    @c#! 0X0CQ00CS0G< PJ00CS0K3 PBX!4K0K]/PS0 8 $pp8  0墉0p(K0pwp Wp0c! P 000 XP00d0I00H0 0 Sp(0Lx0 0 SD- -,-w؅--h&4-4- P00P0p-SLM` $  00KpPp $K K.P $0*0 QP@P @$0( $0T000D-~8,- P00P0p-SLM@( ,  00KpP ,K(K.P ,0*0 QPK H0$KP,0`N+ 0(c"KR000D-~,-A P-L 00 P KhS KhND-GL 800- L@P00 K0h0ꄹ,-T P00P0-SL M쀟( ,  \00 KP ,K(KP.P ,01pP !PPP 0RP7@7@/`  4 H;& 7&ؽ00D-~a P00P0-SLM0 4   0 (KP 4K0K.P ^!@P@ 0R@|7`H/|0P 030pp`p@p00004 0 D0@ ? D-~al--$-PK P-L@Pp 00`P P P@+p0 ` S Pc@@ @000 (V0D-[,-(-ܲ- -Lp`P @P h0hKh;P (00.8 0 RU Kh%,-ۇ$- 0- LMPP  R KhNPX@X`Xp0S00K 8R  @D-@0&,-ƨ 0P-Lp @ Kh#z PPP` HKhP 00 00D-,-ۇ P0-L L0 0D00S808K0hG0$@$P0P0D-H-,-"$-O 0@S0-L h0 0`00ST0TK0h$ @0PP@ ,P0D-H-,-T$- 0@S0- L l0 0d00SX0XK0hD0PP@,fP0 aD-H-,-$-È0@-@CT @ T00 P0S@0  -LZKM,PE,MPQ g 3 (KP#EEZ,P @3`p娓W 3  㘔!&2P@*l+20A-K B00`A-K B0 (3A-K B 30A-K @ B100S  2@0 00@Ђ0S0Ă00ppV"^p"p0S@$S \SE00H@0S@D"  0  @#00C  BR!0 B 10 Z5iQ0@SAK A0! B1A-K B0 C50A-K B00P,1D 1 R ! R0 ! R Ԡ E  ~1  2/ R 0S l0*\h1100000mA=K0C0S 0`S9D- --,-h-l&`-Uh-j-$-в-|- 0-@LP 00P 00P0000  -h0LhM [ T00S D 0dpK P,0pK0pp$뤲- -*,-x- -LhM: P00S @ 0dpK P(0pK0pp  -D,-x- -@L|4Pp `0 0Cs0S13  XP0 S 0Cs0SL13P  0 0Cs0S13 P -`LP@:X'P <. 0S1PS !2.tKh-.,`W*P %:'P00 4.JS!0R^֎g 0-@LP 600PU 3  8P0'0000@-@CT @ T00 P0S@0 P0@-00S@0\0%\#0S P   R   0W7 0C2s00W70 0C0l& p-L M`P0@P<6 0K*/.0St 0l R0 0  ZKp B 0 R00S 0Cs0S130 h-r -L M`P@pP) WPP P0  WP 0 00P10S&" pWP0P 0 U -+*+'+ 0 01P1 TZH(K/8&P0 A +@ /&P 0PS 1 P*: &P P*%P !: &PP000PSU& 0Kႃ0S 000S0 @Rđ.0 Z@ * K 0C `P8H K $p \8S 0S @HT 0S Y@! KK^(K8Ph 0Se ;Y`Pa P P xPhyY XtY00@HT 0S 8HT 0S /YT4(RK@.놮K@J48T C/o" R D$PUp 4( B0pPZ P PU p PPTp pW D pp44$0Q` h8 h80BnK `F+T.@(<P( QL( L 3H(  KAl( h8 Th +l(h8 R.<(3R @x~048 )@@ $P @@8\8 ,3@)@ :@$P 00)8 fP  @z@wRX(\@)P X X= 0"Z KAvZ %  R5 l4(R /$P  4(R R + - KAL( Th P R0S10}S+KA-ZTO RL U K+  @-K+8 @K+ @NK @D+H- 0Th PH L( ,Q (1@p R+-KATh p0@@DcT@@0P/cXP0H8 0KSL A @꺊0L,-l---Bnsi{-!D-&cز-؅-`n- -cMLM(   t $ `       VKK L   x  |     d h l   5     <% P<0]K0[>K 0C (5p1 (l |(h x(tEV>K! 0CTd `E ! P 0S 3P(xP 0S#T(  T`>0S(PW$6s 6s6s6s5S6s K( z=0S5  /WP<( 9(=5S 50St5S(|  0lMl 0 SK A AK A <=0S ]K PEP' t5Sf=- * 5S MK @D*P=K 0C<L 0 *00 P,P0t )p<0S'd< R* $,5 R:<N1P4<5 3 50|S/    5S;5 ! TL%; < 媀%R %SR  Sx  4;l+u 5S 50S =KD 少p0P 0S} ' P/`]K@D@P@ 0S :VPV{/V :FS@PU F 6St5S 6Sa : 0d U%P E%l"P4 0, K " B1P5 T5 X5 0[>Kp L50X5S 0S PET& 0S 0P  SVUK@H 00=K 0C C 0S 50S P @@0P5 (&P  K*UKKN00Pt5 KSU ]^K @ PEE|e38,K0 B5 05 ]>K@^0P S>30 |VPV 6SZ|%\UcL]U0PEK 0CC.K\60 S00?o2A%P5P *G P<#) * P<L60S"UFT$x%](KeV(|S( 0) Gd XH( H@6(&4{5@T =K10%5m@x%*(VK A50S U& P5%( %5Q( (u6弅S`et5T4UPX 40S 5 H4@ 8'V d40S 5 $@ 'T H'd(p )pa30S 5~d5=K0K 0C 0C 0K0[>K 0C0-K=K 0C B(P< PS P 5SMP@S>K 0C SR P0S>K 0C@C0 UT2 SR P0 20S0 6 3N~00  00 p`S>K 0C SR@Ÿ UT%( 5ST35  1$ R2"\;2R P n1B%220c>K0C6s 06 4BVU %(P@Tn10K0 A70&PR `10"0C?o2? Y1"0 0AM06 6 R ;R [.Pj d06 6 R Rx-0-D--ز--c$-ܲ-W&xsވƍЍӍ*4-MBnxfЂ h-P  5Ύڎ0-HfόUZzď`{ُh^X @ s{m S-=_r -l-ؐ--Q,--*-U [nKP$ `F0S0 R?0  F6S F?U F F FR0`F0\0 F5 5'P&P 00S&`P 囧ZK@  FR0F,6 5p0ss086 0 ,8<6 墺p<6 @6 }0 @6R #R X Q,&p ,& 0CS10S 10Sq0 6S PEU0S2 }K pGYK@ֻGY>K 0C CP 0PZ R= 0 R0= `  #2c.K0 B cKAR0 &U00R0SI P6S6SjP%d'PPhl-PxU V30SV3P0Q33 ?P03 D #NZ %3R!]K PE SR RNK @DV !5e 3/e ᖺph4@x ᣿4 R04|%|$  &5S-5%0R/ KXVK @U[K @"[K 5S Z05 6S S06 5S L05 5S E05 (K5S 53/5S 405 p-L MP @HOP  BOP0P  Kp#`P  /OP 0 FxU 0S S TP 0S  ,O0PP Kph겊ŊIވ -PLAMMAK(LA-K0 BAKJK,L0,@DA-KP B4@PB P (K ,D4幦,0P R (5000@ :K,0C4r"p`JK,@DA=K(0CA-K$ BP8Z A K@0@P 4D0A4P0400S Z Z pA KX@0PE A KD@P 00*S0 AK A[AP0,0-SAK A0MAP0 P0,00000 /R0 *R0 ,D6AP0,000000SP3 0D3QEA-KA K4 B0@0~P A=K40C0A K0, @.A K @+Ps 0 00SnA K@=A=K00C0fA K@\P 0!`\A K@RP A Kp@LP `PMA KT@CPDPC0 000=A K@3P A K@-P1 P 00 !'A K@P U KUU U WL P1U 0UV 0S Xv1 0Hq W6 30!0SPW) 1U0S 0 埽0 0A K0,@0 u 0S 0 劽FnPV pl&g-w-ȑV~ۑ9MS1eS-$-,-Ւ 0-LMKd 0 $0 TP P10S 0S$00 0 K  aQ @T$0, S 00S 0s $0( :P 0( S00$0@xp @T hA*P 0|S 00 0S$00 0 $00$0 --  S---W -`L$M@@KP %000 04@ (0 ,0 pD (0P/S:S X(@c  D $ DDP% 0$DP/4@ O@P/:OpP O@D,P  K@[ /0, 00P0DK=@PU@P04K00 l0@@DcT@@> , 4K00 0@0CcS1S@ꀉD-PP00/ 0-L, (0@  000z,@0褲--  p0-L \00S P0 0Hpp8 00000$ 0 0<뤲- -,-b~-}-`--  -\0LhM@ d @pKO$80 0pK0ssW 뤲-3,--00CS0 Sp0 S0 p/ @-0LhM@W0 0 00 0rS sS psd dpK$d XpK*P0 0pK0ss,d $ꤲ-`---n_,--h -LTM@p  T?t x &K%K+  ?&KTRT LKO+&K`%K`%KR0T b<K@$KKP 04DPZ R= 0 R0F&d `@ 0KP %KK۵P(+0S +0#S +0PS H1 R KR00A#R O{+yP v(K  `p 0 %K R0%Kp x偵`P^+0S Z+0#SIY0S KP0 R0 ~ #%KK 0%K갲-@B,- p-LM`PP@ @0BKss0,0 U 0Kss0000@?,KP V[U 0KA0T00Kp 0-L+ t0@ Bd00S X0 0Ppp@ 000400S $*@0褲- -,-b-S-}- 0-L*@`00S T0 0Lpp< 000000S  *@0 -,-b~-S-}- -@(6BML M@6D @0 5U84 K 0C l(0p4 3G.K0l4 F>K 0C 0ChD S0P S (0 8nK 03 Rx4,Q 3"xD 4 T  TK 2x R 0 PE~K0Pp2C.KMP "CK{  w 0S x40S \0C.KTA PP CK,L@0S00?o 2Pᝲꬑ  0@x0bR0 P4 |14 xD 害pp4  P1p}P$ 0S004 0 0C>Kᇳ0(a(0APSp JP P  0 0S 4 0ҷ3P@F>K 0C0C @4 R4@,hL4(K-y--D-S-d-$-Bn,-fxct--Nb -餇0JMLM4 pGWg P|7l'S0dS00p  #P(叞W 7 0FS VPy60 0 0K>K0Sd6f0S. pW*6&0S0p0$  K$Q0 P R44&44 04 R & BR5s00)0S P)0S6 5sp|E共00S04 B>K 0C0C0J>K0C0B>K 0C0C0B>K 0C0CC.K\\| P\ ,5L D5pW `0000J4ss40pC W``S`V4I>K 0C C0C F>K 0C00F>K 0C00F>K 0C CF PX44p$``!>0d4[K0S  K>K plC xޱPx20 00 K>K\ӱ ,$ &J.K Bձp 40PpC0Yd SC10SC ܑ0S?J.K1p0S  0IK [1C.K CKP#tqC.K04 \10S00 04S0$q P 0S1!0S Z 000S 0 00Sk Z0s0p04 ZSW  SM04 00 K>KFD܅--y--y--t- ----$-,-H-D-Ȕly-4-͔8J --ؕ%EU -LHM`1ApWk pPH  pB 0\0 0TK5K ԅKl1Q< ?%KDKK$KP<LPZ= X  /\Kph%0S ^0$K0@0( 4K幯ppV%0S PH姯00塯 p哯p 30[S $0K< #   㧰'$K܅--h-y-w 0-b@L0r 2Tp R B ^2 2Q ,00\2Eυ 0SE("I0S 2A 0S!A0 S 1 R$!$! 1 (!(! 1 ,!,! 1 0!0! p1 4!4! `1 8!8! P1 e 0S 03/ -----$--,-----X P Wh&-~~D--cxs^QP -D(- {*s-l--5B -LBM$1 0! 0, @ 1 _1 NK@P,0 ,<@@P@;0 1 ;0 1 o 0S?;0SW 01 ! + R000 0 PKPNx:p70 STP 10|S XP/B@0SR 0 SN  廖): 0RS 0S 10-S1S :!启:!劯0S !$K0S L: 1si0sj0JP001Sd1Sh9! 9 ! 9T001S  T T/00P90S ^0 S Ph \90S O0 S P $90S9Q0S|PPP80S1S"&r(P  88(l80sS_p8  dPx10S !<Pm0U 1SP 7 7 R0ZW0SB|P 7 1 <7 <7 1Kp 1p 0: S0&0&0`7 R,T7T'TT~(10|S  ,"  1S⨕p6 l6 61 $埮  1S66 R P h|6F 60SP 50S 5 R05P50S 40CS10S 5  p cP0W1%p1 1q 15P00 8(ePOF0 SH41S 1 3/0 1  y0Sl4 RQ 0T40S !4RO 0 QPK Kⓩ.K,K0K0 ֨ps4K@QQ  0hg\PH0Sc!00CS0p@b T000  T$C<C 0 0 0 0P`pk V00 0 0P^ !00CS0 pT P `p !0`#u܎K0 ?.KЀU KX0 0 !00CS0{@ T0S* 10@ U.10@ x0 S61 10@- v!0@  4T< mt{j &!0@k.K@T01 #l7@ `TiJ @00S /x t 1S 1 3/-----K,--\---X P Wؖ$-,-D---U-D-- c&ܲ-{2xsQ^s-l- -٘f{ /0Oi,-P P0-LdP X0 00 T0 @P$峓 0 K0h t-D- -L M@C0 ሬK蝙Q 50@-@CT @ T00 P0S@0  -p@0`LPPP P@80& 0-X@L0SHP40 0R 8 0k-wC=k- 0-X@L4SHP44 0R  0k-cƨ o-PC-! 0`Pxp^ Y @Y X BR`P0Q 0& -L$M`@plT PT(KT <<@DT0@0 pP@0  P' ƫ`0 P0Q 0`師@PS 0S 0TS YJ@X 80K @0 @0,K0! 03/0 00 ጫ ,-؛-0&0@-0 P$R!R!\6 \> 0 Q Q Q 0 T1 R   R  41 0 Q 'Q Q5S S 0 Q Q 00 !R0@0 0"Q \Q Q@T "T0@0x-0--Ȳ-7& h0h - `0` `@ X0L P0 P w`V000x-h-0--в--`- -aLM0AS mg0 S tӪb 0*\\ Pd H H 0S  ` p ) A{ QG`pYT#X30H# OK 00#1{$@ Xڐ  = x2Y4# OK  0d"@)dY OKd 0"@<O?KT <QdT1 T" 0@@P  S  RS0O/K "d1" 01U?K0P0 P0UK U?K 0 UK  0 dT1WK( X!P1##t/X1   0WK/ 5; 0 0 %A5+ !ᣨ`1@S{ 0`V0vs0ЀX0n0  0X0eXj Af Ak{H7{ UzKpTO?K`X doW@  .A-ƨ-~Q{--Ǟs-ўb,-OKd04 L@<]O?K<pd 0l ;`|@!D`VApQVX0O?Kd $ @O?K d`1 S00ppOK*8K(K`p$1&%+GŠ` p0 0-@@L0s(00pp0Co07&,-00S000/o$-- 0-LT0@ R0 @00S 40 0,pp@0谲- -,-b -L MK,K 0K ᚣ K 0-L0M$ K< <K80 40 00 ,0 (0 P$ K --LNMppTTe  "QOK4 W?K!PU?K <10CS P0UK `4WK"R0Hd.@\W?K " 0UK 0S w>0Sn KPk MK⧘30S@ K#@@@3ЀX03W?KՋ A ' A{{jodVd`MK0dP#$L3@03X-HP HXd( #0 #HMK d"@W?K P࠳ࠣ\^\b M?K"dQ?K @ R0 <10SZX=9 =:~k{  A1SK R08 A{ QS?KP0!SKRU \M?K1! 01SKP0dlP dP㐅)</?  %+H1 /? 0SK 5;A%0  y0@ R`ldЀMKXPWKRgp k Y@.As--h-- s-L KdԲ-D--ƨ{{$1Fݞ-Sb,--?~`\UK?\0T1X 00MK*`0 0MK0ss9[jWQ`"Ce 0LP!ŠHˌAL H B 0SKP GUKP8! @WM?Kd\!@d1 0MKpp4K$KR A  Ak{H7{1Xg 0P !¥@P<M?K<`d 04"᭥@H"᧥@ 0-L@@0 -BLd00` d00CS03tp ,P P00 @R0S"P:Qd`d00CS0-^p "P \Pd00CS0Qp00 R @8Q0q`PA 0 0 U90 Pc`d00CS0"p 0@S P,P \Pd00CS0p U0 0 "P@8s-7&9s- -LoMf1 0S(KEPd0S K↿0P.K01K00KP50`u1 APpwP@ PVH5pn P$P> $5 P P7 .t0P1  P 10C 1 5P10S .]PP 0P1 PE h5`P10S p0 P P  P PPU @P    PP P 3sKd0ppP 1? *8(8p3d[p P 0S<,3sKd0ppP1?  8p P 10S120S 2d(0 P Pd00CS0pp Pt2ta0SX2\ LR D0 dL\  ! 1 Kp1@S PQ d00CS0p0 p!x  S%l PT!Q0<1X dL\!  1 p1! p P , ^0U^0C 00ET^7 ` ``0S  CR"S!  4-c8s-ƨ -d-ڝ؟ -,-;w-l&Z4-4- 00- L@0SP 0 000@ A4P t0 0pP P0 0PP ,0 00P  0 0l&ɠH-Π ڠ0@-@CT @ T00 P0S@苤0 1 0-S0QL`0P2V * P ڀ100.S @pd1lѣ `L3X1P@  H,3P10T0!0!00 (1( V 0 ! 尣0Aq000 000000P 0p0S000`0T h0h0 @V t0 P$0``-$-rߠL-H-,--X--V~--~H-ԅ-, O 00-LP@ )0 00x 0t 0p Q0 `0 0X @0P 0L PP 480@0S, 00---X----$-Ѕ-- -  L0-L 800S ,0 0$ppW뤲- -,-b- -LP*A`j0S p0S pp00pPㄝj00000S pp0S ppp000080oU  Z`蠲----_ -BMLM2P 2p0SB 20S R$5 P1 y R 4S4 Y$ (K4St2BK+ @ ,0K4P/S BK+ @BK+ @BK @PBK A咉``!0< 04 0f00@$ 44 |1D4 8 X \1oSL1LBK A0F 0Y100CcS``V10X 0o4<40$BK @44$ D48$ @ LBK @ܝ4SU005$4SPo P0 0u,-`-s---y$-l---h)D-H-c -L M1A pR0 Q`00S Q0|^P P (K$(0 R 0000@ ` KPl00}S0s00X 0S$P,M^ -$-H-,-̡H-l&D- -L @ Q0*0@0S0 0 0S00CG RK mU.RH T:* @0GSp0d000C R9 T+* @0GS%@P.@ @@꠲--(-ƨWd-Ѕ-/ -p`L P@OP0  T  `00T   0@ R   `FVx`00CS0  PpTL000`000 0 ST00h&" -@LM`pz P0尀UBZ| 嫝 00P$0K*aP#lP`0( \嚝L00D P 0 $Kh-,-9Uh&[eв-`- -MLM`8 @ 0~KpG.K0@p3 B  2P Kx#x@ h`30S, P Q PUP ژp@d 0`00C.K00 B2w2P CK"@`P CK`AF(K ᗗp.K0 B||6@ ሗp@ KLA(>K 0C8 0(th 0B$2 8 R 塘88 @_ 0 hp@U 0$SBK II 8S 0AS K A80S  uI8, RdPZ=  R ( ( /8C0C8 p8, 0S 0 0x8 8 PC>KP 0C9p |8S |8  0 p@@b.K0 BL0壃[P <00Bn-v}h-_ 0-@PLK0hʖ 0-L@P0  -LP 0-L@p0 ; P-L뫵P\ 0-LlMPQ@0K|0 0 0  T  40S P 00  P 00  |0K KK"PsJ 3 @0#S` 7 |@$0KT@#P tKdP/X3x T 03 P غ00 PU   P ɺ00 |PU   |P  KětKr P 20S x@u@@`  H P ` P@l0S @P@KB N X P@C M TO|0S @P@K%| 1 ; |0SPP.]Hm|@P  * U 11@T  `0p Y0PUږt!rP*f/000T0 0 0@B@T|Q P/P-ڝՈ-D-,-h&ce-#Ăׂ̂߂ǥЅ---- -3ԥh-`-в-(-- 0-LM P 9 1 K0Q0S 1 1Pʔ!KK!0 CRx @R hS \1P 0S DW<S0R0P 0S 10S 0 0崚@ @0 @0@0 @0 @0 @ 0 00S 0JD--d-ڥ,-^ -(--T-$-":---I-8-S`--H@--d-̲-- -L4M0@0S@K, @K& @0K P@0S04-@KY@00@@KQ,-~ --LlM @K ]E0SH  0@0$KQ0 0| S` HK hK⸕&KK0r(0K@q/0xK 0姕'KKP 0%K`0p 0SP0 UZP=9K =P0 %KR0 <00@޸ 0X K0 H K/p 0S0S 0 0 0KP  0 0S 0#S|0@P0C|0 0 h-/(/ -LM$0S  0K #3 K 0-LPP@ 0.@P0P$00 p-@LM`0 @ PP  `$@0+0 0KKp 0-@PL ޓWUS0 -LlMsP0S@|KK0`gK @T  T@!  0`F0C 0000吢V  劓ppH 0#S) D 0S% @ 0(0= 0S (KppP0,00TP @  @@@p0 0 L0K w" p "  p ,0K! 00 00S0lKzK&KQPtd\\ 0@傲0 Ș<00(0RP 0%Kt0d 0CST0 P=9K =T0 0 0 R\0K0 0P0S 0`F@Zh-,-ݞ -L M0pS@  P;P0 000(0(0S P K,0S Q 0PPEUPH 00 0P PP 0 00 0%KP(0S,0SI0 %[`0V``0PP `%0[ S0S -p`LM P@P,0S T000(0KT000@ R   `FV 0KP 0[ ST(000(0T00"/ -L-80!R/P$0<1s0S/V10/-D:&Z -LBM30$1 0 1 30S3@TKCpmtP fcPBD#1S<!0R< 03/@ 3 cpPQP P@BUQ $10@SR&R哗@PR$$10S $10,S$10S$1 $!   103/P 10 1 $10S 1Sr !2R$10$1 $a $1X P$1 0 Sz0$1 $1GK $! \PBa$1< P$10 SP^0$1 $$10S $10,S $10 S$1`0S$1 $!   1 03/P 5$10$1 0  - 10 1 TpGoK HP01 03/0-<--F -D:&<-X7&m--cE=8~-0w- -Lp 0 dK ,- -Ld 0--`@-`0 @CT`@ pT00 P0S@X&X0X h& -LM,PK@e` I l1s0S p||0080 a Ɛ80Z0S   pW  ( (K-D:&,-Ȧ- -L MA p@' P KP AKX0/LA<)P :00R,RߦD:&& p-L M0@ @1`s0S P0S  1 H-@0 KF0[nS iKp0-D:&-b@- -LTMP dKT P H00S@0\A Kd@KPFA-D:& @@0-LT /Ag K--2 H0-|ALT 0S [ 0 Ϗf D:&- 0-LM<0/LAP(0P00 K0D:& @-@0S S S 0\ \ \R \ @0 R0 R -LMP@ ?0  堀?, ` ?p( @㸔@T*h Ki@1$ K QTVW@ Qs00 បx7&;D -LAMMB^KPE`0 4$ (T B  l2l h2 9\2 XR 0 E)4K 0E84  8F "*4[ R  0 S"P{@`pᨁ娑0SBK A$1*$[0S000 *4KRP&(DBKA@T  0T L@H1<1s0S { P0(U$!1 َU0$K4P*4[S S ($ S( 00<1s0S @| (4BK✐A0CY 0寎Y D? 0 B>K0C(4 --0-@--@---K HD:&W--D 0-LM,EKP GK▏P@P?K0 ,EKPP 寎 ᚎꪎ x0EK<  KyTPb唎EK m?ḑn~K D:&§ -LMT3@P `@s@;<0#8   3 KT@D*{KB00CS00 p00R0S0 `P1s0S2 Pp1 Ps0S 000 0[;%9PT2H2l1s0S  0Kꙃ0 PXS,1s0S  00 S 1s0S <1s0S l1s0S 0ㄑ0wx1<0 d1 0Kٍ RG<0P) g Z 11s0S V`F'z`p18<1s0S0 响 h(KS 0R   R5ZP$Kq V0QLLD>0--LK -@--D:&-D,-@---ЧW -LBMv,GK\PP4P1 HL,! 1 [@PS>`p0<1s0S z P00 & K y`pK+TPp0uGK7GK8Edn0--@--D:& --- -LBM ,GKhmPP4\1 Tߌ[X8!,1 (G@P=`p1<1s0S y P010 幌 1.K y`pK⾿TP|P妍壍GKGK8Ցn0--@--D:& --- 0-L0MPl@@Kx`h@0PP <<@0 @0 00<<0@ K< 8K0-ۦ- 0-L0MP@@@KS4C80P88@ K80 K0-ۦ -LAM,EK,PF AEK 0 001 *1 010 000 001s0S 1 011s0S1011l s001 012 02 2s0SKD:&0-@ۦ- 0-0@L (v K0hw-{t zt 0-@LQTqK0hC 0-@PLP0P 0 0-AMLM$ $P$K0A>K0CCⴌP}xAK$4!@⃐뮌PPt1LAl1T@͋ˋNjŋA>KP0C4!`uWx嶋崋尋+压@婋BK⃾U $[ 0R0R0S $  MT4x$$  T$$lt  10D0 S BoQ 0C)D:&c`d-&18@P- -LAMHP P lhl lBh@PHX^K,EKDP ,0< EK\-p-D:& 0-LMP }P @<0@S|<K0P55*\ \PPL"AK5< @⼏AK, @|\--Ũ 0-LP llDPP0XX啐P@HK0h<@ Lbl1s0S0 0K0hLT-pcǨD:&- p-MLMP P @0@S;Kp5P5p`\PP\T AKl!5r R@ @  @UA.K B,\-٨-cǨD:& -PL$Mp8 ʀ1Pd~@$4ؤ$KPP0 4P 4$8p0G$T pW W4 Q804 x P40h$h40d4ppXL@4 0$$$$Pj p g T Tx3 X!  ! REL SeS %FSJ 0S9SES7 0SaSR cSU PSX3@@P ,Pq  @P~ !nSp hS[ lS@ fS qpS. ZsSJ tS0t"0x"x"0a2 *P000 Up2 pxPE  \rPA PB 82@ 00;2 1 040 4<00S1/ P<0& Pr:!1@01 1 T T@ 00C5%0P 0@ 0   R C "0 l 0S0a00020K0h*r@- - 0-LM0Pl00K0p@ 0S 0[S p0 K S0 [B8o03/K0R PD:&7&--D -8AL1`S 0S 1PP 3AP0 PP P P  P P   tt塊l0 XX@00#0 00Q D:& -Q@-sX&-9& 00-1Ls0S 0P ?D:&- 400-0@L 塄 0K0h踄@--- p-LCM@GKGoK A媄P1[ S0@01s0S U01y0 W0Pn01K0GK AmKp K BRGK0 A00P y01K01-D:&h-@- 0?o2 0/D:& -AML M<0(2@K R$$ $  r (4 GPڶ0 (4a 9P 0SS WS BSd0 AK+A%P  Dg0S y,10SA>K0CZAK A1s0S `0S RAKHAK @   |PZ 0@^S0C\ \00 P0S 0 T| 0--D:&-@-- 0-PL@LP@0P P P @D:& 10-L'o -L@PP" p00CS#ꬁ ,     L `V TPPᄢP0 P00XKhh4 0S P0000 !0S0R 00 tL-`0 0CS`0pSX䃉X0X h& -`AL0P0C!S`0000CS1x L ԃ ԃ ԃ ԃ 0 "S 0S!:60 0P0 Pm0 `"0"S0L0Kh3,0 0P0 p-DxKd0@- R RQ \R ^R^@N  @0 Nr@T 0N~@T!0N~\!n0( ^00@ 00S@꘰ -L@tP1 lql =`P`PP1 00PE 0P 9 @V P 5@0S@0Si300@;PP?P PPP P  0!SPim-KdD:& -LM@P@AK\1  @AK @PP `pAK  @e9Pጲu00u0K 0T bP 0T@ 0000S AK AD)AK  @P00AK @RT:&D:&c-İ -L`@#PP 0 &9A(P@ -LM@`p@TKP 垁5 K8 R 1 x-(R( d奁0 P!P O<P K(P f@xt -yt - p-@LM(  @ 0, (@,000 0*@P ,Kp0,|0 !Kk(`!@[P@!@K(0EP 0S  p0T @ ꀊ -D:&- -Lr (, б- -L M@ 廂 嵂v_P v 0P3P xFtD Kd嗂 X}v 劂$K-xt yt  f@H 0-L0MP%PK01<1s0S A@K80@ K980 Jv D巀<F4D0 寀,0E R/ 夀 堀/P +1PP #v0(0S"=RЅ00ESD x X ` h p pąd…`\XT H嵅GD:&N-&ZKd`e-ͱHdqkv 0- LS Kh+-Kd --LM n0 R   K- --LM n㚃 --LM 0 R   K- -ARp`P@1LT pP`@D -LdM @ P=0Pl0 60P0 0 \K8pT0 l0 X0 0`@ dP `P@'Ktp hp pp `0SM W( Vp% d0 $0 d (cp u T9 @p@oop`0b0`0 'K ?'K`0ST`V xrT  8 T | ܒ  $ H t Д d Q 'KR0S;l90S'K  (KD 3  d 0C`0 qE0t @p0 d QQ h* 0Cd `0 @xd Q< 0Cd `0 @md 0CPh d `0 @dU@a d PE h  d 0CP@d `0 Sd 0C@Td `0 KU@Gh  @C d Q @0Cd `0 ;h  @7 d Q @h0 @PP-U @)80 "dK)P@ dK*0Sꈓ ԓ ē ̓ ܓ T0S00&S `dK0X|xtlT08s  lt0 D0t  l0P $tp00p0 ZdK0@l0X0 8T0 SV d tP0CS`0 00 Sd @Sd pPt0C Z`0 d XV в޲+-E_zѳ "2U{ -LtMKt 嬠`㩠h oV@@T "8PdK  0"   0X0 d2dT0 `2 0 P@0 A P 8 @PADp@ PT0S(l P hܢڢt0(KX` T `0S(hp0~0Px  hx0 Dpx0h @&K_ M<P,dKE<PXp J lp  ZPp0 SX` T dK@P$<0$8s00$4s00t0 0'<0'8s00'4s00\ w0 ᩂ lP$вl<&z8Ĵ -LMP1@ R` x.000 00wp`QP ,K }QP 8`p 0`ǂ 008 ?@PPd@VX0&0 0QP(` 5ɐhpf`R0 }?@l ,K=$ K0@0 S$K @. @ C<, K0匂$K0l<&մ"18&N p-LMK~P!0: S0D 0 SPK@` 000pKp 5}p P @TP0dsHS 8$  K  -->FW0 R R /00@-\0R@ SaPNU APNU @S AL^ T00  `0`P@P-L@@ a0S 000S 7F,.-. -L P8\ 0-L@)r0 000/- p-LM@P 0S`P,Kr,Ks,KqPKpPU P lj0P0-s 0-L@P K0h3 00SK0h 0- 0-L@PP000S0K0h - -L` P@P000 P 0S00 ƨ 0-L@yP 00SS000S0K0h -0 0S0 T.| - -@0LQS@\0S@p<`4P8 p|( pv0 S-8.М p-L4MBP0SI  |2P tb HK0S  HK00HKqqPk 8nP_ 2PV KPW P1PW "P1 $ 5 [1 3 [1 14 [ <0G?0<0 D0x00D0 02K0*0K-0K{H KRPKpP4 KPL1  P8 <1P. KP1  P) K P0  P( K P0  P# 0P0  0 0 0 0 |0 p0 d0 X0 L0 @0 40 HK -@.`./P.<.|. 0-LM K|P@P1[Q[S0 P e2xP0S00\@UP PP R28P0SP00K0ht@8.Jl." 0-ALMLPPP + P" PK P PKzK0P P PK P (P 0L00M0KhK`KXKPKHK@SP0ML0-  " -MLM0PEK@0H P00_P00XT8X4ԄS4tNKH4dP 4 0$S0$0$0$0$0$0|$0 t4 p4(8 >K0CPCP P4L Pt4P(4x0S 40S||4S4|dSdP 0S0`00 S P 0S0 `0tP 0S00P34HP<3 R  d s  0 P``4 0400P4 0400P4( 040$0PkPPe 24x_Ppa0pS (h o(h( " BP\a0S 1 (h Bu o(h( q z"P`Pppp0PSt _40S ,1 $K0|44, P 0S k -%Wx.X.(t.T.+gud`.ƨTrd.L.0.$D.\.h.p.H..\-/r.-.b*`!hC 4.h-V1- "Ĝ48.Kd -o" 0-`@L4S0P00SD0D x800S 0 040-.8.| $. 0 }-| 0  0u8.| - 0 m-| 0 f-| 00-0LS0 0|Wx00S\0\ X0tMT00S@4P 3@0S 0$0$.8.| -../ (0- L Kh'-| 00S/ 0 -8.| 00S3.0  0 8.| - 0 -| 0-|@L4 l 4 P 4 4 4  040-| 00@`/<& 0-LP`@ \  D  ,   T0-| P00-0LS 680DTK0h5K0h.- 0-L@ 04 00K0h- -L Bo 0 x-| -P/o"Lbp50 QP U@P U$Kk3p P`U PpGWUdp\p7/pP V@ P@T*U  $Kk!8Lczt  0 0A.0 00S/- p0-LP @ 0s  3P0<& -L MPЀ@0̠B>C`p/ 0@P0&iv0 T (K0  R ЁYX40 H0 =w40 q30@P-<&`00S T R $ <0/=C///-.  -LMЄPU(K00Q`C !SR04 S05:?0 02@0 Zo@U !SR' 04 R $ $ R R0 /0P 4 0 40@!0P000 00 @0 0 0Pa @@,$(4vyf0 KqlK000V 00`S KB> CSRD 4? ` 0g0 QP22s!SR'0$0PR*0 R    @ @   @@04 S@05I:@_0 KB>C1 qO   0! R!S / R  0 .v0T! B΂L`S`L K<1-0BS> U6,K!21PUP00!K|wP)0+KSR0,KSR  0 0 4 00*by0p0 P \2x 0L00Sc -.<&  .<&.D.-...$\.<00@-0S ($,ē04VFY00- -X@L0Sp 000$R C.@B`p`B 0$- -@L0S𫝸|0Q u0 0\0 p` -؀BYX 0 1(Pp 0 <&--\. -(L@XP10T0000P 00S4 $B>`CWV ?0"0ˆ ^0T0t` !QP }p 00B> CR0C>C0 P@0D-\. 0-LP0P0 0R AT 0 RAC@A000- 00-@LT04 MD0 QP4@ K0hu0)p0-\.0@-0S 0$R BCNP $`Pp ? ƒ "\AUT`N 0$@-P00  ?P/  /<& 0-LM0@PT 40 0M DK00T8 0MDB @C @004=@C @P@C404@@ 0I0 QP K0h0- 0-LM 004 K00-B>CB/- -PL`po@P!㔗 0 AC A0 400 At P 404J0$rd$Kkq-- -`LPU4 @ P@ Dt4 2tT 04 0  0塘Ꟙ0@Kh-- 0P/- -PPL`@ 00S E0S *Sn0S 0Sn0*S x0kR  dR   0C^S0SFP@sR  uR  @@-<&- B 00^2:!P* C\ 0-L @0@ R S0(9R0R*.R p/bR cR S :@0 B,, LR--% -@PL`' PPpQ 1PP@PlpQVTg/YP P0S<&=&= t0-L-dPP 0P 0S ~40!0%,(!(K0h3@PPPPPPP0 0 @ TPP ||PlwP LmP ƨR^--jqzl&- 0p/- p0S-x LQX  SLLhDS@#0$  ! dw-ۦ-p 0S 0S 0S 0S P////// 0- L0S@ P0PR00`3s0R 0 CP00 R R - L@P 4 p #-?&? r  )? ' ? ? , $? ?  &?* / ?! ?  ? &?* 81@-0@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P q!l?`lplPą`@@`ĕ`? @@- 0-P@LP QT5@2@TT@DQ`V B@T0t0S 8@-H2P: /<&06P: /<&(C& Q p0/- P0-L@$$g0PQ00 @0    !0s0KvP0! T0@T0  T03:T03:T03:t00 S,,A #c!0,!0St ,1 ,! ?   $C--0X;P: M/\&@Q&00PbAA0CPQ//D -L MR( P`@(pMT KzpWP 0T0 0WPP (KP TP00T0 0- -LM@`p( Pp0 E K- 0-h@LMP(8R 808K0 KK00 CS 8 0C8ڌ--P P / $Bn- p-L MP @P 0S ?P@Kpt6P KphT8 `P 0S  P|(0( 00@u=WJ -L@pP Pd 0R Q @<` Ru@h'P 0 S` p-L M@P`{ _0 00 BKp p-L M@`Py8 R8S#Kp K$K$0 80p S$08f+8 08 K$K$0 0S$08W+8 R-l. p-LM@8S00 Kp00S( K,K0K,0S, 80(SP 8`0$0 0$ 0C?URX B (00, 880C8(0 CS( ڙ K$K 0P-l. p-LMP@` 80(0 (0 00C?UR(00C 8HgKp K(KK 0P$K K 0 D$0S 0(0 (0 R-l. 0-LM@8 R KK0 +0(P 00R0 8808*80S K00CR80S KK0Sʡ*08-l. 0-p@LXU0C8 EPUP 80 08S0S 0-Q& - 0L80S - 0-H@L0S P X@ 8P 0 00-Q& -@L`P5p0 RȔ 00S\0\: $0 _00-Q& -LM@`Kp@& P@T   A@P K $0 ( (( ( 80 /-Q& 0(( ( 0 /-Q& -LMPĀ@p0S$K$KP  `(0S 0S 808808)P IP:P(8 (0-- p-P@L M`K@&P@ 00SKp wP-0P$/- -0LSP`@P P 9@A0 00P@@00 0-$@L$P0 $8 0- -LM@7@G0p`S(hP`. Q008(h 8" 0S0S < p(K0S08 Q00((hʤIP (p0 8#0 h 8xW080F?oP20S| $Q (6Qy PP P0} P P 048bP[ P48XP ]P P48 8tP P0 $48XP 4P48US.8P 0884 80 08S$8Q UD 048 D(<8R DP 4@Pe 048P: eP_ 48PpY<(KoO488080 SJ488SB0S S 8S<0S S9 ;904880S/ 48,4848 0p48!488S0S S8S0S S8S 0S S 484880 S80 S80082堢 R( B 0 ` U`XF   00 sP 00`$ 0bH80S IG80B Q( !؁ < 8 0  B@ SY0 R  S 0 4D0 =P@ D0 Z ( 8QS``V @K 0CwK  @"P >K 0C@`pcsQ&Q& 0-LM ,0Q0S- PP* 0q@T# KpplP0: SppkX XpP Hp@< ,p0 ẛK0Q&sQ&Q& 0-@L0 700000  0  |0  l0 \0  L0 @8800K0hP-Bn -P@0L@`@p|0@/00lu 0S pW DlV V KhaP-WDU -`@P(0LCLKhP- -Lp| @P0k  ' P0;0 $Kkx ) ` h/0pP     P $&V $Kk$  P- -LK,U Kh% -La@0PSP  SE SKh S S %SS #S, $S0 )/S 7S!Kh.0P S+S@ AP ێ0S0u0  #00 0Kh900S Kh00!S P  \00S LPHKhl00PU$EKh&P-- .ƨ -L'P P@x0QP  KhP0Q@ @0Qp`P@ p`.... -LP e>wUp`  0匀 @0SU V0 0090S U82 .\..00SS/P- -0LM K0!% K<]& -@L(0S 0(08PKh2'P 0S S S ,P P`,P?o2(0gP- 0-@L}0@, , ( 0P- 0-LP@@T08T -0L,M؎ePN~0>00?00'0 !0 S &/>0 S 'f,0S6B&"P  P >|P>0S P l>kP ܭ Re 80 SP "  `$bP 8 X0SeUU`ZeU@0S& SS SP S V VyB4),P  :$Z 0S:#a .$0/S 7S0 S0SH`KG0KHK Pr ]Po 0,K0!hPDP HU 0EcS p  h  t 8 \  |   X P $  \ L \   |   h T    h                                              00F.V SYdPT n0SP0@ _V0 0Sh V V00K Z" :0V :0V :0V p`!V V@0#0+V -VR00R0P @ 0 a0CS004K@K0!P 440@0 @0P 0Sa0@S @P@00Z,K!# 00@0S" aFQ0(r s$90V 90V 90V 0S!P,K!HP  0 /8PV" V V/ V07S <!V V: 0#0*V @V70S 07S ;\50S P!R ,50Sn !R   n(o}!R0 0!ı 0s!R00 !ı0<0!eR00d !ġ0<0<^P0UW!R0 0!ı3 sKfH&,K!x"A>30SD0S7NP @ 4 P+ 00!R0 0!ıH0430<0!R0 0!ıh P0000!R0 0!ıVPP000<'( P2p P@ 120S HD"D {|20SPP2 P 20S !8"0 0O1$/.Pl!R0 0!ı2P P P  !RT!010,K0!@O.P0J!R0 0!ıP !R 000,K0!6!R0 0!ıh.P+ Pl.0 QPf L0 hb\.P-.8.,...-!ƨ9- ...D ~OeWo-.-DU# .*P.@.<.2.,.l.. .!R0 0!ı4.P|!R0 0!ıP -0P PXP  000 0,000  $10S  !  0 `*{`1`0S p10S |10S P P 0 c1`0S 10S 10S P P K20S (%F42`V @2`V L2`V P P`.`0Px"$` %30 .P02 R2 բ/ ?!!\0 ı0L 3 pP03 R$3 բ/ ?!8#0000S 0 h{xx30S080J?00S/- 0-L@0 S0!0 -LMSP@`PPp0` 4@ 0X:W  0#1  W RpG Y@G @(K40 0K80 u0 40S  P R 4 BQ4  R Q R 4 Wp10 R0  0  0 < P< Ɖ4KZ80H C0 P 0 R:p@-PP HPV@^^)0S gSd0p00dS fST ^g\ 0\^  \A0 000   / -L Mp 0 ʆP@䠟&. QP0`PP40 ` 40S ``F0Q@0QU*0@S0S000S 00p0(KP= Q-LP KhY-? Q-LP KhH-_ 0 E- 0 ?- 0-LMd@P K4P`P  0S K $P K0- -LMP2@T @(K]PbჇX}P0`pb@PP 0@0 QPe bbW V W0S0 MR +R GR  SR 0SSZ SER SnR0SdS0Y CP,`KP&P00 0 0eS cSp0800 vS xS p0:pP  0 P0  0 .- 0-PLM@P 9P P@ QPK@!$fK0Ut 0-P@Lqq 0 $$ K0hR&  -LMP1p0@@T*$K R?#K0 pK P0EP 0S0S 0 @m$KR0KcKP[@00S^ 00K$KPV *.S\..-.....0 QP-L@P P^p 0 P P @0@`@S@PP60@@P<&H<& -LM@PP @Z 40000 0 0  '@P0@ j 20S2 (KowXP (Ko `p  r  T0 RK #K`p X, 0J x t0 0@(KL 00C S3ʪ 410SC`1`0 0`0@f#KR0Q 0 000 @0@#KQP@P 0 QP@P P0 0 vg...8.. -LM`p0 QP@P P x00S `0 +KV0 @PS(0 MK`a .. -LMKK  K -LP |Kh- ~*`p 0 P@QP  BKh@-QPKh48. -L@P`aP P p@P400S  Kh. -L`p0 QPl(u0 QP@P@Kh0 P0T0 KhOj. -LJ08000  0$  0  0\.0.p.L. -L108000  0$  0  0h.D.H.d. -L MPpx`x?oV2@@T P yV y 0 00 00y y@p(K- $1P-0L@`P S #P@@SP%paPPP @@R 00SP 0Si@P R x@@}P00SP -- 0-Lt@P 0S\00XP 0S<00  ;00-FP/ 804   $ ( , 0  R 4 /-. -LMQ`0pSp1pA0S 0  P1 V    (1 V0@00 000 00S< K3<KPP!P3 <0K [B0 0  CR00040  4  0 B4P `p`p0UQ 0 K..-<&<&+z P-L0常- P0-L@ P0奸00- -LM_X@]@$0S@@t@2 RXxP:0S t20S PP b,@DR@@  |@ 20PH^P ` gP T_X@t@ X10SnS$Sj10S SU0SR `X_P@t@ P $@ 0+v@P @ 40 BS@RPBpPE  H00Pᜀ @T0CR0S*QHPPE`  PPEU 0x` 0.--.<&l.U&- -0BpP0LP`p %> CP0 0 U1X(0QS 0`E0000P@0(ꘑQ 0 (Q30@08P 0L 0R <10?P 0@X 0S @00S0S 50(`R0S@0 Q0@ 8Pʈ?PlP Eb EV0(07@,010@00P(0 -0.--.l.- 0-,@L(0S%>0(000- -AL0P 0P0X0S %> CPw@d2T0S S@$K0K $K R0$KDp@`S0@@S@10S,0K@ 3X0 \0 LP @X0 <0@ (P 0 00000K040K080P *$Kp `!$  P 0 00000K040K080P T 00040 080ma kaDK?HXʈ00S  00040 080Ua Sa0Sp`75.\..0...]&..@-\^p`@UT `P~T@^"`p^AP@SR @T@\00<00S 0S$0 0S.<&<&]&.. L00- LR@4  0 P `0 0K0h.... 0-@LPT 0S D0@P `0,0 0 0 ... -L# Kh5. -Ld;98 0@  |`|Pp 0S0S 0T 0?00e (0 (00S\. .l.8... -L` Pμ@ȼ/0U0P ຼ/ 0-@@LP ,0   0 0  0 ^0]&. -AML M$R4 $?`4]V 0A 0pB>K 0CBK  @P i0S0000(K,4[!S BK A P,0K04S S S 4 0S 4$0 QP44 48 4 0S B>K 0CC.K8C0\  ? 44 4$  ^Q044 444RP S$R 0C44 44  0F0P0000\P044 44044 0]&c. -`Q`P`LCMVPp (KCEU`3#S csP 0S PEU TSVP`  ``ϻ0 `&Y /]pP)]U"0S000RRRKKP ,0K@1P S@ c9 Pp K?KQ 2U SqP 0000@ 0Q @ 0P @ Q @000 0Q @ 0Q @Q @ ,1[ S 0S 0S MP I ?Th0 0 000 KK9P Xl (0U p.0]&]h&\.l&bƨqcS 00-@LᦪP0៪P ᚪP pᕪP `ᐪP 7P7000000]&|W 0-L@P 'P P P,0K0h -LMT!0@ SN A0 +@P(KK 1p0`0:0 Kt#K0@P #K 0#K0 UTl00S K 06@00D0 媨D00 P0S 0 SS^@P@P.\..0@-P0PPP^0R @T  @.0]&0@-P0PPP^0R @T  L@.0]&0/.0/.00S /. -L6P 0 `./ -L MH@ K9p Pι0[S00KP[K`. -L^0\^1!0 Ӄ ^ @Q 1!0 [\A[^^ ^\00]Q00 Q]Q 0 \Q\ 1 !0 ]Q [Q`.FqQ 5 `p0]X V0\\`[V0 V0 nV@0 \VR 0 0`0\  $4. 4.J 0-P@ 0L RR\P L L D@D@ K0h> @@l&$4. 4.l p-L M|0QP`P @NP L0PD0`0 0$0 R Kpl+. 4.$4.L4. 0-M0LM00P/S $S- +S00- 0 0 9S%\SK A@P0 0 ۂ0IS8[@S0 K@00K00@00KS0 0AH$4. 4. -LM@$$ T(K0rS aS bS @tS {S000`V Fp` 0S0QU02p0W000 P00  S0 404 `0 (jPYH4.d.$4. 4. -`Le-KeM`? M B0 PPPPoV .0  pW>.0  W Q >.0  Q񟗼Ꜿ ` d $ < D 4 x   R @     P R @0e-K` B00`S U =0S @S#SPPz ;SP ke=K0C0@e=K0C0 P00 P XP < 0Se @,S_ 0S 00@9P  \<0S  00@AV<,0 1@` PQ @;Q }Q ;+0 bP} P @\P P;P+0 lQl PUr P@ ;+0 (\\\ \0\ APP000H Sp \KP >K- P R @H@:0S00(*(3p 9)0   R @  R @ P R @f0S p @0S< QUQ 1@ V8(0 ]2p0W 0 CPp8p(0 /P0p\PC_oSRPU (8((0 x9$=K 8AP7'0 8(*K, B (RpR   K8@6 p0( 0Ye-K B00S t'   e=K0Ce-K7 B0e=K0C0e-K B00P\ Q&e=K 0C0PEe=K0C00C Se=K0C0e-K B00e=K0Ce=K0C.KP6&0 \QA ZAe=K0C0Sm0S 08S .K 6P00e=K 0C0Ee=K0C ZK,PE0p 09S50;S c S GS 0x%p5 0qZZI) e=K$0C  e=K$0CP  0@^q Q4$0 LMP5 P\Z&Z  PE^ Q4$0 Qe=K0C1 CRZ"eK A W0"S YD4$0 4iS: IS7 gSZ+ 3#0 L%pS& wSY3,>K) QQ. S /l3l#0   ))0Sf 00@a909T90C9 ))0S 00@  Q2 0S"1p (  8U@S0  K8@Y8 H20S @;S PB0110p\SSP1!0 TJK,@DD P1!0 ꃞK @P pp1 0S 00@0K,A AVp ~1!0 pp0eK Vp X 0 0 D^@10SQ000 S9Q|0 P0S> @;S }S 808 0 =)09)4.e#.$4. 4.l&@]&< V.6 q ,4. D {  d.$9Wd.!íXP~&(S񟗔4 x x x x x x  x x x x x x x ` x x x x x x x x x x x x x x x x x p L x x t x x x x $ l \ x x x L x p 8,00lQ: 00 0p `8pp:0S;;0S (0S[0$ 匐 40SUP(0S$PU ` E ^P0(0 A E$ ȅ0< 8 0  00$  0  0 0 0 $0tz0 p:R<000sX 巔0P0 0S- 0 S0K0`̠0S,0`V: $ 00@ 9@0S dQ 0cx K,P<[S 0<00K K:P0P0s0 :0 0K0 勠00 ̐ Y0`V:B$a ^`0 00 00C0 OP P0 R:t%`0 彏`Y Pp @ZP 0S:  `8I 8 q0`00 R:`Ԁ00 0 ]00S `h70S (0S0$ | P-0(00 P(0S0$  Z (0S `$  H6pP0G$0$ 0 D W0$0<60S (0SV0$ 0 l%0eQ: 00# 0p `k0 ` R  R  Q 0 50Zw$000 P 00$00pW W <5pW(u 0F 0 0 00 H-p4W -KQP 0 0 40 QP9 pX`X0 0 <0P  ßK p``$L0pK$0 0` 000S 0$ 劎 ` P2 000P 00 l`3p0 -K0-K 0X` SR 0 XX0`0 Pd (0S0s "u)p0 v0$  D)$0P0 <)P 0S 00P(0S0s"L)p $ )$0P )P 8 R0h@DK p``0pK0`(0S$X T!p `RP0"0Vy*00000S0K!0  K S0 0@H  !   R0 eP0( 00 .J 4.3.3.04.4.H4.@4.44.b3.^&&"{84.}lht@J w N $4.T D4.3. Dƨ&4.3. 0$ ($1 0X`<K p``0pK0X0`L0 <0 0R0((Q 0{Q  4.ƨ3. -@`PLT0wS {S sS 0p (P 0 Hu0P@p (P PD -LpbG`qJ@oVP uP1 R @ P@@XPW&$KkLXPP0=S! !S0 <S :S/ 0S0S U00 000 0W 0S p>S @S 00 0  x-u0 0 00 00:nP 000BS)~P4.   -`0L@0PT P ᦚP# 0S   00C?o2S `0S000S000U0U@P4./ 0-LMP'@P  XtAKAu'p8tAK+A' P'K0D H0  BR Rp R- p/h&&D0 0CS0S - 0/h& 0-4AL30 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0K0h~5.0-01S \00P\ P0\ S0S Q0S Rr P0S0S0 s00Q qR  /5.0@-  \Ğ\ @ T\    %R    5./ -`AL0 5S <0S (04!0<P a q0U'0 ! R9  (P 0  ,P 0  4PP 圌Khڟ00\P P D ٱ04 0ӱP$S/ 5.&5.* 0-@L0`  {)T  +tbh lmP`PT 0 ᛊP000STJ @h&& X4.  p-PL M RPY@P0?S0S@P` Kfp Kp/㞾P@iP  0S S d@ꌛ0S00rk    -LE ]+( & 0-0L0@0TQ0 T00 E+0001S R0S|K0hTdl T@0$ XDK0h'+T0@  8K0h+5.X5.Z QQa &/h t }    -LD +(I & 0-LM@P K 0S 0@T 00K00"S p` -L M@H9P Kp UrK <0@-`Xpp#QU"RŒU<0v&PEQ @L^& p ##L @ "L / p ##L  "L / p ##L  "L / p ##L  "L / p ##L  "L / p ##L  "L / p ##L "L / p ##L "L /0S00//00// P0P 00-P@!LR@0 U0 ,U0010<.p.01//00/00/00/00/00/ 0  /y. 0  /y.00/c`00/("00/1"00/j00/:"00/I" 5005/.00/ 5005/. 0  /.c` 0  /.(" 0  /.1"/00/00/00/L"00/T"00/\"00/e"00/r"00/|"00/"00/"00/"00/"00/"00/"00/Q00/p00/ጳ00/00/00/"(0 0- L|1<.  0-@PL@|!)1S m0 嶌<. 0-L9<. -@`(PL0|AŌ ׉<. -L -L،Ҏ -L5 0-PL,p@ ᭎ G0 0-PLp@ ᜎ/0 -L Mᒎ K@%PcK ᅉ -L B "e ` -L50踍. 0-LM 0  K  -LA0.. -L .C $-5L4c . -L"  -LA0.. -L ~.' -L. $-5L4c . < -L |. < -L }. < -Lwz. -Lmz.  -Loc.  -LcYx.  -LcOF.  -LcE(. -L;y. -L1. -L '{.  -LA0蕋.. -L |. -L }. -L薊.  0a- L蘈. 0-@0L@0T<. 0-@0L@X0T<. -LM$0 K0 n0K5 K" -LM$0 K0 m0K5 K" -LM$0 K0 d0K5 K" -L0a Kh5" -LM$0 K0 f0K5 K" 0-@L@00 0-@L@/0 0-@L@/0 0-@L@/10 0-L@n10 0-L@/10 0-L@00 0-L@0 0-L@B0 0-L@90 0-L@50 0-0L,!P<. $0-0L,!@P<. 0-0L,!P<. 0-0L,!P<. -L2 -L2 -L2 -L2S -L~" -Lvc` -Ln" -L  0-L t. -L2 -L*R -L -Lr -L- -P@p1S0Ű!21( L "S` &0Lv10 $1Ux  Uu0a r wRb `V80S  3/1S$KkgL0%( r S0`p ᷆v$# -LMQ@0000 bPP%PPP` p0 40 嵄P 40 H  ĆX` 0S0p1 `0 1@ QHpS100C1ġA10P:1P;0C40 40pP00Q0S1 10 Qp(00 0@1S1S 0 圆! jb `F3(Ko輠Q010C?1 000 00S 0 0 00 # 0-(@LwP 0<. -hPL`)1S P3@ |A0 㤈 v<.J -L@` P  0Kh_## 0-L@Q9$ H T `      54c K0h  A*P t03S lh d d` `\00S  0^8 0..C.7.6.{.. 0-L@Q6d          54c K0h   AxבP X03S \ TP L L D04 0..~.'..." 0-L@Q:      $ 0 <  0$b K0h:    A剑P \03S  \X T TP PL00S  0蘈..}.|....{..Q Q Q$ /  z.}.|.Q   , 8 < <4 40 (  /x..z.}.|.Q Q Q/   F.}.|.Q    D D<0 0 0,00S  /(.y.{..QX h t  , $   /.y.}.|. -LN KhJވ -HLD@04S  4v 0v6..ވ -HLD@04S  v v..ވ -HLD@04S  u u게..ވ D-@LwP ,b0  .7.ƨ D-@L^P ,bh0  ..ƨ D-@LEP ,bO0 | ..ƨ00//00/00////00//00/00///00////00/00/00/00/00/00/00//00/00/00/ 0-@0L@0T<. 0-@0L@0T<.D 0S00/ -L {. -Ln/0踍. -L |. -L }. -L }. -L |. -L }}. -L s|. -L h{. -L/0踍. -XPL`)qW @0@ |A层0 q<.J -``LP)qW H0@ |A啂0 UF<.J -@LPP 0S `0P j/`1S0P 0P 0p Rr Q/` 0-@LP0^ P  0 0冓0000@-P`A\P%U<0p " R\<0e%@DA ^& -L Kh 0- @LK0hQ 0- @LK0hR -L&/# -@L`V`-]P`) CuvסP  ydtPKJ]@ >P` 0<("!0%S005.ܺ/^& -L4M@0 0P40 T; R0AT 4011!0 S01  R401=wP ,0S  R03/00S 03/0S!P 00PP <0 x0P80 <0 Rc`p:`80 ! 011S0`@R ` @0 < s@0Pp< U< P``P@0pU< PeUP<0S009 0CL R RڰDPCPE_ C B R@ R0 w8@ 1  p0(P R  8` p0C0CS0V`0Z `1Z80Zv80 0800 00 0 "P P V`x CȀ  S CU 8P PEPE_P0 OP v80 0 P@0o\뜠P uc1 0 . 婒 Q p7Y0X/@ B0sR ' ' ) ) ) ( !0 RxPf3p<P P P P PRP0!R0c !ġ1S 0C" !s0R11$PU>f婆p娆0 ŒP < 5ȅy.P` 0YppSpW` 1@\ p5r0 m  嘚P0S  400CPY$` SuI1Sa !0C B/!?1 P0EQQ0 E/R 0U0@0ж!s0xP00S11!:zP`PxP@a@1S/020* (P$JP P- 3000+P!P PL3P ?P 0CP >PP 3P 0P 1ovP P1Q[ P 叐1Sʰ1 {[ P 倐P =00`B0R0 2u 0SpW 0 03/p P ``M[ P  | `O|00H10Au0O40 R P B=00`40040 14 R40S 03/Pg| PP b| P(KqP uP APʬ0P0CU \000CPEqP rx  C|T0Z3X0P 0P N0CP5. ps#&# $Ժ/ܺ/K$h&l&R 001/5.P0 R0//5. -%@L M$pa00 PU!4 ;0P4 @(K40 噍40P0 P0QP#<V;P 00W0000 0 000岁<10, 00080040 0$0 0p(p1  @5.x$ P0-L0D0 R00A1 0P {< K0hM5. -L M−p0 W0 #~ p   嫘0(KP, R  R uP bo   1@@@``Q @ R R R RP ?o R 9o  P R R 9P &o #o   T @ FR R@@ 4 4 R*CP n 岀 V! Br R@2  @DnT5.VUUUl& @ -L,M@ oSQ0@ <0 p79@T`,Y 70Y0 0S @0v Є[}c@広8 幃0 徃00P@0@40 0pD0 @00H0 2 0DSpDU404pE40\U00ӧ?0pU0 CR pC4 0ER 0800 ^}咃W 20 8y}008 2 B堗2l P~ P7 + P[ P" PJ 0JSnt2000 h 0D0 0 EDH0 pH0P@D0 (| ||@P0D0 AP4 P1P1 0P1 X 0p00@0p00@X E@DpPE D0ST!D EpPE@r벎HT@D0 Y @ P  ᠇P@U@°H0S 00@  B08m0000<0S U@0 0 <0(Ko:<0Y S 5.DUl&`%h& -p@`PLp `PỂP0U  8`PP P {:`5. -LMP@p 0)pTp P@@K0 00~ 0 0`` @fPu 0~@P  r&5.c% p0-PL@\`0PPs Hp R :P 0S@@A@Rr&5. 0-@LW05.0T5.0d5. --@LM00 < K --L M00 < o K --LM  c K 0-@LK0hD -L KhD -pP@`LM0 0 w; 0`0 0K -LM Kƨ -LM Kp`@廁Wo0<00 M;00 0pS^ 0S[ 00SW>Ppp00pTpP80s@DO@080 V[<#` 6W`003/P4 00  h0S  R l 10!@t.<..D 0-LMM@K+@GK+@aqKAK+A@<AK+@VqK@R?PP AK@M?PP 0 d @@@@@ @@@@%PK0AKKA@ > h8 0-@LM (K⬆1@,@ #P @  qP |A0$*!P R)Qz%K000KR00S 3/P 0$003/0(K$)(Ka(K.@P2(KP.pP*lPP&(K @P" 0@ґ AdSʑ,K v,0S 0] X&P (K?P ޷'(K(t.<.Ժ/ܺ/ -@LM (K*0,@ @>>uZ#P)  @U  qPP00*!R00K$Q (K((Kg@P ,K ),0S 0^ d&P'(K(Kt.<. -pLM 0 0Z#V*0S p 0B0 0 SS@@@ŁP @ 0 S0 0p0@ᴁ0 S: ~P @` 0P00 Q %Si0S dSN %S%Q0@ 0S0 aRe cR0 K3/P (KiS sS 200 P 0 倐ಐ@Y, K @`  R R 10 R @ 0QR K0T K`\P0S  S 00@@Q|0 @$`R`R`V0R@ KЀTh ,0K0S  0! S 0@S$SS0`@V:Q 0 ]}l& 0-LM@KLPU K;! h u?00K0ll.P \V K#!L P u 5( 0$Y .*:E^^ -@QLPT<0<0`000S   0KhO .y.}l p-L M8A`PQoE uy|euyx uy^OyWuP){0 A;PPxx0>O:P YXXtt B͏Kpܺ/DhC&j -LMpPVK" `w2 0KV?KK8p@6 0(KaKVKF 00S  )P R  0S  똥P t눕P tfp@T Pa LbjaKVKx1B?a/Kx1 !fBP  >@P  >00%P P: P  t: e:0S a:P ]: <00P$4 0fu3 zK吃2,K"!0311`01   0K prKzK?K0/K rK  1 P60SVP,0K"!!03 KK  PW  XU j/K@2 0S l2P hZ}0S$P0 K T2 <"QS   1P s 1 l@Z0[NPU O3 /P,0K0XCKK^ x1K_K,1[SJ_KPE @ aKKK 00R0SQ s0S! 02 vP2s1g00PTw 0pꖐ$.{&ptbtf@y. .!ǐ{.ʐܐ.8 0-LM@KPU K ?sw=00K0PP K| )sd00S 3L 0HY|ꣂ 30 ,#y.h%6.^J& 0-0(ML@0 00@@@0 TwPP DD@0Q ,FK0hR {&&oy. -- LM0@ IK1 MXoKIK P 00$KIKLQC`P UZIKD`PZ .Pp@@@ @U Y p00X<LEc --PL8M 8K@  hwd`dd>pP$K @ i i `!i9.%i:.7.8i(6:. ,:.э -ML$M OXVU`oK. AGP >Q % +pK,Hf尞0堦S 7{V:, K4e0 w=C$ C< x a0 0x@>-K0 B0`0QkɒL;.q{ԒsW`Qg8;Li7.\>.ݖD_}* P 0R//ƨ -鿏L!MP@ `xP3S$2K p?K 0pK:00 0p@0p00IK0& K0P 0P/S/00 0 /S 0% K0H0a@?K0p0@ E $K -LBMp`xPAxPl@#d0RX@@ GK@0W<`G?K ((KƨԎ.}. . 0-L@ K0hꘈ. 0-LM K0!P @0@ N18 0/Q00 0  KЎ.z {. . 00-LMK@! 0 P t t0tP p0E@%10` /S0000H 104 /S@0@$ K0z Ў.{..Ѝ.. -L#M#=KM0CChnP#=K0Cw@P  r rK0K 8 Y8S@`0` `W@P L0 (0< r 00 m }.wЍ.|..y..Η. -LBMBX6S 0P \8lPXzT20S H81\6S 831424"GK; (GKr1`Pr 0G?K SP:4S / HE\PaV y0G?K ::4!SO *00 0 B/|,||?1PP) `0l "`XH0S 8!80!00S    46P\6S V o43jK 0 B5.v ^.;>7.7.(H :.:hal6.9.S;.R˜Θ0@-@T^$ 0RC# s@ T\ \@B0 PC_UQ @0#3000@010000@00000@ 00s0S 000\SQ P00Q 0 -LlMP`p 0S K0 KL03/P t0 @ Q (K1/P p0TK℀0K8/P 0 0TK3/* RP0//!01000/ 00#0// -L,MapPA@T t 8 pP800 K ` 4K>40S 0S00S(K -PML M`pp" *0JK$@D > X\5XX SS=S 0 \3R 0 (0  KTTÙ -LMPP0`0U%$pP +@Đ0 R U' p(K K0L03/P Kt0儡0 s0 K s  |K0S P |Kb |Kb@љp. -`L@n0P0S 0KhB}l -LM0`Q!p0 KL03/P< 0t@T 4/@K0p0 s K0s 0K0S K7b0 K2bT `K,b K(bKs0SC0K,U K BKp.hDP P00 S tS, R ,0S R : 8 80R:P#3/// -LM`p@,K ,P 9PP ,&P'tP,TP0, xP@$U@@,m&T (@K H/0 @sPKE 00-SL@P0 0000K0h -L|MPp` Z$0Px0 ).&x,&(K@ 0S0 !X T 0S0\ KL03/P L0`@$Px0t p0  Y@/0 0T1<00 @@@@0$p` x0hKh0 d@ `@ Xd0S $P 0d  !`00 0S0 !Z T 0S0\ KL0 3/P L0 p0, @0p0 t0 0t0 @؅  -LX P x0P 0@?oQ20S QPPTPQD !P 8040P/(/$//hnH 0-@@Q0DPL@AP0 hKP0 |& 0-PL@P  n `0000h -Ll p,|& -Lc p8|& -`LzMP@PN/u Tn0  p0S1 0S@$KmoKP+ a+P@1 11$11(11,1 1S, `K}P& d0K0`0K#@0@N?@@T0@u0S u0SAT K\P lDKsP `@L` u OKu0`<1K?}K @a 4 0 ,1 Pl (1[Si0)#0C?o27 #2RR  0" R6p7 'S$KA0'S $`K`pF'Q``V0$`K0A(\`K C Q 0R$0K 0 0B,104!1aK 00V9`p0! ,104!1`K0 0?9`0d!jWJ` u}K R K u01K0aK 0K00K KKp ` 0KhP 0[SvoKN/KaK0!.K0A.K{K0,104 !0 T0K0 08`0< \?.QNEFXƨ('Q`( -@ML`p@@ 0K !^pK Q!PP @@ 0K `^p#H<@P 7/P# 0-LMKK0KP[ K贌 0-LM KK0 P K` -LaMPb-K4M BQ@0C(xhP> 0b-K 0q`P3 qP3 Y KV4@TY K+4@^I K4@I K+4@^`pP@``V.6aVY K+4@^+I K4@^,P )0 Q'4PUNS0$P 00S 3/p0p$QKI K4@~b=K0CImK4`Fb=K0C0 S (K\QQ00H38qP !> ,! 8PP 00S 3/pp003/NoQU $P 00S 3/pp $QU ` 0 `` I-Kx4 B;9/ 0 ``Y-Kx`4 B;6/b=K0C0 #b=K0S R< a K4@0b=Ka K 4@]] K 4@ka=K,0C 0Cb-K0] K 4@`Pq匁U%IKa K 4A4@4+PG  `{P?jY K+4@]I K 4@+*b=KY K4@PVpP% pP pP pP pP pP Va K\ 4@]a K 4@]`b=K ,㈖P꬛<."[.7эk+uZDujwP;00 -LM@$q@P0 `sAPKP @> C 01/PP  @T003/003/$Qk -LNM,MJKWN K.p,@D@trI KQ4@9D7`0]W~4P0N-K( B0N-KIK, BW4J0N=K,0C0S60S-:K,0CtCN?I-K4 B$$6 0}10  A j "j ljp, $(> ,048/ A A<7$q1W(1)ql, $(> ,048 @$1%S1 0!- @R0)^',1#MK,A(pA dM6 0M K$1,@0 @0 4;$=6 5P p>؀C @p$100$10M=K,0C 0C0M=K,0C(0C  090pK,Hp3M=K,0C0Clsp3SLP $003/$q0'V00S `TWm/0X##    N3IK4LL30B#NKAⰓ0\>P S?X3?D0l3 L30 00  NK00000A0p  M=K,0C4C )W t3S0Ct3ms`B "i2@(K0A N? t3RV0`0 V  ӣ? @D2pW0W0S }1S 0}1$1S!> ,! (6$N=K,0C0N-K0, B0N nN=K(0CPpq000 pS$1M=K,0C, C'PlPE ;CSA 0$10! A048!K 0C0x.K; B89/P< 㑮K0 J  x0.K B;8K 0Ch&` VjP00P0)42YP0 U @&K Ar'`P 0Gd0S K!@#\0S K!@KKA@`0S K!@KKA@X0 KS @>K0C  H @ L0 7  4  1 0S # * 0, K9"0^K PE0EP# ES3R#   |%x%t}%0S dx%`v%\ )K_(KS  S S\D 3P` kPp00S,4[S2BK+ @f2) P90Spp9 0@ , RT0 S00#20 00#R00S P0  04nK `F 0x; 88/P009 0ST0a䁟aSQ S :Sđ p0ḑa9 ykP9P p!`LD!@|p d\A@TH@ 8,0 $ (p @9  _ R r0 T xp$Ԑ0pȐ0<.\y.;_TfF.TmƨϝÛʛ֛ޛ,Ӝ% -BMLM@pT9`TBK! @BK @"@P`TBK$ @BK @PBK$ @`BK @ P```8PP`(K@@88D8 @$ 4 (4@$80 DP@<@T@8 3BK  @BK @P BK  @3BK0 @뀣3BK0  x @<4 \#BK @<4 $0(48@Y03BK  @BK @P BK  @}84BK0 @ܢ2BK0   @<4 l"BK @<4 $0(48@Y @Dx2DAT h2h"hhv/#P L2 HH%PL<2<  ,20)Xp BK0" @BK  @CPw&BK! A$0 @0S "P 0S /p 08(04 0000xB.K; B8:/ P$P !CK$pP 0  c `1$/$0 0y`0pTW#p`!"[0 BTZl m۶9y.<.DLƨc\ 0-LM `2p \K!,^0P @40 PP@xp0 ;87/P  5PB\?.\A. ,00-L@"Q P0K0h\?. 0-(@L2S0 020\?. -L M0 PP@BN`P@   PP@ge%p@㬠U(K;EC  40 2P40 C2P R000 $RR00S@ p@B^El&"[ 0-@LM0$K.P Q P 0 VKh -p`LJMI=K$0CMppp Cyk2JKP$@DU\bjI K,@pPp_.PX N?I=K,0CX  hP I=K,0C0.,1 0 )0P T2X"T PT2X"TN_UT2S0 0T"XpPY J-K BJ=K01P 01A010000 tPPPP^J=K0C8P20S6 0S&X*$KQUPX 0 RUT2$!QQP0P 0 003/PT2X"S0 S(0S 0SXe(0S003/PT2X"SP. ̈ }& 0-SLP@` !a(0SQ 003/@QKh R 0 -L0MP`p@0SK0L K0L03/P $K`p@180/ -LM`p@0` @@P.Kx B;9/P$K`0 @@B.Kx@ B;4/P B>K.K0C Bzo 0@o/b 0 11/\E.10/g 0-@8P0 `L}b11110\E. -L MP@p`АР0 (R!  !00  P j00)S0 0  )S P0*SR0B `p@P X 00,0` 00000(K\E.8 0-P@ML -Ki1/KK00 0d0@00 0T0@@@81 0 0K0@0PKFK0 \E. -PL4Mp@` 0SpaP `Ppp R00V0#S (K0L0\ K3/PP`0\ KL03/P, %K  DQ 0S  a0 0P  P %K $L04@H0H08p0`S,00T00@0T0<0X080\040`000d0p -L0 `)R  <@Q@*QRpB   !DAHAP0 \Kh 4)Q     TLA^ @@\E.  p-ML M`\P  oKpP@  BK-zPPAK+ @?alPPAK+\ @VSPAK+ @OSPAK @P4@- D@0*SP@ )S 0   \E.   -`LMM@K c00@ K @p W K@pp! 08: >K 0C CP8:SPKW%K^P A`P 0 a0CS0S(Kp'KH @dPU8U2 RPQ RlK✠ a0@L:  K@pp %)=K0C>K 0C0P: s Y )=K0CK A +p0H: H:SL: $ >K0C~0t00 00S 0 P (/0PH: )=K0C )K+0A ,([R>KK0C A ( 0 R*,0K 09BUa0 (E'Ld@edAҫ(2 0-@LPpP K0h0 -LMh2 P!RT"pPT!R4"ITP!R TAT(K BX!X!Ro{`|c!P U T!PAkP!  X!V% !0B 0 0B0 KP 0S .R  _K$>p Xq@W"P}P 4q 0PX  0:R"P@gTfP !T@5g@ * Rd P!rl XATqP!@XA RP!0r,  Q\E.}& ZF.̼ @ ؼ -LMpPAK L1\10 <  "R \!0 S 051DH<LHQ@bD` bV P1<`1 bV P1L`1 bV`1 P1bVP1PH0H 8$Kkk(0(0\1\10 0\E.$Aƨ(7 -LM@KP @oK -LM| 0S pP \0 T0T 0PP0L0< 080<( Kh KF.8.}.Ѝ.W|.. 0-0L M(0 P0K000$ K(0K O"K@P$ %K0d X0-LQ@4P".$eK0hShC] --LM @K  R (=0@E7Kq 0-LMK0!.P L0L L@ D 0@8M@0  FKЎ. {.Ѝ.. -LM#=K M0CC\YP8  #=K0C@03cP -coK -LMM#KAYP K 00-LMK0!0S@K0h0h h@P T0TP P0P0H H0D@0P0( (0,x...z.}.ӟWЍ.|.. 0-LM K0!P <0< 040400 00  K}.՟z.Ѝ.|..0$ 0S/ /hF.0$ 0 S/ /hF.000 S$0 10 1/   hF.\E. 1-1L40@ Q !0 " !\E.0 10 1/\E. -LM_ -Ke/KK0l0d 0 6 0 P 0008!K  0 7@KK}& \E.H H0 (Q0/QQ Q 0\E.}& 0-$@L0S0000.ܟ 0-LMhd@ EK] EK7P@P@00 0`1,X/SK0\E.. -PL M@ 0P  K . --L M  K --L M0PP0 @P !<  bKh  --L M0PP0 @P <  BKh4E e  <-L(P "P 茠 0-L@`P@ B+o00 <0-L@kaP 0 P0 0km|.}.. <0-L@UaP 0 P0 0km.Ѝ. . Q-ppP`1`#WLxPx@ tP w vLv~7{7TTHNFN6oKh2oܺ/. 0-LM@P @cc 0 K0 & 0-LMEOKDGK2PGK [ RP0000U ($$0`2@+K0脖.Bn\E.8 -LMDN@A [\_ 1P 0`! .F?T<s>0 H ` p 0000`0PP0 `Pp4b`042T`2d GKX  K[KKGKK\E..^c  }&% -LMPP !0@b`rg`P  `P !`bPh 1K PE01O@04P(@T lM\nK\E.‘c}& -L< Kh= 0-LMK 0  K 0-LMK 0  K -LM0@0( $ (0KK K 0 K 0-P@@L0(S0Q _P0@}& -L 0P}.Ԏ. -L M@,K(p`P쐟,0K (K(P'0 PPP0P 00 @,0K dyPP+0[PpySa0+0K,0[00+0K,0K$K<v$y.ƨ^(.?.{.] -L,M@8 ^$P-Q`VPm $!Qp`V50S` ]ppGWY l1l!ll l ,K !0 K0 !  080V A/oQ" S  R ]4 0BPEP`B$P`0,K0!00K0!0 0  ~00V A/oQ" 8S # 2R `F <0 Z<0`Af]4@p$ P`(K舡l -Lp`ePP@T  a@P 7/$Kk11@ -L M$PAP`pP$K0$K0!(0K0 @` ( V0B?oR20XP$ fP --L M0 0 K: --L M0 0 K; |0-d#LR dd#*\0X&T0P"L0HD0@<0840\E.ҡ`.ڡ.d.j... P0-L@ [- 0K0hxl. -@LM KA A `0 1 0K!#! @@u/K{K\JmK<@P1: S uK*YP 0Y ,YKG_K,` yK`A A N`Pڬq  EV``?  |1|!||jxyK1Sg P1 0yK1 ATT OoBS=P@00S lo t`  R 0 00000 00jpP@ k}KA!}."Ѝ.|..H.z | F..H. -LEMR0@S0 ` p9 0p!KK~K0pS.KKP1 V! 000 01S 0SX>X2 0K/K@7|&Y+ V ! 00 0K/K3/P (KV 000 @K/K R h R K/KX L V     Ў.{.Ɨh.'DP.t\E. 0-LMPQ@0 S S 80 000XK0+S  z -LWM pp! r4Q I _#ß0(SgP3S0ȃ`1 @(Tj3  Q0PfcWtS@ A@ dPT}P @{8x0u@1 W W_KPKP,KQP P StPWppW TFph^ 0 10S 0S2 0 1S.a0h1 0l1 `1SN 2"ZuIej!0 _0!K 0t1 `!t1R R@ 10 1000PYR 0*S R@B  0 P )S  (SPR (K@ 1Ph!d0`  l!PE  0000000 w%W .h.~&\E.}&!MinأԺ/ܺ/Ў. -Pl`lpL@TUOU P  vP`8&D -PLMMJK,@DpXPPL DⱙP P6P U  QP(K D◙P D⏙P,P Y`P ,PZKPh ! \᪘YAK  @VPA=K00=SP  ] ᳟PU  P PP PP     PP HPx D&P#% 00-4 LP@]0 PK0h -LHM0@ RK`p0eKSeKP 0S0L KL03/P <0$K%K$K%KPT K\K3/P %KR0 0 %K1/ 0-@L PP]P  K0h 0-@L b (` K0h\  -P@L0S 0 R!L $KkH p`0P0hp00W20#00SY Q0p`0h Php` P 4pW000S 3/ Q0p`04 P4 -L M0tpP K(@&`嵹p ᒹp  (0K Ặ``V(0 t@(T  `TL(P <P @1!202?2K2}Dj2ƨCw25 -@LMMpA.K`@; B%pP  p\`\`K -@LP b\pP` P  0Q{ Po |d zd@ -@LMMA.Kp@; B`%pP 0 @VS`Vs\`K edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/ 0-@Lp PHT000/00/ 0-@Lq0S#0Q400080,08 S0040803/P,000403/,, H0 , 4 T 8 X !Q  0\ SR:00400SS QU Q408  040S80S001/S S S S0/000 ,00-S1SL@S00 800400803/P,000403/,, H0 , 4 T 8 X 00CS$ 1 0408 080 -L M14pP37W00@`㨡威00 Q 1SQ " X(K  0SQ&W 44SSSQ R S,0S p0  ##00 0000S `S00S H P00P0 S 0 F`03/PP0 LRR00<R0S 01Bp X (   5 << 000/ -LW;@ x   PQ0 [P3003 0uT0 #3003 0fT0|300!Ђd3 0VT0 0DS(0p`@ ~0 x#SH0pP0`@SH0pP0`@SH0\000 SH0`000 |S#H0d0S dP`@E0 $PKtK4"T%a7 P0 -#`R R=0 "#H0L0 #H0L0 #H0L0  #H0L0 x#H0L0 `"H0L0  H"H0L0@ 0"H0L0 " !SH0000( 0PpG0 tK d 9/000( 00P.}~  5 << ƨek.p.tp X   P ťʥ( -LM pQ0@PE00(   R R"IoK`d 09/0 00(0 0``0 0pp07/h0 3/$K 0-LMEOK0P0 3/P 0 000@@ 003/K0 -L(M`H0PK O@0 0P0P@ 00 RS THP pW TP00H P00P0K @T@0/W/00H  nOl&Q p-L$M(@K`D0T YP 0 00@@PbVcH0DdKp舥 -L(M"@PA a `P0` S!U"pp !U ` 0 `SS QP `00 000 0 0pppp0" KPPB$K ӥ,ޥ -LCMP0@( p!  P U   !CoK0#0 !AK0#U|K|PK <VP N00 P LP @0(D00?1@S8 0 `@?@.A!0 00KA$0PKp! 00,0`KH! 00xBp( RP!3 AᨐR K0-A Y- - $b(, P# 㨐 P L-㨠@0K| @ p`I=\(K!0P RPQ ƨ.(P.P.MhC -LCM|5PK0@$9P"0Kp0 `P Q 5lK0 2040 ]? 04A00 00lK@ @#40S8J0P1  &0P1  0H03/4 KRp0 p0C `poK/K`P R0CK 0Sx~P v0pp10(1oP 4!2 B B%"9 40 R B9")U %U P8pP>04 `R 1p#0p0wp6q `0(K2Q 0 0$܏KR 000I0Sp0pC 0Є$X 0ހR  00" 0/K|0 Kq0L03/ 0K℀0K8/PJ K 0!/K!/K )KR 0 K0 3/P3 -K)K0 0K3/pp( 8 K0L03/1K6( K)K0p4PCK/K DP0 2!"/K0`00 P$0@80#A#E#A'E(0(00<010O01 K<.  4@-\80S001\80S  0D SR(SS AT S!!0 0 0-SL@P0\03/0   000!0C?o2PP. p0!HP! 0 p>`P !@pP B"8000l0000X0 01`0100$Kkv! B/"B "810C o -LOMP@` GK(S1$A 81 !c 1 02p0 81S(K 81 ST08!0C00 0Z0 R 0C$ 0<1 <P5 şZ@P TşT0@0C0p0NC21 81 S 0$ 0R}̤81 S 00H03/0   MK0 3/P`KKCK A AK  0 0 803/0 P`p K*LdKCK 0 03`0370000```D<14XB`8!0 R0 0)0CK4M/K3/088q4 0{C/K0L03/C?K $A?K 00,00T00X0&`C/KM?K6/P %KAK` R0 0!x" 8!  R p0 B7 !2 B"y71a0C100C0 KK8q pWpxpW M/K003/P4~ 1 #*04pV6`P0q `AK!`p p 00Ca:7 !2 B"0710C1010 0S0100C0!W `08 L0C/K3/`P o|č.@  | -PppL@w!dP0 `0 S p6p &RJpP !@  B"60\ 000 !p (p! a  0 -LSM@R0 $88S 0 0($0C"0C!0CR0C0CSoK 0 QP T@p0 0 @@@@@ p@@(0 PPV(K0K5', 0 2r  P @w 0-0<0LS@H0`4 PqNV09hN/0V090V00:!Kh00*8v -L(M40PSB S  C0SR>'@P; p`쐟쀟`Vp07410`l00 00 000 0 00 0 0Kv`P PH8 R-$K  0 -LCM@P 00CU#*0L0 K3/PP /K oKC?K0ܠ1 0X*0 KL03/Pi /Kf cKAKE?K R0A?KC?K P000 S V0E/K00V 00S@ Q0@ oLpCK `0hL@0  1 2 1`0 PKPAK 0QLpEK0 `JLK@H P@`|K|0K K%(Kp..y -LK 0C ! 0!0$ R 0  0 3/ 0ps@` r S$ 0'4' K @J=K0CW4 4a@0s0t4 0'09cd ,KY=K,@K 0C4$4P4 <704   P`U Q PW@ RK.K B@SK.K BUTp" B>K 0C0@0 MKP6@ D $ O.K BP , K-B 5 $ 5OK A 0@IJK& @T  0S  MK4 @0 0=K0C040F0 4S KJKA @JP@ 4[S[$`Q00Q0S 0ENK @DL0 aA 3/P `M>K 0CKK LL 1/KK A@AUT ?p4$5#0I 0H1!)MK @ 404 N>KMK0C A P0N>K0CM>K 0C  P0R05%MK0@@K 0C4 =K0C4 2K.K0 B4 D s@KBK+A @7BK+ @7 5` S*U 0 MKT B>K 0C0 0MK0 MK44 $Q030#Q0S A4 MK A  K@,p K>K 0CCMKN>K0C A 0 0@P3/K K0@ A@M>K 0C0P0T%@MK A R0(N>K0CM>K 0C R0MKN>K0C A MKO>K 0C A 97M>K 0C(K 0MK A p.Ԧ٦ަ.׺# -@!Lb0 !P 0 0 X0" -LMaA|K-K1/ MK@TP5`VX@ 0zG @P0tG @TPYXOK  0 hG X0 K˱-KKR0-K/K-K tK% 0` r S 0$k0$K0K0 t0K0 4M00 w KV @`T Nn KM@Oh KGTPL 0 TK@4 00 0K   K@ ! 0 /K #T/ 0S, 0 K⿆0 01@K0F0@ 0P [HPT(K/K-K~DK0 (K☆00 0S 0[S[ `Q00Q0S 0\ KL0aA 3/Pe %KR 0P K+KKYKȌp@0 X+K0KKQ0 03/kKWV S@-K@P2`0 .KK.KR0P0.KK0T0NK nK 0`RpVnK`pT@P.KR0K80 0@P3/ 0@KK K1+KQP-KR0剿@? K-KR0 AK? @0 7#@P 07F6!f0pC@_A?K *F1 B1!P T0 0  T0 -p.׺Ԧ٦. -LDM0@L K0L03/PLK" ! $KRP0`p 00!R R0`pbKШ p-@LMM MA.K`@; BxPPNK @JNK  @dBN.K B @oKp{dЀ 0-@PL DVGP 8QGP (LGo000 0- @L8MPK,0%$Kp`@@0< KDKB3PK<K'GPVJ0@0 0H0 0 K00"0DK(3PL@o -ML MX1X PP HQ0`P *1SG$A T )1S  K Q 0 1/P@PE>K0CC 0S$0E.KL0 B3/P @4pW<nP 0pB.Kxp B;7/P BKX@tP<.8q. -L 0Pƨy. -LM0 /PR KP/R0 R/R  z0^@q. 0-@LK0h 0-@L K0h: -LMpzPPKIP@P  )9`0S  e9U $  н$ KT PL P  0IPKy. ."& 0-L@ 0K0h) 0-L@P0K0h -LM@ K@~ EK@E?K/K K7 0-LMP@k K@e EK@KSpTPE?K/KK0@ 0-@LJK0h -L MpPRD`@P P  CA0! 4}PP m K0$D L8q. 0-D@L4S0PU0$ `PP0PT08q.c -pxPLDT`` yEPp@0 0=`P$0R04(8q.s -\@L4pS`Kh4P 4 0H@ D@ T8q. -@L4S0tp4TU TU T`040 0 48q.s 0-L@P0 K0hD 0-L@P@ o0腧   -Lo -Lo -Lo 0/8q. 0-@ML 0K@@t0P0K @@L0H;P08@4|;P 00K0hsLu.Ƨ -L Kh( -LMA0J?PU:`$qW0 P K`> C  01/P $P0Ό LP0L0$0 R 0S P P 0$003/0$Q<.$ 0-LpQ4B #"T R0/ p-L M(@T@Kp(0`弻0 0l003/@P/ -LtM`P@@) 5 KK׆PPP /KH-5/K8- %jc^ͨy.ۨD -LCMIOK`P D뼀p0$KA!(1 (1S1 1 K xp pPX \\X$1[S  @ 1( 1~../.$If.= 0-P@L!1 1  0脖. 0-L P vT<. 1-L@`hP@d0 Kh]ꇩ 0-P@1L⋳1(1 P1 1 0蓩I -0LM00 +0,0 0`$0 0Pp 0 @P 0K@T 1\ 1T1H 1 [P1 1 KkmE./ 0-LP@lDP $B1P1   0é+I -@LWM EKDT%@rTb1 TD Tj3h20$0@T@P"PP4"E?KnKPb ! @0 VP1J㾸P*P KP P !080i!0P p!KP`1P?U0  DPQ?X>1L0DPB0!KsPd%P PK?000PN aXN 0 0 0F& 000 EK ᨵ@ჲxu.&.~...t.ܩҩy.p+;-Ժ/ܺ/S > S -LM`$@P qQ-@T  ` pzP( 0 (K P (0 I3(@ _;P0o KX\\ȏ T2p04 (Kꐪy.Sc%jIh//C-M C` 0`pa^Ѝ@T@T, R* @p`@PЀV ЁXЀT ЁX@@UT@P@` @T@D @B`p@PB 00!/ᔘ. -L0  V00 >F6!TP0@PT0!0 VP0 0K%K$KT000P `R0#02SP(KT0庛KPKTY##KKP00 P0@0P0 #K 0@PV0K0 =F6!TP0@P^K 0SH ĀXE   0R$K0!QPX50T0$KT0X $KKR0@PV0K 0=F6!TP0@$KPT0 0#K0T0 P0KR#K2 0-L0MP!! 0$KP P $PKK0@/ 0-@L ؿK0hq -PL@/dP `@ H9PP`Q +a0AR20S0a.C" QQ 0S  -HL 0R-HL #9 -@H`HPLp1ST00ԗ@!T 0u. 0-0LSu.u. 0-L@ ^T00PUPU% \"ST _p2 `@UT@P@B0`pb 00C 00 ꁫ ,0-@PL@000P ;0 -LMPẋX0p` @ ࠁ@%АYĐY ^ U:0 XW0a0s Vb b b b  9@T 04 4  $KT 0  ͫҫ,' 0-@PL$0$ $$JK0h׫- -dPL0@SP0 > ipV   R@C蜘. -LMPX0@S`pg0 oJ\0S0 h `0S|0l i d0Sh0T j h0ST0< k  U &0K<3Ld -LDM\K&K`PP(K@P >TX0th0 &5#P0\ 0;`P(h1#P0 0;H0L d0P0` \0h0x0X0 &K! `$P`PY0 (04H000 0䀄0 00;X -LCKBM M A @P 0pn B.Kp; B! pP0 tPX(K P 0 0KA 7C>K 0C !=K0C "! 0X00p; S/ P㲽Pe +RQ0 RP \Q SP00S RD S ? S S( R0000000 0C>K0B>K 0C0C00P 0S  v?:#<4 74$<4Q0 ! "CK L R0 0C>K 0C R0"piedA 0-L0MP@0S>C"R0K0 0R* 0! 0!$K ]P 0+R0#*S Q 0Sꜘ. 00- LRP@p0 C!Us00!S @0<00R0( U40 0u... 0-LP@P0000 -LM1P0pS`8@ 0QSPPT SM r#K0TȐ0 #K  ^0 0"400(Q $F;,0QX3  T vQ 60  0S P S h0h dVH0KSY 0 0S3(K 0WP!:@ u.@ -lL0PS`/p@;S S?* +@" Q pBPT-@T%RQ0000!(Q $: Q 0S T vI6 0@1 00 0TRT Y ɲp0T"1ꜘ.y -LdM $K &K 0 h0 0`!$K! 0P <K@!PXp(K#K%K 0%KK%KP0!V V eK> C$K R0$K`pH9@0D b2!%Kp V0KPcK`pcKK&KR0K&K$KcK$KV0eK$K%K 0KdKRKRKa0Shp`;S`! SJ* +`" QBpPV9`V1RQT00D0 0Z(Q $ :Y ' 0S$ F v5Kh0`1 00 0"R 0KR 0"aVRV XW S0F"1.y 0-@TL0PS T T 0(0!@D0T055403$0(2#0u... <00-0LS@tDP0ЕK0hu. -LM@p0PS] T T 0 P `SW 4T($K0P 4p0P00  0<@p0X   pH| `0@8 0'p(0,0`(u...q P1-0LSPp@ ` 0QPP: S30 \< r0 0 !Rv?000#QV ( 0^X3$ ,0000 QP0 00 0WP!:` u.P -L M@ K➈00S T K9r -ML M0@X4 X0S2"E\0S2" `0S2"b d0S2" h0S2" EKJH 34T4[S ჼ808`S X4hŸ C0XBQSR80S <0 K SRPPHP BK @ BK @`P1 B.K B \0d 0`0.0h X p;S"|X4h!0B>K 0C\㩹PBK @_oSR(K0:R 00  `4 \$ \$a  `4  00C 00 ;0CSxxշPp^3Ldl&S'Kbs~{b -LM#K0p@T(KP`ȐȠ@D0S UK0 0  01/X S  `  R 0 0`0Q#K 0P1/P Rꤘ.X -LPp@`0SP8p0 S7/P 0403/0S0D03/0S0403/ -L^G@P`p1S 3/P @`VTt0@/d0P0SP000S@000S00000$Kkx..X  -@<`ЀX000 dK40 4l00403/ 0P l<!0` R 0  0|K3/P: 'K&K'K%K0 006`00p00`00 Ӧp`lK⨣,0[S l K0dK03/pRll0 0S001$K&<.p.l~ | -L M0@80 q  K003/P-0A0@0K -LGM@P, 0@0003/`P$0I_KS$aK ,p0 pPP0|$1[S 0JK0@03/P(`` K -L|M@pD hK40@00 0$``l@ 4 PP3 P p,0h$ 0 S *PP 0X*0d KL03/16 010100 000 p@&\0lKS,0[S l4 0Q*0d K@p0K4/Pp+[P l3l0 0S001 K&̌ `&l~ | -LlM@00t 3/0H03/2`0p>ЀX0Zt 0! 0 ` 0lK3/P^ HKa3&K%K&K%K 0L0 0 40R! L 3/0H \K0 3/pB 0\ KL03/PP; 0 R8  %K1/1H&KP%K0< 80@3/H 0 0\K3/p P00p0 t0U 00㓥.\K 0!%K` lK p03/P P(KP<. -LM5P0S J?0S\U 0Sd5d%dd<`VO T%@T xKF`g?44u@``p 05`050@@0x qp`p嬧0 娧 奧 墧` 㠔pK $0㜀K`!0`,0 00 000e0 p4 0$10w0 $10q| 0KK@ lKx0 z200S< l0K PÁ ,|3 000000 000 0 0lK0@嗤p` ,3xK,0lޤp0S= S@: SN@`$ KK3/P 0l0 06K2 `0 \0K0l KL03/P &K0 \0X0S 00CS@` 0ST D^C@P02Q $~(K@P00S^ 3/@@OoBS =0&00401,K0@!R!@!0d0 `0 @P) h h0S`0X*@P* PQ 0!:@d  0T:d0S@ @h@OoB@`0dT:@@<.Qt. w.Rx ƨ08hC,~ <~ .L~ s ~ y.> -LWMT! S8! T$ PTL @`P! .0P@1  (pP@}`(K0PH1 lq@oHa3D!0L1S 0RA T1S7(1SK0L ,H!Ġ,LP>#0C4 H#M_K; $C   0PKK≩KK PU @!@1R"2 H1@ 0S 3/PD10D1 X1D!0STP0$0c81 v h2Rԥ~ XQ @D XPN ȥ[ť,H!!LM_K0# `,a (Q 履K/K` ,P ,D ,D10 00L1 [ P^ ,   D! S ,D!J,L1P1:1!:yP0 000000 0000 0@Ģp NK❟81S`#H!5Aa7ZUX @Hy }@aj..ƨnۮ\~ mQ -P/0LKMMKKp@ I0ITKʺ`P+(P 0S p0|"x!l/eSP TP  I+o( P:]0?00@T* P/R 00{PM0@᥻jPI0P.$* R"X<0>00B~K pG!4 mP,0K44@,4[/Sp0 *+,( RCP]K PEBK+ @( P*EP 0/SP,4[_oPRS +pBK @+0%00 PU+x P*BK+ A P*=P/@8/@X3(K^ -LMK@]P  @P K P  88S 00p RK  -LM8 `4CpPP X`P㰐&HP)9(K0S @ x'P08  0KjpLu0P XP@00  O0A< -LM$ `PKAP'KAPK+@V'KK A@@PP.K0 BP.K B]Kx@ȺKK A@⼺PPKL@K+@+'K,@.K0 BK@K+@'K@w.K0 BK@m ڬ@PK@c Ь@P{K+@&KP@R.K0 B 彬@PxhK+@&K@? K@"`K@5 ᢬@P]MK+@&K@$pᤁ夑1BK0>K0C @⮽BK@P B.K0 B(~@ TU <6$KKK A@ PP9K@K+@&KK A@@P K@.K0 BtQPK+@u&.K BDP _>K0Cd h<P1 ",8 am&BK U/00/00/00/ p-L4MA?(0X) 0)@`K` T0T0H` D0 065H K@P & Kpp.׺.$x. -LM1@1c20 00 !0)K 000k 80sT0`P)K (K0?0 KpUK\5X5 08)L%H500<%\K˼00 0U0 5 "[005l`K00 00\pK`p0 /U xKᩱ4x 0SY @R%SSQdPS00 P,KPP! d|0S K0803/PP (K0800Sp05)80s $(K` 0X:8P0\ KL03/P %KKQP TP\E_oRl(K0U<3|s0 x P %0C?o20 00K0H03/U`pKQP 1#0V0  (6! 000000[S 0 )K R0 0pP^00000 0P 000 0S00 )Ka R0 0!0S p0 e1K0t0 1pP 0,!<1tK(0)P6 R0 00 0S' 0)P"`p S$ Sp0 08 r  QP P 0!p0 r'0000KX0\X0v t0 )P`0 `  #"000sK0Wp.DUƨb.^l&<. -LMQPx0Sup@0 0K0 P K ` K" '"KR0 `T0 S!V0`vp`h"&|KB``,0SHՠT`K0<"(5` "ˠ`"&|K+0K01 0'!00' OTpK0!(p `0@00+0@080s=0 0 t | KV X(KpW pP``p  儠0!T`K( 0 h0ovT`K 0 40 0t0S 8q 3/ 0S00 00P0 hpVT`K0T (ᵺ` HL K+` p.M"ieszb(px p-@LM`(㕠P0pQ-6 *'`+$0 PlK℺@ q)l Kj,0 0F00Kn-0 0KeKp #"0P8 r@0T*U +P lKT#abhC.(tx. -L4M@  "(*(0 p`\Q\1T1  200400<1041@P 0,1,00000 1800b"`Vp 0S0p\) 0!,P(EA(E@ K'0p `BP00T KL03/P D0$K`p0`Vp0Ȯ  X  -L MP`pp 0W,X\p "!0 pPT 0 p@00 ]*Q R  " 00 8, 4 $0T0 0X01@G$,0S,S P Q #K'#KP8qT0 PS840 0S 0SP00P0X 00 (Kp -LMl2x`K0@$xPpPP0$" Sz22plK0p 040 ]? 01pA00 00ppplK@ @g40SV(PO p(01呙!0PD 4 0P  b "0 g4  B` ) )p 8p0 =Ph lp0 04040?o21000(K 0~lᵾᲾl<.   -L4M@᠑堡0@pKS0 00 00.p 㮟@0[S(K/S  ?K/0@0K`p0PU/(eP p`f!^P 0% (! () $)0`40 0%,0 8`N0100  H0 j&PH0 ,PKp%0 P`t.Kz -P`LlM&K4 (Ё&KX0P&K R 0"&K 0'K! 'KR0'K P0 0"pP8(K*.!U0(QP0pQ ",^T ^ 0h8 0@PPl0 0 h0 |0 pW(0S@b@pp0  ,4PP80 TQ 0X 803/P0 0, 0( 0R T RR0  0 ,0S0p,0vP 00p,0S 0R @S  %P|@   %P R0h00h0 l00l0 T0S0T0T0S0X0@( 0S0\ KL03/P H00S @0SS0p0\ K0(L0\ K3/P L0H00S K&KP0 %K'KR 00\ Kr@ 0RH03/p@|0pKW80s !؁P'KP0'K 0!0(  BR)0 S0!R'K0!Ԁ'KR 0h0W&KK R0(K&KX܈K c#'K p0h d` !" Ђ" R 0|0W 0 hWph 0PpXKWp0 ?U00S KԇKppPP (K&K &#ԈK`0d 2#(KP 0KXK|0U%&K R0'K&Kစၕ᠚K #ԇK`0d 1# 0R  0P0 'K R0'KP!R'K04 (KK$'KR0 0' 'K 0KP0 0h SVl SkgKKp0PP PK0000000000 0 P0ph080s   'K =lWNpl呠!G|0h UU 8 r   0ԇKXKP8fK`V'KpKP&Ki"'K p0h d` !" 'K h0W|0W08 r 0 P 0č.<.h. -PLMp -KPU p<Pp@E040P0 T=F(K00#h R 0  80s0PEPW p ;h0S 00  80s`V p@p )h0l`0\ K0L03/%K `h00V:p@pp0Y:P@TPJ C 0 1/@P0$A Q 0 > 1/P@P` 0U:@1S<1@1 @0> C @6PU` , v!p0#K&p&0Kpp&0K0V$p%pܖ0ؖ0K 00K00K   00pȖ0Ė0K 00K0p0K  0&|'0峖0 寖 0K K@ lK0 !V0l0 0 6KP5l0K`0 \0K @%` 0 (%P  (P  %,  4lK 000000 000 000Γp` 4K,0ᣐ`V2 0FSL(> *KP A*K 00S KK3/VRjKԊK0<!YX803/ 0lKY 0lKd@`0hQJPp3V`@PHP0l KL03/P \0X0S 0S`PV003/PQ  01/ 0S 2"+V*KjK  0lKlK`PPlKlKX Hp0  Dd0 h^60^< lKkPPn3`, R0 7P0 Pp@H0l 0H00 KL083/P 0l 0d0 0@ K084/d00DH pDP 0,QQTQdT V``XQ 0p p@l0 KL083/P 0l0d0 0P K085/d00P  P h00d00`00\0 0nP} 0lKd0 `0 <.t.ƨp408hCȭ . ԭ s ӰR .-LH    --L;  0 ,$! (! ,!P 0! 0-@P`L4M#ߍ@0S $T K0dL03/P #dK 0 `#8PXV` K R00S 0 // -L MpW`@ 8 0呣# 4 P002  r pP0S(KQ*  R' 0 8(0S Q000 0 02 80P 0 哢# 4 00000S p  pH$$0!0R!/S01/ty.!0 /ty. $10-SL@ x1SP $003/K0hx1P$1 0S -@0pPLiK,`FGMM{FD7J0S  0{CGK L@0S Gd0`h0Sڨ GK⚬@l0Sڀ GK␬@tp0S@ GK↬@PPt0`7=A>?ABMWCEEFG -LMPW`@ GKhV(|  < d 0D`qK1K @0S GKr GKn8`V@ܑG?K Pԑ 0K(0St GK,@,0SL GK"@<00S, GK@273E5W6 -LM0P@1KQ*  , @ T h | 呑 GK GKq0`N 0S (0S GK GK,`VG/K0qKm GK GKp0`N 0S (0S GK GK,`VPM$0 HPD 0Pt?0P:0PP50P@00P0+ 0D [    -@ PqMLM0G P 000x R0 00'P0pHH,vK,sK8`  0@0S D` P, ` &Pp%Kk%KfpW00(0S rK% @3rKbK% A @S00,0S rKp% @#rKbKL% A @C0000S rK4% @rKbK % A @30/K 0b.K0 BޙP( tx`!R00,6K<0rKSn0y0$ @rKbK A @ 0rK00=,0\$Sn0y0 @תrKbK A @0($00;8rKQ40 @$êrKbK A @0rK00=<0#Sn0y0 @ⰪrKbK A @;0 0 R rK|# @❪rKbK A @ m`0 R rK8# @⋪rKbK A @x0 (#0= 0S rK" @xrKbK A @x`000=$0SrK" @drKbK A @0``m(0S rK`" @RrKbK A @rx0 (#0=00S rK" @?rKbK A @_x`000=40SrK! @+rKbK A @K0``m80S rK! @rKbK A @9x0 rK(#0;! @K/LB_K0e/K0 _?K$20S 2ZKT1 0P1 2@L1 0H1 0e/K0Z?KD1 U?K 10S K0e/K0 =KapB0 t!@"l!0  1P!0 SD!0C 1š(K0 1 80 "$  040m0K/KL03/P 1S !_R0k 1 80 "  `@p040pS.ty.F..}. H$d..`.  0-x L@+0 @0p0jd  K0hN P 0-L@k000(0,0000Rd K0hΐꐯW -LJM|A`0Psh!  0 ∊1SC XK@0P 0PP@0 ~(PoU@@TGoK0 e0 00`PdYPY,P4p0P,pPpĂ&s7E9: -LPM0a@0 $0@sP!  0 ($1 SQht@(1@$K 1 @K چ@0S$0!㛶`PoU@@T`   @ T t  4 X | 0 00 P0PP ݌ 0/S  GKG?K!ɥf@@ 0/S  K1?o21QU|1N0,!@<1(0@`1?o21P 1?o2 1 1S 1SIOaoTPPUGK0 ᅥ0 00p脌WPW 1S 1SJOl` 1S 1SKOL` 1S 1SNo #<.%E&' 00-SL@@0S000 G0S0ب.j 00-SL@ 0S > R0000 (0S0踨.! -Pp`L]MԂQ 2P2@D] U(K0W/KL0 3/P1 L1.DZ+ 0S( ]KI]K,0KI1P/S 4]K␖0]K0 01 1SwV p`  ]Ko l1S1 0 p`1 $ 0 SAT2wV 1S x1S $! WA7N 0KK0D! ᤤ@41@,!Q^K1S  0Q ^/Kg& : ^00!15:% RP n Q 0, ($!` ^/K?P\ 00 8q4a101RԨ..cƨ²^ -L0M@PT4`p!PP 0T KL0T3/P KP000T0SX0`pS@, XT $0Stxxb< < 0S00$K@D&7#".߾ -SLM@pP 0#00KpK`P x/KXXȤT3P /K8/K0 $ 00 ,0 02 P0S- XZ*02KK0042 PP Tq 0 x0K/K0 C"T0S `㋏K,cK |ڊt0p⇞ 0S K K`,pYV KoK$ 0c 4 7/K0`0" /K^p@% 0  K0Sb  KK✊ `pV  0  KKO1 PS D 0  0N 0S< @0S@ 1<0!04000KKF@0oK$ 0DL03/00 R,K,K,K0S 0p!K,8qD` 0S KKG KKC8` V0 + `x0 SX c V0OK  ` 0@ KK/K3@呆 0  j R0t 0KK  ȴW5Ӵ)Dٴw1ƭ -L4MLPKbp@ X 2 P0 SW X ZP0 Y P    !D!!! "L"@ Pp:0 @Pe@ 2(K Pp,1PeS` 1S !N !~ @p@dP0  Pp 1PeS` 01S  1SD!0Z @p@d( 1S 1S$1!J @p@d 1S 1S(1 : @p@d" 1S 1S,1 * @p@dt 1S 1S01H  @p@d8ty.W0^p.׺DE!" $1-SL@P` Px1S x1xA4_Px 0-@LPMP( @K$1L H0 00 @0@00 00L0K0(00 0LP D@ K01ب. `0  -LM08 S $0 0 0 Kب.`01  0-LMA1 AdA 400CSPU 1S :包qP; 01l1Ph1P  X\4 0 BR %4%4%@%%x%%%@ 0  00 0 0 0  00 0 0K0 0  00 0 00 00| 00000d00`0ty.<.y..\  .   .0 ( . t -@P`LML pKtP P PP1 00 BP P< "0 4 P 0!K K H0Q K |PP(`hq000C R  R41$0 000"xP0t K88/0!0 00Pt0KKⷞm V PPP000AC, \ \ 0!̓P^ X^ ,0 SL $0PK≞ K">Sj4. !Ԩ.߾. -L4M`$pP@ QP@0\ KL03/P L0 @P$ 0S(K 0SK010.\ @\D\W @  @H0S0,0Ԑ @PT R,P PTZW0P0 0R> S|08P0p @^ B @YdYW0@0 R<0S@4..C. d00-\0L0P H@P00QSP 0!RQ}.<.. -L0MP$@0L KL03/P T0 ƒQ  RK dKƒQQP  RR$K  0ꨘ.0@-<^`@WV 0S記. -LC C  01/P 0$0>@CP C<. 40-SL 0 $TR µ -pP@ᜐ圠LX0b2 S40S00 00 S40S0|1 @8 S$100S00 0VUO 0-L8M@8 LK T P $Q~$00SU LK$ LKHLKz 00 |10K0P !P Pty. -LM`8 \K VP KGP $A003/0 R   01/PP 003/@P$Q0H03/0 PpKu X^ X XU0 803/P  0<0S KK3/ 0!!0!P p0 K3/P,K+K,K+K0K0 3/p 0 KL03/3\K␫ \Kᴸ\KpP 0SXp@ 0 |10y0 0 KL03/P 0 x0RuPp0 KL03/P 0 x0R (K KQP  x00p 0SxPty._ µ -LM`R@p PP \q_K, K4"DbP`(KP(  ᾔp`0S <08 (00,0 000040!04 04$0D0(0`P kW `h |`t`h20  Xd Lc @c 4c (c vp pp # [K 8p 42`#fs0`9`a8SPb 0  *0*0P0  0* *ꍐd@edAŐ֐zd@ -PLCM M`B.KpP; Bup@P E>K P0C0P᭒ULT$P!0#  K / -LKh:mH 0-@L :K0h{ -lPL0`SV@ @T pW@ NP@

K0C @0@WKA VKA Xe t@P@ 0PK A ,UKhU 8 KBpPL%H 000 0SRK @VPN=K 0C VK 0A d5<0L50@0L51800S UT 0@% S000T0S!@PU B=K 0CU 90Ph5 ,5[S RK  @'RK  @"RK @PV>K0C  X0WKA }RK| @P=K 0C  0UKh5Sm RK < @PR>K 0CR^K P PEA@P D喰U>K0C R0& Ꮀ.` DP=K 0C #00l5Spp&W P``PPX5SX50@@ 0XE 0 0.0\0۪ 0!U>K0C !W>K0C " 000B.KD0; B@P0`VS.K B  #x|0000. p H#`Pz #QPu#QPp~0 %SDD P #pS|P[4@5 Y @ 00 0pA|P HY#p\7|P >  5 #P1 P* 0(& D0S 5K D Wv#\  `|@0S 0 0#@M000@. ` {d@ȷϷ!j5Rhp -Lj 0P 0耖.. -L(M0$00 0 00 00 00 00 0 00000000 ׌$ KE -LMP `< p#K <@K#K 4 K 3 K  R0sS08)  @0 P@0 p0lSPh噥( sP p (KXPU -LPT`0 K#KQP0P cK`1/T 00 -pL\M|0 >0d x `0 <0K0L0K0P0KT K`lPp#KL@R_CK40K0@0K0H KD0K `ZP#K@P@R_ 0EKX#K\?!8D\0 C<`?,PH@T ?P!&'Kp0FK0T@p0 X0\ 1!"0KP 0hlQ_ K0PZu[ "? !h1 0@>`C0Rl `p ?0 A$(0@SR`<0K0L0K0T KP0K`PT RP02"l0KX0!*%KX00LX0 %K ?KSR@TL0d Y0x0P|0YVWB(K<./ -L M#KcK4( p40,0 \ Y@ \T PR@PHR@PUT ^ Q0 \S40,K000( K40P($K -LLM`܀V4 0 PP T !dK`pdKpBT@R00p XX0 0&K0T000T W0#02SE 00X00 K 4K04P:4`0X @0@K 0 9 8#P 0`@Z0`J4 0` 00 0 K40 K$K$KR0KP0  #K p#KK 0P0(K 0-L0M0B"T @PA@P A $KrK0000C R / -LM 0  0K  h K茘 0-LM 0  0K Z K蔑 -LM 0  0K M K贀/ 0-LM 0  0K < K 0-MMLM@0sP0A.K0 B;B0s NK @NK @-N.K B لK0{dЀ4β -Pp0L4`@ *0SD10>ЀX0@(@ 0 Q RQP YXW @1<<1@0S BT0 0"Q 0S ,Ko=Dmu㡕P,mᵕP1<<1<. -LMpP4@`!0 P& V0\ P\ P UƁʡ!20PP `80 4 P4 800(K`VBTU -pPLDxx @ 4``0g 0 `3 @ 80p UWR*  @@ @H.y. 00-0LSP@U U UP0H0T T 000D$ $ 0 @0y.,..RXH. 00- LR@0y. -DP4ML@0  tl pp0d (@0p @ 0 @Q%@@$KH.qy. @00-0LS@gD0   R0K0hy.H. -@LP0 u 04 8 <`p` 04 8 <00 00S00  SR000 0-` @LM#KPop1S PUBT(KU  (R  SR S"0` 0㓥*2S R02Y0(2 0 KQP 0-L 0D@P0S4k00S00ӵ0ŵ0P00y. -L @`PQ Q QP  w0P00E00 *0Q  (ꈥ00SQ/\o / -SLM!K0K KX -L MP@00 `؀  P0 RQ 00Sl   (K `F&4 0&8 0(4 0 (800` 0&l<< ( `0č. -LlMP\K@}0PS2 0„\  \^Y 0SQ00Q0S X`(Kw-kpKR0E  %1#R 0%K40h0 0 Q YT QP08R  RX3 0pQ W QP Y 0pWRUh0U0P21 SR %K'KK%KK8”\hPT0 "`0 1\0"`RQH0d d 50` Kd0dK!PGX20p1S ^  SR !2Q 0KKR0(KKR0^œ"!`VR`` 0S1!023%KR0XI {jFd0`\0 %KP0X` Ko0"\Kơ`P2 L0 d02 S02D0S PS D@0S 1<0Sp1h0S  1 S 0 C,%KԅKR ^\ PT0h h0! R00 CX,0=d S˹tt kA-pP2uSvw_10000“b\œ@FqL@$H @ ( P \P/ ‚!S Q / 0( 4 Q S 00PS// l0Q!R0-LL0L HR€;IPT0@0020> ˹ -L8M P` Q @`qdQ2"@! P0 * 0S$ 0T KL03/P K%Kp`  P`Rp R"&000㯮$K<. -L0M0Pp` 0 9P@P0 00ם 0R0 ! P0"<0?020x 2002LKؗP @02<02802D00HK ˹ > 00- LRP@0S DLR00U0SRD 02 0"@ 0y.H. -L MPp @`@"0U 0 $ 0( 0,2Q 2R0 002S R02S0(2@ 00S!S8* S S4*SS=*S-S+ S0 SS$ S! SS S*  KS S BS SS S S00S  CR  0S0 S S000 @-LP@(0@8 Kh 0  X!˹08S^/H.@. 00-( 0L @ P0R0PS 00Sh 00 0-LM0P0@S K?PP 00S T zgK0D0 # R2y.H. -LONKNMM @D`  Pj``NK 0|  @.B.K`;` B 4pP <~pq}n} (K*yd -L|MP Kp@` BP@F0K!@P 0S X 0 R8L1L!LL00S 00(K (KP0 0S0\ KL03/P K(KQPK(KQP 00   x@ 04/@(KZ:Z ZY X ᫁ @Y@  ( ᝁw! ˹L -@PL_oZUKhT -LM@P0 /0pK0'4Po0S  '`VRU p |0P 003/8_o'V#Khm!j ˹ -MLM@0P 003/0A.K0 B;FpP p᧟`P  C|{|K 0-@^LP8Q @ 2"0282w -p@CMLM`/@4 B.K; B0P44 0 i0 L$ H 0$ Y@#;$  4]p P!14"S> B44S&|zo@ xU01U01 (K PP =K 0C 0   41p CK? A 0SY 0I,>q0CK ASY 04o_SP 1 SR 1S  RS1S1S2pB@?↯<4 Q !<4 SPTJ 04"0SE04S00D04 ֞P= 04`0D l 04 8 < QR@ Q@$ r"0@$0 Q031 Q 044 8 <" 0slD \D40 FDURX -L0M0Pp` L1L!LLぞ@P* 00J 0R0 !?020 20T 0002?4 p@Kf 0S0"P00L KL03/P 8P P003/!˹> -L P@^T@@ 8^ @T;ep `P ` `b p ` `p "0a0qPqq L0`pT08BP080@T^ 0Sp`82S4@0 8aq R  @Q" "40T8P 2SAT8BT0S  ' -cML M86 0 QP& B.KP06 0; BP@(Kc.K4{p 86 PF<6 P6@ 2bK, @D6 D6S rW !R2"pG.K  `  `  ` dhl#V!bK Aaaaaaap@W8C.K Ukt@bKp` A1nPxBTzQP < L& D6 81b.KZ 1! B,?? <@`8T1V`!a&a??``aL&D6қP<  0KA 0e\6 0eq'X6 e>KK 0C A 0    mK?AQ P0EbK, A=K 0C   m =K0C S R @d@!˹U -L MR@U|0| ||0`0P \ e"{PDw04 o Kn!˹ -LMp\K`W00PX8X(XXPWD860 @(K'K0"TQ\@Q\ 4š !KK0SԈK40x0 'KR000X 00S 0PSWw? 0(K0" &KK'KP0K'K 0KP(K0 *K 0)K(KR0W68B4T%@2r/0 q?080s?0 0KR000TQPM)KR 0PHW<6{ u?vτ0'K 0KRlBo_P0"\KED0S SP D僗t0  8x@ U x0x o?0 R S RQx 6 0^(K㌛`PW50c+$? 012U |0 0o_)KP"  aԉK|00X0܆K@PK0 20\KD0S SP D&B|0܆KC)K 8|0#|1#)KP0 K܆Kl 20C K (KR0KKP K0 \KD0S PS vDx0T82SK0"P0 @P{t0"2? 08B122bFTW (K02y?0"P0, K40"0 0d 0dK04aP `PU0d0 l0 0%K0PSb0 F 'K&1#KR'K%K%K'KKl0P%KU0KUK40o04"\K(D0S Q<PS De<@B#38d0 $1 0dR !R  "#(Ro_x0PP 0SPo/ @T \ `TV U \ QԉKR ~wτ \ KRꉺ!˹č.Ut -L`M@Y`p 0P 003/0PU_4T KP.Y) ( LKX"V 00%K  dKz P &K%K%K$K0 TK@0 T K P$KY K0 0 %K1/P0 (@00S $KR H %K @1/00P 0"P25/0P,.X -LdM00 SQ HQaDA0 P|K@{| KP0jb|K-0@>SPA0 P|K/{| KP0Yb|K-0@S`0p> C(KK 0R(KK ?x ?uK?Qd@P\ @`@10d p07/0@`P(KE<. -LM`0p048!PAX@@ \^0@RX d 00P࠱ࠡ? 0^  0 (Ko/<.> 0-LM@0 410810!u`0K K KP0T0T"K{`0K K K?0PU !K 5/7K0<. - LR9w  Khu -LM@0 00G{xƨ& 0-@@L0su(00ppj0Co0&. -L MK,K 0K %v K 0-L0M$ K< <K80 40 00 ,0 (0 nP$ K --LNMpp Uxev "QOKv4 U?K!PW?K <10CS P0WK "UKR0 xğU?K " 0WK X4 @R w@0SJ xPG MK5k40S@ K#@y@3ЀX03U?K募 A ' A{{jodVd`MK0d#y3@l3X-HP FHXdනH#0 @#HMK d(#y@U?K P࠳ࠣ\^\b M?K"dzyQ?K @ R0 <10SZX=9 =:k{ G A$2SK R088 A{ QVS?KP0"SKRU \M?Ka0! 01SKP0d㜁P dP㐅)l/?  %+H1@ /? 0SK 5;A%0 !y0@ R[ldЀMKXPUKRA EW "Ce 0NY@.AH.x.X..Kd.Dp..ƨ$1FSb..?~`LP!ŠHˌAL H g 0SKP lWKPx x @WM?Kd x@0 0MKpps4K$KRn A j Ak{H7{1X 0P $!tx@ĒP<ၰM?K<`ຒd 0t!_x@!Yx@ 0-LK@&G@0 -@RL R:700Pp:@`W:00WP0 +xP -L M@pP`耟0*@K(0 0S -S :S S  ,0K+K00P  0  0@0( 0R T0S00W  ,K`pG@ K(/l& -LMPx`P0@# pK$0 0'0 $Krp@ $@P 0S$0%0%*P@ $ 0S*$儗\Kc -#MLM@@K0A40 lp 0 R K(/ -LxM$Qp0 K 0 j0`t0"Krp@3 rp.  rp( rp"  rp (”0P ` @p  $ 00< 0R a$ht rK(/   0-PL@T@ @T00 S $  0 0S 0 S   0 0S  0-@0 S   L0  Q WrK0h̖ -MLM8q00!CK 00 &r0S0 0R<  ,0K0$CC>K@PT*)>K 0C @ t`P` @ 0 R 00>K 0C  p `0S 0#S@U@Y700(K(/ 0-LMP@0$0 0 0 0 0 0$K 0 qp 0S 0#S oK00 S   000C000$00P0$PS0   -LM@Pp p` j 0W0 h 0VKU00P PhDvƨW -p!LtM G/oP`0"K(0 p@ KKr Krp tqKr@( 0R (Kqp 1S prp @0W ) K r !Kqp K(/ .0-L@Pp00D  U 0 p 0  0 p-LtMpP0 K 0 _p@ KcK qp`q@ 0R ŏKp(/ -AMLMQ@ӘP0p00 `ڙ7000 0R 8 4  X8C>K'@`V CKp(K(/ -PRL`p @ X 0%S @TR' @0 S $  0X ,R + pPP00P @ @0 R Q*U*  dR7700  㬓@PR U P P L 0-qL@0 _ ep000 #-`p0L@/0s` qp``q @ Fp0p0xqp`PU0 S   0 ( .pᥔ` 0-LMd@P0$0 l00I0K0p4 0R ˎ K K0(/ -P`p0Ll0@TT 0S V qP @ Kh3 0-@PD0QLa}k\0UK0hWC^f -@L Pb,`|l080 C0ll , 0 0 8 `| lD #0Kh m p-L M@P#l000`V Kp 0S 08 BK K B 0 -`p0LP@ @Pp$Kk8 ʓ@H, 0@Vp D D* p-L M0P 0 0l0@T K nP 0  0al0@T0Kp 0S) 0 R Q H R0 0 [P 00 0 iP iP 00 0 0S h1S {P 00 0 @ 0S *p @< D0-SL@L0S)\0S4QU?DQUILQUSQUaVT=a1C8D00CD0D0HS00H01C*L00CL0L0PS"0P01C\00C\0\0`S0`00 1,P0C 1 aVa#H1,P0CH1HaVDDaP1,P0CP1PaVLLa 1,P0C1 -LM@0 PP @0 0<0Ѓ0(080Cph`Cpi Cpi`C C#$Kk$K -p0L#h0@l*H0S D0S080 C0D0S SKhp*n 00-SL@0080 C0 D0s0KF080 C  QP.jK0hz -L M`p.2X@؀D0 0* D$ ؀D 0  ! D؀D  0 0  D 0s@0 0S D#K 00 0 0 0#K 80ԃKD7 D0 X 8 DDdXL D 0 0S 㗏P`$ U P, (K=0S0%0 P 0 Y  i 03?00d6000 0``&0^`& d&R0@Q 0-SLP9080 Cp 0`0$0- :0)CO 0 P@@@ 00$0 :0W 0 P@ 0$0 zW@`%@P@ -Ѓ: $0l0L`%$: 0 OP$9 0 VP$: 0 `V0$0  : 0@Y 0  -LM0c@ %0K0 t0 0l0P #0" HS  _%P P 2 P + P{PU%P P1P 0!c 00)0  $KPmp? pP P pl %K$Nlp<@- $el0 #6 P  l$Ml %K  lp Blp  lp` lll'l# K̾4=" -@Lx c0l0\`PUKhB 0SR(P0$#Kh] -LTMa@0P(0 l0S 0$I0@hK+p 0h0K p0h K P  P ( 0R }UpP @ pl XW gU㰀  @00<0 K(/ݾ`r -LM@Q`p` R  P00 0 WV 3 $Kk$K 0-@L 0S0 0K0h -L(M,Rp `l( x @P| 0Sy 8،0&0s 0Sp V"H0S$p/`P v D0sb S  $000D0'$J K( 0R@ $p$0A0AS`$0 V?D0S<   H0D`S lpI` 0HK/l RHKყP 0@ <M'LezX( 0R$Kk$Kk y( 0R$Kk( 0R$K(/n -LM$`0xP00 E-K 0@  Dqg Qn -K+ 00 0d0S 8P[ 0 KC E  0n E 07 Yp TV E E E 0' 0S6W E0 f E0 |w 0S؀E 0 6 0nwp % ,0 0S }NP iJ P00 0RH .P$0A0AS 0,K1@0 K0 0$ `0 K  d6 S}0` 㓉(ᗦP 0 K0 0i 0 @ (K(/, 00-#@0L 080 C0 A7 p K0h}l -L MP`@T(KpW4 wP4   U W R @p RX 0 80 C#K% ,#K0IweNW   O< -PLMP@5 P PP PRX!XX < T00B0@0lKP# P- P< ! P P ph0Kh P l0@T (@x xP*8p\KhPKh@KhO XHhQpz  0-L@-$ 0K0h 0-QL@0  0S0 K0h -qLMpP@( $l @P00$K 0S `,0 Sl   0P(0K ,K" PlP@P W0P0PC& l`P 0S ($0$0= = =0S ))@0 S   000l0  @  0S 0@ <;U, K 0S vP0 S   0n # -@LM' IOh,,ptt  K0X! %(K `Pl0   PpMP 4 Rp耟PU ᗌl( Klfl0 S   0l*P  0 l0  P  0S Pp 07,j` 0-L@X/p007SK0hyy0 S u0VS0K0h@ -LDMp@0l(0 PP YP T X70 0t( 0R f@=0)`S $P <0d K  ,7=@  K(/R}l} -L$MpP|@60P h d/`P 0,@0 `(K `P 0# Jp`Ppp p` ```pWF0P Z)``Ix<0 <0ᮋ 0Xr#KT`0` 00K0D" 0bp"#K :0X 0S1#K\` D0 < Yp < 0p0`D0nP NP` kP#K #KpP xP#K:#K*cKp`dK00 00SlP 0S cK A`p$K0`A00000 0* AV 0Sl0@ 00 00SlP 000@T@0 0C0 0l5DD& -0?R0(0L?@0P0 1S@0 `p00= )0=@ 〼 -LM p0`00 d0SFK+PP2 U0d0<!+%0, K0"0@Kd@0p 0%S KP ;K0P=0S' d0l0@TL %0S ((P hP00 h0R2 Մ=0S*@@kP oP i0 KPYx k HpZ,@ !g 8(K(/1InD -LLMPP`p2"*?oR2Y2"Kq`00(K R/AT= l  Wh d ` KT@  L` H D @ K4@ 0\WD 00 lKeX W0`p0\ 0L` H D0 @p @ `P  0`1 BQ@ @T@ 0 S   00X000` p0 0 h0 &K 0%Kl` T@ W 0H0 D0 0 @0 0#KL` 4@ WpD  pp0lK/ep` 0 S0@0@@00`As/@P00C00p0@@e+  -LM: K -LM 0 0 K -PLHMd1d!dd]0S\00KR0 S R  0@\  `p%K D0dK0X@ D0 00\KdR@@@P @S! @L\ X T P DKD  < BK8 4 0 $ S0D 00 ̿ -LM`Pp1!R1! S1! <Ke@K 0Pp40@!pW1s@exP6|QP S00S0 "00CT000 R  QR  0S$0S(P0P R( p P  0 0؀YX  R  R   00(KT  DQɚ; -LM!K00 0 K00c K -LMP`@pẠK( 00$ 0, KGK@B -@PL`0 ; PUPUR PU P^P PP(P`P(\Q Y P-L0 0LH0m -L MpPx1x!*tDp cdp`D@(K8@ XህPP  0 R 0pT@@0^c@0S4 C   0Yもp @0 0 pp @0@  -LP$0$  4#@ Kh, -LMPP`0 ~0p@40 00 ,0 (0 80S  4Kbp` K4010C>S@$ K 030@ 0-@PL0h0 00 4080P PP$P00 S (  0M0 S   0D0 S   0;0 S   02 0-@PL DbK0h$ 0-LM$Kcp@K0P㻅@P P0P0000 P00P 00$P(00L0cpD@ p-LLMPP1!0aH0H Rk,0S , 03/@T0S^ 0 0@D0KDHbp?0S ` KpdKhc&KSR\\\ 0 S   003/00(00@(@PP0\ K0CSL0 PK0L0 T@KP @ R<0@D3/,0R  R 2/LRʚ; -L M 00 y$@ *$p t@K& -`L0PFp P ڣ# "P  RP@@#C 0 0(@0   && --L M  K -ML Ml@p0P(0 H`BK0 @9f᪇B.K0 B$( 0R M K(/}l --L M  K --LM  K --LM  K --LM  K --LM  n K --LM  K --LM  V K --LM  ~ K --LM  > K0@B& P-L,0 4V00&, -Pp@\`LV`0P@ 0-@PL0@Fo[MK0hU 0-@Lp `0S0^%K0hD 0-LMPd@ 0K0  Kl0 K0bp9[ $00R hK0(/i -LM@p 0`K 0 p 0R MR0  K<0P K,ZKap :[$0K(/i 0-@LT0EQ@ 0-@LT0KFQ@0Q/ R0 /R -L$M`P@0'0S  P P P:`P 00K0!0 0   @008S0 000(K080 00S # `p0PKP` 4K 04P 0iS.S P`  40P 040:Sl& p-LDM0@P ` P Q@Tq00\Kzp@ 0R {~V LK rP @0SKp(/ -L$Mp`@TE@(K 0S P P0S S @ R P0 P D0S 00S㺀000 GP P00  M P-L000QPl0P/$0/ p-LM`Pl@ 0K 0  K0@U K8P ` 0pR }Kp(/i~i -L4MhQ`0(0 0p S@ S$0SRR #PK[0 00 P@Tl0@T(00( 0R% })S0.S /S R W R00$R0< K 0S ,0S @ K(/ -LM_p@  0K # ( )_pxK^b 0-L@"p0 !p`0 -L_M1 5! 0F/`PSK00 9<1 勀pPJ50 0Rb :}p|=p@! p 1S001 X 0S 0SbK 0P1 P ^K P PU1SMڠ1^KPB 1PSP@L0SP0 ^K縨PGL0SP@T0SX0 ^K窨P;T0@COoSB@TP@D0SH0 ^K痨P*D0^K@COoSB@TP"P^/KD1SPP1s1^KP#0PP@@@10S1 D@T^KPA  00P1 ^Kc"0PP1 @P]: ` ^K l 0Z$0Q  SKc < MK 9<1 0S/K1081 _p <1 B00 RR*R R 10#U00SP ; 5R R1S P0R 0 R R0(0 = 0)?=)(P!=0Q0R0S D0S HPP#0000U0S !p T"00@0 "p0H0@0 Pd0@0UDP !D0000@@@(K(/fpi@C-@$0R ؀Cpe  r @$ P A E@ @C؀Cp`  pn  PK@C؀C`p  K"Z@C؀C` p  AY@ClPA0@ P 0 A -LMpP{@P$K$`Kℐ@& VP {PX  WP,t'%0P tZ -LMbP0@00 0p"S8` 0W"SpGP Y !0@s`P 700800 0R +{YP T00@010KW YT X0#0%* X # 3T R\Q``nQ 0Q< bQ QQ ` tQ xQ rQIT  T  PT 00 @T 13 K   4K  ``3K3 [R) T'  4K2K|I2 K4K`0PLU R`2 [R T  4KdIPT T@(K(/l&P /0 S S /S/P0/S 0 S S/0/ -LM0 4 z`P}@(K=@P \\}$PP8 X7 z`P  V@P< 1a 00@A @@ P0  ~@P0  0@ 0 0P400PqZ 8  P40S Kz@P{ -L`H p @PXD! H!p6 0 t60 00= 0009 00J@0@  PL! P!x6 0 |609 00 : 009 00J! !h6 0 l60 00 000 P00p@ -L MpRP` 0SU00000VK/:P= 0K 00 0 @   0S V 7<PU # P| T /00DV 048 >< 40 8 0TU@ 9 0-L M0K 00P 0@ T0S0K00 P0P00P00P00 -@P,pL ~` 0e SP,p~$` PP(0e S$~0(0$0PP -LdMX0 0\0 0pd0 >P0@00 X010CzS񟗚=))=)>))))))))))333444t5556,6<7X7Nt7N(8)8NNN<4=)=)))))))*0**+NN8++4,l,,,N<-.N.4//X002N$33)t)@?>??@N)h@@@@dCCCL>>x?CCDHOCHKLLLLMLL0>h>0MMhMM0@L@ .)NC4N/PNlNNpTG `Pp DK`PHT XTP T6X T&D !@H<0 0 RP DxX, To X <P }0 `P a v<` 0h 1.h{P  0 p 0S xP }0 1X, T6  BzTx, 0 pp P 1.S 0 1@AP0'' AT d  0hp@D tX BpT Q80Sw8bX, [T 80K0 0 0 R80XSs  DT 80K0!0 0 80 S] 4 .T @0K0D0K0H0K0L0K 080K0P0K 0T K<0KV00L0@0P 80<T`PPD0@0P 80<TUP @@00P 80<TKP$ TXTs @0K0D0K0H0K0L0K 080K0P0K 0T K<0K00@0@0P 80<T'PPL0@0P 80<TP@H0X, Xp RP GGTX# 0S /ᘼ`P /㓼`P00 2V /0P0 (P,,,000X, ~T 80K0!0 0 80XS  gx? 0 aKpXP ?cpPX@?30?KT ,7`P 0S<TA 0 A!pL.X,@ &x  0@4  80K0,08@Y0 g`DK@PhX,700@4D 0A;C @4p0A;A@@dPA[B@40@@ 0A  Cp PX؀A pdT`A P 4P 4P$: A06S 06S, T2 80K0 0 0 U80XS T QH DNHX,`plX, T `Xz`,gPL `<` ypPh04"[ B(g{[X,`plRX, KT10X 2DP0X 2; P 0X 22 pwP `rPX % @ X, X, 0hT3  00p@W, CX, X, (/Xr jA ku&ZvQ7@JO^$k[5я`X, X, T P@0K0D0K0H0K0L0K 080K0P0K 0T K<0KL0@0P 80<TPH0@0P 80<TP}0@0D0pT P@0K0D0K0H0K0L0K 080K0P0K 0T K<0KH0@0P 80<TPZP9T =?PH  yPX0S P 6,  ,0 bP   YP PE  LP  FP  @P  :P6 `P,]pp @KDKp 00 8Kp 00 P DKp@KmX8K8i G P  A P! DKXp  pP ,`K&HEXDK8A  P An PX  P80K0-0 0/ !O80S  `P%/ i@P`` @7PT00i 80K0 0 0 N80S U AO @KDKP/7P0XL P@0 OP L6D P! @0L&00 @KDKP/P0XD H@0 OP D6D H! @0D&0T Q7P LPX, X, 0,X, 0,X, X, X,  X,  TS @0K0D0K0H0K0L0K 080K0P0K 0T K<0K0P0@P80P <TP 0SHT+ X\x&sP\|T QpX, X, X, xX, qX, jX, cX, \ X00WppW LX,0,P pT /+pP004Kp0p8 ,p 40[dX0 30[1`[\0 20[``0 xQ, NP d&T0d604 [`Pഀ 30[@020[010[000?o`2V``V0S$ 00 T 0^  ^ ^ X\\\`\0S/@P` @]5P  % T 0S80K0x 0 0 FM80S D  00X, TX, Ao⚏ Ao'Ak➏oAk⣏)n0\ X0d 0d0`V `\0S `T X `\0`V$(`L cX _  P80K0L80` S  H@P @0`0 pP0:0p&P  80K!00 0  L8Y P= P xxP @PpPhxPP@PpX wxP @PZp$GexP @PVp5SxP @xP\p|#pAxPP \;xPY H5xP\0.xP#PZ <h0 h0   7\?o2= WwxPS wP wPP lwPP XwPP DwP P 0wP@P wPX wPT wPU wPU \ wPU wP\ wPW wPW xwP\| dwP\v PwPVp 8v@P00wPRp ppP X0S0@<0 , LPGu `R  R 0<0 ,@ <0RRT  @00,0$00 0$0(0`0Y`( p P < ᔿ eX00CS$3\0@ d0@T) VpP0080K0 0 0 p/K8`VFN@P$ 0 xpp 0S< :sP 0 fX -LP wuk<@ 6< &!倆]T \WX606Q4X,`plHX, AX,`pl8X, 1T dP0 1(#X, X, T LXXpP G (NP IPGX, X, X, X, TY p0 pXAD T 0Y0D   T7 X0Ss aPPT;((K&ף;@Yt) nA:P<P- 0S! 4@0 忾 0@0S 0 S S0P\S  @ G 0 G@\ `HPl@s`\@=lP@\@ P0S P P0 S P P@M@ LS0 0"S ( ؿP @ X>0K00K00 0 020PZ GG0Q3#//Q :/// 0-PL ỹ@P0^q -` 0PR!0p0 L@1 P`P T(  G$Kk 0 00T:T( G$Kk -LT\l0l l T0S`0T  DDP `@@0P0Q3#bv p-LDM`Pl@ 0XK 0  <K XK <K<KXKj 0R *kKp(/ 0-$PL@pV$K0hQ 0-L@P 0 -LMlq@Q0P00 X1X!T`K< t8lK <  kTt0Q  P 0 0 0 0R' j P Z  0 t Z  pRl0@0 `LRH00` <(K(/vƨ/G 0-@PL$0$ $$7pK0hEv P0-Lh0h hh# PᎸ@P ᷸  m@P s0'Vv P-L[$0$ $Q0  T/vjm 0-@PL,0, ,,PP 0j8yv P-L808 88T0S Kho Kh迷?v -PQL`P0 U0t  @T Vp 0S 90S7@Gvf 0-LP@P0 T0K0hP/ 00-L0@jT @0 T0-SL0 ` Kh{Uv -@QLpPT2T"TTMT0 R" 080 C0 2UU*ҶPPt t0 t0 x x0R`9@0#P P @T T0R88P `)|0 |0T T0RPt06 t03 88Px x0R` p,,0S Ip!0S >p0S l3@V fYP`@bv -`PL PpP@T T0pS7@ -L(M0p ` Q0 T0S0  @T0x r Pp@PP  0X @KN@K 0R hK(/iv{ -P`L4M\KLKߵ<Kܵ <K00#V1 V< \Kᤶ@PTx  \K✶0SS90SSLK⼵PT0pᴵpP| H 0|0  <KP" @\K+P\Kp<Km(K\KA;T T0R88PY0Sx x0RႶ\K}LKԵT 00 :XXfP <K cP T T0R88UP `P pp "@LT0 04 8 <0#80/ P-L@0@ @@1Q80(  ,000 Q : 0-@PLQ0KD -0-L M P Z^p@@K0p R-LP`@B4p p0S -LM9 @0 TPp 0 E@P@09P̐GY p0SrRAP` `x冯Pp(p p Xp  Dp 0#0Q 0F?oZ20SV 2p 0h1SPw;p@θP` [0P6S# x¸P hὸ`P XḸ`P H᳸`P 8᮸`P (᩸`P ᤸ```OG 0pr D0S& S& #pe @ p_ H pY $ pS nx pJ d>Kp0l00B Sppx ^Pp1 080 C05% p" 510 R<%P %P0l0p080 C 0 xp p0S p Xp H0S l0$0I0KYp Kp 0F?oZ20S0F?oY20S x0S |   Sp l R  0 Jp0  0 gp00sٷP ԷP ϷP ʷP[p Vt0F?oZ20S 0S FoYQ V?P pV1Pp0S0pr 40)pMj#pLd%PpW%PI pCT0Sn   pI 08!p^@0S    up5 08!p- Vn?hV0Se h1Sb SQP^ t0 0p0LSTpP 1 RRp`0PU0SS x1x!  RU RL1D!H`0V }?P ` 0pPEU D 00 0R bQ 0(K(/4 Dn  #)5CNWhtHi9  0-LP@}p 00K0h! D0-sL`@s!S ! !p0P`S  R H R pPt0P pP>P >P l pP0S h1S {PP 0h!pPn -L\M0t0 0`8 1pSPP  p@HO K ( !R3 @ 0l h@ TK`p@ zp" 0TKz1聟pd@ `@ \@ X@ T#:dKTKzTKz l0K l0`T0KpKC@TKzT @l \h0@HaXqt0 T=s[10C>S00@"$K!@03@0p@t T tKጶpʸ0S 0t0 t0#40 l x SP l@'i 0Hh0 0 *p0t0 @M}lCcz P-L? 0S< P@0`0S5 S P Q \ @ P.S0.Sh0_S-SPP,  00  ?RT"0T000K00l& 00- L@P P0/T0000Q  >D00`@-`0 @CT`@ pT00 P0S@X}HX0X h& -h1LS@PaPPE @ 0.PC_oSRPUdP TP @կP ,0 .ᆦPPꮀ 0-@PL'U_ 0 tG0 dG0 TG0  D G08,0)(& #  @      F0  F0  F0 F0 |F K0hC APT%֣ n(;I29@EMVЏ_ -(6ƒ \ 1 Q0^  ,0\  ,0 -QMLM`RNK0p 0 P\tp0 0 0F 0R `.K 2.K l d0F0SPE@ p 0S@K(/jp -L,MP80 ) $``4 Q4K@Pe(K0S  ǮP@  PpP@80W Pp W2e밶00 Pp,P R ᶳP 0 K 0 0 :0 R R R 0S 0Ze낶0 咳P 0 K 0 0 :0 R R p,P100 s0@P001ZP@-0S- Q0@ @^ .^^QRQ D Br R @ Q@ 0D0CR000 -`p@LM4 < 8 0 VZ:W 40W00G<0S00T@D @BV00(KRY"0T?,SP0ZP8 `YPU`!` V?Uص0W 0 R͵70 @0 i.0 000p C0B00 @0 V:D X0 0 4 @WR  GS` -P`LM0p!0Y* @ U W700(K$@PpG`  |00U W 00  P     \Do   ' T/T$8 #KL#K\T8U W@@U W\$0@00@@pGP`U W @pGP`l& -RML M̓@0H Pp 00 p`A SK A@p9H%lDp T =p SK A? (DpVC    CK0 @p P6 CK@Dp C.K Bz   i0 0R ]     CK`0@  8Y @pP0P@T*:p0S4 0p@`T*T 0 lDp @ p d P /r VDpx @ /r   2/DDpf @@ 2/ @ b   C.K.0 B!PL C.K Bh#DpE 0S @00S DDp5*001(K(/DlE  -LMP` @0Tp(0  ( 0R! ]R R 00H0S0K -00Kl0#0I0KG00KW0$ 0  B$K(/ -L4M@` 0L SH P (0S `0 Lp0"(K 0  0K   p000 00SpCX 0KPYp 0"000ibP U0 0!000  呰`0 0LTp0p!00x PE,p 0S(0SU$ (0S40K0P<0K8 K@KHP0: S 00 KDKT0ز0T 1_`P   =p`a0S 00Sq00/ -L PΠ R00\L  ^ -LMp@PK0`! (0 A K= KP 咪 Kl?>PPV@[ Tv700@ K( 0R [ K(/i 0Q0-L@D0D DD 0S00S0 00S000  0-LM K"0K0 0p K -LMaPQ0@(0 ,00@ 0S S6 SJrP@ ( 0RC /[벀X1pW 0 8KC$0Kp8KlG@pWl0P@ 0=0S )xP @T0S  00SqQ l(P@ձ/0 K(/ -L(M` @Pű00K0S   V0w'@0Kx Bp ]0@t0> 0 880S00 0 <0S#0S|0@0|0 0  ,X"00Qx0 lrTT0S0SdlTT0Sp00 8 00<@'꣙// -L MP`0p 0 ,0K  ]@P 0R' YZ !@ 3"p 0K # ` @ <p HH 0 0",0K<p =K(/*#30p/i; 0-L@Md@0TK0 PLP 4KP P 0R ZK0(/D 0-L0MPt@( 0@K0 啰 @K0@ KD<p (0  0R YK0(/8i( 00-I @ L!p0ll0l0@0I00 p-L4M`P@( 0HK 0 \ HKⲨH Kh_<p 0 ,00S p 0R YKp(/8i( -LM@|P`K0  0 - 0 pK' K` | K0)< 0P [R zYK(/:i -SML M\3PQ @0 `5 D3D#DD T0S83(# X$3#  R~K pG#0*5K08005 t0 $5 0)EK 5 @T0$%@0$5 50 5  P T0X00 50 5 P 5 0 5 T$5x 0$5 $5Z<0$5 |0$5;$5 R 50 0 5 04 $5UnK 5 `F0  5 T@堯100@0 =xT@@D 5@@x @ Z: 0@0 5  hYI @ 50@0 5  XP RUPPEPP@ D r 9p`50 0`R X K @1G5[ST0 K@H[K A*YI @(K(/\7{9 -LMpQ@0`00 0p" K0 @@0K K@ @ 儘p@0 0R> lXP@ [P @@0K Km@p@@^ KgPlPxR KΧ ޥZ 0@ T*00Y00] @T@(K(/e p-LLM@P`0@ `K 0 幮 `K!> VL 5K3K,  R4K< 080V` K,: 0R WKp(/ii@ -LM@`P0 (0 0Kp儮 KڦKH00xKPK⼙K!\K 0X40 $0崖K00 40 K0n:( 0R W$K(/kii p-LKM`@P0.QK 0 K QK⡦0KK31KMK0Q/K0,D: 0p4R WKp(/Ii -LJM@Q.0QK 0 " QKw0KK31KH00MK0Q/K00:p (9W%O?Ka $  P ``F$` 0 0 bP B$  @V 0R HWK(/ji -_MLMR~K0 pGP%00 Z8p_ P@\P R 0@0R*5[S)5[S= S:SSwR5S[K A$pQ@V@T@4S8 :0CSR E@ @l`P K_>K B A p 0S NS0 8MR1S S  $@0 0R VRl0P Q Q 0$%5[SH%)5[ S0S@%[>K"# 0C  q4S@%@)[Pk [K% AfSd S05 5S  R0 085 5S  R0 08[~K pG@  `5  i!>15 5 9p3O0S K01S g)5[S5)[ 0^>K 0C0C0^>K 0C 0C0_>K 0C00 t)5[Sq[K 0 @_|[>K[ 0C  5[ b)5[S^}K pG5 J0 ep0 01S !)5[SB0)%[R= %[R%[ R  )[ 6  6 p 0 t%&(K(/i@o6G p-LGM,|@P0` 0 l0JK0K!#  .K P>K, ; 0R UKp(/x p-LTM@PH 0hK 0 X 0hK`嬤h KY8p 0R Ux0h KX0 |0\<0Kt0H0 p0P0 E8p0S0h KX0 98Kp(/liHmiH -L&pY -L 0PtQ -L 0P: -L ML0K00 0K# K hp  K/ -LM@pQH 0(0 0p0eK`ޫ eK4e/K47p >0p!8  0(0*000R e/Kp1 7p'080 C0 .SK⮫ SKS/K7p0VS dS/K\7p0VS <( 0R T$K(/liHWiHPi Oi (0S/ 0-(0LS000@@廫V000 0-(0LS000@@媫V000( 0R ~r/ -LM`LqP0@@(0 ` 5p@@ K$` F7p <[S<[S5@.8/P K% K{ K(7p K"7p `PP 0S 3YP `0$ K0"H 7p ( 0R \T K(/@qB@ lBfB@pB -L,Mp0@0H L P 0 PU  Lc50S`9 P @K0P 0S8P尓[ Q` H\ P  Z `1`!  P噣P 0P 00S00#0% 0%0%0#0%v (K -LM 0K #  6 KgB -L,M@ (\ 8  /( K!K )(K" K8 #K0 8K,0 4 0R SK(/ 0 5 -qLUM@ (0SXYK QK4 KYKK航00p/0/ R0-0L0@ D^!Q0s# R0p00 0-@0L8\K0h 0-80 C@P0L =0S0%0`0{`0l0 RR 0S ``0Q  p08 b0 =0S KhKC -L`PK@WP 04 8 <0D0 004 8 <0 00/0KcSc -L$Mp0 !(0 {p@ 0`$PK0%`0 P5p34@( 0R R`0 ?5p  8Ky070K;X 4 8K3K+5p K(/ -LP\P @ ^00 ``0N\"0 00 \PU0, R-@@Q@LMT<0  v0@0(K1Q kV00P0`pQ : RPSO  (A PC P l `0 p0 , `0 lpW  8  4 4 R0 4P4 RV``< P4 TP ,!R *(S0C@0 VP @0(,Q0S(1 ᳡ 08@4T0@cSc -LM@ 0K00rP 0S00K -LM@yp`W1PuuPۨ0S y @ Ky3pPp y0S(KW@ 3T T( Wp ly \0c!`p050 0)K0(00h&[iH -LM@ 0K00P 0SK -LM@ 0K00P 0S00K -LMPR@p1!0 0`\ , 0? R1 0R00  0M 30 0 0P0 0:0 00P00;0 00P0060 00P00$K!P 0000t 0 00p0 00{p0 000S -`Lh0Ps Ep@hܧ0S `0`08 `pl 440$ @$&]}l p-LM 0K080,`P@ PU@ @T T@P  C00Kp -LMMpRp0D1 0\@00 塤P@Q R PPW (L H S`PHL1 JV@10 0RT(K0,0=V600 0MK40MK0P 0 ARp051K,0 @S6 U751[PQ7@0K0UP0 X 5UP`0 4(KoU(/j:@b.; -L M@pP`Q`,Q0,P !,ERP㤀U`,@(K76,P  R ,00 )6 00`,P ,6PpKS -RL Mp00@PT:3p T ` Y@A00U *"0 p(K0T00  0 0Ku`0T 0 <S6p @0 T  I6puA -AMLMaR0p(0 R00@TPB T@ C00BK0  @p( 0R JOB.K Bpp0 WT 6p  p PU K(/D -LM 81SsQ S  0K0 0qP K0S Khh -L4M0H SP@ x@@ `尐0@0 _09 o0 <0K0@ 0GpP36T0 @P0<0K00@ 6`P <0 8 4 YzpP 0,K0(8K4K8HP@<0K0@ y0pP2 P0 <0S0L0 @J0 SD0 00D0L pq00R*y"0?P 0W80 4p  0 8KtD0 c04 p8 0S00   S SK408Ks0t04K0K8HP@L0Sh` F0 0x0P  l FF(K<0K0@ !0pPW <@SXR0p80 0S00 P@008S  S SK408Ks0 t0W4KT0K8Q H@P@kP4 1S 2S0 0(0Z4 0[ƨ_ -LMP4@000 0pT2 40K0`0 AEKpEKX; X8l0S,0S,00嚘 1S,08h0嚘 8l6S,00嚘 !RT28X2 X2h 1 S0㤣P2 X2P"l6S D R 0ppP30 0R M0 0 K0p @& 0p 0 0K0p @2D zR 0p7@ nR 0p@< aR 0dpE2[t0,08l0Ku?K $pfE2[e@0"0,0Kc?K pWW^e0T"!P !X,l ,aS  R/K  [P 0P2 82 010 00}S82SJP 820C82 00  00T"!P !/K  %P 82 0 0 P2,0P2 (K(/@ 0-@LTP0hq 0 h0h0l00l0pq 0 p-0p0 0%0 -LM`@p 0尀SP$H` 0R000 0 0 `00`0! ,#K0 ` $rQ 0,7000 4H0#0u H(Ko#K0,0 $QQ 0003@0S3H000s8040$>Q S l00080 zSG{k{'{z40S# zkg{{'{ zt0S( $0P$x0!Q00 *S:kG{{'{*z8 S zkg{{'{* z|$P00 TH0S0Sk x h 0R<0S 0S22H000s8040 14 0P018 0P010 0P0#h00@0S,0y TVi/D,p`%0p0s 0S*  0R% $1s t^ppn(Ko\0S00 `,,x0| (Kot(K??%,IPXs0 Dr7>  -@LTPp \0 $Kkx08،0 0,0 \ 0y0-D0S0S <0S $P   #`0 K `P ``P000` 0`HpP0`8 `$`UCL -LWM;@0h 00 0Pl1 0Rx1 D0S`X,t0 4; 0+0Sh P  Rl1 `0x0p1 ppt   p1h` F0t1KCNPPv t0S h! BRh!R ( Q  R P*Qx 0 000(0S0 S= ) h1SS F 0 0SQ00` F0p1It1C)h1/08! R|  J R3= 8  ⼙8!  $ R' D|1Q#h1S StQ xR% JR2  $  < P  JR6  h1< S < R JR6   <  h1 SRt1s JR9  C pFI?#R J Q:M ?#p1p X? "R  JR<  "p F  A%R J Q:^ A%p1 p 2A h1S R JR3    p!KK{p1p8 " JR P t1 t1 Xw:Q W 0  2` 0000W00 `p1x@4S  J0R[:+ p @$0A @@d``6S 0JSH|0000vp1 p6JX:0JS470000, S:`p1xh6,0lV*l10 , 0AR&lWK%l1Ȅ%R4r `T  0VD0QTa SX,0 ,4 (T @ 0`0 ShR PU{j[{k Ak7kl1 `0+t1S4p ?t1 )Qn SK %+> CP 0D0 @QD  R0 D30D1 0L#QP00ŁNp J00 "9 `0 *0X`: 0   `!P:0p00S >Ne0  000 0- /(`p, papap P` hP:LP YM 0,,S\ Y(,pq P  hQ:@Q Y& `,000I0C0 0  0C 0CK/ pWwx1S @x1W/K00 0R H Kl1x``* pv  ZL`Pa PleA(/cSc5?A6e5wɚ;ʚ;.GqC`DCl1t0S l1 $ P l1$Z <X x t0,1 K?KL1 0H1 Y?KD1 0( $a a IP 0Ph0p00P 06yH00% 0 0㰐xЀH,0 3'8vJ 8! Z:  GP8t 2، 0 0'0\ 8 K0=  dPJ&0 %LJ؀Fp0 ppX XOtp$ 0T%YK H 00 Y?K 0+0 0hGP8) 81 81  08h d=yGP8 ( 81) 8= =Q K0)ޱ  PL? DOf p R0-PL@ $( E 04 K0h@ DR K0h -MLMr@0P00 l0mK00l0l0l00 t2h:p 0S P Ll00l0rX X @1 'Y^JK,@DT0@SX 4TSUA.DRYP:QL YI:PD C \ R  Y 3R9($lBD@$$ 4D4404P .Y+ 0B.D0B-K B0 ;K,0C,$ -K B(C=K 0C0-K B Y :K,0C0)E  |"@Tr0 0R @TANDTc ;K @,0C00C B+(K(/$}l8S -ML,M`QJK0$@D(0 ;K$0C0C(`8 ;`Dp  @\8q0@8 ;K$0C<0CX80T8=K$0C 0CP80L8 ;K$0CW,0CH80-Kp=K$0C0C B0=K0C$ D p =K0C\ XxPHP\嬿( 0R ? R 4eh0s0 K(/'4p -PL`p 0|l0@T0S R `0S= R)-]P  - 0 @@ -0L8l 0@  $KkEt[0 P嚼T y!080 C0 D0S𫝸$Kk@f-\ Q pLn0 t\ \0.000 0S /f -PL`CP@ 0y`h0 00S 0< S `0 HKhyA}l 0-@LP%T DD D8DD@l0S 0R $q $0$1(mD0(100S 0S0 -LM@PX,08 P 0Sp =(\0؀C  \pgp $( 0   04 8 < S00X0000 04 8 <0Cs4 @W(Ko>A -LM0PS@ (K`lq00 0@0 @0 H@T 0p P0-L0@T0P`>K0h\>0 S   0T> -MLMHa@0@ 0 唦P4l0S !凸41?S@;P@0041{ 0R. l80Q@p`WHPP p ;B.K40x  pIpW4P8 88PU I041K(/}l M 0Ѝn -#ML M8 0xR8 2 0 ( ap00 00\20 0R 88 0C0PPB 0Q@0V@@@@ Tz >K08 0 8 08 (V00.K8 08 B008 ; K^ j fV8(`00 \K @biK K @jKK A @j K8@e E8@S78 0) y>K0Ct.K QP B0#03 QP00Se 0KAt ^>K0C YX0#03YX00S 000j70hh(K(/ -L M@m0KcK -LM `P@p!@ R0p'ppW KP#q`00!(`P@ V0mHH \00-@ L@@P\  ` d)U000S DK0hU0, \   H HR 0 0- U0 S   0 HP  0R 008!6`0 &Z  Rp ,0Kc 4 R@0 Y@0 0X000U@U (K -LMp`0 0 l0PU@ 0R' 20S@P0Kp H00#0  L00#,   P00#(  T00#$  @TK(/ -LDMq`0 P00 PX`6@P 0`B`\`\ X0X93 ?o2"2  0 Hp8y,8@   0 0R, a2   .0 ` KP 0 0.0`=H``PKvp  0 0 S .0` KH(K(/A 0-PL@ ~P0`0 p0 P/0$ S/\X0H -PLX0`S0S0S@T2 KP  0RX0' 0 <P@ @0@  \0;0\00 0$0800T@ c@8. -@PL`PU RVhV <1SKh0S 0W7T70 `Kh 0-@L<E70K0hA7 -L Mp`P@H040 T? H0 400 5OP \0H0S`0@W W\0 `0 V\00\0\0 0 S   0X \0@ 0 0\00PSuP 3/\0@0\0V(K/ -LM1@ T0 0 R p NP㨀K8Y Y  ` 0KKO K\KK(P0K((0 0(0NP  NP2S NP0l0`V$ 0K00S 0S Y0K00 0R 0 P0 NP 0``(K(/ 0-@L ((uNP {K0h; 00-PL5P@D堰0 0 00S P   -LMp`8 R0 lP ֱP PUPP @4 TW (K H#NPX @08  @p08$0(0 0000@@000 X0\009\0H0S0I R S: SH0S5I00S1X0.Y+ 0 S   0 03/ 5#0 3/#0 X0\0@0\0##W W0 S   0# " W 0S 0S 80 C 0v #0q4000Ph (Ko -PLU`pP@T2P H弯0S 0S @ 0`@0  -L,M $0P00 L  P08l0 Dq 0#0!(0S=@0D aV0)` :MP  4MP Q00`L00 0R `/pWpP |2@ @0 @K 0< 8 4 @P` D H0H0 0$`80 C 00 `  D0K 0H08pD0`0040H00L0(0S=0S)0P0*0Q0+0S`R00T0,0U0-0V0.0W0P00#P0 4S )0P00T04V00`V H.0` #0`0@@" HHLP!X0 080 C0D00D0 4뽅10j` d̮4볅000S`]` 4P (K(/19M -L20// -P`@LT080 C 0@@T Vh00$KkҠ\0 R@ HP\0@0\0\0@ `@ -LXMr@0`(0 \0@ @\  0`P0 0 @%080 C0 0S  /X+0<1PU% QZ P  p 01S 0S  $0KL #H0 0 pd( 0RL +p0X K0\0H00\0.0 0P`0  . ! 0&KT&KP耟d  0P Qd @0l Kl h X 0S 0 w+P \XP S 00$K(/ ( -i Aʚ;ɚ;6e,Y -LMpQtK0`@ 00 <6K0(spK]0K00 0 0 X0K\  K0p  㤀 )K Kp 堀 吠  x P  ! 0 0R8 K+0tK S0S $ ).xK K\ 0 p0 K8@ pd/0 S @00@ 0H (K(/O \ | -@L4M PU b/PP(K81s<: 3hp` 0,pK$0'0 )= p 0$ )P 0 p 0% )P ' p p LK`@0p<0  L0K: p 8a0 ۦ`o000=pW00 00 /P z0W0 000001 0 ) z0S  i 0S- L S 44吪S S -`L0KM # 0 0@T $Q  $  K R0 $PU 0P0@ @  0@ @0R%0S 0S 0S 0S l0Sl0S0Sp0S hphW0P00@@P 0-LP T000!Ġ Tq&%%:D1H\ @T 0P0,0 -LP0Q0t pŀ0S Kh -LLMLK/ 0 #K04 <1@T; 0l0 0SaPU^lQ7 %`p`5\1Ì`eȌp6̌KQPD ^ʋ^ V0D\ZŌ RkɌ0 ̌K4^: QP44 Q4P V0 \倩0l00P0 P0S&L`P0P0 $K%KD0Ah0 Q P00#t!QT }*O00UZ l@R#K4 P0 Q[ q0S0 P0#`pP0@X3\ 0`p1ÌeȌ6̌KQP0D ^ʋ^ V0D\ZŌ RkɌ0 ̌K4^1 QP+4 Q+P#V0P0\0 P0` Pp 01S 0S H0P $0 0\0H0\0P00qR#K4  s0 !)  DS S@Q>P0P: 0S6pG O%`p`t1P 0`p1e6 %KSR&h0S\ %K`Vph0PZ V0`pk #K&K04\ &KSR 4\%K0P0 A$%KV0&KV0 0#K4 P#K040S P0< KY 4r$(Kɚ;  c# 0<1S0 /SQQ 0 -MLIM8KG?C@>HK0,@D00 0D08@`0D0D ~ D   D0  P-D8KG?C0KP BA8`F p  0pP(KP.0 BHYKt A* 8KG?CK DBA'`PD 0=0 0RF ( 0S080 C 00 0 R\YKA 0S (K B 0S 00S KA 0  'P  !P (K B 4 厧8KG?C0<1@T,@P  0V  rEP @ `K. Av0 P 0P8KF?CPP wP(K0I/B0P0SPP(K0J/B p0( X0(KQ/B0 l 0R h004KFA?s0 !Sl000S   X0S@0|0 0 0 0 ~ p:pP0y 0 00 ?t0 t0 0000x0 0SaK IA (KI/B R(K-B08K>C0S 8K>C0SN )8KG?C0D!8KG?C0H P8K=C(K0I/B 0# l0S P 8KF?C0SO# 0 080 C0 h0 8KI?C0S8p0\  \ 0 K"1NA0P 8K>C0S145:0r 1ʃq , 8KG?C0D8KG?C0H0SQ 8KJ?C0啦8KF?C0S 8KF?C \ 0,8KJ?C0\90R R RP ( 0KL 0S0(K.B00(KM/B08K>C0PS  ٥ PK,LL0L0\S S0\0S d8KO?C8KK?C8KO?C0 S PU_8KM?C0@ 0셟80 C 00(K.BK0 A jPP 8K 0C0(K.B0|580(X000P8K>C0PS6  HFP0 oᨂ(KM/B \00\08KK?C0(K 08KO?C0K/B $0\0R0 S{ 0(K-B0(K.B0 SK A CP PSc  &P^ 0@S[X $0SV 8PQ嫥NPI8K>C0S 6#0P 8KN?C0(K8K>CN/B 00C(K.BY(KK/Bk8KK?Cp0HxSx0 ,x8K>C0S 0 RS00ą01=001 8KJ?C0 , 68KF?C0S 008KG?C0<1  @@8KI?C0S? ;<:8KQ?CmPP0 p0 j)@8KI?C0 S3 Qp.*S ƤP#H0 z8K0C LP0LpY BPJ *0P(KF/BP00P0SE (PL<h֤8KF?C0S *\080\0X0(K(/N q      66  0uG ^        $Z* > S f     . -L M@p`,DQ0,PH!,ERP㐀U`,@(K,P  R ,00  00`,P , PS -LM<1S0  KQ 0S00 0ti 0-<1LS`pP@0S PU@T  P@ <1-SL`pP@@TPU P@ -@LTP" `)@)0@<1P 0pS C@l0 R 8q 8"0810S 0<10S/ R R \XQ /0<1S 0S  R RQ l R /0<1S 0S  R R RQh   /@  -LTM2p0dK00 0<1@T 0 SRPUO0|" PK] 0P KhpH20 0R `#%8 P Kp &K P Kp ,00Da0e H!R#P,08pf0e 08t6SPPL`PE`U !4h0 0!$i U*z000P`aU9@PPq0!) ,ȃp6tƜ ` PE^  ,0\ D1H \ ^ ,0 h0,   0 P K\ , ("(R  R ` P Kkpo 0P(K(/V \ g x  b 0-0L<1`SPp@T 0R0 0@ -@L<1S0 0`<10P  PR `0Sܹ080 C  Q PKh  p-LMP0 ϟ080 C0^Kp 0"KK"K@`$  0TQ, ( `Kf$@ #UJ[{k A{7 +S@P40 ߞ@eAʚ;ɚ;6eĒ ^ <1-SLPp`@T  ?P @T  R R Rl R00S0Sd V`0 0X `O< FV<10SKhn   0 R 0SQ/0/p/ -L@P`Ux0@0Ux0@0PE!PqVS@PE -L@T` p Ux0@0(0PEU*x"0x00LPP ^T@0, -LBMp`axV0U@(0  0PQ  U: ( 0R= d!!0 PJK p P PT* K?Kup,100Pf6S@R r]JK p XV p0@6 S$K(/  -L,Mtq0P00 d1R XA @R0K4/P [_Ⱐw00 0 0RB !5[S @P[_@w@ST01X0`[ R R c&@w000h PKP0KC$`PDѠ Mp000(K(/x < ( t -LtM0 0R0 L5@000 w000p0 $50 0pRB 0̠0 0S B| t x0 p0 \\0| P | t  B Bst P`) P P X$\w0 0`兠t0S|00#t pPt RGw0 0pp x0R0S00`KpG 0  jFw0p0 0Pd6SS0#0T K 0`K֍  h ` R 0 =P0 pV \;0\ X7PSX T K 0dKⱍ0 0X0 0\00X0 \0 刐 0P 0Xn1x0 V\ RX0S} S # 3Q R0tpf0K PXh  ӟd&[0RPC0 0IHKv0 0ڟP 0S808 4S4 Pv00#K `峟 HK-P>PU0 HK 1(0`0i00P0000PP08 480R\   \ S$0 S05 0S S0V{p00?o2R03S s\00\0\090\0(K(/e Q }     $ -L$MR`p P(@(v 0 0P@0 v@00000U0<K ʚ;Y i (`V `(`P0 יX0@ 0R 0D0S0K }`P =[S+ t00K |K:P Ksh0K0 (00 $0).`XK` Kh0 Kl` `0@avA0S 0s`: DpԀKU,0Spp KPKAQ  X0-K100 ԍK)X0:d!9#0"R  Kp 88, 8p R`#`3WppW,  0P D`jH`VP0 嗜a8K(KИܘ  \00-@ L@@P\  ` lnU0@P00S00S  80hK0hҐ\ H R00 -L,MP`@0S pVl6 0 \Ǜ0h1 00KoP 3[S> 500 )00  SVL x!p0x0t0|0h0hp0l0lt0# 00 Ꮉ0c(0 080 C 0 0c(KP%*?h1S4h1h1S4h1h1S|4h1h1Sp4h10S 㬐X4Y Z @宛딐吐0S0s:kg{{'{$z0S0s :kg{{'{%z\r p R 3 #P R ` H0 ~H0p3h1jK(P4AQX@|P0@00 CrS00C00 CrS00C0[0 S0000Bs \20(0r 0Bs|20P0f r T20P0[V9 `$$V4 \ 0 H0   Q `  $ \  $ 0`H`Q`  R    `R0 4X s (. S Q$  ^"L0( @p 嗚i/pp8ʚp@T8hZ.R$ |8 ??   Q     4 htܰ4R = l r V 0 t p\0  R @@ HP\0@0\0\0@;~ 0-@LPP0 U0K0h話 -LM@PU 1`vv`C (K`  hp` Kp/vKlK`V(p R00t pp> p (KlK`VpP0080 C0 ֙'%ppZt =UP000#?PUt0S Y J0 QP KnSp0p0t0ih&E -LWM`T;@`0P00  0`0尠8 "R`! ,0`1t1  10`1 KK☸t 0 Sl 0P!L1d! p,0h! d!R8`1WpS`1d1  t#Pd pA5S0p0 hP;PSP (?3S -0GPP0 S񟗧ԧhxx x|VU(P, p!YP ) h!p r h! ,0,,\  0h1 d1 p0 \0hlpXptpWK 0 w0Pl1 80 0R# 0X0Pptp0S-(0dP70|1 \ 00(090@PXptp \ -((@<D40l1 \  Q  )RP0plq `&#" 0RPPp|q lq o00 7< 900p1 V?K0C P 0#0 oPp`z XdP V?K0SS0 X 080 C0 =0S0%@ 8 s0qp 0l Rw,V?K `pX1p00h rQ  dg06pl1W_KS ,V?K sX10䰀X  lgpL5尐0X1 0P09; S?# R  0p! p!RG,U?Ky KT1 0P90P0S 0#090@<X1 00l1 |1S 8d&lR,`00S04lT \ `\ ^^\  r l!   ldgl!0 l`6p1#p1 0PP1 0 L1 H1 V?K X1 0KEg묀 pX l10l1 P\03 Rx!  - p1)0S1 ' pd51P0C?o2PQKH0$4 x0d"0 X!  QK KKR0py`1S '$Kp\ ,0PW 0I 040`0`p 00 @兲<0 ` Cy P -@LPP|u0p`p0 0)p 0,S ` ]hKh}l 0-PPL@P 0a}Pf 0000000 P0P0 :R R @\R @:RP.l&@-0P:P@A ^0 \:R\0@S^@\ :R\:\0/ & @-@A0S :^|^  ^^ S \0L:\\ |\  -CMLM84 0L !SP H$ PG SH|EPUD 0P@4 >@ `Pe 00l@@;<4 5PU P= pP 0 `R0 :R `0BK00p84H$CK @P x@4S 8 %P(K PP ;<4 0H@4 H PP84S$0 0801] pBK HD `D4S$BK+ A8`@P@4S 8wT e@e@P R0P84 0@4 B>K 0C0BKD4 H 0 RY @EPY:RWPp\R R R <$@T:BT4 P@DT4 @4SN 8-Kp <$ @`X; x:0P0fL , 0Q :Q00$ C B  RpG:R:   F JD$ <$D BQ#T4 <4 C|P @D pG `FT4 m@4S 8,fd 00;P <$ @p`  DT4 HT4 HD4,@`HI `@4S 8DP$0A0<4T*@P`4L4` :RpfpW 0 @p0p84 PW 084 0 S@ 0#SS pP P. & 0-LM  0K K 0-,@L P 0 00. -LM0xB,8 0pS 0S`,0PP %$KK A wa0P P 0@P0 PP U ,( B,(R#000S  R  ,( RB^KPE0C R*K A Ca0PF PC @i ! "# :P #P R R 0Q\S0 Q\R  :R0 0,8 S>K0CI R  0 A0S@Z\R  ,( B:R|R  .l& 0-@PLAK0hL -L`= k@P@ dPuRc 00@^S0S:S] p00@\Sp0S:SP 0C^ 0@0LT1 0L\TSp$ ES/ BS CSNS RS" FS 0fS cS eS bS0rS tS nS 0 R@AdP 00Pd @0:SS0AR0@A P Pd : -L`= pP@ d,PpGPd0b 00@0S @AdPPd0 :RRAS@A P 0-L@# P 00S 00XS@ 00Bs ^a0BSW0BA0BS70BQ<,00 00-8@L0P T0e0.c -L M`pQʟ ٣PV00`c QP00CS02 Pp0 0 S,K*D "s@W00S( <_P  s, sP 0KTP000SW@0XP40S 047σ4 ,Q P04  S 4 ?@T Q P0 ` (KP..2. T00- LR@ R 0YPiP 0.. 0-L@HP08G0. 0-P@LPP0^P0. 0-LP.P H0@QP 9P87SU00.. 0-@ LPS P@0 0 0-LPP H0 @RP P87SU00.. -L MPUp``@oP@(K R 00C P 40 0 P^P0 40T00ST!`@R ////// 00-8@L0P 0 0.c -L MpP0 ႢPW00p OP100CS0 Pp0 0 S0,@K0$0 `q`X00S ]PTqHqP 0KP000SX`Z``VqP 0KP000S qP qP0 qP0 h|qP PvqP 8pqP${ :46OPvp(K.2 -L Md0 @R R AP;,@0@00DLP0D K.0. -L MPt0 `Rp@ @T 00P@0 'P`  K. 0-L@P08D0. 0-P@LPP0P0. -LM@p`P XPQ@ 0@84ST@p$K. -, LM0K0B0;P K0. -LM@p`P X PR@0@84ST@p$K. -, LM0K0B0;P K0.@    / 0-@88pL0P 0A`0E­@-@S`P ^@ ^ p\, 0S'@0S^ p\ 0S0S0S@ R@@0@0S@\ 00SW@+ 0Sh0 P R  R 0  \0000 R ^P ^  @0 ^ 0S90^3P QR  Q0Q  S  0 0 0 S 0 R  R 0  \000^ 0 0 R   R  R 0  \0000 R PP P R R R  Q0Q  S  0 0 0 S 0 R  R 0  \00 0p@-PS  Pr0S R 0 p 0R5 3:p 0 @S5@T `V `@T@T@0@T@ @`S@00 0 P@T@ @T@0 @`R00 0 T `V @Q@T@0@T@ @`S@00 0 P@T@ @T@0 @`R00 @-@S`P ^@  ^p \, 0S'@0S ^p \ 0S 0S 0S@  R@@0 @0S @\ 0 0SW@+ 0Sh0P R   R 0 \00 00 R ^P ^ @ 0 ^ 0S90^3P QRQ 0 Q   S  0 0  0 S 0 R  R 0 \00 0^ 00 R  R  R 0 \00 00 R PP P R  R RQ 0 Q   S  0 0  0 S 0 R  R 0 \00 0@-0S000R 0 |@ 0S  R 0 \:rQ:Sn0 0 S5^ PUP^^ 0 ^  PS0 00@^  ^ 0 PR00 0 ^ PU Q^ 0 ^  PS0 00@^  ^ 0 PR00 @-@S`P ^@ ^ p\, 0S'@0S^ p\ 0S0S0S@ R@@0@0S@\ 00SW@+ 0Sh0 P R  R 0  \0000 R ^P ^  @0 ^ 0S90^3P QR  Q0Q  S  0 0 0 S 0 R  R 0  \000^ 0 0 R   R  R 0  \0000 R PP P R R R  Q0Q  S  0 0 0 S 0 R  R 0  \00 0@-0S000R 0 |@0S R 0 0Q53:S  0 S5^ PU P^^0^ PS00 0 @^ ^0 PR00 0 ^ PU Q^0^ PS00 0 @^ ^0 PR00 -LMp H?W`@H`FPPR0T *:0 00 z/ S9#4 80 00 J%W 80J B P: S:4 \= \: `P@(K@@P` 4. p-LMQ0Sy A1` 6/`1!6/  ! Q10P! \`6/! Q 10P! \^`t 6/4K` 1!P6/4K`0 06/4K`0 6/4K`w0 6/4K`n|0 6/4K `eX0 6/4KP\40 5/ 0@ 4/Kp4.$&ƨ b$U zeVh h K d  ' . ; J Y j `{w | -L@`PplU fU `U ZU Kh0@-\ l /o@ b2#",  10 R0^ n /o@ b2#@ ". 0S0S R 0S  P0 R/-$0( 0 010LQ\   $ $00004. 0-`pPML00`< @P3p00KTT p$Y@ \Kx,0@$0\ K 4/0 0S G$&b 4.00,0S/ Q05: 04. -@L00Ps P$0:$`p0 ``FV`01P0`4p8`pU <PPP P48P4. L0?4 0-8?@ QLP:4@4@0P 04. -L MAD0@`H00$PPM @0@ @$@p T: T,$Dp0pW0 T#$0HP L0 Q(K " 00 @00 C   4 00 00@4 J   0 @00 00P(0( 5/ 0SL0P 0G4.$&ƨ -P`@Ld1T00SPL0PL01SxPFUPP4.0T0S P/4.0XPJ X /4. -L@M@AP\0`Sp)`0S&L`0S S fD`0P00P@0`$K T@㸐T*P 00 _@spW@ dKw\0@lT0d KP4/ 0S F 0SP 0P0=4..$&b -lq$@(P@`@6e2U 0冑0C001$  0LS  h0S *0s0`FP0Q00Ql0 R1 *!$q P P$  QP 0R 00 0S0`Sv 0S P J @ $KkC4.- R 0(0# 0 4. -BMLMEppWp9W0,K@4 004 0,4 04(0 ppCKQ@p0060@<00`o`U(Y Y +CKMp~ ,0K04@CnK`F0S}YW@400S $0 >Q 0 x1D(CA3^@0HC3< 000 2 3!l < !|C $2hhh 01C0 0@S 0 <4 84 44 (P,P\0`dP XPRt0 0t0t0S3R05 0S#11:PPPPLp(K&J`P #P 004K2`V~A C9R񟗏    ,L     4h0 0=00 0800 030( 0 R0C+0)0S&0t00Ct0 t000000S0C0( 0 BR 0 0S0C 0( 0 BR00 000 00000000<4K0;4K0 :/E 3R00S?00< !U%L00S0p0974.$& ~ /| 0p0S/4. -LM,"@$P PP`q (0 @2#$`\P\ BSpY  ZWU0H@DD)X!@җ X-1(@X@0 2S051 0 0S0 U00 S % 1X0威t@ QSU QP$KQ0S  PYS  ZT , <K2@,Y  ZT"X0X@04.0  -AL 0pS 00S PP900s$P`d0SPV PX0X`0\0S`0S PP ``0<`$GWPP3P0 0`0U 0d`V`p U01`5:RTpV 0S:S*J>X0X`0 ``4.. -L MpX`(1:P@TU% `V P v`P8 h0l 0B1P $1h@(A  R  !P!@Pl@  Q :00 @00 $~SJ(KT@1Q*P4. -aLx0Sf:0S 2@c@Oop @d0㓄$$@PU' 0S$ 0  B SP0 @0R\A:|p p@C7B @p0D d@/oD@@@D@PU Y  a 0 B P GP  @0U 0  b Q2!  !P 1@ 1  4/LA0  0 NP0T-PP  R 0S 0 0K00 BK$K@cPP Q\0S`0S @,R 00 4.$&ƨ ~ -L,M@Q`ᬃ 0S Py Op 0S DKxD` @@ 0`0?o 0c7  `o `S( tpP T 1l*mJDKH 4` H P T%U030#U0S |0 " 00 312S T#2Q EZ0T00S  DOQpU< 00US*00# V \0S`0S= DKH 4` k0H 0<0 0 pp  pP! $0    T#2Q IZ0T00S  DPW2wP pW @0@<0< 4/@pP1Q 004.~$&`.ƨ -LMD0@ 0S 0 K$0 0 T OK4.~///4&/4&0p0/l&0p0/l&0p0 /l&0p0/l&0p0/l&0p0/l&0p0/l&0p0 /l&0p0 /l&0p0@/l&0p0/l&0p0 /l&Q P00////////0S/ R 0/ -pP@`L0 P @U*0Q 0R* /0/&p0 0CSp0 S P0 / -P@0`LSMP@ T 0A S00// 0P/!R/P/P/00p00Q/  /l&P/0p00 /l&P/ 0S S//0R/00p0/h&0p0/d& 0-LMLPPP04@S@O;0 K0ƨP &PQ 0S///l& 03P/ƨ0 AC\ 0ABs0\ r CoS \S / //00S00/!ؔ&n 00S00/D & /// 0-@LLHHCP nO, N K0h?&E]( --L M  K -- LM  K -- LM  K /// -LM  K -LM  K 0--L M  K /////// // // 00-0@4L0PS P0gP 0褣/ 0-LM80P @R U@K0KP ꤣ/ 0-@PL 0S rJ@P/=000 0 0/ /0 0 0 0 0///// 0P-L  P  . P P/ / -L$M PX#K[ @d`p!&?`p 0SRp00@X00S`0V?#KSR+*1#0K00 0 K D?KX d 0Sp00" K x0*K'$0SD"x$0S .""x$00$0!D*K0 C^HL  Kh0 00 0 0000 %DdR 0D&$D%"D$!D$ %XK|K 'KP D H@v. @ L?% ?#T X?$ KP?%*K&000\@ D0$L^%{hs #n D#i !c D!] D !X!D% #S"DdRD K&*K%GD p*K!D&*K r0#8 DS R6 S RQ- $h# DD*K  Kh*Kc 0h@ " R >01"ό0 Kd 0 Z@ KP 0#!DD*K D%  Kh ##DD$!Dh% 0$%h 0S !p!D*K D%*K#$0S"x$0S"x(\ KU  RR $ RO D% #$' r0'00 $\ P"  0 x'00 (00(0|" 0"w,00,0s000o % D#j!D#R KD2#*K&^!D%!D#W0 K R05 K0dP00(0i 0$0h0@Q~p h %*K# 0&/ K&+jD8X,l'd 0 Kj? K#d 0e?d 0b? K%T 0]?^   K Q P RlQ P\  0$$%^lv 0$d K02?d  K0-?$ -LM@ C02 C0X0 T^ 0gK2c ? }K pP# 0?K0`0@ v K_?K E# 4 @`H`X`D`L`\`a a |a xa ta pa PPt1Sp!RʄQ|!R00 1Sd/` `Vp!pFV0dV00`$`p0f1 QC#Q PK 004!R0 SR P`H@$ $" /KЀ80 FXp1<"R:1@"R60 YXx3 Q9Q2 @0>C 0C42 8 'PQ@x0S Bg0K 0J3xPQ@8|!R qW B20 (KD2 B rK |YXD2 /K`"&`Pp!&/ SXrKK$ P: 1!v> 001K 0=?Kvn@ `F 0a =0R! 4"0!& R1 ŀB 0$ :0 QP`p J 00 QP gB0S cB0SXxstϠl V 0H0}K2 pP 0 KgK }npꟆlQ0rK1 vΆ, a`\'B KoK !rKp@PpP  0 T|=@P P$0P" 0 K ?K R]?KPA _ 0BTR"^C@T0S ]Pà̌?K@@ P 0 @W0 QPQ ꃏKθA#00A0S@xA00 (K0rK1 mxЀQ0a12c1XßD2 A D2R 2$2#?K 0RBT"^SC@T ]Pà̌0zA0S 0-@LO L+p0T00at T00 R PQ R  /  L" 0@- DQ 0P S@@H  ^ 0S  Q 0#0S00!(H  Q j.0 0#  Q/4!t00@-0PP X@o> 0" P0 0  -@LP`p @P@0% P PP0 0i0 0@ -L M`pP% ؐ0  00 @`P@nN@  0 pP  l`P PX [(KXP Pp(KW < $pꐼl -`PLQp @Q P@D 0DB(000S  뜘` -LMp@`P@( <@ K  0P0S 1@0"S" 0@000S0 4/K@0"S1Es\0@T000S PK1Es$ q̘pH` 0-@L K0h -L MP`U4  PP2S<pPD &P@H PPP M \1000 `0@P- 0nS: ={.P00PPQ! Q P 40R 0 IQ0 @Q0x@P(Kt000S cp`(K0oS@USp , -BML M`pPi?D Z_P:.@P  N_Pn084 8:P @c8'`B>K 0C`CK@4  0@@ d(p 00P<4 p @@ 0<$V(p \<`P) H3H 0K 0 'pR  (@> 6(KBK I  P p$ >X 6 @< >4  6  0 >0Sta084 #v> 6 0 k d32HDj@$$zd@D((h -LM 0KK #  K  Z'P K -L>M 0KK #  K  C'P K -L?M 0KK #  K  ,'P K 0-0LM K"0KPP K(0 P000  00 /td<X 0-LP5U@ =?( $ 0P 5/0h 0-LP'U@ =?( $ 0P 5/0< 0-L@P0003/0\, 0-L@P0003/0 0-PL00P0S@ 0 0 03/0 -P@LTPQ` $ @04/PD 0-PL-00P0S@ 0 0 03/0  -L@PP`P3=,`0 Kh/ 0-LP@P 0 0 03/0@ --LM0 0 xp@ 0 003/K\ 0-Lxp@0003/0 -@PL MԀ(0K 0`@pQ0(0S <@(0`$ @6/ $K  -@PL MԀ(0K 0`@p(0S <@(0`$ @6/ $Kd, P "}yuqmiea]YUQMIEA=951-)%! ///x/p/h/`/X/P/H/@/8/0/(/ ////////////////////lTD0  lTD0tdT@ -LLM@pT00PP S S S ;00 (K@?0<0 0SJ  < P Y0J"p p0 T0SXTT` < @ 8  0A0 4 D V; `Ff \`3`"V= R0PL @D 4P Q>3@5 2 T *`L0  J <  L0@@ T p<3p2 7X` ( V 80<S  Y>0305p20 0R 0(K8@<^P0 0 4  T4 85`%5`5p2 VP;0X, D Q)R00 L @D04Ppp S>03@05 2 T *080 J < %80 W@ 0"  p0< `8 g@ T`502`P Vp0,8 X` VPT`P VP@ T !`5 102;0<0 ;0<0  &K ` < 0 @T X \ 4 8 0 QP k * A<RdD  l2,! L0,   S3"QI 4 RX 4p 0C@D0T0 0\PP S>034 5@050240 5 T * 40J < 4 h004@@ Tp0< 3p2 7T R4 \P+ 4 t   ` S3" >L b@` L` lL L` L8@`L B@ 8̠@H b1̎D` @ ܄KPKK`I 4 RX 4p 0C@D0T0 0\PP S>034 5@050240 5 T * 40J < 4 004@@ Tp0< 3p2 7T RU P FRp ` 4 ` `R  P0\ 0 l \c P\0 ` 8@<Q  RX  X \  \ 4   T4 8 5% 550p2P FR PB0 p04PX` W- S+UX  B@D T  P\` R> 3@ 5P2 T *00 00J < P00T @R  0< p`0 40 0 P 08 @ T5 2=QD  BP  Tp400 `PV Y* P R'XX A@D \Pp R> 3@ 52 T *00 00J < S00W@  <Tp 00 p` Ke@ T`52 p8@<Q  R\ PX  X 4   T54 0p2  B8  04P0 p`V W. 8 R+UX  A @DT  P R> 3@ 5P2 T *00 00J < P00T @R D P0 0\P P<pK @ T`52 P0 J&K  P@ T # 3P00` %P!p0P1` 50@ T!`512 T , 08 XP0 ` @ T *TP-@ T*`TP00 0 Tp 4 p` 0 4P Rp0 @ TP=03p20G5&KJ < P@`   T0p0Q # 2R` T , P8  BR4 RX 4p 0C@D0T0 0\`T  S>034 5@050240 5 T * 40J < 4 WT00 S40@p 0`0 40 0< P8 h4P pP0, \P 0 PT` 8 [ R6  BR34 RX 4p 0C@D0T0 0\ S>034 5@050240 5 T * 40J < 4 T0 40Q@p@ T0*= 4 pTPTP0@ T #0T %z*= pT t`0  BR-4 RX 00C@D0T0 04p \PP S>034 5@050240 5 T * 40J < 4 T00 S40@p) 0`0 40 0< 8 @ T0 #9*# , ` pPT 8 @00 TP *=0T p4 0G`4 T040 @ T# 3, 500T 0%5p2` 8 4 <00K T 4  `4 0 00-LM@0@K0 p-`PL M@ 0 Y 4/Kp -LMpRP@\  U`PC/&Pa` T1 0(0p0. (K0S% 1 0 P0 p0%70S0`0 P0 p070Sꌠ 70S 0(Kd 0 ` 06 0 6 0 \ \e|( -L M @@K\s} -LFMGnKQBNKM @D `FPpF+4 . YP@)T  YP@T 4 0FA`    V0(K6 0 (K6 0 8 -@`LMp P.P /tY0SP 0rS(0rS00P 00@0@ j0K0 Kh}0rS @ 0@ U0KH6 0 <зxb -@LP sp` 0/S /'YP @0 Sp 0 S  . p-LIM M@AK` @PP KKAp 4: S \0 0ip Kp5@O00Kp@50@0 p-LIM M@AK` @PP KKAgp 4: S \0 09p Kp5@O00Kp@50@0d -LM 0KK #  K  P K80Q 0 080/ -@|LPP` r| PP u |%P  Kh"&)P|P --LM$0 0  Klm --L M0 0 K -- LMI4P $0 0 Kl 0--LM@IP0 0 K -L(K 0\ 0:1L0 ,l 0-`0L0MP0HF(K0<@K@ d@ K0 k00 0 j -LP@`FIp Kh -LM,, 00  K4j00 0 \i -LP@`Ip KhK -LM,, 00  Ki -L+8000,&Pe  0-404 00L0 @>P80@0800d 0-L@>P80@0800 -LM0   : K -LM0    K -`?LmM0Qpp1 P@  P?p!K͌W P`?p!QKK͌V P?p!KF͌(U Pu>p!GKF͌(T P>p!KC͌ Z PqD>p!KB͌80S P=p!|Ǩ0S vP=p!TKB͌l|=@ 0S`=0SDH0H͟ \@ P͟ \ D  Q̟ \ P̟ \  T QD̟ \  P̟| \   QT˟ \'( |  P780@1 T0 P0AlA  |1 0x1 d1t1 tx1PQ,0Yx!10 -! `q tP@ Z,000 V? f`Xʈ`0ws!<11 P,0|!B 0 11 00p#=S1 @0C1 |1S+` 0C 1 A 帡 Q @Q0P ZZ,0!0 0W?f  1`SA帡Q1S S `,0封0pD,00xJV=p , H0 ?3p3 Z H0x1!0Sx1 b01 5@P@t0A 1 . P 0! 1 'PPPL0Q 1 0P0`1 P|!0B BR1 0T! 1 ʄ01 !t1 =a! 1 xA X @,0tQ0p0P` pW,00p0T?% d@X Px1!0Sx1 !t10t1 xa V,0@0APDD,00x<pH , H0 ?3P3 V @0!|10C!1 R0Q1 eʁ01x1 1 !=a! 1  t X" @,0t!xQ0p0P` ppW,0t!0p0T? d@X P1!0S1 !x10x1 ڀq嬁Wʈ!,0P1Q`AD,00xpd<p , H0 ?3`3 W P05p 00R 1S$ ,00!`0Ap!!1P0 PU,00`p0X?3 #h=01S!| Q(,0 A0` p t! @0Qp!!1P0 `V,00`p0Z?3#h=0 t1X!R& ,01-pp! 0Q@!!1P0c @T,0 0p@0X?3 #h=01S!|PQ,,0 t  A1@1x! p1 `0q!!1P04 X,0p!00U?3#d=0 x1@S ,00` 0 ?33`00wsD,00x;p(K#! x!10T@K P 0\@ 0[Kt1 @ 0tA\@`GK ` 0PU QK  0pW QK @ 0Z K p 0`V Cd<K P 0@T R|@K P 0\@fhZ-p1 0KA a P@`p<PPT  U1AaP RKa С A Q @P`PP3   U aСAQ!R! .KЁ A Q @P`PP 1 U `AЁQ`Z :1O1{11@Q q P`pNOKPP U `q2p 00R80000Sꌡo11 Pp!U00G0Kx @ `PP@ 0V  ` x1x pR00Ut Ppp`KPP 0U  ptB@0T00p `@PKlP@ 0V  `pPpt!W00UH0K|Q `P@SP`k 0V @|QB -L[MpC`[?K@p Pp x1 @3?K͌l1Q?Kl t1 2?SPK͌D1PDQ G_K2?c`F͌(1`a `K{`2?spF͌(0p0p pKn2 ?C͌ 0̀ 褀K`1?B͌80 ᤐ |KS t1?̌|0 0| TKF $1 @?BM@T0T `0t!xp&(KQ?Kt1 j G_Kv `K 0pK 㤀K |K 0TK  PO p-LMLL `P @0`0P @KpK p-LMLL `P @0`0P @Kp\KT0T 0  D@Q 0Q(00?H/K0 D0D @ 0 R ,  R$ 00?H/J0 - 0DD  0 L R  R! `?VH@PpqU,010 0RD   (  \@T 00J00 00@I-L L0 H?3\0 ,,  \00DI0 -L M0XaSP`(KPx@P"T= @00 Rp @p0R0 T0 kP X@0 @x0D0T p@W`0 ?3Q HQ@   0?33H0AP @xH00 00,G 00-SL@P P000 00F-H ?0 00S 0 0 Sx0D S   R 0S 00F00 00E P0-LP 7T@T0|0T0@T0 00 /D -L$MB2@0P`00 V| t2*lh2`\‚0T80 ‚@24 8r 0< (Ÿ  2 H0 0"$0 @ TpXppD \p H0p`pphp pip0pjp0zP吂8 4嘂<$h0 T@jXD\i`4 04  1 0 %0  00  W(K舠| x|p 8 pl4p d< \` @ P P0D H0D0 4008El8$<0 -prLMPPp T@P 0`  PZ3$20"Å"bbbdbhb``c ````cc`PV c pQ p|L 0p RS `b0``` &P: ```0 &P/ p+ !p' ``0 &P  %OK`000S :3S b$K|$@$Kh0S Pj@B4|Ap 0-@ZL$|| (0( 00 R  K0h? -L MPP10`PC+@/T->  | ! _|o#*:!C1W?Ch3:| R 0S 1QȌ0 S Q(KQ  20 9>1hIP  \ 0 P(`0V(p0(K><^v8#:0'#Z #H#p--`_|opryz{@|h}zp=v!,&+!%nvu#s#o4%%$%#d"e"\NA-d0d 0`_@ p 0\@(`V(Pl8 -L$M0070ǟ 0 < 74 080 70L0 7J0H0 6}0`0 pD0 Q00S[  p p PP] pTPIQ Ĕ0 s 00bR SP 4T P60 P0/N 0 ;0  TQPEPaU 0 ;0 4p@ w @0SV 4@ @ P0u0PPcRTT 4U P%5 0(Kp PP  4P 40 s 00bR$ 4$ 50P0/1P~Q  q lRQ $ 04 T0Q00S<0 S0 pk ~0P@1 pb 0  $ `0Q0  40 n $4Rs8 R  P0u0PPcRT 00S<0D S{ 303#` p4 G0P@h p+ 0 $ 6P 0 r  ; `R $0 4Jp Pl pp 40 s 00bR44 $RJ0P"0 0(KS 0P@-  $ `0R0A 04 04 0 s 00bRS44!0PR40 0 ;04pm4|S0P@c `000P D00 s 00bR A/o 4"x10p1#`:H00`0044 0040 s 00bR44QL 10! 0z4L 0 s 00bR4k00g  @0s444 00TP0u0PPcRTT@ 7d7L7<7,77p65L054A4$Q2 w000$   0004 44// -LLM4 8P@$ 0P`V e :Ó\jQ A300S(K30h0 X 300S  8Z P P@ \0-L@!P @!P T PP0QP P P000 mR R0@0R0 1BQ;R" S0S0mS0 C ;S R00S0 S0S0;S0C  Q0R0R0R0 S0lqPq(q -LM0tSPpܔ J|P M0m 0Kr<`0r  RD|2S #R $ hPK?T0 T@P X R4$ 44 |0T`# 4XS0300SJ p0SG 4S 4S> 0t#W2l"Q匑T 6P[ l3l2Z; L1S80 7 `P3 800P, <0 8 <08 R! 0p22Yt2!2Ux2  PK 2x2h(KL%R4S 4S0?o28p2h2Yt2 PJ D2t2 0D p$l h $ <%$]U  P1l2Y  Pl2<l2Z  Pl2?;~0l2Y  P1x2Z  Px2?;~0x2W y Px278x2U  n P1t2Z  f Pt2?;~0t2Wz  \ Pt278t2q|200S0X00 r0r >C|2Sf1S0& 4S"iH5S_0)o|o\o<$`k0 00$0 0$  T X| hp  ` lT pH t<  x|NK#<$88 80 0Q $0X 0/0# -L M\`pP@T 0S"!0S S0S0YT0(K 0  -LP 0, S0 2 Tm -LM@bdqPpQ$K p` QR  0 $K00$K PQ,0 ( "P`( ,0 ,0 ( P( ,0 PEᰐ帐 少帑P Q8A㧯(0(0 0-㝯!0l k -L@PPp p@Pp `E`PE0 0"@0V@0 t 2@  -`\LP@U 0S1 RU0S@0@SʛKh -lLp`@S0 SpV0S"Q0S 0SV -LMP0 00`P@ @ jJBK0pPPPI0|" QU P  [X$K$Ld - LML0L0 P  K 0   K@ \0 Q0-0L@D00S :T "0p00 -0 0`L0PS' :#CRQ# # p0@P: #Cs## Bv0:#!BQ##l - LMH0H0 P 0K   K8 80 0Q $0T 0/0($ -L`Pp@P 0@ 0SP0`0:3S 8 80 0L 0:#< -LM||#  t3tS0l*`d3B0<0 X3P08 0 p 40 P%Wu 8p p P@q _p   0 @s 00lR00@0ϐ1PB PR RZ RW00d S 8 `20X2#`pt u @@X(pk t00 ?R 4` 0 S[   r  `R R  1 0 (K ! \D 0 ^(K:p P@0 ` (K@0s 00lRS  @0 S @@ ` 0 < 0 @Bos 00lR00k s008`0`0 0A@  0LlLxh$Q b8 -DSD3P`L@P? 80$ R, ; ʌ3SX#3Sp 0C#3WQW " Rp 8L 3΄`s780#0 `#ohi0τ贒?F/"oⰀ 2`Y?]v0Ppvr2S `0  0 04  0-H@H0@PLp0 (0h 0i 0 0  0-@0@PL:#Rtt - ^# 0ppA`0D:0` l 0-@0@PL :Qll Ó\0- pp#`0 :l 0-@0@PL:#Rt Ó \ "R-- ( pp#`0:0 0@0-HPSL@P p (0008 <@%8 008 0-L0L 0@L0:#R#R"#00: 0-`0` 0@L0:#R #R0#|""}#00:| 0-0 0@L :QQ σ #ppmP0p :0 0-0 0@L :QQ σ #ppCP0F :0\ 0-0 0PL @:QQ t|} ppÃ#P0 :a0 0-0 0@L :QQ σ #pp`0 :Q0 0-@0@PL:#R' Ó \0 @8 “%\8 --  pp#`0p08 ::H 0-<@<0@0L0:3S  00 0X 0-<@<0@0L0:3S  00 0 0-0 0@L :Q#Q& P",B“\"`#p@ \`#pBƒR#G`0J :Q0 -@0@PL :Q%Q( P`“ "\#ƒ“`,\#\ `ƒR pp# ` :Ql -@0@PL `:PP! hVh“X ƒ pp#` :Pl0 000 00 -LM@Z) pQp& c0 ,|0 ` 0 -/| 00 %/080 | 0< /03KT T0 0`` V:`c3P`< 0 000:/x - 0 00L0<@ -T0T 00L:3S 0ppa ` -X0X 00L :3S 0- pp`$0$ 000:#Ro/4$0$ 000:#Rq/000 000:#Ro#00 /(0( 000:#Rq30/0 000:/T p-L M@0@`P0$ K0ppp 2[S|000 SC q R 0:#Kp"[R 4400 3/Kpht@< (-L6  00  0-H@LDM@  ,K0 (0 $0 0 0 , 0 0K -X@LM@, K0, R0 0 K 0 0Kh -L M1A00@Se 10 0S^ 1, KP00pppl!l1K [ 0Qp1L1`0S0S  e 100S0S  Y030pp8  03, pp:,N2# K[P QPp:pà 0p[Jht@<000S/: 0-(@L@0S0l00000 0S/300 0S/E -LMB2@PQx :3SU0a3pp` 0SW10 0SFʜ1p0SC  0 B'd1`00|PB L1@ C-00 R 8 8 7-0 0X1-00   :3,pp0 Q`K|0`00|Pd @00@ @8 ,008d` p-@L$M0,PK<`K ,0 (@ $@ @ Ga8 ,0 (@ $@ @ =[<0< 000:3S  ,Kp   0 000:3S/ -T0T 00L:3S 03pp ` -@0@ 00L 03, pp` -<0< 00L030pp ` 0-@0@0PQ0L0 |P t0 ],d000*0xP 00 M,(000*S0ld` 0 000:Q 0- 0 @P0L:R* P P P0t\   ,00h\ P ,00 \|d`0 000:x0S,01/\ , 000 0\//A-` V `LQ/,pP UU( P@ TTQ  S@(P XPE P UPQ00 0 0@-PU,LQ (@0 ^0C0S0 U0 800-L@0@T0 800,-( R 0S0 0-@L@T0-^\ , 000 0\^ -L Mʀ4 ^2 P Ü, 0K|B 0)5Kh* -Z3LSp`@3@S 4S3p@`S -L,M*D 02@L0 T0H @ P <0 " 0PSe p 00K`80 0P+0 `Sp PE0  0 8@P @(K0`<  R R R< @V(X2@04SHDn(K< 0 RPHP RPE0PH< U@  80 eVH@80 L 80 P0 F 80@HX  P@` PQ-LM< D@0 8 `380< 3S-@0S*V> !0 00@ 000@PQ 80@ {p0K0P @0 PES 0 P(KD{P <0$C02@080)(K ``< -ZsLW`@C K@P03Q4 Q'W- Õ@ @@DP00  W#, BO@\  D@L| @W@3@TKh 0-@PLP T0:|"C02TP0:CT 000P 00 5 /sd808 000S :3S /<0< 000S :3S  b/x808 000S :3S /,<0< 000S :3S  B/808 000S :3S q/@0@0 0\ ʌÜ\ 0  !/P 0-0 00L@T  J3$S |B0pQ #3K0h(P K0hV0<0< 000S :3S   /`T T  P 00R0S*P4@//000 000S :P / -H0H 00L0S :P p Kh}h 0-0 00LP J3$S 3S p K0h|B0tQ 2K0h`(0-$$ 0  d000 000S :P /0 -LM008 0p`V# ,@K [$P0p ;P 0 0p p@ 9(K 08 @@P  P / -jLP R3S @P4P30@SKh 0-@L J 0s3$ PSP"0圿P |2 $R 02S 0L3G |20"1#3003000m0P :3S// -8Q@PLP( '0S&  0S  0S0,0|00 R   R   R  P u4T `TT *2S Q P Q0 y| T0-:|bL0PT!@RN   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @ &  (!R 1S ^  08!R 1S X00S T@ |'(@ Q0@0@!R@  @  T0-:|2Ha0`T1LSP@/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  X00S L00001S@078@0  d808 0 P @0?30Q@ 080/(0( 0 Q0/X(0( 0 Q0x/ \0\ X0 0 T@0ʌ|œ78@0\Q0@0/0 00x0 00HT 0-P000 00L@ :0$Q@0?30R@ 080/R/R/ -PSL` 0@H@?-$$ 0  0TD0ʌ|œ  \ @0R78@00@0/@/X 0-P@LM00 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/dd0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/d 0-L@  00 0K0hx 0-LP@  K0h -RL M@ 0P P S CKh  Kh 00 0  -LP@`#p Kh -L M@00 0  @ K -LM K -LM,, 00  K -L0@"`  (  P \ GoD  Q\<PH    BQ   Y(K0GS18&0 00 000 00   P 0S006 , W10 000(K00C?00(KT0`Xp`00pGW%ڬ` 0W00 0 p`8 0  000000000``00S -LP@` p0 00Kh -LM,, 00  K| -LM K\0\0T  0 8Q Q @0<@0/6S/d< <0 0001S 00 @0<@0/dP0P 00008!R !R @0<@0/6S/\d,0, 00001S@0<@0/d\0\ 00 T0:|20(Q Q @0<@0/6S/0 000@/PT0:|20(!R !R @0<@0/6S/0 @ /@0@ 0 P0 Q AR// 80-P L@`P! Qp L3fY ,<00`V $00P\0 00Q 0S0BSLP //,0, 0000P//Ld,0, 0000P//d -L M#3 0@`V 300S`H0c`0QL zSP HR  H4 4 pAWQ ,  X    !0pGWPEC R0 6q R*0 ?33Y0",0P D `Q,  xPPp(KP R4 4   BR 00pGAQ0 4PU 00C *0PEUP  (KSaa BZ 0 0 PBU4P ,0   ^  0   !-Y0 40R) Rp W,0几0D Q0 `ܸ,0 0x0p0 ?## `p4000Q40 P00S`0 0CPVPpW 00P0/ 0̼0Q /p@-@PpP`V0A(, ,1C Ba00V00@PpP 0S 0@//P 0S 0@///// /// -,0P!PL3@A,0p QH`@?cq``W2800D9xp0?330 @WD)Z0?#R RwsL\ 0 @ 00C x0 00?oT 2 R0S P/(00!//-(,^0R0SQ!R@ -L,M<褮P0@-, 0S)  \$@ T8 @ƌ^t p8 P,A0P@T 0@0T00 S00 Q-LP9T$@0S00â?0 0\+ 0T `ApB 0S"0`V 0S0pW `k@ 0 0 0O@U80Q@0@080/ - ` 0`FQL(`0P0 ,, Q B!`Sa ` p I D@T <@T0pS ` QP(`T0@-8  P E?J0R|"8000^$8  Q0 00S00!R0$R0 R d1S0800800\^080 RQ-L M0 40 p`sڈ@Po |倀儀 P,j j۰PP0g V4, 0 04RH T?#P#p $p H 00@0x0L0<8 !X0\0`0d0h0l08 (Kz(K ᣰP45 㝰 P9 00@ `\" 0I P`P ppZ Pʨ0S @(K @ @߲ ݲ۲@0 ֲԲ Ҳв0 @ -LM4Q@Pp`PC QAR   B P3 \0 X+ P&PP(PP D0H D00Q0H p$`00P@ 0 R0$KP$K耧 0-LM@ P0@K0 0-LM@ P0@K0 -LMP K -LMPAp@ `hJVYW0p ʜJ`J0 X`x``F`P0 PPI 81D 00SH0/00 PR p$(00#p@0140 0, S0V0 @ D哲0?33 V  4w00pS(K`000H040 0 0 `400 0P(K舥<0 0-LMh0h0@LoL   0  PhPP 8K0蘣 -LM@44 00@ @ KK QP-DLM00@$ 02K谢8 / p-LM0 `NP0C 0 0F EKp -LDM`R`F S` P0@00V B`P0C`P@APAAP W` P@LPLL VH01Ah0 1\0 0l d0 `0\ ,00@h0@l0p+*T0KX0 X  @ 0 L RT P0 LK0 0R0P X @W*d0`V\00\0 G(K` 0R / 0R0 oRP\/R/\ /P 0RSoR// -Ll |0^O0P ,!0 s0SP H0 P00S0x0  H0 PU P00|0 |0SP0,0t0 T0 @0 =0h0 P0@@0,0T@1X0 P1L \0 `00,01L00 x RL 00P `0D h0x p h @0Q?330H0 `0\0,0000,0\0`V0V 0Zp@Z1Ad P `\Pp,pLpP 0A @D08` ?388l p@0P0 H V8So00S4{  0 \ p000|PE p0SB 4S 8\  >l @P Z 0 Pp 00pM 0P 00P fu = 0p` 0 0 B0h 0 P080\00S0\P0@@ 0jp000P   U P! f@1l   0  8 Np000P f,t1l  0 8M RPlp U  1P 0 1Sl@pP6 V 0` 0 L5S( 0\ 00RPlpU 0P 0L pP0V0p L  `4S 80S00Q0So L5S3r` p-LMP0P`@0 R    80t p  PZ80  @00 ! B 0C/?! 0 Kpk0 00L0 hPL0H  ,K !0 80 dX00S P00@  R0SD0?ੱ@P  5/@TD0`0<0@P  5/@TCt  0-LM@ RP !R "R Q  (@0UK0 -LM00 0 K@0 0-LM@<<<0 0P0 @/K0@ -LM@@@0 < 80 @@ 0@K8@0@-DB000 \S@R ^S? %@@; ,S'S \S:Sb{cS10AdqD A0}dAD0C00000000 SPU. 00ES0@P00 01P\00C00L0'00 z?Q 0-LM 0K * d B"!1L12c0A"b L0( "02!1@K0赁N g 0-LM 0K ) `@@2@00 BL 0LL0 "12@K0kL > -LM(0K )@($dD A0@ 0$4ƒ!b1cP!b1c 0@ A  ),0 ##3!c!b1@K-?L@ *S0%p - 0  -L$M8  9pP 80 0 8 & 00R0@  f娖` mnnΉP@ `< ,Rx6T \ 00@0 008 0 @ 8 080  RS  Qm%R 8 +0JGSU/SRPONKJIHGFEDCB@?><:9876543210/.-,+*)('&%$#"! [iT0 S\R 0S0\S 0 S000 X @0PC0@ T$ <000 00 0 0 h/>0 0000 00 0  00 (K080  "!.Q *Q080  @0 R@90 SP0K@% 00dZ0 00@ 0 d 00@0 8 PeuP90 S0000 00@00008 0  0 SŸ0 kΌ  0 00@00008 0 0 Sr<00 00 08K000 00K H0 0 0D H00 000 w00D 00 @@0@00 8 0 S@PN %00@0 c 00@{ 0 S0P00K5 8KO%+0c 0@0 0 @0 000@0 00Pe0 8 uP% 00iZ0 00@ 0 8 PeuPp( 00(K00KD0 )D00K#0;   p-L M@0@P`0S PS"  00 K0"P 0 Q0 Q`00P0H0x 0 Kp0 Kp3dH:4::P -LM0S 0K0 0KK@0S pKaI$P0 `VP$@U @ 0PfSPKKD`Q`P0 ' 0K2d~ -LM0S 0K0 0KKP0S pK( P0 `VP$@U @ 0PnSrPPKL`A`cP04(0PK1dh} -L M0`S(0K0$$!'0K&Kp0S= (PK0P4耟A0P*0< qW# X $@刀0sSPp @TWV 0S ]f@p@@ Kp K0d| 0  -LLMX l 7P P0K$ h0 0X K:` R0K @P Pa \ 3s0p0 >0pl0 0SM  R T0KS K`Vz #V =V =h`P 000`d0 lPw  X;V 50 0Y*S\ a0P\0 \0S0, \0 eVP ed0 PSN :` @P\P@xr`,p\ h` V AT@ 1 Pe= 10PP e ` VP0\0 (KT@K$P 倁 ;0Pd0 I d` ~0, K$0T`K P 4倡 P 4>0`d0 @[TK0Pl0aP P 0`@d0 >d0S (K  d`@0Hᥓp0< ?${ $ \x Xx X c #0S0-L@,08QP P2᎒P,0P0 Q0-PLP@P040, 4P0 -L00 -p`@PL0\ %\0pS sS lS@ 0\TT  1D!01 CR0@CUPW ^[ -䯟LqMQ`P G PH 00 40RQ yOK$  =KpH W0 qQ R KQ %Q rP Q, 40,(K@P%T . ,pK>g01 0DXSXaVU^SRQPONMLKHGFEDCBA@?>O<;:9876543210/.-,+*)('&%$#"! ( 00 00D =P@0A?S@0@0^ R!1! D]R񏐲!~}|{\yxwvuvsrqpPlj hggdE"a`3p]\[<YXXU^ \ -00A|l0@01K0]P(KJ@`V\P` 00040SP, 0000@T$ 0D, K!@00 Y 3 !P ,40 qp 40P4 0pW 0G, K!S00 夐 pG,0K1&@D0p VT)s'&%mD"> 4!B;Z    $30@T @D,0K1S0@ POQ9 ?Q  ;Q  Q0 0%Q a0As RA0AS00OS3 A, K! ,K!000 1S101 1Sx10x1 0@T_ @Dp,0K10@ P OTYw10As R0 OR,K1PT  T 0 0 R ,0K1X@ BT0 ! Y1 +P ,40 pp 4004000@OS ,K!!000 0'SS 0S'S'S00S  0C, K! 00 RQ  ?R ;Rn PeR~ Q %Q0  01 0000 0B 100 OR,K 00 0}SS 0S}S}SVJ0@T @D,0K10@ a0As R/, K1 90pW pG,0K1!T0p ' ~T 0pOW,0K0 00  R  B0 OR,K1 ,0K10,K1 0 ,00'00#0&@D0VTm|y00&P 0p0 ,0Kq1@ 0@ 0000< P$ 0!T0y ~T F  G0060pOWQ0, K1!p夐0p ]0pY0pY ᕧ0p @0p0p00pY0pIoᩒ)'H*0pY ᮉ0p)0p P0pPi 1P @A0AS3AՕ/o"P  --LM 0  K --L M 0  K --LM 0  K00/̤ -L M`QPp@. 0S0T0 00 KW& VP CX 0x09 X*T /Ti KG`P Ppp0 0 R0S TD  T,T T, KEkp 2[S "[R1 000ST00P 7W00lP ,W00@ö4࿶xy 0] P% T% `PV @P|PP0EV o P -PLU`p@ gP T  R-L@P 0`BSp%  p 0! p 0#p 0S `ᔌP ` Q00S00S00S 0 P` @pp0 R U \PRp`0P`  Sp oCp0`p v`榏0 `R0`S0 V0`  p`0Q1U Br 0R`V, p `W $0 p$0 0$9pW 0S  $0p 1`!nV`02 sV# fV  0 $ `P $`0p`W00U0Sp 0qQ :`0V0U ppp`Up`W`` 0_0 `x0 -Q@!LMPp0 ld P 000S4 P(K`P Y4PK0pK 0pp 0 RPG(K40S! 0 PP _PP 0 00pPP+ P0 *X`P0 P40  lX -LM MB~K04 ` pG0:S(0@:SS 0:PSPSPU0D R00X0S  ,0K 04 TL_P 0P`:S (K`(K -MLM@ 2 Ÿ0` Pp@P< 0/SL ^P Z PK PMP 0 (Kh}0P BNKT! @D kP"8 0 r(Ke0P 0S/S @P ់X 0  0 P BK  @Fp 0,, XT <000(K,000P Ќ | X \  ȋ -LpP^P pd`P@` @T0 P00@0A0$Kk ؊  --LM@\00 00 /K -LM00 0-@L< ,K0h 0-@SLP:0S P0~ -\0 ^ fQ00\ PnQ0 sQ\00 - `LVp@fS@@`V P0P0nS@ sS0@`V@Kh -L@PpP4q`V'*0<P& D0< `D0<0 D0WD <0` nWD p' sW, fWD0< DH00H00 5<P0`Z |0 #D0< 峀D00D0D0< D0<0D0 D0 0D0?  -L M@0 pPW `V 0$4 40 D0 े00P ` 0P  W ൐0   0V㲀  0 R( Q8Q#H R, 0 C(K4`P   (0Q $P` 80Q 4P` ,H 0R DP` < 0@-88! 0 @ 00 @R9 ^  R@. E^\R  :Q  R@ R Q \^^ @R Q @ R  @ @0< -L,0KlM#\ ,T0 ;`P0l0  |sP0@0@|/P0P0PLPS 0<0 80 寃P U \0AT \0 ,TsP: 0S7 L\ !t < " x X X .S  ROSg = PP$ 0 0p`v` b 80,S+ 0S& RPR ,T;P 0S< (K# @P P Mp`vP ( 0R Q0V  RP @KQ@0@0SPv P $0 P$0 0$0@" 0"0TS\0 p@4p l0<Kh0 P <040d0 L0 7Pp 0p0 \P \ 0'\\00StW:P0%0S0^\0S P@U0L 0d 40HQ4 *<0 Crv~ ,RP 40, `404, 04040,0404 <4 8040 #M0pLw0SE0L/SGEDCBA@?>=<;:9876543210/.-,+('$#"! p@{ @0@Sq .pPu@%  0Q R 0P  RP P 0 P 00@000l 50@ 00@< 00@64l 0000 P @ %K L &@00 CR l  00 0h t\c0UqT0pGWpL0@pL p@ pPu p|@f ( 0R  Q0\  RHPzaP $0 @$0 0$0 0h p\ 0P0 0P0 $ 0 \Z  0 \S 0L 0P L @p 0L 0 0L 0 0L 0 0L 00L 00L 00L 0ᖁPU pq@p 80,St 0So RP,P9 40, @40, 040# 0#L0cP 0h x\P @)\   0 s0 " 0\  000 f0 <Ć (K?U0P0  ] 0 \x\ p@ 00@ n0 ` 0 \aq@8\H V { { Py y (x P/b p-L4M0H`K2P@P KpW0 00S !R2Kphx - Q !P 1`pPL@7 0 4S0 00"0 P,xPp00|PQP`  fYPpgŅGPQ  ZY|0P0ŅPPE00d 0-hP@PLP  $,00 R00d0 000/0d$0$ 000P/ / d` $P00//Pv -LMP(0K ($ b"1!1h"b2c L0@ 0 0D`0f@B!A@C0PK赁Nu g P01cK//\u -LMP[(0K a( $0|`` B0C 0"2@`0fAB@C1dKPKkLt >( 0P1//dt -LM@00K "`0,圆f L0@ 0$4!b1c!b1c L0@?AA0 T0 !S1e1cQ80PB0?ZP$K-?LГ *Ss 0-L-@ l@l @00@0s I SPJH $KK0II $KK0h 0--L(MDH0@  @@S񏐶y@*4GG1kc%>hO'lD. ~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRsP+lreO+%BX0'&%$#lM      ]0cPD0 ʈ$ 4@ P0S"h4"KDK P0S !00 $KK00cPD0 $ X4@ P0S"3"KDKP0S40 0!00 0cPD0 ʔ# 3@ 00sS, 0cPD0 X# 3@ P0S"83"KDKPu0SP30 0!00 0cPD0 " 3@ 00S"2"KDKP 0cPD0 ʈ" K2@ P0SV DKP90S p2@@@ ,0 y"00 i0cPD0 r! K2@ P0S* DK\P0S 1@@@ 0 iR"00 B0cPD0 H`! Kh1@ P0S DK5P0S 81@@@ 0 B+"00 0cPD0   K0@ P0S DKP0S 0@@@ p0 "00 ?d Ԅ  G܆ ܅ @ @ L  d  0cPD0 4  K<0@ P0S DKP0S l0@@@A 0 "00 0cPD0   K0@ P0S DKPa0S 1@@@ 0 "00 0cPD0 T! :{kSF{ { 4@ 00S DK{P s0cPD0 |# {kF{ { 3@ 00S DKcP [0cPD0  # {k k X3@ P0S DKNP0S30 0_H!00 80cPD0 ʜ" {k k 2@ P0S9 DK+P0S2T0 0<%!00 0cPD0 `" L2@ P0SN"1"KDKP0S20 0!00 0cPD0 Mʘ! 1@ P0S;"x1"KDKP0St1T0 0!00 0cPD0 +! 41@ 00S"0"KDKP 0cPD0   0@ P0S"0"KDKP=0S00 0!00   $ ~ H } ǘ~ } G} | (| } T{ | z | U^  PEt@T   !R 4Lt%00` L0L QD 0S@U? 0PEt@T 0S3 4%00` 0 R=0 U& 0PEt@T840G?o20$0Q000 $4r '$0B0#22cR0St 3L@$00` 0D`30VQ U`18 V `!V  <BD0< 0CI D0PE8 < 0D`l0` S*XT@ U 0PEt@00 Ql @Dq T U 0PEt@T:0jD+10 D0@D7q+U 0PEt@T:0H 1j ;@D0H 7q;T{0PEt@TuUT0PEt@TU}$0Sw'$ 0   '4 4K30K4pKG0h!K p @pU_  PEt@T$ DpRp,  p@4 8R,50C0 @0 B D R1!80\! 0C80 <0 BD 0C Q < D0 S< 5 0T(^ ^ f =?>?N?O?5?hd c A?H?(W L?` J?9?:?;? `` U9 0PEt10@\`j+7~ @DL3q@D0qL`< DB $0Sp0  0p3@0Q  ;7s@DD n 3+0'8<#0#w`V \4L$00` x40;7s@DD4<0  4Ld$00` P 4RD`0 @p0S \ 00C$ 8 P0l0S>0X p0P0Xp0 t P l5L,%00` 5`05L\%00q@D `@80pD0 F@ 5L%00` 7p` @ s Q`:00r PlU R~0PEt@RxU`6LT&00` ZP 6R0[`LR ) R0PEt@RU='''<3K2K 4K4pK10K"<l0R` 1YU d` ``U PEt1@Yd`7s@DQț7~@DD@p7`00S<0Cb  0t88L07p` @q c$ R'400  0 '4 4K4pK30Kp8@0;8l0'4 4K4pK30Kp@0 \7p@D 0@D''q00 )S ?0S%X9L00` L<0 080P0`0Xp`p0P0d  0cP @:L00<:`0b-m`:LX*00 `Y`Lq@DT p0\ d dT0 \0` 00h <P :L00:`0;@L`p6;@0;L+00 -@PL 0S $PU `P(80S 5/$P(5/00` -@PL`P 0S $0S pP@0 QR 408 BF400 @8?U000p -@PLp`' 0S$ $0S! PP 0R| S  P00S   0S  00>?R? 0-@PL 0S $0S MP0  $000 -LMX2X"0`PP0(0 0S $0S /P@pT5 2 Rt  Q0.,K 0A+ K S 0 <@ P00cS R#2^ SࠃࠓP0S@0S60l0@TP  N Q00cS R#2Q S Q0Sl0@S@0AHX0@0( 0R $Kl0Skؤ(S??? P-L 0S $0S P0 Q@oA? -@QLY `VV $0SS {XPKP!(P6/pPL 8`V  ( 0(3/`P; 00 @ P@ 0   0PS0P *p0V0C0p0  (08#8`po=PT0@0C0PT0($03/ P-L 0S $0S P 0:+ 0-@PL 0S $0S P Q 000 000 P-L 0S $0S P0D R , RD0+0BD0C?L? P-L 0S $0S P S>p0@@G-M@@0@>0^QR APQUA`Q |^ `\W PU V`! V! 1PU `vZЍ-0  0Ѝ^ 0Q0P0SP0e`0s0V0R @0C 0S P0RS`bC0P@R@0 P2 0 PSЍ0,4000000@?o280@0 0<0 00 $  B( P 0S03p`05 :U`03P340%PE P!0'050%00%P!( p490C1pp Rp`P00L3 0S C@ $Q0 Br R$A\Y   \?( @$ T:  Y `(\ L (*Q BR PP BRPU : 8 Q  Rr, %Q  Rl

A @ 0G-\ X2HM00 8 \C P,`4p CP@PP $PPP8P@DP00<T(0@ <0,` p4P0R@P0 @hAPQ35 B@@@YX1: ]P Uم2  B35Rj@@@qD@QA`36 BP @Tld`$P`PHV B34(@PFT*0@KT @Tc,@`@DQ@Q`P @VA@E@VQ@EpV@pE`PQ PQP  (I\ 2ALaX%@0H 2a" <0@ HЍ@`BPE0  p`T2pم  6 @T5*@E@@Q8@`@D@@pDAp`Hp Tp @DT@@@A:@@p@H@p`P``A``UQ`HQ. PQP& @`@DQ@b@4A`Hp Tp@@@HU pq@<A`Hp Tp `pA@D@0`40`W@@0@H5(= Q???< (; LD, 0qR0C0s0\0@0qR0C0s0\0/G-,@l0A/D BS@P M8`PA_ P@E xPp<@0\0 @00T | 0t0"!!\ 0 01@40P R 0pP P P@\\ U: 0S1! Ѝ  0@ T5@ T5@ T5@ T5@ T5@ T5@ T5@RLoQ 0C `^0pP0p00S0       0S P /0L *SES[SgSqSS90C0/ 0-SP1P!UL@` 0C0 Ỷ00S S 0 0 0 050 0)0 -LM@,A/J Bt 04 2PZ00SV ,04l # 04ᾀ W@pH0局&R Bp08P<0Q*lPt `Q *P0CSP18 P6V(K, Q*PF\0CPSP18 $6PV(K -P`L@0T@!T  0  0CS@B @000 -LM4@< tP( Udl `0pp8HPXT D`P4 H@Q x0d`p P,BA@@\S`Q^h0S/ 8 6\f PV !9096&0CR \0l S8 B0l0\0 l0 tP0PERl0tP(K0tPPE Ulh0tPt0 S< R S Sl `0px0d`0l Sx0 PpB QS`d fBq0CvsPA0t峀06P0ALI" s0S30җ1Ӆ1&=  tP6xpl P0CPEG40 8 0 tPx0\Al0:8H X`T&" D`4ᾀH @ ᰀ0Qx008 4p0 pGRlph`0\ 0R8 Gl0\000Se tPQP`~x0l &hl QR010#<6P) 6SL \0S8 B0l0\00(K8&VP0 ) )l h0\0S8 B0l0\000S(K輌DP D4-0 L$M4 t?pP@0Cps0T0ƈ 0C s0!I.S# 30җ1Ӆ1&=  `t 6QN0C^0C?ol \2t0 8X`Tpm0 `lH f"`H`S= 3^Ol08H XT " D4@@QH 0 , CA/B BPq`&PF8P0ƈ09096&0C0C?otl 2N Stl \0l S8 B 0l0\000Sm(K Kt1Q40S Q6 Ql0P@D A8 @ L < 4 @@ @H @ 88 <`D H0 l0L&# P0 0\H P`D0 H0L@8lm l0`l04S1#*\ &R \ R8 C0l0\00(K\ R8 C0l0\0w00S(KxDP -L M` ,0IY0 !20X0T0X0S0D SpHor 0t0 #4 B $ B B  0B1U"T6WC6@*01T[:\ lPPE@D# 0S0S@1TP1 T:XpD pGopr \08  \ 00 00@DA TPP\  /W  B@  @ 00 @SP ,08Su A , l 6\ AQ@@UF (K00 @Szl 0 \\@R300 P V0Spӏ S00W #̠ #800#"0 p0oS0c0ŧrj0S=0 p000` S *SC00 6R;Cl R 00C0#2 2c0# 0l0S  00#  #800#"0 q000S0S09S ES IS! [Sg gSg  R]YV ;0S0(0(K10S 0>QK  J Y:3 0 X 0 Y %*I 0 ,0 JSR  B00V X; R( RdR@0aR00]  , RZ0 0I000S.  0 0S0   0S,0SQ: R,0S  R0 B0=00 0[00$0S,0  0$ 0S0   0S,0SQ: RM t00   0 0  RC 0,00Q0Q0$ s0Q0s0R 0s00 0 0 0#40 0  0 0 S0 S00ӈ R01 0 0  0S 0 0 0#40,0S E0 0*0,0S)  R0 B000,0g  S 0 Q0S 000#40c0q000S 0 B0U00 B0N0/pVy 0 4 V 0Sqt6l 8`Ƙ Რ &!909&tl0 BI0Qtl0Q Yt0SVF :V㴖o 6S9 \0l S 8 B0| l0\0m00 00#400 03 0  0#400  0 \ R8 C0; l0\0,00S~J0 0 0 0 0 0 S0 S00ӈ R01q 00 0S0 0z020 p00060,0 J0f0L D!B t0S*l0\064p p0pt0&l8`Q  A R, *6ƒ᱀9096AAot0l 0C t0l Qu St0 SV} S S`l8 R R,  00 ZZZZZZZ0J?o R20S00 B IR` `0 R 0B&Ɛs0 0 01I>001&=  AAo`t0l 0C `t0l utWBDP\0S8 B0# l0\000SN4p\0l S 8 B0 l0\000S00/*V4p6 &R \ R80l0 Ct\ R80l0 C0000}00z00w00t00q00n -`PLPpP 0SM $0SJ PGq@A Q00W0S=0S 1 0!1 0S yp* 0S1 U Qj6S S L D!B 㨲06| 0 1 0P |0p0PL D!B F$F -@PL/ 0S, $PU) y`P&0(pQ 5/0$P(DQ 5/0$P(@Q 5/0$P(8Q 5/$P(05/0qW`0` -LM`20 80 0\Pp00  08Q1S00P 0Qz $0S yV0`f40 V00`F40 GQuFQRq00 YSmFo40媢SZeV @!( `4/@Pl * !3Ƞ40@ 00A402P  CX0`,L0T  0 P(3/ 0 8,(3/ 0 @L(3/pjwD 0 v(3/68!Q ' @ R$ D PR  0 0600&儐0$(Kok080( 0$0Sd080$0z(K@ @0 8 000b -LM P 06 K Q-LP| @Ty $0Sv uUPn 0p0` 0S`  00(!4/@PZ l!@= 0 ,P(3/ 0 8,(3/ 0 @L(3/D 0 (3/8P4 @0S1 ooD0bS`V*, 8 , @ @ L D D 0&0C&΄ 0 0夆$0˄+vRC-`  d 0 R0#s01&d#R PB$3R@@0B  p` tlawp |pq`& `&&,|,|,d v`,Ƞpl|a ̌   p̌ t awp |pq`& `&&,|,|,d v`,Ƞpl|a ̌   p̌ t awp  |pq`& `&&,| ,,tawp,Ƞ||q`&̌`& & hpv`l | Ġ|aq̌`& q&, p` l Ƞ xq |̌ p' a'T`&lP RPB%Q@ A p` l 8 xq s0<p'a'T`&P R< 4 00#s01Q&d#8  l  G-RBM[B(0@A0T0 `P0S p,0V @p0S P,0Y P0S @,0U@ P0S   ,0 UB!0 BߍP 0 0P 0 0 / 0Q /0Q /tsR@-%@pPdǠ 6l2B $'!8 8b" N 0C0qQ H  @ A R,A B0P C 0@P @@qR ȠC-p Q R RIVB0 N@W]0T`TpT0 `T0 pT`0 Tp0 `T0 pT`0Tp0`T0pT`0Tp0`T0pT`0Tp0`T00@0UhHg7VfBVcV2 R0@LRR Ru@B$B PR0^^`^ p^0 `^p0 ^`0 p^0 `^p0^`0p^0`^p0^`0p^0`^p0^`0p^000Ud@ B"  0 Q B"G7dc"2@L  0P @@|0 \LL R  0Q@08 P"7&c @2@L 1 Nq-/ U/ 0`0/5[]G-:PT0/SM %pQ͌0!S /\˞U A@`kṐY @11: W: 0@Q=0@T! Ѝ QQ Zࠁ -LDM @0 ` T ZVP TP4p QQ \0P4p\+ VPp σ pP 0R  !QP4pP XA   A&ST PÀ qXQ=0pP4!\ 0C` P4 ` `T$`; BX T$T;! 0QQ=0P02|0&s06v0 `kd0 Td>n 0\ `SR0/Q h T0 X!X ap0100P0T0T ZpYpp` Nרv0Бs#\X6 `0v~.X0ST hRK T Y> 00`X0 pn@Qe  ^0BQ Y> 00A .0I000Y0C0PT# X0X 00aY^ T@ 0`FqZ 0S pF0@C#6^T@XHX0d LK ( 00\0P r 0@AQ , K"^ "N Q 0T(K 0=A-P@\A0RP0@+}n\( \ 1>000R R# P0T0S R S PR00 P0 S0Ѵ000°0Ѵ0P0G-pMWPPRH@!j00k0 Xᶐ=Y1 X8Q^ @@@0 0@#4@06X c\ ἦ &0@a2Rs0As@ X@&Yn Y @P0 0R0 pЍWƖ0` W !.@ <bs0 Qs P 00P#40Ɩ B0lT3 0s0Ɔ.@< as0 Rs hP   0 0P#406A cT"r HQxr I0 q 0#406Y cX0C⸀6@ P X+-3ʰP< as0 Rs u  Q r J0zq    0#406 cZ 0C⸠6` @Pc! V  P <bs0 Qs" R&q4 J0z q 0#406 cZ" 0C 6, Ɔ^@ 00@#406 Bc Uq R&q Hx &@   0 0@#406A cU"r Q r wHx! G-Z M6k~ S἖r <4`0 00400(400 400400# 9 as R| 0@    0@#40编Ai^̠| |漖`6S0ƕr0Q  , !@`@9ds0 Xs    0 0#406@D cV"@r F0r 1S tacL|$r ^r@`  `@"$@ FC d\"@ r FAQ0003ӕӅ0ಐ0`i$rV| T@`    `@"$@ FI dS2s ἖0rcV| `4 fAqɌ| R| 40    0#40编`Fi6 `Qq S q漖]0Ɍ a| R|  k>  Ѝ @ Fw ἖B ἖ ἖:@F@`kp p @`"$` &AbS00 Ѝ     :&@-R Rk.  k &k.@@ "$ :&@-R R k@@&  B&k.@@@@!ƃ0@-P0 @ K@ +,K( J&̀8+k. $ˀ0PG.V 0S 0 ,S0 + Q0I0&&&&0T# -Lʀk~@s0p ^P`p 8    "$ &bS1 B0&^u 0  u0#Ġ  <##400 C   0 6W0@-k΁6 S#r r@+0P@@@  0@P#4P06 c^ 0C6 S0Ҽ60k.@@0@@@#4 06 0C60@ 0@6 -LM RpP0, R I.0 40 0`&M80 @+ (+ <N 40 BR% pQ j \ 1! ^3 "Y0kS\0* Xq8s00ἆ( Xs0< 4 Aq8s0k0 00#4 0缆0hQ3s0 H0ἆ4 Xqs08s0k0 00#4 0缆0hQ3s0 H0ἆ Xs0Bs0x k   "$ 缆 hS2s0 H0ἆğ MΌk00#406cR. 0CZ 6ڼ0 / ! X8s0sZἆ8< 4  A  P  \ I0 ,  R3 "YOjk>&MI.0ἆ@0 XPqx k>   "$ &bQ B&4N.V 0G. 0R < S >+ 0 Q00W0&&&&(K(Ko &MI.@0 j 0 r 8k.0ἆ8s00 00#4 0缆0hQ3s0 H0ἆ<Aq8s0k0ἆ0Js08s0k.0ἆ8s0k0ἆ+R+R,R I.0 EPS R  MI 0 I \  :Ɠ0@-V@Q@F   !I.AQ!ѕ"х&  & BBo0) ) -LP`@C h0P `0P @T @@V#@T yaratcid -LM$@K`p( KPP K 2p ( VK.P 0-SL@` Pp0Q C `0Qp2W p#p2Vyaratcid -L M K@P @oK -LP  -L M Kt@P @oK -LP Ҧ 0-L@P ɦ@0 0-Lx@P @0  0- L@P @o0yara -LP 襦  0- Lp@P @o0tcid -LP 茦 0-LM@KP B2p  <O@PK0v@K0q@K0yara 0-LM@KP $2p  <1@PK0X@K0S@K0tcid -LM,PK`p0 K@P  1p 0U 8@P 2@ K-@0UTtcid 0-L@PP 0P 0P0tcid 0-L@P (0P0 000loob -PL`@PP  P 0-LP@ \0P 00 P P 0 QPrbmn 0-LPt@ \0P 00 P  P 0 P0rbmn -PrL`A @PP  vP -PL`r9 @PP  bPn 0-LP+@Y d0P 00? P> Pt 0} 0 QPrbmn 0-LP@5 \0P 00 P  P^ 0K P0rbmn -PrL` @PP  P -PL`r @PP  P 0-LP@d0P 00 P P 0 0!QPrbmn 0-LP@\0P 00 P  P 0 P0rbmn -PL`h @PP  P -PL`` @PP  P 0-LPR@\0P 00f Pe @P 0 P0rbmn 0-LP1@_\0P 00E P D @P 0u P0rbmn -PL` @PP  3P? -PL` @PP  P+ 0-L@P$0P 0A0gnts -PL`@PP  P 0-L@P$0P 0:0gnts -PL`@PP  P 0-PRL@ @0 0-LCP@P  00 000  0-@L0P RR0 P-L 0R P Q ̠o< ; 0-SL@P T``#P8KhiP Kh;P 0 -LP@P &p`OP   `X@ 0-LP@P P 0 000 -@PL 0 0R iPP 0 00  00PO`P Q #`P: -PPL x0 0R9@P |O`P Q {#`@@|9 P/0 0R /PP/0 0R/( 0-@PL X0 0R  CO0P Q B#00008 P/,0 0RP///|\8 -LM@P ?o  2P0S K0S0 P 0  P`OpP 0 S  R L  1 PPp cQ00  $ d7 X7 -LM@P 0 0R KQ" 0   PP`NpP 0 S d  a1 PPp )Q,00$0$ $0 $ |6 L , T oP- ?o02 ^0S 0 S~  P-L<0 0R P /o5 -LM$0@S`PU  K KP,0K P ,pRNP 00 (0KP "KS P8P mP P ,0 0D 0 //  0-RL@P 0S% R:   P0O0P  ,0 0X0X X0 aD0D D0 Y000 00 QT  ` @ X 0-@LQP P0Q0 0-SLP` @ 0S P@<P QQ P>Kh 0-L@<PzP0/sP Q lP Q>dP  K0h] 0-SLP` @ 0S MP@<EP QQ :P/4P >/P  Kh( -`LQ@ 2>Q# &Q P Q' <QP&PQ  PhPPQ PR(0S0$00`>S@ /S~ `(`  R R00/R00>R00 B\00S{ R `R  R R00/R00>R00 B\00S0FU0 S fP0/S0$0 0>SH SQ  0R R R BR  R  R R BPQR 0 R R=R BPQ1 R   P P=P @\Q! P|`FVy0S0(0{r0``000 0` 0 0 ? 0B00"SX0 S 0R "P P0J C  >RE00 @-\ <\ AQ R\ <\6 &\@aT lTt\% @mT pTo\s\;\'gTt\;\>@pT@;T;\<S0SqTu\o\t\;\" Q-0L  eo -LMMMK`X1QK0H1 O?KL1 N?KP1 SSS@P+M0!S0-S0-S0@S@S -S 0-S>Q@@ M -MLMPR`pcP 0S ə@0W : sW[ /R 4.0BKH0ᷙ 0 S*100 0 Vlp@0  (U< PP()0P K? 0  K0CW /RW  C B/QW0@C0@T@!BKH k0$ K@4DÝ 0  K0 (p (P(DP(p (%(p0P  -LM`}PI@PE3 ,'pE KF)pG dKe0V@p `0 0 `x'p)    `0 xp 0PP$K0`p `w'p  $K(@L$K'L@ 0-@L (K0hL -LZyP 0 0 ئ 8 <  -LIMMK@ 'NK00 `PX @AT{ 0 R 2/0pP9yf PB0mK0 3/U@ 5/T yT T@AT8A 3 p0S7 03/P Z :/x81pS @0 R 2/0Py$ P Z :/W8 003/U 5/mK(K 0 0C/^ 0 0C/U 0 0C/L 0 0 C| |0| 0 p:h h0h 0C/\1 \ T H 0    Fp <L ! -LP@P-  PP$K$0SP  RlcP P DPP 4 `PPP < ( P0/ -@LMMMKH T! L ,T0 HL00D! S@! ,S/KmKQ_KNKOKP! RK T%`0P! QP4 HL0 @04/@PSoKR_K@HL003/@0 6P(KT@D1L!HP <80H SL D! @! (KT!R00 0 0K/m<  0/0/ 0-@LK0hsJ ((-L Kh8pT2l (0-@LڒTJ0P 0-(@L@ 0$ 00-0 S @ UT:0/S  R0P0/P0- 00#0 A T0!RSR0/T0!R0/ -PAL@Zph`P (cGP ,O`P I៑X`(0( (0 tXh ? p-L,M PP Ao/ -PPL@E@P@FP`p @E@P Hp4Z0,p0P4080<0L ((-LY Kh(t 0-,@L@ R0   0-L@K0h p-L M@P4 00RBS,0 S R$ 1`V/ P` 00 P! 40, 0C40P- `KpS 0 0 rGGKpR Kph0h h0 `[X0X X0 SD0D D0 aK l h b  q -@LP,`EpP V 0 !,p0PBG,p0P -LM@P pP 8!0 P`P (0S: 0 EP (0S G#0`0(K$`V00 00KP 00S`  P  P X  `0 .P F( (0( 0 h   t < 0-P@L@0S 0  Q <0 0K0hjP 0-SL( (0( 0d  KhF  (0-@L0 -4PLUp ,@焑Q ` 00E`£P #A焑Q ᷔPX@ @X@  0 0| I 8 z 0-SL  P< P 4Q ,00D D0D 0 8 0 000 0 ,  c 0-PLP X0 0R @!P0 0  0 l D ` { -@PLP` 0 0R U ^P @T @p MP@ @T  0  0 ෠( , |  -0LS@` dPPnPP Kh 0  0,|u 0-LPED@P H H0 0 40 0RP <0 008 -@L MP`40SO #P@w(K P 1 0R0P00 00S 0O dd p IP P wP P 0 03/P 0pP 0 S 00R 0.(Ko0 00CS 0 0pS mPH@4 404 0.(  \ D 8  40-SL , 0C!40R  Kh@ @0@ 0-4ß, ,0, 0- ຟ  H  -p`L4PP 4 R @, 儑ᄡ  ,04 儡@ 0T:80# -@LMP`80 K KP 4 0Rp` S"*,P'0 B!z4 <0 B04 <0wKd d0d 0.XKP P0P 0.DB< <0< 0.09 F G H P-L@Pp1 `0VHV. 404 S S6 H000,  0 0,0 000,0P , 00/o00"\ R ``P*    ` RqP`D D0D 0^/}Ξ, ,0, 0^/ Ş  0P 00R/x 0P-L (00RP80080@ 0-@PL80080K0h 0-@PL 80 0R@ 0P4@0 0-LM@P d0 0R@ K0P 00S@#:~K0@\ 0-@PLoT ,0 0R@@b0 -PPL 0 0R4`O40S @40S,0pP@>`E`4| -@PL` @0 0R@ P" @0P /o40"0\ R00\/d -LM@PP l# Q (K40 Q8 `0 K GpP @P䂟9 HpP 40 Q_ 4Y3 <0,0pP<04 ~ zp,WQ<W\Wm)@Xh  0 "0p 80 a pP8 Y,00 QT  #KṐ#KPR B0 / I@ I!x0 4<,0 q1P4<Pg,?,X* p<?!w4 <0, 0pP4 <0_]| |0| 0.ph h0h 0.\T T0T 0i/UHtp ̽ Ȼ 0   -L`SPp@ T  P A000 $KkA 0 0o/༜뜺 P- ?o82 ^0S 00 Sd0P/ 00R/  P/?o, 2 \0S/00 S/P- ?o02 ^0S 0 S P/0 000R/\-P /o800"00^ R  R( 0-LP @P P 0 03/P P @0QA@0 0-SL@`P pP $P p>0P  pKh<l -LP@PP  PP A;`A7` 0-L@P $P0PԶ 0-L|>@P F00 000L 0-@L0P @@0 P-L 0R RP0SXo808 80 $0$ $0 Ļ T p - 0LS@`5 LP. @X1|qPpP P  P XP0U UB#10@U"B< P*0? H@,KocX% XpPp@%1< $B @P 20000P X p=P =P ,Ko@ $ h L -P`OLMp@ϟ40 000 0 <0 0@0 080 @Q pA QWpp Q <Q =Q 0P Vr Vr V X YxA Qo Q Q Q Q_ <Qg =Qe Pb @PY^ 0A!2 0QR Q Q Q Q <QJ =Q@ DPA X Y<0A!10 Q0 Q Q4 Q Q <Q( =QP P X Y 0A Q@ Q Q( Q Q <Q+ =Q L jPp(K`PaPQ 0A QSS Q <Q =Q OP`Q 0A QST Q <Q =Q :P X@QQ Q Q Q QE <Q =Q @ $P @P`Q 0A QS: Q <Q =Q  P @^XP<F`Q A QR Qg <Q =Q( ~P Pf@Q 0A QS Q <Q =Q 8~Ps`Qo A QR Q <Qg =Q ~P_ @`QY 0A QS7 Q <0ASP~PSLQH 0A QS= Q <Q@ =Q L ~P7PQ3 0A QSr Qv <Q+ =Q ~P"`Q A QP Q <Q9 =Q y~P> PP`Q 0A QS Q <0ASd~P @P`Q 0A QS QU <0AS N~P P@PQ 0A QS Ql <Q =Q4 7~PPQ 0A QSy Q <Q =Q \"~P`Q A QR% Q <Q =QB  ~P`Q A QR% Q <Q =Q }P-@Q 0A QS} Q- <Q =Q l}PwPQs A QR= Q; <Qk =Q  }PCbPQ^ 0A QS4 Q2 <Qy =Q <}PP @@QJ A QR$ Q" <QB =Q |}P9PQ5 A QR@`PPQ) A QR@`P`PPQ 0A QS Q <Q =Qq t}P @P`Q A QR Q <Q =Qs d]}P@Q A QP QI <Qh =QE H}P`Pp0S400P(K`Q A QR Q <Q =Q] (}P4`Q A QRt Q <Q =QH H}P`Q A QR Q <Q =Q |P3@Q A QP Q <Q  =Q |P}`Qy 0A QS Q <0ASp\|PiPQe 0A QS= QU <Q] =Q |PKTPQP 0A QS= Q <QH =Q |P@ @P Q <Q\ =Q |P0 Q <Q, =Q T|P#@Q 0A QS Q <Q =Q z|P@Q 0A QS Q <Q =Q e|PPQ A QR Q <Q =Q dP|P@Q A QR Q <Q =Q~ ;|P@Q 0A QS Q <Q =Qq &|Ph ` P D D d 8 x $ ̴ p  d Ȳ t t  İ p  ȯ t Ю \ ܬ 4 < x $ Щ | ( Ԩ < @ 8 T $  X  \  ` d   h  ` @Qe 0A QSe Qc <Q] =Q  {PLTPQP 0A QS& Q$ <Qk =Q {P?PQ; A QR Q <Q3 =Q p{P *PQ& A QR Q <Q =Q {P@Q A QR Q <Q =Q l{P@Q 0A QS Q <Q =Q `W{PV @Q A QR Q <Q =Q ?{PPQ A QR Q <Q =Qt *{Pn@Q A QR Q <Q =QX \{PhPQ A QR{ Qy <Q =QJ @{PFPQ 0A QSo Q <Q =Q zPA R} X( XzP<RP  0A QS Qm<Q  Qf<RPE $4 0X •PQV 0A QS] Q <QN =Q zPE@QA A QR Q <Q9 =Q $zP0@Q, 0A QS, Q* <Q$ =Q tzPPQ A QR Q <Q =Q rzPPQ 0A QS Q <Q =Q ]zP@Q 0A QS Q <Q =Q dHzPPQ 0A QS Q <Q =Q} 3zPw@Q A QR Q <Q =Qa zPqPQ A QRx Qv <Q =QH T zP~PQ 0A QSo Qm <Q =Q> yP8PQ A QRN QL <Q| =Q yPTs@Qo A QRI QG <Qg =Q  DyP^PQZ 0A QS Q <QR =Q yP I@QE 0A QSE QC <Q= =Q yP,4 R1 0S, <SP) C SR S0<SS@Q 0A QS Q <Q =Q uyP @Q 0A QS Q <Q =Q `yP@Q 0A QS Q <Q =Q , KyP@Q 0A QS Q <Q =Q | 6yP@Q 0A QS Q <Q =Ql !yPv @@Q 0A QS Q <Q =QT (  yP^0S @Q 0A QS Q <Q =Q; xPE P @R~ 0OP@Qv 0A QSv Qt <Qn =Q xP&e RPa =S^  RX  RS P0SL L -LP`PU@G6pP  ᅂp P@ 0-LP@P0P0 @00 -@PL 0 0RPP 0 00   `V 6pP  SpP00PP/0 0R /` P-L 0 0R P`U V 5@P  $V@ P P0P 0x D1@0 000 0x $%, H B @ F P-L\0 0R 0S P4 404 0 WPDX ( P- ?o02 ^0S 0 S}꼠 P-L400\ 0SOoh -LM$P@U`  R p!0 P 0S1K$0K P $PPM5pP 0 0 0KP2 $0R. kP' @P$ PUp7P$0 0@Ɉ P Kp$  ! P0"S D D0D 0 8m7꬈0"SD  Ж B/ 0-8P8@P@L0 00t0SZW4 P/?o8  2\0S /0SP/ 0-@@@LT(@@ @10@@F 0-@PL (0 0R0008P/0 0R/P- ?o02 ^0S 0 SxȜ 00-SL@P 0$0S 0 P 0 P ttIh@@ @@0LLL@;@808 80 ੑ\ H TE\Ep$  -`PL@94@P@P5PPp @+4@P6p \P@K <P 1 0RpP 00S 0/0 03/@P P  E 00CS 0 @ 0@S P\Kh)@{@, ,0, 0 }܅ <؄ | l #S0-L@P8S ~4 <0,04Q<00P0 0 0 &NP -LMP`Up@#  P 0 zP (0S @l @0 PP00KK$ $0$ 0 l h ( Ȍ B -PpL(4fP 40S @,0a, 40a@T:8 408  -L MSpP`'V@ T 00Q @00 K( S@T (  Kiq 0  0F/എ먐 H 0P 00R/ԏ 0P-L (00RP80080蜏 0-@PL 80 0R@ 0P0@0P 0-@PL 80 0R@ 0P4@0 0-LM@P d0 0R@ K0P q00S@#:jK0@꜎ 0-@PL[T ,0 0R@-@N0 0-@PLD80080K0h< 0-@PL58@@@00 -@PLP |0 0R` 40S,0AT @@ 0  0O/D  R -@PLP` 00P@ p8040S !,0X <0, 0a<0@@:@D D0D 0S/8঍0 000 0S/됌   x 0-LM@P P0 0R@ K0P @K0d p-L M@P 1 0R KpP  4 P"80,0!aV# P ,0P <0@04<0iKphoKphaD D0D 0W/870 000 0W/$. T Ѓ  0 P- ?o02 ^0S 0 Sꨉ 0-LP@P P 0 03/P P @02@0 -L M0@S K  BP  $0SKhy -LP@PP ~ PP 1`1` 0-LU@P $P0PDy 011/ -@LPp`P P1S„  0P 1'/P1 p` P 0808 80 Aq$0$ $0 Bi ( @ ̃  -L\ ^ \-QRS  0S0 0`1 QL R S "  0S € 0 0 0 0 Z!봂 T -PR0L,M0Q@ P 0 ` p Pl `k 00R0S00(Kp`0 - 0   S0-    S -<Ͽ 0   S0- 2/    S p-L,M@P`P 0S R00p}$P KpKph.0-S 0  0 0  00 0 0 e P0U00 R 0S U00ꠀ 0Q000 00/ 0-@L p00T0007 08   0-L@T 0 0-L@T0 -(0( 00L0S GrXd -(0( 00L0S 7rd -(0( 00L0S 'r؜d -(0( 00L0S r茜d0@-1!0 ?^@@ !0S0&\ 0@S ^ 0S 0\ 0^ #0 r? ?PPlRP ! @P00 |? ?P 0PbR P $< d0 0 /, 0 0 / 0 0 1/ܚ 00-SL@1/000 -L MT0T0 0@0S P K  q pd/V  -Lvq- -L  -(0( 00L0S cqșdAo// -LM K"$  Kvt -LM K$ Pp Kwt@ -QLM Q Q E 0  K  K 0 Kt  ^t 0($/(/$/ 0Y.<+ < 0/(/$/R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@[ P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pz8000 0@0 0#2 /UUUU3333R/  BP0P BrA0A/  J0: S0@- N S  Ss00  Sw00K r0-00w0-00!=@SP@ V F SW ! Ss00D r0-00w0-000S> ) SS Ss0'r-w -  !P> 9: P3 Pt 0 C   0 SC  Sd00  S@ ?00S-0 0 S-00  @x0x00AS00AT 0 C- 0 Cx 0 CS0 SA00za0-00uc00rp00ol00lb00i -LrPPP3 sP.  rp` 0@0rp`QU  SvP0=S Q`Q@U1Dq@VPʌs0rp04~ 0 |$ -LM42|K0P 2t 00 N @`lpK {"00 {s+ 0T! `p(K`p$!0 (K:*&6R5%&;R?/&1R4$;R 4RV 0 R0 0 0 0L ` `p $ ` 0 꼅$g f (f e |e -LM@dpdd ` ppKp@( 0[S( 0R K Q#\( 0-LM@ @ K0?o Q20-@@LMT K5PP @K0@(@K0]zP 0 0  9/mNA00/ -`BpALP@#Q!#Q JNAX1P U B P  X0 -L,M@XPHP ȟT 0 @ `L P0 Q008H 0S |( p(p D h(  8 \(4  < P(L @ @qmPC0+0C? H @pw  Pu 00 PEPB( 0 SD0P@TL0 000S 140-Q@T.@K ;mP0-Sp0L T!0 0(Kp(K70@P0t5uP p60  (Kp p &-TP 00? :Tp +@P  hP WT0 :S  0S000L00@D@C@0H S000500S 0:S  H 5?p0@L 100 @0 5 0 < %Q 4 =g0P00 s PC000 P0Y 4 8` p `@@bV  qPtP"2< wp PP 0@bRV 0S48`>w@S P0r0S00S$ 44H 00Sv0S 4H0 0+ C :R :S?p%:p#48` CR0 R T0 0 pSpp0S@(KMtPd3H 00S 0:S T <e?p H 30 (K3H 00S 0:S N;S 0R0D0 0R=ʸ"2 H 00S 0:S 1W \2H0 0:S X X"~0T0 0R' :R$ 0 R" 1H 00S 0:S H 10@0+ Cb^L !T0 1!0  ~@1H 0 HS]L0< T!@0R0 0S H R :R ɚ0 R  H 0C0"00@t^ P< L0d H   |4P D 8 4  c c   x l L 4 _ ( ԑ ,] \ X\ \ t8 [  Z  -L Mb2`p00 S" P@T P2P@:T60S" 000200S 0:SG?(K0X000P1j8Ÿ -Z cP @P-T@" TQ P P(fPn -@ !fP 0:S" 100S000(K0Sx100 \1 X0"@10Q 10P10:P W00 0 000 0  :Pz 0Sv X0 x0?ljv4(| h X `8 , l W W -L% -LQ* Q Q  R !0 0R 0 0 qR`q@V PT 0 h0h h0 W@PTv 0 vT 0 V V V V PV dV 0-P ` 0X0@0 TLp:@DV@1 o 0R ! 0 9$pP   Iv0 @p -OoPB@LMT`p#P "PP 0@0 @@` 00@0 @P HKv0@0@vp$Pv@pvp$$@vpXL00 0 X o -$$ 0  Xo Q0  jY0 fYQ  ;aY0 Q-LP```h00@ AT hV@aR! / -pRLP` @@T T !03/pWG / 0-@LPp$T 0K0h/0 -`QLp@P RP 0 开D  p$`,@(P 0Rqu00 -L MP`p!@P 0U0dV X  WPppH0PP  KP$dd p-L M0@P` 1S ,0S m$0S m LpKp 00-SL@ h0 P @0P #0 0001 1 00g00t 0 -0@`LP 1S ,0S m$0S  {mX0s 0-@Lg00CS00 Pg0/P --L M0 0 X K -- LM 0  W K 0-0PL M R04PKS@'  S%  10-p 0 B0!  0K040 p H00 0,0 ( 0$@KS4PK 0000h ls M M P 4000P$00///M dM -L,M@ `p% < Wk<%  \ o\w \4V- @0WWQ>\ \ #&\ \! R P U _ U  \ R  R *T   _\ R(K\ \4 \ \ \H0 >3 SR$K D04 SD FT :P40!R 0 H0 0Q0D @\V uPR@  Re R  RV  R T R  >SV‚ P @k PRF UT \I R*T_ Y  \ R Uu 0>#0!> \H\] \2 \m 00DK>SR`40 cKcK` P0cK`U $   L  8 D0&0C>SP40 P  P0.!!># R% P>S P!>#"RPE 01S400C040 0>S0DKR` 0cKcK `P0P#K 0p0 0P>3 00 0040A>34PA0E pP00C00V h -L,M@ `p% < Wk<%  \ o\w \4V- @0WWQ>\ \ #&\ \! R P U _ U  \ R  R *T   _\ R(K\ \4 \ \ \H0 >3 SR$K D04 SD FT 09P40!R 0 H0 0Q0D @\V uPR@  Re R  RV  R T R  >SV‚ P @k PRF UT \I R*T_ Y  \ R Uu 0>#0!> \H\] \2 \m 00DK>SR`40 cKcK` P0cK`U $   L  8 D0&0C>SP40 P  P0.!!># R% P>S P!>#"RPE 01S400C040 0>S0DKR` 0cKcK `P0P#K 0p0 0P>3 00 0040A>34PA0E pP00C00V bG-MRP 4@  lD8Ȓ`Fq>SU7 U :U nUT U[T 0 SЍUg  U L&U7 UF0 T0 U<  SU 0U U. >s  U U U >s < P5  BpB Ǡ \ T0 V 0 U  "U>s > Q UwpW 0 P PPP  >S UP >P>s W  X 0 rT >sRP c8Ѝ -LDMpPL A/P P00QD0 9@W< 00 0 L4 0Xc 00 P3`@ 0080 03H0 9 T 80000  _T  R?00_T@@T 2U  X 80_ X00 0S RwA_EPEUH0L 00000 D0WPw 00 4 p@@0S6 TR  Ta `P XD  X} V2U X@ 800000_X0S6  TQl 80000VQ# T@ Xp 4@p!0  `VT@Xp T5  T@ `PP00<00!00U` VQ Tw<00 T<0PPj <0P,`0 0 4 jP000(K<0PPP00<00`P00`P,`P0$P0P000DY -`LM0Vp0 6*0Q>3Sq S1 Sl S@n S S04  E0@P0 Z4`0 Pp0`T:(K@0>3@1># R@004P  P I0@000 U4P0F>SP`1`>SP1>3"SPE P0Y 0P  p~`;>S@04  E0@nP0 gZ4`p 0YWP P 0 pJ` S S S`p0TH:(KS  G>S?R ` >S G?R `0 p`SYhG-RM,@0 lD`Fq>SU; U DU UZ UeT !(PS P  ЍUu  U T&UG UMpŸ TUE P  S U U U4p P>P PP U "U U p P>P PpAPPYPU B V \ TU  "Up P>P PPpQ >S U PUxX }PPY P \o T >RŒP bpP>s Wp >SpPQ> Xp o -L4M@ 4 < 0 40 D #(0 8 Qp @XLbm0A/4 00 0 000 W Y 804# 03   _Y RP T "80   _@DOoRB  R 2U  Y  _Y RQA_EPEU|"0@00\0#Rp R0 Rk R@m R R0  H0@0 Z0P0 Pp0PT:(K@>3@1># R@  I0@000 Z 0E P> P >1>3"SH0 Y00  p~P=>R@0  H0@j0 cZ0P0@ @@p 0TWP P000@ 0pHP R R R~Pp0TF:(KR  G>32P > G? P0 pPRWe -LMϟ` ^ 0 x   h?  R(000   0  Pl 0 $S000 0 0 0 0h |0 h0| S<Qp  S*t ` @pB`YpGP PR@@ W:pf2Pt`|0U P0lp`0 h0吀T0 |0d X` P0 \P HP P@@  `0 00 p ` <@ 8 4` D \k0  k A? d 0@ 0@d   pc0l0 0t J U" 4-x0   _UPX  _UPPU <TH  X  _X RQ=AOD@DTi|0h@  C/oQ" R 9Pd   cd p cdP 0t h XPh0P d`Rp 1h Pl00 Ul0 P  Uf @p X0  Xp W7;T X_ +x0 _XQR  UlK   00 (KS0 Yf00 0X< Rh " X* @pCl p t` `YpGP PR@@ Rhl1Plpt`0S 0L*\0 H0 @0 <0 80 40 0 0|` x d X` T P 0 0 90 :0 p A?p  t  0 x 0h0 0l 0|0 0 0 0 J W @P Vz  V U\9T V  |00000_V0S  W(I  |0 0000_WppW 8T  V |0_ V00 0S RAOD@DTe00S l0A0 0xtp0X`&KlR0 Wh0 p0@@w V  V | 000_WQ  V00 "e0h` |0 10 00 $00  00 p00 p0l'00TP UPG WU@G p ` xpt` 0 iPUiKf  60 TpWF td` 0 pW@@ XO  XM` 0pW\F UDj0S0p0  -pPLW 1: S\ 0 0S:00S000000]\R*pp``@B  _PbP `VT 0S00$?L 00-SL@ :0S00000 0 Q[Q.Q000 S*R .R 0S00(00000 ]R000L>=p@-P\#* 0 P0   0  R00S!0AS `CV@@R@T p 0S 000000p2< @-P 0Ur` 0s @   B0U 0G0Q  00C 01>3 !/ 00-SL@P* 12!2#S 0S 004000000 yPP0; 0-LM0@SP0S* P  QK0 P 0  -LMP `0 0:R00 40 ):q 210S- xP( pxP0 W 0\ 1##2\D ep00 塡** rBwpp0` V< 0 0 ] P&  ] P X :Q |9 000(K0^S D  ]S -S-00p-p0-00H) 8 )  @ S* ]P2 R3#-PQ\ -P] [PR:0 `S! 0!*-Q 0    0 S H :R? =R0S0:0$(S0 00  0-S]S0S007000= 0000HSE* V =R} 0S00 ` 00]S 0S 00X|:04S000]S-S0S00vfp`| ]P 0S `V0S000S000S    000S`0S) p@P  I 0 0pCm`0S g` 0SP 0S 00HS* V :R ]R00  ]R-R 4@ 0&   0V0F}C{R  ]R -\ V0S 008000\0<00 -0 0-00-000 S 2* 0]SQ0$  SJ4p0rc  c ^ ~` Br0C0D R! 0SJs   ` ` @ 0S * <00 " 00 00 0C00SQ p 0<br  pRWB00  0Rs(Ko_`2000(K 000(K0S 002000(K]0p]p0]00H! V 0D   ]R~  0 R:3Y0T A/o" R S `p   Q  \ SrY@0000 00 DB"(Ko2`7 )w0 0D RFSC/  |99 998776  8421 -L M@  1 `0P8p(0  0 0  0S 4040( 0R  K t  0U ] 0,Kp*K,PK+ K*0Kp  0 $(8 -pRL@P`P 0![0pp -PL@`  aH0DP"%T R!0@B @@!,G 0` -@p`LMP0 S 00$K0SV 1 V00U U0SzvNMLutsrq#mlkjihp`F0`FPEp  B0  B$Kk+`0 F  B 0 SP "0SC   PPEp`  B0` 0~  B0 PS "0SA  $Kkp$K \0 000$K  B A   B + -L4M䚟: 0 RL0 0@`00 y0 Sv 0T0 0<0 :8 0P0 H p匚P0 Sz*|Q Qu $LXP0 .-,*'&$#"!      w^, 00L00 0R-(K0S008000( 0S:U0S00x8000<0S0S 80 E Q*,(H00000 Z 8 000  0 R*A?QP{Q P@Q:0S00|700000 0 0D @ G 40K010K0 740 @D  00S 006000Q:0S006000 D0 Z 0DQ 0 S*0)S T ) Z 0! Q*00)QL 0PS005000G n 0(0(0 tZ 0 0Z0 0S 00l5+Q000 :?Q {Q D%P 0+Q ?Q {Q>0 S*,Q 00 S *0}Q0$0}Q R00S 00P 0o*Q0 S  B0 S  B0 RPX*A?QP {QQRNHE 0PS 0 00;P*hß@ H @ Z 0Ss L3000 0 U < 0R0p 0S8p Q 80 E0S0H80 2 "0<0 0 S]  B0 SO "0SB  0 0 S/  B0 } x0  H E*Qn0 S\  B0 T g 08p P0S 00:  B0  A   B   B0   B0 *>0000 E P H000< @ @ 0RQ XU(D*$*L(<((''^ ]X&,&p%$$"H  -L4M✗ǟ  S8 < 0 @h Re  `ZD` U:L 0H0 <7D0S 0S005000 00800 0Rk(K5U} N>E0CSM x 0JR 0S00x50000H Y 0*Q= Y\Q `0P\U0@ S000  P4\Ux0S  < Ri*UP0S 4 000P|4U 0Su 0R  B0 S  B0[  BP`h0S 00W0  % 40K010K04  0 S-*R \R0)S H0) \ Z d0{Sk20 S*,P} 0PP& Z*0Y\Q} Y  S\R^ 00Y0S 00@2P000`^Q @0 z ` @01P0000\S0)S  B0 I Rx  I`F `@0(0  (0 }R Y0S 00Q 0L0000#R ,RLP "R>310>#R R@0P`@RP (pp(p 0>3S S0Q>31S B R R R SRdD `1C Lp(p @ 0 81 00 0 @(KR(D 0L @ 0000 0  V(p@` @X JP<@ 0>#R0P00L @ 0P(K SHEe -LM K -!MLM@<1<0pnK`FP@ 10 8K€P 0 0 R6(K腮KJ  H[,0K0# T PH 円P\HT PCK|H04TK 0PP 0ᕀPXP @T\Hᕅ\咅|( -L!MP1!0A@P t1( 0K`pfPCPノKP 81ZP7$0K 0#D @ < 8 4 L( .KHX PX &P%THT PBnKp `F0,TK 0PP05P&XP @TTH0S h  T-( 0R $KT$,$00 ,(t   -GMLM ğ  ` 4 0V0 4 @U F^K PE 0EFK0C.K;ApPx4S 0E PT 0 Pl40I=PPtpP~PypTp hPplh,=P DpT h DXt40 0R(Kxb`x4TPSPXWPWPx4$`0S b`/Z} "P4 V1 K/E}PppT  <PZ0 Z"0$ 0 $|1 x!P0 -1RPLLx444  4 !0P4  10$ 0 $0 P0 0 |pibxxX( \ @  | p    -LM@ 1 0p`K0P (0 gYT& T0U0KPK @K,@P@0:Kj|P:[?s00Y/0@0( 0R K0U0K YP~Y@P( -ML M00Ɵ| x 4 0 4 0 $ 0 4 @%`9-KEK B A$ Xd Td Pd \4 zpPH %5 $ %t4 F>K 0CG~KCK$ 4 pGI uPP#  Po,Y00S+ (Y0=S0`S(X  V``V `ሀ\xDY0#S@ @T /P40 0R(Kt40Ct4 X0 P44K00 @4 ~P$X P0 @44K00 3 }P |3 {# P# Pt4$0CRt4 e  0pPp4 CnKP# `Ft4 LT @ETT0D00lT dt X Pھ0 4CK@CI Z34[$SX SV dT dT d T  Pfp$[R&}M n4GNKt4 x4P@FX|$0 ! `0Sp4[ S  jP t4S IP 0  p`  4}Pᔙ Pᐙ Pz4`X0S VP4xhz\t (8 @ ,   $ t  0 X y ( @ -LdM p!x P@K`qP 0? s00  0d l0 ` \ X T t0Kp Kh p 塂P3t0Q @,@K@O@P 0S t0 @t寁x00 0R(KlK0  @@匁 07z@}( 8, ,  -@ML@K -LTM(( `p!P@KP qq0 0 @  0d l0 ` \ X T t0Kp Kh p $PtQ @,@L@)Ot@0 @t<0 0R (K@' $y@( D| -@ML@K % -LM+Kß̢ 2 0 p2 " 0 o0nK2 -0/P EPW 1[ S S S| S ``# @ Sq S  000 S S S Sb  R 1[R@+S1 -SlQ[U: @U2S ) Q+ 2 `0_o2 0`+SR%0S* @Sa2"MPP  PpQ[U @UO2SrQcP̂Ȃ 0+S -S/ cSPPUxpx? XPr;@0 S S@0 S S C0SR 0 C0SQ h_oR0S @S2"PP`  M_o`R20 0R(KSPP2 0_o2 R@C T(8 -MLMB@  0 0 R 9  PJ K A0A0C.K;PU9SR NK +M+?wp9` 9 59P@ #=K 0C9 6P-8: S1 @|1 )009{|90 0RJ(K88u`P 0 @P 100S@0 )0@0!|P 8S ) S 0 )0@00 )0@08 d0 )0@00 J@K,(h \ L{ h p -L4MD@KP`p T H0K< PH@T@T 0 !PPH) KH@#P KP 0-L M!^\\@@00&  " $ (K  KRK 0RK0p( 0-L M!^XX@@00& "  $ (K  KRK 0RK0( -`@ FLPZTp 0 ` 00Ap ^aAPWAAAP7AQ0 S A@P 0 R:0Bp BS 0ą0S  0R:0B00 00 0-q@pP?0@XL`P ?XW8 0\p 0 0 0S=T;*@10?0T !2*0$q$$a p `Q?p??`  S*!  P* UR*.0Q S *U00?0R*00l@0  # 0R ? S*: 0 T !: p<84  -`p@@@0@PLn,00 e@ep 0-LM @@0P ( @PP K0` -L,M 0K00K 0h0K0$0K0, K(0K6P <,@($ K@ 0K$ $ -L4M0K 00K0@ 0Kp0$0K 0, K(0K6P !KK00,( KTS 0 H -L\M!` P0@h P DK !@  @ 0 9p` l)PPO @T1Tq0pd0 0   @P7 +PP%TKPP0K0X0K0T`0 dEP LKXP XP0S h00 0R(KLK  pP  P R00( -LKM1!00pL1 000 hNhdPPN @L1La0`H1 0   L@P6 OP%OKPN?K0=K0< 0 HPM/K@8 @e81S`8 L10 0R(KMK P OP nR00(   0/ 0-L M0 0@PQ00  (K0|)K  0 ""C C^0 0 0R K00 !PP0G,(l -FML M@0 0pmK0(0 u [PPBNK@Dz+I Pʈ$ R@`R$@R( 0R K \( -LdMp`T0T0 P@K0(0 : G{( 0R Kl( 44 0-D@L@M@PK %I 0K0Pd 0PM1SppЍ/ p-L$M0 0P`Q0 0  4@KN0x( 0 ""C C^0(0 0R Kp8 )`P8h( -ML M@` }K pG( , 0 `P70C X04+0R0# T @CK P  T0@T_0?Q@;Q@,(50 0R"(K+-Q@)QX@ 0 IP0uQNK @DDp F/'( 0-LM K -LdMp`T0T0 P@K0(0 a p>( 0R K( -LM?/0  @P p@K0  0\@0ϟ @`Pa(0(p  ` 0l` 90#hP eQ6.09o @ xp d@`q 0= Ԁ !%4|` ca ` (0'\@ Paᨠ 02M&90# XdQ   -.@(T:@ऐ bp p 1`0$ p%P  p0`a=') 2L cq H0 2 3 0P&Pa %' DP n -@%:`(@bQ` @ M0 p0&0`!< 嬐 ` &0dq=%2O8  @ c`|x0 @@&2o '4` # 0` `0)8_)ᘀ &`@*`&  0@nQ-0|p韠x `& @('!xp@0M`&) 0(bqᘀ   () (% "*ଠo韠0` (da| x|=' "ऐ  )P(*`QP )P倠/ %|PcA)P& p$P韠p%PX;* P!菠 n  ` .``. 'p,@xp(a *)`&@Mnq唀ꯠP `& P夠 ,PoP.` `,,|` dḐ P% `'Ϡ ) !. P%@O@ 娐 @ฐ`&`)P嬐p*@P)na*ฐ@ .ꯠ嬠 (@ P%ଐ尠P% ,@a埠ጐ Pxp刐* *P%pP% @& pᝈ@$a,p% i@ (P矠`唐 倐P$xp P%|` p'儀 P%_p'@ ! . `Am p'*Pxp )pfa$P%P%nq .x帀 圐P%|  ภ& )@ ) O嬠x@ "_ "|P  "ठ@aQ| $O'@ @ ,`n|(`@%m`!( @尐 菠တ @p ,ठ)@pP.*)fA ,(`ᘐ` (pPo,`p)`")韠 p]*`$` eP% `&Px]n * `&@p 0@p&ଠ/|p ,0Me!,! %0"Q0 ?P0%0?SL`@@e DPe{U*v0W@@pG $KkC -LM 1P0@`0)K 0 R001 13R0 0~? S pp 0~? S (KV `F0"01 13R0 0RK(@  p-L$M0 0P`Q0 0  4@K0x( 0 ""C C^0(0 0R Kp8 )7`P8(< -QMLM@` I~KpG0 4 0 `P70C X04+0R0# T @CK P  T0@T_0J@J@4050 0R"(K+J@JX@ 0 uBP0RNK @D'p G}( 0-LM K -LlMp`T0T0 P@K0(0  >( 0R KS ( 0-!  0 #EgܺvT2G-pM@P0@ 0\@00@  A&,0b{4P ʈ &0 "fK8 b),0 L l̅P " nL`( ``&h` P@@ l ,@  P  " *apmvmzNS陌d{ p,0 p 3 Hb+( , ́8hꭆ $`@@$ 0lˠ+@ @@a@0#  0e[ p p'`f+a b{`,(pi{ AX!@j 0 0# 0@P1际0+NDCDGD @ D " .P`aPT@!  `&@ ` ʄ 0@Y  `k@lm 3 p0 .  d@0#0|k>P  ld>t@ P#pW>|S>P lL>t@ K:P 0@@=>:>(K(K'!Դ@B t- L`a\0\ 0P`@P@@T 0Q P@< LX ?P L0P00 !R 1 R/@P//ᴝL0@>S 00 00//HL p-LM4@K` PPV0E>S 0!31 00 0  yKp>SH 0!31 00 0 A00A00/ -p-L MP@U0@ ` ` P t0t 08 R;0Kp a 0 ( ( h D @-XQ -Q =QR-@+@R +QqoQ uQ gQR   +S -S =S000@"    000000 0@-0P AXS@ oS; uS6 gS 0+S -S00PXST 0! 0P \PSPQP\     0 !#  I@ -LLM@wTPp 0<`K LKL0 H0 D0 @0 c @ [@`P 600000" %K00`` pa0HS   v'}pC~p `+X@ 0-S`=XX00X0 0|PXA@ Q񏐀~}|{zyxwvutsrq%onmlkjigf aII00W  |<W  ;I?S R:``Q h0 d P d PE Bh0`  \  =Xk +0H?oY20S Ru*W\00 X00 R:``Q d UP d PE B`  \0T0 00 wS7X!=XQ X R:``A &K/P` h @D Bd0`  \ c Y R*W\X0 0 X^ ,X5`P =XXX 0X0 ``Ad P+ d @D B`  ``Q d P d PE B`  y? 0PK  ˶P0@0Sm>0"S1Ds `` >@`>0@`0 `(K>0SV-+`` h!` @0 (K`X` p+P-@ +0B XR R p0+R XR  -Rpp p X0@PPQ`>00>0`@ 0`` >0`` 0  0-L M K  'p` K P-L 0 >o`/00/00/00/ 00// ///00/ // / -@LPpe,`+,V Pe 0 000Pi@P P`r`P T000p@000=PHF=P0 ( , -L@r\P` 0p0/80p0 `@0p0 ꐬ 0-0@LTP` @T0rS  PKhP0+SKhH -L0K$M #, K_D!0P $0 ( J 0100S2p@$ P 2 0$K0( 00S.$00K K @,0 S/R=@2h0( 00S d$@=0@K,$0d4o o o  -L$MK 0,, 0 K 4 !0P $0 ( A 100S4Ip P 0$K'0( 00S($00K K;4 0,P<|0( @00S d$EC<0@K, $0Ld`$ -LMT1T!0p`0S6<1PU 0V:0S P@T0S8<0P0^000S  0K(0 <0S  ( \:pP o PKiKd5\0PUL-280 0@ $!d`xH 0-LLM,PKl`KD0%0 p@ pNp@ (KpT<0S @WppP 0   pp p.p@ (K0Pp R@ -LLM8 P#Kp+ 00 S 0/c%K`00<0 S~0+c%K` 0<0 WOW0K 8 RH Z00#KR05> ԃKR 0 0@P 0 0$K0`KL0 0[2`0H0 |70X0 0 S0`RW ԅKCK 0` /7W00V0S@PCKDKԃK0 !H\"PR0 0<02H`d 0 ` 7L "?lA!p` 8 ` V(K0+a%K`0<0 0/%K10<0 x10H0 X0pJQ4QA CKd 0 !(?A 0qCK2RCK0T 0`4p \ eK0 6P 0@PZ4p `W\CK W\$KSRKd 06KcKL8?P%#FP0P 0<0@ 0H0 0 *`GzG4y y d w w v 8 u e? CKT0!!1T$?@PP1$?!@P 0$K0`CKL0 0d $K0`L0  100#K r0#K0d $K0`L0 `(K6X00 P! @"_reL0<0`!CQe/I1b 1 H 0E `0 0 @ 8 ` ` 2O SQ Qgffft G-0P@M娑娡Q:^b ` V. V0 V ^( 0U USQЍ^` V V V00@ T@@P U P000`p 0W``p```W 0X W0p`d0W` 0^ W0Q0#0p`*?[!]-4KR 0S0/0 R pP// -ML M @B^KPEp`+( P @ 03/( 0R K( -L M@`P``a V00 p!5SP+ PR 0SQ  0S0 B@0000 "P00$ T3   P- 0   0 (KP& T  00S"Od    `V *o`(K0 _9 0 @ -KML M/P"p `@0 T( /T  @@T/T  U0 0Rc(K^7/T3UU0@/T p=K 0C4 @$0 P 0   R  5 0W/S 4: S% S 0 0 0,0   'CNK+ P 0@ (03/P4: SW/ 303 101:8/0@@0}( -MML M`44   4 0尠P@ 0 p4 8T%*0U@% @R0 R0$0C?o24 00RU4 0 S4p00E0,0S004 04 4 4  0$ SrCK +0 0@ 0 3/ 4S 0@3$04 :/PG   ß0 S00  0.S V 0S0 SYY4S 4S K4$ A@P4: S $P I0HQ/03 10I10$p 0 0P00:/P0 @4   2/4Sz  0 K$0 A P4: S 0$0 Q(K X:0S0Y0S  0}0Sd CK +Pd 0S + P@7 4/P 0 4p 04P0 40- e 0.Sb0SL 0.SI V\ P 4p0I0 <P5 40.S0 @4 7 4R~  9K 70/0 00c/A4gP{(*  -ML,Mh5hş0 PQK~P@0  kK{K,`F8pGQKL0[P! *P p0P! ?P $ 0 S  SP  0p!W W 0 V 0FRQ=K0C0 `Q `` Q=K00 0R(KQ K @ Q K@@P ]P!WQ=K0C ]P  p0-P]\ l3|0 ]P0  Dß 0 0 s kK,`F pF 0 /RRR;Q 0K0,J 4ZSZe*Pd 0/ @Q+S *P;Q V FGQKJQK JQKL\gQ=K 0C0 C0B   CYT SRQ CYN SPK 2KA+`P^SP Q-K B 00|1A0 '!J0FK0C.K;AeP4S 10FK0C.K;AP 0+ l V# h` [!W 0 >RxzQ K @   B  0Qv R r ``IQ=K 0C |u(?**[!-] D -LMMnKQpP  0PPP@PPP0S @ }R& R [R {R R  c(K @]RR^ @ ]^^ ]^^ QAP?{S }SQAY  B0S088  388 T#:0 [S ,SQY 0 E S:    0 S]S S  T*00(K0]SS -LM 0` Pp 0S0 0%0{S @(K S 0{S@p0 DP 0 }R R  K( KR5 0 -LNKM @DM0  ^K     pk \\ \ɌRB \  KP \K\@ -`LP@PTQ@D PEP@DP t0000 S [S \S ]SP/0S/*S ?S/Q0 S 00 0@-@@0 S0 #S3 C SP0 S "S@$ T\S 000S \000"SP @0@0 CR S 00000 -QMLM 1 ! A0P@ Q`  R 0R/K Q~K pG G0K R~K#  zp x pB~K0 P\BP@:00  0Mi( Z Z (] ] 4 -LM5u0$pP 500S U0KP#S#40 0 0㪣P@$f 0S h%` @ 0S @#S (u1PKp " 0@S0 0 40  0Sn ԔtԄԤ p 0 S 0 "#0S $ 0000@SN  +P  +P0 S 0 "#0S $ 0003P}(K +P0 S 0 "#0S # 000 +P)0 S 0 "#0S P# 00010[#S 030@ R "0Pg  (K0 S S N+P0 S 0 "#0S " 000x 7+P p 0+P;0 S 0 "#0S1 0" 000Z(K0 S 0 "#0S ! 0@00CPd60@S0 /@(K| *P0 S 0 "#0S   㔺 叺 [>@`Bh00p0D0`00 2 0S@C. ` `@`F tv0` [0 ;`0 0 C0@Y0`0`00C0  U [@` @`@`B`(Q (G |Q hQ XQ N 8L @ 0-LˠM0 K 0-LM@P@Q  0ˠ0P K0Fop,K0 OP uLu -@L@0pS`"@@Q%PPR @-P  p 12c1NS@*  p p utt -`L`x@Hp0@P@T \0\0 R@@98P00-LHV4ss -pLp`@P @0@0S @@+ R"@d G@@`P00Q/@U4 @ @0-00LS lP Pii 0-LPP 4@@)P PP00hi 0-LPP 4@@)P 9P00 i 0- @L@P0n000h -SL4MH0 <60@ < d  &0000 0 40 0 80 0 @ D0 TP0p  > 00~0?S S; *S 0 0Q?^ 2^& *^T T 00 0 q*Q .W Q1 /Q 80S P ?^ ^<0 /W (K[^ \^40S T0 [^W /W TL ^^!^00 PP T X0  ` 04P/S \S U T0  0s0Sy -R Y`T0  Რ0s0]SVX0L SPPPT] pe fT ``ᶠ``]Q``V \Q 9 Y YW= /WZ .W D0S @0Y3 80S 0Y/S-  \S+40Ss 0 000000 0 0mUT  `(KLPPT\^ *^ 80STB 80S0S40D0S @0Y 80S 0Y/S(K H0TpC<0`040 00 0  0 P/Z T00 40S <0  /J8@0c P0-L@ P +0@00Q 0Q Ro@a06 6 0-@lLP (0PT  0@'0PT   0* 0 6 h6 -LMp0!@  H"  0 8 p@\ P  H20 0R](KPU 0 8ʵpD J  P; D2S;P<2 #nK<<2P wP+ < 0 8嵵p! 0 @嚵 P@D2PU*@ <00,0K 08L哵p@h*@-@T@@DB @rC( -LMp0!@  H"  0 8 ^p@\ P  H20 0R](KPU 0 8CpD J  P; D2S;P<2 #nK<<2P P+ < 0 8.p! 0 @ P@D2PU*@ <.00,0K 08L p@)@-@T@@DB @A( -LMp0!@  H"  0 8 ״p@\ P  H20 0R](K PU 0 8弴pD J  P; D2S;P<2 #nK<<2P oP+ < 0 8姴p! 0 @匴 P@D2PU*@ <00,0K 08L兴p@`)@-@T@@DB @j>( -`P@@L@PP bPP/ -`P@@L@PP PPd/ -`P@@L@PسP :PP/ 0 00 W;$ --LM0 0@ Q 0 00\100M 0 0 R   R  0RK;( --LM0 0@ Q 0 00\100M 0 0 R   R   0RK:( -- LM 0  #& --L M0 0 ) --L M0 0 > -`ppQLPp @Q ݵPD@, 000Khi9 P 0S 00 //< -LK:KK2 K@LpKD`K"P XR  H K@Kp  D H#DX4K p  D) P [R D% 0sqY@-  X3K7K;K?KCKp   L X8KpP <K X p X ` XP T?DT 0@1q00p`H#(Ẉ4K\pB K XC@Kp0@P0t@5T0TAT1@X00nd00 0R(KX00X0 Xqp 0%[0 0f8(ZxZ$Z* *  * * * pY`% 4Y0 * X) X) dX) XX@Xm X) W( W( W( \Wt( 0W& W ( V' ' ' ' ' ' HV% TPTWEVS 0-PPL) @T !@0U /RA C B/QU0/T@2 PP@PPU ; S000P@PU* C B/Q U0:U 0C C/R0U:< 0C@T@!(PPU:,s s SSr R -LM`P!PZ !@0 0 0 p  p! 0b0C SG>EDCB;@?>9<9p@%0 0(Kx80S# (0S 0S%0"S  1#HP 0!YX0@$K0 XQP0@AKF% 0 $Kz%" 0 L/8 į 0-@PL/ 0S !@T0)0qT& /S T'*0Q/S$ 0 AR! R B/P@Ct0@T@!@`\P;P y0008@/S@$@@Co Txo O 00-@PL@M4 KD TKL0 @0 <0 EK p K0S K0 -L`Pp@ Pp! V U 㰰h :p` VC@ @ N Q?o?o 0@c\C-L\3 \PP(! /@`p&!/D! .l @L,$%+* `2 pf0C22@ P0@@P`L8& f :L9 960 / 0-L  C-/ P! MQoooo `@f\L\9 \`P&p@(A OdA NlЀLDE!  Ѝp7 h7 Ѐ@ P`F7P@PP@L d8d`:L9`9t``@0 / 0-L  <0 0-{Pk @ KE0 0/A0C0C@0 0-kP[{@{KE0{7 Q/A0C0C -LJ Kh?@ =p A -LJ Kh@ p P-L ` Kh #00?0/R//R/?0S/R/P/R/ -L8M0Q  $00儮 K0倮 K& -L -LMPPP @T p00+K0`p 0`:@$ 㓭&QQ 00 R ?0Q 4-L# 00 0S Kh葮P0@-@D"a0!s!!@00nRR0c0L1R aP (0@ B``C00Q$IC-P0E \@``0L┆@SPA:0E XppTpWS^!: -L MRp0  @`BP BP @XY  00 @(K(K -LM`10P@p( 0Q1 00K@ )KQ 00#30#\0#02S00R(2[@0( 0R$K߭P @ 啭($ K4#( -`L=<;:9876543210/.-,+*)(i&%$#"! \7,K 0! 7\80@ v>C 0C@< 0 0D @ 080h kW@< y D0@0  ]W@< k50 8K0@< aU0V08H0  ,K ! 0"80@ 0C@< 0 NWL@` 0 0@ S< @0pW=@ 0<  ,K !4680@ 0CW@< 0)W% W  0,K 0! c080L 111v>C 0CR@< 80 @ h%/"b!!!L080 @ 00L0 tc0 8KL0@S< @008 ?2c11180 @ 0D0 00 8K@80$/A!b!b0C@ <@ 0\ 0 #K000C S!0<0 0 B?#KKa 0`p<cK< 0A ?\#K 0A QR0`<` =0 @W@0 X@<  < TQ <@ \ @Q 0\ "#  R z F/o@"<K{PzzVEbX p8 Q:\ ``2PX0@ S0`$ 0(0XX < MQQ @ 82@0 @ "@ /#b!!"L0 K/ϠlR3l11R00@  10 1 B000 80DSd080 ApALAwp P^UJQv@1@0< 0@ 0c$0(b@4K+Pk <@Z@<@ @< R0L8 Qm 000]Qn QYH0#rgqqq@;W8p Od< >p ^ !Q ( $Ix l'n Q h@^@APN0A S@0Ma$0a@a$< @(0QR p@G< CQ=8< < `t @ R @ R 00@ 08pK00P D0P .8<0 AP@@0($   <T /0P 8 <0 @P@!@0 $( ! <pP @8 1 0!0( 0c$0< @ 0 0 0s p-L4M@00P0` 0 LKD00D0 L KQ Q Q 00 0RKp@ᗩ0ᒩ ፩(t,t,t,0@P/ P @/ -`LVpP! W@0JS  R@ D0JU R  RS0@0D@R B/0S00  Br/\R/0 0R/ -L M0 XPDqPpF PA   p`A !@ 1q@W40  00S0(K0 P0 0 @P 0 4`P }0 @ =   0 0 g0p $ -fML Ma`   Pp0 R RpK 00CSN K Aᰨp? 6: S8@GKY>K 0C @5 D D |O⩛_^K5PETAXA\A>; 5 5 C>KE 5 5 pU  0 E E @P5 P 60 0R(KO00@0@00@0 (T- 0   D  --L M0 0  K -- LM 0  q K -LMRp@` R00?t^ 00P @ P 400 P! !  3x1WP5 0 K4K VP Y409 V[WP0P`0 0`f`0` 0 00+ (K4`P% 0P0WP C0PP 00  (K80 eP80 V ^P80` \$t -@LM(0S1 . 0 +PP 0(1/0 QP`p0&  00 0`VS <0`VK 0S  0C`e0`p0 -@LM(0S< 0 1PP 0(1/0 QP`p00  00 0`VS <0`Vz0 QPK 0S  0C`ebT0`0][0`0U` 0 0-RL0 @T0l0 R00 0R0 P P <P K0heE -`4@L@(Pʙ$0PZWKhꘒPp 0-0@L@$P嶙 0PSWK0h讙Hp 0-8@L@,P壙(0PVXPᛙ0p@-M t1t!00`00S0P  P XQP 0pS@  U8 CR5$0@D0 pS "T 0^ #R ЍU   "T ^ #R.S @A a  00CBp0@ @ NN!RR 00Rl4  R  *4 8/p 0X\S 040:8 R РS /F xB -Lp`PL0L0@D尀 1W  U fȧ  -LP`@60 A-PdH u@ \ -+*)("!%$q`\ mJ rOv ?Q00000 %\@ x7010pS;^ cTXǟX s@dT 1U QQ00^^70A00-Q ^Q0000  00Ns00W0Cs0 0#Š,\Q @\0@0%Ao 00&Ao  00=Ao#4~ 00z00NSP0<00C0o50000 I G 70Ns0 00Ns0 20Y ^ ^ 00S (50000 - + 00N70Ns00A4 0 0   $ 0W0Cs000 u00"000;^ <40000 0!00C0 0AnSu}i_J|{zAxwvutsr4pon+HBj;hc00NQ0v00N#^P0P0 00@p ^| =^ ^x 00t00p 00k 00f 00a00\ 00W 00R 00M00H\00C00=00800N0200.0000 00#cT`=dTR000<0@0p(dT? X T 8 -LMp@ P,K<0 10KB1K(80 `V, @<0 80PJpS T, 10[0UPE& 10[p08 08 0(K0 0(K 8;P U 0@ 0 GUPE10[p0G0 00  00  ơ -$RpPLP`h ""##12b! GQAUJ 0S$ RQ 100S 1003/P.!@0$p ~0V0Nl100SO\100SD 3/D!U 000($10P03/P, U@ @$p X00  0S000S00SV@0S |P0@0U@L  000800"/>3!8 P!Ѓ! $=  - bp` LPPg ""#3b!b GaAVJ 0S$ RQ 100S 1003/P.!@0$p 0U0Nl100SO\10 0SD 3/D!V 000( $10`03/P, V@ @$p 00  0S00 0S00SU@0S P0 @0V@H  000400PЁ h$<( -`PLPy pPv A@Pd  00 Qc,咈)12a10BqAW% X _PXT $00\! 0S7 I<1003/P0 0 $000! 0S 000S0 3/ W 000(tPp0003/P 00000S000S TvP00000/>38~d~<~= -`PLPx pPu A@ Pc  00 Qc,咈3a1a0BqAW% X PXT $00\! 0S7  <1003/P0 0 $000! 0S 00 0S0 3/ W 000(Pp0003/P 0000 0S00$0S P 0$000d||,|| SR-Lp`P4 000S 3/0Y @IOP  T 00 00 Y @IOP T L00 @ @0 0p`PP{p`$z SR-Lp`P5 000S 3/00 Y @IP T 00 00  Y @IP T L00 @ @0 0$ p`P0zL<|y -PPL@ Q PPp`L@P P`V 0p"S x0P0P -ML M@P` Q08  QL /QH P.00F "PP:p᠂x /Q1 Qs P P /RR.Q4  J   BRm/0  I0  P@E#K Ap@ (: S( )S /Q Rn/Q @@P800 `(KIQ .PQ V 0z/S @0W8 <8^Ku PE@ OP4    P/  8/Q0#8 x V/0 P00P0(K?0 V0/0 P00P0 C`P h U>0000?00000`0 -0Q@PLP6 i0a`0P9 0 0\0 @:\0 S \S 0@ S @ 0:S@ 0L0P ^04  ~ 0 @-0P:P\\ :R^0@S@0\\:R\@^ :R^:^ 00/Xs0@-A@\  \:^|^00^^ R B|S0 0:SS  -ML M|ǟ| @d l !Th P$ H4 0 X } T KD D4 ;/0D$, K <$4I H,0K0$Co0100M `@@ ႘t0@d 0D4 CKDd0S:SD4V F01000D4 \(t    0 00 $ -0-L M0 @ 0R 0 0 0P0U100M 0 0 R   R ,00 + 0RK0($ 40-LM @@0  -L4MŸ P`p 0 l20 RA dKD0K<@KH0K0L0K 㴃KMPH YL0 P0 g@PP0 I 0 L0 P0 T H yP0 I PH  X100s !&$RG 100S @0 0RR(K X0sL "P 410P0 /P9 5SX"WV00#  @ P<0PT0  A0ST0@ T R"@3:  |0v &ft0`p 00 ` 0S"@@@ $(\t`x   ;-,@ M@L@00:PK 0- {{ {kG[F  @:0/0/=A z0- zkk'k[FKE{{@:0/0/ =A 0- {{ {kG[F  @:0/0/ =A A{0- kk'k[FKE{{@:0/0/=A -QL4M@ 0 $0  " , 0 0 ( ,KT D KP00@0#D  K K 0-L M K, ,K(0 $0 0 zP K 0-L M K, ,K(0 $0 0 iP K 0-LM K"0 0 0 V K し ㈗0〗 -`LVP pP@PV P/ -LsM@ p` g?K|K0 1 @ @ 半O⺊0Qa a TA}oKXA\A0H  0 @0 0R(K(P- 0    -LMϟ@ p 0q3 0  1S01 `̓ Г $?03 ?03 P@U P0!%Uȃ  $ 0S0 R 30 0R,(K P0 P 0C `S303 @p0zSE8~}|{y(pniedbpJ 0 B0`p B PO 303 @3 03 0SI3  @DT񏐦|K Pq0 P 0`0CS00003d0CS/K10PP[ c c# P M# +@MQ$"$ 3S03 3@P UK303 @903 ?K3 0 Vo3SPkU3P03 303 3S03 3@03 3S S @PE!P U0C @`3S03 3P03 63S3P@S  ,K003SS 00C003 0X0 0S P U PQI 0#C  # 03`03 )  #S`L 00CS01000X3c cS XR    0##0#        #3 # #0C`X VM# hV h@ @@HVL`  M 0,K03SSo 0P 0CQ g S fP U3S303 @s3@<3 03 l3@03 g303 #!000C3 @[ 0@3 W330903 0@3 K3;3 330;03 #3 # p# 0# `j#`f# #+`^ ` Y`W3@93 03 3@<03 03 3:3 v03 V3:3 o3@93 03 3;3 d0^S0 3 0# 3 ?K,@@3 w3SpDj #S # P $  c ` !  # , K BC TpD-Rt ]RJ R 00 0 P 0C `S P @ P 1 P c 3cC 0D S(*k0/K0Q# 3 3 @0C c `  s  APR+ E  P BR@  T 1*PNU \0U IU\ P BR Q *P@sW30S 30SWW00CSpP0s T:sc 3@DSS5*T T 3 #@Su 33P3 K u30 l000S 3#0CS3S 03 3`03 <( l T   PmWk*@P XR sWy P 0P0CS0 R00*@Ps Pp 0@0CSP00T .*P03 p0ES3S P} 0p0CSP0@03 3 `Fs0S񏐗\'P<p+0E 2P 0P0CS0 X*pP P @0P0CS0\/0AS00P0CS003 " HPW*@P(U0P0CS0E 3P T *P0NSp0P0CS00@3 PS3~S P! 0p0CSP0@%03 3S 0P0CS@0 T0*PwiU nU3 sWT PO 0P0CS0 0R-*Ps @PAQ 9Re*P@ P BR @ X *PU P BR@ `T *Ps&0P0CS0pW 1*P@Sp PP3U#0R0C SP00X :*pP@0P0CS0 u0R*P03 3S.p@cs3@ 03 wB04 K03 ?K3 0p3 U+3@PC 0 WP #0C003 0X0 0S 3P 3 3 S @C %P 0 0P 0@ B0Q 0 R0@3 ps  P30A0VP PT*0pP PT*pP)Un0P0CS060Q*P@pPS3s 03 03 @X8K03 _Kc spw0S6W8 JPJ 0C , K0 @oKL> 0p4 P p ,0K3PS 3pGS303 3@03 P TcsSU 3S0303  3 tP3 S0 0@00S0 3c 03 9s 03 _K`s3#S # pG0` R)W9 ״P ,0K B@  L 0Kᇴp P p 3pGS303  !P Xcs3S303 C 0#劔P0 3 `0C 3 3IU!d # P#JRH*0 P PT*Pl3p3 M PW*0P0@3 p5 0#" ^P^ 0C , K0@?K 3 NQ3  p0F P p R6@bSP00X H*P@ ឿP)X'* pP/ # 哿P#)R'*@P ሿPbT`* P, PX* P _0U0P0SK0p0CSP0s <930 _ K30 WT< RP,T**sP  GPQ*P#]X sp3 p-P@@ T t pP P3# /303 0Wcs Ჳ0P#U B`# 0O PT*0P03 :c0cs3 # P#7R5*33 P@" ۾PW* 0# P оPsXq*0@P%0c@s3 PxXv*0pP@ ᵾPT*P(csC @ csC 壾@#S C# STs0c c @t t3S30C3 mTC #@t e3S:0@csC @QcsC @LcsC @Focs @@cs @;-00cs@3 3csC @- @ pcsC @csC @@} -@P`pL0 VP- 0    2p-0LP@8 !00S7 0`v 1S010e B00uPP0! pW@0P@ ᶰ`PQ 0 s00 @ C PC0000$  Q  Q* PR'  <0@08BP P00`0s0 P ; BA@ ?#0@0 Pܣ 0-@PLm )sPo0 -L@`pPt0t0l尀 @T  d@0 dᷲ$ -͏X P 0 0a -LK0C.{ 0($ !$ 0  c100A@  08 8P08 \  AL+\ -<+*)>'&%$#"4    p \Q d     QD P7go(Dr u <$r ] 8 H Hq 0 * --LMPpᔀ %@|ft6`0S00  P P㠀  P000 0KP  -R񏐻dhgfedQA00   R0 0R00  00B Sp 0 Q00NQ Ќ 0Bpp 0B ^X @ @ @ @ pEW pRs0 00S P Z#  # 00`K(K00 0 p P +^+ -^@@   0pN WP p0^p@pp 0^ @ 1pNW0pNἀ ☀ 0@N T @ ☀ qp0pG0N Q@ @H8CWXp@Tpg00R0 00 u0XSR xSP  0R R00 g :g{Q@R࠱ࠣ@G R@ #{ Wʬ\# Z000S @ `K(K00  R  XZ@p pRS X Q/ @ @ @ 0N X8p@XĀ @  @^ @  pRA0^ ЌW @ TR Ш и@ (AfkR[k#k B@^ڤ@Tf ^ \]@ #{k{'#{ ( EpPp 3 @R0b00 ?0 0 0 ˟ ۟ 0 Ԡ t@5?55?5?A|lN(IY @) Z  0``Q0QI`FJSZYhʬ0SVZ @Pb jP] 0 ` 0L0S{ P){ - +K,KJ{-kk$0S 30jS k&0B0 KU1{V  3 R  #{ 7# ECA?PP    ! xKK# P  Ҫ@P 0Q 0B R xAഒA Q6`q  uxK0p00K KxKKl 50@ SZ# P8 0 p0^ @ @0^ @ 1 NR @@ IN%^q eQ\#{0S1G{p0qk{'#{ M\, \5P#{`@kP{'\@U#{ A5N k#{{'h@ \#{ FD\@XP HK^ ?Af (|t y c  @K?P 00(S] L0(K T@K0P 0p0C0 ' P000 0(K0 N   10 8:@P کP $Y 崪P Ԡ0S D1(K0S   "00#  PP VuᎪPPpP ᬧ \V 3刣 Y jYPQ :S NVN{+S+S k 0AK+C#{{#{ 30 SQu{{VG>0S$&RfZԠ嫨ᩨ᧨奨ᣨZ#{@ 7# Vp"崐  B" H2,K3@PЀ t VN{+S+S 0sԠ 1(Kj l@ #[k{#{ L° \) 7\2#{@k@{'T#{ \! \. kl\ \e@4\@ @7Ơ LЈ #{@{u 0(K70sF{{gkg[3k -kEk 0S:0:g{3{ ,K,K PKR 50 K0Sd46S2 { ] ^N{^ C+S\00EM ???(_ |#{5AK+C-{  #{{*<0 Q#{ KK>0X S[ h0(K t0|#{0S3G{p0qG[k#k @%b\#{0S3 b0pA!kG{1{'k{'#{ JiSQԠ 0(K5& 5 0ԠS0Sڠ0S V `r0SK#kkGk#k 冧ᄧႧ倧~0S3 l2# 0 00 9{ *`2# 0S'S"00",Ÿ@ `VԠ0S 46S20kS0S0S$P ſڨ0S10 kS7Sڔ=;975 \|j 4VԠ07 SW 0S0  VKE !#{{7#{ V0`Sp| 46Sw0?o2jQ0SX00jSk&pBkxx K7P'K46(KS0S@ ?(?P9࿈ _!#{@ 7@ # ! C0S L00jS#:k0c3Qp0Rq5 006 0 )j X06C#: :(K;zP`p 0 0 AU> -L(M8180 0@SP`- P P> Pp  p0K0$p 00 K80K0`40Ki P 00CS  01:Kp  80804 45 ;01"0 0K$0pUX xX W  0 0 HT0Q/0S/S/0@-PP0@ S 0\\0 00@ -p BW"RL$M H L Hx P@P-T`Q +T@P00Tz Wo ? K K 0"` Kp <K8."<@_CK 00Bs \a0BSW0BA0BS70BV^KCKUT  S  R 0#K0P@L0 L0PK^00S pZ 0EH0 H00(KZ ^ i0Z0 H00(K0 $K 0#K p00XS00 C R A BRWx(KWq 2$K 0#Kpw @2$K 0P#Kpl 㙙 0 0 00pP- -pL$M BW"R< < P@/P-T`e +T@P00T W  ?X$K$Ka$K\ 08p KVGWV \^>cKK.4 `PcK`@0D| ^aD\WDAD\:7D8 Q6v cKXR#WV \^cKK.4 `cK`P@$K 1"#K$K`$K 1"#K$K`ZK V0E<0 <00(K0Z0' <00(K 0 p$KXu $K$Ki 0s00XS00 C R @ 0P$Kp(K A BRWJ 0p$K ?? 0 0 0L -@PL`-UTp 0S *P @p%S T@p@@p @ -LHML@KP`pP 0P KP0P0p0 K -#MLMxax1`p00P00 =@PN H1 `0 S 1 P(/ fk뎮K J  %xP% P P$P vPP0 0R%(K P 8 P PP0PS om@P(9k(ePꢕlK(dN M -L`TPvp@  PP r`vn`P` -LMK@xp 0: S  vp  `0KJ 0 K0K -L$M@`< 딣$0 40 080 00T0Sd30@0 40o e0D0 @P U0@ p p0PPu @G0 @0 00  gwp P PE U@0S4080SL4000 0,  A Vp:0  0 `| p-|P 0S)H PnP V0 S0 0F0Rp Q/P 0|  p ` Ap| l!00C#/ @!b1HK0   (rVH0[S0 0 R Sp000`0| 0p|0!R  B00C"ᓂ B!`1HK 0  qVH0[S0 0 R SpUP|0" 1HK0  qVH0[S0 0 R Sp000`0| 0z W|0T! 1HK0  qVhH0[S0d 0 R ] SpY|00HK/ b !S 10   qVDH0[S0@ 0 R 9 Sp50(hp ų80 4 . 4 . , *+ + + * * ' @ & 0&  x% $ # Qm  l n  l L $I | |0H  1HK0  ;qVH0[S0 0 R Sp| 0 垌a|  N 0  @ P ?NhPŃh@P A8 (A @DOPEAdAd@@DH~ RRAH`AHΟłi^œi A ^ N`A ,0400`0| 0cp_ 0t00`0| 0Rpq|0 0p0`0pe|00 SU V1h\0S0W 0 R Q VpM|00SE V1D0S0? 0 R 9 Vp5UPUP000`0| 0p QV?00V?00V ?000V?0L0 0@PVS= gS 0 p ` (p B /@!b0@P 0 p `00 p  HKpH0[S0GK0 R Vp\n h1HK 0  oVH0[S0  0Q VpokP r  HKoƉ -LM@`HKDP@. pPpP0 XU@@K\ p-@PLMK`@,`0 ?V@@Kp -LMp`PL@L0@J_k8 0 P@>_$K< -LMp`Pl@l@ P(_ekT ,K 0`,  00PU``@_(K < -LT0P DQ4.  Ӊ,  0-@L@@ 0$Hd0R0@-0 T@0PP0Q 0@0@ T D008 ,j0-00S |0 \\ H0 000000  9xXmNA -L M 0 0pX!G!`00FBK(POPEXd@ABd` P@ST000H 刀 1X@@T K`_ N̤d 0-P@L@P ^0S 0000P$ K0h^`0 -qp L` @P] @DR000CC110 0XaX 1D0   p ]?X0H!H 0p 0 0`1000CC1100XX0  00p0 00  0p@0 0?p0p 0 <p 0H@ ]$\,У\x8ܢ !-" LP @g`f] AR000CC110@H 0T`F# 0 ठ0 PTP ||00 Q P?]< "pgqp0` -]gfffDl ġ 0-(@L@ @]P]0` -@`LP# 0PaP`pT@a0Jh@X 0`AA\0O]pG00wZoTAXA\AXP 8 000  D. 0-L▽,@@0@P00S@0$ -@P@_}L`P(p0@aa\0O\ZO00TTaXa\aXP(0(  0 08FL@$ 0-0 00L0S P\P0SZ 0CsX@ R`\0@T P PP@\P\ -LM1!0P@Q0p00 `O VE V8 0)  `00S0K0 0K  h`P$0K h`P h0`SpV/0KT  KhPc`.0`00 0R$(K ` 0 ꀐ, KⴀK␐"hp`  0 @`[R0 0 0KhPKh( --LM00  K -Lp`ḆL0L0@DP lW   Kh)<  4 @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/Pp@- P^ 0S^ `@S 0TT0`0`pPPpp -LM4 Q@ ! 0匐匠 pP4`0 0 U`@D X00 0   kP:04 0(K(KL#    -LMpp P#NK` <0 IP  Xp  dP0 0R:(K0@0S+ S 3NK 0 Ck0S 0%  0l 3NK0 -k 00S3NKP 00S+ ( 8 -IML4M|ğ| @PP `p0 ` 0S SJK  `0 0R(K JKR JKRV# JK A  0J-K0K B,J0t J=K#J0C0 ? s0j h0PS  0S< S0SI0S  0S0s S0S 00 0WX` 0`J=K0C0b 0`{2J-K 0P( ZK0PE   S R 00eS:@PT8 0SL D`D V> U 1R* @@@0T&\\!^\ʔ 0 0 R0L?o20S 0Rp0SR pR ^ pU R$ D0DPS 0SU R D0DPS U RT 0S DPD@US0SA-@dQ M%R @ 0S  R 0  0S @T0000 Ѝ`lq ᶀha( R 0 0-PLP0@0T 00@@0T0@K0h p-L M0PS `@K`$2` h$@+0S 0S 0SKp -0MLDMK@(KDLH B00K38L #0 KLA K P@hK0`F0 (Kp1< BP0 1K0@A00> 0PS h2u K<A1#n 01p(0000 ` PPP  (K8 B ! P8K80C I008K80C 8KL0C000Qb(K 8 P0 K@@0 08  P #0?sQ (KD B s0(KD B0Z8KD0C0S8KH0C0S S S H0 0 0(KH B08KP0CD0C H0 0H0 0H8KH0C0 0b( @ -LAM` p0P (0 V@ @P' BK0 @` P+f ( 0R$Kh0 RP @@ .RB^K PE $0K@dDXH00( P 80 0P  R00/00h -0LS S0S4  R  R R R0 S 0/ 0 0S S S S S00 00S0 S000S00 00 p-LMPQ@`  R R Kp RRR Kp00 EP00PpV0S S  0` Kp  Q Q @, K P 00 ? , 0-@LP0 -L$Mp1p!0` P@0 C P2 0LK P% PD[,0 #KKK~(P/00T/ ( 0-@LPP ោU@0 0-@L ;Pt  0 @ 00 -L@`pPP  00 0   9 -LLM`P@2"0 ph 0 @0 D@ l P@Th00 0Rj(Ks@P P @K  .P& @@0K p0 APp0 RQ@ PD : 0 @P/0' 00S 0Sp0 0 SR sPD  0p @P 0 00Sl@P =@@l@P~(( -LM`p K   8 OK2 0 _K  WV` Z 0S0S `pP 0"020 0R(K 0K hb0?K2 V0h2 2  `P@nB `@?KB Ģ R @``V 0f4 0F5 VppW5h"R 0R000Sd2S  QS` P  P\?oRhb Q20Sd P2P` S 2 `PhP2`0`V2 V0SX0SU0;0S^ ^ ^`I 0d2`2  0V `Q 0+K `^0S 0@?o2P0Q00S0S?K`l2 ( Kp` ,P9 `p/K0 `P R @  @Bt @b"QKq \PD1x00x02``P E8z0#^0^@`@(8P l2 Ii -@LTMplK P1儡0|0  ᬿP0x | x0 DPL 0  R0S R R R0 T @+P`LKp0K L KL` P0p0  xYP(Kp`V`V 000 U`Vp0S 0PP0ST -LdM`pK@េP0 plPK @40p0P tKxK 0 ଁP P0S004 (Kx]P0x3tKxK0  P P x!pLKLKxH 90P0 P0 0 00SA 0 D -MLMŸ K0$NpK(AS 0 P K*K, B A h"K A X"KTK A0J * c `P@ 0#S2 =K0CSP, P=K0CPJP# @P 0S   @O]P* T 0S S S@ -UP0P:]P 0DD_P0@=K$0C00 0R:(K@K=K L(0C$L=K 0C(0L$ L$@ P=K 0C0(@T =K(0C`@T 000 4P =K 0C0(=K 0C0(@x\( < ,  -0L,MD@K p`H0 ttY_$PK$% )P @0S @HP (0S0 K  -&MLM&LK\K,N@D̟P MK4@D(@NKNK K~=K-K 0C$ B0 @`MZ* LE0S >00&0@0? [K-K K04PE B@0 =`P=KX0C00 =K(0C03/PK `0W@@S@×-K B T`~-K B0  &K d1 8V00\1S0  P X0  @P4A R@0SV X0  P zz4`10 0R(K0@l1 @=000Sr  .S 0S Q@Q@.@DOoBRc d10R:0  GP<0Tt1 0  DD@Q0p1 h1 &dATQ 0 N DD@Q0t1 0\1 ] 0p1 h1 0 Pb0=SA <0S S" S \1SI t1s]h1S^p1S- zzl100Sp10p1 0  Qh10h1 <.K PJd% 0 0 PBr<00n<0 0[ yg<00U0p t1 h 0 P'ʭ0 P Q<0 t! rt1s H<t10D<00t( -LMPpU`@ 3 0 S[ PP 0 K0 0 00 00000 |0 x0 t0 p0 l0 0KS5 S S6 <00<0S& S S!0`  0 0 0Pd KH d0 `0 \0 X0 T0 P0 L0  d1hH0S 0(K0` 0 0 0`  ` 0 |0 x0 <pP d0K0 0K8 0 "   ,1,0i?0 0K0 0K 0 0R' +KP 0 ` KwP 0!K 0      2P0SyX  d1 Oh0SE Xd -LMPŸ @ `p0 ' ,p! YP  PW  PQ P Qp0 0R{(K|0@SW t0@S0S@2 p@ #>KD2  1/K0KD2 S@"?KD0 ?K P@"40SD 82Z@2 0 SH2 @2 tPH2@"D0Z: 0S ppZ: H"  0 @ Z R  QpTH"IP@D2@" > ~ur( -@P`p 0L0 0 0PBA000 R#4000@00@/G-0HMp 0@P@0 84 0<U0 8`'0 `0`& `8lP.P00P%P8eZ@.@00@$@t8G & 00 " Xȟ0b%% `0!08`<$ P, haP"`P@%$`Wǁ@#P @ $(PGi !@ 0`"`ว,0l P, P00 P%PeZ)+C0)0O B @# @t4G0&0  #8 P7b%%0`0!04<`<$  P,@ǟaP" P@%D`Vǁ@#P @@$  b PF ,@  "00m @&0) 0 0#[4@&0& 00# lIp&0% 00# b&L6$0!`0=0`," ,PD` ƟP# PP%@lɁ`U @!P@@$  b,PE ,@  "00m%0) 0 0#[@%0& 00# lIt%(0% 00# b&`@,@$T4@ᚃP" !D a #@@ , pğ @$ @)0$ 0TDc>@`! `&$@8ğ `j P"0@P%ğPeX @# @$<@D&0,#0l΄ %` )3`隌0 $P !3 Pa0 ,@ ",0S $P0) 0# 0tc8c>`!, D@ `TSj"PP,PeX,C@# @,@ß D )0$0l̈́ `! b0`Ԣa 0 P " (0P0#@@E08b` )` xŸi P P%0PXbe[`0 0#  ( `020*@@(0bE`0 ,D` l̈́  `!PPe[ Б0  0#<0ม8 ` @`&`@e @! l͆ 4p P " \Pb+@  0$ 0,@pRL`0p: pPeEY@0Y@@I $Kk -LM@p0 0P(`K0 0  p!? 7R8 bx b   0RX KhQoH( -L M"2  00 P 4K `1pKI 0S @ 0 XR@@0 & T0 4.00NsZS Z'00@# P! 0F0S$ S/ S( Q >.Ġ.(.< 0T+ ) A a  00C08 CR0 0R(K^*30[4 [8<^*40[^20[3[44 [ 8<n.S^V*0 ꈰ( -LMKjP K -L,ML1L!0`@ TP0  Xpo TP8 ?o2T0S E0 0R0(K PK# @1, Ks0@$S X $ CY ,0K1 $ S0 P, K!0$ R0 0S [n$(е p -LrM@ P` p( tKe?K1 |@ x@ COC0TAXA\A1 zqP    0 {K Ypp 1@rP ( 0R $KP s00 0p0 n묬(B- 0   | -- LM 0  K --L M 0 0  K p-L$MP@dtt0l $ ,K00 4 ( 8 ,@ P @X@ᠷ8K`᣷V KpH   r-LQϠ\ Khm -LM010!0p`0 !(0 Pp@ PK ( ~ +Pp N@( 0R' KNKP@X @@T PU 0S]P@BT==0@0Qm(i 00-PL@ P0 000r(0Pr(P,Pr 0h0PP 0P 00 00,,TP 00 0Pꌰ D p 00-L@  ~ 0 00 00 0 0 0 0-LM 0@P 0r 00P 0   q3?o20cK0& 00 0 0-@PL U 0 0-@PLr0PPr0P(}r(P,P0 -p0LP`_ PY 0 S S @0 S S 0PH  @pZp @> HЭPP# @C 0S@ P@T! 0S S S@ 0AS AᮭPPQ0000!qP Q` pP/@v+ `@Pꄑ p -LMp @,0(Sg: ᲻( TQTqqI 00SE 0Q?@D@T0P: 00S6000@DP@D `% T4 00T%:P 010P I@0`" 00S0AS00pP  0(0oP@@$KA00$K( pP ( (,@ B( 0-LM 0@P   p P K0 0 0$ $0K KP K0=p 0$00$0!KFK0 -@ULTMPP`K ` @@0~PLPnPH @@0 qP=PPPY * 0p` QR Q3 0S*QQ   pQAp 0S`:0S bmn0P\0   \0  @h `0X d0  R  R RX0S R 00I @T: h p\  0JR5`0 (K  X  0 LKX0 띀d  D H j p 0 @` d0 _W G`4 R @T:@`0\@}p(K  HDS QAR  R p l@ @0p P AWU WK Wi p WY T' QWD W: Wp` ` @`^ \LQ  QAp@ \ ^ Q\2 @`0 @p(K` ʹ` `  ¹ ` R4   0Pl@  @T:#`p o'pԩ oL -'QL M`P]4 χPW<Jm$0 p Z@` (0 $p1Z`30#,`5 1 !,0%W-0-00(``P `0 0 QB`U0`c&V0!03S` `V:PVYIW(K`W,` W030#-05-0%011!00@oo(K@00(K0WK #((R` `84`F2`F1`FS 0?`FAPhV4C  0Fs0: ;0(K0Y' #((RP P84PE2PE1PES 0PE A`@U0  0Es08 90 :04  800 A*4 A#00:`08P0 -LM`Jp@% KKp dK!0R0%0 @᪚P`Ju 00p0 0@P  KOJ@ KK KCJ0@0 / 0-L \,\@ \ Q :^ : A 0꽿00긿00 -L$M$@\PJ 80K( X448 `00咀dK@p;:H LH `B>pC6j7z$>6`7- BL0C^8 00 4  ^  0`f89 0@31 32 @00(K ^ 0 00-SL@ 3/K0h$np@-$S8 Q@ $A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U N B B ^ '" ^ R^^W \ŸN `@O Q@#` P `N@F$PEPET% B B&"@D@D"F$PEPEX% B B""@D@DA$PEPEU% L B B \'"\  \ \ , ($ P@\1\E \A \C  P@$ NP$ P@@D@DF$E@  BB! D B!&"@@ AA! B B!"@@ AA! p\ \ \ \ @`N P@\XTLHDy7М ̚ I6 -`LPg00s !R ! PEU6@  ^P G0 0  PU pWU@XyPp X 00?  @@pG  ֶ000 , 0 @00% - 1 !0@L P0 010 00C11.R 0  0P0 : S`儺 P p@l0q`00 @  00C10 B0@@H ʚ;< G-5p%0  M ~0S 00I10@ @ ~^`P@T P~@T@ p`0IAP@@pP@~^P- PPPp0IQP`.Yp ಐ@`@pWp `p@pEI2Y 񏐓}#~}|{zyxwvutsfqponmlkj]hgfecba2cABdQenQN2Y REPONMLKJI(GFED#BA@3>=<;:98765432%0/.-,+*)'&%$"! 00000@000@ 000@Ѝ002cABdQeQ00⊐ಐ 0@p`B 0J ಐ ` p4 p  `p,`!0@ `p# -PLM|@ d%2Dh B!0CH M!!1C ,0@0 3Kl QL -LAM@ PpBnK `Fp 0( -pP,4[ S ( 0R$K.xJe (0, -@LM`` P,pP·P 0S 40000K00S.SK -LAMd0d0 @\B^KPEp0 `P g 0RKeЇ( 0-SL@P` @0S EIPV 00V00 -@LM`pWPU 0V0 R PU_L0P0` wW00KW 00K| p-@L MP`*0S 0U0S @0SOL0@0P JV00Kp@V00KpȎ -@`LM KQT:8K,@@ 0 0!Ks, H Q 0 0{0 0vrpr -@lLM KiQT:<K000@@0 KDrt \ -IMLMT ş0@@P@ P4 x5l 0TX4 000 rP5Yg0PL4 f 0 05}K0?h4 C>K 0CpGH4 0` p$ /\ ` d$ 0 4PhP400V0S T40  \4d$Sh4 ` JX3D4[S @4@ 0P$RT@$ U x I`  I V 0 |"1l$0 00 .V 0 ta 0` U` 0 dt刄匔AP4SVT40   { 0 0`0D   IV 0 Dר0l$0 00 .PV겹jl  IMb(qp \  | h h L , Ȉ ` -LlM\@Kp `딅P0 0LKLPK^  h  S%[`1l $[S` $[ᰥ[d 应[ + 40hA  l0 1I`1S   ;`1S0 P  P   P  P  P  P  P  P P`1SXh0SZ RP_ 0H 먂 `0H d0 H \ 0 H`1S   ~0 ` 0 `}@0 `w0 `q`0d 000& (K >  h0S QP_p 0`RH eh8 DH(K (K 0 g!0 `m0 Y[0 RH0 K50 D"| 0=d0 6}j hh < Lg Ѓ @ \ \ <  ܂ 0-@LM Ta TR !T^ 2Ta QTPK0TI T= /TU lQTP 3^\1P@0(  T0  TE (Q TP @T T) Q TP T+ PTP P TP PTP P TP PPPPPPPPPPPP|PPtPPlPPdPP\PPTPPȂ  ā  0 T L  T    T 8 L 0-LMP O@ 9PK0 0P0( 1K0,z 00A b M-L@M0 0` PPpKP @ .0$T @D #7000 0R K$00. ?`u( -LM@8 4 0 忲8PK4KpA0K`=0 44Q0P RP (KR `8-\ 8 +\ 8 #0@0 0ಠ 08  Q匠ಠ10 B011.\K 80 @T@ ppßW* 0S#380 @ \R  R 0S#380 "#Tp 6)8) *,& )Ġ `0&*8&d*p  ` 0080   080   0L080   0 B   E80@ p @  T  R 080 @  S # 2RP T=S; 080 @T280@ @TQ 080 @S#2Q\ TS 080 @T@ @ g dbs -LtMQ0@ S 0 ß 3? S12/!< @ Ÿ8 QS0N0baf\0 専2'ccK)ᐃ00b02 P2cf1NRL0 Re2`Q@1ARD0 :P0 W0E0< b0bf,`0 !3'ᓀ bf HP P4 ra4baC4 c11BR X0 Re:`QNTp qL ^< ^@^ZT X0 G Y I XK 040$ 0\08 0D0, 0` H0 0 0(pP `%K4-Z :dY 6dX 2d(K8 Lo@S@(@U  0 0(K`Y PX@ Ԅ igsEMb|!Qx p ,Px ^ ^ ^ 0-L@ðP00D .R S0*SQA@0T.S 00 0-LMP0OK0 P \@ 0v. 0 0  -K0$w -PL M@( K(0`Sp` T(0w0 K P| 0000 ,Kp᳴0S, W 0#03R0S0(0 Xkv -P@L M( K(0`Sp` T(0w0 K |P| 0000 z ,Kps0S, W 0#03R0S0(0 Wju -P BU"RLM 0 8 4 `0p\ p@jP-T 6 +T@00TZ US < ư`Op< " 9 @00Ds Qa0DSW0DA0DS70DURV:  S  R  0@80 840RQ S` 0J00 400  (KS R 04 0R00  (K p Pt`XQ 0A P A@P UUp Pb@ Ppbꙙ 0 0 0]fZ -@L`᫦00CS0 vP0 `㨦 SvP UDP00CS0p 0/ Sp RD 0-LM@( '0 0 (0K 0 $  m00s !R ! K᪢PiK0 -@L`T00CS0 vP0 `Q SvP UCP 0-L 0R0& @ R S & 00004S2P0S R0 S0$@ R0 0d -L0LH0 @P`pp0 Kh\c 0 0 X pc  -LM P` pp@ 000 0 0 000000@$K$+J !; 0!# =+J   +J "  " +J   # +J "!  +J J! 0;J=K-K<0C8 B0 EPDK@DK =K0C0S  0D; 0KAD+ 00KS0+ P0S"  K@@P`q0V4  0d  =K-K<0C8 B0  PD+@T=K0PS=K0@=K0C0DK T:U=+J01-0 30;J0000;J020 20;J0J000J;JJ+J01-0 !30;J0000;J0 200;Jp+J0-1 0->JJ C C Cb=W ꫝK I r@PQTT ,n`=K80Cp=K<0CPD0Q00 P'0PTem0 P$D>0d D  =K-K<0C8 B@P0 lP@PꫝK I ,@PTT d 0@ =K-K<0C8 B0 PV9 ]@D;PD;@0VD; . 0 d =K-K<0C8 B0 PfS~LM0@0d 0 =K-K<0C8 B`P0 PND+0D d  0 P=-KD; Bp0SD; *L@D;0SD; * 0 d 0 P(D4<0d D  =K-K<0C8 BP`0 pP=KK K$0C0AP`@p@C 0P 0 UP)=K0CD; D+  PD+ @-K BD;p0D; ;0d P@ p> =K-K<0C8 B0 )P?PD :D;J0D; R@0d ! =K-K<0C8 BP`0  PD D;0D; 80d  0 PD D90d D  0 P@y-K@`$ B K KA@ 0 BsPi=K0C0D 嫝K IC \9P@PD ' 8i`=K80Cp=K<0CPD0Q00 PD0PT^ኢ0 P7 0H+HK{D 008B0d H D  -K8 BP=K<0C0 ~P`D;-K-K< B0D; -K  B@wp-K B R9K D+P V  K@ 0 UP `0d @X 0 GP`F@P=K0D;D+47D D  0d 9 =K-K<0C8 B0 $P=K0C0D 嫝K IC 6@PD ?TyTd f`=K<0CPpD-K0Q8 B00 P0PT@ܡ-K8 B0 PD;P0D; D;@0D; D5@MK @DP02 D =K-K<0C8 BP`0 P_-KP`$ B K KA@ 0 BYPN ,5 0d =K-K<0C8 B0 P;D@TD % -K B 0R0-K, B4`BP`4000 0 g 0H+Hkd D 00CTH D 0 =K0C0S=K-K<0C8 B@P0 eP D;@0D; D3@MK @D02 D Y=K-K<0C8 B`P0 BPKA0 D VPD =K-K<0C8 B(C`P@0 D &PKA0 D :PD =K-K<0C8 BP@0 D PKA0 D  PD =K-K<0C8 B@PH0 D P-K@P$ B K KA@ 0 BP>vD=K-K<0C8 B0 D PgWD =K0C0S& =K-KK<0C8 BA0 PSKAD;L! 0A=K-K<0C8 B`P$0 P ( x> P> = H= = < 8< ; (; ; : \/ : $; : : ; 9 - 8 89 h9 , 8 , 7 8 x7 H+ 6 p 6 * 5 =K-K<0C8 BD`p@0 D )P0@0d ,0@ P`0 P80  PD \QDP@0 D P H0PH A` 0 H `P~0 PvD D@0 D Pi H0PcH A` 0 H 8PVt0 PND [RDP@0 D P? H0P9H A` 0 H P,0 P$D 1D@0 D P H@P H@ 0 H mPPP0 P0 \P 0H+KAD;$ 0A(=K0C0,$0C !KAD;D$ 0A-K B `0Bd$ Tڭ=K-K<0C8 B0 )PTڭ=K-K<0C8 B0 PwD40d D =K-K<0C8 B0 PD 20 PD;XEp@D{ 0 P`-K$ B K KA@ 0 BPuD{=K0C0S=K-K<0C8 B0 P*b=K-K<0C8 B0 PV4f`_T ڭ=K-KP<0C8 B0 PDx60d =K-K<0C8 B0  P1=K-K<0C8 B0 P%f`z=K-K<0C8 B0 P g`ꫝK I >@PD;TcT \wp=K<0C`P-K0V8 B00 \P0PT0`F:7-K8 B0 MPTڭ=K-K<0C8 B0 >P=K-K$<0C8 B0 1PHh`m=K-K=Kd<0C8 B0 P|pKTxڭ=K-K<0C8 B0 Pl=K-K<0C8 B0 Pxp -L M`^pA@0 <  00@P@pĜ` PPK4cMM$000 1 2Ѝ/P -PSL`p@ @W0 V :@Ot@PU P@(00V@D : 0-`VLPA3: 0@4T0, p 0 40@T"T0TT400S0 XT0(00$, P@@ꥡ( 0 0 -QL MP@`p~$0S 0! $, (0v(`Vq0Sm(0S0! , ($P, S=100IPc, 0\,0W   ,  U$ ,- ^F:1, 04^0, 9:(0$0,(0 S(PU$P0 " K0F *P&, (` , (0 0RTPTP(0$P0Q (0,  K0 K 0 ( 0 0 -QL MP@p`$0S 0! $, (0w(pWr0Sn(0S0! , ($P, W>̠ 000Pb,0 R,V0U?s01,0?s01, - QF:03? 1,0?s0Q1, 9:(0!0,(0 S(PU$P0 " K0G P&, (p , (0 0R QQQP(0$P0Q (0,  K0 K} 0 x( 0 0QC-W`@p 0 <S'A&a$Œ?pF$@`P pP0 < S'A@&a%Œ?p0:P `QP`Q Q@ AP <@0U,``Q`  ==Y*0 0/ / -L$M` @ğ4 0p00 3P0@0 3 040 30D0 3080 30H0 30<0 30L0 Q 00@{=Q 0垎0Pr Y6 Y Yy V XhTP0C10Q_ 00@t=QX 0PU < 0C#" 2@T007:SHQD 00@]=Q He0P9 V@ X48 0C#! 3@T007:S'PQ# 00@:=Q} DD0P V X4 0C00@Q 00@=Q @+0P(K PQzY(KV@ P T* P P Pdb` P]PQ 00@=Q LP @Y  YR 0@0@ 0S VX0S  R 0 R0 0@=R  x. d. T. D. 8. ,. . . - p@-0A0S@ p00XSA 0SpRp.PC+SU-PPP` 0000`  0C ^7ࠃ0ࠓ`0CVs0 PPP  0PN U7P0PN -@LP`BT @0 x0U ࠱ࠣU0 .PF0 #2 S7`0`000p 0 S7`0`W00 ^P ^00 0 0/0 0o////d -LDM @0\`K0p2 ( 0 RP 0 PC P( 0R KOG@(' -$B$DhbL%Ƞ᧒f 0NMcKa4 R8 垆Ae8P L D"!Ⴁb%)@)bQCก Lc`0 p< @aN2<0S9VAUIY<0`00 4`K0@K0 SP#Z0S    00000000S0@(K40K0 KWiP40K0 KD<_PV 40K0 KHUPU 4`K0@K0 MIPY E.‰%I$ųMn8 -L`Pp=0S@2` /T#  0R.S@0D0bS.P@TD \PT S\P  @0. 000B @  @^(0 0 -LM0 0@^KPE0pp  0 PBnK`FH P *o 0RKKF ( 0--LM0@R0  ,PP*K )K7F 0-L@ 0`00K0h -LM?  + K 0 Q000/ -LM0`Q`" @P0 Q0 0(K0C3K@ `<4 P0u# I0@%T *V  "<2P  0 840 0Rt(K 0  CK  @ ! < %C@PD PP? 8<0@ 0 㲢P= 0P00<$ 0 0k_EX5  0@C\0  R     @T&n 0 ᑖ 0 5E 0 .Eၖ 0 z 00S SoZ?| ( H  -LM`pE@P0P0 0  `0  PJ(K`0 PP -LMP`p@P 00000 P% K0 P0 RQp-L$M``@ P/0S9 0S 0S0s7 S 042 1 00 00( 0 ,K,@ $ P P0@0KpR R @/ 0 0Kp0S0@0  0S @ 0 0Kp0 xL -LLMLğL `P \0 0P X 0 T0 (A@P 0p ED0p  P PP 0@ K0 L P0ï RR RRd0 0` S Sh P0 S S DP 0   R+ ` sH pPp``0P@ `V R R R`  T:(BP pT 0D@ PH\0h dS GDAA`C\ 1XVH@ ;:`FR6pL Ꮝ 0p`F0V': L0 L0T`FP0 K T0 ` CC  j0H QpR`FP  d@T`CC뵔 0` T 0P00 0R4(KL  P0ڵ P& 0 0` H0 H0`:XH 0H ]C0T  `00T 0}00`@ ` = ($ p-LM@P`0000  0gKp?@ -L M@$$ 9 K?? 0-LM@P9( 0$0  0K0@?D? 0-LM0 0@PU 0t  00 000@mT 9 PK0ᄪPU\00h >>@-p1p!0@ M pP ` 0\! 00 0 L RC0100 L.\U 0 00Ѝ R0 XS 00 9\0 \ @ PE U P(, $Q0 3?00 -L4M2Ÿ0 @P0`00 2 P%0P@pK:U@0 00 0H h2 0P0 0Lp \p  pP`H 0 KT X YM .P0 pWg/000 0Rs(KZ@H0 0H00H0 P PP0:YGW T0SH0L PT 0P:U`H00S L X R:L*$ pL HPY\p0PK L 0U:*L0 T0S% L R 0BS L0Ts Sb 0.Y`\pL00PKYPL ʄL0S<0 (T -L(M P0px 8`K@ ( !P * ؊( 0R$K0@0;T ( -L|Mxßx  P )K0 PpK X0 @B1T0 ,PK2\T0N` 0 r 0S Q r v PQ  0S` rq v00Y0S Y00`` `0K0 2圐 0@0 2KT\ P UN*:0VT0V J1 L!XA@T V00 S 00SV:0@0Tv㜐0 `V S$*: 0 S* 0C\ :@ #0/ 0 0 Q1(K 0 0 v0   P0S S 0Sl0X S0 J ᜐP ᄍ0d0S : ( -LM⨕ ,K0@SPN ᷄(XX Ur U U 00ᲄ`(K 0`p0S 0 % 5$ X ;0`P+,KP8/0 QP" 00P @ P [@00 0 00 x(K` 0* RD ;0L UW,K-KZv 0 008/0 QP 00`P\ <`Vbᑁ0  0P8/0 QP`p0 1 0 0 `VR <`V,K0 P,K0Pg0Svᨂs,KR0] 0`pfKppPn%K K K 0S  0C`ppW pKP{ 0P0\L 0<`80@ V0 0-KmK KV ᩖ) YFmKL00c` 08/0 QP& 00  P  @ P ?00 0  0`R0 KP0S : 0C`0`㞃`弐00 @ V0-K`pT4 K mKV0\`F0J00 @0\ K? 000 l`g`c0 x -L,MS\0p < L  P <`D0 L0 D #`8p >00KH0 WPPU8>0P 8   p@0 8 ӈ @0 T^ X0 00H<PT 0P@@V@TU 0ED  R% DQ DRO 80Y5* 0 LR0.  PZ CYR Z Oo PCUB0P @SQ00 %  ED Q" P@@@ @@ T @pZ  R0@<˂0P0S8  (KSy P0L\  @ R:P\8 S00 8 P@kL0SW a~P Q  0DPL@Q %Q# 0Q 00-8 <80 偂U>80p(K @P rL ^ 0 R R R R Q  @ 0 QV R -@00LG`F0wp 00QP0P@ 10TS P* -L M@P0.S00K -L M0K#@p@K R .S.S Q0B Q-RS  .R0 .Q AAQ0B Q//0*S0.S S /0S ! C]R.S  .SQ \S  0 "!C]Q//]R0S! C//0 0 /l 0 0 /L ( /0/ 40/ ̠ ( 4 0/0 R @R /AS0S01!// -t4L0Mp`80 0T4 Q PU 4 P P*. @ 00 P00 S@U P ` \SP` p"B!B:QD9B7@?>32;:98-6543210/.-,+ )('&$#"!  S3 @\]PS&rBp ࡁ  Bwpqr   @S @p40PqP.03052l:ɍ( 0 (KAQjQ0 4  cQB!  Q  SP!0 Q`+``q0pH XPX0 `X)0 8<0 @@T<0%4@0I S P ,`0 0X 0 h(<0 `P<0 h(!"l<0 `P<0P*00400@U 0 P̔QHį$ -L,MH0 0P<0 4d0@0 4 L @08 `P0 Qp- UH [Q_ {P @Q {P @Q【p {P @ Y80SPQ@p<0 D B08< P<R  8 RÄL 0CSH R00(K\Qy .Q<0 0D0CPuKQr<0Q S.Qj <@ @]{P 0pJW00 R0xSO2@ 000 F 80p SZv0D /R_ ]RGQ)SD0p2080 SZgQ 00S%0HD 0c3 X xA0< 00@SV .SM< PEPT0  0KB0  T0]R @j0@P0b( 0 (KQ  P D X"D 0S 08 pZ R+  P0R 80 SZ(@- 0 (K005S 80S„L0 BRH0S0 0-80 SZ T`0 -PaQ`L@16*0pS. R/ 0qP0*X'*P@  @ 琠岐 T  C d 0 TC0@Sp0Dȋ(00 8 R-P3P#RP3LM U `4 p@ A0 <0  Q5 @P P P (00 (KV@Y?00B@S00PS@8 P8 40S @T* P pP<0p0G0YB -LMP K -L,M`S@@ %  Z< ` 0S `0SPp PpWXP 0S1(0p0(K<` 'p00(K00 00 @0L` p0P 80 H` PU 80P`V* ᨃXp@ P00U0S <0H S%*40 40`40 V 1 HY0S - P4?0S``VH04 Sъ00͊(000S L 0CR* 0GSP0S 0P0 00pL0 D -D 0 PP P 0AC\ 0AL^ \ 0S0SY8 0RH` ?0)40@0 pBY<`AZH`P 00M@0pFN? -LMp@xx Pp`~K 00@ p@  p 0RK@o3 ( -LMpp @J_K`p0 ( p 0 ( 0R$KK3 (Q/!0S/P0R/\/\:00/ 0-PLP*0@S @R R R ( 0 0P00QtP Q0@S Q- AL 0S R: BR B 0S  ԉ00Aˉ(00 -L@TPp01  0W#0XWXTP` ᚩP @TP0   0 莉( 0 0?o2 Q-L`@S 0RP@`V  0PR@^P0  -@LTA`pQTPAPW1Q@B?00=(00800 Q-AL% 0S" S0S  Q :AQ0A 0 0 (0 0 --LM00  K -LM@$Ktp KTKR-0S0 \ S \00 -PLM BU"R0 4 `0pg p@܃ P-TD `+T@00Tl U PV\8 2Op8 " P-  T  R& @@0Dq \@aDQW@DADQ 7@DTr VP  T  R  @ @`m h 40S R0J00 0 40 (KX04 0R00  (K8 1cOhp8 XQ 0A P@P A@PUP 0 0 0Zꄸ W -LrM@ `P eKp( tK |@ x@ O\ 0 TAXA\A{KQ Q 1( @0R$K 1P (- 0   ꄷ -- LM 0  K --L M 0 0  K QP-LMP4 0 d 000S000s !R !p 54 @xP @H@` #/1R8` = 00Q*R  "!"""$"( < i5P< / 00   " 0 BX@p @ RBP  0@8p 8Q 0080S  (K`T 0 @00(K0U 0 -@P`pL 0S pP@TP P 40 @U:X 4Ppp0PSP @TP 0@U:X 40@@00Q@QKx00p@@p KPj K<00 bp(FdP F\DFEEDD 0-L MP @0P X00 H0K0 00oP K0K0DL -L M PRP H10D0SD 010a00q00@`p 00 #).0@S+00儑 000S 0 000 00 |0 00 00 0  (KoQ(00H -pLp0S P`0 PS0@{P`0S  pi 0@@  0"P B`B -LlMx oSR|0 3P0`t @c#00 0SSP0S00 3ß0 t0,K 00 0P W @0P<3<00 43 00 00 pp VA2 Q/ p Q*  P0S@ x l 3/0 10p0PUp@RP\00Sap" 00C0T@(K0,K @ 00EP 0S t0P | 0PK0L 5P 0 SA` @@@10PT `0QD 0 R? 0S,0K<#0`!` 0@d P] <@@h0(Sd  d @0@h0Sd  d @0@Tp p1S MP3 0@0C0,0K<#0  0@d ", K<" d0 @ dA@A0A?d@>?D?D>>>=P>P=G-MrXBϠD2l11Pe 0Ss z:SjP @b fTb@?0cf0ǂj1N1 @P 0 ἁN➈ϠIlǣj@ aLf?@1c1c0\0B0P0BPDڅTa ` a V ڀ`@\ P 002c2c^3P ALRAPE l lT3 l P 0S :S 0Ѝ002c2c3P0@02c2c;P3:=00C02c2c3Q*gfff$I`P $0-A?CB3c0/QQ-` 1 R 0PR0P 0 / P 0V0 0R 0/0 0S 0 0S0 0S0 0S00C0 -LM@K  `0 0S0@ Rై8౒?c0a!BS ! BQ  R\0A0(E0U@!"AP/QA!bP1CQ0 10CR00SF \ @Š`0LS  qpGPppW,0Jtǟ@ P%v>R 0SXXX0CQHLKB`PA`A\ \  R SSVT 0(K @Ɵ堦 N _eSeQQCRC@ T BpQXo PW @ S v>C 0C;R 0 y00 pK@QĠK` p K0  Dd0C/A!b!b0CvD AT`PbJ/2BL1#b0w?C0C0ԃK/A!b!b S0 B .0 z.0  z< 0 z< 0 yT0Z 0 ?<?"c!!T:3c11T9 0 00S `F 0 S0 P` 0 `$00!dR0@ -ԃK \0 RPR ` XP0D0QQQnmP$IDxl\ 0-LMp@@0 0P1P U0S V"!9# 0K#K#KX0P 0}0 0(K0S#^L !V0H\ / 1V0 gVb 0?0 R ͌,1P0!V#K0> VPx 0 0Ό 2 >"tK!9# V0#K:∛ Fh P0t P F>02lVK  P0SP@=00 S,KP\,K B@!L^Y; >KT2  Y4 `bFll0SP TrD0@BFLl R ?ohh A @"2 0 <2  r01[ Q h0oh  C0 0C0YP Yv|T 0H0 ^(KK f|L20?K `| 0s%봋 ( -LP 0SS2FFC`0 X?o20S;R,R R0d Sp0 x K:> F,lp-W t  ! t p  "F lP ^tp |  t  p pတ `x`r0FS 0S>S>S@d V9hʅ bph&lvpvtvuvxv|vvvv { `s p(KdKP ` V0 >SS 0S>S>S0@h0 T0K|0 P 0,S@0K0 P 0S, Kp dgn`h`aʅfxp l6p6t6u666x|& p (s;$@ `3##!U!@2U@@xPUpP p0PC B`K3P] F,hh0`Pt@ @p0p>p0 ` 删 匐 @ O@2#2a11W`#"Q20VN` 0 2Xct0剡  %K RP0 V  0 t0剑 %K ;P0 V@@ -@ p t x*Pp0pSt d| l`` f@ 0 JD Q@ 0@KX`  g>f΂0`@K0GS000ř0`P40@t p0 hDԝ{Q3 -LLM@ 4 R&PL 0T00L 0:S0@/SS u<:`P?@5(ʟP p0 0: I0P/S .hP T0.S0S/SBPPP)+P< P@~((Ky@(K8YPy@P0h0 0H0 ,0d0 0 0 $044\0 1\0 0 $044`0 1`0 0 $044@0 1@0 !0 $"0#44T0 $1T0 %0 $&0'44D0 (1D0 )0 $*0+44L0 1L0 @0d1SDPLT 7R1\\0PS`PQppH@,0@P01#02#X  0t <  0Sx0 QP - l `0p 80 X j pP@4 <$ \ 0W0R 001!RGpP0X0080`S00 D`lV04Tp0P V+@T S00t0L@ 00Fh^0 TP, ^0^ $0^^4Č0^S 0@p 0$4x@PlD0SL0S d 00LVS -  Q R0*;@0 "F,l R 0D"F,l  R 0S0C"F,sl  R$Y`H23242d0B RlD Rl ,`@   P0D0 \ :<0 6 PS40 GKV,JOV|h 28 00 hpD `80U`PUL 0tP00@SD40YD P/ 0RA 0Q-=<0`@0paQ3 @ R0.\ 2Š@G;F̌@>hYD 080D00Ddur1\ Pgo0h0 1AL@0 ^`a0 tRE SQ0- 0-@L@}0S tK0hud"PP P@ @h@P  Z 00 h( P[ -@QLPU 0S`X)00 000h6l6p6t6u6h; Y`P 0:S  #P `V _VLpg@p`dPT`V pp 2F"F,l02YhV40 T1<080 T U0 R7 S0# @T A@@420C42842SV @^ T(KS 0R0P3/02S04"R4 0T 3 # T 3R0`0`@S 8 0  3/02S @^ x F -LM `PQ p( ,@eKtK |@ x@ O0U1 >KPETAXA\A1 1  0{KQ Q Q Q q q  1 ( 0R$KqT00#\ ( -LM 00 K[ -- LM$ 0   0 K[ 0--LM0 K -0 0@L`Xc`00CS`0 vPX0 X `Xcp SvP UX0P$[ X0X 0`00CS`0p X0X/p Sp RXZ  --LM$0 0 X KZ  --L M( 0$ 0  X KY  -WLP@[c0S000 `PP`g+P.0`VP pC0 00Hc  h000K+PJPB V: h 0 B  p(c Glc G lp --L M0 0  K -- LM 0  , K 0-LM` Kp*PpPP) @P&  1 P(0R!ʬ0 p@ 0$  0,  0( 0 0K 0keK@K!o0000@W Tx 0-PLb@$C@b0 -LP`@Hk RT0U :T:0T:Kh1h R-L KhS 00-sL@P !R ! 00 0S 0BuPQ`0AP R 0 UPPUj`P0_P `_P0  Do 0`0 R-L@ ` R R ^0A A0\00S000B A 00 0b P A0A0Pp p@D!7C000A0 L␀1 BH!!C0^ pA \ S\P  `Ap AWp -P0P@!@1ULp `P  D!~n`@"`P  0 0  -LL0K`  u]P0U* , uTP0SW #uMP0U*  ! uDP0Sq   u;P0UY* P KTKJp(K ' u)P0U*  >  uP0S uP0SL   uP0SP KTKp  uTX0P P KTK p s uP0SP KTKp  uP0SP KTKpP KTKp  P KTKp P KTKp  P KTKpP KTKpgP KTKpyP KTKprP KTKpkP KTKp;dsP RuT Y1` TKp P$R`0 7 uxP0SP KTKp> AP0Uf* <@A0 SOX0P- -(K`@@@@uGP0Sk C u>P0SP KTKOp  \0P00T,P KTK<puP0U*  TKd0 -pd0P KTK%pP KTKpP KTKp@ B uP0SP KTKp  uP0SP KTKp  T0Y1!P6P KTKp 00B SA0@A@ 0@D0B Q$R uP0S!0T Y11PuP0U:P KTKpy  |tP RT Y1` TKpc TKd0 pd0Z$R0@ 0-L@Z0000 -ML M? 00 | ' 0  1S0106KO&0   R 0 S '0&  & K p & . 6 7 7 6 6 6 6 0  夆 否 $7 f0S %Snf0 6 P6K5Kg>K 0C@ `6 ` 0DZS143Df ]NS! b=.w{vzswx@T  %T6 V 6PJ60S6  pQq p TV t6S 06 6S o60@0S 06 =K0CPP a70 0R (KF[P 00 S*v0s& `GKY>K 0C @5 d d O1TaXa\a.jˠ^^K D PEe `, @ECKL0'e `Pf ZP`f 0@&0@00iKP pʟf :  o Q =K 0CX =K 0C    `REK 0  &KQ 3S06  =K 0C006@@S@T R  R#@SnK`F0X  6 6 6 6 6[& F S& & %[R& & & P R& & 2 P@U/UY 0p `@PEU R 0& QPEU  @`pl80^ P 0<6[pS 60S6 k>K0C0 pQW p 5[S 060S6  R R% Wf p"6& z   S K! A R0-0-K Bp6K6S66 06 f 10 r   Q K L& [@6[@S 06KP@G006K6[ SR'  0S \@@00 D R0 A R$Q&7 R06 7! 0& 6 & 7 6S0c6 +0@6K6f S0Ds06 06  P@v6t Sf & 06 E (  e  D 8 YXLXWdVT l ( P  6f @fo V6'10,K ' ̆ F V p5j `0&K@& & & & xP@ PP0 f 6  S* 1&  6&S707  0K A x H>f %K: `[@06 6f f@C^KPE _V76YK J07  7sp ?F 6 f PaTf v X0P & 5K6&S06 6`n S7100{ {j.K0 BiK7  L0B0G 0B{ X% &6B Q s05K6 S&  f Po06 6f 6S 6S7&07 Z 6SFT!XC^KPE  _nKD_@v 0`FvP @6 0 0@svPPV  C>K0C  㠦 _'0 jK pC 0& 0`0@*T 0 D R0@100 D R6 wP@9@@P@Z@P3Z@0 P@-6f V 6S7&`a07 V V  FT 3WP3 HX 0&K@& & & & /& Ff P"xf @PTf s YnKEK̆ 0V &K@& & & & `F)0㵦K@7 =KYK J 0Cd!.Q000 0L`L0S00SdFH dXںiK_P@& px6S6S6&6@JT@T ڌ60S`@ 6 pQB p 6T0CS@+S&4WPP p@DT0S 6 Q.@DT pʔ70P0@0  pQr p '6R`k 6PSd  p8k^K0PE0$6 V W60C6 600pGJP0   Q  6@CT@T ڌP `@  T@@@T#T:P @DT0S P6 Q@DT 6^   6`WSөp  V `!6S6  7,K60pjS  6 pQ p 7@C6T@T ڌ60S`@ 6 pQi p 6T0CS@'S&*`lZPP p@DT0S `6 Q;@DT p:00P @ 0p66Q6 iK1P iK 7 *P   7iKP& pz6&PCU%U20㤫 pPEU R 0& QPEU p<0\0P0 pQb piK 7 P p 7S7&`a07 V-06K6`fSO 06 66 6060RQK [SKH F`HD6&S0 YKK P J`K   Q6 C 0@f < 0@LT@T`]PP 0@DT\ ` Q>@DT 00.P  @  0Q 06 _>K 0C@6 0<  p66 iKJP+ 0&'P _.K B  Q iK5P piK-P& 0iK#P ^Q KQ) niK P& piKP 0& R@`&  gQ 0ciKP& piKP Qk 6[ pS7&001{ {07 j.K6 BiKS L0B00BG {u?&R16 {iKP priK ' P p 'iK ' P p 'P   `IQN_>K 0C@6 <  00&> 0R00 & pQ p 6S6  60S  6 pQ p FTo6&06 60 7 S    60NS `T6[ڠm`@ ̆ & F F F iK5P d6 V iK(P  pdG@e C S&7a`0v`7 A Q aX =K 0C tl@y Q 6a& v` my@] Q 6a& v` `iKP ?&0S%K- C+ S6E%K0cB SaBNK @D D C0 P0BB00BDs0\0@*N_.K B00^0DC000C&7 R6[@/& F F F f@]@/& F F F f4Q6& a&  7`07 06KQV K LQ76& `0a& 7  iK ' jPK p6[ 'K06 A/& 'f@& & & iKRP3& 0<`6[ 6 =K 0C0YK Jd` dt`H   Q  K? A     S{ NS01 & W@X  Q`a S7&001{ {j.K0 BiK7  L0B0G 0B{ > { Q& @ & ' -K B_@   S &/S7&0 K7  A? (  H Q& @ & ' -K B_@ YK=K J 0Cd` 2>!B 0 0fd,f ``T$f`06KHf`EiKPc pĆ6V 6 &00 ER0_.K_.K B BK000 K AQP,`&[0& -=K 0C RK0 AYK Jd@-K7 BV v p@̦ p 0'\Z0  G`G 0S T  S00S0 \@P0̦6dvHF6 06 X K A q`yx05Kp06 R !& `@=K 0CeRS 60C6 t&@d8TPP p@DT0S 6 Q pQ@P&  & ' -K B@ S&7a`0v`7 Qa`v` Q@P&  & ' -K B@   Q76`0& & a7    Q76`0& & a7  Q0  K A Xb` 0P=K 0C0 9%K0 PYK=K J 0Cc@00L0F HF `6&0CS?6 BDiK@P iK:P& 06 6j.KC B p &6R%'  ' !(100P @ 0pFiK P& p*` V `FiKP piKP p & C f@& & ZiKP pk' H`A < ;7& -K B '  & -K B '  iKP pPiKP p%6`G0GXr0 iKPu p` {7  K A  K A Q| F pQ 6P6 Q QM  K A QHX `' F 0K A C>K0C  㠦 gW 0jK[p@1&0@00"^ 0 0& && YK JF d^ 0 0& 7& `07 7& `07  @' S01 & G_.K B0EiKP pF7K A  Od^ 0 0&   S01 & @00 D RY`a`0 A R$Q& R0C !`& 6 &R @6 `&0@00 oR !& `@6 6j.KC B ipd 6@6 `6 6j.KC B YpT &6R'  ' V 6 7` 0& 7 ` -LP@`P44 0 fPPd -@P`pLP0 PPP -kWLMϠP0 JP|  @00 (Ko{kG{&{ 8#00(*,B<@ UPp Upp`PX  G RBR  RV#Q B RV#Q$BdV*BVA UL U@ R UP㨏N Pa P RnPE Q VN VJ rQ Y D@VFBR(K`!00'*/B B 10  0 8(Kob10  0 (KoX R@ pPBQ @XPE Q rQV00  X PE QV V rQ PE K ``11-   -LTMbŸ`D P0pP KU@0  P Pi P00@0 U0002ȳCK8 0k {@{{ u @ R0Sz R00@0 4K0K 9PPX ( 4f $K@HA56\ +Cskt[Fk7t{{s[k{{kZkGkIY0`0 1k01{{0`0 IL0Q S0aBL UL0 E0CY d L D BL ih @  0 B/od " Ql H Q AD D  BR񏐇a7< 0RP 0XN  k@(K0C>0 SA.< < @0c0" 0c33ѐ:g{{ $KH\ A6@ ?aCoc?`(?yPD? '-P(|0 +@P 0X0 p0 0pT0 |0tp Dp 0Y / RT R \ R4C6h0|0 L00P\0 |0 LQSQ  AHL 0ChQ T R1 \h0 0P\0  `P Ph0h0 s`Pz dh0QDT Q l `R`L  L 0XS`0S X0S\T0S L0Sd0\S?<0l   h X 0D0d0 p@ \@` dp w00`PL0 2 D0 @S@RX RT vTQP @0hSQX PW@TRd0@ SL00+  PP \0X \ 0P\0  P  P0h d@(K@0S0@0 0@0 gX3Q  0/1[{;{'kkKE{{:N{7N0CB:N@{:0 r  0J St0S @0S S {7{E{:  @ T  p  RX |0 @P D0S  @0S00S t0 |0t T X RX {Y{  )!k  "[ {[Q ! {k& K` R c{KJ `k[kXk K8 \ Bf X{`!T[^*0 E{4kr  Af G;[D[5[ <+Gk2knJ\d 2KGk2keJ Z[ {'k;[%C{7{*0 r  Z; T W pp Xp x0@0 pP   ! RP@(K$@?@?(( k{{{ K8  B{ AG{4{Fk{Z-+0 0   QP 0 (KKKT L\ %Z  iK{B"K'T Dk{k& \FKD`Ph0 DT Q l d  h0 !vh0 `#h0 vPPh0*o`P&<0QlQQ `Lplp@ t0S @0S S[ R `Lplp@=pX \PX} {h|0 PP|0S[wP PPID T0S:p0SYX0 Xp PP4 00 JS0SR0p<0 @0S S PBP<0\ Z\0 S  S9R0J  p X pi @@(D00C0X0S C\0S\ ;`1002X .,Z0@{K&? k[4[Z Z T Sq  S9R0J  X`V{[%{[KM\0P\0 V< RK$&R !**R 0dd Q$ \ ;{'k[E{7@{*0 r J Q J T0 @PT0w Dp QX  t pT  P T X Rr p\k K${kkk K8 I B000 Z0 PG \ PDk6kt0Z J0S  \Q `WP\B4PP$ LP9W5 `01p100 Z Z0R0J <0\\0 n \ 0P\0 p0S.X0  Z <0\\0 @0 `SLplp@ 9Wp9  JD00C0" p0\0 `Lplp@<0 \ ?@$@@D00C0 p00Lp `9Wlp@ SUp0X0 < R F<`LP Q` !46SP/\46S//// P0-L@00 R@P@0 0-L@PP00S0 0 R U0 0@! -L$M0@pS4 q@DP`T180 P00 <0 4 D`  `@P H@ @ P0 C R0 R0 Z*D`80@P0H@ S< 0BV *0 S0B 0CRV@D:@4?P' 000 PPZ 0*!1R CV * R0C 0CRV@D:@0(K -LM 0 0NK0P.0 V 0 KL!,! T! P! L!  0 0 (X 0 R?K H D @ < 8 4 53G4 (8u -L -L -L Q-LP @T0 &`P  dO00@Q  R @ -L`TR@ PP  GO-M Ѝp@-@ P` !LNS !@Ap -LM K 0-PLM0 P0P @P2`1$K0 BK0K0iV 0 ?B0 00/X X -L @M0K #K@  s?p`K -- LM 0  W K  0-0L@Q r P 00 S P1 0 PP   ! N# @0 -LMP 4K0K4`0 A Q@4 0 05V% 0S| Sl 4P8 ppP Z80z0 Q# RL 0 0 U" p0 ?0SQP (K0S Qt0p0 Q A V0 !PPJUSQt  P 80 U  0U80jSPp0pP  0p   0P0p 0p Q=0S 媠 pkW4Q 0P80 49 80p80 &80p@ pg80 P80 S 080 0 p0 800a80 80@p_ 2 J0 pxV 0 p80J`p@0 0Q/ R  B / 00-PRSL@0B!R@ RP   `2 0@!R@  P --LMp 0 T?00 ~P 0Kxp  t  -Q, 0 S 0p`K(K00 `x` Q 0Q00  00A S00 0P@!T 0PBT1Ѓ00Ax @0 A R \  EPJ xp x  +R -R    x  0B Pxp 30Rx尀x 0R 1BP%x0B x  0B X 0 x  0@00B S0尀 帀LdP\\`00 x0 FZd  @ R   R /o" Zg{T @Z pp Z{ +:0 fk01[kk 05SZӷʨ0S 0Sڨ %0jSd+0j {A1k!{'k0{' dK{  00K0 0 PLp0K0 00Q0 0`0 70XS xS `x` 0Q Q5 00 (00/0SY 0t xp 0 Qx000S000 R  t ,x@K P x00Cx0 }  Px0 0x0 0 00t Q \ \Qx T  0B X xX ⴀ  R  P PR1Ѓ0QQEZ1Ѓ0а x  p0K 0 pJpWT  8{01k{'{ p |K Pt g |0p A Xp  0p  |0 p 0 @0S 0P0 pBW0 Sp  00St 0P00 00S P00 R"0t 09XP ` PԐi!0V0 ʜ0 @0S@Txw pP  P0t @ 0 p0 0C| p0 Pt ` 0 00 0xKt0KP *0xp S0t p P@.'Q @6  0k,,v,h ?Ch {{'0CL"* \{ 0hu46 z5G6pGh0 Qp L @{ 50k {'0RG { <0Rx 0R 1BPS I B%R񏐡~}|0 00K 0 0 lKPM00 0 00 @R0b0˟۟0 ? 0 Ԑ `PPD   ! Jt0P9 t   !J|`0Fpp0 Pp) W00`C0p G`pP BpGppW  V 0RpGH`FSGQs0SXV _ P  pP 0S0S   0P@@S@T 0S@#% X  !00 0Jv 0 0| 0#R00pS00 KKH  `P Q  `0tS  ! tk Pt 0S  B\40 S| 0 B0 | ecT| p00 Q C/o" R (K{9Hk{FZțJʜ0S GE CA*x@KPy  0 0x 00(S 0t 00n?@?AV瞯<< N(?(x`0 B ` QP00Q000 G @0  P0  P +   P!P-  X@`0S``Vi00 0` Jۛ0 3PP` PPPt  B\Aʜ0SM | 0 0R0| 0 HtD Pt p  Bp 00C0 t00@0 P0 0 R t P0S0P 0CSSF 0 00CPP t  PԐ0@C0p@ |0 @Pt 0S p0  0b`^\Z p0R" 00S S S tL 0t  00 "!Q*0R00 0c1300t S-r X0 0Λ0 000 @ UI^Z{狸0/zKSH9O S!0S ڼ00:狸0 000c0 @i{H:ɋڀ0 P 0 P0 Ԑ ?(? g ,0[01k{{ p 'Q T0  0kpp||h ?Ch {{'0CL"* \{ 0hp46 z5G6pGh0 Qp ~ @{ 00k {'0R{ G nꐀt`H:Pt p |  Bp a00 t0  vO"000 00U  b g  c00 00 P  10 0 0 R0t0 p 0 00 p a  0@ J@ 0 t|0t 0|0 7s 30[1Ck {0dK{ S !    Ql 83Rp 0]h0d K6 0" K `2{0dK1k05S00{'{ 00 00K0 0P% oQ| t <q0|0 00˛ 0QG!0 00C| p0 |0 0BS0 r ttڜmt p00C p0 gP PԐ_0S p0K0 5 `gXP ` PԐf 0S t |0S*0|P| 00 0 0#R00St 0* X\V&  0 RdQ00 S!00P 0 PԐ00S%0S !0P t  PԐ0 P00 0p0 0c ?(  0 00 t V!00  0` St n!0 S0S000 P PԐPt e 0|@@d@P|00|0 !00  B -L00 -` LPPP`@PI ``p 0s y #8 )8"80 ^#0C\* B   q!8,8Y0@@#Z 0V 0 a 0PP   ! LF@`@ -LM3ß08 @00S 0"0@0 1 40 040 8040 @ AR 0AP0Q p`0 P@ R PT0 V-\ # 3Q R2 \0P@VJ(KQ`  0 \ L pL 0`  P b0 P0P  a a< X<PW< XR P0) @/oV" RH 8 00\0#03Q0S 0a @a0! W \' 0 X *  X*40 R 08SY00(K XR_ P0\Z>0(K@04S  0c1# )P  Ri  Rc )R08 0]0D T -LMp< 00 4 8(0P`00S 00 00P 00P RX P@ \ \ P 0Y@0Y P0u X| R  B!8 PX pX ^@q 0D0CSڣ0S!pPc 0X@0  0 0QZx*@` T0DS@I0 Q 0 T @   T@ 0CC10B40DPP`%408 0S48 0S@CU  0S Sz Sj LP@"00(K0 @\PR @(K PP pP 8 @@ 8 +QB -Q > AP rS0J 0^\a 40X 01S  S  SW 40@PB``0 0u00T` 0T V 0PCSU40< 0P@0 S S0S~ N0p000 40b@0p< 0tK"00 aF PeP408 0 S8 w\K@"00(K8 A IP @ >IQ@@8Xa8 r@V 40 0Sl Sm S @008 p<0 (K@@J`P `D@ 21 2 Q`80080 P  \ PZ P@Q Q@EpPLVD`X  ` @218`G40PE0@80 80`0C80 0@0 @000c00S `Tp0:  RLPD!@0S+0SM 0SI 8 =p @00`jUUEP 0@ 000S0S ~Pi `h4   BR"@I 1P5!@"@A` T / -@LDϠl\@`pP \"P 0 WP0 0 V @`F`V 0 BPp PU0E  0 BP V@98 0-LM@KPK   0 B0C2S ( 6cKBKZKBK { k K0-0AC^ 0S R0A  S@- *@@\@0L0C00Q00Q0  S  13S / 01R *0CPR/!3QR:// 00 00Qs00aP00Qs00A,00Qs0/ᠾ T8X 2A-R`P !! 1R31 a p@800^31: B B  `S000 CB!S 0000 R 0R    0B! -L M 0!S*0S @0SR @K@K0 @K@ - q 1pL0`S3 V00AT  R+00 0PVn@T `PR x0PhV!@0 0D1S  $00ꄼ d Wl:0P80 4 ` @a@P 0  R0 R0@PVCK@P@4  Y  Z0 Y @P0I0C00RN0>HS 808(K@0@Ppe0P80  088!(K -P@Q`L. 0` P0E T#5 `116< +CT @ *P PE` p`T17 501P56 +C0? -LMPkWP 4'J66V(0 ,` (K0( T 0 C@@1` $K,Kt"KP `!30 (0  ST0 CND@D@5`@ $K0S0/0 R / -D1DALMPP@@Kr`P7 GpP10S  Q3 Kp# 0: Sg0P v`` P0 $ ,| ( Kl`EO000KE 0 E 0 ̯ Tx7 0-@L800CS00 P80P00CS00/y -0LrS. wS( aS |E00/0S +S eS%0S fS$ lS, xS0+S ,  0-SL@3 <8 P00P! !& 0S 3/PP೼000P @ P 00 `00aa!8@0`` 0`5PE 0P0 000-sL@ !R !P 0C 000 0 S /:5 0-Q1P0L0@S3 0 UK <000SA 0*$0 3/0P:s00000P @ P 00< R 8000f  0@000 0|0PpH{4P00s06D 0 @000| / 0-L QS :S0lB @K0hc0LB @K0hbD0000B @K0h6@000 0 0000/8 -L M\S`p@ CoR$塏 P $ (P ) SS (\y0᱀X  0(Q\ 0  P  KQ5$ 0$1$( X$ X $$!(1s(Q00(QSU 00\(1 ( Q\:0 R P(xP0\ P 0 SxP^P!S0@ B0(P0 PUpP(Q$!(Q$ sC, P0s -L,M PXßUL D  ` ! PH0 2/,(0Q00 0 P@ @@pp@P0K p< PB ^B  @pW`VV 0 P^ 0R@P"pWDPJUX@p(K 0 npPw@< 0 nPM 00  P4 Rp@!8  P8D`V VB V 0 @P/ಀYHpHp@ @  \gP$K fjP @ @(K$K Yj@ P@(KD0PJUH0  nP   ,gP(Q`EV 1SU0$Q(qP $Q(1յ@m 0-L@  S0 K0hB,0B00,1 0-LS@0 K0hB00,10 R0-L@1  0K0hvB,0pB ,! P0-L 0At 0@^B -LGM41@S4 0%  !2/p`P  00qK/aK p `.QK-KP,K@+K*K)K(K'qK&aK%QK$K#!K"1K8 .KKP p`0!K KKqKaKp`K1K0KKKqKaK1KKp=`KKK0KKpK`K<0 Ƞ K K0KKK尠KGpFEDpEFD0KpĀJI`G0ŀH0HpIJƀFEGpD`K0ǀMNO`Lppp 0SR`QPpʐ RDE`FGpːP 0< 8A/p^ APpM_Ām[PQ 0pfPMQ 0pfPBQ 0pfP8 Q 0pfP.Q 0pfP$Q 0pfPQ 0pfPPQ 0pfP U(K(KAO00A ,!a< -4!L@ `PP/1S 0L1@PPP!R PMPP !Rp 6V @`_oR@`@`` 0-@PL P0P -`LP0P@H UQ0p"P< UQPEE,!00D ^ ^ ^ ^ ^ ^ S `@  `@ Sd@@R`@0@ Q0-LP @41S0 P0P0100A@ 0 -p<LOMQP`* w@P# 0Uq1  WK "@Pp 0 p@`@P`(K P]  0p '0 VD pWA qA/2` ***!# p!!" "#, "$ ,( 0,$#4 ((Ƞ''0  0p't0..p!|.!"#" p!#|' "$!"# $%,,& +0 $#4(p/,x3 ̠4)*0,-p.012 D!74; !x!""#"$5p689: ?00@ABDEF G崜HL0)t..Ƞ.ŐpCCCC嶌 (Ɛǀp0!G!!GG尐 ) L A AAR!Hp''' C pC C C,BB))x)CCpCCR,BBZ!!!tCCCpCR.ĠBB`z `APZ0SVIXRp q 7/@ PJ( 9P 1Dp N2ḡ !0 NV Q`SUQ0PP4Q$a$0PP #@C|||3 0 !(KTß pO` >>P>ĠQD  < x8P Ÿ 004p  >> @ :>V Pj pR4 W qQ^ PŸH ^^^@4:P3 0uD H $ 0ldPI*> 0BH,0<0(e mpQP2X< zX!P00 p 84 p qD= @ =K PDP >;0S 0 >PP >@`P>`P`= P< x8P [=`>=p=pꘘ al8| -L M@(` 12f0pSP( p R ءBP- `0( a1 ,0Y DD S 1"1 (Koeꂑ P  0 " IM=0mء(K 10-@L3/"R000 0-@LQ +00 210o= 0 -fLMS`- p@ ]=0@0(KX *0C~KpGK AH4 D4 @4 <4 ?p@ wp  2p X p  ( 0R KhX*0P6P 6@P6?0@0t ($H -LTMş @ ` ` \0   %00 RPZY :Y 6 0 ` 0 QP(K w0QPY 1S _$P䡄 0    {?p @Ppz:!h0 Rm  ppRpWo0 d0 Pgh0张pod0YT poP0h0 0! 00B ^:A|Z* NL l0 0h0 !l0 Br 0!!h  0P 0 {(0 0S 1S  R10C0s00C S  w$ Y "0 "b R A r  BW !b$T K 0Pd0 d0YTp P 2  0 pd  D$d04(00S, w0Q8RPXK po  00D SX0 @0 @0KP< H0 HK pZ  00L SX0 80 80KP`KP4 P0 P0  0P e#pP: 0㸡d0  0Rg1 S0"1!bd 0 n RZd {0!] #00 d0 Pch0z 0!{/Ⱐ1A055 0 Ipr ( -L$M(p  QP@`N ഁ0fpk! p H!w v0!CSx p ^01W 0As0s0S Cq0 S00s060RA(0 0S (K0 R1S0C1 0RX 2 0(4@ cK 0 4K P (00(0 p0 p pWT V)10C0s0S4K 0 4@ 3KP(00(040#[0!0dVQJ10C0s00CV Y4@ 尃K4K0H 4@ 3KP,(00(0Q R"P 04 K3K80 4 P806(00(0  "p000 4K4@ 尃K/P 1 C r  BV* $"P 14 K0C00C4 3KP(00(0  " " 0-@LQPQ0 !P 00 "0 !P 00 y"0 -L MP0 ,10C0s0S/0S PoPja V0FT S1Q !@P] `V0ഠ p0  p0  <"00(K1 p J1w戀0FV~1 0p\ 01W 0`L0s0S 0Cs000\ 0|6SL "00 R 0\P00t00(K0(K!0(K 1 1 -LM@`Q !00 21Y6 Y-(P* P 0+ )!`PO 10C0s0S 1 !0 B r RP 80 !80S 0 " "(K3 0 (K0K P PP 0 pR1 "0C0 s0A R* ZP0 P  l!0(K1 0C0s0Boᩒ <P 0 p" RR B 10C0s0SPSP  2!Y8 *!80/o"| !!~p 0K8p !  P `0 RY ,< Zr !뼁Yj  HR!f p  뼁p X0HJ S1G V `P| 1X0C0s00CQ 1qP P!!1 P P!  2 PX PpW0*`  # `PI 0R  `P:Y40)80 802 0 <  8M P`, 0R Z | q W> 0GS1: q q W0G S1 `P WR 1 BrPX P!P1`p L  `P Q1PEPPEuP XPp! 6  `P 0-LMK0 P K -KML M``PPß @ Op $ 0 10@040 0R(K G@T R B@ W /( P g100QB Q]1?0040SXS02G0T Pp@ UXRP>  HZ@ p4T CC>K4  ;o0 W *0/S0HJ 0C/RF W0pQ l=K` 0C܄4 Pd dV! -Yp"10S X `0 S00R0FX} P000t4S ጼp @jዼP 0@@DOoB_0K0 Aq/0PP0U4: S 00@0L ܔ^ ( R-L Q0P:Q:0Q: KhV)YD 0-$@L@P!  K0hG $ 0-LP@  #-@! 2 K0hG-pXM`,pLT $t8` `` P@0 $ 04 ࣟXCWC p WX4 4(K)4 尃K4KyW(0币10C0xs0X 4 尃Kp4KfW< p W  HPJ 0(0p4 尃K4KOHx4 尃K,꼁 X  -P/ 0WSIqYG  P H⨀Hx4 尃K,p꼑 Y  P 1ᴀX0C0xs0X弁XH!1 ⴀp   P 0p r 0Cs ~각 0H⨀Hxv0!1 p 崀! X P -@LP`P 0 00(0`00Q(0 -p@L,0$M@ D H0 1 PF A@D@t@T9 < 8 `p@ @Ѥ@r`T! PuP P @DP t@ p8 0$0!01P0  @ p8 0V PFuP 0"0P< <(K0D <0(K 2  V 10C0s0SQZ0D <0`(K 2 < `Q` "P4 14PK0C00C @3K @P 0QH RD 0$ 0ES1  QH @R0EZ S1W P `UV 1`Fv` T`!D  r P4 P40K@ 80 SKD @PO ]80Q0H RD 0F 0ES1B Pc !0U B r  BS8 =QH @R0ES S12`1 P * P? a1`F``Fv` @T`P! 4`: 4 ?  "!0s00P !1 ` `P!  YP0 @T0* `0000/ 0-@PL L  0 0@ ($ 0"0T G-`  M2 0($@ \0@@R0 @ p` @P00#%h#","0<Ͽ&' 0 0f!" f+" 0PZ01!0 0@ @ 0  pp`P 0 10@  00!Dj93#1#! "! 5e3# # 0"0 0 &  0Ơ*`, `,0 @T 0 ` 0p P  0P ЍPT/BTSi -@PLP` q?pW(8 /$0(00 0` d06  03?Q0h $ 08R(@R )@ b $8 $)8 b# -P L?@` @p`W(3 "(`F@, ?V@pF?p@pp(0@ @ Q@ 0@" T?`V (a"?V@pF?p@pp"@@ T R-L  S 0-@PL P Ό 0 0@ (# 0"0N R-L x , -`PL X00]M\ 0 P PW# 0$$\N -LM b3P0H  fKaBKBmKaBKB KBKB ^/~?0 40K nK 1 @P &KFK@P-K%K,K%KK%K1K$'$9)7< D0 %'%9)78 @0 $K܃K)0(0 ;4H0 ;4L0 dK`& p'AK `pA?K`K,K!A?K  0fK -KԅK0pp'(> 2l0 ?(10 )>2h0 ?)1 ``&0 0 C?K K܆K() K 0܌KAK ЀCK``&p'AK`eK̠Ì ̠ mK`&p' 0nK` pnKAKЀ`0pS,K.K-K.Km0l0 ,0 /K,0LK0=0 KdK JiMK`܅KKK܃KoKeK K KeKdKKKlKCK$Kl0 1t Ġ̌| p !Ġ ̌x gKGK@$P%MKIvp q~#H,p 3l ܄K(w yp (yQI^ wP p VmK`&p' @P PNKK܀ ܄K@ P)790 )970 .܉K(K  !,à)K " 0#.K,KD @ @P 0DK@$P%K`pKdK p` );40 ;40 (jK.K`&p'dK`pdKeKP@ 0܃KKP% (@$ ( ))  K ԋK 0 K !KKԍK@PKK@P ܃K<30 <30 ܋K.KnK`&p'@PoK`p(`) p,Kl 0@PPXK܃K#K dK @ PK!DKEK܅K@PK܃K"EK@PlK`pCKC%KfK`p@PdK!%K`dK!#K`"C(K -@LQPUP`  0pRPQp bP!p K!0P0 0H  @ 0 0KhR Q b3!p ,! -@@LP `YP7 d0! 0 #0#0 $P H P0Xp【H【 a $ QPP$ UX P㈁$  0 #0#0$Xp〠H〠\` P   q$ QPP$ U R-L  -L M@P 6PH8p,`KS0KU@   K -`PL X00[M\ 0 P Pu 0$$B R-L < -L M@P PH(p,`K0KU@ K  K 0100-@0/ 00-,PL`Md0 ` > P 1 P< bP !P RP% PS 0$K0CP <8P 2P 5P F3PO 4P>0$p  00` KDKY Po K0!P ?P P P8 P! 0$K0\ K00DKd0KY p \ R K0[P/ZPqHPqWP  IP{ VP(  0 0P P P P 0$K&P )Py 'P (P 0$K7P N7P, 7P 0P0$ 00` KDKP`0\ K00DKd0Kp \ K0>P=P:P/  z;P <P0$0 00` KDKPi`|APe&dGP aEP,^ M W^P RXP YP!M ~ J 0$KR <0 D @ ` R 0$KN B0$KJ 0$KF0$, 00` KDKP $.P 0P+P P P P0D0 @0  DP P P= 0$KvPx pPd  P0 0$Ki#Pw q$Px %P$ ,0$K]P P 0$KP  P &0$KK*P +P  D0$K P P 0$K96P 7P0$| 00` KDKP(  yP0 @00\ Kd0KDKd@ D @ p EK ? 3P 0$KP0D @0  DKPD  )0$K *0$K +0$K0$H 00` KDKP h 0$K 0$K 0$K 0$KDKKP P 0$K` 0$K[ 0$KW F0$KR G0$KN 0$KI0$H 00` KDKP ' <0$K8 0$K0$ 00` KDKlP  (0$K"0$ 00` KDK[P  0$Km 0$K  C0$K E0$K $K\81 R 0KP#DK \ KD @ P p0\ 0  %0$K0$ 00` KDKP2  0$K.0$ 00` KDK P! 0D0 @ (EiD|C 4YAT@D?==@=<; -PL`pᄜUO A@0S 1@PA VPF l 0S2 %P0 W`= @ 0S: P8 pU ! 0S01@0@V 0 0 W 0 0 @ TT e4 V@W T T Q@00XX J@ p@ | X (  0-L 0@T 03/@TWpPP |00@T 03/@TX0H00@T 03/@T$Л0T ` , -LMX@@P K 0K # K  ?pK -L MPRa@p  = 0 S 2 M SV: i 0 0S6 0 0 S 2 / 0Q70 P 0 0(K  00 0 P 0 0(K  P00 (K0 @@ 0@ (K 0 0P  00|P   0-LM0 R@P Q \   R0 0 \  R0 0 1K3/K0s?0 Kr?>P10  0@-(@ U1!^  QN \SD0L00@-(@ U1!^ P\0PU000 -@L`P@0Sp:ؑI Y P1P!  @T p `PpP p@ -LMq00K< D PpG@0 0<0 c PU @<@P U`1`! 00 0 80 :X80D PU0<0 ? (K(K 0- LP@ 0P a`F 0P @DpV:  P/0@ 0A0S'*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0@/ 0-P8LP@04 02P*T 00S84 0`@2T:0800 -LM2Ÿ0 P@R0p`00 Y 00S80S 00 Q(K4P  yP8 01\ 40KK`0Ġ`☠K8  0 0 ' R= P8%YD 1 ##à140 0` 4`V 08  R88P@PX`002,"SR,BT 4"R 002"00820 0 R)(K 3 P02,"SR,BT 42S?00 c/K8 02,"SR,BT 42S00 !Kp 80Sl XFSP`  " "P 0 S c/KoK0 `w42S04"000@ 0~((P X` `0((\= 20S P02,"SRl,BT wK@02,"SRf,BT 342S00QX-028 808 `0 R`SQ P408pC R48 0\R408 \P0` @ cUY@B`@ T T 00S`<2P`R ` 8@P@@ wK;@ 4{@ )02,"SR ,BT 42S@  ( *t T -P`pT@L@M`@ 叕0 00YPᄕ(K謊 -LM@ß@ P@T0 @`ISQ? r4 rD 000V``V20`V`0 R2`0b ` n0X@ Z ! 1;@T X Z:0 0R(KV 0 4S`RU @@@,V 04S:0`S0qKp~. A Q @PPK k00 PT  V@7`p W4 P V  RX( QP 0P0 @ R R0 p0``~S _W` `pG`0``Y~``Y``Y`LKVQ@q -@ 00p ( 0@- "A @ " @q 10-S@LP  P 10 2 0! 20K0hp@-@P` VP p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/ p-LM 1 0 @ R 0 ^0  0Q0KphD KPUP*`KPP `K`1E"Fp0^ R KQQ*KQQ  R 0RKp q< ( -`0L,M0 "!D  L  H cL0040  P 0 0@pP' (P@8 _86/PB6/P8p6/Pp40S  00 H0 X$K:pH@ 6/PPXT8@ 4P00 p Xr: 6/PU UQ 00  S T8P40SJ 00P00HX@*@0C00pG0A<S B@1!<0 0CS RoQT00L*S*SW:@00@CH 0L H0 m 40SA<0 00 < 00 PD0 0S 40S 00 0U0@08P C00pG0B< S D1!@D 0 R000 So*S:0'40S <00 0R000/RW @pHP40 S0E PQ @0 CU40S H0R0000S0P40 0 H@咐#S80 *p4P4p Y *00pc0 0 Z p 6/PU U 04  W  Z p00@80S(K@0< C00pG0AS D1!@'40S@0 Co0U"6/P8p6/Pp<D 0 R0<00 )@ <0 6/<0P 08 @0 86/P8@ 6/P0 080 <0@G6/<0P0P0 b6/PP06/P0Ppp@0@H<00<0 6/P<B6/Pd6/P@X"! RQ @0 C!10S D 0 R0S D00SD@0 P@0 @6/P!6/P@6/PP06/P0Ppp6/P8@ 6/P0 080 v8@ t<@@0C00pG0A R-L Q0P:Q:0Q: Kh2 -LM 4PS@  $3/pd0 f0Q P ps4P4S $ 3/ 000$K0 0 4-dLVP:@T@T 00 S   00 S   0/@P`0d0p@A -PLMK`pPP$0: S@P +@ 0 0S t K0 dT Kr@00 K@ K( $$4/ 4-s0L@P`0 }P4 $ V0000C0  0R   10 00  0% 0E8  - 0RL0L0  0 0 S  A 0 -LM4PS@~Aa0S-0S*  TPc  P0 00 P!    0    0(KpPJ $ 04  0 . 0QP3400 =$R P41e00@000S0p pp0d 10V0 p0 $ 6/0(K  0  0 0~O 0 A0 000/ 0-@LP R 0 00 ;P60 0-@LTP @T 0 9p0@T啛`0  0S S/P/ Č Ȍ$(0c03?c00 R  0 0 3??oP// 0-LM @K $ 0 0 0 1h h0 0QP00S 3/ 㡜4 $ -LMT`PpK00 $0 00K,@ @ (0 (K P@ DW @K -L M0SP5  0S p@; `00 dT BB Q  x V`! : 0 0C `@0 p`@V` T `0p@0(K T 1+#3/P0p0CS@D0 ,0Tp@R- 0 T!1 P`#3YQm R~,03/Pq00 0S00  Y 0 p 0CS @D0 `0T @Tp  00 1P @ 000 =Pm s R*V * 000P7@D RD,03/P,`Ve*`C Y:ڽP   I0`0 `NdP 0  000WP 0 @ (K t 0 B 0 0| i 0 B0` @0- 0 8 0 3 0-LP `V 0@0@DT`0@T` ,0 3/Pʼ0@00D0SKh/ 00-@PL0 v0 Pw0s 0P0, @I PC0 0-L4M @D x>R@0 <0 80 40 00 @T00 13"000 , KDKP,K<00 -@0 DL4M>RD 0 @0 <0 80 40 2K1, ", , KDKcP,K00 0-@LĚK0hÚH-M  0ЍR- qS 0^   0-1!00L0@S! 0  R 0   0&  0R0U0  00c0000 P @P 0 0 $0s0 0l  -LM@Pp`pP pKSP04 :CoR  S  L H0(0P   ; 0K; 0K< x -LtMR"P`0 @0 C 00  0 0R(Kx K|K0pZ |ᨺP0 D"D2x 0Q0P ppAPP0000S!pK @ / Pf F0B/SKDIHGFE9CBA@?>=<:9876543210/.-,+$)('&%#"! 0 0 000000p 0y0 0 x  倐 00  t0K0?t0SP| p,IPζ| ($tP p-L M@0PN00TaV( K0T1S Or0T1S  0`00UTX1\1S +Kp\10"Kp0UX!\1 0X!\1 0-P@0LU0 \AQ\ X10CSX1 K0hT1O.0K0h`Ȍ00 000S/ d -0 00L@PT0׋00TA噌T0` TAT@ ˋX1@0X1ꈌ0T0`X1 d0 000S/ d0 000S/Q d0 000S/ d -L4M<0< 0@DK00  0RK ( 嚘t,@ -L M@PQ4PKT0@K 0 00@p`  QQW QV  V0"`"(K V0 R00S `"(K`(K`(K R0 0-LM@,0,0 @@@K0 0-L@PP P _@0@0 -Lp@P`P P HP  TP@3*> "0@09 0@0@2 0@0Q:// BQ:// -,1,0L000 A!@00QP P`_P 0 PQ 㼐 p$@P   0`R DᾺ@V`@0@S 000 !B B!$Kk l4 hl$ lk 0-@PLP 8P0U0 =S00=S0  0-8@@@LPP0K0hxj 0-LP@P 0$ P0E00tj 400-0L@P0 P3#0@j -L M10 000 @pT4 _ `P gP0=SG @PT40SJ @A@P P)Y - R@`@@@R*Ya2   嚷`P, 00  D!  00 0``@(K00 YpQ1S (KR@`@`PP $xiihh 0-L@, p  0@0000 $ -Lp`HP@PP  bP$00@0\ $ ,0-L⧉@P0 0@0Z ,0-L☉@P0 0@0hZ ,0-L≉@P0 0@0,Z -@LppؔP%`e0:0 p-L M0` @P 0pp0 0~0 QP 0 p:p0Kph荔l 0S0cKK.4 `PcK`@0D| ^aD\WDAD\:7D8 Q6v cKXR#WV \^cKK.4 `cK`P@$K 1"#K$K`$K 1"#K$K`ZK V0E<0 <00(K0Z0' <00(K 0 p$KXu $K%$K i 0s00XS00 C R @ 0P$Kp(K A BRWJ 0p$K ?? 0 0 0 0 000/Э 0</0 000/ጭ 0</0 000 /H 0< /0 000/ 0</0 000/ 0</0 000/| 0</0 000/8 0</0 000 / 0< /0 000 /ᰫ 0< /0 000@/l 0<@/0 000/( 0</0 000 / 0< /0 000/ᠪ 0</0 000/d 80</ @/ /H-M 0Ѝ -L M@`pP 8( "K0(0 "K V0 K -o@ "P! #L0TM R0@(P( 0! R0$K  0S RP/0?c0 3??oP/ -LMQ@P Y8Z J (KXY/ TBZ 6@ Y 0H @Z00 X 0h0?o0c5#8 c432<0 ܃KZ P @(Koo?o`FV` Vr 0f"ZN (K0I KZ00@i o`5/o?o B!` VK VC 0f2&5p ?@P 0?40 00 #K @T 04P`V 0p8 < CKZn   (K 0 coo?o`FV` 0f4&1 @0f4à1 KQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 040-L@ P00000Lt< / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/00///Q R R  // U /Q R 0 000/0 0/0/00/@-Q @ S Q P 0S Q P 0p@-Q@`& T^% 0C P PC@DUT QP PCUTQ pS@-Q S Q P 0SP 00Q / U /p@-Q@P( S(  P0C S @ `QP @` 0@0Up@Q @p0p@-QP@`# S\   STP P Q@DPPQ Pp0U0pS @@-Q S P0C S @QP @ 0U00Q   U //q 0/00/   // R S 0Q000 0/0 0/0 /0 0/R  -/R S 0Q000 0/0 0/0 /R S Q 00 0/0 /U/R 0 0/-P0 0 0S0s R S  0 /0 0/U/0 0/ R  Q 0/0 0/0 U0// 0-LMp0p 0@| 0PK0 00 ) )0 0 #K% 0RK0l댙 (0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$ $0 00S0/ė d -L -D0D 0@L0P p`.q@`h //////X0 // -L4MQ`P@pT 1 0 0L K(TKT P0 F B > : 6 2 K6/(K;0 S)  QXP 8QS: S0S S. S 0SQ/Y1^00 0\0X R 00Q 0S@B QT " l00 0X0 D00 800 ,00,;;::99t9d9T9/// -LM ͟ PQ 0 0 1,< 0 0  0 0%SS``Sg @` ` ` 0 0HZSzsb[$}bve{zxF000 0` 0`0 `0 0 t00K0   000T0S @ 0T@P@- \ Pʟ  p PS U5P2 \] 0 U5AP2Q R: U5025P2 R*0C 0@C U 03@D05P2T8000 00  p0 ` 00Kt0 00 C 000 00 x 0  ` 0R0-0`vp0 00H! 00H S 00 00  p0 ` 00 K L  J 0t0 H00 0&".'p`  c  BDb0@00 00<0 0`S t{  0 P0  BT` d O¡bt0 00 px 0`00K0 0  0 t 0 0 0 0 ( E B <@9 0 ~0;0  *X 00H S@A@00H Sy000 + 0 n0 0R 0 0b0 000 0S 00 z0<0 u@,0K c `@ ` 500 05 0`0 `70lX 000 0 N000 IX @,0K℀c   U 05 P2 U#3 0ZŅPP \0@ U5@P2Pʖ@ U 3@5P2PʃR R 1> p`0 0 A0A0RP 0 A BCD0SW V0 P@ 00  d0 Q P`p0@ P 0C0 B@D.0 0 ~ 0  `p0 U0E000 0R(K0 P0 V 0`0 `L0<" ,7 0 00 `p0 c0 j0 .0 0` @ \ `p0 ` ` 0 `p0 D0 ` @` 010u0 `*0 0= ` 0 `p`  d0 0 @  `p0 0 0 @  `0  00 `0`00  p0 ` 0 `0 p0 `@` p`0 f ` 0 `p_0@0T@0 T0 0 G눔 (@<\ -`X0X 0pLP@PU J0PES 8/`uX@pWH  - 0LS S S 0R o 0R0 8@o -@L`p0@@P@ ( 0$ oP$  -MLMA@P `X p0 r0PmX40 0PR.(K 0CKEKJI 0 0v P ᾫt 0d /L0+0 \4 +{\4  4K%{5KP ( v -0LS/ S+qW( Y%`P@ U@  0S#0P0S0S 0S0S0S  P PU 0R0 ^^Î ^@T @Ȍ ^ -BMLM00 P0_uPUD @ 8 <$ PE00 @`* C~KpGPU%:0 00kP@ V:ll84<$ @ZP@F]PD40 0R(Kꬣ ( -BMLMp`<< @ TP@ _84 0 uP= 0Q::0x0(S 0?s0S @40 0R-(K0x0(SUPE CKI< @V:kk84 0 <4 nP PU:00 0 0kPQ ( -oMLMϟ&    0  @T 1S 0 S`1  ? @ X@00& p@ @06  >6 0S6 S?=K0C✖ @voP pR P, p CKI  D 宅P  R!Rs P YPʔ6 @0᜖ST `P6v PP0S`V6@  ^ 0S <& & \- @  & T06 06 &0& S63 6 f1S0b t6 0Sc S006 1&021=K0C6 =K 6 AT *pgnKg^K`FPE0P0& 04/P񏐜6 S006 W0f6S66 66 60S!AT 6@PP PPP6qw 0;F ᢢPn6`S6c  A`e^K PE@EzV  `=K 0CC6 c>K 0C6 ?` 堆 L  f :fnK06 : `F07 16cK FH0  0 p PP U0ڴ& Q `1  : X0 0R  6?06 !66 6iK CAR 0L@L9iK# @ 6/C)bi>K0C2`!lv ߂PL 0S L  6 @06 T606 0& S& 6S6S  w< 0 x6&0 QW(KpW A6 00fiK6A C   6 "P6 `1  t8 X0qQ7  %00 P0`1 d 7 X0SF6t6 0S06 f@0 @P < 0P > w  &L7@X@" 0 0R  `>1 01$ 06 [0 CNK@D 00t 6P&0&d X⹇0@+S .0CS$ ! 0K %꜖ 0& @0 !56Pp0 t  5 X0|6q]Q @U`D CK @-cKL01V6 6 p06 ڨf `#& v@U D 6@ S ` fU CK A6 Š6v`160006 06  `4,@ X0 T06 :{ i(06 06  ᄁP0&q3 @X0 AQR RP D`1SH 0   R0 6 6 3  UexV  RU`!!! QQ   2&@x&X0Q L=0&R= ; AT` *`g^KpPE&tPp 04/PQ2N06 /<2 X@0 0R  =`V AS06 1S&06 60S+ S006 06 1c~K06 t1`06 pGP14 6  Pi|00&πPR101eNK6 @DPDscKg H]K PE H&  d&] p60P&06 0 P0D (ꈀ (4h CPHt̳ܳ8dخ@ L`@ TP Br R D0D ZP0@6 | o D6Tz6Sw =06 v 6 hgVC0 0 0X0 6v D6 P TP Br R D0D  P06 \&R!6 0Rh 0`1 } 1 0XP0V0   (PP `CNK1`K+0/P 04[S ! 8$ 00@ 00@ 0SϮ<40 0R+(K`VP840 @S 0S0S 00@ @@4@C s @៮ i (] -CMLMp3#8 0 D$ @P@ 0 CK0`010<4 0>000 P^00L 8,G Sb S00; 0 ```p 0 P0V8$ d8$D400Qs(K0 @00 ; P0 <0 0;  PS L8$ .8$8$ d8$ 0P+ P3 P, d .v0?s0S 8$ w.8$;0?s0 0/ 0?r s0摂d }d xd 08g (@$@ @4j  -AMLMLL pP`0  R; 00 0XV@ @ P,0CK`@0 PU 00 00 0R(K PP @@0.SC^KPEL0 ,0K@dD0  d̛c (HT` - L@P`3~P KhC -CMLMß P p8$ 0 @@ @c R/ 0.R@ RW S5<$ %.0B2?o121<4 5T! <$d1`0T010#S<4 ` 0084 LP`V @40 0R(K<$ C.K2 BPw<$d1@  R<$ 0s @D D0RH4 m `Ld Dd 0S? .S: 0084P.0=S 1S. S< S1 T0 xPD4SRL4S cc`lLd Dd <4 0084P0S`00SL40L4 0  H4 RH4 D40D4 <4S0<4 Ld Dd 008$ 0m`<4Ld  Dd cac]̚0 084P@TN0<4 eb ( -LdMp20P@`i VTY 0 x01,,0 / U|@ px  W U U (KV,0K |K0  0 FBbP0swpbb0U?o2PPUⴠ  B R,0K0 B 0!bP bbbb ⺠H(K 0 55 0 | 0 `F 0S0 s xbwub vb 0snb 0S   0<H0$^  -LMpP@`,@D T@,)HbVpBb0 ;b 8b0 ?0s0@?0$K  0( + (+ę -L@`Pp帐ἀ E0S@P0WU! bPa@ -DpGaD+ -L(M@{x;| 0%`p8 D xS| 0  0 <K< $0 4 bKzxK輘 -LM0P8 4  @$dt各吤 0`p 0 S-0 S S  9P%  3P2 -P]  'P40f W+0  SR 0  SRS(K1d1P00d10d dtc|1P000 @U 0P  P  P)  P&090060 K1P000 $| ip4  0000:0@ P ( P090|090x P010n  P020d  0P<0 8 RY @?P01?0# @0 80So8 @00< "E4 `0P<0 8 R: @?P01?0# @0 804o8 @00< (#& AP @ 9P010  /P010 `t\c4H,bDb4lx aa@t@ -LMAT $Kz$0000$ 00zK@@0 p-LtM0 0`A T  Kiz 8[xPK0#08( E(p( 0RKp@@S ( -@LPy 1!01n0SPpuOPp yp0S -QL@U x3s|p r01P l01000xcQzVxxP //0iP // -L`P@0.V0#\!…R  p p0p p VSP@ 0 -ML MP@+@; & 0@ 6 000 _0T ;,UNK,`05d! 0  d!.`1111a0OK兛P h0? 0Dό6 d10d1 w yPg ``@ m`0D@S_aH c S\"  S S00 Q`@ 0S S R: C0SQ 0 0CS00S00 0,9,0}0P5 + 06 6 9)00$6 B>K 0C 6 ^>K 0C & CK5 +5 (Pf 04[#S;S   P *4[ S S'6S60 S S @COoSB@T`0 Wm,_AP`@`   aP*4[ S S   VP &4[& S S00R00S  CP(D[ T T t  8P)4[ S S6H' 6d!S 06 u02d1 Akw|Ƨ1|xpA ƟZ>K 0C`0Sn V `0`SH`DHp .S`0SVP@ .T00`FV0S 0 e jP % y &00 0Q0_(K6S/60 S S pCoSrpW"`@ l_q oPp`0D@SH \P?* S S00  R @0S0`00CNK0P.FP `lP` 1x#|#s|'DQ hdD@`{QL'0  SR ]f6 S6, $p(f V T T@ 0D?oT20;T@@TR@T 3&`0 ;TL  00@@T]  PP  %Pu@p, 56劁h PS @@t0;TS&2p0 00@ 00@@t0;TS00%P& 5l1 Z@ (fV,S%Pp p5- 1613?S01S24!0P&-013?S01S14l1pu@- 6p@ T T@@ @0S S 05  @ 5 H1EK 0@ @@@@ gN0I Pu RP 6'u R6@F `P`Jpu 6@2 ꃔP (0g Bdd̍pP$P\H(K -L(M!1P 7؀@aYX@ T 000 $K pQx#r cvV p  \00x0D0KbuPT (000 $Kh(A-@ RP0`P pp P0\^Î ^ P   ^ P $0$00-@Lz0 \7 -@L,0KUMA#T P HQU  `0P`1 0`!lA X! Q/KdA pA h!  PUpP TxP 0Z\1 ( \!RSXQ02 0, K !`F0PX1 #ZHp 0PP TP wP0S 0Z\1 @0P1 PU%XA 0`FPY @. l d hQ   @ `FZ  #T YdHP 0H1 0` 50P0(KPldP`!P0 ER*X1XQ p1 P1d1 \1l1 0\1 ʤ 0`Q PP 0H1 Zi 0 PdlS X  :0CS P :`C0K pTA @R  q Yp`FP!p0ZTA pv T `Fp % Q?KT p P1  f `Fp W  P1A` V*TrHQU 0 v 0X` 0yn 0` Prg 0-(0( 0@LP0@000(> 00/p 0S hL 0 0=  0-@LP0!0000 0-@LP  0 0 0-LM@ 0K    vP 'P SPP   0 K0PK0 0 ٣ -LM`1`0\!XQ Pp QpGR`, `_cp5 K A@vvP! 0pvP 0S@0S0bvP@  `0 ベK| | t 0 wKX X P `0 jP< \UЄ\TP,T,S 0-0PLU# 0U#0PUP!q@@0``F0P  $ 0w P 0E`1(`$ P 02~PH''  -L$M$$'  78 G@ 7 `R 0P$ (& 4 & 0 < SF &Q  FTڜ&(dp0CS+'&"!  ,6 0(0 &  A@dP(P@(@ 0P(0)P] P00Q@40P0S0S 0SiH6S 0S 0SI S 0SQ 000SP00 50( 0^A02* p! PRL C TA X\ $ R|$|4 0@(SPT( 1  S<80  \40p(PP(K p Nq0001RC@!R*(0S000P(03 0R00 1d# (0\9<(0>(02 30 (0, (0 /(0#"2 0  (0 2 0(0"2 0 娂 0D @0 bpS (0 x2 0(0 d2 0(0 P2 0(0 <2 0(0,20(007S 0S'20W 0T *!1 0P1(=p5 @(41R3P1SSX!D@0 Q0C @@! tp  _P(K1k p  3pP  0(P9 \XD`zTz4z 8(yXxpw,w@\, u|t||L`|TG-10 ! M X0*00@ < 0 o_^0 R  \:Pŀ 000^ R/YЍ$0 0 1 L{,{ -(0(0 Lvs0 l -@L@`V 0 CQ𨝈PqP pG PㄓP 0`0 } -L@00 R ^^ ` P`1PP0 0D@  $  T h/  0-@PL0T  0S  T0SK0h艔凔K0h胔P@-0@ 00d  0^,0@01P(0 0$00p.  -L@`~PD ` 0(S  1T  0"00iP| -L`0Pᾑ@P P⹑P 00({ - 0@SL`@  P 00    $  DPP$p0S , < -LDM: 0( R@ @w * `< *: @4 0^_H0 <80 0PD` `:P0 p?L ω00 80 04SpP@:Tń 000P0 @:TU-9y0P9p00 \0 LL D0< IHS  !$RQT) P L) T D) X SdT T ( 80$ RD 80, R9 ( 0S  !R 8d0`  @` $`< @c\H@@$`P 0!Q < ȟ A  B QP'@ X , '@ $ GH<@,0 0PLIP8<0z@P: @pPD`d0S*\'0 0 0  <' 000S:7@ B0@<00(KA(K(K(K(K60  260P0LP(KP<0 0 a0I, 0CR Pl0 $0` 0T0  0,  < ^ 0* S(@C\h@ Tn%<0 00C?00(K(K(Kh@\ AR` a, R$ hQ BSdP  P`p \@  iP `  B R9\pAA 4 0 T  4` 0 0a, @Td  0`0X0 0Q`<0 @` QFH40<00D0 @`pdP R*#0d S`0 R 0ch ` B` `P@0@ ! P`  1 x d\o$vp$`@ dsP@Pr`0`# 0S `` 0l00`X0L`@<00D0 0d0 א d0P 0C 0뼢`0 0 $*sP R6`$ $0d [rP`  0a\ 00b`0 `$l 0aK0@P0@Pnkh1Lp 0 pl0T@``10 <0S0ρ00 `@T ^ 000@P!< /@:TD  T00 /0`00L`_, udtL@4x4 8,`LtpTq8p qdqkk\kPPp, -P@PLP00 R P `` ``H0 0<@  $  l ( -@p@PpUL`P 0V1`F1`S (  0$ 00l Q-L`pA@TPQU0 @P 0 p``PPpP(P,P0@tm -`L@PP UD0N  P 0 000P   QNhmm 0-L@%K0h0/0 00$/l00,/X0 00/t 0 00/T 00/Ḷ 00$/00,/000/000/ -`L`PU 0AP pjp80AP404 0 ($,4 u/ -LM< < 4000$ $ 㠑 K p 4k 0-@L0`00K0h 0-@LQ e00 2 20 0 -hsLMP@p 0㘩p T 00  0 0 0 0 0  0K- A`P 0P 2h "Z &= " 2* 00 00 QP Yv YRKDlPP%K0p 0vPF 2 @0 2{ 201!1! 1  1  1  1 0 0JP# 0 R00 0  T 0 2 13/p (K <R 2"6003@ۦZ j+`@(KT`0-00ᰢ`P 0P2 2p 2: 2 2< 2 0SzY 2: 200@@400` 8] \ -LM@`pQP a000ESbX`B^]CZI 2 13/pb R0 R0S 2  13/P"?o2R03S $K EiPA ($P(0 p  2 (00$K"P?o2(0"?oP2(0 $PPU0PU "U00r00$K $PPU00 -LM@`pQP 00U-0PU) 2S* 2 !13/`PE PP 0p  2` 00K K`0`0` -LMB1PSȑ.:b, V(@ &*,pK@Tp UpT   0 P $K0  P`XBȑ$K ṌP BȑA`V* 2< 2$K -LM`X8 r=*40K<0 A̡P@pP W ZJ1! @DP ̑@1@DT0@ 40  04 K P (K0 @D< 0@ 4 P80S(K80X* 2< 2(K -LM"1`S3:r, W( B R"*T$*,KRU  R00U00SR 0 r PpX U"B$K 2< 2$KP"!$K -L MrWB Rb+*T*4KU4@ "0S 0 0R U@E0 0 . PpY@ U 2< 2(KDB(K(K -p഑@ 0L`P: ! IP1v`xV0`F1v` 0  Q01^` 0A0000C0s0S Cq0 S00s060R2A0C2p -L@aP P `P  ` -P`LQ@ 00T T(0 2S $A@P$00C$0i0@00Q 2S@3:A@P@ 2:0 2 -L4M@`PQ 00 V_ 2+ R (K 13/p3 0 +0+0 "@0  P0KD0 $% ?L`KDpK0 40  08/P7 0Yp` P$0S@ 1 R "! !0###R0DDD0$K@Q6:: 0P90S0S  Q #$0 0@0#$ Q0D0 0 ` 0S0Cx s0 Cr 00 $K@0( ޡ@0( 0~O 0 y p-L M1@SP aP8 0S,000CP8KpaKp -MLM@<<Ÿ P K8LqŸU`(K P< Bw00 _ 1 R18K<0C0S<0&%@RXjj`? L<0 l60l 0` XpC UM8K80C00 0RJ(KV:`K,HH8   f0S ! 0 " "Ƞ"S CCC X 0ႀ " 0X tpp'@0!@0O00  (O -L M @ p?PP 0H2`a 00  J 000 0Npⴜ0Q(K -LM40@S00S040000 `1D00 0$pA1< 7p0C 0R40 0NP`p Pz W 4NV0 ^ | |  0SPW00 `D q `  R 0S  ps"nR 01%$0U6V8D0UD 02U0V1D0PE2UqP.U* 0 ᱠP 00000P@L0 (K0EV$08 iP8 }1 (c00 (K00PV$DP @00E S*`V|1  U 0410CQ 4 0 B Qs" 00lR3uPu1PuP`10 `DPD0P0CD0P0S$ʆu P1D P U D uP`V `DH  A PuD 0$10C0S081 ,1 b00tKK8J(J -LM@ p`WLWJP0P PASP[*0 P6 @0^ S^ ^SP0)P@P 0S 0  00S` 0 sP 00080080(KoZ(KP00 00S a0008(8940P(K4` `D0 0P 0 @ @<0 |0080 w80Cp0440 0n< 0@`p D0 0C 00@400  - @`t051@0JJ@0D$ 3R @N !A$0@DRLP@ T00t2@@`RDAKhu -LlM0 PşU@ P` 0PuPp0 i 0  P| a p0 000` 00P> R?0d0 p0h0 T0Kl0 \0K @t0 x` 괠V P `v` E  00F0d0`Pd00d0 pP@ ڴ R5 E\ X ™`0`JPv` 00CT l txP0 h0P r0h0 x h0x@p  L 0p 000| 000(Kp0x h00 |0`0p@@|pt@l t 0 T*  BRm@@PU RX#r PP@UD0Kd0 L0Kh0 $0S H0@ 00SC,pPg `d h!000@t@T*00 SP0 B0C@0 H L D 9`0Sl0S H0@ 00S P2 0d hl0 000d hd h`0t0<0K0 0 0 0LP8Z 0SpB \A P 0pP   0(!0S$! 1 $!0Q 0YP @0弐p0p 0 S ;0! PB ἐ8xP 0$! 1 $!( 0 -LMP @T@p0 0CS 0@D` 00 !P g P' 0 0 0ZP00 s0R0  (K 0 R P 0 0 0P_00 0-LM@ Pp10K0 -LM80 `p 40KP @pE ᢕ8KP10zX  0吪  ⼐r ^Რ p ഐ 80N`p0`000S0X(K 08 pP 0Cs0 p000 P p -L4M`8"8Ÿ Pw ^@HP p0 ]" R 38* Ps WP崐` W?1 CPX: A rY$: 0Cs0≐11" 2 0" 2 H00 0 RC(K GR  00C @ 12 S ~p D Kpp D 8 8 K4 < @ @`Ky0 VP202^{ ( -LM@pPQ` 00 2   Q u:1Q噶0" B!2#K00 40 V^ X[ZFWVHT0PUO Q * 2 13/pW 0S* ",, ( A,K0 PF0S: 2 K04 KE0PVP V$P 0  =0 K0PUP`0PU Q:0(0$P 0  K ~P,   ( Y00 KzP 21 m,j -L$Mq`@TP  lliadAPD00CS0=j@4a Pp: @Y@DOoB0S@ K0: S \P ]0S 4K;R pW !+ [0 R@@ 9A03 KlT#a0 @00CS0"0 b(&h&ƨ/ -LAK 0C0C(T:BK @|P xB.K B,@` p|d"[edA_T^P-wCwcw 0-LM@K0$`0 pP  /{pP0 PP Kh}4O(@P +OKru -L%3\&c -LM K+ @ K+d @ɸK K+ A @ K+< @⾸ K @⺆P K K A @⍅ K h -Lm\ $ $0$ -0L< )X,D $ $0$ -0L( Z넯ܰ 0-PL@pU0 (0":k0cS0: A 08 80 $0Q/ $0S/dj HH!<<0 0R/$ 0S/j | 8  -LM@Tp 0SEu/PPX`@Q0@ @@]PP 0(Ko/4d& -LM`Pˌ~qA !Vp1A0Q,4SQ 0"K#K04 K  0 XpE;lP3 bP) BP Twh d]KeP0 fP 0tP! nP0 sP0uP vP00 0eE(0000 00,40000W0S 0S 0S0S0S0S u<PvƨP&D&oܙ&/& -@LM`pP5l}@ @ X3T#*Sp* fPD LP8 P8 HPA 6vRP6 XP PP ` puP#rPhP/ oP0!C!-\\ R0C020PU UT R7 Y htw0@S` pD2@00 00  `pWPPVPaPTqp ᓌP   Pb 0P0#0 T!YaPP`K]Xp@ l9% B R4$4$4|4$444$4$44$4440S  X  X  6/P00S C$ P| ZP$ P| tQPY ^pPx0S @Yƨ&D&/˚D}l -LyM@`B|)0Y刉则y0000x)Tpd9p@DTT)0 RS S@ 0S0S0S 㜣aP03 NP) HP LP wPP$ RP0lP* fP(! iP00rP vP pP000000000X(0000000000 (((SC 0S001 0S1006V7V7@DV1'2 71  P"Pi1P/X  1!0`001P0S}K<@W01 0S101 0 C C10S S/R }K2Wp0Sw &WK'WT1: S0S 0S 02 2/XS\&\002 @IPU   30P2 c v0g 2 P0@ /Q50CS999999999$ P{   xP2SI 1 "`0000 S\ <L0, S " 2S /P@ (P2  0C2 0/S 0V/S/00`4"00B0 S !%!*"B2P$002 840S S/R! 3K0S VpX* KQP! KQP X00: S  C CUV0: S 0: S |v : S  S  S btP= P: Sx S1 L0S !u0eS 20S V S V3Ÿ00Ÿ S2",Q VP2!PQ  <Y<@PV0S; ɡ0: S K00V\10S !00C0!S 1! sPQ X0T |0Sx ! uv0Sq ! uoWT@0S 0S d00SX00Sx WKUpw!r1: S Tw ƨ'''''D&'$Y'''''''& &}lśh%K&&6,ǜ?ҜD -LM@P奈`yP&QpD@6@f@4F\v$PP 6($08` Nw 6 80 R 0 8`SP($ wE崅$P0(058`$0)w0%+0@vP30L H5H%8`SP( 80( 0 %$3/ 0(0 0(0Svd!SR vP 0vP 0000#0 x#0 !y0; S !041!"08(1/8d0`0(T$㴹㱹"4`` ` W8080 CS A3#0SYv0 QP @! 0SЀ 0  !`Xp ` 0 v(PU 8003/p0S Z80(03/pR圢 2 #K0 Ÿ `0 KQP Z  [80 $0(3/ ?#K0#K! R0. $  ?xw 0  80 (!1/0 ${?0  `p` `p`0)  kv 0 #KQP`t 0   0 #K! ! `pb RI0 00003/n Su S(uUƨ D&p'&%D 'ج'ox'Qȭ'% %`'h"''ivp''T -LKM`p0x뤊J 6Pp  $0R| S 0S} h+iP5 aP( GP0, PP: qq4 0 WXUgP hP000mP" kP lP00nP tP0S #0 0001000 000;00600$0P9PU 0S8nS0oSP0 00,BP sPP,0P{ PS 0S8BKxPQx 1SBKx0PA 1 KN@ZH0 X$1 $1ZL(KFhsP  0: SwP  P 1R p 0 'PP KRPwP>pwP<7 8 1NS0P 1 @$1fq0@KS# 0 00RV!KV#xDV|0 ?V%|9V$10$1 1 S`(0 `0S(0-0S,0 S  S$ 6R0]4$0S; ,0*GK 0`pM?K 0  00M?K E?K @AK x`@@K?K O?K {U@,1OK# 8!(1V##81 1KK# (!1V##(1 1c1s' 0 0SU0Y`,1 :  #!8v0!!!"1v0!!!"*vM?K 0 00M?K E?K@ AKw(U 0S #؃`R pcP 0 0HU@UV,p5 0SV/*. 0 ,0SV(*EK 0K?K0SV&*GK 0 0 K?K l  0T됈,1V㐓)1KK# (!1V##(1 1#1#  0@AK7wƨ%ح'2ݣ&/ã_D&DҤ>xx('UަMҦE '*DKN/ -L M, ( (0UP(000%0PDr0C?o20, (FMp( !( ,00C,0 ,0S9 (000-S40$41, R(0pP EP SP ynT PT`RsP xP00I(4 $4  34! 3L! 3 (00(0 ,00C,0 }P@OLI啁@P7 x峊STL381S p#p@|TDcQ^{PdHs0S 4aVB( 咊ቷPM81S% "2 YTww 2 ,0S (000S (0!P (0zP`PR(000!S (0 LV,0S (000S DPFS妴:T``0:D100P S 3!0`00} 1 ~@P }@P| 1 }@Pjt t t(081Sv`@0`nPQ081SqP 0 pS \SP`PP3$081S| \ D0 TU4'D&\&ܪ/'Te'D'''|K`'&'Gh&('' -LM@P`/P@P@P3 DrDB Kp?(2Q-= 0Pq EQ R[ R] R1 0!BSQY KOPT0: SPm00 !Kpd10 ER!MpE̚hP LP" 0FP 8PP fP000sP0 iP000 nP00vP wP 000000|P KN@P0: SpGP @zԳ'D&Dƨ -LMP`@1sM0B@p$ 2Kp 20Q1S `00 ?0PE0 @T_PmP pP ܙq倂P B/p qXD l \ H 0 S0 CNP00 0K0 3NP0009` * R 0S /0 00S 3MpSNPHm9`0S Mpƨ|D&/˚D -JML M@p>rQa Jp1 @DTbiP0 vP fP 0 0>β Q1DK AMP4: S T 禙O0!CK' P` 〙C>KP 0Y/S / ,0K0$C`@T p᤽@p @/R0W/P 命0 S :XPp MCK_Pƨ.'D& 2 -LDMP@嬀4$ AdKeMP%KdK&KLdK[MP%KdK&KLdKQMP%KdK&KLdKGMP%KdK&KyLd$@\3\#X3PK@@ @ @@ 83< KTKT0 ɝP,< KTKÝP4< KTK㽝P8< KTK㷝P<< KTK㱝P@@< KTK T@ 婝P< KTK㣝PNP9x2 K<P <K┝PIH"e<0S <KㅝP<0S <K{P<0S <KqP<0S <KgP]KQP!깣p p坴@PhA \1R@᫼T`@ 0p/S Zm(1Pp`V  ዹ 000/007}00CSlcccc\P0000S Bȥ0s00Xrȣdb(&=`b(P b(dLb(E &eݧקhb(pb(@<(4L<( -LP`p@p Hpt00S LP PP@@TΎPP Nƨ<D& -LMP`,Gp RpP P Hp 6 pGW/0S (KfP RP" PP WP dP`rP iP0`0vP xP`0`0 ` `$`P q Ű `V 1S 'UI䅟䕟PU KKP$0 S50 0S600 奻 @`P/Q / P` .QQ .QQR`   Q 00@`X0SP$0 S0S@P `pP PP0S <850C S_liiidhiihiih0$S P Po [00$ @o 00S $ ?RR00R0SX5S S4 S4dJP8 0S c0S  X6 $ o 0SX  P  a!SR0SX PI 0SJP 0S0St 0 0_oP j0S 0Sc 0?S_ 0S L 0S 0?S 0SS eo x0: S R  :S0R0S0: SKIP` 0S&500oo 0bS`V  K1P SI 0SIJKP ꯾0S 0?S 0Sb(MƨD&,DWw}l -LP@x}np` Fp 0 R1 P0C@PKpPp mIPh5PW` /_P 0S 0S0PRIPM50ƨ.mD&D p-LTMK7 K80!P L H dHHPH@IUIT4` }HP 3 ]n就30X0 口P 30S S" S 3 I 33 |3 0X0 \30S X R 8#6 R <# SR 3}!$3 3 ,20S DK 2 20S X0S'0X0 2@T$&P0"?@c+B00CS00 ! 0 T !X0S?0X0 16 R0S 10S0KW&0P^0KM0 X0 1 1@T 10S @`Q@ TDK d1D1PF410S <10S \1 L1 zX0S 060S (! R!1 I 00 ,DKK;`0S d00S 0-S0X0 h@00SY%0S 0X0 *o3$l(|f(ƨ^| &,l(f(f( l((l(To(b(f(f(0o({| & &`q( &bf(n -LMs@P {@m2@ @0`S ^ ីZ"8Ep 01 K0 HPt`KP\Ua@P|sssssss@ bGP =@@4 K|HP3t KtHP3T) *00S@0Kt 4K`K40Qah0 l0 0Ql0S ` K卞PPh0S 4 K<JHP,3 J`K11KK2PKK0PKKO3P0@0 00 @`K6<`K6<0l0 000  ZP`K(1PD6D&ƨH&}  Bt @  /Dht@ t@ l&  gt  -L{LFI -LM `{ale@0o0C?oS20@ @ @ p3p#Ap3p00S" ST 0S5 ZX3 Y/ \fPP HP LP P03@fP RP 5hP vP00 00 00 Y0T 00<0!S5 : zP  @5A0S #S @52   vpPN 0`#A. 0P0 #p0p5KGp 0S0 00050C SA,yzztyzzyzzyzyHy0S ?@PY0S- ̒$ `k` 0 3/PP 92$ `k p`Yh0T00S dHƨtq( &h D&p /jq(}lD -MMLM`|Jp|1 00 1}1001|XX:pL 00偮P 60 {pP(Z P zNPi5PQ EA@6P񟗺|}||d~|d~d~}d~d~h}\}T|}}d~~d~d~d~d~~d~d~d~d~d~d~d~d~d~d~d~d~d~L~T~d~d~h~d~d~p~|~~d~d~d~~d~~d~~~0USP( BpQ Q 0(SSS 011 8 0010101L|P0 8vP4 6 p0  M 4"R 㾑0 zp0 0 8 4"R  hp0 ( 4"R 0P 40pl50y010000010000f0d0b ^ ^  ^ QS00 00011qW ;ocGU1SPP60`FV!R UU0U0%;ւP%!1S KAtEP4: S011PEU4t0V0 18V ;,&(5P0 50BK% @HBK @އpPBK A}0pvs@P D$nAt4 BtD04 4 4 0M.KNK BA4 CPP&7MK ACDCD1D<P4D@B>KNK 0C$ @r4S P$>pPYiZ60#S MK AWC'0BK @D߼NK@Zv0E?o2? MK AACtWBKX @IPPBK A0f/廸8psW ;PPBK @D`s[Hi00CS0 sP Pp PNUu0 P00CS0s0 V ;0 S:00S:0v?!V1 1;1S1S 45Pdp|!@D1 BVHP HQ7P-p0V,4 wB.K BH :P40`FVhP@0P  f/0 %T  V8i5P :pq(xs(qK/y$X|(p( &D&(ݧjקDq(h&we ~c`dc&mdCq( -PLMʄB 0P @P` @ qGKp!!Fh`00CS`0X H@TKX0 X @ Fꈗ(+h& -P`p@0L\MhP dP `P \P XP pP  t0 1@pt0$`FVlTT!Yt rTdT x0 Bpx0!|$|BlP aPP Q @REdP@pP nP p rP tP0p0 dT0 RT ST QT0X0  hK⫯h K XCp (KpTM rT! lTV p E hK␯h KX =CpH TK⃯0T K 0Cp ( TK TKsU  DKmV@FcpP  t0GPaU4@ 0p T K Cp@"@>"Pl `#  @#  ,#" l0KPU! l"@0 !rl"0P|0 sVP'h$p0@S_F|\FelZt0,pK1('6` x 0|@Y S pExePU 0P 0P q"@P ID i2 $ 0 t1/D&1~D1D1{D12|D(2!202?2K2}D\2j2w222Dyaratcid22 0-,OLeM22222222220P1 1 1 嶯. >p2>`PpE !P 2S 2S02S-2S*2S'2S$2"S RP R2 _ "R S, 0s| bP 6EPo "2Pf 0P>] 1P^ FF3P` AP-_?Km 0 B呙P |10S"|2RSP_ FP0Y IP2TP6 aP02sPd iP" cP fP02lPD rP= <02tvPH tP  uP02jwP zP<a\= P  ʄ  Y ,= = `@| Kb<10SPA '2;028@[k0 E;@T(K202%02;/`WpP000pS KEp| 01 W /D`P000`S KoEpi 01 V /1P000S K]EpW 01 02_?K0:j0* 0ŘP |10S 㾌2 S;2R20j/pP WK@PT1: S :  `P d/P *0  NP㗌i^\?P ,Xk?BK@p eK*0R0\  VL H9*1 3?P1  +!14 )S o`o`K KKݝp `apP ``>K KНpp2S WK5@PT1: S022S 2S2SQ` 2`S2Sxw0 p7}P py0SL HBa >p (d+XP/ P4 f/ 7,0$7('4v?S㠒"2"2 C6PT 00P U_`P Z l㮋2 S2 K?pD&+ >0 0%K$  %KcK 1/Ÿ0 cKЀ4 4C2,72(7< 72$7xu ?p* x ?plV`D%->p`* <> `l$HDP G%oD`Vl%jDbV 222222T|2S"2Q|2"s !14!8!K0>K]/K^K1BPpE`1p!0C`1 0K0Z/KY?K[K"BP4d!t1`hL1 ,x Rl0cK *Pe?K1! 01!0Q e?KcK ң0P u 1 5!bpp_ XW02Sꐛ(FD&$F1FcFF(/{EEE.E3JEp(l(SE^Et(?DEE(UEE(FF(0(@(G-FrdA GedA'^D>YG4G((GGGG H( &HHH"HN( IiIIBHiHh&c(uHI (I(JK0]/K>K^KyAP x1 St!'#p!##`!S`V Y+1"R*> R0;|2 PR"2R SP1 p10Sxq2SN2SKE1MFS 2S/2S,EDP' `p`" 0 B,0!`" 00B? 0! 0 " 0\BEXD P 2|bSBpl 0! ! ! J2S5 2S22@tBA@2SkDP% +A`p0 0?`(B@0WDP 1T011P#011011012׃<ѣ<2BT E2S202S 2Sr2S M8S8S !DP WGUGDg$$P @Lx5fP` lPFtPM pP qP'K K A?xPe yP vP#00#000000#0 00#00#00 R :LP9 Z`N) 叭P)Ly0S0S9  RnR"oQ09 0 0R0' K@FPPW "RN" YP"  TP x OP  `壇Us:p 8I0"0;PE}:RN00 LY`V3 @K  @pP/PBK1! @?BK HP X Z R @Z K  @qp@P.K$ BV']KPE ;p  -:v0P(`CQ , K2?S S D !TPU0 #x(((/[(D& XZ&Z|(D &эƨ((uk+uZ([I[(zd@("[^DedAZ[x[[[ -LM`@qQ 7p$X 10S 10S D1PAPV  P lL1 R L`@CpP fP nP PP PxP yP qP 0 00  0 0 00000 00)^X 00K _0P &Qp080 P80pu9V`PUZ(KM^t(x(l(V^D&`'o^/ -4L,M$P`<K :P#K<K#K990@ltl$00dd4dd@@@H@ L0 P$)7p0:H0S00S 40S 40S @H@ 30PUaF 30S 3 ^P Y30S ROp㜓圣Uʔ30S(KdS\ 4US FSZ PSz BSL3L0P0 姫PP043 0ᠫP 30aS0 XSq PvbS"+ cS 0 Qv2PՊ=pSF mS) nS9 fS00yxSD qSx"6ySA zSd"000i 0L 'vD2<=^000Z0L 0V!0 v2 >0S 㝅h!000\1 <`!00 D1 4!P10H0 .!0001@&@K0!0 0 d DP3S KuS0 `lS sS" hS `|wS* &zS3`3X᠀qꐃpnwk00h0 0eL3``a 03 ] `D3XY p CX0C(0 0R2`O5>KPe!00 0 P3S "lS LS aS㌂. |"CS*sS mS%wS zS`L#KpH L3S  0C,K#P @P!J@]p``:p!< P!6 Px! 0S1X!ܴ3/ Kͪ/KpP `PT1T!T ! KR #/K0 p !PP Q! P1!!0K 0S/Kpi `8p&(x&&&&(((D&(20&/&H& (`&(DXtiZgui  m-LP  Kh3x( 0-L@LHP@,(K0h(&,MM 0-L@LHyP~@,v(uK0h( &XW -LdM=5PT!{PN!5P0 p) Pn5To5@P D5@28P04"@ ,2,,2 5 DKp DQ #!5P ! @  p1a 00 @ p0 @ t0T0 P0 L0 H0 0P0 00 0TK$@P  TK 4 DK@@ <@ 8@ 4@ 0@ DP ! DK/4-4+4 0 X0 ,0K4 #@@d K\K\P pPPUPh0PP 0/(KͩU3ژc`[&ZZYY( -P`|6LMtvtF P 0  1pL6Y q  p[O啙PN_ 00 >Rㄞ0^-K0]-K4 B0h>^-K B00^-K B0]-K< B@^@n0 -p@G >]-K0 B 10 >n0S0S= r- R   t [ K1ZK B0 ȚP^=K0C0r04ПP ˟P0X#t]=Kn`(0C`0T#0000S:K,0C('R $4SS *0" `ᣟP  1Z$ ♟P Z1$0SጟP 22T"ZPV=K,0C `p`:K,0C4SS V=K,0C l2 QP*,ypp]=K<0C0 \2$b ]=K<0C]K8A0!"0\p   y^=K 0C0 KApؘl O]-K0P< B0j @\(T(_/ (D&&%Rpt(&x(`( 0Gm\tl&.)LKX(4(&.a8\s jTd@w}l("[(d ( $q ! e\( (:Hh((&|(T(xp(P(G$2P0 ` 01#bp00S 01 ^K? A V0]=K<0CfP` 0R$ S\? ^=K 0CV 0]=K<0C +p8L `VS  !R \ +S :0 Q+-! P ,} P +P +* ! QS 010$0S  Q* 0SPhPD"Dr0S010 0S 0S 0t"tt00"0S0Q#1ѣ10^=K0 0]=K40C00^=K0C0_Uu [+t W+30SK ]=K00C0KA뇃p@ P 0 KD#d(@/_JKKA@⮔P6.K BXy\ oP $,0 K#d(@/+!++++3Y-K0 B03 0KY-K B0x0 0[=K0C@ A(+p>K0CKK(AⲝP KZ AK♘PK⦝P ]K AIp ^ T:K,0C4  P.K0 Ba -$:MLM p`Z* * *  (p@ 9P0pGs00W ZTY 0NTY FT IT DT*K Ap)p00* R0C0s0S Dp wST0B VTQ OT0 0 0 8mTd fT0H iTR bT0*0 0+8sT[ vTf nT0!00 t0 d8<0:  P8 0s000(0 (0,80@y 0 0  0k0*0 0+7_0!0 0 7S0c 00 p0  7F*=K0 1 @1 }0790&40S3w.0: +) K  @=K @8Ya甆W 6 R, 0S6 R0&)p  pL )K A"+p XE 0*S@:S V 0㿚 KA R0)=K 0C0 0㮚>K0C 0 R0$9[S >K 0C QP*`|v U; 6h0P: $Hv)K A*p 0S Q)@P * K@o0P:    Z PPZ z:0S: Z>K0C0>K 0C 4 p $$Z K`dPr0`4P P#(0:v^PZ #0St:S0) $9[S K @*0`# :SÛP34#(cI>K 0C _pp   !0#Xp X  v:0 KA\pؘ~ K0P: ^ 0KL#: 0S - K? A >K0C R09 3M!ЀQ4PS4   : ۚX0:=+$$S$QQ 10S;  0 ᠙  (:SppW (+>K0C>K 0C P0 6(pdu>K0C K R?A : 唚X0:*!f  ㆚X0:1 : |X0:#100)O!/D&& 0(K)))\t))LT)-!w@e"[ $! : --P`LM  P `K3)\EPtu ()P (p@X(p(p0 u\`pT$ %pQ$ 0{@{0 싟{SH{{S 7(P0{{Z.(P<;S'(P0ӻ Qiy $P By AG8 ({0*000R(+  R$ 30"R1<;020WCD20SC C@4P<lPp,HXdt $d| 09 0j K0P 00R0S RtW 0;8;08;P 00l1ppGIKL41 00S  0:{ 6+S+t K00S0?S < # 0< 0: 0 t@0 00@; 0@0 00 008;0?{Gz?eA`RMb@Ao***/+`*++$,@,f,D&****+8+T+m++t*0)++ƨ*),l&,-Z-=-**)p*J-k--0%&)-D%&D0)) K0`0S0?S Z0P 00A 00> 09; Ki00PS 0? K00S0@S d1K 0t!; 000v 0! 0 000K{1 00S l  gW0 0S+W 0 )0%&b....X*/&H/'0('p0CS D  (L ( L p 0 P Q:lz'&ph'0 oPE d0 fP< Q$5' ('0 GP da '0 7P '0 -P 0 $P Q Q LHxDv0 P$ ~0 P 0 P 0 P 0 P 0 P 0 P `0 P <&  ) p0S :Sc S0 C0 S W; `S`B`0J0 0`0C00 Р `d//////0)0C0Y0p0000000 111(1M1o111121172[2e2u222222*22222$0 N&00C0 `0` Z  0#0`a00C:#0 00 0` V0`CVB0 W5 ;V ]P W &0`S`B`0J0 00  kFW@&p0C0J`FV 0 0C#1`a  B##% Wa%^W D$0 0H 0 0>p%J0 -LM`P?@0P-S@lP/ @04 p$0p p*40SP a`F PZOBPģQM 0CK!PM F m7P@ `3tC d@PL@ RK@HGG000 p 4 卑4  W X `Nm00S')f`P 6P`0b 2 R CF _F0 S 7F 2FU+ 0 KF!F0!00FX852/, )p4 ,pz0S-X(` ph0SZ ^P pp@@E 0l Vp`Tc+V3D&DM3Gc_3l3~3ƨd73333463^3 -AML MP@PJ岈P㰇8 嬈P7'` 0-S& oAP ᳐iAP~l p @ `FPX@ CPE0S0 P @DDA@D얟f{b@qQ 61 Q嫷< ~4AP -<0P@X-   p pD0B5S񟗕@,,,,,,,,,,,,,,,,,,,,,,,,,,x,,,,,,,,,LX,dp\ CKpN H5040S 0kP k00 p d0SMt4P k000 04084 4 0S |k `4 00,tL2$P 4t CK 4040S P3 000 0t0C?o#2p R0S 3 P㟄㜄P㗄ljs`3@DX"8iTH3Q00PE@rS# RSm iS e!tSr xSq!r袟@T*i  0S U_!qX!2B R00/S +|b 0S T\  0P@* 4 ( 0S 0S   2 00S }0S @ 0|dl  !cXa@T:BK ABK @" 0 BK` @BK ABK @" 0r QP0$00S BK @B$BK 0 @a;ݧ:,ק7 +6/:,=6U6 7>,w6P%&6h666>,D&=&(:, d\%&?:,@C&J7e7w77Q77> -PLLMPp@O& *fP SP@ LP ? TP; dP> sP2 nP* qP>tP. vP> 00.p>>PE>A R t p>h>0S\5jT> L>H>D> >"7aV=0S*P tP P=0S (0X0 @H h @`D @@ d ?< ?` 8 ?oo4 ?h bRd0S`0ZSYP Q0 +1`0 <`00gS <kD>@><>8>4>0 >(KB-|E-hE-tB-hB-WD&`B-pB-lB-}*B-|B-tE-pE-\B-ƨxB-]$]B-xE-B]/&B-B-lE-B-B-B-B-B-B-B-B-dB-B-< \\a\\B-0?-C-hC-Z]g]u]]]]\q[ 02]]( -L\M`PMP0y0I (p90`FV"$&R 4&R<&R <&,&RG 8&RD 嘱0? 0fkP. dP" DP" bP o)fP hP046rP0 nP pP06xP zP vP@680 60$60(60,60686<6D6H64&R <&R 0'7QGqQ|Ky>P@h7C'K P LvPDW0S  (gP 0000V 0  E^P.P061 (fVppN>0+S`x&p6 000(< $6C'K000 :XP00F00X|KH`ᛉ @ P/D./D.t/D.t0D.0/D.(00 00C0 B##DSd000 P 00C##10C0 0 00C0 B##P 0 0 00C0 B##P0 0 00C0 B##0y0 ğQP 'KPP͌0Be 00 B00C2#d v.B B 000C0@#  7JZ6V00 q`)os`F0+P% U0#03R0SU 5%PP t0= \= KP0(`0,#,R004# F@ PKopPE (X!EV0(P"E0<6S"46S" 02Q" T201=Ր|U6S lPk(P0 BV V 0 q0 P0' ᶐ,6S m/9PP J'㟐<6S46S@%d1Q|0 @6D&S1x0Kx0 t0KRp!  H&0R\!\ $&0RL! 8&0R>$>;;0>8>L>T>`>l>>;>>;;;;;>0S00a0Sz00Su00Sp00Sk00Sf 000E00B00?00SV@000030000 0H3 )0SB<0S=00S83P0$00S,<:(U 0S# 0S 0SY UU P p P l PU< UG U3$0S -Ug U) Y7U  U. @U0000 0 8P U$  UQa\PJ0000  8Q aP Laj77 ,KQpt0K QP*n|@T , 0!$!6q0?$P @eP `P`Rx$xP-D&/wYx&vxjw0yDxxxxx -P@`pL ipl0 R10C@P.:RP fP'80 `g:PPPb{D&P- -LGM  294MG0-0- -0w|Pp=0@d=@\=\-@X=@P=[@H=H}@D=@008-000-0,-$-0 -0-- P-0 -P-0-P-0,0,0,0,0,8|`P  ᱀P:? 9 0`|< $|<P, |@P 8PP < <2d@ᓅPc ; ;@ |<<P 0S K0CPC l*\T zPG>K0C0CH| 4 P 0S6թ E>K 0CPUEK AOHpFj%|5+0 4 5 zp"0|%0%a0 wx6P l՝h6`6?QXj$K86< 060 & F 00Kz0P 0S Mz WPt&@P U0S P 0S :z7z5hD0S5Q +~pUP{\5?@6 PW 4 050S0z5 yP ~ pze iy\Cd iyd iyd iy iy$iy$|ixy lihD5vmHDmmm(~m4Syڐ4S   Y@420S +&@Pfa+=pP}_mv4:tP 4wP{X@PXBTFmL Cmj,B@P 9m 6m4@`8tPP0@P`o/BNK@D+}4lD 0Ad4 0hd `4 U0FK Ap00z2U p0B?o20S q R  1 4S Ky20S 20S 00yJƨ(--T-<-%,-؅-$--܅-4-4-,-----ز---- -P--- -p--$-ԅ--3`-ݧ-קCqv-kœh& -,-&/Op]KD&--\---ǜ---0-}lW&h---э(-2ܲ- /H\r-(-̝ڝ#ވՈa=wX & <& ĝ-  - -  -LM@PCl5ud5\5T5.LP <5 庄,50S E B Pc\T7wPM `t܄ 0PN9PFvPJ$000  p40`DVAT 4 000PcP XS,L|0@D R&44,$  (4($00K0@KAu >u;u8uͅP\ 00@&3`Y0p xP3# |||3 @R lSP  T[}| P D0Sf$C҈P `  PdRpwp@pb 0<0 00>00r00010ʇtYpWlUht\2\"QPfH2pc P` A1s0S LJ}Pq嘁zp1Kl U0B?o20S ҈pP1K 1 [\=pPS  0 010010K 1K喈1s0S 1[ 00R0S P=?o20 P P 1Kz1s0S 1[ 0 PPS 0P'1Kꉉ(---4-x---]ۯ-D&l&-0-D-5Pt &;-8:&Q8-D:&BS---0--@-dK ί¯D-d&Kdƨ -^ML M`-PጀP 6 vF  px60S`V=X6P4 FD6/DnP 4iP 6 VP 10@S%* dP0 lP cP 050@00%B.K Bю`0-S0S P 0SB.K B㽎@_KAP% ?o 2R0S 0S~4p V/PՌ {4 {@嶌5: Sx  Sl0S  pP H塌w ( X 1UK AP  厌T5BnK: S4 `F +6 zU~3 P @ 6 P6 ^>K 0C C P pX T 0S0S8t0 00z 0S0S- P  y0S `&0ӎ  qK 0C z 0SBK- @. p`BK A崋<`-K Bᄍ4 0S/ p`堋ꁙ-D&|{&wl<&~ȵ6ڵ )?Uz^ٶh& 0-鸃c00L@@P0P 0S005+~P t3 ths$닩딘ٶO`-}0V* s/R~P0c0K#3PP 䂟T 0+0C0S6P3P 6 j~P@D k0S ^P X2 TdPbP 0S 8[P 0S20Q2P R! 1`V !`PET 0SPP&P ʱ`/@D긫P㭫T10S H10S0Q,JO@1 @R1}PٱP3%q,PP@0QP  %ɡh꾱P;P p. .T-. .O._$.wnf.o.~-.X .8]&W.. -`LLBpD|?@R@0` p"2 0 QQ _P"PPEaibfPL IP> EP8 *0 M aP8 ePx1|hh  5nP5 iP+ lP0 ,cP$ =rP uP0 cP 000 S00000`0t S000 0 Pd0@:P HW h+.u /ƨ(4.D& &b&  ,4.44.4.o -L$M sP_Wğ L@l4/Т\4P@ 0L00H0 0P ,4 $0HA@Tn`PtD@ @@ <@ 8@ # pz30IYZs0崓0 1 4 K0Y #[3[R S 0 H080S$, cFP "vaD0S  \<0S    @0S r@P {@p|"P20"  -R R -R i^eR^|iRy kRv eRseP8 QPN EPv IP) -P paP& dP$ SPh nPe kP) mP2 iP0`^VZ0SW ?S``SrP) sP* pPp080 G\C0P^U?0S< ?SPP80@^T40S1 ?S@@-0<0 '0D0 $0@0 !SC0S@  R;ڴ3K04 K3K 3h0lnY5. X5./l&ʉ5.^&/ D&/5.5.ht@ &4 : ? 6"    8   gt -@`PLTMrp@ p1p`FVU PlKbpl UgP uP GP0p0 0P0S@@0Tx@  ix p`V  p!UZl K  `pK? P R YUp V lK, p T xp U p|UPU p TqPL@@H 0U /D& Dэ   *c`  0-@㜄LP1: So?K& _oTRPUK_Ki W#  sK╷|>@Ppl  0P1  Kv1 v1}?P"+wP^@Pu ,f,(3fV% bV eV pV zV! lV 1 0 v1P!0 X 0j x101 tpr0!0n@lT 0r  2Q 2X 0"q 00 ss`pP 2  G(0P1 * sKP%v^PP!!1 A. m !HDS(,(0"RP 0S Rl㏐!PV{0S バ1 ` 0Y 1 P{0S h L p 80 K81Q   S  R#4sz  UqPh{0S T > k2*WЁ@ p../D&Dc )MW.x..&ht@..tŽoeиѽ -LiM?P0 00 0`1 1 @5xP /xP | N>0 0 RU %$cOKV/z> K`1 00 0 0 0 h0 01 1 H>H^1 0p<1 #0>K0  >p,T 븮1!P1 0cOK B141 08!  La lPP#0u \.1 0CS> H>|-00+ #OVPX NPJ 6P3 ?PR 4PpTPD HPP#16;3kP( gP) jP fP<0`1 pP ʴ|91 S 0(!#cK# *#c?K#041Y uP@W8 )Wx800l8 (+ncK# 00 ᗴ@Yy @ wY@8 mph KzpL oK# 00cKh p1 R 1 AiK  P d}%P0  00璣P%&Pl 1Q +  q  !@PW ![Rp t,0Ka!P6RppOoL!P ᥗ r RB` p``W@Tf sp1!RS 8Q1 o?K0o?K 0(0060 0s 0s 嫡 `ᐒVt刡hGx0S P幡1SD 4.pW1SS x0S. 尡W x0S( 圡~ sP1SS gd`gK$! -p `Vd儡ZW ZT#0'00pDx0S $0 _p7x0S #R(.P  q  S)4!11 圢P1 R4! CpB Q0C 1Z@i/K ᳢#0@p 1`V@Ѓ0%00(0 180M 0W CPpfL pdH 0~kP 1|BPUBK⭟P|dXs 0S   ᭖NPl 0S ؓ080 C0p D0sp` R080SW 0R  @؝ 0S @ 0ϝP R `VM& a 2 vW (/MTf)Q /k}bu@AW=8j CK\m`+=D&ƨ6?F8Sv1S#0  +ppp7t#@0#0(0 0000   00 05#  QP២p 81S #mK 00m?K $#04!418!iKᕢP  p` 8! R0SR#0_#0(K 0-P0L  xp00^ 4Sp Kh 0 0$010r `/ 0-LMh@T0PK@HD0% 0b,, @0ZK0p2lf1`f00@-S* R  @ @ R R@ P ST 0T800 @ (00 000 @Ĝ\D4 -L M@K0 0K8p  -LMd  Q K 0K#@p 0 S 0 0 K ,<  */;*/08*/Q5*/2*/)/*/{,*/|)*/#&*/#*/) */=*/*/*/"*/*/*/ */////^*/*/*/<*/*/*/T*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/4=*/*/d*/(*/$  0|*/@ eu*/r*/ o*/fl*/i*/f*/Kc*/+/j^*/O[*/hX*/iU*/vR*/O*/L*/ I*/F*/!C*/@*/=*/1/ 8*/5*/I2*//*/,*/)*/&*/#*/ */*Q/*//7*/>*/ */6 */*///*/@-@/t@*/ps_strings missing }/\1@85n?F\RØXZƘZ̘D]Ϙ__[ ddӘdlژm٘mPtruݘuuphz1|ozh38 D4t)6w$BTNTGGc, Tc, _^)d*g$5[t7p:n BBdRxdRoX{XX``yHdf8l|nsydDramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory +^8tơ @@c(\gh@@m<sL   z0@@>@@<unblock and -DNO_CONV?ԏ4ĕPFDoflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat%s %6sCan't get mount information1024-blocks1K-blocksonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-agln] [-Ghkm|-ihkm|-Pk] [-t type] [file | file_system ...] aGghiklmnPt:only one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %s Used Avail %%Cap iUsed iAvail %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %10lld %10lld %10lld %3s%% %8jd %8jd %4s%%Usage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s ????????????????????????%'*llu %*llu %s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)ifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot close file descriptor on %sCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ...  0EAZUj# _^F<>?PATH= tHf/dscml r;3pjn v  b   EOF reading here (<<) documentkb $+/3:A\ }-+?=@%+18B@v$  abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'`p(0A p(1Itp(1OLp(8Yo(0g4p(0p(0 p(00p(0#d  Fq|+ze ¸.m c  KdcE w !hwv$                  ]\;\<z ] Ax!jH. NH`S0W!(V(ܽ\`4@cL@kWkksXlcLx/[8_6hPZ8d$:$a%$(>Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directoryerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcfrsuv [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dCannot continue job (%s)[%ld] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%ld] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%zu more than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchp:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Illegal number: %sCannot set mode `%s' (%s)HSabtfdscmlrpnvtoo many argumentsunlimited%-13s (-%c %-11s) unlimited error getting limit (%s)error setting limit (%s)internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeIllegal number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultIllegal option %co %s+-Illegal option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Illegal option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Illegal eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sBad file descriptorCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# PS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... illegal signal number: %sunknown signal number: %doption requires an argument -- sillegal job id: %sillegal process%s id: %sevalreturnshifttrapbgchdirletfcinputrcgetoptshashprintffdflagssetvarumaskunaliasulimitwordexpPPID20181212 BUILD:20240511144838Z SMALLNETBSD_SHELLUsage: %s format [arg ...] incomplete escape sequenceunknown escape sequence `\%c'format %s too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed n[ c   8-:m|=(===<_Jh<=>P>o??<i?|0?4@Nh@A?=<,`?pt??BFJNS#R3[#Z3b2a3h3g# @@325=LTE @;%, C$CC$C;r }@!@ ) wo@ \cjqy @option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gTIOCGLINEDtcgetattrTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.%8Zg=,'/7@ @=@E@L@T@]@b@g@n@} @s@y@@@@ @    ) 0 6 < B J O V ] g m s z    MR  o!s!x!S!!!!!!!!!#!j!j!"_T           N 6T ! !!!!#!'!/!3!j9!D!S!_! R &-4=DMRW^gow}  o!s!x!S!!!!!!!!!#!j!j!"_T           N 6T ! !!!!#!'!/!3!j9!D!S!_! o!s!x!S!!!!!!!!!#!j!j!"_T           N 6T ! !!!!#!'!/!3!j9!D!S!_!changing %s byteorder to %sline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environment%s: unknown machine typeattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes failed to read bootarea from sector %uread sector %u len %d looking for labelno space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] 0w+,Usage: %s device %s device command [arg [...]] Available commands: rwnot %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. forcesuccessfully scanned %s. %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s Wedge dk name too long; max %zd charactersunknown command: %sstrategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s'unknown command `%c'@nJJJJJJK5K K K K K L'L>LKSLrLLLLL M#M;MWM sM!-#-$M&-1-2M3-4-5M6-8M9M9M:M;M<N=(N@7NAKNBNCNDNENFOGOHOJOL8OMIONPOO`OPpOQOROSOTOUOVOWO\OaPc#Pd^PePfPgPhPiPpPq-s-t-uPv-wPxPP Q5QTQaQvQQQQQQR,RIRaR{RRRRRRS#S?SYS_SxSxSxSSSS!SSSTT%T0T----:TRTdT}TpVTTTTTT U-U-U-UFUeU|VUUUUUVV;VCVuVVVVVW@W--tWyWWW WW-WW-XBXUXhXtXXX/%lu/%luusage: %s [-aBFfIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1Can't read %s partition table%s partition table invalid, no magic in sector %lldsecondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld decimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. realloc [n] write_disk(); wfd == -1Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Sector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsExtended partition busyExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitiongiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafiIluvA:b:c:E:r:s:w:z:bad disktypeBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s size (%lld) is not divisible by sector size (%d)DIOCGDEFLABELCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]_T           N 6T ! !!!!#!'!/!3!j9!D!S!_!returning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo blockUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFbadCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directory%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 Invalid long filename entry for volume label RemoveInvalid long filename entry for %s %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersInvalid long filename entry at end of directory %s No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  mmml        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s CLEAR (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %lu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %s** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** starting CAN'T CHECK FILE SYSTEM.Alternate super block location: %d conversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'MISSING '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%ldcg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONG (TRUNCATED)TRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****cache missed %ld of %ld (%d%%) cannot allocate quota entryffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- )W`¯%8M_s &X& & & &&,&H&`&x&&&p&&&&&<&0_T           N 6T ! !!!!#!'!/!3!j9!D!S!_!@nJJJJJJK5K K K K K L'L>LKSLrLLLLL M#M;MWM sM!-#-$M&-1-2M3-4-5M6-8M9M9M:M;M<N=(N@7NAKNBNCNDNENFOGOHOJOL8OMIONPOO`OPpOQOROSOTOUOVOWO\OaPc#Pd^PePfPgPhPiPpPq-s-t-uPv-wPxPP Q5QTQaQvQQQQQQR,RIRaR{RRRRRRS#S?SYS_SxSxSxSSSS!SSSTT%T0T----:TRTdT}TpVTTTTTT U-U-U-UFUeU|VUUUUUVV;VCVuVVVVVW@W--tWyWWW WW-WW-XBXUXhXtXXXSFH0eC0TSFU0eC%!Hah!IdontNeedEFI/4(s*K>;>|nQn- q+IU|nQn- q+dn|nQn- q+{|nQn- q+|nQn- q+=rGy=iG}þξ;Mt?پmWC 3KOOyD<#*=(3Dh&!\ M}-4E-чH!V-чHjkZIчHIчHIчH߾2IчH_TS'@ )Ѹʿѿ*1@ )ѸS!1x )Ѹa:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuidCan't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:partition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size]New size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverError reading backup GPT information at %#jxNo secondary GPT header; Run recoverNo secondary GPT table; Run recoverDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:sector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidGPT_HDRgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapssetifnwkeysetifchansetifpowersavesetifssidsetifpowersavesleepsetifbssidsethidessidsetapbridgesetiffragsetifrts(&&&&&* &ą@&&D&4&w&wD* &&`&T@xxsetifprefixlensetifflagssetifmetricsetifmtusetifnetmasksetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandusageprintallstatusmaindo_setifpreferencedo_setifcapszi&Pyi&&g&&x&&t&H&|&D&&&&|&|& +@7COW `0i@r{_u @# init_current_mediasetmediamodesetmediaoptsetmediasetmediainstAO LO`W_@W_AOV, media_statusmedia_constructor%.aX&.aX&a.a.&8.8% &7.Ma<&Q.Q&paddr_matchL<`JtE`JAJCK8;`J:`JEsettunnelaN&g&print_link_addressessetvlanifsetvlanyh&AL&~WƨSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockSIOCGIFAFLAG_IN inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeNONEWEP40WEP104TKIPAES-CCMPAES-OCB%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211BSSID/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211CHANNELSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: BSSID too longmalformed BSSID: %sSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS CFPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM ???unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAaf_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6link0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtype [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] mediainstSIOCSIFMEDIA mode %s instance %d media: %s status: supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno networkno carrierno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctlSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@ě@˛כߛ  %;Lat @@ffs %s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousautomountedextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdupJTuk+_  _@fmr{ bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.JTuk+_  @_q/@͛@mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %sreloadJTuk+_  @_͛@q/@softdepJTuk+_  @usage: mount_kernfs [-o options] /kern mount_point "%s" is a relative path.kernfs on %sJTuk+_  @_@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %sJTuk+_  q/_@S[! '@07?EJmN @jpTy @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s_JTuk+_  @usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o Gn F';[9Y,Q%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%uCannot resolve "%s" (%s)%s only supported with IPblocksignals: sigprocmask%s (%s)0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()PXsTsPsPLsHsDsP@s %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Checksum error %o, inode %llu file %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%llumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY]]]^,^U^^^^^_3_e_____-`UPBROADCASTDEBUGLOOPBACKPOINTOPOINTRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printbitmask_scanqq@qq@qr@^r@q$r@2rDr@QrWrfrtrr@rrrrr@rr@rs@rs@r0s@, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpfetch_url,Wysendrequestrecvrequestƨnrvz~***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbervbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20170803malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gzQ&Q&Q&S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: filename expected%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: extra characters after \ at the end of %c commandw commandread commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-iO @.ʍ{.׍ƨЍ.ߍƨ....?J}.gv|..ƨ.ƨ.ƨ.y.F.Ďˎ(.Վƨx.ߎ.z.y."Ԏ."}.-.6.DL.gr~..ƨ.ƨ...ƨ.ȏ֏..ƨ7.ƨ6.ԑ@Бl_T           N 6T ! !!!!#!'!/!3!j9!D!S!_!NAME=mount_disks       !"#$%&' str_arg_substget_available_cds_T           N 6T ! !!!!#!'!/!3!j9!D!S!_! edit_fs_type_ext 5 << p X ( P   0J c s edit_and_check_label _T           N 6T ! !!!!#!'!/!3!j9!D!S!_!disklabel_freedisklabel_change_geomghx([ q r u j u d` ^ s 4i a p^ l^ (z j Hn l a Z ` xu $f d Z Y c _ _ _ b ^ disklabel_set_part_infodisklabel_write_to_diskXn outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var normalize_clonesreplace_by_defaultب.... !"pm_from_pepm_whole_diskgpt_create_newLL[tZ[YTYSLN(O8T,SXcIKTIOIPI(z Lgh g;>|nQn- q+IU|nQn- q+dn|nQn- q+{|nQn- q+|nQn- q+=rGy=iG}þξ;Mt?پmWC 3KOOyD<#*=(3Dh&!\ M}-4E-чH!V-чHjkZIчHIчHIчH߾2IчH_TS'@ )Ѹʿѿ*1@ )ѸS!1x )ѸS STQ! !A1LQU;K[ n|inside_ext_partadjust_ext_partmbr_init_default_alignmentsmbr_create_newX" "LldwwwLԀPl}p~(z ԪTlyp<,zd}ph̜mbr_get_generic_part_typembr_get_part_devicembr_freembr_read_from_diskwrite_mbrmbr_write_to_diskmbr_add_part/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6) [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 9.4_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksmount point (or 'none')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-9.4_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-9.4_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-9.4_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-9.4_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsSwitch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Bootable flagSafe eraseUndo changesUnconfigureEditForce umountAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionCannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (ADI_BRH)Kernel (INTERGRATOR)Kernel (IQ80310)Kernel (IQ80321)Kernel (MINI2440)Kernel (TEAMASA_NPWR)Kernel (TS7200)Kernel (RPI)Kernel (KUROBOX_PRO)There is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] [-p] where: -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -r release override release name -C bg:fg use different color scheme -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog9.4_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-9/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/9.4/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filesysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)%s (%s, %s)%s (%s, %s %s)-t -o disk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2 %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %d %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.craidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi/boot/dtb*.dt*./netbsd.ub./netbsd.img./bcm*.dtb%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10schpass -s %s rootsource for 3rd-party packagespasswd -l rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousdisklabel -r %sinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %spartmanlvol%.2dvg%.2ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%lliPartman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.c/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c%s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEparts->disk_size > 0parts != NULLgpt destroy %sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt %s %s -b %llu %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1138: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1100: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2100: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1743: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1773: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2067: internal errorparts->geo_sec != 0t != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2198: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI Boot***************************************************************************************************************************************************************************************************************************************ƨnrvz~usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_handle1control_handle_datacontrol_writeonedhcpcd_reportssiddhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1z();dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_geteloop_event_add_rweloop_event_delete_writeeloop_q_timeout_add_tveloop_q_timeout_deleteeloop_exiteloop_requeueeloop_signal_set_cbeloop_signal_maskeloop_startxsocketif_discoversplitvadd_environparse_optionb<c_udMefQgvhijk]lmgnonpqяrystukuvwxzGcyABCDEFGHIJKL, MNOPQXS:T UVW)X3Z1B4K6F|~T}_]fvkěqU | $I*08=MVdefault_configread_configrt_compare_proto^^D\D\rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtX]X]rt_buildrt_delete \ \sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initsa_in6_init-}z T#| make_envscript_buftoenvscript_runreason0123456789abcdefdhcp_envoption2Y 8Rt9Z&S|!<b  6Tiii0Kq$ =[Dj!if_copysaif_opensockets_osif_routeif_initrtif_ifa )( PT@P HEPT$ @DCread_leaseget_leasedhcp_openbpflog_dhcp_jvdhcp_bind2*I dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_readbpfdhcp_readudpdhcp_recvmsgdhcp_dumpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1ipv6nd_rtprefipv6nd_applyraipv6nd_expireraipv6nd_handledataipv6nd_recvmsgipv6nd_handlera        p !        dhcp6_checkstatusokdhcp6_validateleasedhcp6_openudpdhcp6_sendmessagedhcp6_writeleasedhcp6_startrenewdhcp6_startrequestdhcp6_startrebinddhcp6_startdiscoverdhcp6_startinformdhcp6_recvifdhcp6_recvdhcp6_recvmsgdhcp6_start1 '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_dump/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: connected to Access Point `%s'%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version8.1.9--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 8.1.9 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-8.1.9 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware addresseloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.cread_cb != NULL || write_cb != NULLwhen != NULLcallback != NULL%s: SO_RERROR%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption `%s' does not take an IPv4 addressinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argumentunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleteddeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinTESTSTATIC6ROUTERADVERTUNKNOWNPATH=%sinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=%sif_down=falseif_up=trueif_down=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid=%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'%s: executing `%s' %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%snd6_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtsrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_USELOOPBACK%s: SIOCGIFALIAS%s: if_addrflags6net.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6fwetapxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: %s: truncated leasebootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s not foundNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: timed out contacting a DHCP server, using last lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: dhcp_open%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: %s: short frame header%s: checksum failure from %s%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired, extending lease%s: DHCP lease expiredDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired address %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %snd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_addr%zu=%s%s: delaying IPv6 router solicitation for %0.1f secondsreachable againunreachable%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.cdelayingunicastingbroadcasting%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f secondstimespec_to_double(&state->RT) != 0%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: DHCPv6 DAD completed%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: ignoring unicast option as not master%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to request information%s: DHCPv6 lease expired%s: failed to request address%s: failed to confirm prior address%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%05d %s%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6DUMP6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B+ " "1 "7 #\$#= D#_ d#M#C #a8#h #I $BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~X t&\   e   +  1 7 \= _ MC a8@h I |7!x5!t3!/etc/group/etc/master.passwdJPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pid !#$*0- ).+(/, '!% #34 :./, .   :       , /.       .  .  .=                               9%'A)*& , ./(&-0;51234<=>?C"DEFHGB$21678 !"#6$@8&&&&&&&&&&&"""""""""""$$$$$$$$$2222221222111\+GU9U   +: januarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresv0%llo%lld0x%llx%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME/usr/share/misc/terminfo%s/.terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist