08BOoj<  BOoj$-t tBOoj@@<@T 08BOoj<  BOoj$-t tBOoj@@<@TU BOojt`ABOojBOojBOojABOojBOojBOojA.BOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojCBOojBOojBOojABOojBOojBOojABOojBOojBOoj$ BOojBOojBOojmCdBOojBOojBOoj (08@HPX`hpxh $QBOojBOojBOojG$\BOojBOojBOojH$OBOojBOojBOoj (08@HP@$QBOojBOojBOojX`hpxF!BOojBOojBOoj aBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOojaBOojBOojBOoj aBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOoj!BOojBOojBOoj4!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj B!BOojBOojBOoj B!BOojBOojBOoj!BOojBOojBOoj"!BOojBOojBOoj"!BOojBOojBOoj"aBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOojaBOojBOojBOoj aBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj?\!BOojBOojBOoj>\!BOojBOojBOoj=\!BOojBOojBOoj<\!BOojBOojBOoj;\!BOojBOojBOoj:\!BOojBOojBOoj9\!BOojBOojBOoj8\!BOojBOojBOoj?\!BOojBOojBOoj>\!BOojBOojBOoj=\!BOojBOojBOoj<\!BOojBOojBOoj;\!BOojBOojBOoj:\!BOojBOojBOoj9\!BOojBOojBOoj8\!BOojBOojBOoj:\!BOojBOojBOoj7\!BOojBOojBOoj6\!BOojBOojBOoj5\!BOojBOojBOoj4\!BOojBOojBOoj3\!BOojBOojBOoj2\!BOojBOojBOoj1\!BOojBOojBOoj0\!BOojBOojBOoj7\!BOojBOojBOoj6\!BOojBOojBOoj5\!BOojBOojBOoj4\!BOojBOojBOoj3\!BOojBOojBOoj2\!BOojBOojBOoj1\!BOojBOojBOoj0\!BOojBOojBOoj2\!BOojBOojBOoj/\!BOojBOojBOoj.\!BOojBOojBOoj-\!BOojBOojBOoj,\!BOojBOojBOoj+\!BOojBOojBOoj*\!BOojBOojBOoj)\!BOojBOojBOoj(\!BOojBOojBOoj/\!BOojBOojBOoj.\!BOojBOojBOoj-\!BOojBOojBOoj,\!BOojBOojBOoj+\!BOojBOojBOoj*\!BOojBOojBOoj)\!BOojBOojBOoj(\!BOojBOojBOoj*\!BOojBOojBOoj'\!BOojBOojBOoj&\!BOojBOojBOoj%\!BOojBOojBOoj$\!BOojBOojBOoj#\!BOojBOojBOoj"\!BOojBOojBOoj!\!BOojBOojBOoj \!BOojBOojBOoj'\!BOojBOojBOoj&\!BOojBOojBOoj%\!BOojBOojBOoj$\!BOojBOojBOoj#\!BOojBOojBOoj"\!BOojBOojBOoj!\!BOojBOojBOoj \!BOojBOojBOoj"\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj \!BOojBOojBOoj \!BOojBOojBOoj \!BOojBOojBOoj \!BOojBOojBOoj \!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj \!BOojBOojBOoj \!BOojBOojBOoj \!BOojBOojBOoj \!BOojBOojBOoj \!BOojBOojBOoj\!BOojBOojBOoj \!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj\!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj$!BOojBOojBOoj4!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj !BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOojaBOojBOojBOojaBOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOojaBOojBOojBOoj aBOojBOojBOojaBOojBOojBOoj aBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOoj?\aBOojBOojBOoj>\aBOojBOojBOoj=\aBOojBOojBOoj<\aBOojBOojBOoj;\aBOojBOojBOoj:\aBOojBOojBOoj9\aBOojBOojBOoj8\aBOojBOojBOoj?\aBOojBOojBOoj>\aBOojBOojBOoj=\aBOojBOojBOoj<\aBOojBOojBOoj;\aBOojBOojBOoj:\aBOojBOojBOoj9\aBOojBOojBOoj8\aBOojBOojBOoj:\aBOojBOojBOoj7\aBOojBOojBOoj6\aBOojBOojBOoj5\aBOojBOojBOoj4\aBOojBOojBOoj3\aBOojBOojBOoj2\aBOojBOojBOoj1\aBOojBOojBOoj0\aBOojBOojBOoj7\aBOojBOojBOoj6\aBOojBOojBOoj5\aBOojBOojBOoj4\aBOojBOojBOoj3\aBOojBOojBOoj2\aBOojBOojBOoj1\aBOojBOojBOoj0\aBOojBOojBOoj2\aBOojBOojBOoj/\aBOojBOojBOoj.\aBOojBOojBOoj-\aBOojBOojBOoj,\aBOojBOojBOoj+\aBOojBOojBOoj*\aBOojBOojBOoj)\aBOojBOojBOoj(\aBOojBOojBOoj/\aBOojBOojBOoj.\aBOojBOojBOoj-\aBOojBOojBOoj,\aBOojBOojBOoj+\aBOojBOojBOoj*\aBOojBOojBOoj)\aBOojBOojBOoj(\aBOojBOojBOoj*\aBOojBOojBOoj'\aBOojBOojBOoj&\aBOojBOojBOoj%\aBOojBOojBOoj$\aBOojBOojBOoj#\aBOojBOojBOoj"\aBOojBOojBOoj!\aBOojBOojBOoj \aBOojBOojBOoj'\aBOojBOojBOoj&\aBOojBOojBOoj%\aBOojBOojBOoj$\aBOojBOojBOoj#\aBOojBOojBOoj"\aBOojBOojBOoj!\aBOojBOojBOoj \aBOojBOojBOoj"\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj \aBOojBOojBOoj \aBOojBOojBOoj \aBOojBOojBOoj \aBOojBOojBOoj \aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj \aBOojBOojBOoj \aBOojBOojBOoj \aBOojBOojBOoj \aBOojBOojBOoj \aBOojBOojBOoj\aBOojBOojBOoj \aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\aBOojBOojBOoj\ !BOojBOojBOoji!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj aBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOoj aBOojBOojBOojaBOojBOojBOoj aBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOoj!BOojBOojBOoj!BOojBOojBOojaBOojBOojBOojaBOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj!BOojBOojBOoj B!BOojBOojBOoj B!BOojBOojBOoj!BOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOojaBOojBOojBOoj!BOojBOojBOoj!BOojBOojBOojaBOojBOojBOoj aBOojBOojBOojaBOojBOojBOoj aBOojBOojBOojaBOojBOojBOojaBOojBOojBOojBOojBOojBOojbpf!BOojBOojBOoj $BOojBOojBOoj$BOojBOojBOoj$BOojBOojBOoj$sBOojBOojBOoj$BOojBOojBOoj$BOojBOojBOojABOojBOojBOojmBOojBOojBOoj$2BOojBOojBOoj $BOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOojABOojBOojBOoja7tlcFTm Y,yuTq=Q)HVɮglKQ?e$iOJp@ j.oO:`+!&0aI|. VE4uNF3i| Y!I O_igdv^_8b:yPv}Dd=YjXLF\G t> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=vt100 export TERM HOME=/ export HOME umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? echo '' # mount the ramdisk read write mount -u $ROOTDEV / # mount the kern_fs so that we can examine the dmesg state mount -t kernfs /kern /kern # run the installation or upgrade script. sysinst || stty sane fi  . .. catchmod cp dd df ed ln lsmkdir mv pax pwd rmrmdir shsttysyncchgrpELF(4 4 (pp```t L8```NetBSD5 NetBSDearmv7hf9L H D00-0 LS0(PPP@CP03/T0,,Tt pp0 -L@0T( R@ppGppP`03/T0@S 1PQt -L MK \!X1 PR`00: 81 0S  /S 0SP fgB00S5 0 0S*ppp@Cp03/TOg 0 0S*ppp@Cp03/W ^ fL d0 00T0  0 CD~D$Xt0l@%JIHLNLT 0I F 5G=DO-1F :=FT,AF0F4г&*(18@BC Kn:f*oB² *IQ񇺚mQeppG x-O'PNFXO TFkh;k`+(F$AFл J3h3 ,-ѸTOsh+>гh ,$7QF0FPFX5h+?%h#@c`.3Сh0FP0 &I%&H( O?$K9p59F0FPn0.5h-+#I%H!HP.F(ѡhHP,I%H HPp0!FHx(%0+.(F! T  K-OhFHPI PF IH$ F5FjPPAF KX`h+KhKh{Kh O +@Kh+8ЛMJI(F W+]+d+ }+p++ +pN0h#L(h42h"FIFHHpoph%5`(Oh` K $%`KE г+ FKhXL"h0O\h#`(F " I HB( KJ3#T3  pDML.i*aUTF*px\+ pGO0pGO0pGO0pG-CF$M$O`+hB4"Lv8h#h3#`4hFIFHhH#h;#` Kh  Z#h`;8`#`+Khԛ+h :hY)`B#o MгX KJ-A$FK 7hhB`Bȿ3Oؿ#EV#@BџBOȿ3ؿ#h% K!0 Jh KhhBT#!3(`` 0 lK-OFFx 0gKhIh3(v)FIF(o$_N\O((F0`-tBF@(xxd(FT, *F+PKI3(!F(8 Bv4030@BF4D!F (S4h<6IF6H^6H0;0+2Kh5 lF 0#` 0*H+(I3r( &H&Kh<`;hx+?y@(l(g1hFF(]Y 0;0+Khԛ@IF F22. $p MгX +++  p$MN+h0h3+`K`K`K`K`+h4`;+`[ Kh l p -GF'L#hx - -$H oF(#h||xBM3#`(h-hF0B F(F(0# #"!i#QFF0F@ B5$h F(ں + Kn:f*oB (IOjmQeppG x-OF$0+\8FF0cѻ`+` fB򟀴đFOz  D0QF30(u4 hYIFYHXH_0;0Y@ 0`;0+MKhKԞ0UHK"`4{h;{`+8F"J;hZ:`x - B@B&F6D01F30K(3hz+IF+H+H0;0+8'Kh 60;0+KhԚ -KhUK"hUKhKh>້[3h: IF H\Ho0F< K "hU"K`&FMгX ,< -OFPMFOO+hMK#+`;`KKhF IJ$IN#F0EU,SкP+M>I>Hb;h+R*h*OE`4Q"$*`I6K2hh22`3h;3`31Kh o s2h:2`*$JhԒDFhFF(+h+E;hZIH,E*hC ;`h*`$4 F,ѝ < p г&, 8,FxF!+"I0DF3h?"FIFH`Ho-]I1F#x(F!+x3fh"F IF H< H": Kh#:F IH.KhOгJ,a, y,p OF FB ;h)F |(3(hIFHHfo< Mг~,-OFFF FV KhF Kx$tt%h+8F$B4 F# 3iB   "T3F8F( 56hDEE0FYF(o< -AFxFFF!+%I0fF3h`*F IF HHo/~1F:F!F+x0F!+x3h:*F IF HZ H"X Kh#BF IHN <4 F=г,, y,-O%RN,Ftlsh;s`+>0F"?Fk lBK۵FOFOxD;hAF3;`P3,h` MгX + -OFFFF'HR%'DB 605BI%H x ^+\ &x1FH/X 5\(4 500 x00 x00 x,x,1,%,#J8Ih# `jFN( ۽0+;J`0+;JS`] ht@% Kh J K ``hhB*JhBH)o -OMF,h|O O;hB%4$ F FBF0+ #"#FYF0FP F,̿4K"`h;`+f hRTѽ&RF9F w8h;`+=o0)F B̿j2Fd(PFi0BF18FaF(F]F;h 3`;hB^`00Կ#0ȿpȿ3DK`#h q (F/F8F+F p -OF3N0h2K2Jh3hF`BF ܥB -6+L'.E,%hHF3`Fxh;`+6#h . rB߱#0h;`##hԛ6.F%0F 8FFF( o p -G F)MF FF h.F3`xh;`+;+h 3 M7+hB̿` {F8FwKhFIFh+h4K",`` K`h;`S0hѽo p -OFbKFbL&hB̿H 6F@F2FUE+ZMsh,FB{۶7FhOw7D(i3`9FL(_2h{MIFMHLHh;`+@+h+(F  05-HM+hx +5FKh+hxP1@ *AH 3+` *!3(` x!+0(`(4L h0z h/H/L,q&F/4wh09F3` 2hP%IF%Hr%Hh;`+#h  dh,q;0`##hԛ0#+hx ,# p](0Y)`QxT $a- r- MгX-CKHhFhFKf2`v ,%)`xh.BQ.a(E.!.$=. .ѪK `KhD#(K"hFr`H.ʂP.G.8Hc. W.a.܀V.e.~Ef.g.q.Ll.,$j.N@Ƃ0h*`_x($*hSxn.p. l. +`x +@9Frn.~/p.wKhF(")hKxn(p(l(+` x +@Bu.~Cs.J@dKhF(_NaLv(^Kh+'h/`ZKhB[$*hSxn)Ip)>l)@+`x +MNKh e8F[w.Xx.Ѕz.D>K `>KhDL(H+hx1;+Յ26& "3I;L`(h `@80@ą2&h"+@3Hh&`&$*hSxn)p) l) +`x + *HUD+`DD Kh  Kh(rooN1hF($*hSxn)5p),l).+`x +Kh KhKh~(0h$ p L. %--D+`DDN1hF($*hSxn)&p)l)+`x +љKh KhKh8(ەJ3hhB33` FD+`DDI h)I4)𢅉I h)݈HX[x320\ԅHPrF(?c$*hSxn)4p)+l)-+`x +;uK h(LM(E(o3x3!+"1FnH03xgN,0[jHD+`DD,6!0F}(YK"`O3^J`^J`VI h)[x320XF(?x!+TH$*hSxn(p(l(+`x +Ԯ x"FH/DHSD+`DD3O<@1D#@1&NhDq3` cFh;`+߫3h X֫ DB (hD{#DqH1h;`#3hԙ< O@1:h#!I4(  +!.-( C@1@1@1A@1# @1+hxn*6p*&l*-ЦKhFn(j$*hSxn)0p)'l))+`x +B;h Z)<`K``K`*hSxn)Ap)8l):+`x +YM, B;x!+"9F,/;x+,0+?POLKMJOHPIhW.Fh8F(0BIK" (D+`DDh+?41+q1Kh+?+hYxn* p* l*)`x +Z0HX)`")hKxn(p(l(+` x +FKIh&K hhDBFB+`BB$*hSxn)p)l)+`x +" Kh KhHD+`DDKp  = :.%z Kh+?;($*hSxn)"p)l)+`x +٩M(h0(h0RK41+UHD+`DDoDo@O4< f @'HS+]pG@ 0Ix^+0x]+0x]+ +[+Ax.۲+ % F/FK],ъB0 ,"F 0FK-GFhF/F;xB +6AK}(!FBa@B.F6D,01F30F(;1Lh1IF1H"0H0;0ù-Kh [+\+F(: M0 KhӹPK$1F0`Kh@'J040Q0A AF0(1h; IF H\ H0AF +@ .4 8 MгXlJ-OhFkLY`Yx%)@ĀxQE@!h3`cH h  # : ` 2YJh񗀑2hQ1`!hxYD *,32hx)@:2`NKhB"@BD.F6D h01F30(QBK ``0;0+=Kh^ԛ+x&+_  B  #F FE9hD5fNRrF3h33`20ha^IF^H]H3h;3`+o FTKh  o3h ;3`+IKhԙ\T3\+Vkx 1)P0;BLDX B 6#FFE9h2UF1MRrF+h3+`0Bh(IF(H(H+h;+`+h ;+`+KhԝՓ\T3FB@BM&F6D+h1F3+`(+h`;8`+`; Kh?l?n UF;hU44 MгX| -O}FF F#co Kh# #"!i#i"XF# F0O PF }FN`Kh5B@3 ECT0h 2 r F 0h>IFH`H : *рKh  OvK0`` : *uKhԙ0+# " F0h!F8D.\0BF F.n #D!x! C #"!F XFJ(?{DUJ h  ETFOy  0D30FKIFh(b0hAIFAH@HA0;0+?x0 E59K0hh 2`rFY 0h(IF(H(Hh:`G!I0` `h:`:!Kh?B?D0+# "IF F0hJF!F8DGF.]`0;0;Kh? ?"- #C H | MгX . Kh+# ")F F0h*F!F8D.pJ3h# + $-ODLOFBJFBM&hhF;#`@K hSE &`ca:H{ h0 `{:FFC o>!hF(,Jh +hO 3+`0FF+h;+`+#Kh  "hF?B+h;+`+KhԚ&h  XFFF(:F1F0FD( p ,| YJ-OhFWLWKhF!h1ch3SHo PO;hPK"`ON 3h33`S 'F<-; "o   ;wB  U?Kh q#h0#`ch0c`h;`+X5KhM  X) .Qh ` Q` FZXZPBhQh `Q`h h :D`Qhh``q`hHh`P` =?i cp % .t -C 'M.F+hihZPF J#3`Kh`JhZ`S : ;(њh\h1`DE F FLFt p % -GF"MFFC.F*hBd3 ! F`YC)F3h %t`HFkC D4D8F``Cb2`4 F0h:IFH\Hhh3Dt MгX2IFFH@ /гK-OFh]F FFYhJK)FGH)FHr ]pCO04#`oOb)F .oC0$?# FK(pCOгhS FK|(pCO3hkh[+x/+3(FKjH)F* FKzF(@3h+@!F(F/(8"F)F}H (#FxJOavovOb!F . F(OajJ ` `K ()FdH/!(F(VG/! F(QAF8F/옻 o.ڨ o)ڽB W>.#;*8FKFDE>.#; x8F zAFK逹*Z#BB.#ZBB?3iC%si F+dpCO^K(x!F /FFZF)F8F.V 0RF!F8F.L i+]йZX@F, "F$IX{h;{`+8FF@F (0( YIHVXX9)*  #kB8Fm #REs # BB8#iB8F#BAh#0A_Ѱj !BFoIOF1CBF  A  YAdKh+pbKh)Di !`JJ ` \Kh)?3j !ZJ> l XF.2BFPF.*BFFOJhpNIRF.BF3DFF iF(ѳ0jF(Ѹ 0YF0`QF 00Dp`x2JhJ)F00D`n(Fa3+K EhP$OsEu F)F.\%J!.!Kh,+?xLCEsD,n4!J4.Kh1+?LCEsD1u8B33w8 9)( } 8< VUUUSK-OFhFQJF+!F"FF (!F HKh.(FOJDO;h#Ov(FFx/&h(FZ/ `/h+_5IP0;+R#kkEkjQkjjQk\(H`j\F$H#0l;\0.+Kh+03 0ñ!jH1F(FjF F\:h*+"!F(F<!jXF# 0 e E ;0 <0-GFhF0KLhK*FKhUOsLq+"F F F"8 , ^,00< 00 Kn:f*oB (IJ&mQeppG x-K*LcFF(F B"Khc4B IgL EyۻlBq4B 4B0 pC O س_гO I * @O г`O% / m | @ = 9K-GFhFm,#4HdF3Kh۱3Kh+6# ! /I!0,I JAF*HDD)Kh(Kh+30F9&KDhC%KhKhpCOѨhD FKOhK*FKh< OsJq-F F8FAF K0Fh0 1 , ^,0 $ < 1 8Fh8#+**j Fj_ h-GF ,KKh FY&hO\\ #+*;hm+#jwH0#FtKFh+ "O ,KoJCS!B20jI !jhH|h@i"kHFpbKh+ k`Hf j]H`\Kh+ ajZHXh0C_\ѩjVK "VH3ɲ C##lk@PKh+l CMKhLKh+j0F-JKhh;IKh3pCOhpC O0FF h[>K-J=K FF;Kh< OsAq-F FPF!jx I# h ! I!0?^akH#IL#Hak`FKhK0FhF 0 1, ^,0D 1( F'1  $ < 1 1JK-OFhij3DFKh+EKhck3DCKhCKh5BO5:hE FO#jIFFHL j1гI F+J,L,IPh+J( F F)I)K(H!F x I"0I"H l"FQIH"""IHIPLJ FKIP"0IS I"* IH 111L1 11122-O FNF-h!F(FIF(.h+"F)FH '# FIF(h (FI H)F "FIHO{h;{`+C8F?FA'8F;3i+! FI( FIF((FIF(2O) AFK *FrAFF;F !wIrHN;hZ:` {h;{`+ HFC Ѹy?sY?o;hZ:`x (sh+"F)F`H" FI됹 FpCOIl0 (!FVHkI(FIF)FQH_pCO@F(FI@a FIEH!F 8@FI1si3O O !@FI w)F4paFa( @FI8FZFi8FI\E !F+H  FI8(!F'H 3h Jz+0#HFQF##3`A 'x###F*FA I H{{z|Y@H D#2 г ^,1-2EI2 Y2~ 9F@F0!F1H @FIh 0 @ˌ$ˎaF8FI!F&H 8FI`.Ph+!FH z#@c8FI!FH l58FIH.6h-+5!FH ^8FI$!F(FI)F H^wh/?q"F)F Hi!F(FFd d2r222Y2EsFhFFFI( I 'K(F`I!FUIxHHp罱Ij F!LIfHH#"F1F0F( I!IR F)FLIL 3%33)33M?L'ch+jF-`)h`ORKOBXOHO 'OC3`X  +O S8%h ؁!@*]!&]!04&J4e4&! 44m8@!! &BFKFPFYF,LxI9C'3`-2hK Or-?s-" N Kh/:FPFYF,(CK7``c &!! KMi+ Lch+OBiFhH(`` Mh %#LcbKi #"#h,( FsF .: Jh O0hR(%h 4 Ki* I O0h(K JIhhh 4@!!5FFF$*F1F8FH(-D-D F,FFFF$*F1F8FHd(-D-D F,F FKF\hF,M9Fh+i+HJ#k`hB`+` FHr#k`t`D-j Jh j FIz%h !X5y5FMMlh.F, FFhBFHO#kb{` F(h`#k`;i++7,R#sb(+#"#h+,(qhasx($t`#{`0-Jh+$t`-DhE+->h+(-6h + I  $l`-*h+-$h+- h+sj#,I ,Ѳj FI- jJh P KhYi FP! I vI%h 55y55\!6R65K𵅰 * 3LbhB2Jh:*1I O0RXh"`i*C**?!8"a`Z`ch+:%I h"IHr(#c``!Y`B݊BOv#%"h+h(q2F;F,<hg+X(qOv"Z` IV h %@*66m6(O-O FuFFO# #IHhF(9)!+(FqF)"E9"BqF F$+(q -$ Jh jO0a0+%7h -AF@LF`h%F(K>Ki+J+.qk:I .qb#O"h+(q -/Jh@F$O0`` a*sڣj+&I"#!h+(q3- Jh O0h`K.`w0F9F,NCII#h0HV(-Jh # k`%h G7v777!3m7K-O]LhFF X *F {ILV#cFFY F"#F#rKhF*90+р葀!0F##jJTVhJ BF,CFeJOq8FBbJ3FOQ:-@]J]I Fh ]0ӱVK!0F##MJRJOQ ꌨ,쌩F Hl0+IK!VlHJ 2F@F,3FH103L YFF8(Q ++hIB FlG(1K#L F(2? F(: FP('! F(!#y/+ 8H+bIFH%$K2F F;FKd0[,6Jh |+hjG"I G I#L(\!]!! ]! ]!x  >؂!ԁ!-O( /O;hlG(;hjG(( *Kh[KhGR,Jh Kh˹LV 6};hjG"I GT| (ڶM)h +;hIB FlG(U#I F(yKS# F(uKhKtHG UU#0nKhӱkHG쨹jK h #BqdK#BA FH(! F( F+XK##y/+ 8OH+NQIFH%X0MKhFHG츹0+iGKh;#Bq?K#BAz0S!]!؂!ԁ!ȁ!! ]!!x!h! ]!Ԃ!!!H*!!!Ă!$!0H0K"`z FĠ0˹ F'K(Mh(>U#IP%;h)F FlG0F)F F0CM+h+Kh#+` K#K0+?Yh+?UKh O ]!!!ȁ!!D*!-KLM,h".F($ F*hDB#h hDIlG(3hjG(?KhF3h (9L"hz8K9Ih9Kh8K"`m(4Kh+3MWu(F(8/I#L.(3hjGFF'0F9F(#hKhKL#h3KHh##` *(F"I FGA0+(F(۽Ѹ(F(\!6>!Ă!@!c>!!!]!!8؂! Kh+( (KhlG( @׺!\!-OML)@BO38F!h*@oF ї;/+"hI ~ h>>!]!!؂!>h!x!Ԃ!! ]!!؁!!ԁ!=!!Ă!u!! F iF F-ZF FYF( FiF FK8KLM#`+hKh[h+`*hOIOC KO0OsIK`K`KhR( K "h!+hD28(4 $ !\!?J?! &]!!KL#`Kh+KhOIOC O0OsIKh ( J #h!hD3 K(4 $ @*!{??]!!!KJ`OCJ`J`pG$ 4 &!TK-OFFPI NHOJPhFh0`(O9pGM@2FGr"FF*T;FCC1# DBsڠGF FFF#(V# c(0F FuDA20B/0g(60 D@D00 Ig0#cKg!(K"`HFm(0D02 I c!?!!$ !!@*@ &-C&Lch;&Kh+%I O0&*((K !N%OOO !h0h"(3hI`Ds`#Cu Ebh*5B I w(%( &@*:@!$ o@ FIh`FFF$ -OBCFXXRh۰FQFRBR[ 14#% #"*_Kh+5%HFFF(A./ؿOw !"  TKPFhTKhF4 lPK#BA,ZFaFHFxXE0#Cs#4PFF(+RAX?Jh(FO5+D3F;JOwh  vZF aFHF((+,A/JXh oO54Bt j(q1FHF;(O5(F[#BBAIX3F PFF( +AXJh 0D#BBA3FXÎ! &$ 4@@@ AA-ALhsOlN9h h#hI`+Dc`#VCwg(F0#`9("##K"O5`%$ &!!\!-sO#FF"#X  p8N$BOsyKFFDi`P/KhOy"FKF*FF jF1D@FIF(O0#iKFFIIESF+{(Oqq ](qPPE[Fq RF FhFD`kFF $ !!-CFO FF. @ ( +(ܭ-ؿF(FB0FFFAFHF)6D`$ -OX OJ(FFv(9(,ؿOtO @N"##{((QE{FGQF Fh(F"(-;+Kh0/+|;F(JOth @D!Jhhq!B` k{D!`Z  BCXKE:FI ( -J(q9F(Fj{#CO0$ 4!@BA-OFFK,(q($'@N0h~BC#DCyBFKF#3hF"Fqh)F#D`0B"#Bq,I "##('K"O7`%K!JhhB#DS`'8F,`(#-D*FCy3hF)F+D`KhYi)(F)"##@(02hBDr`܂!$ lA! &\!!8 Lh#hB eh!*+K`h8@P8$ &-AFN FO- @ (8h7(ۨBhAF(FFFFD)^-F#D`O0$ &-CFdF`.w ((Bw0FO4F=FF"F+6gF#D0O0$ &-G̰SFQFF 1"hFE)UFF1F(FE4M=I*F O0)F @E?*F6I(FOS(FhBkh@B j(A@B `P0Pkhj( K!Hh)FXki"Z`8BC"PBC"BC" APO@bD(*khJjhV#  BC"$D\!!EF!F=F@!8QF-CFhF#g b# G E FyO@JJ pЃkFuF:K-AhF S6IBF FN F&HU 5hS 3 #!iH!F(jt&K&I/F(F# Fs#iBCX;+تj FKѲ3 C "I CF I FBCX*  BI# FI+ B I!F Ă!M^,FFtFFGS 3F#;B(CX#HF7F FC&p!x 0?"hF\)FhF)F FDFB3x\ (*O +0 ,08B#FA,78a,W808B+0, -0H$ FT M,C;FO ,D/ѓB[ O0 0 ; -O04W4\pOD tFF[ 0! O04IODLtFF[ ГBBO O O0-KFBMx !FxF\ )>*GFO O B+0:Բ,OOE[u E|KlC?O O8_oIBXFaFEEWO % EeO $!@ A B#F F*O O O O +0 , O O Eu E|BA,O O Eu E A|a:Բ,O O Eu E A|O;O<;D,-ѓBPO0 ';/ .404W4\p Dt F)FP0!04IDAt)F FPГBB ! Kh, I FO2` F$$!F-A F0M!F)`.Ih.Rgh`?x-/ yO )O7 qyh `'q yK!F0FAEO!F0FAEaAFFGF%\:/"hCFIH?' Cx:+ I hBT"02 `+`8FCF"hIO7(h\!FгG pG hhE"s"F(z2 FA3oABFoB@B=xk*# b*x*+&x+$Ѓ F)Fpm*w*ѩAqi`AQBq3F FAQ) A10aCDBq !-Cx;#I ;O0FйI FI(W42h"3`s` rh`NFO +x+,!(F%F=!(F%F(I@F%F!G5Gp\!^GIHV .гuGKhQЂB`@* L!F H:!F H6!FH2!FH. гGHIzJsFF@JF`0Fp, *3 FrFK"`<)F"F'#3Up\!-OFdFO QF@FQF F(@F8FCFй /#cU);FJh 0FNFAKgq-O FF/! hKF`(D0`N1F@(JO K!`F^FFF``K'J!F(F C"ѹKhKh_UJ)+@I`*/-U@ F#h0z(8S }}}}}}}}}}}} }}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}A}}}}QU}}}}}}U}}}}}}}}}}#}+1}O}U]ae}i %)-1};-O8h^,K(`:h+I /@` &K`!Khx-*#JYx#``#K"KJ`KKKKh+H(ɀK"`"K`@!OO\!L!(&K@*!г(!^K$&]!0!]!tK!,!P*zK8!p\!KhK"`J#`J`J`OK Kh(E }KK KKJ|Ji3aKhKK}_GE XFOF ~ID @tIS; h K3tKhS` pKuJ^ptKVtKTiKh(?bhKoJMoKpJJnKoJGlKoJDkKnJAiKnJ>hKmJ;WK5YKh[K5jK/jKpTKhifK##fJ|&eIeKL"6cK`NKh(@I+@H h(@_ZK+"YJ`ܐ# h(8jK"`#BB6#B21\"0@L=`KL# ._K` #B2  ZI/ZIZH#YIVH (L#VISH "RITHeAKSJ;SK"`#B"mMK(FFgq HI#@@@POrCI#B"AK"`#B#=HB#KQF( O30PFD(0I  Kh(#B)K"`#B&K"`#Br!^K!!(]!!]!tK!! !Ђ!L*ML!!Ă!\!cLгyL&*#A!!LL!LL+?R#1N3hB"T#FW(ڭ3h33`(KhB'I =&KT%`(4!T#C(3h33`3hBK"` G 0L\!0!(!,!!Ԃ!H*Ȃ!]!L!.\!t)sM$!$&Khh`pGp\!8KhK ILhMh8 KHh(N@ #!F(F 18p\!\!MMг@!OOF F":`xD**9 )xB1%?*.x)[*+"!!F4x](6Ѭ! L E М+x !I h)O0/+=`+.5 F+Cx*++)F5 x+#:F F(?(Б-ё о]ІBvEؿ"B"!p hxD/.5FF(@o 3F ImO0p`)FB;1DB (p    SO-KF Mh+H+L+N,O(Fs F0F 8F@A(8#I'j!H'f@oH03H M.+ѝ@$H F.H)h0Fp@BF0F& (`O0@!mOOOO0OP@BYF@F& `4[FBF IH 4\!PPPгP-CFMx"JI ,F7F;x*FFIo\+77B F(>"1F:p@F\FOcjFAFt +FjF6I FO60+xx;pF;x3@Fh F}\+77*xBO  `8@FR Ff!I:F?SaKhr`\`0F MS+!G+P+@F2 FF+xI*F;p ]p+s+ g+ciCcaciCciCZhaPQEQQ\!nQ-AFFFx;I .O0 F I`%E`0F'\ K``hDh(F`TaQQ\! K M N Oh#"i 9F "h)F0F #di\!MгQ2KpFh*SBADX,N.I h!i%A!a(FpB)Ih0ahBAqX) 3BQi6` FBC"Pp0 ``I ch /"p#c`O5ch/"p#c`%h(F'`8+\/+#+TO#aBC`P% F)I \! !!R:RBC"pFPKh#i.hy/+di,Kh@ Kh+KhO0p 1F h&B( KBFQh+(FZ(# Q"1F h;\!! !F\KFh[y.+Cy.+уy/+лVI0F鐹3FxY*,.*,.* (kx !xF0;0:#3` F'0@ -< 3 * g  P^0`v.+O0>- F`#x ax0;09D+DsaxRx !0;#1;3a#x !bx40;0:#`#x !bx40;0:#`#x !bx0F0;0:#s` \@0O0 !x %cx"090;3d!YClqqaxx0;08 Dd3"F$F>L'hBBKT.`##0S) aC)P 7#%#BB '!Jh NO02FB'J2F9F%(T#gBA g M' Jh  (F'JI \!WWWWXX*,K-GFhF>*I0F$ F@"V F6 PF(8PFF `x8F``8F)@h-)hPF&F(nh8F1F&(0F38Fh`( I O4EEF(F! FI\!BT!H!P!D!I[L!U[N[[BCX;F+Kh3A IX  FA HXL!N\n\v\MO~\\!\\_h_W# 8h AAHX@I&#C% S #F A7HXB%(F=!`!FX FFX"FI% VO,!F@F  8hCh;C`+ :hhY` "phZ`# F;o%Oj8,j4,-C|K}N}Mh4h}H!F#F+ 7" F$uKxj\ Z[x\#FnH 3`eK'FhgK`?\=h*F!F#0 7`+*-!*} * *FSHS *M * F(* %*o&*cx F&+O F 7)*4** ]+x=+/ 0+F+=*0/*S ,*^-*bx-*/ F( :*R<*cx F<+=+S ^*D>*!?*% |*#~*$ # ]5`xh3` F F     cx F=+#>+ cx F|+ F cx F=+ F  bx+* F'  & ) " F F %FF $(!d$!!k !VkKshM.h+` \K.`~0FH1&"xK*F%"` F$F F%hx%h3IxJR\ HL3 F)Fp !!4+kdk-xHFF#) p}gz @S-5: KH1RIHO,Y?DH ()F F$JFFXFaFx$BFFD C eFF?  L $L ?  $K \EK EBuO O BAO O O BABuBBO O B BO O     B C kkk-OFF$|0%+F F.T G9Fz0&+FFH1K##F ;FG1FF@FTTFMFF F F)Fl!!"K𵍰#FF#,F F;F2FF F F)F (Р +9FF F/. EF F F FE!J" !88 FLch)+8W)F!(-OFFFFx(C(;dH&(cK(##4CF1FF8FFF $(l"(FF0#+FF RH1Z'+*|NH PFYF JKZ`;'+%'/O1!O0  A #9J!$"0h 0hFFp+K##CF1FF8Fq aA ##CF1FF8F`PO O O K##CF1FF8FHo o  N0h'-O5%O4$ E BF h>&``h( "!>CF`h>f`(FpO5(7 FK"6 F  KhT Kh#F2F(`hBB $h 04+\!!F$M F+h+' <#XC(`.h8F1F#JF! Fgk{&kjg{[[h#x6+ cx0+"I F"&h F#P" D=0+<.+(FpN@!n;J#`J`J`J`pGP!l!p!h!F #h;+  "iFh [h#adh i(iF "" FYh0LehU*F!H.00z``BU! H0 Jchhy`q`h0`htKc`!**Fh+уhchV@K"hhh3!h-GF!9L8FO6F#h3#`hF{h2N+]@FJ0`#h;#`#.Kh 1hhh+hhF( .0F>N$RhFHzh@Fih2"#h;#`#0 .!0F +>&! !hh.0F>`>-h5`Kh+9F FP$9F F_9F F}!`hrV0+/Kh++Kh*h,`AF F AF FZAF F"i$K!`hFJh[ ``h!;Kh,"` F"9F F H H %VFT d4+X!t!\!P!n ,-GF!+K(F!t%hll @EF U K`ױ (V0k_hD0F%0+ !F!t!,4+P!(-GQ(Mh=)O(JO (N;hh2`)x 2h:Q2`*ۃ*2` *xFp3*xFCpTFMFC*Z8hMF K(Fhd KhtBK"`,+$+!d!t!-GF%MF&#L+h3+`!xhDV0۹#h#h+ch;c`+##`+ch;c`+##`#h;+Kh+h;+`K`:h4 *0 +h#h`++p!P!t!4+-OFMNFV0+lJKIO@,a DO`DL#h3#`-nЖ0+1@Kh@K0h =H  8hCh;C`+D :hhY`="phh 08hCh;C`+7 :hhY` "p8h o"ih V9Kh:*Zh:Z`*`-hF")F F;hdhhZ`hZ`*Zh:Z`*`#h;#` 4+t!P!4,p!h!!+-GFF#Muh`h"+`bh,40 #%hdh3i0F+`YhX#H V`v#h9Fh +#ifh+`04F.J`zvh#F!t!P!4+-GFhFUO3h I 0chSOKOMhOK0h -MH *2JH ".HH (hCh;C`+, *hhY` "p(h ?M.+h+`! FUJF!FF|(R.S#0(QF "(h hZ` )((+h;+`#&Kh !h H`hy+h;+`#Kh .!З0hKhK0h H KGh !.(PF34+h!4,!nnn"L#h3#`(H!0F"1FF!K `h >P! #!w0F=>B +`#h;#`#Kh 4+EF((< QK` v NK`KKh*O`YF F  (TC;K`CKh+n+ 0K0Kh*KBh (` a"K  h\ CV #F  L##` +@ h ` K"`Kh+ KhC=z! !X!KhQ`hR`"`+e1iDJBCJB@K!h`# 8 |=Kh2K"`+8Kh.K++K"++ѽl0+,K"`+Kh+ GBB,?L`h)F $h +`=j `OBH "P,`!@!!\!!!(d!t!8, ,4,<,!uD GD!!0:F)F>"8h+"4h+".h@F4")hSF($,>*~"! F`-h-I*FF !x! -CF F*tM%>K Ghh3H="1F@FF?ah5H IHF  A2H 1H )1F/H 7z.Lk hCh;C`+B "hhY`*"p hCh;C`+8 "hhY` "p5H 1FH -M`h+h3+` FhF+h;+`#Kh H  H1FHhZ`hZ`簐!ooo 8,o00 e(F#h;#`#Kh 0::`*A#p4.;h+F;hrBF3I`2FO h*3 &sD;++K0 ;+ ۲ +;h4;;`#<;h4;;` `:qDp (4(3x/((3Sx(ف+4"UL+F&hxxҲ* ف(1xp xF1B h) h<(EJBKhFBHCBx/+D#K-GF^0F ":K'h)F`7K7L`0F5J05Kh#`4K`4K`ih`7#hvK#h3#`p0p;#`+*0Z p0"Lkd`F#!Fkch"`+d`)F h7ch"`"h*qh `s`C0p hy >chG````4+!!!!$+!!!,+!8"K FM`Fd(h)hF F8@۹0+,+-OOq4L4M0"h+h2N 3h;3`+FM#hZ"`"p+hPF @F+8+h h#K@FhRFFk*h#hRD"`2hD3`+ `!J ho!h FF+ҹ"SDPFY#h8F=+D#`3h]5` C#`#p+F!,+!!8-OF0M0O*0LF+h !!FF̠;hO3+`#!h9#h3#`p I+` h;`MDл.@F")F #h P#` p3x+H*FI  J9 H KFBF0+!!,+<,M2q;q!!-OFzOFFO1;h9`)tKhFqMȱ+!!)h)B'+h3+`peI;` h0 DDNк yкD 7O B:ӗ2F!FHF(i:F~B ) !Fx(11B8F p2F!FHF(Cч77OE 'FO 7B2F9FHF(?y~B ,* "Fx(22B8F2F9FHF(:x*77B'F 4:<+hCJD 9Q [+`OE ;? p*hR:*`* z ":p +h: 3+`_B "p0+!!,+!-CFFMe K!L&t`+h#`Kh0K`0;0B#hZ"`p+h h"9FFz FC#`p,+!!$+!!-AF-LFA,Hb hCh;C`+&"hhY`%O"pB"HAFK hCh;C`+"hhY`%O"pB hZ`W%5DhZ`W% hCh;C`+ "hhY`5hZ`8,*H,UqH&UqKhpGhB`* Kh) Khj3c1 i@ pGh(h pG pG(!*Jh3`Jh;`pG(!$!-AFLFMF#h3#`+hj +hj`Mb+hC`Kh`Jh&hB`#h/`;#`K Kh3A$ob;`0O02 i+{u;h;;`+?JhY`xh+3hh,xh#+"F! F:XS"! F:N(XF3h"Za2h)hSi D!+`FQa1h Ji (&!(2Ja! : *'+h;;`+##p#&x#pK03(hpKh&p+hZ*`)ha9`!*,4,F)o(!* ,<,$!4+4,,!wq L#h;#`+ JhY`x'#h;#`+ڽ@(!$!8 L J#hh` Jha JhabhZ`}#h`O3 ``#3a*(!,!$!FN FI3h33`"!8F: L#hh(%hi`#O`Ia J#` J`#c`3h;3`3 Kh@ h+h7 OpO6'3 #h;#` KhAgQh сBV`p2!FD:ch;c`+ F#h6."`!F$yպch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#hFZ"` "p^+" ",J!I#+'J!XF=%J!XF7(OrB z "YFT0XFDH@EtYF F :6?# FF0z!*5rOrrr"rrrrp0 [ڹ0: BCDSh PU4mh-+FB!#Fp#&F*OqB#3-OFFFKGH\h x%+a PFPFD@H,$?KZhB h"40˱ Fkx+Ъx*++-+%+3K $i ,,H/O)F'K[hZD(J!(Hh#@00+ 0kx?+YF@FL4F6AFPF(((FK!B:Ԕ0[0+`cSMF(F 03;D+9Hj(p(g(&'$3Khh[h 1H!Fo.KhE.I.HiC1]$ F&y(H,:0;"SC"HXE4F# sC8F6X:Ch;C`+0 hBԿ # #P`p0B0hBԿ # #Q`&F O(RsVs!~s!5rOsz18,KFhH!N0hdB F!rJhH#;pG2 pG pG!-GFOMh+F>]#`@F;@HN3h33`(WOhp(`2$O<4#FF3of2j`3h;3`#9Kh 6M F*h2*`Or 3J"6"BO F#0-Kh0/H xC+h;+`#"Kh i F0 F40$`CAF FKF!E@F 1B03 A! *4o@簃!JFFh`X*a$)F FF^F 0h8A3C|!!(FF(0V<0З0+!8FuF," FWK60+8F0^C0F0м&Ըђ)F|F!2{ 0N*?f *`!F!FѺB.P|u0;"SCXJ!0+pѸи,?-? ")F F|^F&O O s!sss!!4+*pF83M+h3+`F 0/K1Fh0h@RF(H!F 0+ #K$JhSCJRhB! F! F~F& :OrB(0+ F+h;+`#Kh 10Fp(OrB&6;p7`p+_=+t $+'+"+"+!&\++X ؅+R Cx +х$#?J+RMӊ+(F;*;Cx"+Dx * RFZF(FF0+x0; +CCB Ё"#&K&H *FFx2#KOOa "F}#"#J)#J"#I #0 }+ @x( 0bF:#I$=\#"Fl!p!tttt{!tA*ts-ANFO,a3h+^#h+7QOOf?DnLInM"hB:F!Q(F#h;+h+bH`haHh`h^H`h\H\H[HdhhYN=chXHhh+h0F-hQH`hOHOH`hyMHhsh+JHhkHHHH`hcFHh]DHDHDHzhwBHt!`h?Hlch>N>Ohf9Hch :Hh60FWh0#h + @F8FMmhhH/Hh!n!hjh")MD")MA"(M>"(M;"'M8"EF5J!gh!Hc!Hap!*)t}zt8t=tBtEtnAItMtUt]t;itbt++ot$tyt}tt,t/t}2t5tt_utpF N Fp0F F%ch0Fdh1MJ.`6F0+$2$ OF<`;h+ <."32UZpp"p$+h"pl!4+p!FKFFFh*KF0[(00h(F8v/Kd K0#KCPO3C`#r1F(F)F!4+*-AFFFRCFЀF:F1F(FA*hFHF:F(F1F^ Ft-OFSM #+`+h\'OKT$ZhKLKhh 3H3+hB"QFhFF0,`M-0+jBFF2x),/*@F6N8<("#"#"#BqC/A0+FF  :)ѻ0[E2"KZF@F# 0 Kh+FI@F@FpCh;C`+W hY` "p"##4{8hZ`!,!ؐ!!,+!t!x!$+4,t-CFkЀА%FF0 v6@,9/9&K!h #H F#V0 JB'1-ܖV0@60.0sHV5F((g 8F(ЖV@, J%FhKBKA!F`4,<,,t!4+\!px+B!L!#h3#`8!#h;#`#Kh )-+LP-`&#0P%#0 Y 0;#0#0p@.Fp`KBHG, D4C hp$k5UFF-8F ApG, 4S )F0F0FDh(FF!u-OM$N(FZF0Kh;hKHp#4h<F F!}H}I}J&}LF%F( FyKhF `"  7(@𐀝 *\* F F7(ѝ *.K"h:"`*H۝  , % *hFn(Ff(@𗀍%xh!h6.!h9!`)$ۋ  -F!h9!`)ۋ  %  p6  p  p籹#h3#`p"W O h"`j" O %h"h2"`Fp!M ;@ E!F"8hLWPF " F((FF.O 9"!F-m%e>u!!But$+!,+!-CgLFO F.F(wcO;h3;`7F7;h;;`#]Kh \Khh,hѸ`^r#DF0(w"#D4 ,ix"#D4 ,DO <^r#0CFw!D3,x!D3hDOXFF,\r# 0w"3D6,x"3D6,D#/H<4 O~)F)H)(J#xh320[#x0;ڲ*!H??+0F7;h F3;`F@C8F0FP;h;;`# Kh Nh;!FF HC<&84+܌!҈tv-AFFMM(m)>LHKNLILOPU4 :+D8Fyy\AF4,DL hCh;C`+r"hhY`?N$?O "paYA+@Fy* 2F:F4,ѽhZ`3H,F+N2O5؀yyB"h\@F4B%L hCh;C`+ 4"hhY` "p"y8FhZ`)IbhF F4y5,ѻ&'U7A FL 1F8FA!7/K"F H]4+vw@)v8,nv[*v"wvvv wF H#$yBF@3+KHY\4+ww8FychKh#06 єp/ (@F6p60+є0+60F0+60F0&Ky3)B2h KO` Fj9hY2h+hN2`h*` `Q#h3`;hs+h hHT:`Zh)`3"`+`K!*h$Yqh`FFh217 `(`A$4+! !!`!T5`=`< x-)\xY,22`Zx-*ћx+ xFxB[x :+Y3hIxh)>,Px:-0э "F.H@Fx:+э *F'HPF?%"#2`FF!I,F!H)FH]x\:- 3#FIH!FHE33`QF"HO F3h O 3kF" IHFO HF*wqwxw<,w^,( F H K( Yyh)!`aYqK;w!!pFM*h xL hh p x-*NxJ.0 `Hx-(щx)xTxB [xF:+Sx Jh`hd H Hs^xX:. 3FK`$,`!!ww! L M'F#hk++h&;+`+p0:hk;cF0p,!BhF"h,`#FZh:Z`F$hD`8FEhkC`+݈ 5#CCh"bZځ"h`8F 8!"Jhij`$,xA  pGxҲ*ف+сF3۲ + pGxJ\?  pG\FpGdx J\ ?=+ pG\FpGdFKHhk,xpF FF"a(F (F`p+x-+kxO3`HKhkk ax,-OeMF+hBF;x_H_J^I_N hx1`+na:xn*2h$:2`* @hPK(hha\,A*2`2ۊ@  (F52h:2`**ۊ  *h2*`CF2h:+*2`_ۊ  ,*h2*`vF0їp pj p2h:a ZF ,ЍB,FQF+bB (*h2*` h`FC ( R (u*h2*`Jhh`l"@F ,* Bpd*h`,+$+!,KFFhi *ќi F#F (JJ"!hFthFhDnJ3F!jhF K Jj-KJj,xxyh`xy𵇰F FKh*F! F,KhBFM,hGBҷ_, $B!Fhh*@kh1F:FFF0FdNN$+,+ă!(y6y8KhhL%h-- H K-F8 Kh08 Kh%`KH,0!^,Jy@!*!K` @0!8LMI\(8D ( #h3#`+hhk2c "!H8@**,,-CSM+h\i,i"Za Fh# +h`+h"KO0c0:hc0;0+0Z x#.0 .ܱrn0F";ICF .$ .).H&.%(.+h$\.A|.(;.&(.;(/+h $ (0U;h$3;`+hh`ae&(+h$B$+hY|(+h$6$+h+h $.$+h+h$C (*h;hh3;`c (y+h"aa,*h(!$!-OGFC0iF,! ,2>hjMFFZ $аi!Fh F^2FF F]Fix xBF` 44a,;h"a FUF,`p$M+h^j (!O02h+h*' B "2`hJi0FHH2aix )0Fl*hi`##`h`pFh*`:*0F"ip@żkkb`,by[KhSi3Sa,O(FHB! FpF;(( K FhSi3Sap% F dT`%,-O"EOF;ha %FFF(F/#hZ*#c`)(H.K F1KD0+4F+O#` 4F `FF-S*#iaah4DF`F.:hSi3Sa;h"a6JXD0+ѠF&!O0:hSi3Sa,h`-O˰ FKh[h# }KhJ{Kh FC  ;oK"!hZ`mKF`$lJh3` +;FmfKhF aK `bJh;`[+/%h-@ rWKh ``Z``VM .h-hF+(!O0xFKKh+EKFNHOhHKh;`0h3 0"`g`(FM (>\(A,2K:Hh07U (F3h33`0h`[h[",;h;;`+\#5<\(`($(;h;;`+,p5'\#Ep3h33`0h`EpJh;`+k"*p Jh(XRF!P"Cp,FI,@!,+`E-%>(3##`00F`\b:0 a+Dp(F(Y0 Fbb00Fa0 (FlF|(#&(###`,P%u<(>('&('# '[#`F` R0 (j\`a.0j-("``##F#"h{( 2JI \+F"`" +{+h"h2"`O i#(Fb}(F]8J\6M0-h5P D}(;F ' +H*F!0p/FEp$J\J"hݲ:"`*-ۊP  J\F"hO= :"`*d /@%+:+`#+bO 1vF'' pe/zhD`h+ k#h khhZBZAF0FBkh`Fh+#h2F!i"QFL#hij 0,gIK0߰h!EK<"! 0BKh@Kh#(P8K:M$!F`7K`+`Vb"F4I*hj; )3,I)Mi!   2$KFU$Kh K`K K`K`+F_0K`K { K` K`Kh+!b# A K K@!4+H!,g,+D!z^,-GM"+ha#F=r (%*hSi3Saj(}n{{"{{{{cc{{{{+h[j3` 'zFF` F`` `.( +hi*   +h VF Fx` `" Zi2Za :+hi+ # #F` `` ` (+hji]H,  #`F+hi`+hi *j*TIiN(6 #`OK`#`C`+hkai``:*Zi2Za+h"a((!! +hk8` (!9`c`+hi;+ oF' h`8Fb' *h #`Fkk` )+hko``/h;i +#Ii!IO0O Y+hi*" "ak #FI;F+hi+?+hi *! k3+hF,(  ,zc,+hi*! k ;a+h"`a (Р +! r ( #;`+h '.F` #```! +ha (1*hSi3Sa#3`+#h+ #4F` K0F ( +*h0FSi3SaF F+h[j3`4+-CF9MO$FMF+h+h (k0`F+hi(Oi *\j<`'*' B$ O +hh:hZcJ/!h2FH*h##`;hk#a+h``^c FZi2Za)O0% 5`=`r#`F0`kE``a,*z-A%'N"'L3ha(<2hSi3SaF( E"#F# =FD` 6Fz``<`'F(##`DF2hSi3SaU !##4F F0H$5,4+z8!M+hYaa` +h$`(*h Si3Sa+hh+hiHH8 F,z"FzpGChBhpF FFch```epsFhF4(%H#h+hh0FFF 1Fu4p%!"FF(4! ! !F! 1F #h+h*FhF 5ZhQoKh0 pGЃ! FF:)O]K5, FF]K5:-CFyOhF;h -;`ܿ#KUh;+5p*v||1FHF44N"!4J!  F4D-`K0+𢀬B^"iOr@!0F4VKN0+5i!0F4CFOr@!iF40(h F4"`GK"`!h31FFBHzpCO F4 #`&iOr@aiOr@ !h() - ( \k#KU;h;;`#.Kh J')F ""=(hh*F!FF!H_(F4Fi| F"! F4K$`!FhIFFHB")F F (h F40FT)FFH)NhshBrh !h4CF%rh !hrR4F0Ѩh !B4AF " !h4BF " !h4CFH-hBkh!FGh4`pЃ!|-OFF #!3% 0 "#C`FPKh``XX 0KKKJ`0JKHJ`Th0 FB@w+h;+hB"! F4((h<h!FF5H+Q!Fph(KȐ0300 + ! F4?F"h* * *h!FFH ! F4 "!PF4(RF!F0F0;0#Kh B Jh3`:F(FHmhfT!8,P,4,6|9|8!Ѓ!4!+ѫh+Ъh FIH!F !FHh* ch;c`+ F-#hZ"`-"pI F!F(i F`a*}/8F:,KhhJhRKh+K1 K"`hKS$ ʱS$ x,I"! hD ` K603,Kh+j`8KX!؃!Ф*:ٓ60(K60+%%F+!B-'-'-! F0=U-! F<#>,33#`"iF 3j##I!b #R<CBLX!؃!!4+ !`!(-OF F;MhI(FFPHK!h0FI(FF(OFMW$0+h3+`W$A!G$ F+h;+`#Kh 4@,єK"`(=ݒI`h|F(y4>FO I hrF(u>4.qѹ$ЂN,FO --V%0H}(F4IF8F ,@F$o5@-yHhoO$Ё%F>FW%0W%0xqHW(F4#F@F| ,jH$I5@-fHBfM$fOV$0V$0xk(F5V$U FF8FW4@,&O~4.O LKh 8 h' 'h;x-+{x+'.4%& FH$PFPFvF?,%ع/K"=K`=KhC h ;K `b `ر7J h3`XF82K ` F *K3(Kh&K(K `)Kh-"N4h,#x+)F F5`$;+ "###3! F"""b>*#`" 3f3!F3P "@S  CC ؃!t!\!@!#`k`#h;#`3Kh8@ֺ8 ,`S!@ThB*FAFh `>` F=+@ F`&F$h|!EKFy FXAiF(FF(gBhV `(F $Z!7H``P(F@1N3h33`;i;h0(DG{h`Ѹh:i{h2R":a L#c#a{`B{h#{`{hH$$TCKEBJB[h 3h;3`#Kh RF $ T6Eh``4+K$`csKO2`KJ`#F2RLM F +h3+`K F"\)T0@(+h;+`# Kh 08@<t! +x!:+H6hh*?3x`1F(F h0 p Fa!FF(FFF(FAFse"F1FRF[F1FaRF[F!FF# `hhXh `h@lIiS+1F(FaS+!F(FH!t!y W hh1ph"-CFF #E (F2IFP #"/I(FF(?;h:`_h'*HAF"ehu%I8F85D#5<!I+! "8F(FHBFyBF!HxAFHch3DH b^5D {x?+-+H0#HdHĈ!FI JI FnChsFhhhHHMN 5Uq FF F )FF Hp@1U<0F#D|,pɉЉ-OFF:!F838AI.F(x+=!(F$pYF@FD/xc/4I(F"(;`i//I(F3`,I(FH*I@F$sbl/'I(Fй`o/#I(Fs` I(FPI@Fb 4T  xB(F( :* I@F 2Dt0+|$x$1$d#K0#M0#P0Cl# CCCdk#cc#bpGj#ACBrcc#bpG"r#clBl`3CCdB3cK@CcCCd#c#bpG$@j 㿂kBRBckBcBl"rBbBd"bpG hh1#dBj80]F@kx##cfF@kn##cdFjhK#I1#b#`t"pFFH0! H8\<@c>c: d8`d4 B.e, f ,"80F0F0-#bpAF@kF8D#bF@kF82#bf dH1 80J@FH1jF@!80#l#SC@s#d#b IB 1:(I P]t I1((I >nt  I1(I .ot h"phF F#x-+ ##bbK@ MI #ȱhԪj* H!F3h2`[hkc!FHCh(FG p|FFFF1h9.x-.59hyF(F8h#h##`rhC 6(F@-.#hzh# #`78 FhJh@(F b8J8(F$( JD(FT(J<(F<(x 8FL#h# ##`e`8!) F-h:*J!HH CJM!JAr-!Qr 2+F^!?!Qp"p+ٲF^ @1 SpH*$!!pFL%h5FahH2 `pj(DH( H(1F H$01FH#hD!y$ &*-OFFFF@F0F)FBFH,F@򾃹 HDAFHD'9FHD ZHhR, ԸKF,* ԳKF,k ԭKoFu,/ ԨKFh,ب բKF[,i ՝KFN, ՗KFA, ՒKF4,o ՌK@F',ب ՇK F,ة ՁKF ,-{H-8,j wKF,+ rKF,د lK_F,ب gKF,)aKoF^H5hs,s{jYրӀ+Uk(쀻MiHF@ /Ak/&@Huh5,-+][3/Wi@jF1Hh,cJ+N@sWH+N&K_GFA,HE//Sh\4Oo  (1:FMU]eq/8A,@ZHOH UL,@< F7HJ F,+tЩH,K@F,KF,UМH,KoF,BГH,;АH,H@D,Hx,鮉KFl,஄KF`,׮KFT{H{H{H{H{H{HDE,Ϯ*wH<,ʮuKF0,ϱoH),mH/0 ,jH/0aHfHfHfH+0 cH г@_H_H^H^H^K_F,/?XH,VKOF,QKoF,ήLK?F,ŮGKF,BK?F>HU<8\d#F:Fd!(F OF̀%W <+b-?p`zċˋӋۋΊŠƊʊ%-5>Fʌ,W,\,BO BF !HD58FP=\BF !FHD -%$ 7n(VHhYH-H䞌FE IFH \όгK IK( FIH F,!#OhгsFF# "`#x#+4 FFh#"FI x+3F"FI (Fp ԍ8Fx;#+LI(F`8o(Ѓh`,!# hh04FFFF "!F(F0`02hB" h"++x#hx(иB K0h30@ O O $pFL#h chh{B H@F IB FFBFHv"#`#p@!fl-O$젭}F'F&F0+!F0HR b#HFOr8 0!F'H|0F } F"JU#B0+!FH* s +%yh(( F(Щ(3[E-y/FB0+"F H!DHFG(݆BFF綕̕@!h++ H]0+ +HH]0HH w0ʖpG8F#F8x+ I+\,+4#I+T F"\#*9t L J N O8F4T < T8F1+F1FpBF,<Cг H KXi! "DCFth"+I J FQ@!a H` Ki! ""CFRh"+I ( F瀗@!FO$Y=!2FI 0F 4H( K*yhaRZa*(iyaJ` ""`н@}p@!0!7 FM*h*I I I+hB B"F I "FI 0HHJN0#JI:HDJ#m#GI7H@JcmEI3H2OO0E +I )HG0U<+Ca9FHFNUH5%#DkB9FXF50+O6%j6)0Hj,),HSB:Xa^ F3F"H`; ) DB  DBF a9F   EۯFFK /@Seę0!ؙ>Ԛ-OS}FFF1t}EU"O4E#o4FFr{CSA4BB3OrZNl9FxXKrh3DB򡀍lBSN!RIB,QaBdCClKKlhwXE&PE43D444XE(PEэ] XBXA(AF#6H:2[3JhB 3i+#/H:2le(3i+AF#&H1l54JFAF H41HIl]Orl8F#1JH#KHh'8F S}4!H^4 + RF)F;HT:HR#   !# +++r)FrDB?(?d)FdB ?)FUBKq)FJB?h(?=)F=B ?\)F.)F'đ9@!H$*K-A&FS&P].8FF8H F6+FX# D# 3B K"1F F'D%FU B Fx đYKh@/ȹ#`O0,'J8F1F+M) S)#K)џ${  zg{{5k)c)*g)џ{  s)t)(m)џ{  Q Kh{k#"FC%%BA0zg{'{Q {  @(! Kn:f*oB (I.񬾚mQeppG x-OF F FFGF+I l9F)Hh /$U IBFB 4!K$"AF0F!FH tU'(F!0DOFWE0FO FV)PYFD(FE (FdFB5 % 7<0*x-GFmHFFJ!FH~NТFQF+(#V# wE𬁐I$("1FHk%Y%I"+FXA("(F9FBF FNOM 1F@Bu9F((F5-(wH砀0sNpOsMj1FCKh9F((FbhNcOhM1FjA1h9F((Fjb]NVO]M"k1FBh9F((FP#cRNIORMk1FCh9F((F6cGNI FBjIF F hhkBM!F+ khhKDYD4IB F Y0hhDkB>!F+ g!F,Hd)kh:F)ISF+ ++뉪hh{!Ihh{ FIhI FJIk!F* !F k)!F* !F dӭۭ^,1>ŭ)FFF $ I)F H0B(F@-"F;F1F(F4DTpG@pG8Fh`Ȉ؀R[B@[(R[B@[шjbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXem\\peR BD pR uBD mic[UJh"13B8Q CC Q =C Q 7C     1 +# 20!Fh KB F# F0Or FWEVF JhB ѳ JhBF!F@پBѳ WEV0! KFhS# F0Ort8!(#(Bs ېBq pGO0pG I LMNFF H" I H4T, \T<)F0F眮$-\гӮ(sF F(LhI F0й. Ih((C3LI h-0+h bhII F#I F# I F(#pL^@!udO=s*M+I(h,F-0jh 'Iih9%H$N$Mah2F"H*FahH 2F*Fah?H 2F*F|ah?H 2F*Frah/H 2F*FhpH`ah H@!td@^,Mt/pL("F F !jFI h-0bhI *("! ..jFahHp "ih  I h-0bh IkhjFahH@!}d(@~d(/A-C%AKALF$F/F"`"`JFAF0FC#hB e(q(%'$DIF-0  *IB&NCB1FRF(  !II%H꿱 K" FN IKH* FB (#!F0F5#*##n4(Ra:^,O@!|d(-O]LhI F|(@љM2 OSF0I(h-0jhI: $ 2D + ]# (4 : #TgTf2F;F~H}I F6XvL{I h-0bhxI FwI$F(mM (hF-0qI pC_mJmInH 2 D OS4YF-0 $,OFKD +Oq ~F"#%FFFMTHJI-z0. ( (~aF!(F?Ŗ@dF2gC-ha0AI 6H`,?;#2M2HPgOG)OF(IY#BA$h#BFKF*2F;F1? H6GxI H"OrYF,H(FHu @!wd/xd 5;Qгt رx(-C F"Ih(8I" "!i.("2I"`hxFFh+Ih"+2O1gCoBB#I .w I"`hxFFhIh"+ѹ??IMI*g(h,-Z0#h jhIn Hj7'Yq@!ydײ( F(# K Ih-$0 FI`hp(#@!vd(7 FMhI(FX쐱 I(FR( K IB h-0 F 0\*@!wd(7 FLI h-0(FaahH0@!d@(0FMI(h-0jh F I( H0,#H#.#90@!zd@"0( Fy"IhhF("I KjFIh-z0 F4S@!{dЀ-CFhFM$OY!2FI f0F`4@Fh9Ff`G hC-v LMDOch`h2F `0bh IR -~@! 4IFFH< ~8г-OFFF#333iB5.I(F"F-0 +I " $O ~("F I(F-0 KEK |FF$ B&~ IHFEQFHO@DC#:FAD(F4OD~-vl1p FF b,KB7+KB@}SB FR&IF $KBc#3B F FJK(FFp@- Fp@F FH- F"FFHl Fp@~G FVF HF Fp)Ftcidyara3rbmnk;k  ,I#HL hDD!RCFF!u,OmO0,єQ@ueD `Q`A?`0`hhh(<` hh 3h DBO0( Q@ueD `Q`A?`@ D8H! K!*ۓ!* ۓ!* ۓ1+  pG pG pG pGH!-AFIFFRiCFF)F@3BF@$?18p? C4pH!?# LCb2#2#P#2o@3H!h hB̿ pGO0pG-CFL#FbRuC*F&1FFFFH9FL 2;B 2;BѽUr)FHC,H!A<sFFJ"`(F +xFO0px+6h"+C;34` F>I"FH111I 4^,гE-OF%OF;hhC#I ~hrBqC#D  tF#F1?$2hAFO,@ ,{hB > Or!D@FOpO0-H!-AFFVKFMFD)FHO01JU"B J" +2F;F)FH Fl˾H!)'K-pC(}FFF"NFeCFH1F(F }p\" Fn"I F#븱\"! FK2chS#1FH#"i h#KEBEhF#iBFl'@H!I8F LiB h~("! FH#18!H!-OFF$J%N  KF +]2"r_C{F:FK  A #AFO AFJsO#Fr:F# A f:Fx#"AX# sHsOd!sJ8FqI d"# #mH #jkI8F;\: +$+Rx *cIZ h1 W-+" "YH.F F8F[IF FXI8FBFVI8FBFTI8F(8LI8Ff;;\ +YCH\# AI0D2IH=CSFF8KOYh3|"EP DE #XFaFF F|2EDT XDB% 2E 2e 2eGD #Bu"#BA"#H# ##"F+FLFUF F)F"EH!-`! =9$޿\ -OFAMFFi(h1I~FD1*+!N2+2Kj+?֮R-Ѯ J!F-H| PFYF0?Į4#CTF_F+FJAFHFb)FRF[F 5-є4#C#2H! !H"^,-?NcW!# JEk3CJDHCK)ؿFBJ)FIFAH@K2+dO&"JU#B3J5K2H)ؿF2J)F&2H2+D,K"F*ݸ&J)F)H2+/#3 Dxb+ѝN0)+J)FHj0)+J)FHOK +"#K)F JH@F}w! }iF(I ^, H!/J{ir-OFBLFbN$%EB9K F9N9Nh11Fd"F+4HO+Ľ2HB1"F1F0H:1"F1F,HK .1"F1F(H&1!1F%H@sD"F1"F1F H1"F1F?H 1!1FH@sD"F1"F1FH1"F1F?HO+iH!!Ea^,3FWiz-GAXJF2F|UHUO%RN2)F8F)F"#0F5<-2KN+3j+=JH@%@i"B2)FHF3ho(FFF F@F!2+PFx3h(FD/##F F8F!5i{2s2+A!&HFG+Ӽ$H(F!H0 HF"FH<KiBHG+R(FhE$F F F!GFH "#)FHH!!; ]v-OFFO(fб?oKiBthF$A&{ I2c? BFH #!F0F\B,\0 ` PJ #2F#,C@+𢀣K'F!ih J"F BjܛK# c FF#BAzۗHr F F"# {I #>F$"#I #&FF$"#I #&FFO8kOO2PEE  J Y O F BB 0"F+oKg g g|18F# C BA11A A 7vs# C FFQI#C4b'Ez (# 1$  EF 4z # CEzO O 0Y (NFWFB,@;-OOO %#*F0HF(&KR-+"K#2F;F"HaFF#Bwu#c#+Kih#  BcgjV@ HO O hH!!Ea^,!'1ӱO  Bw  JBwFFO33+ђK#BwVB,QHK !#r"# EЕ1s #BAHEq FF u3 |zJE'FBA NEw ڱFF3+` PpVGBvR4#CEBw4F=F]K|"#!gXHBOJEOI JF !!SEOJEO#+F!"Fg+𑁍--Ѕ-#42F@F4;Fx:L2+y+Sչ@=\F4H2K"*B,?ѭ0IF Hg%+F-D##@F#2F;F?@F9 H#C EEF#0F9F0@+ { '##)F@F#2F;F3( FI H!H!- !-+  0F0P 0 /   8$2+R-@rH(O0O pOjH@rD2;52:F;5#F^H2 ?!5#F WHpp0`&?@rD2;?CKH`52RF;5#FAHu2!?5#F :He`&??C`#2 1Mi<+hD#1+ F,43CF0>H%,FFFHi*r+/#9FrhhGF( ЄBFF(+ЁKNO@瀃JF'ShFFCECFvK hB,F `F0@,kM+h+hqIrJrK( FqIrHVqN-hqO؁-?o0)h*i) 1F9FAFgH@-h+7JFeIbH%6h! b8FshOcCFc [I*00F F*4HFRUKhCFKDE xX21 VHգ  ;Kh.B FHF2F#` 0B ?#1J3`Shs``V`5JSh3S` 2 F8F 03i0"FFhRFIFF  0+6h9F 9FH0F 0 \!T!HS q&*(!<&^,г$zd@$98F`0FBF0?sEF6h7KKh'KHFZI{iBs?h(hCH#)i2$+OqB SO h:I:Hh*i2Z`jh`4J#+`HShk``U`h#{a0;0*9 : vDF:a(iF{h{(F{B BKh6h.Fh+si+0FlTF/!/4ZO.8FF( ?ڭEFT!Gг\!IFH г7KFh°5Mc+h+P3Hp FB@pGHGOq,Kh#+h*N+O5F8Fp)H jsh;s`+"(FF ,kh;k`+!(F (y, $)hKJH)FJ,hd 3hZ2`x竉$+hZ*`x +Y,n,N,ѤY\B\A,!4! $! x\*𵣰#LFKMh#`+hFH#h"8F+ !F)"hڹF8F)yH*##`.9FvH0%(F#+h+ Z+h+ T0F00F) H+h3+dHdH0F"rF0F)+':F0FC;FC{w|7B+hLHrCl+hGHf&Co0FCg+h>HR0FkCZD8I (5@0FnCG+ EhC ,H!Ԣ)I $ %Ho#0FGC%f DH[HDU%{0F).?(HF#%4!0!,!!'7Zp=To-G  FOrF)F)гH&0F  !U*Ѫ)ЫHl"!D*{n{O3 d(f`&0F$(ОH1F{)|{`#` H|j|)}"|h~#cbk}}"aca}!+~a#~a~e#h#b+#Cc!b 0#"C#cbclCcdfl1% $0#& C' ce(0* Dd+0FjHv- ,1 . @/ `0 c3"2"c!ac8F #k"hZC#BBUH8Ob a8F)o"OI `"MI PFع6ù66U+ѝ6+ ѝ8S8;8U+ѝ8+5߹ݹ/F")V3dh!Rjh!HFHI hO3 gAF0+F FD %=F 2z *.!D3s0z3 DspzPszs s,< * ;ZcF*/@LopCrB_s}1}CCC_i`gOrQF u N#0O30\-:/݀ ;F#NF|HbyI (΀AF +FuCm/ B 5#HDD`_+@^@F]H#]I K(%vDDvDL opC@FBuu5u_#__- P0BhC`^@f`FDHCI (DD#Dwwsw3w`F0FyF 06H1F 8Fy F(@Fz9F.H-N0`H@FzHFz)HiOr! `lСk)#mB!H: X( +ShB khC`3h !縹H+I Sk" P =F H H +O8!sHh!p!L5% %H"UF%h˹ U%` Uyy} UQpXh!Z`FFh` FYhh]`"Fh!8!K-AFhFFF M%1%9FP`BF0FC$ F8!h!-OFϰF sIFF(:qM5pKhh5ElIlH'QF nch5EO D5rnDB!,@5 !* %3mBWIYHL pny(THN O"x*/ 4:3hCC@F2#+ #BBDHrn@F'snBErn@F'vsnB\ nOr!3f PKF3J ! snhO ,(SCLFF F  ! 0"YF *KvK vlopCBѽ.1#u/1cuL@F#wL cw21w31wLhC`## h#BB Hh 5XNLh!8!jVz9)!Ly-#5h!KpG!KhpG!KhpG!LR F2!F  hг-GFFF <4GKZhhHM+h;K^h&hH.`QFHF,@FyFH? Lch lch $h!FFH $!ջܹ#pB$ OyE{ + dE ܹKh+Kh+ڤй/I51F5#FHO ?+"pO $!!!0!\!H!!iK-OFhj[k^C2F%kF(F()H #*sB۵B@  F)DF(5#h+%(FQI F 12FF"kF Jp/r # 0 D"c #Vcw g=K #*FsF'kB0F F0/K!PFi h )вEڸy  F (K%k(FAF #EDcq#h%c+ ?{I F 2FFCiF=DW@DS# 0_K[!8!0!8FlAly2rx!F6Kh `F Cx q8 $!-CF` 4h_"2$y4$4B2ۢ5FF!F0QN3hF Cxqyl\3hKKh3Khyq  $!D!!-O FFFFX"!F #0mKgE8!iK#$[K\FZF+F.C% 8BF#ulZF+FI @FIF 3 DW]PF @;;F2F@A @g 0F9F]FWF/2OP0   !I I !# *sڸ4#C?XF pgtmsZF+FI @FIF 3 DFF 3T#0+# i@!0!!#C8 |F FC ?h#2C # # #0 AqOi) Aq~#P2C#   %C  CBqԀ:kCCi+@퀢Oi':h 00 k0CiF+@ـ:h'i 9h#C$N3x+-H(-K jP$ h 7#FK0F9Fhr;K/.hS"!`C"@OOg3OgVF# .#0O( & B(غ  #yC43 + M O!N)h;hB'd10hv3hH F93jm;h0`d3;`+h2hY)`B#@@!!4!!!!!8F K Fh KhS" "F+FH#BBh84!!pM+hKLh&hC;#hB (hv hv##`+`pV v!!!K"h pG!-O4 FF#H0+ ChGFXF 4 K"j F(@RO;hks;hk^oCFFF0FB'#0A1 C HFQFV#BKBh(FKh+UѳB#iR#B#33JC":Di 7B# 0K)Fhbh}KBxKhRoBO vKO FhRoZErK)Fh}oOȑԡED۫iO #ae'hia R Bh C ''߹bJ Oa Fy бhiJD !"    R p B pNJ`:hi*GPIєH0+n#Cj#0#@A ,@# ,APF;H(FR1KhF+9#aFF-HZ-K"`S(([ FGFЫi#a# F#aFF#a#.O g!!@!H!q8!BPh! h"-O+]F# `##K F1vFF g^pC0@_СM O'(BOswۛKh<.w۹#C h0+IF" IFOr,0 VAq&FF8I9hX @/ )h85@c# C{lImRF@ s " XCA XC!bH/o#DP@𚀺2Ѹy-WJ#@AE`##mEQH_QH(hF+j+hkpCGHFK"`y6 ..hk#bh+l6k #ܐOsC a{h*ko#:Piv[FRF FM9+hZo3g Dk F+hk#bhj(?tA +hkpC@;ch FG ] Fa@!!!8!BPh!oXn(:єH0+Ѻ{#0#@AE#EHH(hF˱ a HDK"`Y a BPh!l-KFhO gEBѻ| OL#؋y1`l2F 8Flhal0 D耹(F{( K!#BB 8 !l-H'EhBBѻ|L# # `8FF F1H F-,Y.K#BBR)F F()MF)H)Kh+6+h`h$tph#H F!H Kh+KFH+hF FH+hӱj!v8@FH$ o+h+`hFH oi8o!@!xT!vlL!ջFFF/F-K-J1Fp@OF*Heb(N7h/93h&H%I#6C7H0g+O2O3#"###!F(FKh˱IOr(F4#p@MHZ( K`" ItL!!@!!8! !0 FFH#E F)F Fx+  #p0#HkK-OFFhX F x+#$4@OO M&F#BB3#BBУM+hRFrI hOFADQXFBZEBOK! . &VEVF0FvFH}HxF+#2C#OYh>!S FBXhv}KhC`F+h\%bEi) i Aqhȁ 0A{@FRF[F+h F (cKhFbKh*+_KbhBF3SEIF[H0+YH# 0chSE5xm+h ACq"@0C )h#j`(;#b#:ORC;L3 0;0:Kh#3Kh#F pCO O @г OCгO#3piSDa'LO FJ #KFPFgP;ц #3+?^*h!FV#3p+h8#3p!!! !!!U P!!@!T!Oy#e |*h  Pm    * CC )FPFqOZ @Pih$I#TCE4 Kh+7wpHb2渲8dOy ,5*h a baPm    * CC )FPF&OZ @Pf!$!-OMFKF.hh  IF\Bi'iAC L|hLsPFVFo+h F tKh+ǀ0+ǀpKbhB#B9FlHw$X"! iKIF@FfI hF*@h**XPFL""` h*RIOrPF@b@FIF#p`0+O2O3#"####0C1F F#,Kbh@F5KIFB5zm +h ACq#@ "  )h#j`3#b#TORCL3E#Lhi3` Kih70iF5H% Pt P0+?9*h!Fi"2oRtWd\" Im!!T!U "I@!!!!P! !!!zI-OFFyJ hFh'mpEF0!+ O O O`   tBOq4t  * D\KCK ,uPJFG`0k 4V$l!aFHF OE;FEF#{dۺOkFFEB{dۺ k EDE{Y#/H~2:PJFF# F)FhF FF FPFYFtFiڱP?]iF#a0k?F`S !E'+V#!''@!!D-OFM/hKhF/@=n#!F#:4 kI[Dt)h4KhKhk#CsFF,k( F$#k$FF4 OK5Buʀ"OeREFFu Ѐ e  DTEu ŀ#{H2O FFQwF(؀pKhk[BrjKh+X04#PFYFx`KF FFF F)Fn#FiGPJF(PKhk[BrKKhki# 0i#aGF EѸ.>HF(FFS$!iC$iO#a+Khk}FfO 8/N V#(?P9FO O ! m#  # J #J {AF(O@F @!!_IFH гsFFFF FBx+3F*FI p.-O"K LOp#hk9hH1ZHHiKh{#hHKxHHV#hH#hH#hH=#hH0Kh3#hHV;hТbHcE# k Oy DI#K###g;hcOzsBFOsKFIIO0 A  "##d#BF<KF "F+FxH0+uK# A l;hc# C [ cFZFgH0+r?hhj4O|FziOy c # # D0A 0 qFDI kIsOyF FzC #DEKI#cFFaR#h+LfOR9hiP'Kih%Kh+MiFH!L!!E\q!!:_,!~8!!`!A!HuX!!!!!!!# 05L#h4K"` &;hjB$u#0+Kx #h+*H)K"`+hӹ #(F$hD#(F$hK@hu6M*hH#hH[( Hp  # B" IH#(+h H#  h!8!!|!L!gq0( !pFLF!h Kh##h H1F(F;C0#hHq pp@L!!-OFH0+2K3+*"jPFYFF mMmJP#PC *s#eH@dKh+cH%(F#jF_NF%SD+/FѸBFyKFIO LC|QK*hD C#s #O32b2C#0A BJ#PC *s+#9H"@FIF3(%#PCF F##@C#PCI  t_#K`#H#H(oK "`M 3hI{0``` hE# љEE0`h``EE h%EX!L!!P! 8!$!8!Kh @pG!KhpG!Kh #pG!-O=FNGF7hF pC 7 FF+S`"Ip`"I~(Z "#C#0 = 0"I(d` "IX^(Z ѣn+#HH"("3h;IOr"IK"`KK _ c#[ERE0 0OsC1 A [ERE OѻOpKh+aoHRF[Fr[0pCW#2C3eKh+ pO!bH( 6hhFXk.T! Hh[kFO{ 0 POsKw0F9F$( Fs1CKhCF FRF4CH[F#AH,#4H0n(@𲂉k'Kh++IOr(I 0C_#2C# O@Kh)u%Kh+q2K3+;*iңn+fKjhFKd 0h F0FAF2pHl@!x!!H!x!8! !8!X!!!YL!hwD!!!Kh[ p#HxRFAFF(0pKh+u"##KHh(żlbFEEfӋKh+<]Ӽh+T#CSKh # *s {yK'h 8A1(q/@ FS(?oI#VCg`gN( t(@؀dK`dHdH`(@Հ  8fn+hK@Cp# *s&' ( G#K@pt8bFsC 3 gD #C##s3Kh+?  T#r4AF4F2Hj3#c44F F(HAFhCro7DH ±4 C""3 Kh+?Q 7T'1FH\Dm2"4'F FH7!!@!!!!8!H/##oKh`` O@Z  F ##0#kfJh3`  03hcbKhKOsBFB_F gOp`gOp0LK !##2h*h`hd*dРh(e*`Рm)F FL##H0 hZksRSC3D3h+CyEE#*H)Kh)Hr3hF[H0+?"#####(#0U o`o`nn.!H(K"`nk f" IO!H!D!X!bL!8! !K-O$%OOKFhjB6Ykb0'HEDN "EsFFBuxX"!I"K""I "KhjBIp>H#+`C g6G7gIO0BhKhQ#C #043D4^#@B#BBF FYHd(FtF0)FUHZ *F!p[@FIF]#I iBB#PCF F#;Kh#`FBbE#KEBE  #qDBB cy$K@FhBX `hthD#s`p@FIFOO #KEBE?_!(@@IE@EBFKFhF8FtSF )F HhIE@ER!p(f`9 !!6X!-OFj'iTFSD+8F" F)F`K('BBFE Eh B0'6hh0B4Ep!!pG-OX"!#P0'6KF>FF4Kh4K`0jBT00j!FFd pC3F*F)I@)H#0&?&J@FIF0h;h#OrI0#0;hSKh;0 0 p#h7'7+΀{I@F,(ŀAFxHqK"`#*sFiBdJhF#OrhI0#00SaKh;0 0 p#7C'2y3#  BPF"## hLD!C;C!F F 0"hFF*8IF(@00y+1Jk#(Hq(&K'h/y+"z.*@뀸y+@݀ J%C%`H(*K`࢈FBH>4G'ڭ :F F@!D!!$!Na8!!0G8FQ:FO  F#PC h3h#N$5"K9hi`ORKihKhiF# 0HV(ѣm+;$e.@󉀞B4.2<+.#$5FH  H "n@H-B"kABZIFpH$eoKh#.𱀛0$uH H/OD ^Kh!n7 A#HTK.@s *pLO)aJH8yH.;Hs(1h #ORc.Kh,Kh#F# 0"M+h+@3hL%2n)0Bf%H3h" 0!H0+MOR1hKhQKh#FN# 0 06 `!!@!!! !! 1 T y    H(H(ծH(+h+?3hL%2:0B۱C1ݞH3h 0HD0۱OR1hVKhKh#F# 0 0H(3hlkB0ЇH\2hk[Bd0H0۱OR1h yKhwKh#F# 0 0rHj(3hl[kB0nH&2hSk[Bd0dH0۱OR1h^Khp\Kh#Fm# 0 0WH4(VKh,S3h"F\HX$9 HF()4,*@0CH0OR1h>Kh/J# 0=J 0 0#;Kh OR1h0Kh.Kh#F3hnij,K)Ih5h @!FoL(@$H!F|#K $`"HlbClaC# K`H(ZH(FR"w$!!D!!!A!!!@!H!8!%j0  aLSBEDF8 zC A|d   @@FA  C)FhQ cO _Kh+"F)F(F/1hck#InxC  C{ RF[F*@@C )FCMHhLKh#"F)F(F3h7kD@DE A,uA@EpCADIO0!D Fo4J`!F3H3H2H(1K 'FF,@! Fo*J`)H(JoOa`%IhA !EE<0`hJ `J`!J`oZJ!`F FoSJ`H@ FoK`X!FH!H!!P!8! !3hJ 5#pKhS1;It K"`KOd Fh)F>)@)FOPMiOyFFHKFh/F(@,ai hKB'НKh)uHH("#9F# FO3O2yp@Fp# 0h(F$"HKhFHR0+#O #rcrr@F 00 #[ zHswKhFxH(0+#"ct"t@F00# 0#[KjHNdKhFgH0+"#!# FO2O3#@F00# 0#[B#+":*/*@OHHKhFIH0+7'i#8F;q{qh# 0# F#qcq^iFB5OFwa*F( F( oFHFoF̱(- Fo05]Ea#`@\` va-+P!!!=P!!!-OFIKFFhO{ 3D##:FjB+F"F:H&J:F!HF7HV࠰FE "F+F9FHFF(0F BF@F##KAIF# 2 B.K@FhF-"Es#2B#+!̣aD O|L XFaF##F F H60DD#HL!Y^A!-OFFF8"L%hO{ #BFDEK"`2F;FH%HE OIFKs#"h!hB(F2GsH#hDDL!X!eA-OF 0 FcMiu8K i8Oh7I#B9F5H#i%0F Pea#i/KB ,F/FF0PBkLc0B>DF#*F1F0FbkIn# C|   "@@C 1FCHh90#*F1F0F{04kDL!^,!H!!!FI hIn  "JE hC3`#BB K1FhP J Hih3`"F+FhHE7apa!!H!!!-C F M I,h hBdhBHgNn  I I gOEFE$hiF F# F`"hS`+he`#`+h,`\`iCa!!еFFF!X"hFhFgнhF+$ H0+ FZ KhS H,##` HiH(##`FHL! "pF N Li3h!h NKh32hi hp@p!!!K"`pG!8FL FEBB H Kh Kh T0BʿXhH8!> !!d.-OF F gFFBB +* F>I@FIF:KFx;+*F5I FT"YF%P4EHPEO5$(KgiFv% F!F+FF/"E,Bg/.K9F0FgKiFP/O.0b F?#<5R)FO#gq!0\%^K-CB}F F@𯀐0+)U h#O`n(`(hRHOb!FOKhOHNKh+:MNL533hOOx)hFOHhF:F Wq(3hIFHF#= R- 3E3h)hFu(h:FiFWp 3h)hFh |qOP# ~q# a# a##ka"j\3#bja#ja# a#zs!0 5L53 #P50"0#"# }Ta!!!\%!KB?ѐ0+; 5004b30304040 5 5L5?P%P% 3WqWp OrOrpGT-C0zKh+@xJ`xL h(wKhC&uIuKx+?tKh+;sM*h*2+hqH,pKkMhpKhpKh+Fі0+BOPOR1FifKihqeKhiFoXI# h 0M^H5(]M' h\N)F@i[Mn h)F8inuh B1iBSHlzp Fx)F hi7n(Fn|EFFJ#3M`EJ`+h+;8N2h 53O:h*K?H+hc1h#*MOROO 0ci#X4p)Kih'KhiFI# h 0;h(H<(Khs'Kd h'KhCh1FU2F)FF#HDm KhZ h H((`D!8!H!!!!@!L!!L!@!!!!!P!!!T!!!8=(-OݙKF8BۖK#TOcuKEhxBu !OJ @݀$B@ʀP@F)F\F#|HB 'ACRCswIwMh (FRCs0i0F nKnMh++h+jKrhB#B9FgH0@Fvs FF  hC TWJshB   2nO ZFTE ! 08F"KA#LkB]i~q;a#:nC;SFN\F401F;0O344LORi1Kih+hiF&H% P@F PO  L4$#D3E D+h+?V1F ilMqj` qbg2g # 0 @#!`!P!T!P!!!U !!8!FKF @P%@D nqF8 HPciB $i"!V%0gaF%@#a F(!X KKi i@P"0B@"@FiBa(!K0h 5sC KBdsEBB fr#BB 0  !^F-O)FF#(FF E#J~(F@FIF(@!Kh(< JShF[i[E"YFq#C#gg_A0g[iSEK"QFhR#E#Eg]AE,!!!pG-OFkOAHtP$$@\O@ 8Bܽ!DJ4I%F[$pQ$`8BB R$%D @ @DB$v5@dn+%\XBXAR#@۲\C  S#@۲#@۲FHt Fn)&\@ QY\#B  RY\#X\@CH Fn)!TP!@\"TR!!HW Fn)!TP!\ CTR!!H/-GF$F)@ ElD!Fh*FQB OX ! 5V+I̿)C%1T!FpU$)F  E(F-   !@(FPE=QE) FN~  <\@ FE6ۊ1EF!FW)DG)BW"G"M!FW%|yG%0I!  B2@` <-O}FFFFJFF(2FbI (`I@FO Z(FO60F }(."FWI@FCF "h+IFQHLkk;j`j`#k+ackka#@0+bB0kbclbO&BIQF0"F(F^*F=I0F;I0F 9I0F7I0F5I0F:F3I@F0"F(I@F0JF-I "!8F(HF&0 &N6۲C0BtLBOТ# (*#4D*#0st "Ft"#(##*#d@edA%=FWcuzd@-Am%OcFF)FFtCF*FF@FF FDM 9`#3#(F mF-O mF.$FFFB0pC_@/!(F^Cxr+#`sJSOaCT(!4FDES+кF.O PF.XF(e0pCOSTjJOa(F(F&%F,. F(ۺQ.#KEBE##ZI F([nu, FO4T@X. (%O44O{_!RUFO FOr@!%FFF# aF(Xp%t#3 F(ڣ-#OCFJF!p"!QF( Bh+ F4#WhF8` I Fn I F( I F%an$## F mF F@FKh @pG!KhpG!-OFF=KFFO JD#hKD !#h#C1FdH]Kh+ZaHBAF h!#h "#F#hkBF Zi*BSHXRKiRHQKFhB yCE Hy0BѸCˈB1FFH#B i#a>AHs(A?KO "`HFK@/1=J>H$iiEBu1j D OE( $ XD@ XCAF#@FCIFErh'(=4D 43i$  XD@ XCB#@FC9FErhE#gEG DEu "F+F#}-Ki!@BK@b1JHgFEw 4FFFFF FBFFLI DEu 4F=FE}pF%ckBӮ+KO1aJHX;ch BhZ`Bh`m#kYk(5k#K@1JpjFKh[Htjmj# Fb#`k3K@!JH k@mV! jF3K@1JH@mm; F@m6"-OFF#F.S3 +L3%O=pO=@O=+=KhZ"BF9FHKF"y.@O0=l!:F@FFHKB ЪHOO PFl3F %5F 0X!UDhBUFljaFjw,Ca#z ##hzb ### #C #C<ЋKOaJHV{ :FOAa @FIFrQzKh[ #z# #zH##j@#kS)8S!3sK@!sJYF'BӸlN# c@&06B #?gc Fg #"#ig# BB`:# FjF(@%,UKB׀3B9;B@ 0gPK# e`m#l eegh#mDlemF=O)FF(Fl%m fe80D%e ciO F RF#0B F#BB'H ciB"##B5  cpY#AQg# #6 FOA2F;F#BB KO/a J!;LBAWuNBAW&, ##QF F#2C lV ##ckg@#kS& `P`C&kA`3cbi#F@F0Bg &ci'BE5  OL Y#AQ FAk+K@1Jz;ch BhZ`Bh`l 6G H$O% FFU F FXFO >-GOCiFFj3KORaJHO0$l'FFkkBHFl F+kS'`7#IF(F#BF?F(#AFHF#RFF(6h#P-AFCi%FF@j3K@:QJHN)F F"Y K@;QJ2F;F@F(d, F #cF-CFCi$FF@jF 3K@KQJH!F(FK@MQJBFKF0FP#9F0F#kF"FH'DI -(F#yF KsFhF L#h H#< h)F#S p!H!\ KsFhF L#h H#)F# h p!!KMx(hHHHa( >(h^N$O+hmB2hR[m8FS4Rh4!!!L h@j 4 h_##`!7FHh(j,)F)0 F!8F FKh˱mKh K@"h`B `s#BB 8@n @!!!lKsh;+kKԿO@bO`b`hM+h Et1Г`)=dHcH aH)h`LOR 5i#s 5#d3TYKihXKhiFRK$" *hd3C+򊀒a)Y)Y Fpa)4)2HHDAH(@HJ)h?LOR 5i#s 5#d3#a37Kih5KhiF# 0#$F !Zr$p#x3.h e#F F&H!($Ho+HH8(?iHL)h#ORa3d3iKihKKhiFI K"$ {FH!!! %!!!@!\~"I@ d"-O#F"##F## 3KFF h3ScEF*FВJF1F8F BF@ѥN2hBH@F(#AFF 3hB@2# F#O3#K?# F z## #F8mB,:FI F"(F9l-t-b- F0рI hF FpAF FS  F''~ F1F:]:FpI F1F F,O 6P0BP0BfI F>F8F7`9F FCF\I F=F#*s$$#z## # FFMI"## F## #|FEI ` FcF2KEB FB# C 2L3 #$"81PF Fq0?@1F FFFsF2KEB FB# C 2L3 #$"81PFq FF0?CFJ!HF#I F%###KFrA ld"A(h.`(~((((*)4(-KF jF FF%PMEBF1F F-!F #B2FF 8FK*F1F F5 #" F -OOF F#F"## 3 :F1F Ff?F ѪKhB9ЩI  mb'ܸA(иLСI lx luO0c иi (F0(F (FI# @4pCO!,F"### F #  h! F(F#C0|I FTB&ѱ8yI,0 )`\##b"44###$F( FjeHv<aI F&_F8F'l/;x/+8F;FZJ[I(#$kF TI FXF!  FNI?XF?l?GI0.#+Os@I FOr9FXF.B F9IOOr9F0F8Fl +@""6)!B FmF'I>i+6ii+ *cКBPi F$~3F0?(3F$  Fv0?IF F<0&IBBSw).)zd@))2)'I*)1**`*:FI FdB F 0j$!m#80PF^(ѝ#CЙBB#BB|}*-O& ( FFF7FFKmWJQF@FBF # RKhCE F$! FH7JI FP-A-FI .F f- p-YF F0O5(F 'O &#a! FF(D"# F##"P.IO"# F:F)IQFOrJU#p1##"x# F##"^F FDCFI F| F#1? Fj0F FO5h0%%**.+$+6+-CFFF'JFAF0FF0 3KhB 2I Cf-r-'! F!F F!F FFn$I F !I$$! IF FAFI%(F$$!0jr1F FBFI/$$! \AF FCFI.^+{++++4"IB@ d"FFFF4[IFH$"F I H:F1F H5*FIH@6I @ջгa8#*sF FO0M "(hH(qx+S/ Sx5h#3#b+B+Sx (ht(#(DLO2BC;S@۲T#0"-C'B0@d$FB# 070 eXO  Dom"\O ) F B1pdFFo BҌ ?d?a4pqpOt B! a1p?adqpp8$O|&F#F_/ET\CB!#3#F, $-њB!P3,$,$?OC3BҴ @/F^,a$$#0A1-CFFLy#h BFKFI0O0pFH("h I(F #*#s"hI (T/p//-OFF# h*Fs FOUڋj k#*s #@ BO0 0Ft(0FF (Fi+[i/XУj BT(q#BBH(q#BB<;0FYF#kF; PF("9FPF8"IF8FG0F0YF0F"IFG0F0ck0FiI $!80m#jFBiF k(-i/FFFFO0"1FG F]0 4"1FjG FX0 FzkId /-CF FF g[I.O2O3FF$D#@FIF"FCIBFKF(F"F#0F9FR 2F;FI.wF F///-O"##KF FIO&hF0FO O YFY 눱  ZFI@FO6 I FIO008FF FHK!Fh(I(FO08(0pF h FLKh(`0I0FO0p F(0b*F L*&a*IFs*!t*%i*(1u h+IpO0 # `1#0O0 01 1$@  F(K!Fho0 @B1 1(еF ! IFF!2F!F( H#0;F0H н^,61)-GF FFF ) FIO0OJ$ jFH:FI FjO#"# F#BFKF@ F:FI0Fj >1FlY1x1-O!FFFx`I FO6O70F9F ! Ff("# F#"#oF FCFFёI$8K9# 3O EBO F K KFFrYFG[O2EA0C1FF F+i vI[FEs FFnI2OI3 F#"#-0$jXFcI{### F#"# PFjYIe4XI O3 h Jh \"2$$g#KA #0gF0 FA1  8 F#0?0$$4O!T@I`BPPPj"5PB"+2F;F! F0? F4j####~hI)F F i50? 2 4$$j j 4j##4##4##11112;2@[2*K0FhB(I !0e%H#$"H>$$#F FHH! F(H O0jHh  #H #H8J!hFiFH!mH .33333334*!434 F$"8F-OFFF!4"`(>K>JIF8FxCF C:JhB$9J(Ff*l*Y(F5X1Kh{YF0F.I0FFx2F+I(F*I juO0&LO`ia`#I(FjbDE F@2#F!ꢉRF2FI(FDE Fj$ ! @(p(F0ѷP4t45(O'. 0^4}FF (!FFjcX#gE3#3FHCjjj F@j-OFDSFF ,܀#gCEy , L XEq "KEiBE3gE^E-i)- IgPF\I a%F#bcb$iT@gPFOI(F )-JKS! -IIPFGKHKS%0)DJ#a@F#IF]F(` gbCbIE@EciC{a#ea##gFFgT2GEE#i4]a%aii #g C g G # i #ciCahaeaCi,aa azw(F IPF@4[ IPF)%e]55@y5454-OFFEF,u1"F+F@FIFC+FE "F1D"F+FC"F+FiA1## DPFY(@#*#sxX L#EyC#i##gc#C#BwVۦBwR#CK,u"F+F0F9F\C1gD#3##gXFKA^ ,u"F+F6#C"F+FiA*1#gDggq*-OFisFFF۸yxIPFTa^uI-O4O5 F)Fi oI44#EkAFFX  E3i;a3i_a0FBFKF F)F 1#E DBAEPF#WI# EeC #cFFX Х@FIFCKFE BF 1E D\Eu 1Eiٱl!E a 0IPFm8ag.?lpai#cFF#CXE|TICi I?#F Fe EIFAI1i # e K#X 3i;a3i_a0F E55565 6D6o6iBpGipGipGF-OF FļE&EE{$%X K Bw$eF$ F)FkaF F𵋰F$ !FF8(F IO0 g !J(ȿ  Fܿ# 45:1IFK"F IH$ I H N MV$(F4, I:$7Z7г7dz$w7*"* I|O0**    7*8F FF#*"/*! *!!+%J@!HK F*FIO ** * * 8   F JR#0O08!!8-O2OCFF@RI(F&F0FhNJB BKI(F Fi(F0FO  FEb4+BFKF=I(F@FIF$$#O0CE4+ݗ0!+P/J@!/H-KBFIF(FAF (FGC&8H#1Fr0j$XC#FxcF F6F# C 2L3F#70c # BEs OO 01Z#0"#\8WEVp888!8-Od 0 FFFO # I=BF9F0FBFсKhB F ! FF#C&xI F- f- A-tI }F(F p-s-#IF F0O #jO Fh#G1?4j1Ƒ I11 4+ݗ1"SHP2BQK D0BFOI F!* ***7* c2*EJ@!EHCK * *****Ӣ+:I F*<*<Х*+Q4KcJF# FmF7 F0?b F0?\!@"u(F#(FQF F:CF"I Fr@K 81FH#6#F\<!#F`BJD2A3F# % 8/L 88"8958)F-IFFOEe jhNcFPN FF(`P2FI FO5(F FCF2F I FCF2FI F=FFl>9Y9u9-GFFBF5/ d2H O1j$$j0j#h(F##&##.a#e(a FlCF:FI F(F3FhFFOKF:FI F5FFl99-OFFFBF9F0FBFmKhB FFF F!#hgI FTr-eI O! F! F !  F! F4# $ SI$*@(rPIr($ 4b 4S"#!("#!y;! FFP%a2F;F! F(0X#O O " FP5I#" F#F0IAFOrbJU#2F1 p;F#"# F#F FCFI FI F+jEEIF F(F+(2g! Ff0n9/9:+$+6+:M:O𵏰F FF!4"hFOK :F1F(F CF KhB # JiF FY iF F0I :]0/KSB@pGd"-OFF#F" # ### BF9F0FCFJoKhBV #*s F g`i+Pi)M#BBG # F# #?F?F/ F$ g8 3 FF"PI`ZFNI Fb- F F0EI F(Fi$$#0F9Fv FyF8I F0E#EEV .w#@FIFNC )I F}%y#QF F#BFKF"?F?Fg2 FG6C7 ga0 g FY0 F# I#ZF_d"0L/E;;%;:-OgFt#FFf#IFRF@FAF KhCEI cF s-"3FF F*0O5(F# F#"#J?:A;Z #I F$$#2A3RE#s  # FI#RF[F! FF(# #CЛI F ! Fp! FjI4! Fj##Z!  FT 4x# F#F# FIuw! F: |I! F1 xI#EEuI FW%Z4j7gB#FFkF F BqRF[FcIVaF"0F<<@  #BA 6#cF F BqRI_#REs Ā{ˀRF[F! F0?#4k2Fj#;F#F F F(Q:I F kg4j 4###3a4#0C1 \!0Fz0a F 4j##4##4#0C1#  F0?1+<I 4$$j jd/;;<<6<c<<<<=/=P=d"Os11IF F'CFI#*sڽ01 {< 4+` I#E{0#BA'n=.-G F FF&'#ghgRFIF(FC,#*s F`i+Ni)K#KEBEE̱#KhB#RV g Fyb(N((a(I -i(l(H , F0,AF F, FCCi|/z$=-OHFF(v EhAHKZ >H>H>H>H>H>H#C6Hr:Hp3j"F! A8FAFx?HEWE826**H*HJx $!m#8$H>? J! 3FJH(1+і1+HFHIJ( FH == +=>>>,>P>6> *@>+=D>^,P&pF EcC1# D ! I!~"F1F( H#0+F0H :p^,g>|]FFF<0F:F5IO0`iB$iOa^R9F-H%j#+H##$$$$#$H+F#J!S!+F!J>M> "Iv>HdJ!>7>HZm#$!8,HNHL #RH* |]>>>3 *p>X???> Kn:f*oB (I@mQeppG x-CF] cJcHcJ `HaH(F_OF$ F ]#8F # 8F i.1FHF#!#"ji( &jEJ!"3F!3FBJBB" ">I""=HB->> *> ?7?b?^,:1??>!>-GFFF$"##BF9F0FCVKhB!(FRH1(F g( a(b(KI EF8Fl(u(i((F0DD(FDD#*s(FXi+ia#KEBE)(Fi(J (H'J %H%H|(FiF.#@F  #@F| R OiPFp G D#!F#2ji 86iHFZ?/'>->?>#@-AFFF!4"'KjF Fh3ScEF*F!K!M*FAF8FCF<"I0FKhB3FJ FT*l*H O01F FM0$ I O Fp0d"3@@@Mz$/Q+B@+pG𵉰4OF F#F"###:F1F(FlC(#*s Fg`i+Ei)B#BB<ԱKhB# F#"#1)a8 (!$I  F0, FC, F}H i@/z$h `Èˀz rCz ? 0+B/pG{ {S{{zzSzzӈhJp$ ]@-GFhFF ڈ z Zz "\ 2*{xs+x$O "iF@F02F(FB{xl+H$O"iF8Fv鐹2Fyi(FCjF1F(F4,4,%-OFF xk"! FHIF F\'8F 7"F 6!I 5  3 2 1  . ( ѝ00*+<%O AF0iF@IF F5-O7 A%pFpLv"F@!hFhF4GB p%FO$M:1F(F4#B%BApFK$F4 F5r)F`ip@dp%-AFF4043309FhF$ CC00#@c0 OHCFI(F F&F2FAF F I(F FO4 IB3F I(FD FAPAjAAA𵏰F FF!4"hF@OK :F1F(FZCFѬKhB#JiF FFpcFJiF F6< I FFiF F 0:CA/FIFMK8SB@D"FIF7KSB@T"-OKFN FOF2F)F F?F ѪKhBЩI F@FAo;hF($!VF(*I8F(#XFF 8FF(8FI4(AI"F(@:XFI(Fgi;+JF(%jOq(FF(݀xIPF\(րO "##1+F(F(iI0F<(𯀕!F(bI0F,(🀕!F([I0F(!F(TI0F (Е!F(wNI0F(qЕ!F(iHI0F(cЕ!F([BI0F(UЕ!F(MF(?4l8FbF8Ff$t+Fz1?@GI)!"2AF(F(?%F(ZF=I FIF(F(?F(4I(F(?! (F/I(?!"(F*I(?ꮔ!$(F%I($"& I(F(?Ӯt B:FI FFt +JuJDE@:DmCCCCCCDDD,DE E' !E]Dp$48"0D0; $1DBF@EFE$#31?II\$:F1DzB$)F0FO\ OO ZFR=J3F8 hQhO3:## 5 # #ˌ"## 9F 3e#secQFe0F^$$+F0a1? I$$1F&$4B#QF0F5a###4$#0a3P1? I$$1F$4BF@!F@FӰFF,"!##2#C.# #@%# #!K""'K P( K) K* K+ K,*F! F9F0FLSi@YiY!iYF"!hF~"x!FhFpF" FhF!lah"hFkRhh3SB"FF B J IjF ICI B $pxFY'iY!!HKpFx +FK&&x+h Bx6@C60@B0нb0+x{HwI F #`0-0нb@)BksHnI FI#`00нb@)B`jH8"!$T$gI F0(+V :aI F0 _H+\H $ZI F0WI F0 "TI F"(@𽀽OsBOHCMKx+?{LHvJKx+JHGKx+HHpCKx+EHhDHd#64I,2 F:.2>02$+*0:HN)-,˹.0**+2H xh300[Kx:+* ",H )F+H*&(O%$i) 8F.?]5-?Y, iH a8i(i\]i]!]6]D]i8i`]l]iisG|]l"]+]>]M]T]2$[\]nvVFHOsBH 82]]0 I$jF%DED D D0I(F F0i8\F"!hFjFI F0I i] IF0 KOq J H  I F0I ` za (yG]i]IF0I D I F00KOqJH0 F IoCF Hz F$i^^ (G]i^F!"! #  I FC J I I F[0I YaG*^i<^IFjF0KOqJHrI F0 I  I F0 I K^ (G]i^i^#I F0JI XF IhjF I F00I saGZ^m^i]FFFHFj(FO< D5-++ 8FT<> @D- WpFFF"! F IP%`qCFH| Fp,Fi^  IF (K!JH ! F^ (G]  IF(K!JH ! F"] (G]0" F!" TH(  0"!(F( ObiF F( H F0+ѝ0+ѽ0i+^^  IF0 K@A J H< I! FS0I O] (G]^  IF0 KOq J H ! F+0I j +i (G]^-O=$F"F!I(F0L@OsP0(گI ,P0'+ @Ȁ0F#  !(2<( *FBF', ܞK HKFKKKKK (!0!!"F 0FԠ2* "BC@2 RK$:# pO23FB󹀛 r`ObpFJE#~KDpSBOI3JBOc3 BOC3BOP3BOS3JBOB3  BA!p3!pF`Kg]H!0D"0 +b 0 D '+?e =1 # HYL 22v@B;@BؠgCH#nA2B(@O "!@B:)##D7K#%0TA$3B٠z`!+w_+WHU0+ǁ)*+њ0+𓀡xHi___V``~_]8`̈" `_~`l"2+t+ex-@΀0JB@ƀIH0+YyyHC!FHc{&{IF&;F6F@ =Zx(`IF&=F 6F@ 2D .4Yx(0HC!d+0[cx!zIFzHTcx 3D *tJtIex+FhH@qOqI53B> ;@FkJ:F(hI0+СxeH0+!y%Fx&x`H`Ibx_K:#_Bݨyiy(y HF:65F@F-2ؚ0+NH!FsF / 9FIH HI3B(h0KBsB@BJCKpEF>H5 9J>J>JBѣysF H(F EDo&yHF d  8F6H F0h3KBsB0J0KpEF+H6 9&I+J+J +'+ĭ(H!+!"+&H'+"%+#H )+Ӗ+М+HHbx!F2HHHHHHHHHHHHa ``_ _+[ __L_i___*_<_A_W_a_q_y______3_0IFjF}BF H F%00I (F$B(FiaasF FPjFI?F$0F0K@QJH FFI x1F J I I(FJ I Fe pa (Kaab8ZbpIF@O5#`(F$p~E@-I (FdFIF+F I0F0 I jF I0FTFI FexLj2bGb`biwb𵉰IF8#`O0 8F0FdKFI pF3FI8F|0 I R I8F$F0I(Fe3 FgbbibF("!hFjF I F{0    8i(+I*L!FFH^,b𵅰 #3IF0I  dFI@I0F0I2$OBȿB X(Fe , N1F8F4xi bb c sFFMF` 1F FQ0*FI Fa#cH 3c-HIFjFV0K@:AJH(I FC0|lL0@g I F00O0 'ЈC jc (Kaii IFjF0 K@A J H I F~0H &fl (Laiqc IFjF0 K@A J H I FT0H` &@s (LaicI#jF37I %]iwb F I F0 K@1J HxI Fl@BccLa8Z7 F F_0J II(FF0K@$A J HJ0 F I KF6@B0$LJZcca8Z7 F F%0J I~0I dI(FF0 KOaJ HI F@B03LJZ_Z@Zca0 +Fa+W8A+=8`#`O0F"!I F#k0I $ ibpFIFFPXTFĕ pjFI(FmFCĕ !hFIFF0FF(F@Bfvi -H F%IjFF0#KOa#J#Hr!F(F0O0 |$lL5gL6 !#F(F I F8F(Ft@BKLc (BLaf8FI?F$(F0 KOxq J H) FdI hdE 8wccLLaaرL ! ! { J HG "F< I H ?^,ccjFIF@+d #,T (2CK \o"Kn FpG BЛi(2ZI"-OXI" hF,9Mh Oyf0QI  gOJI4 B0D0A@ԱGyBBLI D0>IF"FOO F-,(FhKXxF Bi"i+>-hhX , IE@E) B(FG(!0+  0 #BB [EԿ##+I l@Eq (FG(Bq##"eɚ;6e^ne-OdmF FX )F F0I Fd&F"F@J I& F4 I , FKx F0F ~ Z"!*"ih*ih x*.6oh+9FF6(>+9FF.(6:FpI F(/khmKzh'Zzh"ԚzhzbK  xǹ F BFFCF[J[Ix Fy(-h 4UIhh9F &1F FFKJMIX& #Oa#IJj혪AFHH"AFNiNDI8Fl0!NBH"AFNiN>I8F\0R;Hr 1F FM0 ,J5IR)4H^#Rk0KX@"AFNiN+I8FS@#R(S'H>! F"AF i !I8F#O 0dF(vI#cjLf^nn"H"sLYx7fEffif~ifff(2igig:!#~JOai@8 z0:##Oa z#qJi*0+?n XFPF0D XFPF0D01F FGR ^I8F0\Im[HPFdv1F FWKx0{+@RKn/?Įh"1F FGi z"AFPFhIKRFII(F8FL0ћDJEK) FF-CO8BH #,# #R;I;H#R8I6H#R4I1H #R0H(/H## #R"I"H#RIH#RIH z Km/?l{h FG?h"1F FhG,figgl"(2ii fe5|ggSmhh(h3hgg""𵋰FFJFI I0FMF("hF2jFI0F0h+I" I8F J I+`+h"F I p .Z/k$"8i(9kUFkck-GF#I FF0!KOq J!H M,h /OyNF0FFPFXFرF8Fh?FJ1F8F0Fd H @@ p@@ (` O0kkUk$"sFTI FHF8*#`O0pBF(FF F F( LF hhF``(Fd6J hc k$"sFI FF(K!JHh F(FF FFLF hh|F`(Fd6 J h,O0p lkUk$"-AFI FF(K!JH(O=h-F@F<F0FFF Fh*C J1F FDt C8` O0kUk$"kIHгkFjFI F 0K@JHKh *F KN@ @CsC `Al (Uk$"0IFPK!hFhhCZh$"`jFI(FB0I I(F2( I(F,( I(F&(%0$"7iKllkks FgFH/gF H M NgF8  Hp!F(F4F Xl+ial-GF2FfI (F? CF_J _I("!hF"!FhFhjFYI(F\0(C!cFSI jFPI(FJ0OIgFMHZLI~B IHPFIs) 8BN?H8!V/;KFhBіE3hBHF ""D)QFAFZh)F+H m P F Gc޿T% B30FgzFHF8FAFT% d#5B 6#F &OTT .ZhVY8i(9knl1tVzlUl^,+llFhx F"!@-M&FFFFFB 08 c]F0$hj`O0FFļļĜ40 40 0 0 pj(68hkbbc.p FFF@((`(h6 F̹ph$1F"FF((h.` FN #`O0 𵥰FF*FF8:#`O0%$"!C-*~&(F #ji!F8FCVh c`-GF FFF #`+j2FaCO1BFoB#Bw#BA "#h"+O00F9FF #j)F@FU0hPFIk`-OFF#F>3#`O0i)@ )@ I>(@F"!-ۀ ->F(4I@}@ K.FD/!8FF4#p% "!# 5# 1F8FF(@i*@,΀ " F$F"x*O .Z(xOrYB?qQ)?l>A\)fAV [PT0 P p78FcF(?Q(FIF k 9F(FF(Fc/?8;F QFXFo0?.0+ۀ,؀1FHFF(@KFVJ VI((? -7-"#`,O V Xչ8F( OsP0, P > Y*## O6CO6$G"!>!QP9 F FO;+?4D2ҲxV P0O6J:,;+?4 FD2x#x*?!Fa( W<+ #ɲ CA(7<0< ,|+y#YimWmx1 F(Fc$JI "FxF F J I  0058FO6c8FcWbb-OFFF!"0F<%F3pW;F:F!FXFQ5y`hYFhF#G( F56F000+Ѕ- F#`O0(  O` O0 -OF FFF5j#`O0:Dj `#!ia00s)FPFh8 8hf($h+x-+YFPFV((iIaiybh*,?#'8hH( 8h@((x$ȹ #0D(hHF(h& I hF1F8FCck s`i3a 'm-AFFFF=#`O0 ri!FF@FhCge`(F-AFFFF&0F(#`O00FF #ji!F@F>CWh c`FF$ !FFc8K`T7`WFF !FFc(KeDa7W-AFFFhi(FFB hkaac% cFphiO0hkaac4i`a-AFF (!FFcIFp KBF`9F%`FC_a0&w F F,FcX-AFF ,!FFc$F KF`%:F6 A$_b1FCFE0 F,Fc F X-OF!8FFFFO t(JNEO B#`O0pO   BݹO|C@`+h(FZ& "FhF3FeFG(eh6!F+h"F(F3FG(eh!F4-G%FFF/FOE(Fh^h&ifAF hAFFGFPF,k74|*h"t[hG pGh00O0 BjF*#cbdiL Fj0O0`h$h0jF+##bdj| F h2#Aht0O0`k$h08F Fb`ciE``a`a# F#t8@O08pư&IF%IF0FF``""I"H#`O0Fp(F F FxxFBI Or!hFD)F/*("!F/&*("jF I0F0H ?mFm0XMmSmJimIHгm0K!-Amx " :6L%`6M"O0DC h+0H70H!B* OrB (F'!0Fh#h+%he" "  hp+OrB+ + O333H*F *F"ooYolRpovpP9ppps%&SKh#p@pG;>+*`Y T! "D!0 L IFF F!FHR*FI F &гqrr0""!HLFI b MF(` ID!H6([ k`0T9" h+(-K.6%LO h 0K @1 $ BLF K`8FAFK3#CBKK'O`qqq(0QKL 4 C̲ C $B K`!03IJ#CBKK `qqq(0A#!@C%BF#CL`BK`!0K `qqq(A#ȲC/F۲L`BK`!K `qqq(ACS_FL`BK`!K `qqq(ACCOFL`BK`!K `qqq(A!CCcoF#CL`BK`!K `qqq(pACS_FL`BK`!p(ьheI!CS C_FI` !B۲I`BKK `qqssqK"#I0@h] \9-AF!%FEE&0F9F@&FZ(9FR(57 FhF\"FIg Fb(`0Ff\v-A F xn+Kxo+4&fL%FAF88Fb(F&x!Fn+ Cxo+0b(5F b(цiIFFH bvг-OH$ F #JFAFZH&%h0F%|kSI+BSJ+FSM FSIF()FQH0F0MKEKI(FLHz``(vhHHp(FGM+hcF@I#(aFBH`0F+h+b9K8I(F:HT#:H##L#5HB+h+3JOc#AF3JF8FhF`+xS !(Fp*F9F&H"&H $ V  ShKhcCIKh(FHF%  6aHKI(FHv^,vv "ww6wUw]wA+*$Pt-O]F S 4E3Fh S3 S)FFFh HQF#\IF/^9FI8F0 +@𾀣I(F(@𷀡I(@H8/МI_ЙIX?ЗIQKB 8A(FT0 F!@ f  +Ѐ"I0F>(@ȀI F`+3O@ &48I 4ZF(@|OC& 6 D DU`"`;h# S3h {hsHOHFS(FE S3h; 0eHH0?F(aa S3h+@' +@Z" 4@F0@YRH ,?O!8O EB "AIPF# Z"(FYF!F0FFFع7Khk$9H F ]TF #4KZFA3H #  .I3F0,JOa F.)JBOI 8FOfF *?(-*O   (FaH,F6 F,/0FF[,!(F^0`EpF"zIFH |г-OFFt"F8F!FC/`KhB3ѻo^F Z#4WhC58F?4#`й.|8F0e:FKI ^l(:M(J9(8G()U(6g(8hO`gs(m(,o(#:I8he|ꈻ9I 6t(.u(8hO goCgoCoCoCoC 8hO gx8h&qe0n8h%vg #g cg.0gEPCj0oCg#0+.?V gQ(DŽx9|M d(#!FH0#F*FI [$ dOa F# Jg'!&H"# z|ل7 F"FzxB(#F*FI \0F^( FI@ݿh#F_( FI@Ϳh"FBBx ("FI &'8F FV!F H|Ob)F FH!FH4)FH8@87}L}u}KIKKKKFH B :qг8KF K%*F!Fr8F8F I !F (F8@a"z-GFFH"F F!`FHH"I FhMRFIF8F\C ыKh/ ~28F(S ""!!!!!!!!!!!!!!!O#W#!!!!#!!!!!!%!%!%_&!!S&!!!!!!!!#;#G#{#!!!!#!!#!!#%"%%%[&! &/&=Kh=I 8:UlY#Ob , hh  F%-A]@O E% ;H& )F8F`0\hK+QN *J"F #s EOa(F#'Jf # " 2@C p(0оpFH#H "! S ]+F"F I "F H6Їۊ|"8F F!F HOb)F FbH!FH~)FH8@O87}L}u}Bx**I @AF@h#F(F^O3c`#h"!XhO0#hhe`i#"!(Ft#h(Fii6F(:F1F(FChsFOzrF FhF!ZC(#2F)F`hlpO0pGsFF F#!F`(F##2F(F hJhB`h(ѠhFhF`*FIhHO3Fp"P(< `0 <pGFFI°B1>FOS"@#A# #>#? F!(h`d IF HH#`O0B B@}o 砆-OFFFFCO0O QF" @`DOrOSD #$K<h0`EOsD4z 3##q"8I8F~78F#x:F1I :F.I.z ڀ' 8F0*h'I(h#F=Z#Ob8`9hh909Iu < @ 4b/((y|ʎ?,B_8 d(#!FHb0"FI [#H#H#H ]F H ]F H H 8 h Hh Hя 7 F"FxB(#F*FI 0F]B( FI@ݿh#F].( FI@Ϳh"FlBx ("FI P'8F F!F HOb)F FBH!FH^)FH8@/87}L}u}pG@pG8F FhHȀ(i ahi`aiaia(j bhj((X`bS BB heZheh"fhn`fnfnf(o gho`g88F F`H`hH`h`h`lf``lwhd V  lm(d L lcdBlYd mU(e`mQhemMemI``peQ BC p`"54S+BE+8#FBT#!A#38 FF88  FFSBB2s2sXX\\dsdsfsfszszs|q|pcccccvcclccbcXv\C\BAXS jBB b\ V $P$(J(,Dc, cccc cH HLLPPTTXX\\8-OFh FF&F``hh`Fh`h` `H`iHaiaia jb`jHbjbjb k4Tc41R BA UJ\BF1L%2-T)FS "G  2*CEOr5q5p`mxheFmseFmne nj(f`nfhfnbfFn]f oY(g`oUhgoQg"0"KE" 0FDF@F@F8F<F/D#$%B\5SEТ.D#BP%DDED#JCB4%3Q#G#3R# F#3TU pGb#0B Dј#@ @CpGp FmFlF*h KB mp)FOb F&H&qfq FF(h `h`h`+[#B+г&tO#ct##D^t0FLABLsF"M#) F3?hF:(F Ob!(OpF FP#L"#r"pA!papB!crpr#rs2F)F3F[#`N F`pF1 BpG3+P@-OFFFF# "`8F\xFFñQx)PI;F2F XT+O?K+WB+VG+P3FIIM+@S+#,L#`    * CC f h"*г $ XE@ EXCYEPE#;F2F/Ik+b+g+s+t+m+# # 3 3 3,""`####FDEu  KhE:F1FH #BA Kh#1FEH#:F F)F I;F2F #EI#;F2Fϑ0 "CL%hFIHIH#hN+LO %%THJh#F0hBvs nn * EXK\(FCKX*A5(xhBhA(8*tncLO   Oe  0  O@   O   O I H3hk K{X "L ", "U uӜгD"p3h$5+$E9h,+Fs4EnBErEDE,u4d4"@\$T=h4hi~q;a#6C7KgOh{h3{`Ыi|q3a#C ;h3;`Kh+`n   C*1C (khJBTkm[Y9QkhBP5mXC@.+@0`nF   L *L FF#Oy F CCJFF3@FD#I IFOyIFQC D@3Z;3R#kBJZKh3ZK hF hPn Oy   $CMK)ChPFYFH"@\!TI" @\!T:I;H akHDkhD`kd# VCw2F;F#kjO Dkb#IkkkcKu"Kh0kBShEBv|n ,uE#BCrCD*s2b204BE HD "<:U , "L "гX "pFMF+hùy2!F"0F2: Kh[ h[+h0`[py<:, "KpFh!F+ OtOd"FpKhy3)F#0F3pc)D 1 Fpy"<:-O=OɰFFF!OrF@9hHK)Mh#+FF$ `#"0;h+@I F+h  Xk(́.h cl# C sQ rkAQsn"@#Fq#"4+h k #ZҲp2B3+##O &@O; BKFh3A@;h"FkKhcKJF1`"@FV(FJFXF@ !JF@5Or!=h0Ozp!CC\`E(k@ۀOA ###O3F #B(=h #aC l yOX"BR" $ ;h [n%@#FOyZFKFFp;hr  .@݀& HD 0 $ %;I+[FF ` OzsSC F.I#"0u+h Xk FFX $ g c#d`CLp8@q B (BRK #  C#F4 9CD 0  Z <: "X ";", "=T Oq!!!!OAFO3 #aP$1=h #aC l yOX"BROY## ;h$ Xn  @ C,#F )C &0F =I-O-N|M!  Kh+` Kh/\ K4h$hDC#0  " " " "( "8O9O O "C@BDA@8F!FHEFA"O18FO1F ?!F(F "A18F~BFP-OQ ^nMF(`(O1 ^dK`(СKO`K`;h+@O2(5,%0KhK)h4ܘH +h)ܓH ~KH*hhFhcPcJ BЎH m+hYkK BЉH b+h2hYkBڅH W+hk_ORH J+hk?O2zH =+h BuH 2sK,hh0!kBCB\mK\@FXEhKeh+AFfH+hm**"$%kl\kPQBdaBd`lF!e(!Ye!F)XmB!cFf( *F!FIHV ,h1h`kZ#!FB@j@J  cf(Bc@\B @ ;h+U)OF F/H  ,hOR,K'zq`k\5###k'd1h gO3s84bgcb<#cd #Xs0"7L5P5g1X "L "` "<:d "@:D:Ah""ĝIt"" "Ǟ "&T-hzs t~Y:FA Jq8v"FAqn9FP0`!F@DO io0Oz`+aD#``e>g  gDC| L!DDI#gBFsHP JKhhbokFO{"i iy+op1FD:F##@FIFC"##:F#A3FF#BB :F@FIFA3# # D+ORF[FH!0$U--B̿O O [D # DCOHAxO 0A(q0AO JAzO KI-FF@!n   X@BXB@C yC OAIqOB 0 k S OA PFYF  K PFYFX(F0A̧# # cD F # CsIO02E(( F#BPE8F 0RF# L XFaF<:F Aq#xCH2C3#'RF#p`HH-@J#nG H  DEڢ xP ?OsHx8FAF#FF`0HH-@"nAH)DEJFH  ZX " "@^Fpo%n8F)A#iaD#`aF0F 2`Eݸ Fiy ,-AQHH$u/@C H  @Ul*D DbD:@ RJh*oSC*30c " ak#p #O3"IAH@LC `@' v+O,%x#<#(5#06Kh# 0 5׻\# BؿF\3Bm@1ep0IXernOl 1fv3 +$I #KO0!\5zs#k bggKemh   ! BB !R@FOIF":Drv"# #%"%O R<:D ""T8 "X "3h!%ZkR 3hJHHR`"hI `YkA`RI `@%lb @!_ȿORfJhcJheJheJh b|rXT~rbbOr HUP p "T "P "\ "H:"4 ""X "<:"^F "ޟ "h "TH "l "H& )"h!FKhF*WѡI#F*sڞH #L0+hJ1"hZ?XF [OY# 0IFXD OI ;O`Kh+𗀄I"### h!hOPoOb_Ob1h(hwKh)h0h3h0+(hOr!Wp;h+lH$;h+@0hiIj\E =B#ii%aCRCsh CzAn    )!#CCF#UJLTKTIfC (Hѽz0 ;h"+:2h+jOC,F #$4|O`QFLF)tQFOPObNJFF(`ObDN#P# * j:BAF9`#{eO3eHfJhfn  2n3#Af fH  " "3 """, "KTk> ht@X "YhJHBI5smxBp hj:bZhB5smxBp hj;b0kS#@ЩI"D&hhk0hcMB h@0OnDKhkMi"DB@SB؂KPh$5+K2h`ʄKhB яKh+KjkhFK LhPn1Rk`#h!K h!`0Zkd0NzMk0h_ )hOT DvKh31h !D(h0tM`k.o oJ&^ChTD'F \5.@ӂ D!DdLBi$icCAqhUn[LAx\J  C'#hh1CuPPK\%BPKh+'43D40jB@FHRP \.F44 D4[|A4 d4Bt!FF+IE U@,D40HDKED FOq 0 CSCGwBqH( c0!O U L "P "T ", "\ "p "l "TTH " "xw8hN?hK`I{`$` hȿ2n{aĿA;g)2"2ot[KEԿgx#eH mH;f?{fzn0BݟH^% Khj Db*?'F<J0hJEJhnBEvq n:F 0$5+ ݄Kh#@n\CT~K`hi3ayKh+Epn 2khCETkm[S 2C khPCEP55XCm@#0pn tFp"2KC0h @+Z3+Rk7D Xh'FBvsn,  OX4@ UhCj3CbKh2FnBvq n0$5+9K.h3FnsBXXB#@\CT.Khi3a)Kh+FdkhBTkm[S 2C khPBP55XCm@-dFAF"2KCAF0 V@+Z3+R806D%U <:ƠL " *%Jk2JcIhriBphB Fvv2n,gBOXzB47\:C2ThBj2Bbn nD#7FoE +?$BFQ#@4A#@ 3   ,@ 7+$EB#FQ#`6A#`CFB4 @D >w @G OF)kk8h o+nAvB9@ETDF4 @D h DBp@"F# # E*FD\5FaJB i#iZC#FEt%FF8k k k:inEuEs#  ND"C)CF@B +DKh+@G D?Ȭ. 3@:K:I*F 3MPC#D\Bi%ihCCshCw`n  +C&#C#H#DDBKh+0j; KhsH+ L Kh 2  >#U# ԺU h "T "^,1 ".4$0YKhXI WL#!h`#TKh+30304040hKkSC#oFIFMObFN(h/hb!`3h9F h'h0+Or! Wp7Kzwh5OKFBF?3h+#h9hZkF"hPnHL  Rk. @C;hA "K"JhFhB3h##hFZkK"hhPn1Rk`0!K(hh #h8hYkI |M+" "X "<:l ", " "D "\ "P "p "h "-O}FFFFJF8F(2FbI (`I@FO (FO60F }(."FWI@F CF h+IFQHkk;j`j`#k+ackka#@0+bB0kbclbPO&BIQF0"F(F*F=I0F,;I0F 9I0F7I0F5I0F:F3I@F .0"F(I@F (0JF-I <"!8FHF 0 &N6۲C0BcBOТ# (*#4D*#0a "F"#(##*#d@edA%=FWcuzd@-Am%OcFF)FFb.CF*FF@FF F M 9`#3#(F mF8F F!F HOb)F FH!FH)FH8@ 87}L}u} %pG-OF FFF9F0FBFKFvFFO`i#lP4\D%O` FEE`۽ #5 D#G XFaF-AF FFF F!FK/IOF !`#q O1 FFϱ2 !F F[H! :F^^F: p FFFn2Fg2F`2FY2FRppFF F*F((mep-H EC geE\EҏBB,  gE^EҏBB  #Bq  -OFFFF# "`8FpxFFSQx)@I;F2F lS+ G+B+M3F:IK+FM+#k+@ b+?g+ # 3 3L""`m+s+##`    * CC j h"*г $ XE@ EXCYEPE ;F2FI###FDEu  I;F2FE #BA #E I#;F2F F)F ϑCLIF F!FHT!FHP (гn  FyFFF2B2"h`K-GFv FH!N<:FFHEFO TE Op1F8Fy1F(F  3C3uD #"(#"!BڐBژB pG АBИBA pGp Ll(V5.cnP 63D.mD0(Fp#CBFJI @أ F IFFhFKh3K-CFhM+4Ѱo1.Lh@p-O~i60DXC`*N(FO 7h9F'K#BFy!KZi#KhSCBӣhB 9F0hIF@F MIFkFObjIQ,*Q QL] 0B@ 1B$1hM @(FkFOb!F#"###x"-OFmNFF4FXF[MF hJ hI^KF+BF *CѲj# !`,6G҉JCFLF[J4 [IBXhZF+F@!kxAQJCFSILF4 ,Ckp,6&^h+F ,6;Dډ:ځ#i;#aj!EECFLF:J4=I8OI9,f@F'IFF$&@FaFhXF6  G  +  C+FC0F&9F$&@FIFKlXKX QF@F0pC O (( d SEB+F&9Fd0F(FO\"#<^ɥ?-AF9M, 0 $FB F[\F("F3F@!1,j2FBؤ 0F\N FxP)F!"0]\1)0F\4 \@ J I4 CT,6&h3F@qF0F\,6:zB2h;`kiD#A-Oǰ F!F ~KTKh;ЪI"F Kh{;@:FIKGEҤICF:F oOc"FI_O3"FIB;F"FIKhK-JFI FNl F8FaeaZFF#cB 6 8a FSF@FOIF FoO̿!!$FHqa gBw# 2F;FxIt & XGJ XJ x9FD{!FiNF@s2h * "2`1h BB82``JYFh F`!FF X 9 5HF 1PD "B٪!FFI9IF 4F0AFD@L+AF HF3`O2 69Kwh(SC6J( cK `2K!b c#0/HݹdUef P  #ceKX0R["I d%#S#cfHfKh->(F(4I"x"|"-#X٦??##R#?QSN~ #"")FH#0423l f+Bm?bh!ciO O8"jFW8F EOE8@Fx8IF?H8FAFHc!F@UB 0KB(F%e@KOh@F[F,IOBF!;jF%F{n m 0 ;/F ;sD6ELwNsK2hF*)#O\L<bF XlKhCkKO3hHaJ;jjheH)FZC 6" `L#!a#O3"AF`(?WI+ (Fx   H1 1B(F ) -F9)<DD5!D)xQF "i!7L#h#0KzJFSF1I L0J0CFJ1Ȁh.X?+]OPPO0L3h+$H&3h+U9jkzi#!JF1tKfAI (?ѽR0"h3h*:+8;';0##x"#|"#Ч "#D#[k> ht@Do0XC#P#+)FF$&F3A    FH`OO FD?4BlH6L0Cd0 F(> 0hI#ObZ@+ 0 OiO  PFB&,RD6 0HF  #&yKhSFZF!@D́!nHRFp6;B0 O[3.sEOO1`DPOhO O  C 0UJ 1  3Pf$&B,6[D&hCKQD  !g$#>I. 6; 0>I>H##2FHN y HH[FRFIFHB OFH: FH2s+ݥB8F$:UaWsulF.MzG|h/hF՘xxq\[x""H! @ o/ h3՘xq\x[x"H!/'h3SBF"Fh `0+ѽ 0hFս(FHFH @ 6 #zѫ-CF F>F!F"F (Os F&;1F됱}Kh"!0FhBF!F(FC F&HKh"F IF `h+JF I Xihh{`BFh#("I 0I L#sFLh (hJ@FHx Hp"!(h(hJ3F@ b# #/Cxx"x"y#FnKFH]I 7 I#pD F"F2 D @@Cp1k3D$# Kn:f*oB (I mQeppG xpF%L8!*h/<1D<1!K"`. 81;81+f<1 #<1KO2`LHH˄`p<1<1KO2` 81381+#E(#xг0F- gIgH\gLgH`VdeHPhcHJ`":d2B^H@ d2+th?ph?E[ D%%:k{{rݔk' K7E{Ik HKy)F4BH*+S+  ) h,8I 7I@@џ!@ џ -Hzj{k{[S+[ 0k!H:{'{*k{S+j ?@@-C6?Y@H#?#\uEҬp##  !  Kd2+Կ # Ki Ld2 I`2"Bȿ2E#FHh%81C@0"IFE+FHEڴI #"<:sSFv( 0թH#"!+FO (ڡII #<02@0h@POzqFXPehO >-t%5(F~# xMKF*FBF  OEaH~HR~K"!}OaX`2+F"D3`2!#CjI`C[{ ,ձ@ # VCwgh hPBUMt;F*FqRHC VMK(<gV$0kA#F;CD;KEPSDA;YF;H ԩ;@ k{{*3";F0FAKE*v;cD"$I{{yQ#( CgDHBerG#K D𿚙##?`}#гE#8#$###"###ɚ;6e##-CF%KFFFhF lc|+6#zZB/3#D h3ScEF"Fh ` 2BI"##х 0  F:81FFH@F ##-CF!L -FFF @h+KFBF9FHH1FHh? П{?H!!({S+h= ICȻ@@#ͭг K Lh K*FzI#FFH #$^,гdLIFF Fp*F I Fl*F I Ff*F I Fb*FI F\ г<E-C FxF0 * *ONdx *"F"p\* Zx*1F@F+F"p4'*"*ѩF;B+9F0FMF;瞻г{ FKhhSIC h\B Kh ( !`(O OCOC`O0#$Z%#$FFFP;F?'`#S`)I`F;h&K`h#h$I; h\B^##ty*+%'+' "%)h ;^+|F(F È*# #IH #@#ct=###%#0h!(/##$#$Z%гhhFMNO F+hh *3h[S9hO  A L#"`c`y b2D F#$#$Z%$$ K : *B (IO QppG г-A F1IFN("/I(Fȹ-I F)F Fp#F!F x(Op/),#x+x/+ IIH+/*F[/-e)F FF+/*K+cx.+ F&F%Fr*9F(FX=EE-/*1F(F.F4FFNaVR^,0-O]#*1#3@#(KH-K,K+K.3zH`PS<+TщJ#3J`J#3S<+3F+K^OFtF~M2F9F(Fh(F|MbOa F*h+hmqK3 + F8D"F9 + +# SpfK!FFpaxs1 @n#$BHMK MK MK MK MK MKMKMKMKMKMKMKMKMKMK44(F((F `CYF0%IDH\F @F( B=IH^F POb A0L P5I0h P04F(F_F(_(F.@I FYOA>#$Z%#$rNгӾR#$ F] $YN$$y\uӼ&EkĽ*Ll@<0gqHz0[;hI; h\BհKh;h+I@F(?|I@F(?u X# 0y oObIBFHT\F@F9F@F3m6LK"1F F#'FCO !B:  Kh?_FO (HDQ F%(FO  ^FIF8#CCB0-?mB?h=#7BB8FW <8FE8F< +#< +#IF7#PHUKhr:FWIUH y D C| 2 KIFCk 2 DCE@I B6 "SE3EF  I 4IF j(0+I.HI -I +IF R( ] #IF#H#h3#` IF 2( & nIF (sZ%#$Na0г!1 оMa : IF F(?LI#h HHI #$г a Kxi+ H3#!pH #$$$WKFIF"Fp IF IHb IH #IHH +$uz!+$QFJFKFhh\4$@ KhK J K I( FF*F3F IHd FZ%F#$Wx-CF4KF4IFh h3$OO\B *Kh#F)I)H0@F/.%Kxi+$Kh+#Kh{gd!!JX-2F;F0F9FFxF F800C0E F2F;F-F_C〶FZ%#$x#$#$ FI:K hh\4$C PÈ#CÀCy+Y FZ%F-O HJF8F[F2ÈFCÀAKh+(FhF F;F*F?I;H7L&0F=0FHJF8F[FFvC#h+?e 9F(Fo;F"FCC#h+?K F0FU;F"FIZI F{6by*0Ncy+1F Fo F F_i,JF[F8FF:Z%#$xLгr? FK8Fjb[FbbJFFKh(?@ ;FIFH4:FIHn(F;F IF Hd(F:FFH +$#$xг8K-Gh7I7H7M&'#BB2K3N3Oj0F9F6GCy+,Is h\Bj|,д00; FIFFPF F* Fi,jD mjcy+Ѵ0I F3h; F9FF@F F Fi#$x9Z% +$#$SZ%q-CKhIH&N F4j%OF<- @M#j$RlH_%K-OFhݰIHPOOaMJ;hFHFL+hJxFR+;hOaJ~H+h |H6ByJ}I }IP?KtJyI vIqHv0OasJtH00R+0OamJkH0hHCfJbIF0bJ^IaHaM#^IOsn0: #l0kh P(#pCO `HzhX.MIFMHP0FNKH JHn]?!XkFHF`Ozr#PFYF*T"0D"p;`;a&kk # #X"+l! khi+iki3F4&I'H>?$Hc"? #?;ixan#$xZ%Z%FD+$#$=JZ%gqRгNcͿD[%2L#CchpCOZ%-FF*O)M@ Ob1Fb( "Kh!I"H F2B#0"a1BKhIH\$XD 6I(#!BB0+2F)FH>Z%#$гgq-OFMFFFFFX#"FHF+F8G M#"FHF+F8G(KF>J@A0F=MD0F<:iFF#`F(?4I0&(9SF,8.I퐻FFO F,yoObIXF2F$FFJFIHJFIHF0F.y0F84"h#f:iIFD+$Na0Qг(-AmFF>Fx/*p$O&AFF8x+0F!,8$ F m3iFx(FFF(yB2F)F0.(&hD+$gq8P FP~*iFFL F8$FFh2 F@WYK-OFhVIWHnVO;xR+ TKOaTJTHhTKh8SL4#+ QHQIQHROI`FhXJIFFHbHICH$$$#`+F!X" 諉S;xi+Fx+<,Ѵ0Z##+*.Kh+0 F.F 0F0FL0FN0YF0F# (#H0F8[H(Fbt#$xn#$Z%JZ%FгO#$#$#$-AFmFFFFF(2F;F@HKOr@a(F*F;I;H:H0hX7IF5H m"i2M܀F#?hdiF,(F0F o'F(FOg:F0 KmFH FIhXIFH 0˹:F0F^0KmF H F IhX IFd;ջгD+$Z%f]#$[(    L4#+`#x#+H@vFBijB ћibpGiBтiapGF+I F FTFK#BB"F+FHoO F)Fzh:;hES"qbC"` Khvj O#BB9F0FvjZ%:$#$pF FT K#BB Nrh3hS"p#BB@j Z%:$pF FTK#BB"F+FH N F)Frh3hS"03"F+FHp@ZjBB !2`p$FZ%:$-A!mF 'FkF(FFkFk/..pAF h@i,$ F m5.$j8/!FF$ F8#p(F/##pF(Cy+)FH FL/'6*yB!F H F)h FT !5B|$7-CFHe@FOt F4XWFHO50%[#DB >DAF4hF$!`D,DN:$XZ%-GFBMFF 6 WF;H0!&(;#DB0 &F("!cj F6`)@FcqIF/.0F9FAF&H@Fz `@F"F!da q Y$bb!"F(4/!@F0b `ea q+ja,b0F9F}FHigaa FV0F9FiH"F0F9F:$sZ%FK D4D#`:$0е+F#Icy+ i I F#jI FgV0F9F#@I FI F B0F9F9i0F9F F h K&FbbнF+iBia &7:$pFFFwFI FciB F+jeaa,b/!0FNE hx(F `(F q F!hC p# FpK-OhFmInH&mKh+blI(FFhhWhIFhH)FgH&'#`F#BBAO &'#BBXYO&yhB0!##RK##QK##"OKh#F룉[ hW=IIFBH^)FGH FZ0F9F7F6G  0!2#FrnKF0F9FF6G$" $03#D0i 0 i 0 i 0 i $0 i #F"(!2;hS&0C"#F!6"`i#$xW#$=гr:$Z%Z%Z%Z%K-CFh~I~H(D}O"#!x`W8`wH#"#tHÈCÀ5"0FF hWkjIFjH1FiH@Fb( hWWcIF`Hx1FaH*!0< FWF\H"F)F@FD(+hW7VIFPHX1FTH~@FnRKxR)r)uPK#BB)АBqBIJHJH z0"@F(DK"@I###@I#@Kh b ##"~`,D(<`)D('B4(3( +D(B]S(,*DC(,S,C,S,C,S ,C ,S,C,S,C,(3HT"D"2#$x:$Naг0:\#$Z%Z%Z%#$Z%pGKUżüKIHm Z%г@pGpGFJahS BDKBKm I HX ]"S BD H_%IZ%'г KhD`o J3 Im H. nF]cA$Z%NгKh)Kh,K$2IHr FJ 49@# F0KjFIh(hW IFHF$$A$гyNmK Fh3K FFHhhGKh I$*Fp1?KgmhW2F;F IP H F#$D_%E$#$A$Z%г8MLt4C0+"mIHK!a`#e## K##t4+t!Hn8A$Z%#Z%E$KsFh F3K FFHhhGKhK*F!Fp0KEmdhW"F+F I` H6 xp#$D_%E$#$A$Z%2гFN$Y5F9F4W((FpF LKbh`B NxVVx0IH\ 6e`pNZ%A$гhF,K-MhC|5+Kh+O*N:! F>`Xp D#Ep F(9  I FHIH8`hWJIFIH8``hWxJIF434!F H@,FZ%A$#$Z% }O ]F$-CAL#g#8F=IF=Hb##Cg8FF8L8I6H.uP85INs5N>x( F"8+F0I1H<)r/I.H6A2#8F#(IFHF&4#5h#C,8FvF!I(F8"KL0h)#FI8I0h1hHd3h[I JJ8Z%xV%#$г?Y%"Kh(K 4 z̹pGNA$-O(L #F9t44c(дHKh+LOFFFO>`zK=Fh3|5U(@Kh+)IHIH#+`Md KxR+zРK0+NFOO.H0Bl#9Ci  9+2ѐK(FIJKKK<)FHON)F8F(F,2hOa `3hԝ4 + `)FH~)FHxI `O0&93A 9F3F b(FYF `6 .)F NFO 2FmI(FfO)FkHFjJkI(F(F:hOa `L;h WbI `/p4 + aXHWH Du $VO"QHFJ8`?hy MJ(FPIp%FHH$:hEcFHI0H#;`FI#BB g@IBB#;IFHl7H8IFHdO#) C9;h3).IHN+\K0+@+h+'HhA$>$$Z%#$xг#$Z%_7Z%O!@)zmuF$N'Z%Z%c|# .). `>O*si>BOqs;hKJKI.ؿFH2F>?r `-+H|&t4+?\! H#t4.- `= ^,гV%E$-OFO#A$-GmVN"VLWKWO5F#e###c`##iB )hK+HEMKPP-F2-(F'8#BB=3=0hF0E(F8#BB/J=3=O+c`0#a0ca0ala##kkc# #kc# #l#d ##ki`#`+h+L-*IH#= mK##K#eKH HV%Z%#TA$=гZ% 8Z%Z%-I=#vK h+lqKiqKBpHpHt4+cmJOfiM't43t4$0B;c0+XC c _Ki/# `Bw#1!G##4kC<|ڀF0BI(F(N+c@L#h+i@K"t$ ?He`( =+# `Bw1#!G##@FBw#OaFGc0 4@Fr#*s+h+?_Kh+KJI9mH `#!Gx3%5E0B FV%TvA$Na#$Z%xN$I"KFͿZ%L#h++V%-OFM#(eF +k k# #C###+lPxpC`O.س_𺀳OIг_.љKh#"FIHVK3іKh FOq F(bhV"FIF O?г@OгO4+F"FIH(tO )|Kh#"FI{HgO ~Kh[ F^È!FzH2nKh#"FwImH# FFHF##oIpH00.0K^Kh+"FiI]H]Kh F`"!FdH&(F#C F@ FH>K;Kh F JJq F( hU]?I"FF1H~#C F FBF9F F,)F F.,Khk.HCF.I:FVOF F8#C F FBF9F F)F FKh+VCF:FI1F FZ%#$x#$_%г F A$#$Ha4cA$IKh#"FHIIHHKh FtFKOr@a F@K(phU"FK=HL(hU9IFt"b|O+a*iSB3Igh+I1H#HgX/Kh+).IH-H;h+I)H)L*H< F9(Kh#"hxCp)#$x$A$NF$г$$Z%#$EZV%#$J$T#$@Z%Z%Z%Na #$>\Z%@[%L_%HR.]pGгK7Fh Ft( 4hU+F"F I H0 Kh++F"FIH0@#$г#$x8FKh"#O`AN( hU*F IF H F8Kh#*FIH$#$г#$xpF N F#BB F)Fp F)F(Cy+È4EZ%8F F-, F)F8 F)Fx(Cy+È4E5KFIFH"pI㈛IHI H㈙I HZ IH[ IHHN%u#N%pFh$F{ I; h\A(F!Fp%,F2FIH Z%,г-AFMO.FBFI8F8F(hCh;C`+IJ ,0hCh;C`+| ( y, hZ`x3h hZ`x +n,Z%гHR Kh{ H(F H( F@pGг#$C*FFFKh\('hUtI;F2FH F*Kh(hU\;F2FIFH$ KhS I3F J- F H Ij$#$[г#$MVx FF(I(HL F&IF$HD`i#IF HH#=K+FF `0FT-18K&hpOȿOpCcE= ho7+F&AOq h#"E=!+F h"+F! h hC Z7 *_+-+H)F 5F+FAOq(cV%z]m$V%Z%0ðFFFJOqK" FZ`*FC0V%Lbh*IH#c`V%%𵉰 FJ!FhFl"iF H(F DB*18h(I $O T$V%p FF F J!hF>hF6 LiFF h*F1F h!HVpV%TFJP!"H]W)FðJOq"HyC]O0mnpG8 FEx- -a*F!FF H@h!FFHH8@񹽒!FFHx(7((HpGHpGHpGTNpF FKh*F I hC `C!+2FII D"!(h+hOrl O2X` XBXAp Fc&0c&Y3.L#hC#`(P(OC ('K(ohH`Fd!FP`# YB1ӛp#Sp(OpC@O`O?Ӱ`0CЃ+ò+ oO3F F0c&I n; f+X1 m ZeppG  MF# FOaZI M]x-OFF)l>H=I8FO5"G,F"@ *kex#x;C3D2 *'V'@ܳ/Dє?- - F#F"0"!hFJF!FhFFJ.!@F"!hFJF!FhFp.#BF(FAFPF67 /` H, FFg$ xc&&*_&KFh+%x)ГH@xK)H!Hx;+ C+++F}H}J}H|Ih ah@i!iwH!0+ tIL+F`ih oI硈nHኡd++  % hH" gHgHgHgH"!BcH@aHaH~"`Hx "^Ht g;+5201 403OHR @D=201 <0 ;:98765438H"j+#5H##硈#H))*H ,H+H#!i)H)Ih;(H'Ij4&H$I j-hx c&t$ջ^,8Y ,c%9\O-OkN$kOFF0h!FE M<` :FIF+F@F%""#D #!"F DTBWI(FpSBFSIFD! (NI5DMKhFBLH:;h JHN`84F4O B 0FT FF0 FhC6#c# C-;hy B'0##p!F"hCF=0h7+*hF%H4%K  h+) F#Dx F0FHx8@0DFHH #BH $c&c&% c&Gk,c& f&c&FHKIFH г-GFKFFFJh!`!`I/ hC `0/ /)ЂH/( /*/h,hh0F{I#pF/// vJ1Fh3`F+F @FlhhliO ,i##pMк"Oр"! F>!cF F_0 _ aF($/#*((a إWA إ7m@p3 F  Bp"3Fp3#pO F!F0F  O /!0F`F/4K0FhAU/!F)FGMHB/#00FAF백/ Khfh0F8(0F/Ѫh!FgOG0F"C0FQh(0F0X@Fhbp! h|2FI bc&O0c&v0f&YFM$`Yf(9F4(ph,NCy ˆry**0D@񼸽@COqJH|H"`&"KF"HKK&](F ((IIHIH!*;00:0 J #FRL4" Hp 0BB Lp3P00  !:FOrHH0!" <F(.!hFF(I0(p!hI"`&"a&v0EhLh$, -ԕ!(FQhhYOrHH0 FI,OcOqJH,B$OqJH,! OqH JOqJH"`&va^[XJQ#LO. ko2s"x!D1D9D)3B#Hp"`&"b&"KsFhFOqH"`騹.!H쀱AOrH#xkOrIHHpK"!ex- - F+F JOq H1F`hp@ Fp@qO"a&v"`&gDx,,p#F JOqHH@@Ko"`&R-AFFY)F0F, F HA*F+F!FHAF"F!FHA F*-O$FF FFD"#"F!H% TBLI(FNرSFFFD!(BI5DAH.uFFh:VѸДy BEOx[IԔy0B 9Fy !L;x@! +4;C3D1 ) #h P#"! Ih JHFI n; f+X1 #DB0FOS#@!0mZe "p4Fy} O# ]#!"]-OF M'40FFFF,(D+V\O5 `pF#"2K!F (IFH6 xpгH>MINFIK F7hh4{3`7@0qBN@AAJ3FL@Ix3FK-AFhm+;H =!&O0"AFF F #!FOs0F+`Os+K0 1F(Kh+ mX"AFOc+`Os3`K7 FeT# r`oD# `#*c+F0 thS)IFH,+ IH Kh+ Kh+-I H4o&6Pn&o&[xLn&o&-GF7KFFh+d4Kh4Jh ,\1JhJ,T9F(F/K"G=+,K,HZh+N3h+, p9F(FG\,$H{FB, HGU0*F9FH3h#HF)3h+PF G+Ln&o&o&xO+Dn&ջ0QkW-AFLKFF h+@IKhHJh-EJhR-|DK"!F8FA+?K@HZhn?K- !F8FA-6HX6h+4+!+"F9Fxa,H@ )H4(H6-,'HA9F"F X FH"F9FH#aHLHH A+ѢLn&o&o&xO+Dn&ջY9)0*k>-CFOMFF*h! FO,AHI FȹDFO2oCe#T8F.0,ѵ@ 1 "` FB "F1F2H+h+ x+h+DF%F'Kh+&L)!"hb$KhK#oIO8KEBE #1F-#hcKhKoCO2BB#1F# #J1F##J1F #o&uLn&o&Dn&-OFbNFF3h!F!O',S Jd4SF,`HFw0)FQHY#8FF FJFXF "F)FGHC3h+ ,8FFPF8Fh+DFd,HFH0Ѷ@ K&F1Kh+0O O :h,Kh#)F-.;h$Kh#)F#-" FX Jd! #F )FF-_@F3@ Jd!CF # )FF-Fao&Ln&o&Dn&-AF6KFFh+d4O:hz3Khc3Kh2Kh+W1I2HA0Kh*Jh -I'JhJ-A!F0F*K"Aa3'KF'HZh;h+- !F0FA-FH ,t7F$%B )FH A@F+Ln&Dn&o&m&m&Pn&o&xO+ջ+W-OFiKMFFh!FOX ,j F F ^J ^I TBF4!lO FO *WI(FZFOS AC818F h0=Ѵ@  M"XFbCFE @IZF Vh"+x(ѵ?ZF8Ik  QFT# CD#P F#F/Kh+.MO+h+KhCFOR0F,+h$Kh Q#OR10FFV:F1FF @<0h8FR P0F@#"F1FF @<0h FRro&* i?PLn&o&Dn&FF " C-""P0 T +"FI KhKh3#" FbKh!FH zHZ{je[KZfke[KK{KS+fDn&o&o&ջ-CF`"*x FAF/"#KHB=#X FQ:FP #O3#"F9FHFC|M$D0 (F#CR!2B2F0I &0/#C#C #*F1F &Kh %Kh%Kh#)F0Ft3FBF!P## 4nBܸOhKh1FHOPB h8F!F#@F4fm&Dn&o&(Po&ջF`-OFF.oKh# mHB =#p ("3 SC8FQ|FP 'O3 (# 1F '3w (":FD@F0 FOR_ p("" B*FLI ^q08&F8/F4O ZCEݸ 3RF!+F 0:Kh+N#("1F8F (639F(" F(O fE(W   #C W#C W#C W#C #WC Kh9FH#H########m&fo&o&ջ(PF`Dn&0FF" C -""80 <0+*FI KhKh3#"(FJL"h*K)FHZh#h+ ORp#HfDn&o&o&O+0FF "C-""0 0+"FI DI# h#I h1#" FI hYK]h!F*FF H8) H2 H,fDn&o&o&O -GF=JF09h:Jh*;9Jh*7+-7Kh6Kh;$D"FQF8Fr0@FQFFQF8FCD\0#B (FQJF I H%#F)FHq(FGQ;h;+R#cccc H1F1F H1F H1F Hm&m&Hn&Dn&o&Pn&JtFF" C-""0 +"FI VKhKh3#" F Kh!F HT HJfDn&o&o&ջK"-C8KMOxlCEK/!ZpppAF(F@)FH C\%FFD)F2FD D8F#$C90BR@ "(0AD*B#3JpY;E#`#B(FB002hQ!FFH=Op x!F ")F FOr"pOs#uK8 p0!FoE# nKh[mKhCmK!FmH"pjK"`s"hI(FZ(jcz=+ Й8 Bc #DaKhaH #0"!6O #OwOs6+` FKKz0!FX"AF\Zr6KZS,[oC,`#2F+`c+F08hP!FF?H6Kh+5Kh+Z/I9H;+0J7J""5I(F(jѣz=+Й8 BcO D=!@FlF0@F.oO 'Khv t0+#H#0 K 0 Or@F0Or # K0W/B!F $VRPn&Ln&o&m&+o& /K_`o&0P!FHbxB=#<"I(FhF(#z=+?8 B#DKh+H hK!`%#F K`KpKhF!(F;Kh H,-YFPF4ేhO- PIFHwh*F{N~IC00F G#3p<,?'#  b0 @!(FO \/.JF(FD1?h"+ hP)FFVH0[Bx"QH)F#h+-++.##;3" #1F0!׹ &# .C /##.0##ZFFh+ %h-#--# F# I#I F% /+FI F# .+F#Z F#I##(F`x4 0lE)F Hti0fo&Ho&Pn&o&m&PF(IHdFYQF0G FsOPػh+"F0F# I#*FIKF0F##Pn&%LIFF F*FI F*FI F*FI F*FI F*FI F*FI F*FI F*F I F гTu8FKhIFpF CF )F H` 8"F)F $V*FFHfq&L&FmFFOahFT "FI LhF m pmFFFOa&Tx8H)F mpiF&(Z)FH4)FH,Lch hC&h Pc`#h  2F& ( eq&mFFOahFT.8 H!F: mKh  hiF ( q&-HOLMFFF0 +*hOa FT !FrH#4.iYF0F  FjI0F(YFh F dIh8 0Fh`IF(q^Ki ]I(,!(FF#p F,#3p=SI TOK +x3OHr(FP:秱LK@LJ @E @Fp!FFHXz@CK @CJ>F|9KiF8IjP?e;IF`.?\F7QF(FȱSF"F1F2HFBH F(U%FpFC^B^A#F2F'IF'H(F"F1F#HO 4+ @|(!FHO#F2FIOH  q&D*x:KtX^гT-O F- " F ܳHx O`hCO\ I *F ڧIUE*FQFH,u,z,OcMK'#C(F&+ +@ TFO 4qҕKIFJHKKKS<텋#(F:c +MOUOK+Oy\'+'N 'O ZFz+F!0OI#z"FCS!0vH P fOqKrMOCpKpM';mKF{#dKjMu0FfE8FO #0 BKg3D3D&+? +<z'pj盛r"FIFMHpY"FAQ+F`"FY+FAQFxV {02FF?H'{{zhB1KF $%E F!04I)JE![CSz0!JE!r[CS0IF!H@ {0H'{{Y@#.'}\c^,)))430 FOI!2FAQ;F2F;F)FFXF"FFH&+jOK*OXOC)[F4 '+1vM &'JFgCF!l0?T RFg![CS^0?Egb[!CSN0?6_HPF 2FYAQ;F^2F;FAFFHFV2FY;FAQF`JAF+FMHtu+rCOK*OX[z[F4'+F;M &'CFg! F0?ݮ HgRF![@FCS0?̮ P g! PFZFOK"[CS0? {!JIF!H'{{ { 2F`Y;FAQ'{{ 2FY;FAQPF2F;FAFJIFHY@^,5msIFH г-CFMFF+hFS!(Fh` H P@=-۸1F @ꈹ;`(@;`=q&0F )9*(;*(:pCO;гO1jF!*(9* e JOa(FK(Fh/Kjh+)FHK Fhv0!FHjF!*m(jF!*fF(* H6 0 q& FO%Y|QK2FIhKO2`0F5.(hahHx+ H( "!h Hh J` J`P&S&K@P&&Ȧ& KhSK"IhCZ!Ht&&$q& K$` Kh FKhK" `!HR\&&X&@&&-C)1M MFF-L FF;F"FAF(hp(hlObHF ( #K$#I`3F(h\ MJ0h320n+?+!a+ p+q+K2FI$(h`:K2FI$(h`2K")hH`3F2F I(h"&f& (D&&t KhKhx pG&D& K-AhF Khs M! L#/h&h+`!`/`&`#0&&&D&-A F&"@K>Ih>K2 hh"3#1!*1FF-5Kh4K5HhP3J (ѱ+F*F)FfF,(&h+IF'H$1%K !ZhB,ћh #5IFCFH:FRK ! K(FXhK?#BA$0FNqj#&t&&<&&&x&K#CJKF"+x&K#CJKF"x&=-CMHB\KO2` M(XJ (UK$ !`TK#RIhbHPKh+PKPHhNI l!LHhINAMIO#x ;h#+`"1hF( L6K`+h+=Im05K"F;Ih!Fh(6K!F6J.h5KhhFK`(9$!KKAF,HO #C*J+KFDE )J"hR )"FRK! )h) Kh+Khh+hKD+`K`AFH&&x&&&q7q&&X&&&&<&=&&( FMSKO2` MI`h|F0KbhIhH "I0FOLK&`#CKF#Ob1F(F((F,3x+f`;F"!F &O&$x&=JK(FFpG[*nvL(O3#`HKJIh#&&?HS(pFFhR "` h(NhI0FN8##`-KhKI0FN0 `- Kh K O0pKJhK)F*FI[*&nvcJKK`4&k&0KO2`Kh+KHh@&ܦ&&uJKK`&&(pF'M#'Jh[ `$L$N%K!h%J0h)F#IV#h+"K"I0hhN1h H#hKJ!`(8O3+`pLhI FNK"`I FN K` F(Krh IhK`&$&&nv[*& &JKK`ܦ&&JK K`p&&LK"FK`#hK"`&(&$&JKK`&5&-A F,N(O33`(&L'O#h[ #`("I@FNa#I@FNZ `%h9hKձ xhH##`#hh &K``Orih@FhK xhK* FIJ- F Ij&D&&[*nv&M&Fr&JKgK`&&JKYK`&&F$L('O3#` M3Nh I0FNйK"`NI3h h++B `IJ(h+ FI3h+Կ##I0FNK`0Fv(zhI(hJh[ `"&&[*̦&8&nv@KO2`]((JiF(HYh(KhKh#KHh HYh( K"`# Jp J`&<ܦ&&;&&&8(MO2*`KhK`Hh sF 40!FH F8@NN(н8@a J Kx1h I^#+`hH8&&C&&Tm@9 KO2`](( JiF(HYh1(K"&&𵅰8/KO2`(,J()K )I$`Q!F'H"M%N%O"FFP <K`h#x +`+h+!Fh(!F0F)h(K"`);h+K"h`h+h3+` K`&&q7q&&&&@KO2`](+JiFo(+HYh( Hh( K" JiFT(&&-GF hFII/xpHED(F(ZCKh+zBKBHhGs@MO `>M^p/%=HFx;K*F(FjF0|#z)FF;.%F#JF3)F/K0F,M)I(FJȱ+x|+(F FP&KO2`| FGNݹF!H($̱I(F(JN(FF#,,,PX,KO2`,#NC &&}=&-A@MKO2`(X+HJw(C;R#!B#?Ixx|+ q(9Hn($6Ih5K6I` !F3H/M$1N1O+h+;B3h۹ 'K"`BN%&J!(Оh@#3KH,;FR$ `F)hKh{K"`h +h3+`K4&t}&q7q&X&=&&pFm@;KO2` mp! *FQ$ F4,! .H.L/!(F F$`AOb'Khk'N F1h1hh;`+ -#KJ FhH!FK O2`!F hZ ` "p" FB1F cM H,`#+`&\̦&&&3,0# 08I7KO2`0(4JiF%;+0HYhB(F;+2,H4F!F*H2F Fb!F F-#+"HF!F HF FJ!F F-KHhjhh-+ Hh!F F*!F Ft KO2`1&S\dow&X&8(MO2*`н8@ K Lh #x  Kh#x+F H8@߹JI#+`8&&&&8(LO2"`н8@ M*x  Kh+x+F H8@JI~##`8&&&m@cKO2`]((JiF<(HYh[( Kh Kh# K Hh HYhG(K"&#ܦ&&"&@KO2`]((JiF(HYh( Kh Kh# K Hhf HYh(K"&Uܦ&&*T&-Am FFFObhFXo$B iFH( ObV$hFHBObAFhF@4K"` m &1@ KO2`](JiFx(!H&\^,@{ KO2`](JiFV(!H&q@YKO2`](+ JiF1(+ HLJiF (&80' KO2`8 L"B%h"`H(%`IhH"&ܦ&8C+ KO2`8 L"B%h"`H%`IhH&ܦ&80 KO2`8 L"B%h"`H%`IhH&ܦ&81KO2`Kh+H@&X&81 KO2` L"h!F #h!F &X&!F #0(tKO2` Lh!F Hw F!F FHfF(&p8J>KO2`p(;J&(XhC5K5Hh1K2Hhz-K0Hh!/H(-I pF [z{)Khd!K(Hhx F 1F Z#L#I FR F:i!DD F " FhAOh8GKhSK"` 1F + J`&&&7X&. &9@&JKK`&>&JKK`&K&FFN(O33`(M#+`KHh+h+h"Ih H3+`3`, K"ph"H@Ӿ&<&&e&&(7&L %M#%H+`%Kh+h#`0 FO3(,+M !J##`(h`KhFK? + F !,`F#Ob#pH)h2? +Ob!F H( JiF(&&r&&&&(&}(8!M!Jh[ `J`(O3+`8LhI FMK"`K`LKI hJh+F F( FHIh#h I FMK` I FM~(#J&&&[*nv&_KJh+K#K"`K`ܦ&ئ&&&KJh+K#K"`K`ܦ&(&&&8F F)F F8@ۿJKK`8&&JKqK`P&&(-GF FFܢ(;O0&&%OOd'%(nh6I0FM(4I0FM(2I0FM(&,Шh,h%! Y!F TF%!K!K` Khs KJ IhhKhJ+ FI%KK`KhsKJIhhKhJ+ FIQF IF  # &&ܦ&&[*nv&&0 "TK`&0KO2`H( Kh Kh# K Hh H( K"`# Jp J`&l ܦ&&q  &&&sF(RKO2`pKLh#!hH(M "ph&(qxkrhI h6# hRF HI(&&&x&   80 KO2`8L#H%h#`%`&ܦ& -O(WKO2VM+h+UKVHhR(>+RKh#NKQHhD$(h "NNYh`+h{KJ`O , cHILF 0EF3%CMch;c`+\(F8 (^ch;c`+_(F. (U:J(ѦZabi2`+0HFCF#K,HhK`0Z x{ /+h `hRE3+`K"`,23+` 3a K#<#hZ"`x +Ѡ0KHh`#hZ"`x +&Ħ&& &I H&&& >   N0O33`p((J(!XhKF? FEIZhKh,u##& &L0O3#`p((JiF(!Xh1?Kh^h I2FF(F#*s##&& 0KO2`(H@IhH@&  O2K FI@H2Ih@/=& -A@hO30(( JiFA(XhOF(H"F`xK*F(FF0F D F"F)FFH"FI8F"F1F8F8F8F#0M0FMMt1&-G@ *KO2`((%J(#HF(:x K*F F,F0b|#r!FNLF;7h# !#`)F0#HKRhl(F:F#LL&x&ܦ&$&(F FOO3;`hI0FMWXI0FMRI0FMM($hhBFJh3*hI$IJ`h ` h In#& h$ &, &&H -AFFFF8K:FIAh@hL##c`0F JhF``B=H"hIhA๽&s ܦ& -A FMO1)`( LNOXT<[#+`(AT,AF0h4*:F ""&P&^, (LO2F"`н@׽Hh NF0zh0h I@@hL#k`*hI0h##`&&s  80 KO2`8 Kh3 K Hh8@׸L#H%h#`%`&&& ܦ& 8C+KO2`8Kh3 KHh8@ L"B%h"` H|%`IhHv&&& ܦ&  8+ FPKO2`8Kh3KHh8@x L(O%h!`Qh HE%`hH?&&&& ܦ&S [ h;`+ڊiB (D hZ `ppG-O]XaKO2` ](J(ЈK$'(hBфKjhIh "hh4OR}I'#cC&yKxKO Dh0BЀsK"FhF2#x310]lMO [#xӹ+pkM+hhh_?F``JeHhZJ0B4$+ \+Kcx54<#x+4VJhbxP1@## #dF0;bx P1@:B3(FQ#r2R#Di*4B (FS \S D'+p5H/K5Hh)KO2`Bz21Jh'K0Hh/JhZ%H  "XF&*hh GJh:0#K hORH 0+hhV/?6B?&> Ħ&&  &H&$&X&.ܦ&4&&FhL##``hL#c`hL#`K "`Kh Jd!F KhC:!HT\&& &&  Khj Jd!F KhC!H*& &&-AFFF%hI*FFF23x ;۲+!:FAF0Fع] ;۲+ I!FF0x ;۲+!"`(F%FpFh F:!0F령2FI(FKhKh+C=Kh*/JhB9I (@7K+@{B(KN?#ЂBsBM?@IO?慂BAKh+@#LI hK h#RK hLI&t&H&x&&@&O'"ܦ&&}x&=HOR`xB*1+/ѡH/KJ3`+x+𰀛Hܠ(Zx+WO: (`F8FxFIF(F`F($+ьH#x+YF FbEFӨ!F8DF(0FK6+?+hzK#CxHV "+ " [x+x+PEд$3t@3%! Fl!FgH3#O2>3(F=@=1'aI0?#@3 =SxC?#xcYI F8)FWH= FK#?=I3?3+h#`6 "!P+3FO DKP1F FxQ#R (hK[F2F!F:HO5+35H(`O50N1OЀ FO TX #@C!ii谹;hh!`hMX!Hi,(Щ1F@B>JF1F(F:i+HXAFh" @&^ v x&kgq&>ܦ&&h;hi"isi[ (F%((FO5#I 1L h(< I  h(< Khc,/5(FIN3(FI(FI(F#C0ЂLH!h #I(F h#$~IyK|IhpKhT0$rHsJvI3htI(F58(FUqKhcpHFnK(FnJoImJmK) FFjI(F+8&XMeK,FNKh3QK*F`I4h@BF^I8FbvFKh3IK*FZI4h02FXI8FRWIM0SHp Xn'5Kh+8KMHhv 3GB'$ (?J((?x|+! 57I 03H12KK1Hh6En?-NEBB)HJ)I+Mi &ܦ&x&&Wfr&?HgTH'B`\=qqH&KI I  Kh* ܬK@maJHKhB XhK'KLh ```K! KhF 3  O3 O0L-Jb H.n8#"1F``h 2hchBFэH(h"+- "#`KHZhHI33`3hx *;*ЀI P~H3x* *-xN3h#2h:"h#!*8"#["*FBs"#"#"#*s"O "hB`hyO"#Fw(րZKh+@lF( UHߺJOFO #C "#' c FF"?RFYF@FC h* #* йE ;HXDD 4Kh5Kh{Ԁ(O#REs aF6+?y -?t3h+_'9F..*#aF0F,@9t J:pz>ڨQ-i& s&h&& `&$&A&&@B# KhBr+?-?%3+!%oHoI`hnH- lKh+ kK(qhKhaKhBOsqcK h!F#  |[KB& #3?H)F F #a#G!Fb0 KK h28IIF FTDK#*s@K ! J>H˻     ~  xC+1.KhB33L8I$2'/#K##K##K##K# $m+G+K#R  I&N`p&h&&Qt&=s" F IF"("I F@#FF FpI FFX"I F(#F2I %h++HYPxC" I FF Fp@@JY]Rv -O]FF S$h)F<`F(L !(F8O XF ]0 "@xF3J3h20[F% H IF(@€I "K(qx+O ((&FIF(RЄI(x*+0x/*XZx**13x+wK#CvHp "(qx-+0 "(q#Bq "(q]IDرIF,"(YF(?cO3x+\TNI# FJJI0HIGH S R32hhh3`9I7IF(?8hJ #;`HF8`/I(ڴ,,.1F%H6O @1B@3B +xKH6JPH.Jh+`3H.O h$H&cCx&GV`s"s&M K@1Bh+K*FIh S R32)FPFh S3hhhh S3h`+K*FIh S(F3h HO -?C(FJn>ܦ&&m𵅰#!1H4鈱/Kh++!F3'I &I &O&M&NB Kh+3!F~:!R#(+h` #+`!R#v4hdI Fd8#x|+ FJ#3`+¿33&X&}s&&t&}-AFFGI "F F3h(F#3F,8Dd$/ --#03 C..FE<P  /,FJkh20[$ - O$p,d,)-;KBFp3$$hZ`x1.O1K"`AF IF  @BB &Khk%KE иٸи? GKhkKE йٹй? G0/ܘ0+mKh+?hGd,X$cܦ&Ԧ&@&&&$&@&&&}& N4hd HKO2` F@pGO I#;`1 F0h1hH<0hKI"`@ ;hF;--k G)F D&w&&`@&-OlMFF"!H$$"!H"! # KIF8Fx 4僧 (hJSFJF9F}H}KO2` OrYiѱwHnvKuJF`|JF9FqHhmKO2` F9F # %S@C!iiP@BQF@*FQF0F<0Ki3\H3F[Ih"h!`h2FVHhi0i"ici[ (F@((F #"iiPF(#i$00YF2F(F3`NA JF9F;H23J`(Fh3h00+ #"!F#(F/I(FV.L.I/N `(FN#h0`x+H h0hKO2`$Kh3K "Ih ($"Oq(FOrOq(F lM&&&&s&&>&O,&=D&ܦ&-OM#LFpN_EFKJSBB0OcFBL"!`x(}HvϱJ#`JSBB"!`xM.F((`ډHZO KKh#"OqHcx+oтKdh+6\p/0}K~JhhO3`{H)`F ( :tHuJuIh *qJh:*!lKoHh$#0mH0+()cx+9bKgHh'YL hO3#`{+#' ^I ^H  (_PKYHhXKhO(hO3+`#0*HKRHhHKh *+AKLHh $ IICH(6KDHhCK'`_`Os#h0CcCC B"c`Rb4JRhB"K3Hh0 Bѝ0Bѝ B)KJS BB ѽ(0[c#"x!F(h@(GK(hh/~WР&&& p&&8&ئ&̦&ܦ&4&&M&9`|&8&eؠ&&&X&&cx+O XF M#"!#0h+hc"Oq0eH"xdI(aHaKh #"Oq"!WHUI0TH!#p(PHcx{+QKKh+PH0+JAK  h3ScE:FF # < 0,@C' H8K9OhO3;`[F'!4H/2OF (;h+/K0J0Ih;h+? $#0cx+xyby!yxy$HFKh+?ﭻ +h3#'+`O  O *"*`+##"!#"FР&p8&ئ&̦&ܦ&X&&&M&PK-CFOLh h/1F8!:FAFe@! h0]#h9F#0?Kxh)ؿKh@!@!`Ob&I`8Oba"H09F r3hs# 3`;FAG2`Le&)q4&1&t&X&&&&,&&D&&Ȧ&@&8&P&&<&&&&(&<~&-A/!F>F#p)HB0F!@F /##p1F#H !H!M1FOb1&;w8F.#DDHx|+! 8I] (F` #5H)FwK`2K /I .H.K B ؉D(pCOK$IhXMK,&@&{h&H&&ܦ&&&W&Ȧ&=&@&&&x&-;} ej"Oq'Q# 2F;F(jKH#(K+-FH(쮝K"`8  5KO4 h+@MK` 2FC ؉#;FHKh*܋K@*1JHXKB HKMh O0 3!  |Kh+?{Kh3zK#*sxKhxKh+1wM Sh;S`+ AF .@kO4#BAe Xt,@ ZdH [%DF!;+ UJF ؉ M ىVKh6&(!OH  # G# $ & F CK#*s (2h +L:KO0O1# 9hLs#~ #PC 0F#PCV hY`x]I#BqK haK# hHx&Ct&@&& &$&$&&H&&Ȧ&h&&&M(h(,` # # kKO2`W  r q +?{ Gv fv&&-H°JIhJ#` Jg&'KgO6O7IgKHhKhn@ +EхKh+^O2# Jh 3#!~H(Y|L%#h+P{KO2` 3@܃ 3@݃vL h(O3#` +@Ճ +@كfK !`eK`_K$hKh+,Ikx-+ +bKbIh^K_Ih + B(FVI  UI I KRI(Ux|+Q!(G/!Fh+ h +DH{ ##pB! /##p(;Khh + Oq:(4H4H4H0Khsh + ~ G)Kh++K h)U+(8!HF( +]+gH@k 8&'@&h&H&&&&&&@&&&ܦ&&W-;}pP&gqNaȦ& }JhB!zK@yKhB?ۮ3!tK#RrH(Ȯx+!lH(jH !hHz(`KO2`dK#*s I+M]I(([KI[K`[K`C؉p0 pCOPJ#`OJ`OKh*1NK@2ANJNHx|+! JI 0D+FH1F ,+[-K Z h +WKO0O1[V hY`x L I# C I`WE hY`xL&&h&&Q&qA&x&%H#%IEB hu!K h\# XHLI hD!hH CI Kh+? q  { v+?' G" "h&&G@&pGKHh2&881KO2`8M"(hF8 H<KO2 `8@B ,&,&FIFF F5)F"dh;`+ڊiB (ػ hZ `ppGFN$YF9F4H\((FP L#hK H I z0 `#hOaHhK*FH&&L4S H I T04OaHhK*FH& ď&^,-Ch`#FFFSPձF2FFEиbE43FF$,Կ9FO1FF8Q-OFhF8I8FBF0,` ,Y0M1K1J)h1L)F0K1IFhT 80F!0F+h<+zF0Fh4X?FCF I:F<,ܾ:FYFhn "F0FA=hGCh " FQF (( &%LHQ&%T p;M;N+h0hx!*$*8JhA)1F3x , ,,T1KhQ)+F#x ,* ,9$1L1`*`&Jh)=)>F #H!`Z*`x!*F!`J`!`!`K`",\, Tx2T"F{/"/ "F2K#K2{#F#F!`!`J`0&&H&W& KJp` MKJ)hL`"K`"``mFF(h#h3#`p0& &&&&&H&-GANBLF3hk;!h8\xFH ! ?$V O.FV  sF2FO OO O O%@P1FF(q =J1F(F 4q7J|42K"FhCO c FFA @FIF&KA k{7H{{zB?\Oaa FJ1F(F>D8FOaalw F$"$ KhF;CI FFHK"Z`320["I F^K"`I FF K"`I FFK"a I FF(K"Za$a$& f$/r$h;`+ڊiB (޸ hZ `ppG@KAMh.hO3+`>H(7ўp`X&D&&@&$gK-OFhMeKFFdLhdKhkt'(>*t 4 4$_h/8F M4+@PKObhD&`&X&F F !FIF F2F I(FXF`2F I(FPF(2FI(FJF9F F F%L&&&OaL F p&K"-A`KLMh/hO3#`HN(% !H@xCx"+0#@1x B"T/`"*Ѽ"0+T3#3p&̦&ܦ&&l&& @BFFhFhFIF E8F)F(9F H +x/+0F1FFF(FJ(+]/++Na&-O$hF'FB4$$F*KhC(F'h8D9F:FB 3hS'7XB8FO  O 3hS 03FphRE =4;  OEDDF.FB3 #"L&&jF K IhhC K0н *``P"&ht@L&(FIL(I "hKhD#` hKhD `#h+ JhBĿ#` h+JhBݛ&&&&&Jxh320[O0 "tzxRx*J3h20g+ b+@p]k+m+$ F2KhF!BOqA0+I :#h+ܿOS#`#hĿO#`#KhF!0FBOqAp0I+h+ܿOS+`+hĿO+`#AOqK0FP0)hHN#AOqK0F@0!hH>p& '&@'`'}'-A&4FO\] BҞB#;p - =- ئE4"-\- -МPBU84-OF`FJF$0 ##3U%+ yB4F0 P M-€%-ӥ.+yBc% B@4Tm-n-c-03qKh0mHnI+ FF.-c-@pFO xF0+Dј0( #108   03x/(qE1ݻ{B.-3-ѣB PcE@򊀠 PB@45T x ]+?zBi3U4/+  9qEٸ/(9BRe/ B]ټ O<pUsEW9%BPO4+%5TB4>#4psEC 04qF0h!I+ Fx m-.)?$B1U4])K0kKhxB1U4]) K{B4PdF,FFtFF&&^,&}&X& pGFFFF1F8FFꈹ J"`o#` J"`O08FC\ *F"T,##`>BNsh;s`+ 0F (|o#`3hZ2`x +0K#`'' '-CF LFFO FP@sFB8hFHr EJFI #cUiH%RC]!DBKI8hJK0hhhhB3`   &&'' ''&&-Ol FFF $m #CQF@C8FZP@BI"FI0FKh+AFdFh$+3 gO 0+7!8F #h @Ft ;pOzq "r!&BBh++ hA+?{2F#HO2&0"OqA(F 0; #BF!(FCF3FI HG$E(<#`<&(^!(N( &>8F FA)F F8@gmFE[ "FI (I t( F0"FI f(I JI V()-A#FF03F FKhE#HE #H(F(oۍNO(pЍKhLF(FH D F~"FF"FI0F"F)F0F~E}H(F@܀zHF F~ F!F FdqHF(F !F(FV,@iHF FY F!F F> x+Y_H^KO2`$3h*F8h+?ZI$P"CTMVHB5UKUI8hOKO2`Ec#=(F!F(FES#=(F!F(FEC F>I\ 0h;9HYF F!F F-1K`1KhL1KO20O&܀`.KhBq@Fb︹*IOR)H0(Khh'Kh:%J#p%J`$4,^)H(&r!m Ц&&D&x\dow_)&D) 'S)&&X&H&Ħ&l) &&&&&@78!  #1hTCu E#} $DCE <# a FF#*s<#`O4EU0t#sA1#F`x&0|h+3h+U <n#"`8F(d # ^h+Zh#+DBD &hpGjpGCjK!h"C-!f ]8!0! D9F (F F8#`Cb$%F0!(FD$F`*FEb!0F#ObOq0F0 FpFh h`iE`hE FE -OFLFFF#h+ !(#h A{,j~CBiiHF(4F6"F +j+bi#DaFAF2F(hxAFh#+3h+.hbh+ F򴀃(@#b FiB!FhiD("FIFhi ,bao "!F7O[ FOF#!S <CB <0+H # BBF E̿O O )Kh0'IF F *<#`bBqO O c#F F+ 0t#A1s#`  B!ȿ#(h+hDB"+FF P0 + K#`#ob'''pG!P!Hp&K!Z0K<13Hp1hGpGp&Z)K-A°h#KhCKh,@ BL !F!F H! ! }HzJ1 zHzI !<hGuKFuMhaYf F8F4(iMa.ÀlF#hx@+/jN#hxS+@fHgK*F h#hx#hx,+#hx##hZ"`"p11h[hG(3#h3#`UMUI(hFhKMSN"FOq8FH FJ)hMHBLHlkFF`01Fxa08x + F0CHX3008FZ "pT(:O9Fx>8x + F,H63x;x,+x +x#Z"pOJ1h[hG F 3 FK!FFh3K1hGIH&&`&p&L*x.Z&Xt&o2h&Oջ*3*9x&*K! `d& IK"`&?!KH`~&x& Kn:f*oB (I𔸚mQeppG x-G L"OF AF hjl!N%O "AF h" 3hsHFF H6="I hEx&Z&`*x&&H! f! bLCF3ИnBH! L! HF B!F >K/!LA FP`A" F< I HH I !FIH>Iw*}*Zг`**K"sLXhI`1N[P+x;(F)FFphP"IphLK" h0n+Hp&Z<&|&$&*P" HiFI Khs K\A F0(!FHpHRlF*&Z**F K!hP FX!FHPH2 &** K|Al#x[ FrK!FFh Zx& K7FLA/! FHA#J F+Fl0!FZ3F pFx# + + `F+FK , ,њB10 p3x pSFB-AFMFFx*hjhFh!FH$F4HAᾣDR !,.O)@Fs##h4F0X }**-GmFbL)FbMF h`K"`I`"`KXh,_K"_Ihb"  h # 0"  hR*h 0*""@ +QJ! PH0OI GLOF FF#h" &0 +O3#@"h 0*(/d"FB6H5K<1C 2Ha31J! /K"&IXh)F Z& mF+(ѝ 0+ + +p K<1+HAFJ[ERFE H##`x&&&o&&l&&x&*Z*&|&*0ŰOr)Ht0f &HE0"H*Or H]FM ! FI Kk)F (݄B!F x; HD F++,+9+ZZ+K-OFO"FFXh}IO|I zJ!F@FxK"xIh t<(7tKhtKl1" oLOFO kh;k`+&(F;h+eCc(Ѵ1{(_ (1 #w| l+hZ*`x (k+Ѵ,1+  pO  +д1+д<1+DHAFl1+#0Xx F(FFYF $I<1%K"IXh#J! +|h* "" @BюL#gHiHH2&d&o&&l&x&Z*&|&&h+*+&ðOr9HF(A7K"7IXh! `! \2J!(Fr0K"0Ih<&-H&',K<1C Z)Ha'K""IXh%J! L! ,! (C (F<FF2(݄BK!hx !F !F H F+&o&&l&,+Z+|&&x&+ðOr;HTF(A9K"9IXh&! ! 4J!(F2K"2IhN&/H&L'.K<1C +Hap)K"$IXh'J! ! ! C (FFF(݄BM!F(h!(h >!F t!F pH F\+&o&&l&,+Z+|&&x&+0LF h.I(F(JCchCc`! hL J! F 0#ch#cx&[*&0 LF h I(FHC3! h 0#3x&[*Or6HiFn(a4LhFcy#cq0K"0IXh61 #10#00#01 1 #11KHi1#!1K`1 #12 #2 23Ht@HH+Z&[[*&nv"LI h  h"I@[x&{t zt F,!@ 8F F 8)F#( 0MGI M0(AH2Oa>JF;KLA:K,F | 1J!F F C -H Ob&I~FBѝ 03 +IH,HIH~oIK`!Dx *#Cp H{B8+T+Z3y&г+T++x&P"IHHDOr@!L( ` IH,@OriF HHKhF!hkv&,&,9+Z0P"MIHXLHQC+H M0(55Or@! H5Oa JhFJ)FhF+&0,x&8,,Q,],8AP"IHFй HI( I H8@' L*FlVl1+Kh8@a8 &,O_,Zx&pP"mIHNXLHQqC+H^ mp5(F5vIFF 1FHbJ5l!Z JOahFjF I(F J&q,x&x,O_,Z,,,-O(FJ&KO~ LO7 5FOQ``!`2KO J@Fx$BFњJNh)ȀI` *ѓIH`PF8e+,F+U 0+9+@E+>0+ѯa+`c+cP+хKIh(F(𖀂I(F((FIF(~I$n+|h+hl+If+WFp+7fs+Wt+lJ#O1`rJ`rJpkKHF(nI {cK"jIh8F(M"gI8F~(H8F^IF(?daIVKh`\TKh^K`#Uh [INK/!PFDRFTI>H >EKh `8PK"`4睱NI-%-0; "6&`'O9$'"O7O5CIS"PFj4J`3KK"!:"FI@9K"!:"1I@4K"!:"=I@;K"p:":I@+K" "7Kh 6J`6Kh 6J`6Kh5H5Kh4H}4Kh3Hw3Kh2Hq2L2I"F@1I0##`/L"F@.I0##`,L"F@0 ##`Y'/"+cC&&t&\&ԦZ+fi+2ft3d&&Z&Z&s&h&2& (&2*l&&LIFF F*FI F г22JhI f Np&t HCh;C`+C hZ`xKh+##@ &! $KH`8!FHL&&J! M&J! E|&0F 'I"&K`v! r!F!H HpLDFch;c`+ FB"p N JKh #hZ"`x (pB3XBXA0I& & 9K? pGB pGKO\ v^%?'+)"HpL !BaxFYpF)*F@2[Zp F*F[_pp3& 3(K((O^@0"? O"HpG""&&FHlLMNO < <KhùlF0FT  <T<*" "F8FD 43TXZ3"3&0 LF hf)Fv)Fv F#SC@rJxCCJ C3$#q$d$$@!JAa!h` 0#cx&d&ZKph#N FB (h+ Hw#x3D2;Hp@p&&13TK7nM0<KhIJ+xc0BK" h FBkx ԝ F H FhG 0* 5ZHX&x& pF+L1 xc)MBT0FA#I F"K"`p I F%`F(I FI FI F"FIH$FH@*F(FM!N]C@C#@KU1)$ F$"$FZ&L&k[0?3г&YK1#Kh HZ&"LK!FXhK!F"@h޸l&&|&p°#M" (h&F0 +M##p1빴B"#1y#0K" XhhBpB*" (h;Kh( I0FK`n#y#0#1|&Z&&J 0[ `pGZ-H!M VM! UI UNRI L+hPO #03h# 0O2!hFD(ݽ0"DI(h4( ݛ0S+W+B+F0Ob0h O@ ELh+HF )Kh+ O1!FE"F 1+O;h+и Z"F!4x @+|84E x ^+9h xh;`+ڊiB ( hZ `p&x&l&&&Z8F L hF F8)F(Рh )F(4ZCABA@  F F@y! H@'y;+&!0h&)F0F蠱P0FBW(F`H#y#P#qcyCcqhB`+x !;#B`+x"{ 44 IF0 n F; f+ oBX10hmFYep0pG pF0L#h;!+.h0Fh#hD+y `;+65.555? #h"+"` 0#0 `! )hH1FHh#h3#`0F4#h)FD `0h `1FH#h"+#H#`p@1FHh#h3#`(BpL& j(4Fp\x B$pB F Fp\*^*]x@=\]x0ֲ.؝x0=., Jn#BSx<#F?+x0=,04-CF:I(? ! FF6=! FF(:#p FF(Py5[#(FF8F4F. !`y F4#h+L#h+H$##`LIF Fl(F;F)F?! Fpp F^F!@yph(F#x!+ ` FL!F!F@F #L&Z;4M< %LOa$JhF\10"IhFFX N!O*F@1hF\(Fu0#u0 M <D  <4BT<hD<3hiF8F !hF#phF- [ZR4O&\4pF FFy[(F F F pI0F(FF)F s$M N<Hx Fp"I(h 1F(hLR"I(hD"I(h@(*I(h("40!HXO! H(K! H( x&f@E5A5xt yt P&p"I$ v K,3CLF0 f pKjK" h F@5F@8B +! @;BAP&Zx&HH!,0@h5P&"%L&I h L"#I h! hu;@ >! hu"I hRH{0(3(HH $I h~"I h8 ! hu"I hl hx&xt yt 5555f@50F 0=K<1F,IYeov(? x)&4+t#[H2A@FA"#F##PFYFRHQK"`O:O;2 ";FF i$#h x)О)DH2; $ X x)>H2; $ L ;%$  B-?d =2"P ;$[ 0 ;$ E% &-$"E ) $; 9 ) $% $- $8#Jo c(?H! cZCF+GD@BF5h6v6666p&6677/?̮30FAF i0 AFFn B/H4.HOO:O; dn)H)H)HF)H K{D $dTO34+/?H hBH;2 /$r+ hBH H/?j7/7A7S7i777778-OFO0 ALFO0AGFiH8$!"F fJ3FhQh  bI"Os`K##o hi FXZHO O O4O5FO ijO TF]FFO21F ?KHO:fO;@FA0FA F)F:`K ˹O2AFHF9HCF8FAF i* Eu F! g(.HJ! g(1F  JFOCЁE  O2K + i.H#JO1C0F#;C#"1F (H K zh6I6$]7'8TT;8J8\8-CFHNFFrhFH`#os`8F#O3`1?"8F DK?7H&)(3H'BFKFg/HHHICLOsImO4g y8O#Bs)V0O`1F/zs!J ZDDI, ,."H, H_i O8O6 K#$]m88888xyp (HpCOK ""[h;K#F=,p$.F)F"F A$DZ H+ H J! 2F/5p&888FF+ * *pG#\ F\.FRa/٥A/ #A- 4B3O3KOMO`,h,`jkh# Kh   F8'&8'AiF(H * Ff!D!FtJh3`pG&FH8x+NuhŹ ! F Fh` F@!0"FI`shu`+`!Fhh*hp-hIhFt!FhFtNhF[{j&$4jF@Kh# F@O0&8F F@Kh+)F F8@?8&pFFF(` +`#`p0F ` H `#h+K ^,Fp(x08 Kh+ F@ν&KhK"J!hJ!i 9'&٨-C F xFx9KF!Ya F DF N'M J1h/`ZPJ F1h/`ZH+hKE&8'-AFdNiB\bK"`(^ic #atCn(r2(hK(j8MK(m-؆(gН IK` HK`HK `#s#xC#$0#"00!>a (?а1K"+_Bذo8ذo*K "o1а_%K "O.ذO K" aO'а?K"K"K"K"K"K"K"K"K "K " K " K" K" ĕ&8'(9'8'49':'7 jFI<L@%Hȱ `0P+#`#h+ܿ##`Lm%`#h+ܿP##`0H\( H ` HN(ht@8'j$9'40 7(%LL/ (&( ("(H($((H ((( #L0#M0H#0HHHHHH(#ML0(F&jjjjjjjjj-C H%LI#`BF[$(H#` #`7OHKMF`HK`H8`H(`HK`HK)F(`H"`Jh+`J`J`J`J`J`J`¿"K`K+`xKp)FHN)F(0FtHKh(0F+xKh+@{)FHm)F|Hg|4 |d4 d)F}HW ax#c)FyHL0`+x#`ca)FsH>x##caoK4)FnH0mKx*@8"d`hKiIiHe-4fIfH4dK 4bIcH4aK4\I^H4\K)F[H(0FXH(VK4)FUH9N(FFx{".hF[dF0FtX.h0F00D(`1FGJ@F+N)FDH(FFx+?K!.hh:[<F0Ft0.hsV&j9')09' 9'j,9'je9'9'%9'8'8'9' 9'(9'9'9'&(-4^, x9'&jj*28','xjg(ŋ4' Y<'\ D'2pYjf8'0F*00D(`1FHF%NBF~)F#H)F(@FH)F(FFH ;h(F1F4xK"`  #|44")FH(?x+?2F@F:^,R[7&l 'L4 Kh3 K JxhZ Kh3KJhZz#4&9'8'٨9'K!J&٨KJhK8'٨&K!J{&٨K!Jo&٨8Kh;KJhK|Z,Kh;KJhKtZ"Khs 4+hBK"$8$M9'8'٨&9'9'pGFK![J!@#&٨Kx#KJhpG&8'٨Kh+ p9'KJhK8'٨&K!Ji칠&٨L4J!Z4YJ!Z4 J!Z4J!Z#4&٨BKhCCH@ `pGX]8LFJ!Zh J!Z`j J!ZX+J!ZPT8&٨ KhK KD4@ F@9'&FK4X@0g F@&FF#XBXAK!J4&٨-CFFFFR PB2L?FH-H!Cҹ)FH (FB!H)FHHE?/EOGC!HOB4@E4e-"F"Cjjjk.,k,Khb33BpGl'8CFL#h3!Ht%`8P]@k-OAp%L!#hFc# C z J OY2Oj7BFdd$%O Bu۽hB! #BBъi1!YXFO %4E hl'Uk8]KhJhr$ KhpG cpGO0O1pG !pGl'89':K-OhFO0)hcBg#BB 04iBD-?O3 i EwlhB#3?ЖKhF4ՓK[h+ $B B  @(@lh2`h` "giFai`a,$(4WGG^iGdO?#BA c#BBp4@FO FT1?TYFdHP_#BB,0$%iB0hB!Q`ah `h#hT`!``h` i`Y`i`a04iBD ChP 4O23 4TO3#kh`ih```i`a]0c5KihH{"DwO2`O 1Khc0Kh(ۻСiZF1!D`# Cwig[Da#a#Kh+p=,A H DKh-_Kh@(WK #BBK#BBE K"`l'9'P]uk8'8]89' 9'&@9'H9'P9'0 4"DI\wzR!D]F?m(lIFHSFc%Kh+?Z? o:k:' K-Hh($,D04OB;OD<LLLO0O1l'-0HL#hO00#C#hAq0$B20$bE E "l'L#h+ KYhI hO3#`"K`hbg7? H"Z`3M0+h8]l'&k:'-O4N7h 4+t L?4BqX @@Y45c4EE+?3ibE4CEt OYEPEВhV0;h3hc#BAۦcEAr@0Dl':'p !бKhhBFEBu3F6hBEa E0p l'Kh 4dJ? L0#h @Cl':'K-h0$2:0$g(q$;A< ?2iBO0pGEeE\EжhArl'(KO2Z`pGP0@(X`pG"P]7,M,h\4 dO2O3#0#hO0O1B<d"#)h`#`##04cET O4O5E4#4$"#d1?!FH0@^hl'k#"#J@0 ]KhbcpGl'-AF&MF&L(h#F `Oa ?c"#a d#a `#a0dO3O24O3#z 8F0"h4#4!h(h#h$2tA7&l'pN5h4 $4  0hO34p2Z`Bh`@(hB$ D-@K4`!Fp@hl'&KhpGl'pFFFȱKhB?{+x*+kxcxSn!(,F ;^+#x*+bxKk*d* " n!(Fs* u*""4`4`p""t'X]:0$[mhB\B 0Q3 BZ K!p8u F &/JB'p9* 0*.*H!2 b*c*!DB ! H0:$!!*$x'x'kk-AFF`xPO%Y9 F5<(@O%Y9H1F F 5&(0 `F\]^k ;I@u;HJ!88HCxo5H;5J5I5H44J5I@3 @d!(0H$F.HF-HF+K%+J&'@h#4o&|3B!#Hr"I Fx I F~PI Fz(I Ft(!HX(Фl\^,kk4l?lx'HlVl|'l ll$x'-lll#l(lKSypGt'ò+Jh yJ !H`+ I Hs H+؃@Py FJ!t'*'`ldl++++(  pG pG pG pG pG pGFx+F((* O1۲BcB cx@*+*FxF8( ':FHxb?CHx|`CxHx|0Cx?Cx|`Hx@r|C y?Cx|2CxHxB|PCHy?Cx|Cx|2Cy3Kʲhh ):po?B c?;phY`p??4C dphN` pq?a9phfO`pt'KpFhhh)ݔB x4,`pB <) x&B F4FB =+ F F t'IH2Bӈ"q< pGX]I6B@a- pGX]Jh RypGt'(8F4I5HsJ3H8(3M+yՀ@ !yY۲-JF!p F(#F! !"H,,ٴoӴ?ӴӴo,##+O,х,A#Ot####"@:@ I,!;ѕ,1C,!? bZT`l't'dlI3B"jq pGPn@DcB ѡ"c+ !@%` XBXApG pG pG*-A FFF F0` `8FQF(F#(#3`,#`(F'F8FO1 J)F0,(F(##3`,#'FFO1JFh$h3F*F F'sLf%F(8B 8#D8piF0F+288i'((HpGHH 'sHFxI$ FpI F|( Fp@HF(x+n! (FKJ)F3FFfp}0-p2pFH FXd #h"BhIh NhBpx([h21F(F$hppsFhF F&!"(F*h#3FF FpFLO%F8x*8B,hF8D:hB88D8hF+88x*'$9'p(L8B>B+8D(BN% 8#D3h[scڢBX ((F888+2 p"D@'$9'%LN 8#Dx3h[scb 8H FFp)D!+x*'$9'7L8xhF(DKhBF(F88D88x[ 0;B8[x+hF+8'$9'8LXB 88\[- KO2`8B#x+(F'xrK8x '8 L#x% X8O2pK`8 'xrpFL F F@sBB"F pHBCB KO2`j?  YHp;;'xrFhFM',xt:F!0F<(FIF(B F K"8p( (( (O2K`pG'xrK"(( (O2K`pG'xr-CF"O L/+x:F!FB0838838F 0F(1FHF(0F(8(!! D D('t's L% FFMDx(Fp"F!0F5'K$`pG'pF xFDhBhp! ,F0F6kh%`c`kh``l`#h`pL$0!F$8"a'K-OFhƲL{(h&x/M#81FHO  *O(h08 8 h# 8+#+(F '8F+08Z#DB0((h("(  '# 8d(.$鱙KB !!(F (F1(O( (#48!((48$(() (48 8( (O@$48@,~("t(48-@8 ?^#88f(xF@AE1ZJEF?^FV@2F(`IFRHrH8x+?#0,(xѷ1xr )?BJO F~R~ZE(ѓEF@F0O D  O B *FO FO 60FF(?I8HF>H#48!(F]DD(D5(?8B,K[~BHK(F|xr' 'pgqKF$% 'F+0:Ѳ )!1`x.+hF}0` F)FAu'HpG'K$h[hhpG'-A FiF(pCO'I FpF F>}*FOa&("I&&萳(F0 *F+ *# p1F&TAF&Pꨱ0"+$  F*FOa&(&iFB(pCOѴOqCdJ FIJ I F!F H J I F H!F F'0xr= qMqr'qrL#h07#c`G#hH#hZH#hH#hXH#hH#hHyK!@hڻL##L H H '.q9qEqQq[qfq:gqNKMh@4@F/#s`1(F@h(F; H7,, !F@H*H '}6miqf pFKFFX`0F )F Fp@o '-AFFL#hfF8(FA#h#c#`&:FAF h#h#"` ۚO(!H(F.нA 'mqa@kp2AMkh.F+FW +J+p ++%+a#+5$+x"+i@x2/+#7+)hq)`p@11i Fp@}#x%F4++ +(L h>@+x #`(F+ `hFs#aAx"+ixp@NKh+ep@cx!+(j> F`0bKh+0j I Hp@X Kh.F$1FHp@  '&8'q^,qxKJ ?h" !@z Kh K) MOh/h`,`F\/`&`8'P9'89'9'-GFe "vFF)O1 FLM!JFF`+hS#Bw#0Q0+ЛѸ8 2 F:F"F 7`9':'89'KXh8 pG 'KHA=j]}qpLj#bp@ؿI(ch+++ pj(hyb>(0Fm bg  '!F Kjq`"bb '8Fh8,B8 -O#ZLe%XO#`XKFh3s[;`O#"#0CMKhO0j+Do1 -( P*=Kh  ;Khc H5Kh(ܰ0 ~kO E+H80+e-8F0+e-jch+K+)?+%+2 . .@1u*FcHИ0: ` @F '8'8'8'&9'q:t:'T9'8'/+7++ch+0F(?2(?-#A=F-c+R#SSyTURyXZwVXTqSROTUUTXWV WTZiWwUTXXMUSSmUVR SZZYXQVT Z]ZUUU9VqXZZAT'U?XWWUKTZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZL0 +0F (?Bch#;+G(?A..!0Fd(H#c`ihh3@_.#`.!./!.0h+ .\ .Zл&МKhB?KhB?KhB?F+.-.*##`*#@0F(?ح~ZFxa;+##aea(x(Уi#a+ 8y(3PA oH#`h#@+,Цah)gJi!!_KhB? ^KhB?\KhB?i+0Fa(0FA UHi(i#FF/ ie(?٭.( . ...ϭch7+?˭Os!..­OS*.@.;Kh+ch7+?OcOs"hS@#`2Kh+ch7+?ծ#`0#"*I e%{)r%K`#*s3`Kh U"! ie%)rK`#*s="! iD '9'8'8'q^,q&h9'9'#*s#"#Kh+ #*s "#*s"##"#*s#"#Kh+*#*s$ #*s"##"!#*sKh+"!` FJ #*s:`Kh+ "8hFE#*s:`"F8hTsc+#*s"##tz#*s#"##c#e*s#d"##cUk iN(qC#*s"##RKh"?ٮ+oA IH JFKh3+?x"l ?K`(?##`#*s"## #B`#hCs#`#*s"##!i %h%LCC#`#*s"##!i x%`g%h%LCCCs XS K Hh`"dH0!Hq9'l9' &h9'jqJ IhKh+o%KhIRFHHKh)FHJ#I h\K!h-!/K!H'#*s"## i(?)8 '#H*JsKFA=!H#*s"## i(?#vH*rJsqKFA=#*s"## iFjH#*s"## iFbH(J??}\Khw#*s"## iS(?h!RH?`=Kh(FV(FLO(FK#`##`#AIF 0+0J 0Ihz0F8I #6KhBF?#4KhB?2KhB? (e% & (?G #*IF $KhBF?"KhB? KhB? ( (?B0F]:q8'&}r\ '"r:f 8'MrZrq^,irzrrrl9'rr9'8'8'r0+iFEI% 8CKhB?BKhB?@KhB? ( (F.&0FF(8J% $`7Ih.&#5IF(F (q2K`1Kh]EOq(Fq "i`*K"`ah*߿(KhrR#(qK`J#ih D`h*߿KhrR#ch+?.(F#"I(0F!Kh+?̮#c"r9'8'8':f r9'h9'P9'$9'19'Kh0pGt'FF #O2B@# 3-OFFF@F hD,F WEЬB< +4##pd@F>!2FFӱ(BZB <*+B8F!+ 3BZx~( F=F=F#[K# O 𵘱 F7Bhx&xBm\[x+g+d#F?#4`d+f+ֱ%\xg,3K,F[- ,O,L34#F#hZ`F`XxpG-OFF !F=;F(CGDDFB:0 0 *5"pF*xc*"p"B$ҕ0+;+hxUDFp KEF>/#F*+N%F+O0r FYFH(!H@L 'r FYFH(!H@P 'rK FFh*L 'K FFXh"L '7F LFh(0(Fx+)Fh( L '[K-OFh$$ FR!FF@F(F=0.0F/(FqF0F^O4!@F=kF("#0F"1?(F= BF)F0FF0FO{:EE(F=*xBjxM*Ѫx+*xG* ,<+AF(F@,E*,n*(O3O@FF07H<HF1F HF< F9PF<0FF]  F(ѽ;h,F:'KF"h&K" `&KFO2h&K" `&8F$ F@F@B F8@C 8pF F,F F4F F2XU "!0F(pO2!(F(-CF!F$%FFhF!FhFLF8-0F OFFAF5F8F<+(-kF O(F9h$;hB0FT F(F&<KhF  F@{&L#h#H ` hK#`h 'tt$%!F8[x0s+4@4 F-G!Fd OdO FF{h;{`+ 8F (F'#(F#p;hZ:`x .c2BOH!@F)FFo(FUF!DK"xxBFI4F#x##0F+p xBcxB4#x4;5FFF#x+7:FAF FF8F:! D F<(F(K!FJ3F0(F!F((F%< F<0-gq-CEF.F$?!`FF?#p0F#+%+ѷB,B4rxB%+ #+(eD#+%+ѯB,B#p4jxB%+#+(DF Fo@ FD&&pİF Dp$"#(FJ1?(FOr1F.5NB,Կ  *F!Z3h+ + *F!NB'((49'-CK?KhFF;Kx*FGF08F<(F4H{F(Ox2K*F F2F(F.Du*6!D0F'K1F&Jx%Kx#FFHFKh+O0;H(FxF3|*-* F(F( !1H'0IHFd((FbFHF^! D F*FKF!FFXPFFPF<-и(е@" c F((FT(8`O3H3`F F[=` H4`(FF(F4#x+с9'8'Dru}&OBF(F]Ժ/ݺ $% F)Fֹ06Kh+Wk?R1Kh+N1Kh+J0Kh+F/K"`-Kh+,HT F)FJF? FѸ!F(!F(K h9(@F91?йEK"O0`Oп K&.v8'9'9'&+'L+'X9'u[uT9' KhS Kh( Kh+Kh8pG pGBppGl '|9'9'8'-GFFF@E",KhDE̿$$EF 0F9FKF?FѺ EEO0Gd$0F9F,uMFKh+8'9'-GFFFpbX 0 FoJF? F7KhG7K h9(#"F+F@FqFO UF F doJKF? F$%89'8'-AF FF2KF? F AO0"Ph"F+F8F.K(FhB pGuK(F@hB pGuF F@޿FlI hB F`2 IZ`bh`#hB Jhh;`;n F@;ii:ah&up 'KhpGp 'FN F4hB!0! /F8F9O3O2###vca`K-F+h5+h`\`+i,`3#a#h h8FX$hi2ahBJh3` Fup 'hpGipG Ʉ 0 FȄ#vpG~pGCiDAapG@ipGhpG`pG-OF Fn? 6O4O5 F)FKh+@𩀎KhKBh+#O3EqF F F)F F)F (&F/F0A (@0F9FF)0F9FFEy~8CF (𓀠  I 0 ,a@T+F F@`Jh*@_J@3au@F!0F9FtF(oTKh-#20FA39F* oKKh+?`?\0 (w (u0DO/(R;Kh+M`6G7c02 BFKFI jF iy;`O o ,O 2 FA3&JJh*0 (0K"`F FOeau]F50ծ}9'x '89'9'h9'9'9'9':'-O(FMF.w O4O34 0+yKh@BOyFw  !O32F;Fw(mKh+3G44F!F(fKhRPFig , , a (d (b0=+hT (\CA4(<484q44?F?z,hu#2C (#+(=0ӻ08DF414dt4g j+hH02@FA300+K"`$#BA! Fhg( Kh+?##(? * :'x '9'9'9'9'9'h9'pN?F FsB ( (4E KDEb4E0(&KEpH]@]-OFF F)FF F((ۆ.o#3#F F0F $#4FpB FQKh+ OJ F)FnF0!JHO-{FoFu??FFGDEu CWF0;BSm9Kh+fK7K F)F&`8h#"F8+F_7??ТE{ *KRFh#3#8D[F8 F)FFH? F7B/J#`J`Jh"F6#8+F  F)F F1F?DEu #"0F2BFKF]H9'ku9'P9'8'X9'FFKF? FpKh F)FK F)Fh.wFP,KhH!FdHag9'l9'uuhFP]е(!H@>LFFs"h:K? !@ h8pBBн@¿нu8'pF FFDH (0F FKh F)FX2F F)Fp@9'FF1?!H8KF? F! H@Ͻ;F2FqBq0E1Kh@uvl9'? KhBJhABJhBJhF9'8'(9'9' KhBJhABJhBJhF 9'8'9'9'-G!LOH8F:!F8F:F(F;FBF(FIFBF0FQFPF;4HF;1 V'`( x '+K(pFFFh #F&(FO4 Fp (,0 FMh($$*ݫh1FD 82D QD0F(hz0FhD$N(!F(Fh1FD (кot'x 'H^L ax K#aHT`ax Kca!O`!``O`Oc#``vx 'o-v>v(  pG K"`"" "0 ZcJh "ZcpGx '9'F(?n" !($kj CD䲴D_.!DohFD .=Kh+I+*+D;Kh++a&+]:F!0F/_(DljhhhD1FF((b*Ibhk h2D+lݐB#Mh)Fm"!F .D;>D FKh0DBN2F!F (=-H;P#B3lBFKF:F!F9'x 't'9'X]$9'u1 '-CŲSLFF0hs!##F0 -IKhj+ #00EK#DKJbC#d(?O9h BFKF(FXFHF#x+l FkW9H F7Hx+#xZF-(Fm(F9_ @F2@F  8 HF#HI N,,KPF"`W Or FF(XFF8F!0DF0FF4[FJ1F(Fv8F9 HF ]\f $vP9'xZ-GFFFFF=F@5H!O4 F1I(F}F!F/H.H0(F-,H*O5` F FN! .??rGEy!FFBFPF}$!  , K "`QF0 -5CFQF0v=wf $P9'-CFF+'z(hS  pG(h ЀipGHpGKXk0 pG+'KXkA H7]+'yFhFFx-+0""x0; +FO F0 /.` ##`@B$##`O0.HAm 08'z-OFpNpkȱh+ +Ci G#sc Psk"iF `FOx*\x+(C% ($( (F #T Fa@/''F F*F,p+h_H`9( 0(5-(Xx-( 3n(0+z$n$+(@3%8 #F F(x++0F9O<z$pFa?/''xF=+hh++0HA8U2,H#hZ* 9%2M`ci G(K[ ! `/3# `*#xtc0x +iZF/( x+"YF'i8`%+'mzCzz&P+'𵇰FF#@F(FdH-hY2A ^HE(A ZH**-x*y hZ* 0UO-ci+-  G@-tУh}.pУh?K"`-C--"ih[ `2-3- -"ih'3#)#!/3# `*#+!%Hw---!+#i`#`!H_F#ih+!H#i!h3T##iihA=.Eh++-9zz{P9'{G{k{Fh FFexF0; +FO  x F20;ٲ ), #4,XC%#+`O0, HAM0 !<,>` #+`'zKhKh(  pGx9'P+'H" x K"` L$<T<T,`T<!T<FG$4{P+'uKxFFpGBЙh :B$3u-O&h/MFFF4FF+xkBкKИF" @Foh//$5#F9h\ A9)-(JEJE 8hFĿ-AvvFF#=0F !0Fe01 !uF`/@F-#<)Fk(,F-AF F$x F%(_34;F[xn+s+d+iFU hFnhFnDUk (jF` ( Ђ*I@Խ@˸F!MF!J,hh3`KhlKh CF Kh0F9F+hFKh# @̾H4D*Kh3D KhB޿ K"`@&9'8'9'9'}9'$9'P9'8F Fi 8)F FLHiK"`8}9'pFLF"h"Kh G1F(F-#hF Kh# f(Fp,Kh+޿K"`9&8'$9'P9'$K-CFhFF+4!RF ##F9FF^V*! K)FhR FtFHFO481F H%B(F8 FF$t9'&Fh##`@ pG-CFFF*F6cHDB HBѸ2` B52xEШB4"FMF@"!F3#p(  #D0D4`B Kh8p@Kh8KhpGKh88'X0' K"FhFKhFBCgE2E8'X0' KF IFh hZ*gSE:cE8'X0'K"0O4hO5Kh;B0E28'X0' KhEBq Kh#BO0gBqX3X0'8' K-0HhB 0L-,0 X0'K h9޿8'K0hKh#:BO2O3# E3??Ѓ`E08'X0'#M"L##*hchB&hޱhF0F8!(h+hc` `f#Y?@#pO2O3#8'X0'K(h( Bؿ08pG8'F#QxP:) ؉.) F?)\)ѐ3+pG;pGFpGF M.h1B9F&F0F"FkL3+`#3U`0'HjFhF]iFhF]8F MK?,+h;Bܽ8@4 F88'8 Fxd+P+b+ CxEj+ B+b+##`F l+p+m+t+##`(F8oO3oKhT `l9'8HMKL(`h;( FFh``p M(`ph`p`8h:'P+'h}-OFNxF55`+T O#x0hBK@EUDBA :+J %+̀.+Ѝ0# 0 ?+ \+cxLF0# 04#HFA=IdF(ظP ظD[иLXиB I?b:@ظa. FFmP ظf84Ӹl pO ظn(хKhsиx(8hg0hB  (@0 vKh058hrIP0+1?|Z0W(Կ  1?(q`P(qPMw?F#HFBA=F6?7S(۴!/[o';OY 1h"B Fŀ3`"pK?8`0'&8'h9'}9'`Kh(FqFh*:0I10A?F?FvX  o0A1(FqFBKhAKhL8hH8hB368hPмBA+*t(q0A1(=bFF??F F*s@FIFpFFX vBA+*;F FhA 9 (5". H H8h(jHHh9'8'8'#o9d0'^,K!h}KhKhd U K KS$Xh Kh Kh Kh9k K"`9'P+':'}$9'9'9'8'KhKhKhK9hI$9'9'9'}FE>hB% #Bu7F`9`pGB #Bs"F+F#^E#Bu"F+F#E#BuF7sFF FQ)`hh7#k`T FA !Fh`k` FEMDB"KI`F hұ) X`pF1F F?(O0"F!(F7("A` h8't9'hhz@ @h0 -OF*:*7̰EF! ) S$#RCs#FNEB?دB5H*Fi#{3("FTRhKBNE#XFRCs2CQF# NE ! !h#RCsF#  Fh8'}K""""pGh8'K-GFh L&j>##bKh+&b(F %?F?F PF@FIF(FUF;h;Bz%OX9'h8'8'8'1K-Ogy?V-JO0O1)Kh#O9%Kh 4OF9IEܸ/O8HF  JF? FPF#BuK?ІBw F)FLHFdOgFH]@]8'X9'8' LF H@3#j [ #b@9h8'8FhPKO1 `O0  8h7(Fh8'H}H}FFQ KiEBBh  }-OF F## 3`dKh@#Y?ДBu+ E@Fȿ F)FĿ3 <#C#2C#'F.F#3?nKhk,dBo#8F1F~(@cKh˱+O #C#2C3#v+#C J +O NK 8 [ h+J QFKFF F(FJ[F FF FQ !>H0"F#  h! #Fv#/H/H"F#  h "F8F1F S z F7(F7E 8Kh+ "F8F1F S [ F7(F7;vOO8l:'9'9'9'|8'}p8'9'h8'-CFF $`!L$h!LEk?K@Eq {?)дBu%L#h EBq |?EBuh !` Jh*Kj+ 9'H]@]}9'h8' KhFJhZ`h7-#H`@2h8't9'p8'8F F) #xk Li7H#aK"`8*F!FHMh8'|8'P9'eH@ |8'-OFoNFFFj x j r+EO E3 #X?i?ДBu PEq -h?VRKWFFhCEux0(#F  O2O3#i?ZBAl L  EuE{Kh?#Y?ТBAE#BA)'FWFF #2"F3iSC+Fr(  #L?АBA # xb bE{Kh@EOq{ۺ k xEF{Fh8'x '0Ek?o`O3F F F)F 0"KbKh+ѽ@h8'9'-GFFN x+W~HDD_F|KhcF"FvH(vKh+3j 0i`@P !pHpH!O5jO:h*;h+3j#3b#3b FXyKF?Fc{FFOrF(QO:h2 #3bo;h+XLKh+6ѹFHFoFFF#FFF=x? 0EO6O7zg?+qO0H|+ @ѹFo*KFh@FyFF&'@FmFFy?#0FO29FO3SO3NF80h(- cKh0h((Fh8'p8':9'Ć9'l9'8' I*JhC`Kh@A:'9' IJhC`Kh@q:'9' IJhC`Kh@߹:'9'FI I I ! @ݹF !F ! !FqA,K-Ah,QСO`'! D!(F)F )F 8!>I   K"`bNM/h~3hCE+hB +hJ3s[`QK"` Kh :'qP9'$9'8'8'9'-pC!F FFF0F2!D1F`j#wa Fp(F!D)FajL hBK""`2Z`Bh`6}8'-OFRMMhPIF6/KLPF#` F:FOa0FFp8Fh+v+hHF#`#c` M3x!+BF1FPFx(0 + +XFFx+F )!px+ FxFHFLkh`C``hh`3`ZYxx^)3xBЀ,$*O3  p"#\(33  }O8')-OFð F CL,-O`юKJM`XOHoF(x+=-@<>M8F(FF@FF(FFHFVD6!0D+FBFxIFnEHF6uI0FzF0F6-jJhBˀ#` #c`lMlMiM0Fȱ83\ + 3FFB(Fz(#3`|(Fl (012I!pFFF)12@I FF  2@ЛFH2 Aԛ0320X[FF)12I!pFFF)12IF)12IO2x*Л *К *XF(~XFFPF{h`C``hx`3`*FOq0Fx(?bK?J KB(FzF   8'} ^, O):'$KhI F I FI F許I F萱I Fx! F(     }!'}FF Fi( ( (H!@qe!H!H-:S;J-Oh+iET F)FF F F)Fİ'F.F,KhL8F1Fx#CF F#2C#k?!H 'F.F0+"F+Fu0FPQFFFF(ј0# 0 +8F1FIhv{iha;I ~B:K`#;ah!7J8Hx6L(6Ih0K`kihc#+akiihka",a kBx#*Zxn* J!`JF$:Fc#p030LF#3` ( ( $cli#+a hhBha?ap030.##1pSpc4F\ L'T'T'O T'k+R#%a{I}E=Sq9yE!J!h!NhB[ !0hYC`10`'h #2h!{C(i7Pp`d`'`#! 1hCK(ihKhcjS M!bj j+hD)h FT'tT'T'T'U'T'T'T'ck+(j+ej5&jj !0F#bA0Fbb~#HA#"IH:##H#"IH-#K(ih#jOxcjKhKB<#;`;h3 љH(=x+:И8`;h #;`"!&+7;h6BӈKHhK$ Fh*1h &3h[AKhh+h4A"F}IF }P {I @ &0 ;`<#4F(#3 "!x# ;h6BaH$  &DPF4qFPF4Z;h2FB&NHr0!ND8!PF4BFHH|F:hBNF>HP@K6@I @K O ;h B&0H6KD(K+2IhKEVD P-KhcjSN!bj j3h1h V!H #biIH#"! H([j+V N!bj j3h1h *IT'$T'T'\x0,1T'ht@rT'j+%x !28F^Fcb!bj8F0x .?cbKhcjSM!bj j+h`)h bJ!hNhB[ !0hYC`0`'h #2h!{Cki&jZizhjiRhB i K Ih}cj1F#F(##acjO OFkiи@;h!jhp#DH=ki0Fj;hh#1D?O9h##BB #1FqHki0Fj;h#BBOй Dj Oz#"1F)F(Y JF1FZHYNζF^$Ϯ @;hF$9ƣi`ki[hSDN!bj j3h1h nih(F"chCc`HEq 1#"+@+hC h2FI }*C`hYChC:!(F(#p+x B+5(F aU'KpFhKP`h1F>h+  #iZSBSAh0Fp#iB̿###iB###iB#iB$hU'("0FMF*FI }iF l0 I }ObiF F F M0 ; K : * B² *IĻ QppG г I0 F;0+Bڰ1 0 YppG  2L!Fh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@@V'K0hci1s]xe(x+h@,FK|lh~Y}0+F t ɲv!ҲZu"( (@V'Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p@V'(-A3L#hZi5kC#h/J![ikM-N%-O3hB.#)Jh*B"hRi( "J!Mt#"hRi, J!Mj#"hRi40~HR Aʹ#h[im)FOh J!MH#h! J5[iM@9F@F+ѽ(pV'г0" Ib #JI@O'ǣ'^, I H 0" Ib #JI@OM'k'^,# `pG `pG# `pG# K`pG H`pG H`pG `pG# `pG `pG# `pG# `pG `pG `pG# `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG `pG# `pG# `pG# `pGK$` F ]'K$` F ]' h+#`pG"IOp ' K` p'"I@ '"IOp '"IOp '"I@ '"IOp '"I@ '"IOp ' (K` p'F M(h)q? OqFO0$ h"F|A(h;F"1h F' FN0h)q? Oq&O0$ h"F|Az;F")h0h(F F'-AFh Fpchc:ihFm(!0F``&0Bܽi7Y#ihVpi BY!w6ǿFi9 j8iE8 jA##biF4iA#aJ'F`#B7<2%/i3aд)FB<#>~5pOq >Oq @7@Q 1@Q @*Oq $Oq @IHP *гǦp#L&h.;9(9??J@pJ"! JO0;LO0BBM(hD``(hD!`(h9@ !`2 a I#<%@# 3%+##`0Fp&&&xV'(p-OF,򙃞KhB@iS$@,#! +@Os?Gj#i FG#k FGi*@D0 P#1O O O `hX   h8Fx+@&WF&`1i*0B@3FO FB3FF !0F  (0FD BFF -o  mBBF 0 QI Kh  bE*ݴ D %uZ PDB @"*?40 yIhQ8I9H#F#7[BF.&KF-J  hE(? *Ih2F'H[F iHhX1 BF30B? ѣ Oh -Uh-umCF*FQF8DEa? ;FIYDB xV' гq!9JHO1i;>O1iBr#մ QFCF*F8DE bF!jKhE F!@0"ozwC+ FX0D3B!ۭI i@N(F><(,(a (c (S(@@0 BТiRԴ DBDイ0+;iRԴ Bfj&I PM(hCF(hC#FF8FEF(F(9F(hEr%F@60F0VFFKFF+ EE0h@S9"FlK0hBKF"!0hB"!0hK$0hH0h>naK0h3x(od(b<(o>(@`0+[VK[h;DgE`jOF *?F0+?/  [R#s"r₣iO0EjB `p3D7D"rB:FBؿ3ؿ[x(c?z(`(x(8a80Bi[?殠 (8?߮((J C20I1F n(FHn(. (O{pB2а?(?,>(@Bаͮ@SB(г xV'$((F>v(? @0q@0n@0kzh#P i9 jiERiFT0B# i9 jiE@iFB`h11#c`&Mis?׬?h;pos[ʬ FGB?ì(si9 j0iE jAx%biFiAr#a0KiS'@8F|i*DPh 1i+D^`30Bck FGi%AJ jaAD%b q(u( I ܰ-K[h;q(8F@~8FF8FA9n?yXE@BpxV'гKiS 0YpGxV'(KhBiS pG pGxV'-OFFFF%$ PB1+F $ F!Dm P00S$((xV'-OFhL FFF6FAz"ga" HHFeh*x *C* !>2" "PKQh3@@ (FF113In *  C !> " !>#"2""5F * :C !> !>!"! "B, * * BF)FB,!:Ҳ*! KB " !<>," V'$VUUU @-OFF+𲀺PFM1!Fh8:F!F #3p Й0C@RFIF0F I'hAz0FHtFhC6hC6h%FC@C# <+ؿ'B/Bؿ'#B+FBĿ FBԿAC7}KAJzHd= (F(RC ((4(n 3B@iJh20Y@3c* 5FO N#O IYIhAIFhAVIhA[$%F#sLFMF'F(@BC@BFK1FFh=320[)=320[Ը*8- +,+8*1(=DF?F8,V%h}hFIF(F h h##`L%h}hFIF(F h h##` KhI H 0'0-?ب'QV'гh-O7IFF`5N*F!hFȹ(FA UK`(F:1F0hb1hQHhPK! "!` $`F!FORC hB`##4 \ \FĖ 4YFOp 4#F (k03/IF^&r ![" B >"0F!F$H6J, K h3SBF"Fh K `h yGܨ'ptbtXf@'ب'iMx'{[t'Th+.$#"(F B*OrBl jGKhFEK%`>n `T>H@LRh09IF F($&U!T!F+#x+?_/\1 Ft0+IF F # ""I22!F@\F3"xzS/ ̬! p0,*?OrB? u`'t'`7hF#L%hhF IF(F h h##` 0IHF `XhFIF(F hKh[h0YJIFY gh0M IF Hn '?ԧ'Hw+г0#"2$K!" C#1 #IO3 I H Kh H r!F(F 0@+г ' -CpF F(S+!.(@O0##`iCpGI("F(.OVI(sF(OVp/F `9$(FfPC4 B#;U(Fѱ FO4sO2-OF&R[ )FD,@I*F x'/49F ! F&F F' (FO IF/3F"FI ID#F:HFFI FpB x%+@+*!:0;x'+7<*+1/!HFF#pHF  /#0ñXFC (@hEHF/nI8Fn6<'x/E&p> hI8F(0#(0*0P#*0]L h7! hB h>F#h  )FCFFQHeC<@ t(QAFNFA3hBFր !F @,΀3hB;H@ A @'A AF@ @3hBA!8I8 M?F$HCh;C`+򆀱>,N3hB?  0h7*0h>.!0hBdF.F/QV (j(F/J F,yvЦ2F?[Qkp1ht@( $B{.*? YFPF4((FhE6F/F(?KFI(D5F (0;(0/?pH?Xkh3`wF" q/,63hB?=A& ?:AT2 OpGs$0ð@Fp0[.!Z0 H"C0F"[H"!FHV'W'-GFhVO`FB# F#p_-и/-у k20#)F@F%p4#1) F+FJF4z$F!FFF"CFА"!(F/a"I(Ft*F1F FFF Fz,F FX'pL FF@!FF R0˱) !D<.+/`@IHI@pHpV'NaY'W'-A"-I @0nx"F)H"(I @0nh"F#H !"FpCF'("!|"II FF F띹0NOD 3"PFH F3F01F"8FFFJ")F8FF!iZ'%iZ'X'8i(lZ'i-O"]fLXV-@ dJ~ ( aKhaH`IaH /^~FF3x+HFHDB "ROs2#"S,:AF0F1FDF8F{AF0FGKh0DYY #Op"9F0X5F FF8F4 ( 23 R-8F/~/ ]p!(FO5(F "]!(F/LF &Kh F$H"Ow! &Y`3f2BCl&@ss cO3AFf7FfTFr O3HFS]HF%@F/V''г$|'o Oq"%HXV"IH("I}H(4|K"@!>{J#>0 uHpJtIOpkhy F(%#*F)F>0>gH1s+@𹀔1l+@bJ2h32`~^HR(@р\IF(@ɀ1'h\8XTJ#v F\8PJ#u F/@LJ#w F.oIJ#x FGJ#{ F\8CJ#z F?K.rx=J)FJ(>AOAHO \^F(?@:F(?K JI((@Ԁ\8}J  C\8PE" wH / !tHN#prJ  (" nH / !kH8#phKx+\8C\8dJ  (" aH /u0s]J  s(" XH /c !TH#p0+\8C\8!NHl8#x+\8C\8%HI(Fn9GM#88>CI| #*FQF(FYF(F,J (>=>/%i]'^'DHEcnzX' \'"'W',V'Z'nL13vH043( ؖI"HJ#y F?+"I8("IxI:*F FHKF< WFFQFq:C!  xIEwKxF*>vIvHFpuKh, !F pIoI(FV\kJlIF@FJ0#iJ@FiIB0#]J@FfI:eI 6 $@F$3+<.o^Mos^I ;2'5QZI(F&b# "SO1F# 8(G>PI\Fb)FbZFF IF0F(`hAF~*#x3DHFBHr/HєW5C?I >J>I F^H]Kx]H\6[HZK!ZJYIFVIF TI0F|:4#RJ0FRItQI p\yƱGIF(Fb:4+dDJ0FFI<:UBI QBIBHF(5?IF C>I(F?=I(F;:I(F70#8J(F8I/8J(F8I*035IF(F 3I(FJ(F #I .H-I.H\63,HI+H0F Bp&K0F&I$HI#HV'*a'X'=dZ'EHW'7Z'OvlMS \'`Z'sF[/--DB+M,S\&O _/9p0x 04Lx04Lx04LCDB;"F#p\,9FKDp8F9p0-AFF'hB+h9F(FlG*h A(F#G1F73h0FG(3h"F0F0G(#(Bs ېBq pGO0pG hS20K`Ch `pG h zrpG tpG-O FoF'OO UO F!FFFPF(g " b+x++ F]F! FCF*OR##aF0F_d5JBJBѝ0+ٛB #F*F I #F*FI ]TT`th-OP%[hFU(F.:F@ $F8Fa 3hZhBh..`%X4IhhlG(#X4ZF#ZFQF  #P"h*F8F4('pFiOp3hzFS *FIF Fp@ hS1PWhF+h(F9FlG(H+h\o9F(FGF!Kh#:F:F#J!kh S"IH "hBL"I<"!F60B IDanIi59('1@)/ m mñ10 j*j+КB ؂kkB؈B, O0pGO0pG pG-AFFF F!I$8!F .6$.I8F1F-3F FP IF.,Э "FI@F ;F2F!>(F~( F0(*8Fi F[Fh F#`#8@8-OFFO B!@F.% (4'8F. .`h0  %Sk hBah# "hR3 BBhB3B3h)F0FlG(5!@F-F(,& SE7#c2K"9FOpc<#2#BFAF f(FT+ah h1.)(chZ `b`@3S`Z% 0Bah# "hR3 EBhB3B0)FHFlGp  FK`F3 5MK Fh5 @B(с) @Op׽()@!( KS K(FpGHpGHpGHpG"^L8F L)!FF T8")Fv( ؜8 FF!(Fhbh)F hbhI hd ##r8 II-GFF!0FFFOrhh>"1Fhh0Fkh0Fòhh13+z#$ Fz(МI-@Ma:Ob)h1I `a.)hOb `1fh0FEv]`.[2a0BVahOb)DahOb)D `F('chFx)r}Kph-@wM+h$(nh0+iQFG?Fc+h$Q-+h&'f"AFr(Fx bOcG+h"frAFoOc(FG+@^IaIF"r"aiHXIHFVO\&\F-@h aF( bhLI(F(\)Yx3x3! ` fO [E8F ]3K0Fh1!s0F,!#Fxh0[QFG?Fm+h(F0G  vQ-$(h0+QFG?F$QJa,ObahI `a Obah ?Z"IFF(P]gqJ5'x'i k9F(F^ AF(FZIF(FTбI(FP騱I(FJ週I(FFX" I&")F IF ITi#Q#O$$q F`@k"F9hF R sT##"#0GF(F8Fwh,+h(F0G;h8F0G$Q -O]LOrFF0F!O94*!hX)̿!!KFhI&m@* cEI rF- .Y#mAF##eI#m-4 F"FB(FF(#F/cn#0J!DmC!-J>`b#nC!(J2`Vm$I+$M ""lI@KFm;"n*SC!JIMI'0(gq8\M+COVteB$,'IRMILILMIEIDMI>?J!"B BFA&&kz)s5=}I-OFM+h*A\~HE}I}H}NF|IF FL7hG+hxI3F8F4 я W1hrH!F XFnI,(h)q/x0)F(LF|`ꜩ8F`bIXF8FGF(7O@ ZKNF EF6"2(l(F`TFHF,Opu!FF0F,$*FDIXFCL#x! FAIXF@IXF?IXF#x#9JXFI*FBBFI+8г% +)K3O(F&IPF&#.O5kOb `)KXF(I+F#*sRB#IcCXFy I H&O3Fl&O3Fh3Ff M#!OpBKBJ(F_gqJW{\dkt B$0(Sj    5z^,tN-OF|$M,@𽁴M&ԂFU$ AF64,ѫJI6JI6v!60F,F0O60F $MLH*| Hh`HK(lcc H,eTDO  [)IBFRZ(BFIFK#`K BF`I``4xJa4 884D  ıO sKgIS)BF(BFYF衝 #`eK BF`cI``[Ja4 884D  dYK\CB XK@9qWJXHO $FTK"pSH(_RK RIh2 !F2MKh)!LJ3OaRBFIIPF8F-FJFH((;hCExh 0(;hCE !Op`FOp {hp"O 8#4h3#Ocx8G(?JF(HE(%J  HK Ioh2!F&P5!z-Y!!" ""#1"m۶E"k"`'' 80(^,NH)Y3F9F*F'oOF,AB(F,rFD ЉռBLAD !LDAHAi`FU#F IF(FA-))2BI[FN"F?Fs7O#FE #HF#Ob^0O:HF[F2F*Ih h(Iht3`h3`+ "!I ! F(#bC# "* "8F_$"\2 9 T-a#2FIhh_"8d@edA//"8 FF! F !F(F8@ 8iK-OFP!F2eJ!h+3PT!2`Jh+TP!TAL):X!T"+X!*RHrFPH!ZD FBT!! PA`{P!GI ``"X!oDNs>S8FpBBB{.* F(F0F403KXhE0aP+<8FP"X "(K"P!D T+(ТT!DKd`pBOP!I`XAXDTP!!H$4PPXAOP!(F I`If'ng'o'ogq-CF@Lq@K\1#?M" Q]2"*!D \!D!DB @  #51D H < L HQF@(F&DFHF B8MF<8FHFB8MFL8FHF B8F@F8MF!KJB8EFF88FCI K K\1#\\1 #f'ٔ^,"ϔ FiF"8p@XBXA& OAJxI K"!H`KJKK J!H KH]ڿ ]'"'''2%'̥'OA0# K#!3 F#H!C @0) 08HZ W!F MyF(F(FI O F F8@+`q#?FR[)F"*FI t#FI (+0@pG"#C#O3 A=?( K J L`, J!F H#J!FH 'A'2'̥' HiF{퐹 I%x I%@ ] O0 gqz HiF{p0 ] gq0O3 A=+$ F0K JIF(K"M!H`KJKK J! HS K~0''c#''''#%'̥'O3 A=( K! J H KR KJ! HKJ ]'#'''̥'J#3+ pG\ pG g'J#3 + \FpG g' I#3 +KD 1C 1pGZ\"ZT g'f'0Q#0Xh K) !ؑ D !f'KD 1C 1pGf' R} O r!2 2#H#"2J226" J8!2"FF F F0 R}Sqf' J KDYh()#FpGBh) )3f'L#h+I ##`'#0HL"MFhF6"qhF( K+`A0 D# I`1p{/!0(`#f'<'## FKh!Fب'R]pG7IS[HEF; IF )F F FI 0@pG##7IS[HF IF )F F FI 0@pG##IH$# H H(H0 =$F$P$F( 8"I D@  (FIH FKJ(FFH''Ԧ'FIpH FKJ(FFH̥''ا')F'(ML( BFC:1 CO1(h4O1 h4O1(h;FO1 h;B(h9 h9(hB h@Ӽ(ԧ'7FDZ+@0F!F^$ F7$!HFF>p@F 9%P%-CFFF!FF*hFб$B@F!F*FBFG F*(FC*Y$0E$04-GF$!O oD%&' "A@FEg_ V+сE $!@FvFHS+]pGUFHS+]pGuKd#H"d#1K`H,K`H'K`H"K`HK`H K`f'%'%D'%'@':8'iH' F!F QK@h]ԧ'$}!F" #" ! # D ]HFȹpCO"WH>h"TIUHP"TIUHJ F }Or! PL"!!"F@*Q@"iC(ۅBAK@ !AJAH@I*)g +;K"p O3e,9,kd ) *I/H^_(7$@*M"t& 2BX`C|#!j 1@33O3!CF$yk (F(Ft AKh+^!l 'Y''̥'|i'%P%t'o'i'-OFNNðFFF0q3hJH,h F3F FCFEJ!@!Fx*3hF+7 (;KF3I }F@F@F*,5*Jh3`*I !F(hGF( FCJh3` *F!$!F F*@F*$I ?3h;Kh#I F4jhKD !B !/Ji3a爯''w '%% &p'%&f'7FCh F ++ HcJ#)F F#60JI++ F+&gq5&-O@װFHFF:KhH"!H MJ FR<(+@K`N#\L uh(-@8FKhF)@ihB@  ~M/AЈI ( @ I I I $17{H xH0 0#BBrHAqH8pI `mIoH>jkIT RHF! RLT+D 1+1 2i3h+A 1+;chh +dWK!dh=9AP1h#_ DYF"hJJ #`3 ** ED 1C 1ci3ca60*"ai5FFFO5kh*+c`` iIShSihhT!F'H'''('U&(N&%NOVL4 )F ]!FV z("F9F %6 F -O]FfH$DdIFB(J*:F]IOpO4!F` F ]UHwSIF(QHmNIF(:(JIF(,zDIHF(D(F@F*QF 8F9FFFXF0=+#IF0F*FOQF((F0Fl逹F$h@#@F(O4 F!@%$***'*$\FOp(F(IY:(UpFQ˵}D^,'' M$OcFF!F00CF:F1F0 ѽh(F` F(F M FF"! F< N'"F1F(FXB yC ha`)C ` h*y |d FIzd@ M$OcF!FF0CFF;F"F0F F(FBڽ` F M FIedA0hD#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕp"PlV pO3 0pGo 0pGKk+ыk+ ##pG++ ++#3##jF F+&h0+#+OOac ##c#hhhkGb0#h hh[kGbjlhbbkZeke  ;+JR#"#hcachhk(EK-OFOk F & @/o#Bܵ0+ۙBݪiRRiOBDh)Q/AQ*IB )IB)IBв *56%JBjip!D#h#kYԸ 0# 0h+JB+Тlm#e 0SE[EJB3 JBKE"hhhaihnG(ѹBeٝsm# 00pGhp!-OFh)DF(G%Khh)FlG(ch $BСhEE"ыlBѼKmEcp"Fc5 hhBؠh)#h`hc`jF0E0%p'|'-OFhNFF(3h e0`p&h7D;k1ջk3.єKOh#nni\hnB8$FOpFCRF[FI@0F0*hKBiD 0 C# 01chEҹkH hhlG(*hvKBѫi 0Ѣh2Dk@C 0# #gK #ZFZF#@FIF F FC | ZF#A 8A9o1 hF3DPqnh+jHK F2Opx00 q p0@  x #c 2 y3 q p ixL-#F  4'4#I0Kp'('(p'(^,(-KFLFF0+@@}OO 0BOp0B@|0BOpn0BOp`0BE T0BF F0BG :0BH ,0B@0BOp0B@z0B+hhhZjBE*030iS0/kk+mhfIBDeIB@dIBKh=Kh#06Kh6Kh#L 0h.IBѫjpi @   "I#F:F0F0{#IB ѫlpim@IB ѫlpim@IB ѫlm0 IiIB'ѫln0p'm^,))Ц'('%)seѭ3)YUIBZѫl[ns@i`@]OI2F#F(FLJ!ET OpK*F!DIF0 i0(F)j?JBѫl30hP!+FS+hhdBFiiG+hhhj #RF/⮲ *0 &Ii0ll#Ii0ll Ii0ll_Ii0llIi0llIi0llIi0llZIi0llIi0}恞)9)ٝ<)C)J)S)Z)f)n)v){)-C 'PŰh F hoChhj:DRh2*(O*FdIiG#h"O1hhj#hYI#h*Faihho3FGn*FIiG Eh"0Űh F!F0GO1#OpC"#(h!Fh0G E0𵋰Fl$"(F1# S#F"O1Kh#F)F+Zpl4'x'I F#+vlm#e 20 R, F FF///#+vl"!F0X"!F$LpF%Kl J ! Fx"O1 #OpC+F F^zlpdXf(Fp9)-C" F!)DF(S@+N%` `Op#a a%H3!+"-@/ !-Q `K@!JH~+P#)*5P`#"2 !JK 3"2#""1#!F,AF1(F F) <)ĕ) h-O%(Hh F*Fp&B-߀h O O  #3!0Fm2#h h #3!8Fm -@P"F@Ft#hhh0P"F@F#h5h#hhFXhF@@KF*Fg!? O@ FLGJ !#hF pA #h@J !F(Ff, #h;J !;LF0FZB F@F8FH(8 F@F>O-FF ED "O 2O- aFpE4 pP!" JHF- * J!VH HAh2 k@PJ Hh FЦ'/p'))^,q'K-Oðh L F FPF$ PFgh~ !0F(F(F#OB?FOsOQ2ǼǼO3"@@s)F@}KA#22F##2==(F)@+x8!(` (p (F(j hhlG@*FF@p#SChp;D#A V&25FJ3#B򪀻1D (F(6ah0Op 1DbCD0 h(( @O `R 9F bh@B R)F RF!8F '@! (F< B8p@Ѐ (ch@XFDBO6DOf` 04O0CI`kh 32Ey"Bp hXCp DDi i !h"# #O'yinS5pIh;h8FlG h:h&hG(d hO2O3h# ##(# c F"Fx0G(E#& h&#"h0GCF7 h9F&O8hlG 86F(#& uJFASFA  1 # #  5Q  PNFάάά@T0+ + ¼ƼƜpWEO# 0IZj#B@PFWE@j 06O;HF0lGO<F h FO1h##"0 G(F #!###"#hFhkG"eOp "JF$ X @ƼƜ& #c\KAF"D YK7#2## F!@F(XFs0P hWE"h00pc G"ckK l3`T hhlG"# F###hbKeeW!F(F8` G(Bg#cA#?)WEh ghp3D F i RDD:k;kch;c`JF$\xWE?vr h h0G e|'(ؕhh #_kBD6( #i@#p#OpCchg[h0DZC1D i RDDk;k##hh #ch FO8;c`!F(FP& B680HFlG(Ů@F(-C FIhp'Fhq(; +h`hkhp zC`Dhp"!@D i1 (F(p  8D AFhJ#G 03 F ba2bbjh2j`)F F F)FO0i-OFӰFFF*H +B#O;pO;@O;*;;" 0! &O TE"$#2FD(#D% EHFb!AFg0F FS #F* J! 7#F6d8F&KE|E<#%<(F=-A# a Fk;lO@Zkgh)F!Bw)FOOzr#BCBw#!XCBw@COS F@A[OCOC#F aORO3OqKKk-C+ FV*#+R! (F(NF&Y&!56.8`˄@ `Op aOpK"!Ff# fK 2J3"2#"#)F0F F(k+)F ɞђ(-OðFO 0;E 0YF@F  lG(#REFXE E IF@FlG(yPtpg2GB#w #Bw ۴Bu[#BuU# F)FZFZF# zF F QFkE 4P!J4#0F9FBF^BF#F FVFFF JP!gE. .! C  u**('Ц'-OFh F hmG#hhPF%P5% !WD/D8F'qb(oЅJ#E**1 lI  Z#F F eIZ#ZEF FOiA*4F F(FZI Z#F F FTI 5QK!hObF@ROb!F@LF F'om6gЦ'***-H F h#h`#Rg C XEq  ڻl# ؈"#h-OgFEFoF G GD#iC Kh.8I9DF2F#EiA#2F FDFF$e E4EE#2F@FIFF4EyF4( BOtrJ4 444 0`+Ҳ @FhJ!(eKM h/! @F*Ц'***1"$0[ѸOO#yp0PF0Gg/.FtDE#]A]KO ha BqF A BuEDA  a Bw LBuF F#BAi8 %0PFP$0G*F#F"8K!h#BBm4+tOpF4Bt@F#DsC3 2FXFD;FL aF"F1g` DG|XFaFCC1E D^'D#Bu DF#e#F#$4(' hphFIihlGPĕ#1h####h(Fq F3hh#BscFFE ppmF$Oc6!-!F""1FI(FTF(F@ mp F{dЀFx I`I F8I F@  gq*𵏰#$FE,=FD!+F!B 8F`.J#!#O3B0=+F(XBXA F5KO1-CLMh1`(Y0M+h/FBhh LM*1+K$A,GА)1#0h`"hIp# FG(F%O hB%#h)F FlG  _#h" )F FxOcG01hfx`xh5 F''JK(FF^,`'Fx x/(ѢF]/* F/*RJOaHK/*J+'2F!F@ϿF!FI@F *F(8ںdhL h0:FI: h6N3h; :FI=0h* (F' jF!3IFFH h*F I(F& P%*`𽄚'*ب'*MгFF"FI@F -*F(!F F@} Fp"FhF Fh"F@@jFI  }*0} FFQ"FhF(FI"F@!hF0D@jFI }0 * F,!F@a-AFFFFF0&WF)Fr0CF:F I F0 F&K(FK$D"` %*'8 L4huIF(FF(&&T8'+-CFMOD&0F'IF8FbFF$h;F IF0F_F(#h F$B04&'$+FLF4@q4! &* 4"9FF@;"1F T'L4[O#4T- TT.FV;413F9FF (F&)F(Q; 4/(F&'$+pFF FF)FJF Fp@ 8FF7!FF*FIF @ 86+FO@FO@FO @ۿ@ @ @ K0 pG'0$"F!DH&&D!LFF H I(FvD8##`(F0@&I(Fv8# `'j+w+ H @w-A+L#h(Q-NO h$av3F"1FF  hs0##"#G(g#h.w$ sBwg#h$h ic(( #h$h0G#h$Q 'h#p$B @ !" Bh"Rm*3  pGsj$ Fp5hJ#hFXhE3F*F!@#h F0GF(Op!F pG-A $F(a1M!F1K2J/h0H,`/H "F,I,H,Kh,/`$ହ)H(K'J!F0F%K!F%J0F/` F,O KJAF0FKJAF0FKJd!/`dF(I FZOp=1F }F爯'+gq++'++++++`'++ pG]HH@",s pG pG pG8F#Q۹ҹ@ F8@+suy (3B## 80F!0"hF8KhhOp-jFOOO# # FW 0Op' pG pG-AF\F F%Bcm+#~AF谹 Kh$1hmOpw#Bc`# #e `Op5p4'+еFFV Z# L K(`! `н/" /O# Ц'('F IFF\X9F("H*2F F)F@ſ'p$"!F#jF!F@ah0Op MF K!F+`F ckF*h^I 0jFI + @pI笯'ɥ,,q,S,0-GFQ#0} Fh F"0U#0?O@-a>HZ=IFp2F!B0FBOr6Oa2HCFh&}1I"FFY 1F0F }QFBB F!FFFHFxF(0=+BBJ!D\G%0FNlꅹH:F!F0h(;F"FI\0hX0h0IR0hN IHLt#O+~,',,, 9-A°F F"! FOO8iF H+ Ѷ0@/U#0 aB:FIHJI F(JIHI ;#x#"FI 4!Opg0OrU#0竟''K',,,,-@=8F F90J T#0ha8<'"K`  ]'R!0pFihZiF0FU+FIF Fp@-8-8 F0F Q#10I T#0i00@IT#0a 8D-KpF F+#K#FhFF,ж0OrU#0(Ѷ0@/U#0a @E(Ѷ0 @/U#0apV-8F F` }XI p0T#0 @+a 8@It--AְF"!TfM$fO,<,R,@bKhkb4,`J$`I `HZJ!FPh(hF$ 42`3C (UK`Op!,( F(V8h&8IJ9F ;hc%EJ9FF AJ  ,>K@FhF&BF;I0F 0FF0F&|@+OsdF3F/J  m&Vh(?zOs3ar@-$K$Mh= "F(h?.(h-(h=#Or2JF&!JF"!o"F1FF F ph0'<'''K','---'!.-((U-AF0HF/IF,O.MF(9,h<8F*IF F %HF&HV(5K"J H~(h82FI(h"I FF F&@ F HH<2FI F F, JF A.='Q.//o....!!npG pG-OFE"qFFFKgE @@,C*A@&O F@%FVF Ey gFEw  TEu $gBwEgMEDEO4O5Eh,4`E6oA4F=FE23Kh!0pGL'-OFF #DFEMFy gFF#*s#"#.w 2F;F F)FC2G3FF2FiA;FE1B Du4F=F#OI2G3##Bu E@F 0 FOa sE2#Bq EF F  K##2C]A.w;F2FiAjE1B Du4F=FcМ0+_ĐZ !F A##BBJ#BAEۄB Fu5#Bu:4BtLB.w2F;FiAE1B Du#=F4FBuf"##aBs #  ]0%##"#U#( (F)F 0ppGFBh I> F@%׾"/p FF/!(FT8FH(F2F5Dix`)ٴ aB0b#FBp03O0"H0Y * F("HF $ N MV$0 F!h,]#!,E ; 8'Kh H8''#`FFFB,?!K#`ppB0+$Op ` %q'ED`BBO4O5EEfOEg1h;` 532 F2/8OrPF!0# 0P#`08-BFFFFE(@9#*FFE 3`a3ڲ +-%pp/E  E32 Fih$kh4 J( FJ kh JJ$~//""F0K@QJH{`@h% F@%𚽈/ŗ/FM+h*R(`OR#BAsO`!OaBOwۢh@  T'FmFFF+Kg!JH{mKh!JnKi!JCnKj!JnKk! J~Ch`h#uCaȿO* /ԗ///000-OF#e Ofq %_F(sO1O0O0OY'!#B3q:F#F F#O0!B 3q:F#FPFcf"fSCfK#`H#ee#`` F-" IHbX#0 F9h3`#0J0-O,MFOfq #PTX%F(v'O2O39F#@FOc +CF F%{ 0dIz( F%p(F ,MO0XEOq SFZF F\F@F# !`'F#XO F####`` F0SE'(FpBFCIP ({д *)#BݙXPBB+a3  0 *Lh2`+G++4#*s03`#s`## (F #Fбxñs" 3F B F !F#B#A"##  7{#c FBedAS00FM+h)f(`s#BA 0h+hBO2O3#"## F"j(д +hB #B+ 3 T'8FLh # "ABز83!+ K"h KhB (4Bx2F8'L'P'8 FF((`O ###`8VK-OFh FF O "FKFIE (B@vO  #p#00###Fc# C RF[F# 0s(q$,0 X3A" @pBж0##0ӱ,D BKOYqJHzb#BBO2O3 0 3 h3BmBj  2c8'c0ؘ/-CF:KFFhF)00'ė'('|1 -Oh4h3hFXh3hFh("F^Lp+F!@N#h (# SJ!8Ff#h# KJ0P !(FRshOp7!F(F$=I=HWh-AFm FGhF^44! F$(7(`$1F"BB1ЌE"J`"Z/23@N`J`0"a"b@sb"Z03JC,Դ#"K@y1JHyF! OP.Oq`!YF@oa"Z J 3C,,`'1(2[sFMF$0Fxcapė' hph FjG!0F$J#FB%K "!F#2 #2F #AF)F #A00Fr F$O0 p3`u-O hFF8F!F ? 1 $(( P"!k(F<"!/ .+#h FlG<+FF~"# #!#`(Q2OK3 #Bq!F0FRh+Ԁ3O0  !O3P"8I+h7IZj#BO4D3P4ļĜhE+hIF(FlG Os"&K1F%K6#2#:F#AF0F#X .e3 F30F#Jp0s hB h@ G 2qh@F _ O0h+##05h-OF0FFG#h FlGZKhs{O:O;@O0O1#hFFB.B Fg"0 G(y"! ## ## ##hi !"[k G#h"0 FGCFW#h FlGF(O#hi*L" F#GC ##(#hkG#h" F0G0-5#hME0F0# 8 O2O3##  F###"G(%(F%'K-OFh#(1+@܁ +h3K@AJHyi.΁Jhd(FN$OsO~OFCqKKF#>O38#FFCF@=# h+h` @O FXh 0h ph&J#! 8FgO@B#!@Fȑg 1FOp  2x [FqH 0$1hh0$1hXh@"!FO #T+h0+H"^HOq`!Y`@aZHYaYHh(Y22WI b@b#@s3133o O3GF HKb0F0FJ+++\$&F,(FG(##z0:K" O4 F-+h1F(FlGp#C !#h;+46hB؄@o F8#Kh)"H(FF(F@+h0+!(FG\B\A+?Ʈ!(FY'A2B2,'ė'M08X' 'Y2^,hOhh#/Kh@!Cb@! &fI@]IF8FC+&B#O$!(F(zaR hR4 Ch(FQ$l4 YhB68Fk#d 34 B#q$F#$!'-OװLF!O2%hF+Or(F#F(m!(F#F8@F>F#E0FW!(F# (@8F#6@F#3 K hS"+ 0B`+Uі(1+kO Pj,1H!\ # # L1# 4BqUO ",JKCS!B FgFOpJFIO FTG W @+5H@|K` C 0+0G( 3  hB-؅$[BO:0wG O MF,d6FOp](D!#FH3 ! PI F!gD@mdB!FXFFPF 0F #D 3D F"PYFFV@XFO ! QFFV0PF 1F  V"0F#4 F B+K@Q+J+Hx F#"3AF2*F33#?FFB6 &R#`Eѹ F#8F#@F# #??PFLF[ #FX'\'^,22S2-G%mF FuH)F/#P 0ObnI F 85xñ1gJOaF FO!/! F$@BOb9F FoӶ?#(FCB,/*#p FV(ڶh0F%F(F4FpC O'ѸѶ>#`*@2(F9FR(;x/+ JFOaF FOb9F FlO(F(Ob)F*\oOa Fq(#x/+0 ex%m # FtF*p3;DDo?}MObI ForOb* Foh0F,( ڶ0h0F&*`-0F F mNa2gq+F~(  @ F!  "iF ( F +@ B.-OFFF{RF(?иO'0F|j00Fx(FC+ "I FF(#FRFI\0H5"f;FYFHFO5Y32D2-GJmH"F@(Hp(Hk(@߀HObF(\(F(%(I O@((F(чI(ObF `6I( bIF `I(ObF ` {I( bvIF JqI(vtIF AF(@qI(inIF F4F(@kHObF `bI(R b^IF FF(@THlObF `SI(9!F `VIF(.PIF FF(oPHKObTTF `GI(FX$0JFOa ` c `0;F bQF 4 ,%!Op0F Jm((%0I(ObF `r `FX(I( bI%F F#HObF(V(I `VH%(IF Fz cJIs(?2222232?3313>3O3N3222*23H2 `pG# `pG# `pG# `pGpE,u F)F`BeEKh#J!0FK,hu6 5 {!P"FFH F" p('k>Ц'ܘ'-OF@h#C#C#k:գk3!%kd##e*sa#%RBcC#K !Jm$% AP]ckh0G8= %O3c0Bpp#wk3 & 0BO6c501FPFlG(#EE6cm|H #C MYKhCFWKXJEFFRJ!NO3 6" LKp"O1/ ##\0F "V@KhFFxj6 W%-)e(%%3KL%4Kh3(qۥ%#EB;0EAhlGFF!)( 8 3 G9D;FFF2FA d1D#kD##c;0+P΀#BAȀHEq FF4('^,+$Ц'[K ;0Fh8YKh,!<18CF*FF0F~(J#*s## C7+5HI8Fj耻7Fp"B6 B p&vk3#FF#BB #aKA# p#w;kD#;0z?zp'I 0$6 # 0 3  k"cE#kC#cY FFPT#k # a C jJ XFLO Op(''5&gq-OFFShCE@p%h#0*Dk{gpJKhFmJ!h+Dg[m,.wvBdJO& gGgh.Dj+%@e[J(!F0F*" VJg&! ~MK0F9Fh#NJ3k /HJ(!8F`&hD+krYrԫkZ=# #>I )z" F 7~6m @/J;F(!0F(  гnOp%JSFpkh[o#kOИG3h+Dh+Dm^ @gJ(!;F0F@&Y!+#@#('4$4+)4/04!4)4( Fqh$p %F#FBѝD* (F+ $P!3F)J e'H) !#h"kԒk2$3%+ P"F VT* P"F J,HU, KJF!hFp- K J! Hd)V$Ц'/h?4,'Bh!-O2Fjj0":Op&)FO B=7JOP#C4#a@2Ka@b1Kb0#c0Kc#hg#gFF hhCE&ah#Op B3 Fj(ۡji j( 120 !A|hjFAFlGH# K h "k k 3 h  -OF4FFFO p' E1Ѻfqhp'hq" (]shQF`:F3s` Fi1 x#"^kih b####ice+je7hii D hjB6* Ѩi@x1fHk1&#k #`m!cH*Ъi*x"mB"eA!c##c  hK-Oh F F8F${ eh! PF!F(\J#SE-FOsOsQO;tpżż@s"1F@IKA#2RF##k0F"CEnahj1 !=F(eahOp b 0 h!,(Uch` D1Fxbh)F  n"AF0FRFAF(F #8 +c!1Ff8Fl#hkc F[ 0ch3c`1O03`Rf8F8F;'in -GF FOp 0@K"O1+O . #30 /+"9F /#0eh&B@ij !F(ahp&ha!(ch!`( "\2F!O6(FV#h"9Fckc##"bUch F03c`0Fh9F 0눹 OpE}R*F!Fu(F!xy6,'-O FF#!4"0g4PBw#c#"4LA4#C4Bt #aKA# p!!0YKh$O(rVIr)#p&BBj(Pm3oO1EK$!Op COhO3F3`Bثj+m$'F  O32DjUccXQmI+hmkG 0h3Db0j3DBZm**kB cj+@uHhxP0APQQQ`0Dj+@c 0B"F 4r4jhBh !FlG(h+++# c!FCFj$|''5&l !F(FGh+ #Bq# C #REs gCF !F(F4h+hB؛l(FG`p$Bp'Dk3I##(q#D C #I#Z\:*@3 +p;#*#s7;#REs .NE@9#2C3 #k # K PFYF;p# |BC"D# c FFB;"##NE@p! qKA Ok p"B@{7 B4 p#s0A1 a g #zgCC3DBq#  C FF#g#B7>#2C3##GPWyA@CC3DAREs PEq  P%D#C k gP,Dg.wD###YABw #k3 A Bw+0KEyB@p#Ua(q #*s"###kg##c+kC+c##ap# wk3#0C#0C;Bp!qBMEsk1 P kѺ k 5FFU 'H#:K;cF F#A jp# UgCC3DgNEpBO'Dk3J#:C PPEq :60Dj+ IXF(?9FXFH#*sF#Fsm #sesm+#e~gq-OLh% F(Fp& #B"-lp!(D!YF(eFO0E"DPԪK$\CBLЩK@OQJHw03nJk՛k35Sh0Ep"IF F$n##k!գk3&.p4p"IF Fn.fhS66IhhlG0##h0[hBp4 p !p0!! 0Kh;$p'hlG #4O3$F2A3#0BEIEg4#E50GT Op CC3D #cFF# e*sۀYAyE&EEy򋀸i# %0B 4+tO3O4 4 j-@o '[B Op 3D43D440B/&p'03DkYF?!FF6ԙkKP*FJ jhlG0D3kY#i y#A  CC3D#KA#405)wm۶T4R4|'p#pGD;kZJ jk3 ЫE3h0Fo#G0CD@Eq #EE 3h"F0Fk#G504<+h(F&lGFA4 2FA3#0B;pp#wk3~;k{#*su)hO;O< (F c ZFcF#"0G(V###Bq F F#+hjkGa"{m!Fam#bmcb;nb{nb+h0`a(FGCF(+hF"F(FlG;kC ;c#8 BFA KF A  1# #  604p#E C 4[Et @ Dk3@#k@𬀝@񬀣n+nZhB"X5IhhlG(X5 hhP"G(O2O3h# ##### c ZFcF#"0G(=4Fĕ0!# #"hA0GF0C2FhlG#A#iA CC14 4  !O2O3h# #####E]A"F+F#"0G(706#*shO;O<  c ZFcF#"0G(.###BqF F#0jhkGacmam2bmrb"nbbnbpac"1Fh0aO2O3h# ##### L ZFcF#"0G(фj+#mC"e"~*C#e@Dk3z!kv#*sp  )lhhB* 0%j5####kGacmam+bmkb#nbcnbhah0)FFGl.)FG #.BB #0BBieF")FGBF0" h)FlG0cccm[j+#mC"e"~C#e6Bx#p O4BP$p% hBQ O p# cFNFFEp$Ekp!0F F(?%p"8 FO2! p3EdO Op EcOhEx$Op0B e "3c .!F hlG8p&.O0 B0>8 2#*s 8#BB 08@H04w6#CЋk36Cp,C` kCKkB k  +hBp" Pz  }k3h.AFlG0 82d0##3hb.##5ce6ep4_Bj#CЋk3Pp"D74SF$M(h((h7j+`h!0 /bO6 Fb%KOOrUKjF#2 #c#FPDBbڠj (Fb #!F00>jj V0( ܘ' -OFL h)1$Q+-@uO-@o(!+F)FF8O@F3' h#s0##"#GF(#h$Y#h"(Fs#G(F&FhB4!h@1<1@1p#Cs##K@/,aX!O Ah#3N !!d #Jc!#8FdK! "0F#Jd+h"hh O$ O% 2 )h Hh! vXF +h"hh *h PhZF!v& H%+hh+hXh@"AFO #"b#"#0vKO %&uH"`!tJhY`"a(qJYa ٨j0"bmJYb #@s3"6@33o O3GF _Kb0F0FP.?ꮳ+c!hjsq####0h0G.igV)hM#EEG0(FG2F;F)F"2F;F"(F#'+FB9K&Op B@O0O1z.h+h"1F(FlGP&'#h+  6"Y&.+h(FO80Gx12F;F(FGh+KOaJHv.4#)Fg"#2F;Fa"F("(L,'^,p408 X'   gq4c4)F"yFp3l##*F/FEC#EJ"" hOF(@ 7]j *F F6p5R"lkC dhlG(?I"$C hkPKFG$CDlv+p7WDl.&3j..Vm.g( gq gBw gG Bw3p2p&"^Ch5DlkGh"C$hkP#G$3DmBep#PF0$0%0& 0T(?_"#$3K]HOb!" !`bOr!"!`rFO`Or$!"(!",!P"0!-I_XFF&"##+l$jFinhlGP#g FC 85E&` h #*s|+"## pG pG-OFhFFF籚h8!3hhhahBCYc!`a"5hk3`-FJHp`'h+hB*izhihhhkhR 0 P "0F8# J`bhZchJD`3`#i+`2FYFPF7Q K hBڂpG+#pG,' K`pG,'8F$1Cx1$h0G F8@ x1S%5 $1hB%-GMȐ$DF%FO3 VFFXF  E?>"!F)F@YOsQ" B "(#2O3:F!FF0F6(F M z F: OG(@O0 "!KpF)7 !(/i@*  FIi@+ ckiO pkIF(Fp@i@- ki@. ji@/ #kp44pF°OpFF"F . !,4Gq[eyOpiFLIQ@= i#HI#F(F&RBp@> i#kF+z @? i}ckFOpiu80F82FOpiFm+0J!i@A Z)IF F&@B iNm&IF(F#n+#J!i@C Opi8cnFn+J!i@E n+J!i@F #o+ J!i@G Opi coF 445|45*FOpFF"FhFH.3&4@LD)O`T# 40ViO pj+ J!hF2i@5 #k+J!hF&i@6 14*5#FF0)01Wcjqx@ BOs"0dFhF"=IhF<3jc(0K"9FhF2"1FhF,,6BjF2Ii&AOp,OG"0dFhF"'IhF3jc(0K"9FhF"1FhF,6Bi@ !cjFI(F&i@ hi@ #iiOpcii@ ii@ ii@ #j1@)  5-O$ }FMF DK(0#D`R/A21Rx BD#PEqd h'qp8&*h~C"DlD6I2DP =*h&DI2D 6(@́@"YF@Fr)h@"@F1Dj7/+h#Dj+ ݫJ9F@"BX+h#Dj+ ݤJ! @"BH+h#Dk+ ݝJ!@"B8+hB #DI3F(@Fx&+h~C#D3D`R(qC"!C<!XJ+ n#y#@"B+hCl!#D3DXZF+ n#y#@"B+hC8uI3D#DXsK* FrJ!@"B+hC|!#D3DXjJ+ n#y#@"B`S3)h\RaJ!r@"B*haV&D]RYJ!`@"B*hx##C`#DX+ OJ!L@"Bx&+h~C#DCd3DX+FJ!6@"Bt+hDCh&DX+ =J!$@"Bb*hx##Cp#DX+ 4J!@"BLx&+h~C#DCt3DX+*J!@"B8+hDCx&DX+ "J!@"B$+h!x##`S3##J@"B-5.5Q5X5_5f5|5O*5w,5555555P'I55+hBI#D 3D7/#+h"#D_Q1Z`Fl&082B`P/A01&#x0*s@xlB/DK4B }5 -CǰF FNFO@bOp#FJ! >ICF"F0F&fG "!!kJCS!zc"FIx5^,5-Oݰ#FF!J03`KO hF,@!FH Kh+Kh#D[h+tO Kx' Ch#DQX)a`R(qY`R!2D3O JzѹDhO"#`W7'D|}#|0##J%(1hDO@|8!"j""0d *U Op OrIF  /DkK4B~(?А}1A;0B/@ F$@|q/h0G$q}1 }AJ  @(O O}1o1F!BA->.;@0i,@!4BQCH!F(h K4#"C$#FO1@7 (Ov] $+h!J8Fn#"sO1#F0F8FB8F(` F,@9&0@:& `O0|*𵕰>NO3 F FsjX @s! "!"0(Fpb0 +X"DHLPT+K$\`)Fpj= &K"Z` 2 +kbOq 45@& $+h!J8F#"sO1#F0F#8FB8F(`5@&5Ov5@& 5@& (`O0|,'*-OF"K"O$FhF ( #F:h4J!PF#"O1#FXF;h0F4##KFBF"(Fq YCDЦ'('40Ű +')17Etjoz$1#"#FO1@I @K1h#,!<@J O0 k[ c EKk[ Kc$81#"#FO1@K XOw,%#h!%J0F#"cO1+F8FG0F8B0F4 `(F\@M'`@N'Kn[ Kfh@O'lOw o[ȿ# gKo[ Kg"##'*0 FŰ +L08NVb #"SO1#@# #{/+ ")FpPJ!(F(F8D#{/+  sE1[ 11+BJtO ph,!<O01[ 1( 1[ 1 1+1+$1v@%'$(J!(FJ#"SO1#F8F~(FpB(Fj0` 1+1+v(1@&' 1+1+v,1@'' 1+?z1+uv01O w `n'*ChFsl##` hJ0Ih+ 'ChF{;s#*s##` hJ0Ish+ p'%-O$ݰO6%FF{Kh D(xK@s-𰀸x!*$hBR&XF0gJ! 0 DD8F[F0bJ  aK) FFR1+_ "Dh)} WI _h9FlG(84X/Л bYF R > D,/*EIFRb "D 2FnBrЭ "@FB>FUFF7$hBi>FUFF'F|8FhB,IF 0*I #D!1CRS#:F(to5 ] )?}0 ,($!Ir (0"#DZ`8a4Q1D1'x'2^,Ns6gq136Q6-CFDh,AiF&'PhjFTlG`#Bs FFX04,Eєkj+ g J Ih+#+`(h <#3 # 'sB-O}$MF D(0!J#DhBI(Fx,jIHKhI I O ~I0F"DSi#{I0F,#)h !DP0+6ИX1F03DRPTJhOFoF#G*h'"DDmFh:DxIm#GFZI0F  0WI0FO ,#)h !DP0+7ИX0+3F0 YDR8P TK hO"FoF#G*h'"DO DZDmFh|o#ImGF3I0FO  0*h0F/I"DSjj#>+I0F:*I 60F( +h%I#D h\S+h!I#DhF Q+h I#DhIX+h I#DhA+h"#DZ`dO }6=6г'066M667747I7\7'kKO2-OŰ`FhJFF%hTF(9dKhȱ*FcI|1#$ |Ah0G`YKhYI"O4 FE$hi*O2O3G(h0G(JN0h D2h GI"DkSkhjkkFh5H48N-C0h(*F:I1h!D l+$(h""oIlF#G1h"!D l$h" x#IlG3h%I #Dhh(3h#Dl!2!"Z`F(0h(?wIrF00h(?m"FIgкQFHF$0h#0Y,'x''7u7'78728M88#YC-OFPG}Ckh;+#K1sOpn"IFi%* G}|1@OpFhWX3hx5#"9F20F"2#G3h9F0FlGx1+S'0x@4F F F!qJF###F(kIQ2Opp"gI"!F"cI"s""ii#h+ x&VI0`@FhiT;jS"9F&"QF,7EbjGI0F@ !## ##FFi0FE@ i"##2F F#h+?4h/I&{ivOp"##(F2F1 @ t##h+? #lS@) ikIF F%(k!JFckh#l2Fal$hlG### *h8y8}AB79)8 81FO#h+?4J!`Y̠D V<["1FO"QF86E`S/B32 ! A BѸ8Fi#!Jt"##@1 i"##BF+#*s`J!R"88w11-OmNFF(FlIFQ F[)  "EF ` $ASj}@ hi}mB 4F*FTI8F$6 @ hik1mBFS )1sJJthxGJ!(FhOpidBK"FF@ hiA1mBF+ 83F1[ 1s ,1J!F(Fh@ idB 1K13$1!'J(Fh@ idB 1K13(1!J(FhOpidB 1K13,1!J(F~h@! idB 1K1301! J(Fjh@" idB,'})('k> *Ȝ$1pF FF phBx1x1S%0FxAPD%0 !x(0F F("! n$1 J I4# K#3KK09Y ]0 'X C h J+ IO2 K JK]']0 X 9Y C 0@?Kb`ck;+إhݱ1{% 4@ (^#10K`0Kh*/Ipbk#:*  ,0=!F !F %J %I2h2#K#J#K"J "I2h2 K!J!Kr0 F{J I2h2KJKK JI#ih#KKo,'''8'Q3 * ? 1F p'N + A C T'm2 = > C+ '@ 0 = + -A%F)FL"&FhF["OI0FFMKyh0:qXhhBkP!D"; 3jDJ" F>H3B(F,"I0HF -=-M-&0F M@2~"0C0D0۱*K8C4\%hF0p&JAF8FF1`v\(p2p2#0Z"K@QJHqBBFF8F&0[K@QJJ J--. JAF8F9yd$999@58h\jB$ٜj #ZCX@Bггk#B 3h#h8  0+ #*sKO}qJHqOPBOA OaBOq !O`@ :9hkBF#BqO2O3# F"##"U0  pF0KOaJHqzk#FE,F 4 44FI O08`(%OO XP IsF#CX ЌI(O#C  # <0@0O80;x+е4+F9F Fh "!8FOF FC,$- "!OFF5- "!Ov (ѝX0#"gI"9FcI0H# c #y]I"@#C #k +?h "TI蠹 c! Fp4+t3PF%`")FD0#P #E0fS   &EPC0@ 03 0 @5XF0"##4!V4 44$50#D0Oc"0`F.:I(FfDh$\C F/F(Z8F1(FjPF:98'::<':$9>1>>)|d3hYk! #(FxpFp#`cFFx3hk00+@I(F(EF& 9fE&6@B*F12 h*Fh*-#p @B l  *FFhXjB jBCXG"hF9FhFiFD1*F FX-OŰFFIFFNO N%\|:FI r@ Es[h#B$0#"YF"qY5d:i-HFhF$|@( # gBwF #g C g^Ew %@(` P0  #g C g^Ew ,Fh #kFB ОB $*K` F3@,0й+c0!F4(h;`#OCg0 F^:Fh  " FF(-KFkFF"F,SЊB (i "@2B I0(0C0# Fc)FF Fi #KdB " 0+ IE@E! DF0Kh;` "!F80:FAF#40(IE@EC0|'-H FFFF ĕ#3`O2O3##8F#"###,HO0G@j0`hkB.@y #Bq! F .K3`  Fs02F!F0C0z(hEC`#cFF2;-O]$FOcD!@h !$ F ] I:0(FO8j1k#FFF),іD@k*MХI sh I y(#D0tkM,=tc4k,H4kMO,@؀RFIF0FCFF ?" hHh( o  F3?(CFF F0qh #)F*p F##xh#(8khCEhAFlG(#BB#BB8kAF h&*Fo3FGF FFкٺѹJJ1F(FzLF2FF(F>J1F(Fnu =J|=@58pFpuvU B Fp@pF0 K@j! J Ho4O3G=Ov]#ah8F6R-C kh0G8uvU B`h F@:^|=Fk Mh0G#!Oc`hCFЧh!8FF8F:F(F@0Fy(F F M8uF8q@"(F2" F 82F82W-OFF2FO BTF ss 1"XF2   ,W"BQٸ#FDFFOq F(FCFFO F60*5)3Щ) h2"D`# )ER@)#" DSD SD#Q 8  "#FO F CFv:K@1:J:HnO2q \F(?`(F|O2B1FOsFO``8FF"#Cb?#2#2#!`O320 F1s4h(F}0 F$ F h+#"Bq#hjF! FlG(((#h F0G:g|=-A`y,h((Ѕ(8(9Ьi&0F@P `Oh8D'hN3qqq@h b+hDw`+h8P+h8(h&TOBM F3F/((&3+OGF82BOт111111111+h9F8q4FB!2FF+22.h4B8(2+ѐA,8B,ѫi+?[J`X=-O4mFF!O !OcD O5(F 4m I0X6${C3F4sB# @"!pPOr)F  BT!2kK@!jJkHnJ$ sh - ŁÁā4@,ѶJU"OX."OK)[2F PFK~(R-PF\6+X6+FFF9F@|=3>-O FFFFĕ#;`pi0K@JHn(K;`O0$#44O4 ٹ,F3+# 4 C#%C +(/Os-)QO 4!)DFFO C###Bq|#KA #Bqm4 FbA4 4FFBt/Os8BYFd F2& 1DFV*FBqBAlۨEKFA"#Oq F(_/?[SKhV#VCBs!FB/?C@>u;F")F[@BF8 DFPFt s w yjB0)*"*@3B ##RJU"!"!")F+<F*F,#hCEy 8#Fc u )F2;F[@BB:>|=Q>|'h*F#I @FIF#3FF#Bq2FD #I A BA a FFu;FbF)FP[@B*\E"82#"BqOq F0F82JU#1#122b, /?+4#C@Os #"BqhF"B4=#0FXF(#!Bq"FpiFFKF# +(b#p2FI #@FIF#3Bs###O #D#YABy(i ;F4"qk <@Bh< "! p1"K|# I Bu]D[3+%Vt!&y^1  .ЬB?d014)"TBEs Q-?C V -CFFFkh0G%k-@4 1FHFk(BѸ;(")FO""O0+FBwO12F;F F ##"D# F # ##BF"K 1FHF+(FKh`h #G cb#k#*s ! I# #`hG c kHh"P2G%k'-OFhFF0+m@7MK0*FP!LP# F|xCF>+,N02FP!8P# F|bCF+"KO2hs#REs FF"FYFPF*FjCE@; E0*FEF8F @1;h`!dYF`#FGP@*'-GF$KFF FO8O hsSSS,Ey@FIFoڼ@*Os Cb#B@>?"O EF#h:`;F2F)F FFG`GO0'K0hFIOp41810!/ F(@ I#7 F#hP%# FG F0'[&! b c !@ F@K"FIFH <^,@@г L#h3x `KhBK#hXBXAȣH(0%lF*F!F(F 0#iF33bX(O0 ]-O?-FMOϰ !(F ## ! FK#A #iah+2A3##BA ڔN44#$4L"hR?@I  x#h+ҁX(́IK Kh+J! 9xDKyIb풋A @FIF'bJA q D{4{j&vd.d&3FLKh+#-Kh:d!JqJF DJ&D#O H!Bq)@O wN# wJFq #DcFhF 8t#I9s:@FTkIF{bSKyA 8ꀵ @FIFbrA {Q bFFRJ!#BEs )@Ҁ @20(uOC  Fs 2AHA3O1C C2C#Od ( FqF@0 OL O"yBR@2OI O#O"CS)F20F#J^K#*sD Iv y<0Y@.A(8(0((D(ݲ @( (("L(^,"hf `ih%a%c`%`%J`3Fah*(Fh+$hhBҝB"Frbid*Ѫ|7#`O02!a F(`B )Fh0h F*F9Fhd KF ">O30 #p%UFD03BO60&K"O3H0x0O6P 0Fp2Z`jhh`"h(F(F &&S0LFOr!#h#nI0 H##hBД H%0(ASFhFFnhB #jC."9F0dh  H@ʺS8F K F) F!@ F, F!KI F-F8@ TTF-0HFQ [$Hd F12#C|F2!0 32#aP FII"F#F40""b32!|!F2bd #@0P!0HI0!T8TAT-xKFF #CYnF [h[hhx3j 0O 32@ A X 2+PaF22AYF0F2th-HFFVF4h?F HH32@ A 2@4 2# P(h c0 H2## F2@As#Fhnh"h ( ѫh"h$N.hnhp#j[Z *Qil 3 F/3! F0 F30Kh13 F,3dh#jC!F(F00FndhAClpFKo@E0++#dlKo@E0+(##emKo@E0+%##fQDQ-@LQ-PQ-`p+DP#cl;cd+DP#l;d+DP#m;e(F,5U 1; 1 a.a(F,5AH1;H1Ha.DDa(F,5-P1;P1Pa.L~La(F,51;1a.ja-HFZ# FFFxF#l!F FkJ # 2C32@6F2g F'V2@F FF2g2#)F #H-HO hF #;[ #IH0+cl+ Fg0!32#P clKI FJ+FH羽ST6ITjFC0!32#Pcl3 F r032# @ )O F F@˼-GFP!42gP$&R;F2# 2gSfH&;FO1\2#2gpPF;F2#hZ@0 0+"2 P#OJ gP ! P@F*JF2#52# 1P Ѹ>`vFF6`2#C1F26wn/f2#  P И 0; %0f/H02#CqF2=0+CD%0` HFl(FFIFFV/1F8D0#sf#h"9F`0n02n B2n Dq3rnBث# '@B-OFj+I0O32 YX  r#C9 C"C4(F X x $ IOX  r#C C"C(F TX ($ r#C G&VL% $$($ F-A xrCC% nhr#C0S"C-E$T rSC0F j'w(XrCC0F 'w(HrCCvh  F V#!0@P/mH!C'nh} F%((eK)FmcH(F/%( ( \K"m[H%mh # QPUH!9#F!PJ V!@PB#CHH0EIFHBF#(" 0:IUF#j3 F"#@-CF[MFnF*h <F(0+32#Cj+.tѐH0#GbclZ+ EHCcj FCILoO3cdajd F o +hBWДF(Ipcj.Ycl+V 0HH0fdӱnI #1F:F. FnB0Fx0 F! Fh#h FlI F F F +hB F C*GbcjAA+& F CJ +hB F C5 +hB (hUITyU6-O`O IF5 h2 +X AlK) b C#h[n F|( h# fFuH}2#` P@2#  PQ F;0  hH2## F22#  P8#j+ F !2#!@P F*2# !P FN#j+2g qP@"C !! F:0 EHC2# P#j+ F @ F  :H+hB`ГFcjAA+ h"##/K!,K! bj hc # !HF 6QFOFHJF! FsnCEJ7n#"HFw9F.됱# !8FQFZFFH:F F!w-(UUUU UUh!F #0P 0 32#!P A! FE0 IH F@B-OFhFFO V(HFh#j+/W0YF F322F)F F FBFKF F FE BШEdh( F iE F 2F)F FU(-3HF FC($ (f(j9J9I:H FPkcm)F#ln0(.(:(P/J%/I,H+J%,I)H" O #;[  F)F0H J% IH"JIHnh, FdhJIHk0H0HH0H)FH0H6V VUVV$V.V=VFVNV\VBdVuVF bjF h@jFy!bq#jK FV F F@K-CF FF1FnF8>#`(Fj LH  F12#CfF2V2;`h F%`lJ`O2iFBF(9HO5&!FF`O5#`8h(R8F lIFFj# (Hcjsb= = =0+))4F2C`h`#c`l0Zh``"Z`#jcIFH#h F( FM- jF9F@F#j F%z`2+`h` z`VBVV-AFEH"#| F F0 ;I;H!#F6J# FF-Hynh,O5h0F nW FnJEDH6GXXBB CEԿ##k"#`O0IBw##i0`j(( MpihKEiSECh S`#bCh`;F2F#ibk"j`B`` bF#*ѣbEEiBEԿ""Zh2Zh`X` VEw ""h_C__`ɚ;## G]FFFOzqFF FOzqxJ (F;FQC1F&@B0K@Y!JHki%Fܱ&h'jBiBiB gh^w`gh5>`jg`<`b4Fb(F_C_0K@m!JHkV#dd_C_-GF0>KO(q>J>Hk@@lBOCFDO4 F8@HF'F/@YF(F:FOO F !JE O O !D#F)F0FdF(FA{i0?h04pW"p2CCC~CS E agig 3 E a$hJF_C_80KO7qJHj5 8@f_C_-AFF0KOCqJHj'O$DDkB 2FiF 0O0 kkS$0;>+٨4X P,C@<_C_Fi#O2a#`ba 3`h0hxi`j2+Z`Bh``2+Z`Bh`~"a2+Z`Bh`s"b2+Z`Bh`hbF@l F F@W0 iF0$ F0P! F(F%C_`O3CaFC _aFC_bFC$_b#dO`d0 F,F-AF0JK@1IJJHjIM#dl*@jb kG#h+vCF"F# `lCSѨ6h+Ш0h@B `#gBBBԿ!!2ñZ` `0G#0j0(Bw!!"bg0+6+DA7g( *1 G* G|*z l_D_ʚ;FHFIF {@Bc4 Fг-AFJFFhF((@-;F2F I HF0:F1F(Fb F$̣гR]pG-AmLFFF#h4bCF:FOahZ0FIF(F$#hBВ m(R]pG R]pG Rr]pG R]pG RV]pG R]pG R:]pG Ri]pG R]pGK@`  ̣@K"h1 V#`O0̣}FmF$B +n9FS$4 Fر F 1 F F! F F h F@/FCb0C F@0LF"!hF#h%" hF4+hjF I%C0 kb#hBВ'0(i𵧰MF"FhF!+h% F0O0%+hBВ$`7" hF>C#hjF I`0н0cb '(ih F F! dhh F ^ F dh#DFB +* ,F+$p FF#/x+F" F( "1F(F(:!(F F(]oB!#0##"# "hc;`O0p3p")Fj!Kh.F;#Z1 R5oB###"#0F "<# c3px.+i+oB#!#0"## ""`c(O3 ccO3c:+|$pMFF*h1$hd.#`iF0Fb0$f 2H F+hBВi+dhp(-OhFFFO40hw@4`hcah8F8hkx++$hbi5!ich12HF:F! +z i+kz+ 0 m5:F[F!HF _h(#` iB@hnhpGCj@hpLF F"!hF#h%" hFz3h HjF I-FF%C#hBВJ&p(i~i-A5MFFF+h Ki +V i!|l0h,PѨ\#` F+hBLВ"#㹣h+ * *("^#h 3#D DED)+ѣh.+/+*/#i;`$* h3SsEFbFh !iBdh (VCF"OqC-"OB0IH FD`FC "I 0O0 -O߰F F!KFOrh]& OCjFXHK8F]hB𴁒v(Fw,0іH8F['$I"FG BF## 0[x+U(M=h-MѻX S%(K5E%$lB3m" S$](TlBȿ%$smBݳm" S$](Esm+D$slBݳl" S$\(;sl+: 0F&(8 \I  6(mhE%%? h$( # QP %%44B%4B% +tl 0FDй0 0Fj#(%! F`.H#FF"I k HF0 cbm"IF Os x"OC0I\0[ Fh0a *)؇* **IFH# (D$`i`5*Ѓ*+IF8H:%*B*А*#(0  #= D)b=)g=(0+ +sl3IF0F(% #!H@@ FFC ] FE0IFH: # FGi3#d F0#H0#ld3#d%b] F`d#c`{h``4|`ed_P`@`13-H@ 2' V2KeFҲ@ D"0@ 2E2g%Tt%T&`9F22g$TO&`'122g TO&@'!22gDTMO42-CFF FF0H(FXF IF0Fkr0F H F 9h"(F1IHHv F@F;hFZ:`@#(D-OFnNFFFF3hFR+x"+!<"+@?5@(x(#4< #0B'ӹ0ԱE ##p)F F3@E٧7#`O0)F F0F0B E,)F+\*qjxn*0*Fb* *aFat*x*r*Y,Y ",U""p,PO #p4K,IO .K" xh 1 Ѝ xV1J . !"hFx p1F" F[0  P2*Fѝ "!hFZ( ,PF5FX,"p4F?E H($XFxF2 + +pG+FpGXxCx + +pG?FpG-OFFFpF8DH$R F=!F@JF=I=HR0F%p0F6SFM0FHFHF("PFH8F(S@%`"Z`P%@8F@0F@8F FPF F 8FaFP #CUh0ZFQFD0KDZp5FS{/1F8F(+HFF(H/D`-OFFF8I"XFFr G(5D! H!+o 0 ko`;`S03`CD0403``"!IXFDL! P!o 0 o`C3;` C3`@C`D34`! !n 0 n`;`0`Pp4```FFF x{%#+pkppp  0ppppp /!Fz!hDp " F###"# "3H!F)O0&1F J(х/#<.-(h a0`-F)F8Fu(9FH``0 FO2##"#F#F(FH~# `F 0#*F! Fp((ܿ#p(#(OpcpO3Fh%Xi,'#j`Bi,'Mfj%Uj`B `jA# 355-OFF"CFJF $ h1z++7gv+8:E:{:::%Oy::i:V:b: {%bo|: ; T   L h X u  " 5',? F|F6p"F!(@6im"m1H(kmeZje@# 0FkFO HFhB𵅑~5O 2#BF2,55K BV!#"FFNF O G#*H 1O91 (#"F1F00 x+I(@Ȃ O  # 15O 2#B F2,0"!FpO 62#O B F2}( a;D"F!#pAFўIFH>dH1.+ћHO9AY # 912E9$"+FO 2#ED"+FO 2#=5t"F#! BFфHF+,sO ',-)@;k+@7/ FO 85O 2#BF2, O2##"#F# FHj5+!FbHO9,oB##"#F# Fb`+!FTHO9,̇!FS#ȹO5E`E(!F4HnO9,!FS#C(O5E(E5O 2#BPF2D5"F!O982#O BvF2g,;D&a3aPa^a}a"5t#xc/! F6F8/!00F#p"FO/#;p(Fz(2#O "@R2##435O 2#CF2,oB##"#F# FZ5.+܀!FHO97#"F?xA$CFHF(𽀗?a_5D5@?A4D?O ,,! FFCx3!FHiO9B6#b!AGѩHO9Fl5@O 2#BF2^7!2P (KF2#3"@ "2p ! !F FT,#3pFЊHO9,64@ 0F@u((Ѹܦ7#`@0 +D3C @0O +D3Ap@`5D5B@03D@@2FSFAF0HDaF?v(O 52gFp9F2,!x)4)ax4)FrGS2##x6+cx6+2#O CAF2,O2##"#F# F850+!FBHvO9,)сl"FD0O H58HO1O 2#2g{5O 2#"@F2o,u ',! FF F6 8FF8!HO9.T7p#FJ9FO &02FAFp@F?5H!O 2#BC2g05O 2#BF2$aaaab;D*b451#O rI F85#O rI F85 #O rﻱI F(ЯI F05O rݻ!FHO9ջ5O 2#"F2Ȼ5O 2#BPF27#p1l"F#0!#F0ђHF5O 2#B F2 A5O 2#BPF25O 2#"F2|5O 2#"`F2o5O 2#B0F2b,g!FSO5ZE(E(#C,1!FS%%Eg(}V, =! F 0=HO9 "9I F|5RF0+!kO9ݺ2#O "p@2#Ѻ(I " FXFH0RF0M(?ڭ!I" FFF 0RF0"I F:쐱"I F4`"I F.0"I F((iPFF HyO9L8bI F0E%6I F(EkI F EEe$I FEYI FEEI FE% I FE%I FEeI FEUI FE!FHoO98FF#pI Fر FdF(?1h,"1GN0HO988F[EUFF#2hB, Fc"h Bbh*3,44hc3`,##3 3 5%HFIFFF0F!p: >*O VK  > ` `,? FKF7#pO2##"#F# FFTF.p8F=FF3F1F0FC?F>n?2HO9(F(>\3F"FIF'5"1G`!HO9z8FF0O Z  @3W`,?HO9glmlllll dm mdr;Dde|e5O 0#0O5I O 2#BC2g?5O 2##1F225xI O 2#BC2g"5O 2##!F2,? FX8!FgHO9hO 15O 2#BF25O 2##!F2,?SI F52gHOI F NI F@FFh2O ƺF&h2O 5O 2#CqF25O 2##aF25O 2#BCq25O 2#CQF2,?5#"F!p?F!HMsAO mO i<O<>yQFHB"!0FzO9S,?X h.ɫ HO9,D" eԄ΄e@cd-OFLF F%'FOX81F22(5c-1FHDDbj* ѹ H1FO0GDYFPFjO0(DeF%I F #H(F42#BCa"#.#"#0#K22I 1O3`0C0 g#RC2#BPF2`!P2#B`F2xJ aLK-OF FFF+O)K"`I32#pA # aP0FJFSFBFF BFO ""J)F8Fh"F(Fm12#"u#F#*C3C2# F XF O (WWHD-AF F)41+Z1+dn+a8F"1F OKBj4m}lzmwnn+^Ѡnp&oco+_ oioo+`Ѡob`0+_X`0+_N nK(FAFD1Y6(F;&61Y6(F-&"F0F(Cm T"F0F,6n;f0F,6co;cg0F,6o;gph60;00F,60;0 a-OFF}F(T5ˡ2#C B25Oq Z# 3?F(s0/n # aPf,! 5f8H,! (gH,! gعHP F H1F FFF0F5#f#kg#gt#`F 3Y(1ѫn1n 1+oD1koH1oL1oP10101#Ij(]j{I}H 9  [EYF ,hpH #1F F}F ZF f 4QF@=iVF  c   2F! F[FTFR8D Bx + +<\+j##%F UOZF$FI iF  +DѸY?IHF(@ (k/^9F %O G"Cڀ F cF  * ** *#*;*8 \ *" TF x)\)@22F8D Bx + +<\+O9-8F)F(Fh # FJ(D($jmcmB88(&$ FoXoYjmcmB!F(F(koZco[ 88(ѪooBF(&$RiK*hBiIi^imi|iFбh"Fp5(FF"!F(FcmBF(F!F F8F!FhF6!FBФXF FXX(!FТ(bmCmB88(Й(p!F"8FOZO[F5N%"FF(!F!F8FBФP`0Fk F? !"!F8FtcxBF+8є90BЛ!F8F!F8cm0+32SR[ERE!FHF!F w0 Ѥh+Ф h+H# FDF(KJ8KAKi( K;! J HfhCx+ + /#`  i\Ki( KQ! J HfJCx+ + /#`  ijKi(K}!JHf,Cx++s @h@ hJh;i*@i/#` iuKi(K!JHfCx++{F@hCXBXA" I0@ n/#` iKiK(K!JHfCx++ ЛF@hKB  hbhSi*@i>/#` iKi-AFF F1K@mJHf"KOqJCx#F p F+сy1C1FJ F.@yF"F8DAݿ 3F"F)hxAiKii8 FF0K@JHf`!KOqJCxKxs`xkxB"x+xB(F((  F((F ( 8: *(") D8@#: *("jKij-ACNF3h(AK!AJBHfGx//&Ф/#Ch+g+O1 ,"@:@BФt#O4` F3hBNЎ6 0bFBF $)"hF!FhF#p0=iF(FW(K@'JxZ)$"B4,""A B$,3BFx3*F(iKijP(-AFCx F+ +HФ/#`O0 %#p,&FcB8FX!8DFB+&v3"-FH5 BN5xŹ8F#3p!B KOq J Hf6#%p 5p P(5jKi0 KOq J Hf!K@JOs hC`iKiOj0 K@ J Hf! KOqJA ;Q+B@+iKiOj8LMT8(F6K\j3FR0CFO4 F0@pG)F w0FFrOT?  2F9F(FCFdj-OKFFh@%,@GFfF(I8F̐(@kp0+@!(F <(&HJI(F F0с I F0ȁ:FI Fy0+h! #@P@6IF Fe0kl+o~JI+ F~I FU0*l FzIM0𔁕H FwID0jj FtI<0!(FpIF F00wmI FZ0p+hnh+@3!FFv0;dI8F~(@BaI F0U 3!2#[JP[K[I FF0AXKk*@k(F1%(F@l(h%(@n 7!2# PJI F0p0CpEI F0H0nOr!I0:I F0.@Nx0 F1I*F0! F,I0ۀ0+\ F&I*F0ˀ 3!I F!0@F F|(jljjjjjjjjjjk kATk;kk(kKkkk3~I8F(@8F8D<6+:ФI8F(?􏮢I8FF(?􈮟I8FF(?􀮜I8FzF(?xI8FrF(?pI8FjF(?hI8Fb&_&]&[&YJ*hnhB  I F0 O0B!F v0[hI8F4puI8F0HsI8F* sI8F&HvI F0+tH$.Ѻ 0CoI. (F(iI F0iI.ѹp0.!(F .aI F`I F0]I Fy0􍮾+hnh_%(?FVI Fi0􃮮8F%(h.@܀ x0K| FII*F 00h1(F `t0*F@I Fp0 .Ѻ ;1 FV F\xCF*Hg.@*F.I F1F F50?W1ZY*%Np&=;FB<+FK!J +*ѝBx*K!JHe6jjST6ITj8TAT jkDLAkLk3kYkekuk3~kMLkk0B "qE((?2z= `B `"`%hBЍ)`3.?<.T)F F X.`'pF hFFCF F#p@pKlp FFZ+Q)J)J!F0F0O50%[ZiJl:!F0F0O5 FF@J!F0F0O5! F ` F @J!F0F0O50h1{ F 7X0!F0Fh!0O5(FpJjITjj6 #-C2FFh 1P9F0FAF`HS F 2 !*D ;FXH$ `S0.0! SnOKPOO Dh DB. Sx S|"` F Sl`8I;H@&4O#,NѝW$0;>+٣#`4Y  Q@,CA@<b," FbH0 ѣh+IH# #+IH(OrBW I"FFH#i #0 F09F@F$h]Ll`CDC1l.l9l(Cx+@$K"qF&F=F; + ѸBq"2Fch#4H8chX2H2ch0H,ch.H&ch,H 8@] 5ZY&H%H$H#HY"H!H] HHHH]HHHHHld@V'lm mhmlllllllllllllOz 02#4"B h1"B#F0hB2,3hB2,3]NF F F3h5RK0)FK8FJ %3hB"ЍZ B)FKB8FJCBO0-<)F FLCCB D ](XW]m$m-OFFFFFIIgTF00F F #x+"AI4"?I F4MFO E=FO E;0F&#`O0h  ,5*h*!F*렱O2##"#F# FD**hB*h*+'kh$0F#!Fh(O2##"#F# FD*hB  ,5XV#@:[*C STl`3mpxSqKF F$ k..x&̹p F9\<,p,F3$ p30Z:*p,"p0F-O FFF$NEe/Br#<< F *@*ѣfV#`O0*щEѣZ"#-|RuxC   E5xq-F%NNE?-٣:#DjB٣.7#*F8F6zO.WpZSNE@BE٣#O SFFDD/B ",+F+#;p-OFFFFF  CJJ&IKE&Kɱ/آ7#`O0 (F]?lpF6!բ#`-c/O+p[AFPFP(Uъ o h 0Ao \,  h 0Ao+/, ,'2\,O2`-/(FK獱/\ (p ?00hp0004p5L6y-/?,p?56p0F}nL$-O,]F\X5FFFTF0Pu$5,F0(FEH0O0?JFI(F 0и )F= u0 (FEh(FwI0,Lrh:F#F@AHB(>qhH0HhI(FS "F9F(F$%0B𺀍"F9F(FU;FOaHUI(F~6$ P4)F uL0 0(;x#A)Fu>0я  ,] -/9)Z(*-CF#KF,{FFhF#\ F)h F#0B.Ќ..Т#`O0H0۱-#0nOb! I I JHF . F9F0%(8mRm-OFFF#jbhjV#"F^0#h1FgJhH h"i 2"a FaIq@0# K[H F [Iq0iO#jCE&أj+5-3cjOO, jCE` S XFGFgjOjCEf2DD)F8FJ?F 1F;h9J=H#h{  `{h1F;h0J4H#h{hhhL:F F0 1F;h"J'H#h>D ,7#h  3[h # 3FXFG "a:h B{h j { XF13F,7y;FLmmwmdjmmmFi,'$a+j`Bnj$,'j`B44-A FFiFjHpCOТ#` (`g.wۢ#.0FEF(F2F@FHC FB,`&z+Cz+щIA#apG D8%@ЊBآd#`O08C% xLF65D*!F"4,%00O0 B'ЌrCu%9F0+smip(F:F/?G7=D''& m(SiNv/ii-G:N$FBFD3h!"F-"##!40O4- F3hBPЌ(IF(DF!CF(F ,FLE##DE آ&#`(F O4"F 8FF H," QF@FHEPF#DF.(NpM FF@"!+hPai" 1h.Os0h40"i$0 ci H Ih.F+hBЌp(ii@-C$O FhF"!;hA%U ; ")F  H `˅hmFi!(F|X`#j I"cj# KF4%;hBЌ:'(i ki˰LFFOr!hF#hI" hF:#0 i;hjF I0hIC#hBЌK(Ii ˰2MFOr!hF+hIh"hF 1#0 HˆhihjF#Ih0hC*( 2 <gV#аBq6&fb#RАBq g""bg  I+hB ЌO3cbO3#bK(ji -O]L<FOb#hF5lAo$m(н BСO4#``0+ѝ0+E+++w*B,<(F 0gѡ~hV<O4=+E;+*?C ѽnF(н D? :CKx+`+Kha*ٽ13+ O1 !(FF% F0B*ٽno(?|A!) !O1 >(Fma0+50+ (FP+ 7Z ԝ(?S@rM+7"F+p+#F3` #Zx* [h# $ 0#Zx* [h# ( 7@"!08"9FOsp03h6I~07ѡh+Сh1+.I/H0+mA"(F;Fj]0+Y x#e f0 D(F G0+B1 ` Ɇ 3ˊ"F1F8F ?Fѡfh1+I H~0+ O (i@#Nvv0+? 3x+sx+#sPF "`(F ]ǰLFFOr#hEK#!2(FhX J9F0F(E#hBЋO0G(,N`p MFH"!+hVh"Q ;`I0h0O0+hBЋoI|000co0h #oCѡh+I0h#xp(liHmiHH?  wHK0 (F(wQHK0 (FAw: K0%#!C FUC p 04NpG-Hܰ@MFH"!FhF+h[T ;0h"!FhF8jF7I0F 0!F4Hb0O 32K[  "("*CCB jF'I0F 0!F$H>0!32#@P(Or!x"!FI0F0ѡhV+HI0F0ѡhV+H[+hBЋ\(liHZwWiHpwPi wOi w(0+  pG(0+#`$`V#` F(0+F#`$`V#` F( F*"IF O0pGDN-A5NFF4H5I'3h)RCFQ0IB0 н0+ѽ 0C+H FO4j:!F(FGF(ѐ""  HI F0I F0(FF(ЃhB9F@i (ha`*#I FB=0) F3hBЋ*(w@qB@wlBfB@pB-OFO @;h#;`hUhaiCF+F&h3SsEFeFh$h DB/ HFDAF3:hBAF:`B(+FFF5h %i#+D#aB!;hC;`s0F "O6C-FIf]gBpMF,h (@,!O1FQ)R "#"0F +hBЋ@" p(0"F"PpF1԰$А(0+LmFŔ"Z"O3iF,#0F"Tp>#`O0 LN@pGpGphFF5-Mo)D`@@CpF4[+D03Fm F@<0!-0H3FP2#PP1Д=0+-#D%0+f#hnh 0B0n+nB Rh=0+  2 H0H0O 32[[ ѕ(fwpF F OqF 0`X+ha K0#h+0#pOpp@B0 0cSc-A&OF"%I ;hCF&#2FE=Oq+F0 FO4f F;hB$Ћ4+F"! F0"!# 0OC0" Fl0(FEı-ء0#`  ` Fdx` hB١"# F#3` ABhhB1`3,1-OFF *ء#CKBСV#$` F%,F+F.F,lB `+\!FF(A F (M(QFBБ E4(ѻxFB]D,!B()F (D,Q (1F!FFDF,ѡx#`FcSc FFF0]0#x #pO0-IF@!Fyp/4-KPjѡFh+y 'H[$ Fy0"H (FvF(F",,F J HFyCF'y H0hO gK[ 5# #F0 xxNKx4x FFF0H+h ` O0 FFF08+h #`O0-C FFF2EK@QEJEHc(0 bih0O !`<h2#xX P *>0 c``3#*F ;F0FO3`:#*F;F0F##a;#*F;F0F#ca6#*F;F0F#aa`!F K@QJhc`i`#*F!;F0Fo0 h``#*F;F0F`02ccxOqxxpF`n3,I~CFfѠh+KHh3032!F2V Fp  I H(h+FJ!Fv$R УxO= 8#FxTh F(*F1F#cU FpF,F-OͰcMFWFFaIHFFF+hXK(kZF1F hF(qП1F LFhQH8F LK0BlMOr;F8F ;6#2F [F h4#2F '[F 4FT 0#'0,0+E/Dѝ'0N @#3JOq8F,P L-IKF"FPF0iX L|lF(!HO%Lp[KF"FIPFK0B ЊNh uLVKF"FI`PF^FNLFKF"FI`(FMO (xO@xxx%x-OF%M F%NFUQFO, ,5 1, B%p%B&F,ѽ0F U,XB 3BU,XFU ,FHF%6,5#T ,@FT,5vF0F$Oxy*-OFFؠ#`( FB9F s0 DEєf  #3DBҠ`"#9F s0O0#<#1F"F d&DL[FIFF8F04FT L|QFF8F0h&*-A*+NmF3h 4ؠ#` / xU,ѫ5 LLN!FF8F09F s0=9F(Fs+FBF@Af0O0 $3hBЊ I8F0#` m(  31]aS R#h +]sF0-O F+ox@`{_0LՖo0 ZF9F#(hvF(@ST0@ـ$P0eZF9F#(h`F(ZVD"BQ(F6F(ހV;  8AF(4ZF9Fy#(h-F(ІK+-$CDCE 6!2#`P0x0  xH2#B`F2 F 0 +٠#`OSDBҠ"#(FF(?j#?QF#BFD O3FX;B :iBhBO3O <HF3#t0  8IF($t ZF9F!#(hF(? E0  Z< +(FVFO4i B:iBhB O3"2@F3#t0 8AF(4(@CO`C@O#B CoCOs[#FK^,yy-OFK}FFF hh 'O'0*F4#0'^ Yѕl0+@𹀕,0+@΀#hOO, #h  1CE؀0OO, 3h0 3nCEɀ#hOO, #h !BEO 3 hh 1[E 4 OO nCE @F(K:FIF0F@0 O0yKhB*T#*F h0$ :FpIF0F!0#*F h0 (i@ K:FeIF0F 0a@F K:F^IF0F0ѷ h K:FXIF0F0Ѩ'0?B#Or@!l-:FLI0F0.'0?-@#FJ@!,:FAI0F0u2-'(30 "P @AO, nB@ 4 )FF 0:F1F h#K0}+0+!F0:F1F;0K h  , ZsE2(7yHylyZyyy@yT 0 PB)F hih0:F1FK h  , }T 8F@4nJh"n(FO3fnCf!oK +h" o.O3#g"##8-O&@Fh$ hdci ciai#bhca#ifa8#IF(FP2!  P(`jK@F>RF1FFHO3#cKd #!0P𠀫I(Fd!O r#C `jK1FFHO3#cK@0 Kd#kZ 3`jK1FFH+"1FH##ck z[G{k'{{zck zkg{'{{ zco+;`jhB7єx03K#k1FF~HQ*BӸG{1FlkxH'{{*ztkB z1FpHdkg{'{{* z^`jK#k1FFcH8Vli+bДx ^aii iBWk+T#h+QZKd#kYT 3##`@02#!pP01FPHyBFOr@a@FBFUHH!(FI#o3i+^aii iBY(F$13R`o0[CF gA8H(FO4K#h+ 3K3K3K!bk#/Kk!#|+K"k!#r #1F&HRFIF.F0F?ѝ+FJO&??yyjyyz z'zzGzzk&{@Ozzzu v Y z -KF@F !hI(h+F"!K;0O 32 X $ r#C )K F #@y;kl+cik`jKp FH(F("!(F3(h!+F"&h&` if ci(Fdaif#bKi 0f3fb2 d!2E={K-OհhFF`S0*@Cl+6% 2#vU@𪀙KS,"3 HEHn0! FEF@ H 72#qPO Oq F(t0˱*ٹh( B  "wJBјx ԛh`#+p(0+kp+є= )pp2#!PPۀh+@׀ڀր#k  s #aFF0 A)2K3 #PK D )?cOs+IJ\P"#AA*sU##0C1;HB#!F F2FCeE8 pcl+6  2#qP'"KSl&3,JEVZ[2F{kA 9FH7kkn@"uD!NOq F0 HOveA(TO]{{cScʚ;W{5wz{{ɚ;6eĹй,`D2#qh` P@oK@5 D0 8!ʱx 2RER=" 8 PF x2R8!x2D$ *DB@𸃹й@3t0;xԛhBy +@2#"0 $00 <)+@ 6# 0<0 J<@|<0 @6#0#0<0  Jh0,3lB|AFJF?􂮫 ?8#0#0 K S BB   xU{J!ht 0-wHFP&`K h#F"1F)35mSK1F h0#2!  pP Jb1FF H FpH s"CKJ1FHF5S N|W{z|8 FP H F#h #P F8@8|J!u J!깕u 8FP +h;+h#FJ!hjJ F H# F+`#" F#8@8u |J!u p PF1FH1Fk*kHf h#J+`!#Fo#"c##032 e! F2Vp@| }u J!xyv -H #PF`6+`h  #3ҹF F(I 1H4#h! #0PT,I FdH߻69F F2Fh#hO #;[   HHDF9F F! 2F9F X2F9F(a F0K@JHavhg  A(ah F F#$- FHz#}U}^}xOqx-GF`FhhiBsjB_0%FU {32#FJ)FF*Hy#Cі@ ! F"QF F3F!%#F"!xzO X I Fd4N O'C#h!(F h" K!# %}Tt pFh& #5U?#F"!1Phih " FA(=iZ'#+`# Fs F pi FEJX FH F}8F0P3 FF HI Fd8@ 2(aH F8@ 28#}U}I-OѰ`' hF6FO2#W h! #0P$13$13ўh0+иIHPuOq (߀O3`fgP#"!y+`K8Fd###F"^! 82#pP8F8 '#81 3  q/S78F 8(:FQF`2x!`P"#C}8*# FHP 'qf"#h# 2#wCv Fj BF$?d+FrJ\2#! #P##bC#hn 8ȳ7p81"Zp81  #h80=p7x 8p)( 81Zp8= 0r=)*#) FHH~HH FHO0Bvvr#C F? 1 P  F7h(a+i:F Fh1IE2#OyX (H$2# qP@)+k3%y(@|?F?F '0iEw" Hh #3kb(O}ST} }O}cSc}+ckkkckc0SE@րP-?Y+h+?U`#"+`6#!#2xPal) ^H9!PĮr#C hjJ FTH00#Ch+0SEhjJ FIH F h"#F!c2x!PЕ@q h$+i F9F#@0ki 9F( FFȱ@F ha(?hBFd+iog!ax0Cx0 h hK FB?Ӯ #3h+% FQU~2~Iu Y cSc-OF xFF+F PHh+nBCF:F1F F_= *)n(#j+ 1l+4#0O90"hn#!0#i  F" K2ѵ-Ы!07F.F(F.EI FH}P-b S<3h0BЈ!x`B1:!D0F ](O-C!]1M !R 4 2+hO(FFHF!`BFO Sp#D9 #c`#90o"!FCH !S3h+hB#Ј$!F"8FhdFH " 1 Hn3 !] (OO$Fh!-OFHhFFFuU ;Pnh F 0ӱh±nBє= *)XFX )FPFYKFBF1F FVdhN-CO0F 32gyX HCpH h#F"P!>I Fy0!32#Pcl+ FC佽qT- F h 0O 32E{[ Rojh0Bv'V[ I pGTpOqF F(yO3"f!+F0F(Fcia[+{   J1F HO0pI(Fdp@{HO8F@b|i t`i qh n8 j F g,hnñh$K :$O3$1( N#(180h+Rh-HFP 52#PE00= 0*324K aF2( * * 2';NA @ 22& wVKaF22V!Pc"C F^* &'V%N'LK!H\!O#!FF2FCB%`vTZ[{kA  H7{S+ h2F K!eD!eA ʚ;ɚ;y 6e8FP#Fh!JEx0+ h!8@z8y -OFLiP)h(koB  nH# FkglI5 F0F(ѳiXJ)5hhiB/I F_HT0!32#pP FA#h #PO 32#xX . F!32 pP!+h + F Fg(&  cD>pDFF #C90+i ki a]kia+?tcj&'O F !/  Bji0i2Fњ2@*`7/K! hdl F2#!pP?7 # F+`#ngc}ـTypG"Fв2][B F*pFٝ#`O0p$F pLp>pp!2F "uU FF(@CO `@@O#oCF#OsXhH hhBhhB0hJI Fh@Bh8 Fnh F8")F F(dhnh F h[hh hb@h"BhHx0+@o0 pG pG@03O0 biXiұ(Дxx0+±(0 HB јO0( +XBXAFcScK-OhFnhO5#jPfj ѕI:2F1F8FF(@dh+h+ѕx0+ko3KOqJH_Ikohk FpFPO@FhB𔁇Vjo `oCg2@HT=AFkoAFh#1F90"F00("F00F(Vcj(00" F!F( `#HT=AFAFio81ioX11F FVF"FPF(?W1FoioxXCXgX`1F8FDB+0F8>( hF(?["1F!F@F #AF|0S"1F!F20?kx+(Fh8 PF F0FF8FF")FMEQFHF(<   $B +ЙB"IF((KqO}Cљx0ZFL2#<"PFH FBH FMF(?ݮCo `<CCgO3 HT=AFAF 8 FtxA1 X"!8FvFHAF8FAFEEQF8F"!bF(?oAFAFY?`"aj0 2 Cљx0ZFL2#<"PF FH :ҁAi p 1F%H)F CFѝh1+Нh+Нh+ Нh+iiJ 1Hki hܱhhB#hhhBaiPah{Y`bh F` i5koB#x0kg0FpQ`FP0-0Zoʱ0!32 pC %T0+!F0 0pG8F@L F H F8#03`CaP-GFFFFF8DHh$ F0 32#P 0hP0hhB!? F"AF(FF(P4 F(Ea#a#`a ` a HLFJ J F!8FkjKMFH4+F:FAFH!F 0ѝh+ IHi F i#i##`shc``t`{Fy*Ph@Z.0F@,_ci3032#WV__Дx0+!(hYl(F@>!h@K$"1FhjBijB  %HJ1F"(FF  H@k(1F(F#k,0Th+0"Xgx co3hcjB(F#fgx0!(h#h+ѡl(F(h@Bc0 hpGiBa-OFuHBn2 #`FFF(F#"9FHF.F.(*hhB!*VQ`ch`=X4 F('HO"8ha"`` (hb```@(h`8hHF(hJ F !+hhBѸ aai#a;h;3!FRF0FF. FO J7Ph0-GFh O Աi'h.hl:! RF4CF0FCEE YEPE 3h33`4w7#Q R (^PVPnPfPFFFTc `a` PF0FF#RBA (Op#ka(a0F#aF hFIjF3!I 8FmC@e@աh`H 1=8-ѡh H 1Ih0h#I8@mHH*}j8F &&C&C &@C0F@A@FFFgD E CCHF2F;F $%@    CCF@F"##$%E8FF9mHHXBXA8j("H0=mB  FFF:F1FF(F 8DhhllB(F FF8FhhPCж"(F"#FF(F F8@ 𪸁h`p 1FH)F +0ќh1+Мh+ Мh+Мh+HhH5`4hp")FH(#hXbh;Z`bh Fp@`r`F~P8Fhnh F8B0Cdh (h(АH0+ѐI0+Ѓm[h"FF:F8F FL0  pF@F$ht~H0+єI0+mB Fp"1FH(x+-pKFFFFٜ>#`O00O 32k[ !C!F3FCp@*"!0F#"F+FRKBCKm`Cm `-OFmFi H"HFE@e#` g C#l+@zs<и #"la0FF+AJ0A1DcjYB8#cb#jZ #bBRF)F4H#3m2J1I   O.KF*Fbj#jQZ)F)H[!F ?F$Hg@F!HF)FEX)FHH .`n`#(PPPF"I(0 F] F!@P80!F F H F8F" C/`0+ ((FP-OF4F0 nFFFpPF8@F,h$/"IFH(y$hj`#FIF@FF8 C#(ˌ##`khc``l`mX#CCeH0+0єI *+MCH0+HєI0+Bѣm>92+Z` `0GHF # P FG # PУmmC@e&` #.//2+?Z`bh` #"ZFF !F8F"ZF!F8FK/ F 0+?T0+32#  P?E #!P<@F0 3#B?/!0FO%FPFFhL h HnO0hBhB$hhg`C``` PKAj-OhFF@"(@0!32gPil1b#C*ѕ(0+ѕ=@,,ЛV#)"FI0Fj("F~I0Fdp#`O60F0B々p/(F]F(O H@"KF(FO6F(0O  3fH 2#k[ %"QFHF+FjAF Fc0>h.YIF.#` vZ{h&`1F Fc``|`w0d00(0+ ѕ=0+$ѕ)0P0*0Q0+0S`R0#T0,0U0-0V0.0W0P0 Fd+*FR)?eShCe LV#`ZP0"HHF`m[0!32#`P3v F&1#1h`H 1- F#`0&!6hm ^((Fm (PP-OFF 0 hPHˆ@F!#V# X# @F# 3+hO O ("YF@F4"FRP?+bShkbh"YF@F"h#`&0F hBrj j" C #C0n@H1F"PFy#eF0K8 0/KЗ(!hh 0+icjBpbsbh 0#jB3b0bsj+"jB'ٛR#`0F 0 hH"1F(ѹ O g2#8˱#3`khs``n`v Q (P`hF H 1iF FiF F iFH Pm0F 030+сhH 10iF iF FFh H F-8(F007Qh-O Đ8 FO0[hh$DF Fm:fjv" PF8KkkD.ch[hh;\Gem#ekjscb#)jhV Cg g2GsgFBFw+jk#b b8kj+ѸF!h#ijhV Cg g2GsgcgB Fwkjk`b0p FhHpm3@O)F F $h0 hpGm BBe0-OFh O ım'h[.hH4,lCF!RF0FB?%E{ H#f#N,!ml #906#) 2 B𝀚`#`]! D+*F F sBs# )rHє0+<#@ C zKE DK YEPE( gE)ܔp7k  nW2C3 gP-=ЙBB5B6%-E{\0`[H 1AF 60 њh1+Кh+RH#3\0#H\0#UBs#hҲO  D  Ba**])[ph(XД0+zCvd# nC -KB D@KXP##[ERE3рEԿO O O# c FF nP:C; `##CK#[EREB >D#E{O O ɚ;6epQ#E{%#CS! K#k H!IHFe ׅjh<1sh" hBѓ hpGpK!-O=ɰh 2r@&`H;O3c`72F%F6"$" *F8hFZH 3shUKhBx`` +.#)Fu\IHFEHj+0"32 Chzx*@i@e6H+F3H#z+cz+.H @!P"!0F(")F0F0 #H<1hKF*PhF;K F FO 9LF GFhlH#`8F 0BWЃ 0+ ,HaO0F0l(` F &(!KmNFl!B-*h*  I0FlA#`FJ !|XFHJF# 03F ( ljQ܉(R-O*F$KhؙO;#`KXFhB𯁃000+F1:#+h TBFBٙ# `H m\@eh62:)(F((O E ٙj# `HF 4 #BF1FPFpFD9Od0CEC+h! #@P #!  FnH`"B"QF /FB #!  FVHW#3#F2F!(FFF@(On1B/+@+ B*@0@ ."IF0FH{ 8H.0 + ؙ# `/HVF Fh3ScE2FFNFIB ٙ# `H#`#"(FuK0F ( p0ˌ#3`0s```8"0F06h(1Rv /`   B*Y0TmCem#C#e8 ˌ2jB1bmsbBe+ B803j+ B0[-O*FFFF (H'O0G@"CFYF`0FF(јO3%wp0% #BFn1YFKF0F#h+к  H!o bo2 K@ J H[4#0Fn1KFkK8F3hBȀkl+ ."F8.0+6И#`"$|Fع"r))'(#.#*s$#) @qy`0ZY FH̀ 8  IF,0[ }8#aFF )2J3#.K D$y*Id!# 3OrCyBEOs @FFOpF"8F&0 IHkj2b B !'{;l;F  Hs05ɚ;6e(ʚ;pR I I I I I I I 8FmC@@eՁh`H 1.hP+h#+0s  Hh F h8@mH*h8}=-O@FF0;&g;F I0Ff#(h  h1"+F!IF #h;+mh&Kh1Kh1  "r0+ДK0 hPTO3"0%##h+ɀ/ƀ oB#ogcogn#gncg#F3)hO #9Y wI(F,h! g0P#12rC 2#C!i Osh1bKh1h1`Kh1h1^Kh1h1\Kh10ñ XKO 3Ѻ SH'$0{0Z :>kg{'{{$z0+h0X?c:5kg{'{{%zU\Ѳ? J@uF )sBF`YF-Kh12 #F )8AF<@E@#00Z2؋B[#00Z2؋B[#0O??VnwQj#h + ###`S3#h~I(+cF F!5# S3 vK!(h# Q pK!(h#K/OO ıF0\ SS 9 `XF 1$\H SFh"F ) `MH 1 bP``JPFPF"h 0*?IJF0FXX [7 B 0"H +&HˉxjPF fJF`[FC+bF3CBC F  ?hOS +` # +S1+#n+q1FxXDh5F66AOC406 E;A!:(FqA1D+?.FOcF; F#hFOL H L1,3"hP!B 66h#S(?"S, Ҳ   r1&  7,3O O 0O 32XX O O O Y8F@d#h;+(h+FJ!m# #`!# Op! 3(Fc0 IH8@(F8@8! RFh#FJ!:0" !`" " "cJ  !d F0 IH@M F@  RpFh+F!J @1F#h+H# "#`(F#bcb# #Or##0 2F I Hp@H(Fp@ R  @F9FH&#"#`! 6#(h ##c#+F2F owf(FJ0:FIH@ʸ(F@d.R7FP+o[0!32# P H~ ! "#c+`#! h 2#F_ F0  I H0@ F$ h K "!#0LR 0"-C3F2 sC F_ Ѓ!F( &V F F(pF@#o0 32#qP*  H O1¹F(F (FFx H (h&`+F2F!p@ټmCCeh!(Fobo#og"g"I(F4pnT FH F@Fh#FJ! H F@ Վ FH F@r FH F@d -OFPFFF +n;H Lx ++h++ H#"9F0F 0BF H.L1, #,P1BdؖXFF𛀻 @+h+@ R"9F0Fȱ0+hK <FB΀#H#Pke S"9F0Fȱ0+huK <FB#qH#Xe#:F1FCF F0SkY,,  J \B#9F0F@ ]HCFhMY,,! NA\B #9F0Fq0CF NHh , 3R+h;+$222;F"1F F)(a3xJF >H#:F1FCF Fr0 F*H0Z#"9F0F-(#:F1FCF FV+h0+?*ؕn1+ F+#+`F Hc6FHlS :CFF Hb0?F[F HUnB'Ҩn8FfH80ZDQ)ϏC]|R:F1Fnf3x++h+0@AF: KBF HmBhFCF`2 HBFIF FZĐ-C=vN 22O(3hF F!F`.;O3k`BFF"8 " %" \" FC`H@ ! h`2F1.# rH1FVH 33h0B𗀁Bܱh "AFh  F,H nBynFEH 2F0"F 8FF(>H"AF F 2F :H#x + 2F7Hnh-0;n+CF"F1F(Fmh0cn`xQxBѠxxBxxB1nh+nbxxxxIxHx  jnZ`xQxBѠxxBxxBh  H=FCF"F1F(F[_ =/(RS4m!hFh-KFh!P #0P@13!FGF@ыHK3FJ%C B`32ṓBрJ!H<3zK3!2# PH\cT1hH\) C FTK»?|B 2<C ;T2O#'TO37`00 5dgE4#OFFcE[#hO ;[ ٱ20#C! FEMіh+ Жh+?I@H# FK-nU+*~:h*h*i jiڱ+Oc F *~"x+h00#`0C``7/nw3/! (0 "! `" !c  !)FH F@0*FIHK Fg h K "!#NS &SNSё^S! -OFLQ FxF,5&O, P1, B!`%B&F,ѽ XU,,B 3BU,XFU ,z,FHF6,5#T ,@FT,5zF0F00  pGmH*h pG0p FF$ Fp@,2F)F F($hFnFh,F F0 mh@,:F1F F($h pGF F(U) z ! zh1(F; )0&32#wV(F0(0&32#'Vh +@@C`&"la!+F0"1F(F6 Hs*FI(F4)0)O3$2#!POq Oab###F"C/0$(FO0 0K"l!h+3pG F!-OF0FFhӱ32 +F"!$@,|!h ) ##`(FIIOٿ 9 #C4 )2kl++ )))')p # #`!#  3 !c(Fd0 2I2HO(F0+M "`PAF(Fobo#og"g"Ѓ W V__I(FEIFvo n~n{ Fx#0,hnh@K H@O3@10+Rh$qS"FA8Fh#FJ!qPM h#FJ!f h#FJ!^ h#FJ!V h J#F!N*h*#@#+`8  (-AF FFh1ыm-+j+*+h! #0P!0 32#!P03Hi}CFУh Jh#F9;F"F0F1Ar -OFFF+R.ؖ#`O0 hO0O, LP1 CE90OO, 3x0 3oCE+OO, 1 CE$JFPI e\C4>3| ..ؖ#` c F3Z+ >BFؐ7!FDLA\@2o B2+6Ѹ 2`h)F BF-La"PB ѹШK4  (hu 0hB1,6O 1hB2,6.K c (hRO - OqF F(H)O0F'"C!0#F0F9F F0 #{  2FIH I Fh@S6pF M8(h ph`0|(`0 #`O0#`KhF xFp43p"x:*aF+*V5`v\* x25 R:*FX($pF h:(NxF_3B,:* p-@,:*,:,BBxC@*F (FK`pGأpFFNF;0|+:+#FpBFЬB cK,:,|,FO0-O4MF\4!++[ѱL%h-WX(F(Odh`F  #`4)F  FSD<:+ F:# 0  B1HF   D hAFbHFXF o #`X(أDDDF 9F@F7RF0F DiOFXFK`B8F8FTwF`o:*?N&\*?E * *CO .Gl.pFKO;.p=F.O;#9## FO3$]Lh:#` a``aX(-GmaL#FF#i!ahkx&p h(5Уh+2#`o& e&8?+khU@(@h+@ F`.p[#iFIhy`(O0 mhUйh(Ѓ@ф#i`"a]h(FQF(Fy`(Dl+faxD M2 @:)#)bi2<\+#ca<\+#ca:+ +p#kpo AF/"pO3:F@FcF+<`\+?n;fDl`|*:*+X( $8F F)F F8@'-GF="F(d (@f #`o F^+ cx:+o+mЦpK\+cx:+a+_У0 4#˦B0 Ж0 T+%E+3B+C+рN+R+%F+ #f+c+e+b+#r+t+n+ #:L(Fd@(F #Fd"F4F#xA:++*O4p(F_(8`wFd"O O: O O4kF="6Fd w?Fd#/A:*в+O4p(F/0` #`o F;p L(Fd(FSFd#FO4pF#"Xx0+CxX+00!!8$/0޲ .٢a+آWB 4 !A+آ7 ,`pO0#L`h#`nZ IHyR``0 p(Ol-GFELFFJxFbhOaAHf8-y##`(F !PF됹`hCh;C`+ڄz (0hZ`x +0IF0FY (-'9F((I0FY&I,0FY( "h(x+0E+K"FGu47x,("p3C,"BIs  ( " 3pC,"%`* FFp((Qx( Lbh"h2 F(FFY(Hp((F2K 8Gp( 8%L`h%`Ve`8p(8Fh L!ha*F (F87  8%Hp((8+FO*` Ȅ ,`8 8Fh L"hb)F F87  8%Hp((-OFhFFF.ȿO̿%O5g8(F@hKEh [(QF (ѴB!F1FB ܴBG$0O5W B0 pG pGpGpG pG pG#L`h#`n IHy``0 (Ow-OFdFUNFFF eH/@#08F ! ꘹Ch;C`+ڄ (0hZ`x + 0"!(FD=1F FY~(`?AF(1F FYp1Fh` FYj( "h*(x+Ѩ`'тE1F FYT( "h(x+` FIYBa(I FY<(I FY4(?|1F FY,a(?t1F FY$(b(?l1F FYhb(?d:!t(]'gFeQh(Lbh""h: #(LOcFF0/(Ф0((-AFLFFFbh"$hD#+`($ x3F"F!F F (.` F(FK 8D( 8%L`h%`e`8(-CFFFF L!h*F;F F84 %5` % 7`(JOc0] (-CFFFF L"h)F;F F84 %5` % 7`(JOc0] (8@P@@@ @@0pG-A0F O# u F !^.F090FZ1F5F+h-e.F3h+YT `,S#hB %`e`hB4Fh+FhB `^`;h`{h`#Fh+Ѿ~&qFh+v0Bq#hBychh(h``b``h`bhhB `S```ch h h`%FhFFP`FN`,#hB %`e`P0h !`!`Qh``h`)&ЙhhB `J`S``chh`"[h``chhb``h`hhB `S``P` #`8F 0h*``Zh"``h`*BТhhB `S`\``#hh h0Xh(h( hZh !`!`hY``h`hhB `J```#hh`"h``#hZh"``h`jhhB `S`\`0 0Fh"F%``;%O 2 `Y`hh*њhhBJVhֱh/```F iiBhO2F(FEh"!`#h"`^hBh^``h`h>hB 9`y`F ``F3F`h ^h``h`^h>hB ;`{`Z`` F!`#`h/hBNh``h`h>hB 9`y`FK``F3F`Sh hV``h`Nh7hB 3`s``!`#`-AF5F+j-g.Fsh+[T`,UchB e``hB4F;ˈh+FZhB ^``{h`h`#Fh+Ѿ~ vF+i+v0BqchBzѣhi)Zha!a``h`bhQhB S``\``h! i ia%FhFFP`FN`,chB e``P0 i !a!ahY``h`)'hHhB J````h"ia"h"aahZh``h`hQhB S``\`P` #+a8F 0i*a"ahb``h`*BhQhB S````chZh i1h) i) ih !a!aQh``h`hHhB J``S``ch"ia"[h"aachhb``h`jhQhB S```0 0h$"F2K`# aZ4OO Q``hi*hUhBLѕh/i/,aaaFiiBlؙBӋBhF]hO4F+F`h!ahBMh``h`hohB i`` FK``F+FaShahU``h`]hohB k```` F``/i/]hBэh]``h`hohB i`` F``F+Faha]h``h`MhohB k``Z```h$F5F+h-e.F3h+YT `,S#hB %`e`hB4Fh+FhB `^`;h`{h`#Fh+Ѿ~&qFh+v0Bq#hBychh(h``b``h`bhhB `S```ch h h`%FhFFP`FN`,#hB %`e`P0h !`!`Qh``h`)&ЙhhB `J`S``chh`"[h``chhb``h`hhB `S``P` #`8F 0h*``Zh"``h`*BТhhB `S`\``#hh h0Xh(h( hZh !`!`hY``h`hhB `J```#hh`"h``#hZh"``h`jhhB `S`\`0 0h$"F2 `#`:4OO `Q`hh*њhhBIUhձh/```FBhO4F+FB]h$`h!`F]hB h]``h`h/hB )`i` F ``F+F`h`]h``h`]h/hB +`k`Z`` F``h/hBMh``h`屝h/hB )`i` FK``F+F`Sh`hU``h`Mh/hB +`k````-OFhF 9FF>:%V9O{ K h[h9F B:!R KE ӹO ػ_O= ? @FTFF FFFpF(𵇰HM+z+GLGKHH&hFFG&hDKEJFIFHGzFJFKz)FEIEJoz( FDHDI&h/FCHG{BJCK{)FAIBJo{( F@HAI /F?H?O&h8FGiF(i&h)&K(JF9HGiFhi&h!K#JF5HGiF &hKJF1HGiFi&h KJF-HGiFi&hKJF)HGiF(j&h KFF%HGiF`h%hK"JF"HGK$h!HFFG(ܣ^,$֟_w¡U&Y:ۡ +0FFFF9FF .0F1FF &(F)FF  F!F@F CiihiCD"@b@aFZMi3B#SOihDB!S@a@aBa2ChchkhB ЃhCZhBFFh*FpG0Lcjj @@@R3@#dBdDO1D D,bibAQi DSa03(𵕰O3&'AgCc"F FBF#F,ЄB)Fl0є@"h\Kh~KIGK[z+Аܣ$O(Kj FpGiiBh[h(-AFL#k3 رcj( fj&jFB8FD0FB c>Dgcc F0 k"D%F)F{(D`cc(8?0 M ?jkk"DBhkDlc8 F( (-OF=L&FDlD#XC$0F([1h$D$0FO @TE! #P$0wl WDB!#O S$3l :DB#lC)P(FG GF>?+@  є^`#zpHwmJ%&h1@gB`h&da@`djaA9dYg.@+D0Rh#k@#b Y#f2ab*B"f1fnc`#{C "OH#3"%b(Fe c(F9"ie*baco3cgco+@рB8cabi#jқca`i%%eYd(@ȀO@F $M2HF 6(?c#;p^-Kh.[A9* %*5?U^mx}"',;RWfuz#cr5##r0##r+#jkh2B$;k` kh+?3co;cgco3(ܣ1 \(##r#h+;`jh:B3h+;`jh:B3##s##cs##s##s#0#0~KQFGP?9Bcaci+0#,bi)F~(Flh+?+#p0(O%DKp0D pG(YK-CF]j FBjC@}j%DBq]@ D.ih:FZ! F:{iB.р/"AJ\@C jiB8ka"iCai2i3aB*2hB #3`h)F@F]&O.K'L4(K|o`C@ 9Fx+)F0+1hB5`Bًi+0)F0=j@*FZ!*F!FhFFF,\biZ! ime#`(-CF=M+jB+j;DB 9F F(@+k3($ Fkn&.0F4i1FF@Fme3`mB+nB F"9FFȹNFFh Fhj0@8B44FB(c+f,nn#F 02iB3F6hB4'D.3iBӻB0Fu1FF@Fme3`NFvh(P(=K-O (FFF! @% p/K P9F sh@(0@ : FF-hh@FF `#FbiO1aB#i  O2@a"#C5k9D!9FF{*:F(ܣNtj D0%(FF( F:Fme;`9F,z)"F!(F{+"F(KF[hB!F@@(FFN@s{+%(FFx{LKh~KIFG0 #`3{C " H#54 Fp(ܣ^,-O FN (@Ӏc#B, ش{,Kh}KIFGaB]%D @B7hBټB shB)FF,rѦkbC D@B𘀪EshJBlj9F%FF( 1sj@ jѠ@O E 'JDAFXFza*F!- 1@D  TD@"E*AFXF гj'2{+*F F%`3{K# "3H4n(F 1jE(FosjE'JFH(FFpmX0{|Kh}KIF2 9 j \DYFc  AFGH.z :Fm{+?(:F% %(ܣ^,O(-HFF0N(V@KDih0B\ B;ҖB F (0FO3Z (O33BCK!FF(𪀴B"F)F(F j#Fi0BؖBӞB|0RJCh3D@@@@B< #BB  S@;Bј 0CB2(Z!6/F[0+дB٢!ME(\0B`0B   IFF/H0 "9@(FKFCFQF&H FF@$0B?z2F{ QFH 0[B ҩ8Z!/ 0+дB٢!e`pw Kh}* K IFG FFR #`ܣ(^,(FK{C "H#3F F8(pGpGpGHpGHpGK0h3pG$K0h3pG$K0h3ppG$K0h3pG$K0h3pG$K0h3pG$K0h3pG$K0h3`pG$K0h3 pG$K0h3@pG$K0h3pG$K0h3ppG$9 x` x pGFpGp pGp pGpGpGpGpG#BFpG\*3 pG-AFhFF$CF"14B F# hT#!3B"pFKhpG01hF;+`ڌiB (]K, h\ `p]KpGkpFN$V4(F* Fp4 , XK +KKhG pGX8#P# FpG3F爱hxK0h@ pGR0O0pG$XK0h30o O0 pG$@FFR;BpGFpG#BQ#@@#@3K0h3pG K0h3pG7 I L(F F+x+ FhJ#F*FIHvj0^,@)г(9 xH+ pG pGHpG$JK3( FFpGzl^,;+A,A 3۲, 2ҲB+FO0 KhBKhS HpG"KhBKhS HpG|7pGpG pG F H{ I FOHh IFHvI fH@ гoR]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpGpG pGpG pGpG8#F`HxF %`8OqY( \(7FL"xE 0(,`\(Fhx[z@(/! F0  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!HvHHHMt(< (  pG pG -L,M P#KX` f? @d`pcKK@`pcK`pKQPXQcK 0L<#KSR+*1#0K80 0 K :<KX d 02< 0K.<p`) @   0`0(K 0<#K  @  (Kd`p@ 㘙\(\ii -LQM@ \00 `VR ``o KЫ r 0L00c-00 KЫ`vpR 0 r`00S `LL -LM 0xhF K"SPK.XPKs  4Z1Y;Wc  4 4V;TE(KPK 0 40S  4x 4X ` 4L 4< 4Y' $ 4 4WV  4 4T  4 4q(KWVTZPKYPKWPKVPKTPK(KoU4hg hgg|g\gDgDgggffff -PQLM00R,`K000@$p0& 48 0<0 40@0 40D0 ZP 0S nSl a0CS񏐃ES~}|{zyxwv&srqo8 FPY T000U000 FP[Y T070U070p FPGY T000U0000 FP0Yn T080U080 FP%YT000U0000oS FPU000T000u0}` FP (K@ ~FP , xFP  rFP]YI T080U080K< bFPp @ ]FP D XFPJY8 T000U0001U080T080(U000T000U070T070U000T000 (KU080T080U000T000 FP t FP ~\ FPxYRb,feeeed\d(ddcdcTcc,caaa -Lp@<`K>PP@`MPdP K0@Q -L M@ P0L 0 = P03*K G? 0 \\ -L@@`v0 {PP0P `pp0p0G`` 0pp p+`p0p0nG`Vp cG 00[ p-@PCMLM5 /6P5 @@㲱p`6 B^K PEᤱ@CG004 弱t2 0KE@!0 0 4DE:04S@ VS440 SKp`00 R A^K PEYp@@@G04@0 G040 p-MQL MP@4SQ TF /5PA QP0s+ CP ͲpapQ `0PpH 0@@>0 QP=   p6 Kp'0s%i/@@"00p +>A^K PEp @p04@F0#S;p@ F00F@PFPxX,Xl@XP -Lx` -LPPKLMK\K&KPP/ H@j jB0dKFFKOh BAd4d@_P HK&Kf R0&KKG1nh`T! R>0@ ͌" P2$> K 5-LşM pP 0@ @:+C;PJ- C/o"0R , ` 0 `  ` 0 0 00R00z Z 1 `(K0 - CP/o" `  r0 `(K @S (S0 P (P )P 0P R0 @`K-K 00  .S R P* @0[S  00000SPBP0 <BP* (BP( BP" AP P r2p0U=P 0S X lBP  j00f00b=0[.S0=0KPrPp!~Q KBP  IABP B cQ 3BPȁȑ Y #BP  !@@ 0sS llsQ  BP< BP Qs0 0? [@0[R AK0 R .R 0Q  APy QA@0 @@NAP Q  8 <exededh\dTdḍchxc.00 > 00 > 00 >00 Q \@0! A0^U0e¸ 0Ӄ1 00(K1QHm/.?<;hmuAc$1076X(0SgVp dP0 (0: 0$ 0%0h0h0AD QChP  \@ ?`30h s(K\ 0S @`0j!0S!0=S 0jS0S40S @<0 $Q` KtT?0 1Q jQZ 0Tod0U[*h (K`\ $ QG; 0rA T [`ljq\Ph0吐PA 0`** C!RL TA H" Rd Vh0 \ Rᐐ ^0h\@0 0h0 g(K`\ $ 0\@0 *`( (KHPgp: hP\@P*Q 0 H2Sehd0Q"*$ p\P(Kh Wg@`\@ $  Q0G0 00 A`1HQO K0P0 2lXpl( ,0 (0 ,0$0S 0# x b ~ V0 0'$0SD"x$0SŠ "x$00$0 `0LQ%H`LDh 00 0 0000 eDdV0fʡ$DD%"DD$ % XK|K'KiP D HLv.P ?& ?% ?# ?T$X ?%0 000\@#z 0DL$^%Q P\i #e D#` !Z D!T D O!D%J"D`DdR%ʱ&ʡ 0ʡcʡʱ&ʱ0 lK0`V p`p` p9=`Vp 0#`D"DDe`$c 0h#=d 20 2(>0 lK0`V p` p ##DD$!Dh% h$ 0$% 0S !0` CRD H`LX\ ʁh0Q P   R S 0 D`D r0&e$0S"x|$0Sy"xr D%m$' r0'f00 c$Q``"  .>`Rp`p 0x'N00 K(00(0G" 0( ,0A,00,0=0009 D%4!D`D#Re#ʱʱʡ&ʡ)!DD% &"Q00 ]p hl 0&^ R $ R d 0`pC<#d 0=<d 0:<%'04<Q PQ \$'0& 0%# 0$$%Tlslp 0$d 0`p <d 0<$OOoxOdo`MMtLDLKKJ -LM @02 @Y00 Xv <0`gK}K @_ 0 c@P`p 0K v> 0cp @p?Hp& ?Xp%? Dp# 4 Lp\pq q |q xq tq pq 0P42 t1Sp!RʄQ|!R00 1Sd&@"P#@TPFT03dT0l@P0F1 1@D4 UX THЃ008 8p, Q0 S `@Q` `! Y! ! X! vNL! @DP PB1A Q a q aSk SrKJ?K1TJ1UG1WD1VA1,"R=18"R9K0 QPx4 Q<Q,24E0 @>C4 0C8 ,2 K'``p`@ Qx0S ?'_Kp`0 000?K E:x@ Q4|!R qW ?20?K(KD2 ? rK 0K SD2R "(P /K  ЀS?KK .R0 }rKKXP?   v0 !`: 0vnJ `Fa :0R! ,"0!1 R1 V? 0 0 Q`Pp  0E0 QP ?K 0K 9?0S 5?0S$?KK  R0 x]Ᶎ]8K@d`afV 0}K 60@2 @PgK`K 0 _}NPrK01 K?K8Πa`jZ>@?KoKЁrK@?K p Pr  0 @X_4:@ᒌ ) 0K ?K@T0U@T= 0@P┃)?K  0KE0 QPG ?K 0K KT>#00>0SK 0x >K 0 00?K(KrK01 ?Kx?K`Q`<0##`V?K`D2 >D2 R {/K= 0@ᐃ)r>0SaꟆ 0-L@fa BAp0ᤩᡩឩT0̨0T00 R PQ R  /  \6KK p@- DQ 0` SH PP0@#  T\  Qp 5LKO@ 0" P0 05 -@L`pP @P@0% P PP0 0i40 0@3 -L M`P! @000 @0nN@@p040 4d0`P  p PpZd(KZP P(KPX 9 !33 -P`LpQ @Q *P@D 0DB(000S  /ԬR -LMp@@`P( <= K ᥴ 00SP 1=0"S" 0@000S0 4/K=0"S1Es\0@T000S PK1Es$ p0 RHЫQ 0-L@ K0h -L M`P4 X 2S7pPC P@S P P h1`000 0喽@P- 0nS: =q+PP00PQ! Q }P I40R A 0P 0Q00000h@P(K000S ljp(K0oS@p]ZXp X\0Щ4O -BML M`pPf<T \P:+@P $ [Pr084 87P B>Kc 0C8`@4 @`D@,$@ 0@ e%p 00P<4 s @ 0@<$W%p h<`P, T#z4P0D L D4 H  30 @P@)@$Dp p AK AH 9P ȼ`PLH@8@0 pi hW/Q @4)@/T/  @3(K( 3@C>K@ G0 $pR  @%;   B$P K -LM 0KK #  K?  +$P K <-LM K00"KMP KJ(0 P$00 00 /0<x0 0-LP2U@ :,,0 ? P5/0,0I 0-LP$U@ :,,0 ? P5/0/XI 0-L@P0003/0x/DI 0-L@P0003/04/I 0-LP00P@0S 0 003/0.H -L@PkTP`Q $ 0 @4/h.`H 0-LP00P@0S 0 003/0.(H -LP`L@P-:,,0  @Kh/-G 0-LP@P 0 003/0X-G --LM  tp@ 0003/K,xG 0-Ltp@0003/0,,G -L MԀ@P (0K`0p@<-(0S 9@(0 ` ,`@ \004PAP@D0@ S>03052 T *0`< 0L 0J`L@ @ T2<03 07X`( Vp80<S  Y>0305p2 0S000 (K8 @<R00S00000 400 T40 805052` VEpP 0S' D0S$\004PA@D0@ S>03052 T *0p< J80 80X@  <0` 80 j@ T`52`P V,080 ]` VPY`P VU@ T!`512;0<0 ";0<0  0 @ T K` < X \ 4 8 0 QP s * A<RdD l2, L!0,   S3"Q_ 4 R4p X P\P0C@D0T0 0 S@4 5>03050240 5 T *40 ` < J4` 04@0@p Tp2< 3 7T R4 \PA 4 t 0 L L` l@ @` BL @ LL`8@`L b` 1@  "D S3"`P8 H ܄KKK_ 4 R4p X P\P0C@D0T0 0 S@4 5>03050240 5 T *40 ` < J4` 04@0@p Tp2< 3 7T RQ P FRp ` 4 l \ 0P\ 0 ` `RP0P0 J&K  bP@ TP0p00 #P!P1 3` %0` 5\ ` @8<Q  RX  0X \  \ 4   T4 8 5 5p2P FR 4PB0 p PX` U. W,QX 0\`0C@D0T0 0 S@>03052 T *0 < 00 J 00T0@ S 0p`0 < 40 P0 08 @0 T5 2=Q+ 4 B0P  pT`PV W+ P R(QX \P0C@D0@ S>03052 T *0 < 00 J00X@ h T 00 p` <KO@0 T`52 8@<Q  R\ PX  0X 4   T5p24 400 B P8  `V U. 8 R+PX  A @DT  @ R> 3 52 T *p00 00< Jo00T @ pR, P0 0\P P03050240 5 T *40 P < J4P T00 S40@p 0`0 P40 0< 8 j4 P0 0\P P, T` 8 ^ R0  BR-4 R4p X \0C@D0T0 0 S@4 5>03050240 5 T *40 P < J4P T0 40Q@pz@0 T{*= 4 p@0 T #T %*= p G T `7,0P80 LPD@@  BR.4 R4p X 0\PP0C@D0T0 0 S@4 5>03050240 5 T *40 ` < JW4` T00 S40@p# 0`0 40 0< 8 @0 T 6*` T # P , p8 00@ TPT040 * `4 @00 T0:T ,8 ` 4 <00K(T 4 %T# p G, ` 8 4 `4 0 00-LM@0@K0 p-L M@`P 0  4/Kp -pRLMP@b  [`PH/"a`P l0P  p02 (K0S)( $0   Pp0!40S0`  Pp040Sꐠ 40S 0(Kh 0` P  03 0 3 0 m8/.1<1 -L M@ |Kxw -LG~KQBNK pG @D`GFMPM+4 + VP@(T  V@PT 4 p3A  W0(K30 (K3 0 P / -`@LMp Pb+P /V0SP 0rS)0rS00P 0P0 0@@0K0 Kh}0rS @ 0@ 0KA3 0 X/. #-PL@፝p` 0/S /UP @0p S 0 S  + p-LIM@AK M` @PP KKAⲞp 4: S \0 0ip Kp2@O00Kp@2@004* p-LIM@AK M` @PP KKA₞p 4: S \0 09p Kp2@O00Kp@2@00 -LM 0KK #   K  P K80Q 0 080/ -@|LP`P | sPP u |"P  Kh$&P|P -000-0LM  0 K蘁 --L M  K -- LMJ4 P(0  0 K 0--LM@IP  K -L@+8000,#Py "<0 8 00-L00 @?P80@08000y 0-L@>P80@0800 0-ML  D K 0-ML   K -LPpQ?mM0`p1  P?[Kp!K͌V P`?QKp!K͌U qP?Kp!F͌(T _P>GKp!F͌(Y MP>Kp!C͌  0S :P@>Kp!B͌80S 'P=|Kp!̌X P%=TKp!B͌l03@@ 0S@780H0@QD \@@@PlA \ D @@Q \ @@P \  @@Q \ @@P| \  @@QT \'(  @| Q78A Q0! 0C T 1 d1t1 0|1 |1t1x1 _,0Pg|!10! -! P t P@ pW,0x!00 U? aPX P0wsxaD,00x=p(K,00P P0?3300ws<11 x,0 00PA   "-! R@ B! !pQ* P㐁  A ! A `  P 1Y,0x!00 W?a !PRA币1S SQ,0xq嬑0`DIq,00x@=p , YH0 ?33` H0|1!0|1 SA01 t01 @P@A 01 P ! L01 PPPQ `qPGQ 0P01 P 0G1 S0T|1  0 -!  axA ! t1 Y ,0@tQ0p0`P pW,00p0T? a@ PYt!x1 t! |! 0x1 SxaV,0 @0PD,00x<p , VH0 ?33P @0!10C!1 R0!1 R_ʌ 0a|! t   x1 Y# ,0@t!xQ0p0`P pGW,0t!0p0T? a@ PYx!|1 x! ! 0|1 S|qXʌ! P,0A1`D,00xN<p , XH0 ?33` P0L4p 00R 1S& ,0!0-p!  01@01P01 @T,00@0X?3 - b001S!pQ*,0 At! 0 p  `P 0101P01 `V,00`0W?3a00 t1X!R) ,0-t! p 1 01@01P01 @T,0p!0@0X?3 - b001S!@Q. A,0x! P!1 p t  p 0101P01 YX,0p!00T?3a00F x1PS #! |!10T@K P  @0\[K 0@t1 tA p 0\@@GK P@  0TeQK p`  0V1,x< PK @P  0UeK `P  0UK @  0Y2|@K P  @0\GhqW!YK`A @Q P`1 PP) U1AQ RKa Ё `A Q @PPP  U aЁAQ!R! 0E/KБ A `Q @PPP 1 U  `AБQ1!PS2M@QOOK q `Pp`P V0 Pqꈁ43p 00R80000S`p!V009pKP0U 0 PP1|1 Ppt!W00L0K|A `@`pP 0V |APp!U00:0Kxq @p`P@WPh 0V `xq&xpt!W00MtPK`0V D `:PJ -LC[Mp@p Ph3[Kx ?K͌lal  3QKt ?spK͌DpDq 2GK| ?SPF͌(qPQ 02PK ?c`F͌(p`` u82`K?spC͌ ̀pp  0h1pK ?B͌8褠ᤀ Z1|K?̌| | 0MH1TK ?B͌T@ T |1 t!px`pP(K[?Kx1 d Q?Kt1 o G?K|1 0{ PK `K  0 pK  |K 0 TK `c p-LPMLP@ 00  `P@ Kp_ p-LPMLP@ 00  `P@ KpP_X0T 0 H D R #@ R$ 00?H/^0L0 D D 0 R #@ R 00?H/|^00  -0DLD   R #@ R! P?HU` p@V,010 0RD   (  \@T 00^00 000]X X0 H-?30\ 4@  \<0@0D]0 -L M0PXaS`(KPx@P"T> @00 R p@p0R0 T0 UP X@0 @x0D0T p@Wd0 ?3 R #@ R<   0?33H0*P @x\00 00[0 0-SL@P GP000 00Z 0 H-?00S 03@ 0 S\x0D S   R 0S 00Z00 00YP 0-LP kT@T0x0T@0T0 0 0 /X 2-LB$MP@0`00 Vw d:`"`\\< TrT LŸLH D"匢 吒嘂0 00$00D0 0T0 040 0X00\00`010h01080 0i010p@0 jp00z"P 00<0 H0" 2T 02h0$0i0D0j X 40 \00`0080@01 0 %  0 0 X(K脠儐 |< pppH t d0D T 4 P0H0080 @00@0 ,Yl8<$0 -PlrLM`p @P @2Z 0#`` b"" bbdbhb``c ````cc#`PV c pQ p|L 0p RS `b0` ``&P: `0` `&P/ p+ !p' ``0 &P   %OUj000S :3S n$K|$@$Kh0S{PjHVUt -jL$@|",P, P00 R  KhS \1-LT M` + PA?@ T:>< |^0:v p0!# 0'S !!!- _!!!!| o!* !!f ㄁! ^ (!0^  R KQ 40 0>?h0 U  K1hI PP \  0(`V(p00(K>Z<^v8#:0'# #H#p--`_||yovpsrpymzj{g@|dh}ay$Q h0h 0A-_` p@  @0\(`V(P@L h7-L`,M8 X4 0L'@ E < 0700P0 0L J}0pb00 70H0 R40S[  p 0p PP` pTPIRĔ 0s0 P0aR4STt6P0 0N 0 ;0 TQPEPaU 0 8 ;0pD s D0S^4 D D P0uP0PcRTT 4U %5P 0(K0p PP 4 dP 4 0s00aR 4P01P`~ R $  r  lR$R$ $ 0AR8 0R40S@0 S4 40*` pe 0x000@P$ p[ 000 $4Rx< R P 0u 0PPcRT40S@0@ S4? p> 0Q000@P p4 00 $0 >P 80|0 cR ; Ą0p Pw p| 40 s0 0bR44 $RR0"P0 0(KS 20*`0 000@P}  $ `00R0C 08 04 0 s0 0bR4S4 PR040 08 ;0pt4wS[0000@PM  $ `00Q0@ 1 0 H0P  0s00aRBo 4 L0 0 0`0048 0040 s0 0bR44}RD 1! 00MR4P 0s0 0aR4g00 c0 `00  D0s448 00TP0uP0PcRTTD ,KKKKJJ0J`ILIH$FdE  dD@D0*- 0 0004 44C 4-L LM@ 8`P$0S0V e :Ó\jQ A300SA(K30h0 X t300S  8Z UP P@` 0-L@P @P PP0QP jP P000 mR R0@0R0 1BQ;R" S0S0mS0 C ;S R0 R S0S0;S0C  Q0R0R0R0 S0 -LM0tPSp J|P 8M0m0K<`  0rr jD|2S  #R $ |PK?T0 |TTP sX Q($$$4 | 4`T0$X4 S0300S< p0S9 4S 4S0 0t/2 @Wl"Q匑T 5P\ 00@l2Z+ L1S80 ' `P# 800P <0 +8 <08 R 0p2L%R4S 4S0?o28p2Y=3@t2 P[ 00@t2U>3@x2 P1 00@x2h(K0 D $pl h $ <%$[U zP>0@l2Y qPl2<l2Z hPl2?;~0l2Y ]P<3@x2Z TPx2?;~0x2W JPx278x2U  ?P<3@t2Z  6Pt2?;~0t2W  ,Pt278t2|200S0X00| 0rr QC|2S1S0! 4SVH5SL< , <$ 0 0070*00@- $@ TP@h@ XPxl@lB`pT@tBHx’|@00@pK7<$88 80 0Q $0X0 /6 -L M\`@PpT 0S"!0S S0SXT00(K 0  -LP , 0 S0 2 h  -PLMP\qAp$K p`@`@ AR`` 000$K00$K`@`,0 a( d( ,0P ,0 ( s( ,0P `F `ᰐ帐 少帑 Q`8(0 $0045  -L@PpuP` P`@` EPE0 "0X00@0 u 2@  -\`LP@U 0S1 RU0S@@0SʂKh辊 -lL`@pS0 SpV0S"Q0S 0SV0 0-MLM0@jPB~K@ PJpG 1@@@0|" AT #0 S*F \X K1L 01\ - PLM  R  *0K  K1 Q\0 00-L@D00S :T &0t0000 0-L`P0S' :#CRQ# # p40:@P #Cs## BU0:#!BQ##40\0 -LP0 M 00S ʃ0 K$ KL/8 80 0Q $0T0 /.$ -L`ͨPPp@ 0@ 0SP0`0:3S 8 L40 00 :#.< #-L⌣M3 0 pE< @  `3`S040 0PP8 B `P%Wu /p p P@q Vp  0s 0 @0lR00@0ϐ1PB PR RZ RW00d S 8 `20<0#`pt r @@Xpk t20R 4` 0 S[   r 1 `R R 0   (K ! \D 0 ^(K7p P@ 0` (K0s0 @0nR0 S  S @@ ` 0 @ 0s 0 @Bo0lR00k s008 X0T00 㪩<  0-LL-0-$--$+L+ | ) -L4S@P03P`? 80$ R, ; ʌ3SW"3Sp #0CW3 W " Rp 8K 0 0$#0 -L M`p$@V0  =PP8P( 2U3(KP)140 `V PHP $ 0 t0 00SZ03@00$ 4P(K140 0"00@-?0@p P00X (`, p P`U  00! 0-LM@K, 0 0@, %K0 00  0-LP@1p0K0h(0-   000 00:3S ⭙/ -0J3\L0P"Xapp` P 0pp P=3^τp ``0)0_ `#hͭi0F?Y 2? 02|?0| ؒ 2!`($ 00 0 L00-LD@@Pp0$ $0hi 0 0 00-L@@P:#Rxt- P^ # 0pp`0C:08l 00-L@@P :Qpl ^0- #pp`0 :l 00-L@@P:#Rx Ó \ "R-- ( #pp{`0:00@ S0-L@P@P p (0008 <@%8 00T0 P 00-L@0:#R#R"#00:h0 d 00-L@0:#R #R0#|""}#00:\0 00-L@ :QQ σ #ppP0o :00 00-L@ :QQ σ #ppP0E :0<0 00-LP@ :QQ t}| Ã#ppP0 :a00 00-L@ :QQ σ #pp}`0 :Q0 00-L@@P:#R' Ó \0 @8 “%8 \--  #ppG`0p08 ::  @00-L8@@00:3S 0 0 00 @00-L8@@00:3S 0 0 00 00-L@ :Q#Q& “̌"Bpƒ,“p"\`#ƒ\ B`##`0I :Q0 00-L@@P :Q%Q( “ pƒp“ƒ\Ó`\Ã` #`0  :Q0l 0-L@`@P :PP" V“hp ƒƒh pp#g` :Pl0 000 00 -ZLM@pQp& c0 |0 `0C/|0 ;/080 |0 <//03KL L0 0`` VjcP`d< 0 000:/X(0 $ 0-L00!$\0 X 0-L0:3S 0pp5 ``0 \ 0-L0 :3S 0- pp`$0$ 000:#Ro/$0$ 000:#Rq/000 000:#Ro#00 /(0( 000:#Rq30/l0 000:/4 0p-L@ MP@h$ KD`00ppp 2[Sx000 SC q R0 :#Kp"[R 0000 3/Kp<, -L0 0   -LD@M@@,K0  0 (0 $0 0 0 , &0 0K  -LP@M, K@, 0R0 0 K  0 0K@ 1 -0L M0AS@f 10 0S_ 1, KhDP00pp l!l1pK [ 0Qp1H1`0S0S  O100S0S  C030pp  03, ppT,O6# K[P QP p:p# 0pZI   <000S/:  0-L$@@0S0M000 00 0S/3 00 0S/E  2-LBM@PQx :3SU03a`pp0SW10 0SFʜ1p0SC  0  B'd1`00|PB L1@ [-00 R 8 8 O-0 0XI-00 } 03,0 pp`K|0`00|Pd @00@ @8 -00   d` p-L,PK<`K@$M :(@ 8@$@ ,0 @ Q~` 8(@ ,0 $@ @ G~e~808 000:3S  6~Kp 0 000:3S/\0 X 0-L0:3S 03pp`lH0 D 0-L0 03, ppU`D0 @ 0-L0030pp` 00-PQ@L@000 |P t0 u,h000*0xP 00 e,(000*S0dD`$0 000:Q 0P 0-L@0:R! P P P0tP t ,,00LP , P\d`0 000:x0S,01/\ , 000 0\//A-` VL `Q/,pP UU( P@ TTQ  S(@P PE P X UPQ00 0 0@-PU,Q (0@0C 0\S0U080 0-L@0@T0 800,( 0R S0/ 0-L@@T0-^\ , 000 0\^ 00-Lʀ M$^!# P Ü, 0K|B 0V5Kh+ -ZLp3`S@3@S 4S3@p`S00* -L,MH `@  P @L0 TD < "  0SPc p00K80 ` 0{P+0 `pSN   08P @ PE(K0`<  R R< R< @V$X,@04SHDm(K< 0 RPHP RPE< U@  80 \VH@80 P LH@ ! X  @H0PH` PQ-LM< `@@0 8 380< 3S-@0S*V> !0 00@ 000@ QP 800K@ {p0tP @0S  0P PE(KD>P <0$C008@00*(K `` Hu -ZL`CpTB @P03Q4 Q&T,Õp A|g^00  T#, \ BppqL A| T@3@TKh 0-@PLP T0:|"C02TP0:CT 000P 00 1 /`808 000S :3S /<0<0 00S :3S  `/808 000S :3S /<<0<0 00S :3S  @/808 000S :3S o/H- @\ ʌÜ\ 0  `0 00-L0@T J 3$S |B0pQ P3K0h)P K0he0<0< 000S :3S  /hX PT 00 R0S *P@00$//000 000S :P /P0 L 0-L00S :P p Khp0 00-L0P J 3$S 3S p K0h|B0tQ 2K0h(0(0-   h000 000S :P /4 0-LM8 0p0`V# [,@KP $0p P 0 0p p@ 4(K 08 @@P  P %/ -jLP Q3S @P4P0@ 3SKhD{ 0-L@ J 0s3# SPP!0P |2 $R 02S L03B |20"1#30000茁|0P :3S// -@P4QLP( 80S $ 0S  0S0,0|00 R   R   R  P (4T `TT *2S Q P Q0 uT0 -:LP|b@0T!RN   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @ '  (!R 1S X  08!R 1S 03@0S T@ '|(@ Q0@0@!R@  @ T0 -:PaL|2P`@0T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  03@0S H00001S@078@0  d40P0 00 @0?30Q@080/(0Q$ 000/d(0Q$ 000z/,` 0\3@  0 T@0ʌ7|œ8@0\Q0@0/0 000 00J`@0 < 0@0-L0P@;08Q@0?30R@080/R/R"/ -PSL` G@H ?@(0-   HT 03@ʂ@0|œ  78@0\ R0@0/@/\ 0-LP@@P00 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/|d0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/d 0-L@ 0 00 K0h 0-LP@ K0hR -L M@ 0P P S CKh  Kh 0 0 0 -LP@`#p Kh 0-L0 M,  @ @K0 -ML K -L,M( 00  K -Ll |0^P0,0!0s0 S\ H00P00S0x0  -H00QZ P00|0 |0SP0, ͟0@t0 h J  C@T0 @ @0 T@QP0,Q\P 0@P01L X0 `00,01L00 x R0L 0Q `0Dάh0 xp h@ 0RH ?330 `0\0,0000,0\0`V0V 0Z 0 ZCd ^ p@`P,@\PL@^p p # 8` l p@0P 0H V80Q?o2QT{  0 \ p000|PE p0SB 4S 8P\  >l @ m 0 Pp 00p` 0P 00P f P p` P0 0 0 B B 080\00S\P00@@0 op000P   U P! f^1l   0  8 Sp000P fJt1l   0 8O RPlp U 1P 0 1Sl@pP6 V 0` 0 L5S( 0\ 00RPlpU 0P 0L pP0V0p L ` 4S 80S00Q0So L5S3r` 0-LPM@P`0 R   8p t  p0pPPU80  D 0! B 0C/? 00  K~0 00~ -LMP@p `PdPX\ `0hlYX P $K80 4000!BPCp`op`$K} 0-@PL0@T0 !-L1P000S0Hpp?spS,, ` @F&T:pDbx4p0?330 @V DR0Z?# R0 SM |0 00{P 0-L0@ȣT0 p-@PL MP U 0T 0 0S P@T P @@KpU  Kp`00P`@T  P @KpP/ -RL`0p,S@ PP @P 0S pRQ A0@ ", "Q//  00C0/$00 -0L0S  9-0|iLx)$M`@ @ P8 4P pP <)0<0 \ X0 0x1 nRU;40 CR x8p0JPS0c 0U ^PUYP AA  R 4P\0 x 0 aRX01<(p RV,( RQ E P 0\U70 䧟7䇟 0W00 P0 P R' R  RN  lP R LP@70 R4  8  (K40Sy 40H{  R E PĖv pX PE3P0P0xP ~P0S PL60P<& h06< 0P  Y R# %4P0<0 OUuPp0 0JP 0 CS<0P0S 0HSx5x%x < p% 0 D `%H` ` 0 &D000Pp Y Q prpgR p@pWLP<0  R $ 00Q 40 40 4PUɑS C  ^UPPU ,$  P 00C 0<0 R70\300S W0HH`SY%00P # 303Pᄓ0 pxspU  0PEP0xP P U,3,0(<0 3 s000 p0`@@ 0S @2PP0P0U\T00P 0 jP" 0  @ , @!  ? ^% 00P <0P0S lP. " @10  E : 8R"-RR RD0 @0 D0, #P\1aT100S yw<00S YmPUPP0S F aBU( hyd<l~}}}}L}||H||{X{8D{0{l`zPzyy@Hy4y0yxxxxpx|wvvtv h3-L`S M\CP@000 P 0 sp `Z_ # 3@p T10 Th)P b` @P 00 00CS  -P ʔ2 y0Sx20` d20  (KP<BQn(   @DR  T  lPT ` R ! E10@ ` ? @` `nl1 Q&T `` '@T  Q P%   lP ~@T  `   p@ ReB F @D`@^ ` a  p ` R  h R  'P ~oPuu<dt`\tDtttlsrrr r -L 0 q -L 0 pq|1|!0G-@ C@M *⤂X6 L!HO0  P0S& Z0( S!,p`pG\0  R    \0 \00 \0`SXЍSP ,qU0 0 0\  QWXj0 00 0Q 2S0l%R h%R //!R!RtP//did 0 000 0/hd -L MUPPJ 5p 1s?  S࠱젣`q= q|şAQt! @SǠ- T0P\` 45  0P 5 5 l‘0@ @lQ hQ 0ʀh20 d"2s% |202,d"d",d"d"+d"d"+d"d"*d" d"*d"@d")d"d")d" d28d2 Rd\0Snfg~rfRg Szo|v`~fRZ Svf㊆pRM SfvfR@ Sfj~fR3 Svf㮆ppR& S`v`fR S:fR [=!0 Y. 0 C C S: Qlp" l200 C Q1@!n0 @8@1 :@p"bV/ 1O!LO 0 p0S! T100S 00XH0 0H0 0 Y ,01 0 0 00Q^*`V(K0 0 (K0 0 Q 0ʀh2Q 0ʀh2Q t5S 0ʀh2hd0n`jjPd1 00-LDP P?P08 Q8\6 00ʃhœ\ 1:p“ @TnB pƒ 0PUOnpƒ 0A\ B\  0    b0P01@-0G$ 00` PAʀ: nOh0^000 @P)#0000CS 00000000000000000a -PP@L M@&\U ,npvrf 0 P |P 00  (0  K_d`P\0@- P\P nV,pFrPP 00^ 010-L(0 :h2S 1@0@ 00S 0n008!*?pB00 R 00@S0AS x^l0d`d0 000:d/$] x00-Lp@P@00:h2S S0H0000P000 $ @0 0@00\d` 1- Q@#@LP`@0# R!p hQ# Q!*?Q<o23 8|20" 41  1Q=@07 #@8 0@0!*?Q#o23 |20l 0  1Q*|20h t0 z 1Qq 1Q*|20tL\`/|0 x 00-L00@00C0SpP0 0 SpP U~xPxZ0 0-0CSL@0pP0 0 SpP U`xP80 4 00-L00@ḛP0|Y 0-LPᬛ@0D ?@?  Q P/0Y?? \\ /0@-Q 0 @  0 B 0CJ S R!@- P0 p` 00p@SL,0L .W 0*S /SR000 00C0*S X S-Lq$Mp`80 P( 8K  80@T<  !F q @ D $T  5/8 080 @TX < 0FRs0  S00S: (K <R! .\  ""!H >L0 .L0P H, K080 " gX00S P@ 00 R0SD0?S@P  5/@TD0`0<0C@P  5/@TW  p-LMP@` 0S 1S 02S0$0R  `@WKp00 -L$M0 0 KdT0 00-L@M<<@ P@ P 1K0T Pp-LHMDD `@P0` KpS0A-000\Sd ^S/ " %@@ 6 ' CrQs!  @2! {  q SL LL `D }!2c0000 000!0%!@@ +@ cS{EAED "0 L LL d D!b0  @T 00DS.0P@00 0 100C@R00 B ~\S  {   ' 00  0cPS p-LM00KKPt&0,`!N+AHH gMM㐂"n%ll0 0D "2` Kp  -LM(0KT&(P$@k @CL0`0C RbAa L0L0,12@K8  p-LM00K-H 1&0, ?LDc`各 D 0@*EB0A4c!b0 9 0!0` Kp 0@-@%@p 0  -L$M8  @`P 80,'0 p8p  00R0pDp   @P< n m @ ,R3T 00@\ 0 8 @000 8 080  RS  Qs%R 8 +0IGS񏐕D*  ~|zyxwvutsrqponmlkjihgfedcba`_^]\ZYXWVUTSRQPON\T0 S\R 0S0\S 0 S000 W D0PC0@ T 00$ <0  000 0d0 />0000 00 0 00 (K080  R!.Q R*Q080 D0 R@400% iY0 @00 0 8 K 8 @PeuPF0 S 00@00 0000008 0 -0 S@0@0k   00 0 000000008 0  0 S00 8K00KL0 @0    0 0  0L0 H 00000 x< 00H @00@8 000 0 SS\e 00dY% Pe0 @00@uP 0 d 000 8 0 S8\E 00%Pec 0 @00@uP0 8  0 S!\00K& 8K.00% +0 @00Pe @c0 uP000 00 0 8 @`ɖ 00(KH0 H00K0K@Nx ` T 0p-L@ M`@P0S PS#  0 K00"P t 0 Q0 QT00H@0x 0 Kp0d(GxMdM0MP -LM0 S 0K0K0K@0S pKL$P0 `V$@PU @ 0PfSoPKKD`Q`_0P 7K,Fd -LM0 S 0K0K0KP0S pK& P0 `V$@PU @ 0PnS(PPKL`A`0P 480PKEd H!-L M0`4S(0K0&K'0Kp0S= (PKv1P4䀟AP*0< qW# X $@ 0H(0sSPp @TWV 0S  c@pA@@ Kp KdC 0  -LTMX *lpP P0KX K\ @$ h0 C:0R0K @P 4 P#0 x0 p >,0t0 d 0l0 0SL  R T0KS K`Vx #V =V =`P 000`0 `dd`Pq  ZV 0 0W*S |p~P Y0 0,    bVP b`0 PSJ :\ @PP@xr`,\ ph` V AT1@  _b Q0= ` P PRb  VP\00 (KT@K}$Pl0倁0P`0 H `` ,0K 0$0 ṔT`Kc P <倡 P 4=`0@`0 `TKH1Pt0aP" P 0`0 @`C`0S (Kp0``  @5L Plkx0< 9` X  x#"  # 0-0SL@,08QP P2ᰓP,0P0Q 0-PLP@P040, 4P0 -LU00 -Lp`@P0\ %\0pS sS lS@ 0\TT 1D !01 CR0@CUPW  -pQLqM@ G PH 00S040Q y?K$ mK H X z?K Q R KQ %Qp rP Q, 40,(K@P%T >,`Kf0 1 0DXSXaVU^SRQPONMLKHGFEDCBA@?>O<;:9876543210/.-,+*)('&%$#"! ( 00 00D p2"7R@0A@?S00@^p P!1! D]R񏐳)~}|]zyxwvwtsrqQmkihheF&ba7w^]\=ZYYV^.00A \ -00A{0l@ p0!K p\P(Kj`ZP 00040 P, 0000@TK @D,0K0@ A@ X 3!P ,04 &np 40P4 0`V 0F, K00 S1ऀ `F,0K&@D0` 1VT/t-,+nG(B&9$#"! 'B<R     &00@T? @D,0K0@ AT POQ9 ?Q  ;Q Q. %Q0 pa0As RA0AS00OS3A ,K,K!000 0 01S101 1Sx10x1 0@T @D,0K`0@ 1P _0OTyt10As R0 pOR,K1 PT10 T000S , K!0C00 X0S 1 8X@1@!@ &P , 41+mp 4004000@OS ,K,K!000 000'SS 0S'S'Spp00S 0C, K00 10SQ  ?Rp ;Rb PeRd pQ 0%Q 0p!0     0C0"00OSl,K000 ,0K1 0}SS 0S}S}SOpC0@TN @D,0K0@ A@a0As R!, K1 A20`VE `F,0K!T0` 10 ~T00`OV ,K,K!`000` 0R Bp0 OR,K,K1 ,0K10 000000i00xP !T00 ~T0 0jP< 00&@D00`0VTlhjihde|csa`_^]\[ZYXWVa|vRQMONMLKJIHGFEDC`A@?>=<;:987654j210/.-,+*)('&%T#"! O]00Y`0 , Ka!@00@ eOVE0, K,K!1`⤀ 0` VXX '@0XHoᨂH<|=X =(PPo 7P@A0AS3AAՕ?o2P'00 - -LM 0 K - -L M  0 K - -LM 0 K00/  -`QL MPp@. 0ST00 00 KW& 㦎P CX x009 X*T mTj K`P nPpp 0 0 R0S TH IT0CT <T6h, KD,Hp 2[S "[R1 000ST00P S00hP S00<0 L @ ( 0R -L MKF@P K -pL@P% T% w`PV @P|PP0EdV ሢo ၢP -LP`pU@ j᷍P T ]R -L@P 0`BpS%  p 0! p 0!p 0S `ᾍP `  00 R00  R00  R  P` @0pp 0 QU \PQp` P` R0p Bo p `pv` ⦏`pQ `0R0 0V`  p`0Q1U B0r `RV- p` 0W $0 p$0 0$9pX 0S $  p0`0nQ2 sQ# fQ 0 $ `P $`0`Q00U0S 0r R:0SU`U0`Q0 ^ `w0 -@QL!MPp 0hi P 000S4 P(K`P 4PK0pK0p _p 0 RP(K40S! 0 PP _PP 0 00pP+P> P0 *`P0 P40 ( @"'' -LMB~K M pG04 `0:S(0@:SS 0:PSPSPUD3 R00X0S  ,0K 04 TL_P P0`:S (K`(K<2 -L0Ÿ0MPM  @`pp_P= 0/SM P   ᰌZ  PK [XAP 0  (Kh40P B~KT! pG ;hP"80 r (K0P 0S/S pP nY0 0 P BK  @Jp 0,,N YW @0 00(K,000(    l  P 0 -LMP\P tpp@ `NpP @T DP0  0  $$(Ko d$ --LM@!00  K -L00 0-L@< ދ,܋K0hE 0-LP@S:0S +P0? -\0 ^ fQ00\ ^nQ0 sQ\00 -L `p@VfR@`V P 0P  nR@ sR@@`V0@Kh -L@PpP4`V'*0<P& D0 <`D0<0D0D <0nW` D p' sW, fWD0< DH00H00 3<P0`Z |0 !D0< 峀D00D0D0<  D0<0D0D0 0D0е \ -L M@0 pWP `V 0$4 40 D0 c00P` 0P W ൐P  PyV㲀  Pq0S0(0S080S#0H0S,000E(K4p`00 0 PR(0S $`p000 PE80S 4`p0,00 P8H0S D`p0<00 P+=<;:9876543210/.-,+*)('&#"p@yx@0@Sr /pPu@'  0Q R 0P  RP P 0 P 00@000p 5@0 00@: 00@44p 0000 P @ %KL` ` $0x0 @t00Ll ^|\p [Ux0剑@0ISL0YL` p【`@pPup@|_ ( 0R  Q0\z  R?PtXP $0 @$0 0$00l t\0P0 0P0 (0 \ T0 \M 0P L pL` `0@P 0P 0P 0P 0P 0P 0P 0(~P]p@qx 80,S| 0Sw RP,PA 40, @40, 040# 04 80L0pP L` `@a}P0l @\P (\  0s0   0\ 0 f0   <切 (K?U0P0  \0 \o\ p@ 00  n0 @0`0 \Xg@8\H M ` t 0 H P/X 0p-LH`KP4M2i@P Kp.T0 00S  R2Kp (!-P Q1LP@ `p7 0 4S0 00,0PPp00|PP`Q Y0pgGPÅQ  YP|00PE00d  0-@PdPLP ̆ʆȆ Ɔ$Ć,† 00 R00d0 000/Xd$0$ 000P/ /4d $P0 00 //x p-LMP<(0K ANKA$(`Kh$DH gMM1cc!b0%0 0D@B4d!PKp P01cK// -LMP(0K kLG@($Ch0d0DCNC bl K" 020DAB@C1d^PK, !P01// p-LMP00K -H ?LD,0`善 D F?LB0A L*CE0$4bbcL 0 00 D%C4d1P Kp8 -L-@ h0h 000s@ I PJH K KIKI  Kh 0@0-L-TH@@(M  SG0!9"SP:ok1F jQ)pH1 ~}|{zyxwvutsrqponmlkjihgfedcba`_^~[6rt)iS/ -D \4 3210/mM,+*)('&%$#"!      icP0D0 ʘ$ 4@ P0S"?7L"KDK& P0S !00 $KK0cP0D0  $ \4@ P0S"?7L"KDK P0S4 00!00 cP0D0 ʘ# 3@ 00sSH cP0D0 \# 3@ P0S"?7D"KDKP0SL3 00!00 cP0D0 " 2@ 00S"?7D"KDKP cP0D0 ʀ" 2@ KP0Sr DKPU0S h2@@@m$0 NC"00 fcP0D0 |! 2@ KP0SF DKsP,0S 1@@@F0 '"00 ?cP0D0 RX! l1@ KP0SM DKLP0S 01@@@0 "00 cP0D0 (  0@ KP0S! DK%P0S 0@@@h0 ٿ"00 ?| T $ 8 t @ 8 d d   X cP0D0 4  00@ KP0S DKP0S l0@@@0 "00 cP0D0   0@ KP0S DKP0S 1@@@0 rg"00 cP0D0 T! :{@ kS4F{ { 00S DKP rcP0D0 ʌ# 3{@ kF{ { 00S DK|P ZcP0D0 0# {l3@ k k P0S DKgP0S 3 00!00 7cP0D0 ʬ" {2@ k k P0ST DKDP0S2 `00!00 cP0D0 {(" X2@ P0Sh"?7L"KDK P0S2 00ؾ!00 cP0D0 hʠ! 1@ P0SU"?7D"KDKP0St1 P00ⴾ!00 cP0D0 :! 81@ 00S'"?7D"KDKP5 cP0D0   0@ P0S"?7L"KDKPW0S0 t00zo!00   T  p X \ $ d D cP0D0 8  $0@ P0S 0"KDKP0St0 00:/!00 RcP0D0 ʼ  0@ P0S 0"KDK_P0S1 00 !00 /cP0D0 j < : 8 6 4 2 0 . , * ( & $ "         "00  "00 "00 -DT! @? @ t $ l p   "00 "00 !00 "00 !00 k k !00 "00 "00 k k !00 !00  "00 "00 }!00 x"00 s"00 n"00 i"00 d"00 _"00 Z"00 }U"00 xP"00 sK"00 nF"00 i20@0 20@0 I #I "?7L"KRL2 X003Kp2 t00*!00 B!00 = /0@- M  R?AϠ0CSS/@Q  S(R#0P@0KEk{6F{7{ Ѝ03S S{ {7{ AA0A31 00P10 RXH` H!k0+C{6F{7{ ? @ /0S P /? @4@P/ 0-L@p`8P (P (8/P86 , R( 040!"R40GPBV: `V# G 8,04`00G,0400 40, 040S04000R`0``P 0-L& 0S# $0S P04_Iʃ R 0 S PpTP  $ < @ @00P -L 0S $0S g0P ,00040 Kh -PPL@% 0S" $Y NPQ`@aD/T@0DTSpp8Q (0T (9/8p (@$Kk R-`L@3 8S1R  -P/ 0 S $ (R +3/PP P4?@`08`pP $0(3/`H  (0 0$ R(  $ ppp0  0-@PLP 0S $0S PQ0 Q @  \ @/000 0S L ??00P00CSUP L0@7sN?0 QO?0(0 S@p0(0,K; ?O0a5?0U0 0PEt@Tw0pS LQ/<`00 ld`hr0d0  ^4X P"010T :s0PEt@010PiUL`,0< S80 0P0\d* @D7~˒ LD?q@D0L`BD< B $0Sp0  0p7?@0h'8w`<#0#V LQ/3`00 !K?0!7s@D;DM?<0P0D`SB?0| @p  LQ/X4`00 0S \ 0$0C 8 P 0l0S> 0X p0/P0X p0 tP LQ/4`00 R?`0LQ/$5q@D`00 80@pD0 y@ LQ/d5`00 7p` s@ Qd0r r0 Pl R0PEt@RULQ/6`00  P0SG?0`L R0PEt@RUq 0a`d` `VUb h U^  PEt@ 0! `Vd h 7s@Dd0Pk7~@DD0e.El0 4K'44pK30K'8'|20K1pK@pP?`000<SAa  00$0SW$   0  4K'44pK30Kp6?@0;I?L0+7p` q@ LF?l0 4K'44pKp30K`@0]\7p@D| 0@D''q00Q/S ?0S%L`900 L`<0 080P00tp0 P0 0X彯Xd WP L`900Q?0iLQ/900 `@L`pp d0\dT \ h 2P L`d:00Q?0u`Lq@Dp??@0LQ/:00 -@PL 0S $PU `P(80S 5/$P(5/00` -@PL`P 0S $0S pP@0 QR 408 B4 08@U000p -@PLp`' 0S$ $0S! PP 0R>/ S  P00S  b _0S R?0 0-@PL 0S $0S P0  $000h2 d"0-LM`PP0(0 0S $0S mPp^6 0SSt #0\#@< .L+K,0K  Q"$< 0-K @ Q00cS R#2Q SQ0S@0S50l0^P  I Q00cS R#2Q S@@Q0Sl0S0C@@??0( 0R $Kl0Sh(P -L 0S $0S P0A/Q@o -@QLX `VU $0SR XPJ+(P6/pPK 8`V ( 0(3/`P: 0 0@ 0P@ +ͷP45Q *p0V0C0p0 (0 8#ặ8`po=QT0AP0C0T0($03/P -L 0S $0S UP0 :+ 0-@PL 0S $0S ?P Q 000 000P -L 0S $0S (P0C R L RD0+0BD0OP -L 0S $0S P S>p0@@G-M@`0@0\R P0U0SCQ 0|S 0P0\W ^ UP! U0! 0100`V P0uZЍ-0  0ЍS 0Q0P0S0P`0e0Vs00R @ 0PS0 RS`bC0P@R@ P02 0 PSЍ0,4000000@?o2800@  B( 0<0 00$0Pp` 0S0305 :UPE 40%P3P!`03050'0%00%P!(p490C p1p Rp`P00L3 0S C@ 0$Q Br $AR\Y   \?( P$ U:  Y` \( L * $R AR @@ BR Q: 8 Q  Rr, %Q  Rl<@ $P B@B! @@ L0@ ?o2,0%R00ST 0 4 @000XS @` <01 00 ,0!80 , 04 00>4 ̷ G-HM @:,0B8P#4 0H0 @0 Q ,0 LA?C0CRp`&PfP80 009096&0Ct0Cl ?oN t2l S \ 0l R8 Ll0\000Sl(K Nt1Q40S Q5 Ql0DPL 4< @`8 H A8H@ <@< `@ D0 l0 L0\'! H PP`@0 D0H@<Lln l`l0*4S1#\ &R \ R8 C0l0\00(K\ R8 C0l0\0w00S(K蠛DP -L` M 0, 0CS0!4 00 G0X0T0X0S0D SpHor 0t $0#4 L  B B  0B0U \0 8@D \0 0  A  \0TW+6@*01TB:@DlP\0/PE 0 S0S@100TP1T:XpD pGpor 5W!  B @ @ 40 @SP , 80Rt06Aȯ,0l0&\0AQ@@UF (K40 @Szl0  \\@SF(K8 l0\@0l0l< AQLl N&80R ll& A@l0,0l0uPfRP#0 \00\08R3#QP R8P1P!X -L`PM@P4` 0S $0S 6TPp0S80 z Se t Ru,0 SH:D0 40 P< @@ ct0S$lT8 `@X`0 D@@4H0 R:,0 0H0PP0l t0>t0Sl  l \ D 60@ x0`040th <  800(K8 R"L 8`!BD0D `ȵ,0l`\`f EP@0*St`V 4 0 ,0U0`:*D (K -@PLpP 0S $0S `P l0t,@0S@1WTU@80C X` -@PL1 0S. $0S+ z`P(P``0 S`, `S S*0q0 0 00(0s0c0*0 900` -L@PP#@L D!B,0 0<0P7 0X ʄ lP\PtP` 0` |0VhPHPx`p 0-@PLP 0S $0S P0 RP00 -@PL`P 0S $0S P V000U0:60 -PPL M@`0 0S- $0S* 0P00 &z0&0R":kƗ PA5T0C0<0Ve|@T0@  d@l`Fq0(K000 000 -@PLp`P \ $\ P0p`P|0 ? -p`PL1P"3@ 0S $0S P 0S S S000Q  l0S0 0P R%v%\\0 0S00Q 0P$Q 0P,Q0 >-LPPM0`00 b 0S_ $0S\ 5pPYVW 0@So  RiV0S\c\ (\(`R`V ^ BPQ"ST Rt0S 0S R4 R d-  ##03/0@S200 P V0SpӐ S00X #  #800#"0 p0oS0c§r0k0Sp<p0 000aS *SD00 R6;Cl B@R 0哀 0C0#22c0# 0l0S  00# #8 00#"0 q000P0S09S ES IS! [Sg gSg  R\XV 80S0(0(K.0S0>0QK 0I X:3 0 Z  X 0%* HI 0 ,0 S R B0 l0V  2R' RcR@0`R00\ ӫ0, R Y I   R.   0 0S0  0 P,0SQ: R00, R  R0 B000 [  $ R,0  $ 0 0S0  0 P,0SQ: RL0 0 t00 0  RC 0,00Q0Q0$ s0Q0s0R 0s000 0 0#400 0 0 S0 S 00R01 00 0 R  00 0#400, R E  )0,0S)  R0 B0a0,00g  S 0 Q0S0  00#40@0q000S 0 B0200 B0+0/pVy 0 > V 0Sqtl 86` 岠!ƈ9096&0CtRl0It0l0Q Yt0SVF :V㴖m 6S9 \ R 8l0 L l0\0i00 00#400 03 0  0#400  0 \ R8 C0E l0\0)00S~0J0 0 0 0 0 0 S0 S 00R01 0q 0 0S0  0W001p0 000060,0 I0 C00L D0 !B t0S*l0\068P 0P4p tq&l8`P 0@ 0S1 *6夆ƒᾐ9096&0Ct0Cl ?oA t2l SoQtQVw Q Q`l8(kDP0S0S0 0XXXXXX{XvHSo᪢Z0C0G`0S`0S*0Cƒs0椦ᾀ0 010016&0C`0Ctl ?oA` 2tl \0S B800 l0\000ST4p8P\ R 8l0 L l0\000S20/:V4p8P 6S \ Rvw\ R       -PPL`pO 0SL $0SI PFv@@ V00W0S<0S  0 " R p* 0S1 0V SZ&R R L D!B 0㵯06 0x  ` 0 |0p0`L D!B $[Z -@PL/ 0S, $PU) `P&0(pQ 5/0$P(DQ 5/0$P(@Q 5/0$P(8Q 5/$P(05/qW00`` -LM`2 080 0\Pp00 08Q1S00P 0Q{ $0S yV`f0V`F00GQxFQRt0  YRpFSo40 媢ZhV @&( `4/@Po  J40&@B0`AT` 0q`h0 d` ``` `X` T`Td\岀RQ㲀rl `Q= 0\0 T X!p0100PT00T0 0X`0Z pN<`p p`pdըfq 0Yc#60p'v\0STlX8 p0H0`H ✕F 0@\  p0 T 0<l   SdP p` P0| AS 0CV 000000C0. 0`FS T \T@NhLK@0 0T00P r  0Q , K R@BB Q  0^(KT\P`dP l0=bXppT@ x^ T001`FW1 @T@@6:*^Y I P A-@\PA0RP+}n@p `0\( \ 1|Z000R R$ P0T0 S R S |RP00 P0 S+Ұ0000Ұ00P0G-MⲠZRRj+=k!P@  0000p0 Wᶐ@ YP4 W; >0 &02Pa@ARs0 sPPѼ& PPP0 0P#406 c@\ FpW Yp Y @P0  00RЍZƖ0b Z |*~J ᴀ<h Qs0sH@p 00@#40Ɩ0l R30Ɔs0*ᲀ< h Rs0s j@H   0 0@#40Ɩ l Q"r ἆXpGr Kwp0Y@x氀@ 0#406 c0CWrp6 @ P W6+-㱀 h Rs00 00#4 0Ɩ0l LQƆq \q0Bs0 q  "$  n NS2s00ßk MΌ➒s0sѼvp00pp#406c 0CR. 6Z48 + 0 QW4&&&&(K(Ko  0r <0~<s0000#400a A^3s008 @p1s000J&s0FP 00 P P 0 QP 0-LPW@ r2m>FP 00y P x P 0 P0 -PrL`3 @PP  YPv -PL`r+ @PP  EPb 0-LP@G r2m>FP 000 P/ Pd 0m 0/QP 0-LP@$ r2m>FP 00 P  PO 0< P0 -PrL` @PP  P  -PL`r @PP  P 0-LP@r2m>FP 00 P P 0 0!QP 0-LP@r2m>FP 00 P  P 0 P0 -PL`[ @PP  P -PL`S @PP  mP 0-LP6@or2m>FP 00X PW @P 0 P0 0-LP@Nr2m>FP 007 P 6 @Py 0f P0 -PL` @PP  P4 -PL` @PP  P  0-L@Pg>t3GP 0@0 -PL`@PP  P 0-L@Pg>t3GP 090 -PL`@PP  P 0-PRL@ @0 0-LAR@P  00 000  0-L@0P SS0P -L 0R P Q ŝoH < 0 -SL@P T``"P8KhhP Kh: p -LP@P p`QP   `@L 0-LP@P P000 0 0-@PL 0 0R iPP 0 00  000P0Q0P Q  0P\ 0-PPL x0 0R9@P 0 0zQ0P Q m 0@0@$ P/0 0R /P/0 0R/l 0-@PL X0 0R  AQ0P Q 4 00000ܯ P/,0 0RP/// -@PLM ?o  2P0S K0S0 P 0  P`PpP 0 S  R H  &. PPp nR00  hԊ -@PLM 0 0R KQ" 0   PP`PpP 0 S d  - PPp 4R,00$0o 0 h k lk k P- ?o02 ^0S 0 SmhP -L<0 0R P )o -LM$0@`SPU  K KP,0K P ,pQPP  (0K}P "KS Q8P mP P ,0 0 0 // 0-RL@P 0S% R:   P0P0P  ,0 0X0T T0 D0@ @0 ާ00, ,0 ֧j Hi j j (i j j i hj 0-@LPQ P0Q0 0 -SLP` @ 0S @P<P QQ P>Kh 0-L@<PzP0/sP Q lP Q>dP  K0h] 0 -SLP` @ 0S M@P<EP QQ :P/4P >/P  Kh( -`L@Q 2>Q# &Q P Q' <QP&PQ  PhPPQ PR>3 0Ls0S>3 /Sh `(`  0Bs\00@03<0/R>R  R `@R  0Bs0S>3 00/R>RppU0F0 S cP0/S0$0F 0>SM Ss  0R Br R,0 ApP @2=QP= Q @  LqQ>=\Q- \`FV0S0(0@1" @r RP{(0Sx0$00`>Sr0``000 0 0B00"Sb0 S 0\ "P P0T C  >RO00`v 0 0 ౥|` b a @-\ <\ AQ R\ <\6 &\@aT lTt\% @mT pTo\s\;\'gTt\;\>@pT@;T;\<S0SqTu\o\t\;\"Q 0-L  bo x1-LMKQKMM`0H1 O?KL1 N?KP1 @A0 Pp@H Q. 0W bPD  0 3/P D1,@K PLqP1$D<18SSS @83@ P@N0!S0-S0-S0@@SS -S 0-S>Q@@_ _ ] -PRMLM`pcP 0S @0W : sW[ /R 4BK.0H0᪖ 0 S*100 0 5ip@0  HU< P~0P K0?  K0CW /RW  C/QW0 B@CBK@3TH@! ]$0K@04DК0  K07p P~p 5Sp0P<] -LM`yPKE@P3 ,pB KvpD dKe0V= `p00 ` up&  0  ` tp0PP! $K `p`tp  $K@3M$K,M@&M@  0-L@K0hW -LuP 0 0 fPW Y X -LMKIM@ NK00 ZPW @ATz 0 R 2/0pPue PA0mK 03/U@ 5/T uT T@AT8A 2 p0S6 03/P Z :/pu8AT 0 R 2/0Pu$ P Z :/W8 003/U 5/mK(K 0 0C/ 0 0C/ 0 0C/ܢ F0 0 Ӣp <l0l 0 ʢX !T0T 0C/pU W V LU W V (U W V U dW \V T > > B @ 40 -SL , 0C40P Kh@ <0< 0-]( $0$ 0-TP> DB H@ ,> @ $@ -L`4P 4 R @,0Q p ,04 P@Tp:80# -PLM@`80 K KP 4 0Rp` S"*,P' B!0w4 <0 B4 0<0Kd F`0` 0.L GH0H 0.ޛ4 H000 0.՛x< l@ p> T< \@ L> 0< L@ (> P -L@Pp1 `0VHV. 404 S S6 H0001,   , 0 00,0P , 0000/o"\ R `" `P*    ` RzP`D }@0@ 0^/m, (0( 0^/dT: > < l: > d< 0P 00R/,0P -L (00RP80080 0-PL@80080K0h 0-@PL 80 0R@ 0P4@0l 0-@PLM d0 0R@ K0P 00S@#:K0&@ 0-P@L{T ,0 0R@@n0| -PPL 0 0R4 `[40S @40S,0@ pPJ`V`@0 -@PL` @0 0R@ P. @'t0P /o40"0\ R00\/ -@PLMP l# Q (K40 Q8 `0 K RpP @P䂟H TpP 40 Q_ 4X3, <0p0P<04  p,WQ<W\WmCBXh  0 080 .p m pP8 e,00QT  80 ΍80PZJ0 / "H B@!"u0 ,0 4<q1 P4< Px,A8X* p'<A!t,4 <0 pP04 <0_]| x0x 0.ఙd `0` 0.৙L UH0H 0i/X,3 |5 5 x3 6 p5 T3 7 L5 -L`SPp@ T  P C00 0 $Kk C 0 0o/^T2 6 L4 P- ?o82 ^0S 00 S$0P/ 00R/ P/?o, 2 \0S/00 S/P- ?o02 ^0S 0 S`P/0 000R/-P <0/o0"00^ R  R 0-LP'@P P 0 03/P  P P,0PzB%0P -`L@PP +pP $P p@0P p KhO(/ -LP@PP  $PP >B\`8BX` 0-L@P $P0P. 0-L@@P c00 000 0-L@0P BB0P -L 0R RP0SUo804 40 ?$0 0 7|3 p2 L3 3 P2 ,3 -L M 0@`S7 hP/ 0X00 2qPp@P  P P X0U UHU#2000P A"<@ 0*CP? P(K(Ko}X& 00Xp@pP P$1%R< P 20000P X p=P =P (Ko*, 1 , 0 \+ -LpϟP` M<0 00 40 080 @Q ArP|0Ph  0P<Q =Q 4|0P WA W7 W/ V 0  R}0C1 0Qt Q Q& Q Q <Ql =Qj |0Pg @0 Qa0C#2 0QU Q Q Q Q7 <QM =Q@ @|0PD V 0  R> 0C#!3 0Q2 Q Q9 Q Q' <Q* =Qp |0P V 0  R 0C0 0@Q Q QG Q Q <Q! =Q < v|0P|(K @2 YPOpQ 0As0S <Q =QE Y|0P@03Q 0As0S0{ <Q =Qz d  =|0P pQ 0As0S <Q =Q 8+|0P V @0Q Q QL Q Q <Q =Q |P @B@030@Q A|\H0 N <Q =Q {0PQ~ 0As0S <Qx =Q  {0Pp @)@03pQe 0As0S0 <Q\ =Q {0PT @ V p)QF 0As0S <0AS?< {0P9 @@03pQ, 0As0S0H <Q# =Q! {0P @Q 0As0S1<Q =Q t |{0PpQ 0As0S9<Q =QT , h{0PQ 0As0S<<Q =Q U{0P)@03pQ 0As0S0 <Q =QW x:{0Pn@03Q 0As0Sq0 <Q =Q[ @030@Q A|\X0  <Q, =Q {0PQ 0AsP <0AStz0P @00@30pQr 0As0SJ@03 <Qg =Qe z0PC^QZ 0As0S<0ASSzPM  @@pp @ p@03pQ5 0As0S 0L <Q, =Q* zP/#@pQ 0As0S <0ASzP@03pQ 0As0S0t <Q =Q \kzP @W P0S<00P(KP W[ Wp=@Q 0As R00@32dp0pS CpP@1_@ p@Q 0As0S0 <Q =Q (z0P > P <P ) P @<<Q Q AQ @P <Pp @ 0@S=Pz13u<PPp<PPB~ 0# ,3, 0X d@Q` 0As R500@32p]pQQ 0AsP 00@30 <QF =Q  y0P<pQ8 0As R00@320g@p4P@ pPpPp Pp@ pR 0BsP00@300 <R$ =R wy0P @{0@S CrP @2  <S =S @]y0PPP0@S CrP @2  <S =S @yP n<Q =Q 6y0P(0 0 / / X/ . . X. - - x- - , + <+ * `* ) ) @) ( ( ( ' x' & & & % L% $ # 8$ # p" |! !  D   <Q =QD (y0PE@Q 0As R^00@32 <Qz =Qx xPq@Pm P{<Qh =Qf x0P_<S] =S  x0P2R0  pPL PH  PC -LP`PU@P;pP  xp P@ 0-LP@P0P0 @00 -@PL 0 0RPP 0 00   `V ;pP  FpP00PpP/0 0R /P -L 0 0R P`U V :@P  V@ P BL0L 0x @, F(0( 0x ഒ|  P L   P -L\0 0R 0S P4 W000 0 P T  P- ?o02 ^0S 0 Sx4P -L400\ 0SOo -LM$P@`U P x!0 P 0S3K $0K P $PPW:pP   0KzP2 $0R. vP' @P$ PUp;P$0 0@؈ KPp$  ! P0"S D B@0@ 0 ;껈0"S  p  D / 0-L4P4@P@ 000x0Sfc  P/?o8  2\0S /0SP/l H0-@@LT(@@ @40@@Lgx 0-@PL (0 0R 000谽P/0 0R/tP- ?o02 ^0S 0 Ss@0 0-SL@P 0$0S 0 P 0 P ttp@H@ @@0LLL@;@804 40 :  e\e |  -`PL@D9@P@9PPp @69@P:p \P@K KP 1 0RpP 00 0S/0 03/@P P  C 00C 0S @ 0@S P`Kh'@@, (0( 0 ` \ 8   000-P4L@Q8 Q 4 ,<040Q<00P0 &0 0  | 0 -LMP`p@U#  P 0 }P (0S p @@0 PT00KK$ B 0  0 ৎ   H -pLP(4iP 40S @,0a, 40a@T:8 408  S-L MpP`'V@ T 00Q  @00 K( S@T (  Kir 0 0F/H,h @  0P 00R/X0P -L (00RP80080  0-@PL 80 0R@ 0P0@0ԯ 0-@PL 80 0R@ 0P4@0| 0-@PLM d0 0R@ K0P q00S@#:jK0@  0-P@L[T ,0 0R@-@N0茮 0-PL@D80080K0h< 0-PL@58@2@@0 -@PLP |0 0R` 40S,0AT @@ R0 0O/zȭ0 d -@PL`p 00P P8040S !,0Y P, <0 q0<0P;PD @0@ 0S/;, (0( 0S/24 4  t 0-@PLM P0 0R@ K0P  @K0 p-@PL M 1 0R KpP  4 P"80,0!aV# P ,0P < 0@400<0kKphvKphcD @0@ 0W/͌, (0( 0W/Č|| h  X   P- ?o02 ^0S 0 S< 0-LP@P P 0 03/P P P0P-60P -L M@P K  HP  $0SKhl -LP@PP ~ PP 5`5` 0-L\@P $P0P 011/ -@Lp`PP P1S!0„ P 0840P !p` P 180A4 40 $0B 0  p   P  -L\ ^ \-QRS  0S0 0|5 QL R S "  0S €  00 Z0 0 උ8  p -PRL,M00Q@ P 0 ` p Pp `%0 0R0S00(Kp`0 l - 0    S-0   S- 0>    S-0>   S p-@PL,M`P 0S R00i}$P KpKph.0-S 0 0 0 0 0 0 0 0  0 d P0U00 R 0S U00$ Q0000 00/ 0-@Lp00T000k0l 0-L@T 0 0-L@T000 , 0-L00S Qrd00 , 0-L00S Ar蠽d00 , 0-L00S 1r`d00 , 0-L00S rd1@-00 ?^@@ N"0S0(\ 0 @S^ 0S 0 \ 0 ^#  r? ? lR PC,@ 0 0r? ? lR   00 0/᤻ 0 00/x 0 000# /P 0 0-SL@1/000d0 -@X0L M00SP K  q d/ -L}q- -L 00 , 0-L00S jqDdAo// -L KM"vHT K w-LM KDJPp KQ -LM Q Q U0  K  KH+0 K^ B#0($/(/$/ 0Y.<+ < 0/(/$/R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@l P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pz8U5U5E030@3C #@0@#2 0 /R/  BP B0PrA0A/  ꬿ: S0@- N S  Ss00  Sw00K P@r0-00 w0-00!=@SV F SW ! Ss00D r0-00w0-000S> ) SS S0s'r-w -  "P> 9: P3 Pt 0 C   0 SC  Sd00  S@ ?00S0- 0 S-00  @x0x00AS00AT 0 C- 0 Cx 0 CS0 SA00za0-00uc00rp00ol00lb00i -LrPPP/ sP*  rp` 0@0rp` QU LvP0=S Q@q@PVʓs0rp0K~ 0 $H2 D"P-0L M |Kt N lpK$`  -p BLW"R$M H L Hz P@xP-T`Q +TP@00T~ Ws ? Kln 0Kfn 0"`#Kp #K<8@0 < #@0_CK0@q ^a@QW@A@Q7@V\$KCKUTQP D} 0#K0P@L0 L\P#KQ r0Z EH H(KZ \ }Z00 H0 00(K0  p$K 0#K00XS00 C R A BRWt 0(KWk 2$Kp 0#Kq @P2$Kp 0#Kf 㙙 0 0 0*p' -p BLW"R$M H L Hz P@wP-T`Q +TP@00T~ Ws ? Km 0Km 0"`#Kp #K<8@0 < #@0_CK0@q ^a@QW@A@Q7@V\$KCKUTQP l| 0#K0P@L0 L\P#KQ r0Z EH H(KZ \ G|Z00 H0 00(K0  p$K 0#K00XS00 C R A BRWt 0(KWk 2$Kp 0#Kq @P2$Kp 0#Kf 㙙 0 0 0*' -L M@PQ4PKT0@K{{ 00Zp`{{QQW WV&*`"(K WV : WV Q `(K`(KQQV(K WV`"(K <0-L4M @0`0@`Kt -L,MP@U#K p#0 00@ 000@r{0 0K0͍`pi{0"SX 0Q. 0b CR#! |qb} 0X 002`0 p0*S xS Sl D" 0`@ p(K0PP@ 0 0@0#K 00S`p! 0R`pE {"0`p0{.! 0 (Kd!0` p (K:*&6Rp0 `05%&;R?/&1R4$;R 4R#KV0 R0 00#K``p 0P  @  ``p 0$  4 h \ x -LtMp`Pd @PPK` P( 0[S( 0R K aQa#`(p 0-LM@ @ K0?oQ 20-L@@TM KÌPP @K0,@K0MzP mD9 0#0/.00/. -`BpALP@Y#Q!R#Q JAX1P U B P 0 X -LH,Mȟ@0 H@ P0 L 0 lT `H 0S00L80S <( ,(, D $( 4  8 (L < ( @ QmPC0+0C? G @pw  Pu 0PE 0PB(0 SD0P@TL0 000S 140-Q@T.@K mP0-S0p L 1T 0(Kp(K60@0tL0=uP6 p0  (Kp p h&-TP0 0F P:Tp$ +@P hP WT0 :S 0S00050@t P L00@D@C@0H S000500S 0:S th5?pH 0@L 10H50@% @  0< S =g0P00 s PC000 P0@T 4 8` p`` BT  pPwt "P< w p \\  BQ`T0S48`?wT P0 B0S 00S% 3H 00Sw0HS3  0 0+ C :R :S?p :p 8`4 CR0 R T0 0 pSpp0S(KtP 3H 00S 0:S  <H?p2 0 (K2H 00S 0:S ;S 0R0E0 0R>`"@2 H 00S 0:S 4Ě2W H0 0:S  Xⵚ}T00 0R' :R$ 0 Rʨ! t1H 00S 0:S x⑚H 810@0+ Ca]L !T0 010!0 xScL0< T!@0R0 0Y H R :R b0 0CHRl  0' |4H-<-0-(-   ,++| +d+@+$+* *   8 T& l % 2-Lb M`0 p 0S20P@T "PP@:T60S" 000p200S 0:SG?(KH0000Q1j Ÿ-Z c!P@P-T@" TQ  PPfPi -@ fP 0:S" 100S000(K0Sd100 HH!0 ,10Q 00P10:P Wڰ00 0 000 0 :P z 0Sv i lD 0o4Жd$$$##0 # "|"l", " ! Q -L) -LQ* Q Q  0R ! 0R 0 0 R`@Vq PT 0 h0d d0 @PTv0  v0T     0-P @ L0X00 S`p:0CT@! n 0 @S @@1@(pP   H v 0p P-OoLMB@T`pH(P 'PP 0@ @0@` 00 @0@P HK$v@00@v@p(Pvpvp((@ vpLD0 0 X (0-   X Q0  Y0 YQ;  Y0 *Q -LP```h00@ AT hVa@R !/ -pRLP` @@T T0 !3/pWG / 0-L@P}(T 0K0h/0 -`QLp@P RMP  0㼀pD  $`,@(P 0Rvu00 -L MP`p&@P 0U0dV X  WPppL0PP  KP%(dd p-L M0@P` 1S ,0S m$0S m pKp0 0-SL@ g0 P @0P '0 0001 1 00g00t 0 -`0@LP 1S ,0S lm$0S  emX0s 0-@Lg00C0S0 Pg0p/P --L M  W K -- LM0 0 BW K0P 0-L M R4PK@0S&  S$  10p  B0!0 K040 pL0 ( $@K0,0 4PK0 e0S 0000 - $ 0 P 4000P$00///H8 -L$M%P ` p 0 < Wl<%  \ o\w \4V- P0WXA>\ \ #&\ \! R @ T _ T  \ R  R *U   _\ R(K\ \ \ \ \40 >3 SR$K D00 SD FU :P00!R 0 40 0Q0D P\V t@PR  Re R  RV  R U R >C V‚ @  Pi @RE TU \H R*U_ Y  \ R Tt 0>#0!> \G\0p \ \1 \l>C b0 E @CK @_@0 P0CK@U $   L  8 D0&0C>C@0 @ 0!P- > Q% @>C @!>#"R@D 01S500C00>c @ 0 @E `@CK@P@0P0 `#K 0 p0 0P>3 00 000Q>30N@Q pP00C00V  -L$M%P ` p 0 < Wl<%  \ o\w \4V- P0WXA>\ \ #&\ \! R @ T _ T  \ R  R *U   _\ R(K\ \ \ \ \40 >3 SR$K D00 SD FU  9P00!R 0 40 0Q0D P\V t@PR  Re R  RV  R U R >C V‚ @  Pi @RE TU \H R*U_ Y  \ R Tt 0>#0!> \G\0p \ \1 \l>C b0 E @CK @_@0 P0CK@U $   L  8 D0&0C>C@0 @ 0!P- > Q% @>C @!>#"R@D 01S500C00>c @ 0 @E `@CK@P@0P0 `#K 0 p0 0P>3 00 000Q>30N@Q pP00C00V G-RMP 4@ lD`F!8pa>SU6 U 9U mUS UZT 0 SЍUf  U K&U6 UE T 0 U<  SU 0U U. >c U U U  >ccP  > Q Uv` V0 P PPP  >S UP >P>c V   Q0 rT >cRbP c8Ѝ -LDMP P`p00AL )D0 Q0@WL <0 040 0 lSàH  X30 P @ 0080 : T 80000  _T  R@00_T@@T 1V  X 80_ X0 00S RyAoF`FVH0L 00000 D0WPz 0 0p@4@0S7 TS  Tc P` XE  X U1V XA 800000_X0S7  Tan 80000Ua$ T@ Xp 4@p0 ` PUT@Xp T6  TA P0P`0<0!V00P Ua Tu<00 T<0``h <0a,P! 04jP000(K<0``P00<00PP00P`,PaP00P00!y -LM`0pV0 5*0Q>3So S0 Sj S@l S S04  0@ 0P EY4` 0Pp0`T:(K@0>3@1># R@004P  P0@0 00 JU4P0F`>SP1`>SP1>3"SPE P0 Z0P  p`:>S@04  0@t 0Pm EY4`p 0^WP P0  pM` S S Sp`0TK:(KS0>S `R G? >S` GR? 0 p"`S[jG-RM,@0 lD`Fq>SU; U DU UZ UeT !(PS P  ЍUu  U T&UG UM T UE  P S U U U4>p P P PPU "U U >pA P P PPUQ B V  T U  "UP> p P PPQ>S U PUx X}PPY  pP>s Wp >SpPQ> Xp Q \\ }T y>rRP No -L4M40 40(@<0 00 Q@ PY\D0 30 080 0 pm40A/ 00@@ @Y Z 8 @30!00000_Z0S` U 8 30 000_PES_o0R0S 1V  Z 0_ Z0 S RAoF`FV!0P<`00 S 0 #4@0YP~ Dp  Pe0 e0@p4 @0 S! UQ  UI p` Z@  Z W'1V  U 8 10 000_UQ UC  Up`% 0V!1``00p HP 4P@0 ``pW@HP00,pa``!@ @04 B@p0(K``0pa,pa o -LMP0`pU5*01>#Rn R/ Ri R@k R R0 0@ 0 HZ0P 0Pp0PT:(K@>3@1># R@ 0@0 00 IZ 0EP > P >1>3"SH0 0Y0  pP<>R@0 0@r 0k HZ0P0@ @@p 0[WP P00@0 0pKP R R RpP0TI:(KR>3 P G? >3 PG20 p PRYg -LMe` ^ 0 @x P E2  R(000 0 S$ l0 0 0S000 0 0 0 h 0|0 h0| S<X# S*pBp @t ` `ZpGP P@ R@ W:Q2Ppt`|0U 0Plp吀`0 h0d X` T0 |0\P HP P0 P@@  p 8  0 D0 \<@ 4 0 $k0t  l kt0A/ 0 0d@@  d0 @pcK U" x p=0 000_UQY00_UPPU 1WV  Y 0_ Y0 S RKAGpGWi|0 h 0C?oR20SHd0 `h P cd0p cd@ 0`t _@P0h d`Sp 1h l0P0 Ul0 T  Uj p Y3  Yt X:1W Yc x ;0   _Y RV  Uq 00000 (KS0@@ Rf00 0X< R$ X*pC@h l p t` `ZpGP P@ R@  RV1Pt`Kh@0S *0|0 ` ɠ\0 H0  @0 <0 80 40 0x d X` T P  p 00 p0 A? 0 t x #00|0 0 0 0 0h0 l K W @P V{  V U1T V# |00000_V0S  W A |0 0000_WppW 1T  V |0_ V0 00S RAOD@DTc00S l0 `p0 0xt0X&K`lR0 Wh0 p0@@y V  V  |000_WQ  V00 h` |e0|0 - 000 "00  00 p00 p0!T00P UA WUA p ` xpt` 0 @vPUiKd0 00!WXq t@d` 0 pX@pp YJ  YH`00Xq U?e0S-p0A,P+`0,q UR 46x 00S `0! 0 xt"0E h0xL0  0S0H0S h@d`Kp@L0 0 0P 0PS. 0Sp0Dp^ W 0"R0H0S0 ` 0L0S H R/   0 PpL@ E 0T* 0PP pP \pXp  X0XL E B? d` 0@PD " Q2A1(A1( X00S 0\0 HPd 0@@t /@l0L0 0S  h0s 0S0H0S  dPK|`ltpLL 0 P 0@S \d0PD` V 2`paaS0H0S`0  0L0S H R L  t0Ptp`L D0\ I*0@P A L`P \X X0XL D B? dp0@PD"`Q`2A1(A1(X0\ 30\0 HP -@+yT0X|p\00 d0p0 P00 `00 LT0 <@R80h \p0 400 Pd0 W   W h0L0 00 40Sp00PF0H0SX D E0 ? 0H0SUXL D@0 \? 0VPH \00 00 g0IPH R 0\0 ?P \  00 5P\ ' 00  0 CL t050\0 j!K00 hP$0\0 ]P00 P-Lh8Md P@<` ( , S 8! S Q  9cpT  ~_( 0R1$K    \pK2 m_cppp X  rdP` 0 \pK2bp4  ,p8V(::<:Н H -`pLW 1: S\ 0 0S:00S000000]\R*p@BlPP _PbP PUT 0S00_9D 0 0-SL@ :0S00000 0 Q[Q.Q000 S*R .R 0S00(00000 ]R000^P^p@-\#* 0 @0 0 P  Q00S `C S0 B!!Q00V0S p0S 000000p S\] @-P 0U`r 0s@    B0U 0G0Q  00C 01>3 !/0 0-SL@P*1 2!2#S 0S 004000000 xPP0T\ 0-LM0@PS0S* P  QK0 P 0  :-LPM040 0@S00 0 0): q210S3 vxP. poxP%0W 0\  1#2\F e00 q0'Bx< r0` 0V 0 ] P&  ] P Z :Qt9  000(K0^S D  ]S -S-00-0-00H)  8 ) @ S* ]P4 R3#-PQ\ -P] [PR:0 S!` 0!*-Q 0    0 S H :R? =R00S:0(S 000 0-S]S0S007000= 0000HSF* V =R 0S00 ` 00]S 0S 00X~:0(S000]S-S0S006000vfp`| \P 0S `V0S000S0000S    000S`0S* @%0 SG 0 0Cd`0S p]` 0S!0 0 S HS* V :R ]R00  ]R-R 4, 0(  0V0F|CzR  ]R -\ V0S 008000\0<00  -00-00-000 S 2* 0]SQ0'  SJ4p0rc  cc Pp`  B0Cr0D R! 0SJs  ` `   B0S* <00 " 00 00 0C00SQ < p0b r pRWB00  0Rs(KoYD2000(K 000(K0S 001000(K]0]0]00H V0D  ]Ry ` V0` :3`Y0T A/o" R S p   Q P SrY0@000 00 DB"(Ko-]0 0D RN[KP$ YYYYXXXW`W1 8RPR ! 1 -L MP`@08p(0  00 0S 4040( 0R  K t 0U ,0Kp0*0K0] 0,PK+ K*0Kp  0 XE(8 -pRL@P`P ! z[0pp -PL`@  H0Da R % T P0!@B @@!=G 0` -LMP0@p` S 00$K0SV 1 V00U U0SzvNMLutsrq#mlkjih`Fp0`FPEp  B0  B$Kk-`0 F   B!0SP "0SC  PE O`p 0 B `_0 }  B0S "0S A $Kkp$K`0  000$K  B  A   BK :-LE0CSM0J x R 0S00x50000H Y 0*Q= Y\Q `0P\U0@ S000  P)1\Uw0S  < Rh*UP0S4  000P}1U 0Su 0R  B0 S 0 BX  BP`g0S 00V0  & 40K010K0^]@4  0 S+*R \R0)S H0) \ Z c0{Sj/0S *,P~ 0PP" Z*0Y\Q~ Y  S\R_ 00Y0S 0042P`000^Q @0 x `@0,( 1P0000\S0)S 0 B G Ox  F `F`=0(0 ( 0 }R Y0S 00Q 0L0000=<8:9880 S-L|M`p 倀r lXPS@P i  - P ? 0KX KPP P@ p   PS(PP0pK 800P40P P(P,P0P#R ,RLP "R>310>#R R@0P@`RP (pp(p 0>3S S0Q>31S B R R R SRDE LpE" e2(p @081 00 0 w@(KR(0DE" L0e2 @0000 0   V(p@` @X Y P<@ 0>#R0P00LE" e2 @0P(K 5383 -ML+ K 4-L@!MKI 0C4 504 504 3t4 qPP#  PnCY00S+ ?Y0=S0`S(X  V``V `ሀ_\xD*Y0#S@ @T Pf40 0R(Kt40Ct4 Y4 P4K}P#Y P@ 4$K4 }P 3 |V\{$ P$ P4St40Ct4 f  0p4 pPCnKS `FH#t4 OJT @CTTD0lT dt 00X 0Pھ0 4CKI@C  Z34[$SX SV dT dT dT  Pfp$[R&M GNK4t4 x4P@]X7 |1 0 0p4[ S  P t4SP 0p ` |PR PN Pz4X0S 4p`zzTt 0(n n n m l l   j lj i i i i -LdM pPKP q@ 0 x d!? s00 `] t0Kp Kl ` d \ X T h p ^P3t0Q 젟,  OP 0S t 0 ` @tkx00 0R(KhK@ 0  @PI@ (yc( !h h dh [ -LM@@K q-L0TM, P@Kp !`P q0 0  t0Kp Kl @` d \ X T h@ p PtQ @,@L@&Ot@ 0 @t0 0R (KP@ y(,} Z -LM@@K  -L+KM ğ  ̢ p 2 0nK"  2 0" 00 o-0P EPW 1[ S S S S p@l#  Sp S  000 S S S S a R R1[@+S1 -SnQ[U: @U2S & Q+ 2 ,02 0+S_o`R%0S* @Se2"PP  PpQ[U @UO2SvQêPȂ 0+S -S1 nSPPUxpxA XPr= 0@ S S0 S S C0SR 0 C0SQ  f_oR0S @S2"PP`  K_o`R20 0R(KSPP2 02 _oR@A  (8 R-LŸMM  " 0P 0 0 9 J K; AC.KAPU9SR NK +M+?pH9` 9 93P@ #=K 0C9 gP-8: S1 )@x10090 0RJ(K88 `P 0 @P 100S@ )@000{GP 8S ) S )@000 )@|0008 )@\0000 D@)(hHa f ` pe P` ě` ` _ _ -LD@K4MP`p T H0K< PH@T@T 0 PPH~ KH@P~ KPE 0-Lh@ Md@ @00"  P& $ (KP !^ KRK 0RK0 ( 0-Ld@ M`@ @00"  P& $ (KP !^ KRK 0RK0l ( -@`LPp F`hT 0  00Ap ^aAPWAAAP7AQ0 S A@P 0 R:0BS0ąp B 0S  0R:0B00 00 -0qL@`pP@?0PX ?XD8  p0\ 0 0 0SETC*410?0T!:*0a `q? ?`p? .R*S$*"" P * U Q0*@0 # 0R ? S *0:  T!:X00?0Q*00@ S* U xx[ p[  L0-LD@`p@Pn,00 '@exp 0-LM0P $@ P@P  EK00Y 0-(ML 0K$ K0 0K, K 00K0(0K6P@0,P0(@$  P@ K0Y  0-@0ML0K 0$ K0K 0, K 0K0(0K6PK0,P($ P K0dS 0 X ! -`L\M DK0 @   h  |!0  p` hPPO Xq@T1p0d0 0 d@P7 0PP%TKYPP0KT0 X0Kd0`0lP LKXP XP0Sv 0h00 0R(KLK  nP  P] R 0 0h(FP p`a@%% @ p  @$lp>,@7̀ ih@&`͌>p @dp(P PP@$ `7 @`plQM x | ! 7\ dA*`%p <ϿXpn` 7$T`&j `mP>, Pp  p@fa,p(ठ >͌L@paᄠ p'H4P&lAp} P!:Ͽ % `D. gq!ґ%0"P0 0% 0?S@@i D 0iS*0W@@`pG ,KoC1 -L 0M0pK` @P 0(0 R0 0R1130 0~? S  0~? S V `F "0 0R1130( 0R K(9 8 0 0p-L$M@PQ0 0  4K!`K x5 K0R!C0(0 0R Kp8 )]8PP(8 -LQMM0 0 0I~K`pG0@00 F`P60B X03+R00" T ?CK -P  T0@T_0J@:J@00 0R"(K+J@)JX@  0BP0RNK @DtpGw( -ML0 Kp0 -Ld0lM@K Pp`0(0  CA( 0R KM(0-3@PE7FA+ 0/N<  8Iv$02 A1 3L00/G-hM(@@P  @0\;<0E(p `@P$! P`pPf (`a  ,,`芅p$d ˎ@p'@Dp0  gy `( "`& a`(+@@ 4h@)hlˠ'L@ P隊8P@ g{ @ .` Pb+&0@*P@ @fk@$p=FZn` b+ !, P |> t@ PlP>@@ƭP%@@>P|> t@PlP>@K @P 0@@@>>(K(K'!hx  -LPa\ \0@ `PP@@T 0Q P@ L?PT  L0P00 !R 1 R/@P//DL0@>S 00 00//ؿL -L4@KMp `PPPW0F>S 0!31 00 0  K>SL 0!31 00 0 A00A00ꀿ/ -p-L M P@U@0 ` ` )P t0t 08 R;0Kp a 0 ( $ ꔾ x xXQ- -Q =QR-@+R +QqoQ uQ gQR   +S -S =S0P00@"     0000000@-I@0P@XS oS9 uS5 gS 0+S -S00PXST 0!0P \PSPQP\     0 Q#  -LLM@P4T <@KLK0 L0 H0 D0 @0 īp« @$`P 600000, %K00`` 0d0 8a0JS ' +Z@ 0 -SiX0=Z0X0 `pP@0X0C S񏐃~}|{zyxwvut%rqponmlji dI`IppX 0 |X 0 {IW R:d0`P0h d0 僑 }P h I `  B \0  00 =Zo +0JV?o20S R{*\0XX 0B00` R:d0`P0h d0 僑 NP h I `  B \0T p0 0 tW9X00#=Z00S 0X0 R:d0`@0h d0 僑 &Pd h I `  B \0  00a V R*\XX0 0B``Zb ,Z0` PX0=Z0X0 0X0 d0`@0h d0 僑 P- h I `  B d0`P0h d0 僑 P h I `  B q? PK0  P00S@m?0"S1Ds `` }?@`Y0`0 w?@`(K>0SV`` -0/+0` @ 0(K`X`+P-@ p +0B XR R p0+R XR  -Rp    X@0PPQ`"?00?0`@ 0`` ?`` 00ꈻ 0-ML K   0(p` KP -L 0 >o`/00/00/00/ 00// ///00/ // / -L@Pped-+``-V Pe 0  嘩P@P P`r3aP T000ᨩp@000>P{>P X I -P@L`rP "00p80p0 ` @ 00pӨ0 -0LP@`T Ũ@T0rS 彨PㄩKh质岨P0+SKhsq壨 l!-L0K $M #, K@( [0P$0 J 0100S-3ap@$ P D3 0K$0( 00S.$00K K  @,0/㺩=@3h0( 00S dn$QO=0@K,_$0ꄰd=0 $  D== -LK$M, 0,K0 4 ! ( 0P$0 A 100S4p P 0$K&0( 00S($00K K:4 0,_=|0( 00S@ d$[w=0@K, $0̮d;;;`1 \!0-LMp`0S581PU 0V90S P@T0S7D=P00000S `K6=0S   y:pP  PKKd഻\0PUL଻@40 0 $࠻ꈭd\:<: : 0-L,PKl`KLM D0%0cp@ pp@ (Kp<0S @WppP 0   Cpp pp@ (K0Pp RЧ@ -LLM#K08 S7 00 S |d0/%K`00<0 SXd0+%K` 0<0 X\X0X 8 RU Z00#KR0? CKR0 p0@P 0CKL @ P0CK$K 0a3p0H0 7p0 S(0`YX X CKpԅK 0 7`W00V0S@P pXCK$KCK!0D#0PR0 02<0d `H0 `7L"_ 08l1# p`` V(KLb0+%K`0<0 x0/%K$20<0 q20H0 J0QX0 5QA CKd 0 L 0 0|2XCKCKT 0`4p \ eK0 27P@ 0PZX0 `4pS\CK X0S`$KSRKd 07KLcK8?P00<0 0%#H F P @<`x0 CKT00p 0@TP#KL  P0@P 0$K 0#KGzGSQ "  t T  P 0d p$K0L0 ,000#Kp r0#K0d $K0L0 `(KPp6 P#@%!E"ÂgL0AgfF<0 L`0 ` 0EqgH0LϠ00El|gp8``2IG-MP@0*?[Q:^b ` V. V0 V ^( 0U USQЍ^` V V V00@ T@@P U P000p!` 0W``p```]W -0X W`p]00W` 0^ W0Q0#0p`WKR 0S0/0 R pP// -LM M BNKp@D`P+0(0 P0@ 03/( 0R KFg됢( -L M@`P p``a V00"5SP+ PR 0SQ  0S B0@0000 00P$ T3   P- 0  0  (KP& T 0 0S"I    `V *o`(K0 : 0 @ -KMXLTb M@`0p0P/00 T* /T0   0@@T/T  U00 0Ri(KQ8/T4U U@/T p=K@ 0C 4 $0P0 0   R  ; 0W/S 4: S+ S 0 00(0 0   (0CNK+ P 0@ (03/P4: SW/03010301:|9/ 0@@ \*$( -`<L8NM M  4 0P@4 0尠$ p00 Y9T#*0*U@%@0 R R0$0C?o24 004 RU0 pS400E0"0Sy004 04 4 4  $ 0S`CK+ 1 0@ 0 3/ 4S 0@ $04 =K 0C4 :/P   0S00* g 0.S Vo 0S0 @YF4Sf 4S 4$6P4: S $P 0I HS/ 3 I1$ 01p 0 PP00K$0 AP4: SP 040 0R(K X:0S0Y0S  0@4 x  2/4S[  0  0.S0S 0.S} V HP 4Ip 00dPi 0 40.Sb q,1W0S? CK+ P? 0S + P@O8 4/P 0 4 p 04P04 784 R|  dK )80/000 :A4밝(8B  -LƟP@QK AMK3Ka#8d 20Kp4P #K,Ƞ K:K @6K"P0XS0 H K@Kp00 H#X4K  p00) P0[S0% @yqY-  X3K7K;K?KCKp00 L0 8KX0 <KpXP00p0X0 XPd TBT&10@!`H0 0\p⺈4K#8B0K XC@K@t@pP005T0XAW5XV2H@00`00 0R(KX00X0 X00p%[  0iL[(\}||\ H |>   {̪ { \{P 4{, Az zz TA Xz@zT z, y yܭ y8 dy 8y` < 8 8 4 xd wvhv 0-PPL) @T W"@0U /RB C/QU0 B/T3 P@PP@PU ; 000P@PU* C/Q U0 B:U 0C/Q0U C:0C#@T@!(P@PU: pvLvL 8 -L MP@!PV !@0 0 0   `! 0b0C SC:A@?>7<;:585J&0 0K080S`p 00S 0S8&0"S 0 ᚗ) !WV0(KV0 QP0&0 (K &" 0 Q8 x 0-@PL0 0S !@T0*0qT' /S T%*0Q/S"  A0RB" R /P@C@3T@!d@\P; P0008@/S @@@C( w @ 00-L@M4 KTKD L0 @@0 P<0 EKἐp 0KS K0 -L`P*p@ Pp! V U ch p` ̐ɐƐV@@  Q0C- M ?o0?o 0@c\L\8 \`PP&@`p&!/D! .`l,R +* Ѝp7 h7Ѐ0C7`L pf@8&@ PP:L'969 @@P 0 0 /0 -L  / !PG-QMoooo `@f\L\8 \Ѐpp( `(A OdA NЀlLT@! Ѝ@9 pj9 `FP9L4h h@i:L@@1`1x``@0 /0 -L  0 k03D0- {@ P KE0 0/ A0C0 [03D0- k@{P{KE0{7 Q/A0C -LJ Kh^@ \p A -LJ Kh@ p PP -L ` KhɎ]$00?0/R//R/?0S/R/P/R/ 0Q-L4M  (00- K0) KH -L -LPMPP  @T p00K0`0p`: @$ <Ϗ8tt 00 R ⦏s8 -L"$ 00 0S Kh:6Ds0@-EAEdD2 Cr0b 0lR0cR0L1Ra.`P 0DIBID B``C00G-`0F \͌ ̌L@ pl,`H0L0F AY ZࠃࠓT^ S\!: R-L Mp0  `B@P "CP @XY  00 @(K(K$1 -L0M@` Pp0S( 2 K@+)K00S  \#3@!!00(2[R@0( 0R$KP @ 嬭($ KE( -L_DMPP0 @t0\ < EL IrIH @X T0 ` %S& `<` RP 0@S `/8  D ಀ@ 0`00@ `<` 000@X`%0IUS[TYXWVUTSRQPONMLKJIHGFEDCBA@?%5431/.%#P_$#"! O-R> 2*?`<` 0X%S| `(K< 000@X<`m`H0 Rp RH0 ,L0EΠ8 @?3cc0 KdP?BcdT3c0c?o2L\ 4# \H00H0 L0 H0 $L0EAE?3cc K?dP/bC 0C0`< {H00H0 P0L  0080h XX`< iP0 L0  KX`< ]H00H0 L;0 `< OXML b`< P0X0 @X>L 0< ,K n1 !L 80X0C0`< *H00H0 X$H0 0H0 XH0 0H0 ,K c0 ! 80d XQv>C 0C80 `< L K@`b080 L 0H00H0 0X0 nc0 8KX0S`< & L0d8 0 ?2c##80 L 0P0H 0 H L0 `< n 0 8K80/`< A!b!b0CL 0\ 000C S`<` 0B? #K000C S "< 0H$Kȟ? K< \R00Hȟ `0p 0P `pP 0$K#K0$K 0#K$K0A QpL4KЪP H0<`0H0 =0 LXg(X `c0SL0 "`< UH00H0 < TR <` ^ D  @R D0^0 R# R z IL/o<K"?P:zY$* d D  8  R:Q  `0PL d0S0` 0$(0 d <  MR R  D  @ L `1`0 "k< `L0EΠ@?3cc  KdP?BcdT#cb/o"L H0H 2#  A100C80DSd080 ABLB|q QPHJRqh `L <0 (00c$0$D0  `D@ ē (  8 T hh@`<` 000@<0  S8 0A,RcD0000PRc RL*dÂ`h;X8 D <0Π㜀 TP@ BQ NB QM bL $ <0 L`0"< `e8 <0  RX D @K<  CR A @ R @ R 00@ 80K D0  0 0P 8 <0 ` B>L ($0V# D  <0P 8 <0 `B.1L0 "zp"D< P L`8 2 0!< 0( 0c$0c 0 0 0?11 -@0L4Mp`P0(0 TK PLL Q Q Q 80 ( 0R K ,H 0 ,H0 ,H0`1(0@P/ P @/ -L`pPV! @0J@S  R DJ`0U R  RS0@0D@R B/0S00  Br/\R/ 00R/ -L MpLa`WP@F PA  %pPA 100 6!0 aV0 Y0(K4 00 #KP0 P 0 a0P 0 00 =00 0o 0 0.$ -LafM M`?P 0p6 000 R ćpK 00CSN K A"p? 6: S8@GK @Y>KD 0CD 5 庛_^KOPE5TAXA\A>E CKp   0 U  E E @P} P 60 0R(KO00@@00@00-(T 0-  + --L M   K -- LM0 0 _ K R-LMp@` R00?r 00P @ P 00 P ! !  4W\3?OP2 0 K4K VP Y406 V[WP0P`0 ``f`00 0 00i (K4`P" 0POC0 PP 00N (K80 80P V 80P` +$t -@LM!(0S0 } 0 e (0PP1/0 Q`Pp0$  00 0`VS <0`VK 0S  0C``p00 -@LM(0S; 5 0 e (0PP1/0 Q`Pp0.  00 0`VS <0`V0Q P K 0S  0C``T00`00` e2 R0-L0 @T0 E2 R0 00R0 uP qP m<P iK0h襇 -L4@`0P@P 0^WKh <&p 0-L,@,P@P0WWK0h%p 0-L4@4P@P$0[XP0蠳h%p1!0A-M0 @P00S0p  p XQ0p `S 7( W80C0HS 0 `S0" \0^0#S ЍW   "\ ^ #R.S  0A a 0C ƒ00@ NN!RR 00R$%4  R  *4 8/ 0X\S 040:8 R РS / xB -Lp`L L0 H@P X  ᔼ f᭧" v P-L`@0 A- PLHu@ \ 4$210/)(,+%q`\ h\!# ^ =^w ^  0?Q000 0 00NS00N%\@ 7010pS;^ cTƟ q@dT 1U QQ0^^60A00-Q ^Q00\@A#OoPPB,00%Ao 00&Ao  00=Ao#4 0000NS>0<00C0| ^ ^ 00v 50000 D B 00N70Ns00 00d<000 0  3 <% 0W0Cs0 20M00  00A00  00Ns00W0Cs00 00*T40000   0070Ns0 00Ns0#^PP00 0p0@0;^ 30000 00 C10 0AnS񏐻tZp~}|{zyxbvutsrqponmlkjiNgedD>a`_5]\[ZYXW(UTSO MH00000| 00w 00r 00m 00h 00c 00^00Y00T\00O00I00D0N00>00:0000 00/cT`TdTi00&$0@<00p?dTV("y y y Xy 8 -L,KBPpM<0 0@ 0(10K10K80 `V, @<0 8PJp0S T, 10[0UPE& 10[p08 <8 00(K5 00(K 8;P U @0 G00UPE10[0p0 00  00  Hxz -pRL`PPg /NCC=1D%#rbQAUJ 0S$ RQ 100S 1003/P.@!0$p  hV00Nh100SOX100SD 3/@!U 000( 100PP3/P, U@ @$p 00  0S000S00SV@0S =P0@0U@D  000000CxCy CBPdBAP -pRL`P Pg O BH0D#rbQAUJ 0S$ RQ 100S 1003/P.@!0$p  ХV00Nh100SOX10 0SD 3/@!U 000( 100PP3/P, U@ @$p 00  0S00 0S00SV@0S P 0@0U@D  000000lAAtw @0|@@t? -`PLPx \@Pu qpPc  00 Rc</㯃C=㓈)#2cqAW% X PXT $00X! 0S7 81003/P00  $000  0S 000S0 3/ W 000(Pp0003/P 00|000S000S =eP0000>l>ؠ>=4  -`PLPx @Pu qp Pc  00 Rc< ㌂H㓈#2cqAW% X /PXT $00X! 0S7  81003/P00  $000  0S 00 0S0 3/ W 000(IPp0003/P 00|00 0S00$0S P 0$000<<<;X;ܝSR -Lp`P5 000S 3/0Y @IOP T0 0 0 0 Y @IOP p TT0 0 H D0 0p`P,:L:<::9xSR -Lp`P6 000S 3/00 Y @IP 9 T0 0 0 0  Y @IP & TT0 0 H D0 0$ p`P\9$9988P -PPL@ Q PPp`L@XP zpP`V 0"S P00P -@PML M` Q08  QL /QH P.00F oPP:#=Kp0Cx 8 /Q0 Qo  0/SS.Q3 0E000C ShH/0 I0D 00yp 8* R( 9R0/Q0Si/QP @@P00`y(K IR .QRV  u/R @Wp88傮K J#@~0P0 8 8 Q,0  8/Q0#8 PVP/0000(K[V?00/00P00 `P h ZK>00G00C?00?00;`00 -@P,QLP6 a`00P9 0  0\0 @:\0 S \S 0@ S @ 0:S@ 0L0P < 0  0 433@-:S 0S0\\ :R0S0@S@0\\:R\@S :RS:S 00/8A0@-@\  \:^|^00^^ R B|\ :\\0  -LMǟ M` d P$ H4 0X 0 \4 !R000 { R `G@PU 0PT4 3  PP P40S 'C~K h$ T$ HPd0 003 @0S` @ R V1 :RF \R` R R`` ` \+*S P+H}PP@0 @ RV+Y, P` #RR X L4 gL4PQ P:RY P\ : H L4 PL=L4P `E`Ph$x0 00! PP4@}0PH4 0T4 T4@S HL}TY@ P0H4 P$0SP$ m0L4 i400SL4 W 4h 0X4 0L4 = X`PJ 0:RB 0R0CK`K @ H4P$P pP p:00j0L4 L 80:R@ @ R@tD`FpGJ00S:S:00p0IGX$ E @ 8PC hT4SDd$ U E0A01:`4\40 L0R(Kh$0IPE0`FJ P? 0P` h 7@ 3@0L4 @ P` PPz;f bP 0L4  00H| T4S   00T4`ShLd H}|hT4S Hu|8Hq|0L4 @X4C^K}KPE@4 s < `0 6/p P0L4 03/0L4 8`V 44@ 0C<4 0L4 00oN p PP 03/0L4  00^꘺ 03/Pd4p0F?o2L4 `4PJ0L4 @w@A(1g l 0-ML  0K0 K 0-L8@@ P 0 00 0   0)) 3-LcM M`D x#0lC 8 @8 @000 Q 0S  A.Km(p)d)4),)$)tT )'Q 0-L@PK0h -LP= @P dPd :p`\S0 @  R 0:SSd ^S0S:S^  R0@0AdPa d 0S:SK 0C|^6BC2\ ojfla\ihgfedcPa`_H]B[ZYXWVUTSRQPOJFLA<IHGFEDC0A@?(="000Cs^:00Ns^@1RA0@A0"P@ 0 @0{ 0 @0w 0 @0s 0 @0o` @lp @i0 @0e0 @b @@@ 00 -LP= `P. dP, `Fpd 0:SS  R0@Add P pRA@ApPp@]@y@ 00 0-L@# P 0R  0XS <, 00BaPBs QU70BABW0BQ^00H3 -L<ß0BMM 0@ `84 R000 Z /< PPi rP@T p  y'00CS!8G & /0:Sp0@4 B  00840 0R~(K  D4 3yD4 .y )y0:Sp# @4S0S00UP R0P  R!, 0PDpP6 CK@T 0S:S04$10<$ D$   R ;CKH H4, K <$/04J)D$,0K0 $Co010@0M@ P yl0CKP@t 0p R:RW G0a,00(,m tV XV U 7 T 0 00 $ -0-L M0  P@^00 0 00^100 M^  @ 0S0,00 x 0RK0|($8 0-L$@M@b0|S pS -LŸ`4M pP 0|x000 >d20\? D0KdK<@KH KL0K 㴃K MPH YL0 P0 @PP0 IT 0H L0 IP0 P0 PG  X100s V$RF 100S @0 0RR(K X0sH  P 010P0 P9 5SX"WV00#  @ P0PT0  0ST0@T Q"@3: ,x0 @v&fl 0`0 `  0S"@@@ Y`(l~,lLQ P P ;- M(@L0@@0>PK 0- @{k{ {G[F  :0/0/=A 0-z z@k[k'kFKE{{:0/0/ =A 0- {@k{ {G[F  :0/0/ =A A0-{ k@[k'kFKE{{:0/0/=A0Q -L4M@ ,K 0( 0#, 0 $  T D KP@D 000# 0K K 0-L M K,K, (0 $0 0 wP K 0-L M K,K, (0 $0 0 vP K 0-L KM0 "0 0 v K x x0x -L`PV pP@PV aP/ -LsM @`p|K@ g?K@ 1 0 OQa a }oKTA0XA\A0L 0   @0 0R(K!(P 0-   -LϟM 3 P 000 p3 r000  1S01H? @̓ 03 4? Г 03 p`W  P0#%Wȃ   % 0S0 R 30 0R(K P0 P @0C 0 S303 `P0zSE<~}|{zx(om "hdcaPH 0@0P0B0@ PN 303 3` 03 0SL3  `FV񏐧|N Pv0 3P 0@0C0S0003!dK0C S 0!H+`0 # #C C }+@MQ)')3#Sp0`3  WK303 9`03 ?K3 0 3SoP^Wp303 303 3#S 0`3 3S s `pGEP W`0C @3#S 0p3 )3S3`ps  ,K003SS 00C 0X00 0S P W pQG 3c 03 003@03 &  #S|@ 00C0S3000`V3 C C S XR    0#l#0#          3# # #0C#@ # T}# HT }H@ @pxT|@  } 0,K03SSa p0 Q0C Y S P W3S303 `n3`<3 03 g3`03 b303 1#00C3 `W 0`3 S303903 0`3 G3;3 303;03 3# # j# 0# @d#@`# #+@X @ S@Q3`93 03 3 `# <03 3:3 r03 Q3:3 k3`93 03 3;3 `0,^Spp0PP3 ?K3 3SPG= #%c # ` $  C @  # , K BCPD T-Rh ]R R 00 0  P @0C 0 S P ` P 3 P C 3Cc 0F S*?K3 pƻ # R003 c0 FS S  3 3 C  B@R + D  `@F B RV 1*@NT R0T ITR @ B RQ *@s`W30S 30S0WWp0CS@0 s V:SC 3`FSs5*V V003Xp 33p3 K i30 \000S 3#0CS3s 03 @(K K HG 0G E  X 3 1 PaW_*`@ XR sWN QP3p3 P3T 0ES3S :P 0p@0C`S00 3 3 pes0S񏐦{'P<p+0D P  @ B R X*@p P 0`@0C0S] N0ASO0@0C0S0 3 A PW*`@(T90@0C0ST # , sP,V**@0NS%0p@0C0S0 `3 PS3S& >P= 0p@0C`S0903  0 @0C0S0RQ*@03 3Sp`D3S 0`@F0C0SV0 *@biT nTN sW^ uPY 0 @0C0S0R*`@s p _P`0p3  @AQ)RH*@` @ B R'X *@60p@0C0SW 1*@` `@F B R?V z*@sS`pCS3` 03 40K3 ̹?K3 003 0p3 W+3p`c 0 PX0#0C 03 00 0S P 3 s 3 `C: uP60 P03` S0 B 00& R0`@0C0S'0V *@03 K3S00Ck S@0B0X *p@`W :PV*0p@  .P30A0U@ !PV*p@)Tn0@0C0S-Q0*@`pAQ0S K3KC S03 0803 03 `pc0S7U9 }PJ 0, KOK` A0L 0Ep3 P Cp >,0K3PS 3PES303 3`03 P VCSsW 3S0303  P 3S; 0@00Q0cK30 C S 03 9@03 3`F#S 0# @ R*V7 P ,0KP 0A2L! 0KҸp P p 3`FS303  OP XCS3Sc 0#冔0P #@3  # 0C3 3SW+l # *#P>R<*0 @ PV*@Z 0#= PW*0@`0p3  ᓸP` 0, K`/KA# 0L 3c YpG P p0S8cnS@00X F*@` ϿP8X6* p@ # Ŀ#PR*`@ ṿPX* @ ᰿PiVg* @3 K_0T0P0S[0p@0C0Ss  L=30 oVQ K30 d ჿP<V:*s@  xPQ*@c#p]W  sP pP/P@@ T Pt!P pP3# 303 0eCS ޷P3W@0Cs 3  N /PV*0 p# @! # !#P5R3*3`3 @CSs CY PW*0 # @ PuXs*0p`@ PeXc*0`@C`Ss CSc ` CSc ݾ` پPV*@ #S C # S|30C3 VS0C C `v m3SVO 3`v `3SF0CS`s bC` S]귬CSc `WC` SRCSc `MC`Ss FCSc `ApCSc `8 `?`p-0CSc `+ -L@P`pw0 ePx 0-  (p 2 0-LP@8 "00S7 O0`v 1S010h C00uP P! pW@0PA ᑵ`PT 0 0 @0 C PC000(0$0P 00 P*0QS) 0< @8  BP \P00`0s0 iP ;0?B0A@ #A  P 0-L@P 9sP0 `-L@pP>t0t 0pఀ >T  ἤ@0 ᝶$ +ˏd d / @b 0l -L4MpP`!E@0PH0 x50PEu KT  D PK 0@L @ @p 0P X \0 @T:1K C ccK5 p`KTQ KD ^0s|1ry vWQE(H0S)0 S& L R#P R@\   @  @M  @ ڴ@0P5 Z^ @@ ?  @0 @T=*@0(K@w 0"#00\0 00000 @0 '  ῴP 0F VSX0`(K|10000 @- @0  @s 0\ @0 T0@ S\000000@ 0 00@0 @a 0@b 0@t 0@n 0@v 0@f 0@r 0X0 oPj 00Gs0Sf@\ 0 p@0  0F VS\00 -LPp@`+0P_T !D Q( D,TRT0T"@%0 !1 I&2!0 0Khc0! -Lǟ7]M p  YL P0D! x1 0! 00 y @0PT1  b`0Pl1 W 0SP1 0|1  91 P MK  T Ta0P0@T`p U T 0 1 #P0?0S} PP P@6<&<0 T1@FDA T1D181 9@⯲0PX1  0K 1 T1Sa T 81X!0C BPX1A  50 R  t50 R 00@ 00@ 00@ "00@@\00@00) e`Y: TAlXqY5 0 p6/PW@00X1l/T-|+x10 0R(K1SPQZ  Xd`1 NKX倳p XAᱳ0A@.l@@l妳L1Sd 0S`1  d1S@ l!0㔡  B\! h $#`a 0F S!q>P!RP@ 0S* Pz`1Z*d10Sd1 P10P1 \1U@\1 SK0 㐡 0\t1 @h`QOK1`@SOK CSoK@ c@0 P@`QOKp@@P`@``\`V tA``AVX*QOK @@ P43>51P0\*PL1S L10SA P1@@A0@|1 X1 P Kf@ -L 0.SE:P0Si p(K&`W PU4p5 `,0%<,0(K(0SX (Ko00 00` H00CP<0 P00\0 k 4 @8 0P@0 0`0  55050@0 0S  \R   B  0S0  R   B   R 0L \R054p0$0S32e0$0HF 0 -L MPp0㩫@Pm P(X,P ` P! UP1RP Up+ ``Pdt0, PY P0L0U 0` ``PU# 0P;  ,PP8 ,0\L0 IP05YV0P 00`0P PPUX00Y0S3p!, P , 0` 59 X (K.00V PU @(KP`UP1X   0, `iP@00X]cp,00,0 0,QP `   A 0 -SLP %#L R@@T@L 0RᩫP @夫TP 圫,@ @㖫(0c0+dp` 'cᇫ@cT @@ -L@T ,,5S| S%* Rt ` aL0Su 5S@TP`U`QL0s ,0 PL0S,@@ $0@S005` 0BSR@' d!WV" 5P P(U05 ,P,0 bp( 505PU\  R 00 /0\@,  @ ^0  PS,@@cP[00\@ ,0k/P TT `~p \0p@$ !PS ,P[ 05 ,`ᰪPVPPP,0 d @5 ,0(@5cP\(2bMK,0@H 1@807P? ,0<,0B(bP]0S0 @8%PPk P5U0 5$ b 0   0SZbP ,0 ap(" 505@KkPP|0x x0 _ 0%$0YP(aUP,0<,0O 0%$0p> : ; R %-0L:0  -LL`P@p,@,0<!% R@ RP @T V,0``<,0L0S00/S ,0@ @@h bapp@ obPla@@ da9 0 | 0-LP@0S0`0( 0S (fu(du(嫩ᩩKhCa(Zuꐓd P-LBM R   hh ANKX  P( P`z  (T D 0- L -LŸPM Mp` @ q( O TH " KⰒ H"  @` 0 ( 0R$K轟BNK@DH" 0ӟp `0 B>K.0C!0 ( $  8100A@  08 08P Q AA+Q-<+*)>'&%$#"4    p Q\ e     \D Q밞 ( d ` @ pu l, l 00 * -L-PpfMt 嚨`@460S00  P P   P000 0xP K -R񏐾cgfedcP@00 x  R/ 0R00  00B Sp 0  #.Q00Nژ,"Q0Bpxp  0B ^X  @@ @ @ pEW pRw0 00S xP Y  x0 0@K(K00 x0 p xPx +^3 -^pp  x 0pN WxP p0^xp@pxp 0^ @ 1pNWx0pN@x@ 娀 0N@ X@  !x 0pN W0pA夀 @ @夀H@WTӠ@pTpg0R00 00 r0XSU xSS x 0R R00 d :Qg{RG ࠱ࠣ R{ Uʈ\ Yx000S} @ @K(K00  R  XV@p RP pXQx 2  @@ @ 0pN W;x@W㈀p @  ^@@   @ R^ T  TR Ӟ|,Мpx 4ARfk[kk ڀ@BTڄ^{ T \c@ {k{'{ - 僩 P 7  Ȑ Q0aO00 <?O0 0?G0 ?0 0@ ἠG0 0 o @(B^@  .B  ՜ Ŕ 0`W`QQ0C`FpGQ\Skʈ0SVWM@Pe t塬P` 0 ` 0僬0S Pb{% )K )KJ{%kk$Z h00jS k&0B0 lKn'{V  h ??GR  { 7 t}{yw)PP#    !XK`K Pt   @P ` QX00C00 AR AppQ6`n  vXK0p0t0Kp KXKxKL k0@ SY P1 0 p0^ @ x @0^ @ 1 NR pp IN%^ qfQ\ʄ0{S0pG{0qk{'{ M\, \6P{@`@kP{'\U{ hAG5Nh kG{{'J{  \G\5Fh@ Gh l ?A ( ^ x@K,wP x00(SF 0 ?G&Kx@KhgP |x00Cx0 ^Px00x0 0 ?G&K0 Nx    @@ @ C#10 p@P tP tZ0St tPt Ȑ0S??Gh0 0l0 0S tA?=;9\"00 >PP VpPPkP  VVh 0?C pW jWZQ {Ǜɛ:S⛟ IVI{+S+S k0AlK+C{{ { h0  RZp{V{G9l RS0S{ǛaZtȐިܨڨب֨R{@ 7 Q 0?C)K4㸀 @PxꫛVh I{+S+S 0sȐ0?Gh0 0l0 n l@ P[k{{ L° \( \@{k@{'T{ \  h^kl\ \t4\@ Ll@ @7Ơh {@{p 0&K~|zyNzYonmlj.daZ<0[Yyis|p 0SjtK `q K0S RV p,q`QPG 0 P? |0 0-Qg ?Sdk`1 UP|0HKL 10  B P a La q XH0[S0 0` R S0 0 0 | | H`KŸ0 S0C 0 B10Ϡ Al q XH0[S0 0 R S|0H`K 10 q XH0[S0 0 R S0 0 0 | W `v|0H`KD 10 oq XpH0[S0l 0 R f Sb|0j jB  1HPK0 fn.n ^ Jq XKH0[S0G 0 R A S=R(h t и 0 4 @ < 8 L ԫ t d @ 8 , D Ф ؒ x \ |0H`K8 10 q XH0[S0 0 R  S|Π0 K j  l@ P cn唀n0RAJN`nmJodrfgWncfNnQnmA^@ J~``mqJdbnfVnqnnA`Pmpp @HJKOPPEAdAd@@`DF~R0@ P܋KVS gS 0  0 p0 0 | V_ u0 0 0 | Ep|0l 0  d|00 SR  X1h[0S0V 0 R P XL|00SB  X1C0S0> 0 R 8 X4UP(UP$0 0 0 |  X(?00 XD?00 X `?00 X|?00B 0@b/P܋K@!b T0 00   HKoH0[S0GK0 R XDe b`PH`K1 0  o XH0[S0 0 R XomkP  HKo -LXKTPM p@ @.`p0 bW@@K; p-LMKP`@@,0` IV@@Kp -p`@M\L@P`_dk8 0 `@|_$K;< -p@M|L@P`g_CkT,K 0`,PU``@T_(K:< 0P-LP DQ4f  9,  @ 0-L@@0iR`00@-0 T@P0P0Q 0@0@ T D00d98 J0-00S x0 \0\ @0 00m.!D900 4 0 0-LYL_{c NsH`@O ⧁G?@D8c`0 P@R  D0 0< 0 Y@@ Tl 0-LL@P@ f^0S 0000P$ K0hY^  -L`q Pp @F^ @DR000C C1100XcX1 0`   t %^?XX!0T p000 0 0h1000CC1100XX0 0p  0 0 0 p000@0 00| ?0 p< 0H@ ]@0|Ld( g&-f&FLP "  ``F@g] AR@H000C C1100T$ T0P ࠠ0 P |0 Qx0 P]g&f&F "pgqp,` t]8 d@D 0-L$@@ @c]P_]0 -P LP# `pU`X P0`e%0Jh@X 00PAA)]0pGOZ_T]00wX`TAXA\A ܙ -00 00/O0 0.00D0001 0-L0@@½0@P00S@0 -L@`P@_}P(p0@aaZO\0XPO](0TTaXa\a,(0(  0ga1$0 00-L00S P\P0SZ 0CX@s R`\0@T P LP@\041 !0-LMP@Qp`000 O VE V8 0)  `00S K0K   tI`P$0K hI`P _I0S`V/0KT  K_IP`.000 0R$(K ` 0 , KⴀK‐ᐐ"AIp`  0 @`[値0 0 0K#IPp0( --LM  K -Lp`چL0L 0H@P lW  X Kh)- ԁ @-/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/Pp@- P^ 0S^ `@S 0TT0`0`pPPpp Q-LM@04 0! 0pPᄠ0 4`  0 U X00 0 okP`@D:4 00(K(K@ h 0 ԧ -LtMp #NKp`P <0 IP  DZ  P0 0R:(K0@0S+ S 3NK 0 %kp0S  p0%  03NKh 0 k 00S3NKP 00SS(+(( ԑ -L|ğPPxIM 4Mp@ 0``000 0S SJK  `0 0R(KJK RJK#  QVJK A  0J-K BK0,J0r J=KJ0C# 0 ?s0j 0PQ  0S< S0SG0S  0S0s S0S 00 0WX` 0`J=K0C0` 0`yJ-K2 0P& ZK 0PE< HP hP 03?"R   #<J=K 0C`vSS S 0 00`hJ-K<0J B08 c 0: J=KJ K 0C@I-K08 BPu (0P  J=K 0CzJK*KA, B(1ʠ BJK0  I=KI-K8 B(0C EP P`# 00SnjJ=K0C0L2S` S S ` 0Y0 0 P`0  )HP `+)(h P  X w Q-Lhß Md P@`p 00(0 00CS6G B 1( 0R$KQ0XS00 RO0SLx"0 iU00Q0XS00RU iU 1i # 0 00  k0XSO!0 ?s0UiU)0S50S !E ?s0pAiU0S; SQ@ 0S:0! )iVU000 { E iU0K 0 i 0S:  cQ\0 bV 0  hhC$( 8 ̉ X -LPIM ` p 0@000 C p= <P 0SW  9P-Wv`ov`. 0@S!p0@1 MK3K04K KϿ @N/KO?K P81 S:< /r R 0 0R(K0@1 Z  R @1 垠@1P fł8!( -` @PLp0 x 0Pm 0-LM@KPP#P 00S R Q R @PBPK0@PP@@ 0-PLopp@@r00. SAA0Cq .S .R Q P-S /S /Q P_S 0p@-S J RM @\@E ^> S R 00eS:@PT8 0SL D`D V> U 1R* @@@0T&\\!^\ʔ 0 0 R0L?o20S 0Rp0SR pR ^ pU R$ D0DPS 0SU R D0DPS U RT 0S DPD@US0S@-$MdaP P&b 0S  R 00 0S PU0000$Ѝ lqhA  R 00 0-SLP0@ T  0@僋0 @K0hD p-L M0PS @K``$ 0`q$@0S 0S 0SKp h3-LhK\ST`FMKPDMPXKHL8PE0@(ß @D@HK<@DhK@ (KKL BPL0`F000 (Kp1@ BP0$1KDA00K08A@ 0PU8K 80C0u K1@A#n 01p8K<0C 0Ƞ` PPP 2 P8K80C I008K80C 8K0P0C00Qb(K 8 P0 8KD0C008    P #0?sQ (KH B s0(KH B0Z{8KH0C0S8KL0C0S S S H0 0 0(KL B08KT0CH0C H0 0H0 0H8KL0C 00ꅀ ( -L `AM p 0P0(0 V@ @P'0B^K PE ` f 0( 0R$K 4RP @@ .RBK @ P.$0K@dDIH 0 :X(|j P 80 0P  R00/00, -L0S S0S 00  R  R R R0 S 00/ 0S S S S S00 00S0 S000S00 p-PQLM@`  R R Kp RRR Kp00 ?00PPpV0S S  0` Kp  Q Q @, K P 00 Xaz d 0-@LP0|1 x!0-L$M`@0Q00 @ Q2LK 0 P% D[P,0 #KKK #p(P/00T/Hy 0-L@PP @U0 0-@L P 0 @t@0@0 -L@`pPP  00 0 00  y -L,Ÿ`("LM pP@ 0h l @D@ 0 P@Th00 0Rj(Kw@P P @K 8P& @@0K p0  Ap0P RQ@ PD : 0 @P/0' 00S 0Sp0 0 SR sPD  0p @P 0 00Sl@P =@@l@PG~(v -LϟM    烯K2 OK" 08 _K00  2XS` Y 0S0S ` pP "0020 0R(KK 0 hb0?K2 V0h2  0  `P,nB `@Ȓ Ģ B Xx @HXR`Bp2 PĢS `\p2"0?P 0"S@  % 0P2  m}P ( 2C"0P TP"PU B/K؂ 0В ܢ ?K`pPU 0S RK  R RQ $0 0  R:,"R7 R4"h0 ?P>2  PPchP` P] l.  @P  2P  `Ģ2S l2`z̉@9ഢWr r02 9崂 02 T ?K 0d0 0D10 08 h2S5d"0R . RS+`Q $ QP@,B R  Rd2 Q2 Q` `P`w 2 R 0S" @TprȒWĢ Y 0  0@P0" @PTU 20k0S^`502 f0P2 w, K?K@p@ hB,2 zP,P%pr0S 2S ` 2 "00AX `ĢВ؂ܢĢ` R:P 2KP 02c/ &2 M@P- * ('&`,Pi g``,BT0S 2 2 Pm@T 0S00S,2"0C*  R`V` @P  `Pv @@ 2P@,rHpX H HH22W @B :P@PIIz2" AL0B `4R @0Rp帢 2 " 弢^ @T9 pB (D^|puKp 0r $2 0 2 0"l 2 ^$ "(=P"<P<B Rx3̂0ย"'.K0堀0 0Q   {pr00D, K2 l"=2PpD2 2 |{0T S S \0S0#pp0S}\p(2pSUK.>"QK =PD1x00x02@E`Ģ幄 0dX 0 `P 0^ 0S  0H?oR20P00S0Sl2  Kp`y ,K 0P  0B R R   B bb/K~@1|@P@0SBR(klz Dr0#^0p^{`uR)ptd ( x p xU@m l b t -LlPKqTM@1p0|0  |Px 0x0  ᩻PL 0  RS R R R0 T@P0LK`L` p0K L KP0p0  xYP(Kp`V`V 000 ^`Vp0S 0PP0STK K -LdM`pK@.P0 lPK @0pp0P tKxK e 0'P P0S004 (Kx^P0x垃tKHxK 0P P x匃ppLKpHp LKx:0P0 P0 0 00SA 0 d c -LŸpK (AMM K $A0 S 0 P K*K A, BlK KA\"0J KH"A * m `P@ 0#S2 =K0C帺P, =KP0CP᯺P# @P 0S   @:]P* T 0S S S@ ᒺUP0P%]P 0DD_P0@=K0 $0C00R:(K=K@(0C=K 0C0$CK N(0N$ N$@P=K 0C0(@T =K(0C`@T 000 =P =K 0C0(=K 0C0(@x (H b G O Xa 0-LDK,M p`@H0 wt$PKpA_$% (P @0S @HP (0S0 KDN _ -LK&M,LM\ &KL(@NKN̟ KKP@00&@00 ;K-K40C K B@=K0C 400 ==K`PX0C00 =K0C=K(0C03/PI =K0C=K 0C0`PW@@U@To=K 0C &K d1 V800\1S/  P X0 P@P4A R@0SV X0  lP ~~4`10 0R(K0l1 0h1 0< @Tq h1 .T0@T R@R.@DOoBSc d! S:0  @P<T0t1 0  DD@Q0p1 h1 &dATQ 0 N DD@Q0t1 0\1 ] 0p1 h1 0 Pʱ0=SA <0S S" S \1SI t1s]h1S^p1S- w~u~l100Sp10p1 0  Qh10h1 <.K PKd% 0 0 PC\<00X< 00[ @~Q<00U0p t1 h 0 P(ʭ0 P!;<00t1 rt1s 2<t10.<00 tP ( -LMPp`U@ 80 SZ <PP K00 K00 00000 0 |0 x0 t0 p0 l0 0S4 S S5 8;00;0S% S S ` K0 0d K`0 d0 \0 X0 T0 P0 L0 PH  d1iH0S 0(K0` 0 0 0 ` ` 0 |0 x0  -pP Kd1dK8 0 0 ̐ p l01 K 0 Ki?0 0  S* +KP# 0 `oP K 0  ! 2P0S_}X 0d1 h0SE L -LŸPM ` p 0@000 ' ,p! QP SPW  LPQ BP Qp0 0R{(K0@SW 0@S0@2 Sp@ #.K1D"  /K0KD2 /K @"?KD P@"40SD 82Z@2 0 SH2  @2⛐H2P@"0DZ: 0S ppZ: H"  0 @ Z R  QpTH"pP@D2@" 6 ~r ( -` @PLp0 1 0P;A0 R0@0#40@00@00@/0G-PM@`0P 000pQ@Q Q84V0<0 x4 j7Mp.P0 p@,0p'pV7 8Nب |0@0@$P@,0 4BdJ00 (P`'> 1L臄0` 0`& P`$?|5Ofe0p!$P0(*& 'D 0@0# &0(@V0XJc:P  "@! ,u F}O'p@`P$FP0`@#eU @p$4@pg"DkH|`0@!8`@0%)F<`dJOA0 #'7 \9H"!꧄0 P) 0$@P+Fci 0pP#!P 0*-OyfJDP0Lp 0# H@0P)`c: P!h %iD P!`p' P<`%bU `VOP(feP"@s @pL!ppQ^B 0&00#W 0YNP] ;p!$P /&M) 8PSdDb@i` P# P`P%PLp塨MeV ){0wN 0#  0-p0%p 0 0#B`40k "W!7SL PPaդO0&00#0pc6  !`t`&ZuD 0`靃p #D`  "JPpc [  )lO  " b)`0%` ٢)oFp*H gv0"PP%@P 0'BY0_O0#0$`;P`! `0P`&v `qwHp fipP#0#" 0<Fc6P%P`& Oe^ `&`0#pD*j$J0# 0 P% c8{DP%p Pp`&`TO`&`0#8fnp 0#࿞K0 P%:DpP%.P(B eX `&w`&zN `pp0#d0#0M(c>P%P%@P `&Z4p`&9 `)M @fh 0#y 0#vN 0ppP%4LP%PAe^`&e`&ତL` 0#jp0#D0)O /c8*#DP%P%  9 $O`!s P${Je] `p@ "p @`Ùb+[F@ @$0@` H H!8` }T_OP0`0#p 0P-%Hc= `P`&0@`OL娯Ffk PFP%,NOP @X(@0`& @ D@J ࡁD% @0~SwOpP%<@ 5b:mKR `@jZBP  @!0 p pa4p0C *KN @0pꨁ` P "  %0@ 0#p0g} "0` fk p' PX0`&P@PE@PЍ#; E'F?N , v4(I20A 000/ -1`p L0a@@f "W.P0 : `fR  DW?0W@@pG ,Ko=0 -L0M(PK@ p` 0 0  h!7R8 bx b   0RX Kh?po (= 2 -0 L M00 P4K1pK `C 0S @ 0XP 0 @@  T* 4,00L sZS Z!00@ P 0F0S S) S" Q <ϿT+ )  0Aa@ €8CP0 0R(K\*30[4 [8<\*40[̌\20[3[4 [48<n.S\V*0  ( -LMKoP K\1 X!0-L,M`P@0T00  pXo TP8 ?o2T0S E0 0R0(K PKx @1, K0@X$S  $ CY ,0K 1$ S0 P, K!0$ R0 0S n (`: : -L rM @`PptK|@ 0e/Kx@ ! (0 DO1D1"/O! TAXA\AvP    0 {K Zpp 1@wP ( 0R $KP .x00Lp 00.n@ ( 0-   -- LM0 0 K -,-L$ M0 0  K p-L$M`@| P@t4  ,` $ P ( 0,K00 8 0@X@8K1`V KpT o r -LQϠ\ KhmD1 -L80M` p!0(0 ~0pP @K  Ἴ L0p ;/@( 0R' K2/KP@X @@T PU 0SP@;T6@00vm| ( 0 0-PL@ P0 000^w(0P[w(P,PWw 0h0PP 0P 00 00,,SP 0P0 0(5 5 0 0-L@  ~ 0 00 00 0  0 0 0-LM 0@P 0w 00P 0 b3?o02cK0& 00 0 0-@PL U 0 0-@LPv0PPv0P(v(P,P0 -p0L`P_ PPY 0 @ S S0 S S ?0PH  @ @Ypp> H+P# @PPC 0S@ 00T# 0S S S@ 0AS A PP@  00uP ` uP `@u@ 3  X -LM p@,0(Sh: ( TRTqqJ 00SF 0Q@@D@T`; 00S700@D0P@D P& T5 00T&:`010 I0@`P" 00S0AS00_uP  0(0otP@ @$KA00$K( @uP ( (,@ ~( 0-LM 0@P   p P K00 0 $$ 0K KP K0<p 0$0 $DK0 -L\UTMP`K@P0` @@ ٫PDPtP@ @0@ ̫P5PPPY * 0` QR Q, 0S*QQ   @Q A`@0S:0S bs0P\0  \h `0 @ d0 0X0  R  R RX0S R 00I @T: h u\  0JR5`0 (K  X  0 LKX0 띀d H D 姺p   0@` d0 场W G4 ` @T:\`0@@t(KH D    S QAR{  R p l@ @0p P AWO WE Wc p WS T' QW> W4 Wp`` l p`^ \LQ  QA@p \ ^ Q\,  ` `  `   ` R4  l@ 0 P @T:)`p Dt-@;\. |--'Q -L MP`Z0 PT<r$0Z p @P (0 $p.Z3#W, ,0-0(PP ` P 0 :0 QBPP"!V00PPU03S PU:UYIW(KW ,W1!030#-05-0%00s@(K@00(K0WK #((R 8` `4`F2`F1`FS0@`FAPV4E 0F : s0;0(K0Y' #((R 8P P4PE2PE1PES0 PE A`ᘱU0 0E 8 s090 :04  800 A4 Ay00:`08P( -LM*p@# KT,p0 dK!0R0#0 @P*u 0 0@P  K@ K, K@*F00@* / 0-L \,\@ \ Q :^ : A 00000 -@L M$P\G 00K( UK4 0:0bcK Lb8 >; @>dK8`@2s@ $` A7y23- l39`Rc0  , (0  R  0`80 9Pf N<Ç0<Ša0$K 꾿 0 0 0-SL@ 3/K0h+@-i7nI; QࠑP( P N@ ^ @ `p@D`F PV%@D BD$ BPE&"PE@D"V%@D BH$ BPE""PE@DQ%@D Be$ B'"^ R^^Y hŸN@ PQ QP#@ Lp \@  `@DNPV%@D BD$ BPE&"PE@D"V%@D BH$ BPE""PE@DQ%@D Be$ B'"\  \ \ , ($ `P\4\I \E \G  `P 0 N@  `$PPE@FPEV%@D BD$B E BD &"A@!@ B BA!" A@%! @'  \ \ \ \ P`N@ pP`lhd\XTt! 8 d @6 -`LP㪱00s !R !PE U5  ᯯG0 P05PU pWU@@oyPp X 00傱  N pGp 0 0t 膾0 @0 0id$1 !0-L@P 0  0 0 0@ d .S 0  0P0 : SC`@ P pd0q`00 @  00C 000 B@@ر   4G-0`$M00 |^ @0 I.. @  @|p\ @ pV P|@T @ `p0I$P @ ` ` P@ |\ p. ppP p `0 IP''  .Y` ಐ@ P@`V` P `@` EI2Y 񏐏{#~}{zyxwvutsrqpodmlkjihgf[dcba_^]<lN.O~'`2Y PENMLKJIHG(EDCB#@?>3<;:9876543210%.-,+*)('%$#" @@ @ Ѝ<N.O~' ⊐ಐ 0 @d P`G  0J ,ಐ  P `9 P`30 @P `,꠰ -LMPL LL%2 l d DEAEd`a40@ $PRT$ U x I`  I V 0 |s1l$ 000 .V 0 taa 0 `YU` 0 Qtd刄匔@P4SWT40 ~  $z 0 :0`D 0  IV 0 D(0l$ 000 .XVml wILb뼥 (`:| Jl  P80  P 8   A p H  -L\@KlMp `x PLK0 0 LPK Z  P[`!5[` R[Ẅ[d [h   ğ l0 A l0 00I`!R   ;`!Rp0 㠨  P  P  P  P  P  P  P  P`!RWYYR ĒP_ `0 H d0  H h0  H D0 wH`!R   ~0 ` 0 `|@0 `v0 `p&K0h 00 (K ?  Y tQ lP_ X`0 ɸl8 1H(K (K 0 ࿧(0 วt0 ౧b0 ધO0 ࣧ<0 )| 0d0 ꐟ  d      $ $      d 0-LM@ Ta TR !T^ 2Ta QTPK0TI T= /TU lQTP 3^\1P@0(  T0  TE (Q TP @T T) Q TP T+ PTP P TP PTP P TP PPPPPPPPPPPP|PPtPPlPPdPP\PPTPP  `    l     P        l  0-LMP O@BPK0 0( P03K00 0Aꠄ M-L@MPPpK `@0P 0 .0 $T @D w7000 0R K$0. 0q`Ж ( -LM`@8 4 8PK0 4KLtp@ L0KH0 4Q}Py RP00v80-P 8 0+P 8 0# D  p080  S0 B,,d .PV 8 00@0v p@@Ty'00@^  8 R0#03@\PP  8 R0#300#3T ?*8 'Ġ*,( * ( (0','8p  0R (K 0 8   8  p0N 8 000CQ80D  @  T  R 080 @  S # 2RP T=S; 080 @T2#80D @TQ 080 @S#2Q\ TS 080 @T@ @ ^ [Y Q -LtM0 S 0 @3? S12/!@ D gO  4 QӍabAsb eD㑈HfHHS0N0)`0 <!5I㐄'Wc 0<Pd 0=K-K<0C8 B0 PPq=K<0C =K 0C =K80C0EPbW i-W 3WO2WI*/W ":0W 1W=KD 0CV%U%E0C"?C0 S=K-K<0C8 B 0 P8H =K 0C0@3P-Z 0S .S 0S 0S00S.S =K-K<0C8 B\ 0 zPP=K <0C00=K80C0-K B0P0a=K0 0C00R1 (KWx -Wu W~ Wp Wc0DS =K+0C 00C -K 0< B0-K$ B=K,0C0-K8 B=K40C0%W b!W #WI0DS =K+0C 0 0CQ 0: d 0=K-K<0C8 B0  P=KDK0C0Sd:KA|*0xz 0-K BKAp0PP*#8 -K B0=K-K0C B0 `C=K0CV0PPV0=K00C  @D;  @#'Uʭ=K-K@J<0C8 B0 P[VGʭ=K-K<0C K8 B@ 0PK=K80C 00$PA$9-KV0 0B0#80BڮK8L-KD  @0B 0.0 .0 0Uʭ=K-K<0C8 BA0 }P=KDk0CPD[ 0U:W2 C7WD+0D; 0`D; @: :J!pD #-K BD 000SD=K-K<0C8 B0 JPWb SW=K-KK<0C8 BA0 D TPKD;AP' 0A WiWR*WP WM W4=K K$0C@K0A@C=K<0CP=K80C P` 0`pP0 PKPA` 0 Pl0 P=KD 0C00CS 4& =KK$0C<A-K, B 00K B8A Ph)W &W0DS=K%0C 00C W q W0DS=K|%0C 00CWMKD @D *©=K-K<0C8 B0 P2W0DS =K$0C 00ChW=K-K<0C8 BK K0A@0 0 -K$ B  BP -KD; B PBQUڭ-K\t< B@p`@T D;1 V2 0d R-K8 B 0 NP W WZ=KK$0C KA@0@C=K<0CP=K80C P` 0`pPh0 (PP 0` P|D @D D D+3D 0@(  K$@@=K-K<0C8 B0 P=KD 0CV%U%E0C"?C0 Sy=K-K<0C8 B`0 PAy0D SG=K,"0C 00C0D S=K"0C 00C+W:0W+WD 0S =K!0C 00CcW=KA0CP=K80C@`=K<0CpD D; D P:U0 P4W0D S4=K !0C 00CjWK=KA-K@<0C8 BD 0 PD; 0D T=K-K0C 000#80BLL{ (`|( d(|< d<Xl,0 ph<L lD@T 400Wi=K-K<0C8 B@K KA@ 0@P-K$ BP  BP0  PD D D;D D HKD 0 J$HKD;0D; PW5 W KD;A|! 0A$W0D SM=K!0C 00C=K-K<0C8 BK K0A@0 0 -K$ B  BbPY=KD0C0Q*,  0 KD; 0@D+ 00KS0+ P0S" K @@pPa0W4 ] 0d =K-K<0C8 B0 P!D+@T=KP0S=K0=K0CD 0Q:Dd D30j=K-K<0C8 B` 0 bPD;d CD @0Q 0 OPD D D0d D = 0 ;PD+0D; @T @TPD;@T0D;  d 0! 0 P0D S=K$0C 00CMKD  @D7&=K-K<0C8 B0 P^0SD;P R񏐥RGO REHEd 0@00 =K-K<0C8 B`P0 PqD 0d D  0 P`D 0d D  0 POD;D 0SS(S_@  R-K B 0Bl& } R =K-K<0C8 BK K0A@0 0 -K$ B  B)P D =K0C0SCV%U%E"?C0 S=K-K<0C8 B(0 oP 0H+HKဦ 0D+@0CHK  0D =K-K<0C8 B0 QP 0H+HKb 0D+@0CHK  0D =K-K<0C8 B`K KA@ 0`p-K$ Bp  BPX0 !PD D;H0D; I@d 0 0  PD D;0D; 50d  0 PD PD D @D D |DD9d P@0D  0 P7o'W=K-K<0C8 B00 0 -KK$ B KA@  B`PV=Kd 0C00 :0 =K-K<0C8 B0 =K-K<0C8 B@ 0 P93W =K-K<0C8 Bt 0 P+D;@DK PUB zjp` 0E!S9|+I= :! 0 # +I  +I "  " +I   # +I R! +I I! 0;I=K-K<0C8 B0 OPDK@DK =K0C0S;-K00 0D; K0AD+ `0V* P0S# K @@〠Pq0Z4 =Kd 0 =K-K<0C8 B0 PD+@TPV=K@0CDK 0T:b+I=0,10 30;I000;I020 20;I0II0I00;I+I=0=CL-10 30;I000;I0 200;It+I>I = !  +ICCCf0W ꫭK J v@PMTT m`=KP80Cp=K<0CD00Q 0P50PTaᴤ0 P( D>d D 0 =K-K<0C8 B@P0 zP@ 0PꫭK J /@PTT o`=KP80Cp=K<0CD00Q 0XP0PT m0 LP+I=K-K<0C8 B0 ,I I   .Œ I Ì I\ I Œ I IPDKPU@DK >d @0 =K-K<0C8 B0 PV8 ]@D;P@D;V0D; - d 0 =K-K<0C8 B0 PuS{HMd 0@00 =K-K<0C8 B`P0 P]D 0d D  0 PL-KD; Bp0D; S *L@D;0D; S*d 0 0 P-%D0 =K-K<0C8 B0 8PIPD :D;J0D; \@d 0! =K-K<0C8 BP`0 PD D;0D; B0d  0 PD @D9d D 0 0 P-KK$ B K@A`@ 0 BPx-K⫭K BD  J: B P@PD 9. 4i`=KP80Cp=K<0CD00Q 0PS0PT\Ң0 PF 0H+HKâD; d @HK @x8N 0DK -K8 B=KP<0C0 P#-K((x`-K B D;p-K< B0@D; -K B R7K D+P V  K 0@ dP `0d @X 0 VP`F@P=K0D;D,7 D 0D+ d 7 =K-K<0C8 B0 1P-K⫭K BD  J: B @PD OTuT` f`=KP<0CpD-K0Q8 B00 P0PT<"-K08 B PPD D @D D D@MK @D5P2 D 0=K-K<0C8 BP`0 Pn-KK$ B KPA`@ 0 BgP%]d 50=K-K<0C8 B0 PJD@TD % -K B0 R-KP`, B04`B400 0 0实 0H+HkᬡD 0TD 0CH 0 =K0C0S=K-K<0C8 B@P0 tP @D D D@MK @D32 D 0Z=K-K<0C8 B`P0 RPK0A D fPD =K-K<0C8 B$C`P@D 0 6PK0A D JPD =K-K<0C8 BP@D 0 PK0A D 0PD =K-K<0C8 B@P@0D  P-KK$ B K@AP@ 0 BPND=K-K<0C8 B0 D PwWD =K0C0S6 =K-KK<0C8 BA0 Pc)KD;AH! 0A=K-K<0C8 B`P0 PLMK=K @D0CD 0 jPKD;A  0A|0 P1-K B 0B  m 0H+HK᧠hLD p<<L4Ldp@tܿ4̿|L,ؼHh@`|T=K-K<0C8 B`pD0 D @:P0d @0.0 @+P`0 P80 PD \QD0P D @ P HPH0  `AH rP0 PD D0 D @Pz HPtH0  `AH JPgt0 P_D ZRD0P D @PP HPJH0  `AH  P=0 P5D 0D0 D @P( H@P" 0H @ H ~P`0 P 0 nP 0H+KD;A $ 0A:=K $0C 00C3KD;A@$ 0A+-KT B 0Bd$ 'Tڭ=K-K<0C8 B0 ;PTڭ=K-K<0C8 B0 ,PD4d D 0=K-K<0C8 B0 PD 50 PD;TEpD{ @0 P-KK$ B K`AP@ 0 BPD{=K0C0S=K-K<0C8 B0 P;s=K-K<0C8 B0 Pg4f`cT ڭ=K-K<0C8 BX0 PUt6d 0=K-K<0C8 B0  P B=K-K<0C8 B0 P6f`~=K-K<0C8 B0 P& g`ꫭK J E@PD;TcT Xwp=K`<0CP-K0V8 B00 mP0P0`FT:ၞ-K08 B ^PTڭ=K-K<0C8 B0 OP=K-K<0C8 B,0 BPHh`o=K-K8 B`=K<0C 00PKTڭ=K-K<0C8 B0 P}=K-K<0C8 B0 Pxp -L$M^P`A D  D4pD0@Ĝ`P pP KM0- 4 103Ѝ/ -PSL`p@ W@0 V :@Ot@PU PL@(00V@D : 0-`VLPA3: @0T40, p0  40@T"TT0T400S0 XT 0$,(  P@@0( 0Q -L MP@`p$0S 1$ ( 0,0v(`Vt0Sp(0S$P!,  0(, S>400CPf, 0,0\Z U$  ,  $ ,- QH:0,  0 400, Q::($ "0R*P$PU0 " K0F )P(,  (`, (0 $0TQTPP(0$PQ 0(  ,  K0 Kp 0 k( 0 0Q -L MP@p`$0S 1$ ( 0,0w(pWr0Sn(0S$P!,  0(, W=<0<00 Pb,0 ,QVU0?s01,0?s01,, RF:03? 1,0?s010,R9:(  "0R)P$PU0 " K0G P',  (p, (0 0 QRQQP(0$PQ 0(  ,  K0 Kڠ 0 ՠ( 0 0QC-W`S@Ap &a0 <$Œ'?pF$@`PP SA @pP0 <&a%Œ'?p0:PQ `P`Q Q@P 0,Q :Z@DP R6㗟KR1r QZP@Dh2h hY h @DZW P `S0W~ QPP U@D ``Od2 0 崜00(K`(K0 S S0 S S lP 00  0C?o2P@ x2 嚙x2P p"`" WF*@pSnXn 0Sk @x |R p`pBtRpΆPp 00W P P Pp P( X:( N H @P( 0 0 ` p60l ` !O(K`( |Np2 0p2 Py pG` px2ppB ` x|R``Ox` h4{{81 -L,0P$LM `0Qp(0 , X@K.0 P' W Ԁ0`0 南0\K 0`0K00 JPP `N 0 ( 0R K\%PP `@`NTD|( (8~ -L`M`Pp@T) W ``0,0 E(0K 0,0K00PP ,N 0 KX`` ,K@,zNT KOP @}< 0-P@ 0L`0 S0 E0cP00 00cER P00 Q-LOM 0SwH0CS0H1 p 00 pB0Y P1 H! fP1P@00նH pG H1 H 偖`WQ:  t0H! `Ha C 0S@ 0S= RKO8  :P1 刉P1P S  :S.S 00,""40S0Q.S:S+ H1  @A <1 8! 4 ?0 0( 0 `0 KSP@[00X00圚@00Q<.K ᝧPP\tCt% ( XT" ؜ -LUM˟ M,5 @ ;`H% ^4E 0<5 0 P00 D ^ ^ 0 <50 0R(K:0(5 (K0P85  0` @p?s0U VS#0  00 PP0 (53/P~ P@Vz:,%0B?o2h5 R0@5 S{H5X5 =K8 0Cp5 4wp 0P0L5  B4 0`5 x9\% 0l5 =K0Cx5 \9 0t5 P9T% 0P d5 $ @5Sh Y: ,5 S PI'YUPPspGW P%TP#P2U 5 $LW PPH0 (53/P@ @ V:  P @0 TU PXUP 5 C@R00T0SU P585 8LD 0 J70(5 Q5PX5 3P4% Px. PF@P,5 SYCK4I0  0$ 0P   T 5 % BRPPXPU g5 H5 w,5 S S1 S/ AH]&5P  $L PP0  PTL5S `58%P50Ry*85U0P85 ̔PPU ՠL50L5 m45-&PP450% 0S5YI L5S 0% 0 Qp5T0Q"*0Pᙑ5TU 05 L%RQ 85dT5 h5R00S450S1 0  450S 85PU u@C @0G@S:4e fKT5\ C  0GS |:WD 0 f 05 05P?@CK4I0  0$- 0P  05 (53/05P T`58%P50R855*U 8% P*0S 05 05 " %05 BRPPXPU |54% 0P,0 05X%d00%pLyX%%lPjLs45 < T54%@E 0`U45P0P5 P0KP 0D 4%%5Pt BLK|K\ pG, `GP@\h l1h!0S  p0tp1 S  Rr0U000^0S V^PT^ L5S\% @GPa0 sQTpp"P^45 0SQK % A4aPU(*J`5 0`5 0P 8%P5  B0; 0x D4S@4S<4s 0 PU( J`5 0`5 Po 85P 0C085 v0 @! (0D -LM0@S`04 S/0 0pHPP2 P; ( 0P 㲤P,  0 `aJᬗV 00S S  K0 0pHPP 0  KBJፗK0C<4 !0 %dH@PE PP@ (< 0@ ɢP> <$ 0 0PiIX6 @0 @C\0b  R     @T&p 0  0  I 0  I 0  ޖ 00S SӖ?h (` -LM`p᫖@P0P0 0  ` 0p "Pᯖ(K` 0 pPP -LMPp`ၖ@P 0 `00  Pቖ K 0P0 RQp-L$M``@ P/0S9 0S 0S0s7 S 042 1,K0 ( 00 0 ,@ $ P P@00KpR R @/ 0 0Kp0S0@0  0S @ 0 0Kp0 X 8y -LLM@ğ`PX 4p \0 0T 0P0 000 (4GPP 0 H0 P (@P @0K L0  00P0ë RR RRd0 @0` S Sh 0 S S 4P 0  R `H@ @ @ PP @T R R R@  U:(G PT PE`PH@\0hd S  H E\ X0CBH  !S<:C Q7 LPڍ 0P0JL0 אL0 S%:  @CȍY 0\ ` T0 HH @D഍0H PR  ᰐX`pGG 0 T 0P00 0R4(KL  P3 P& 0 0` H0 'H0`>`XH 0H  pGT 0000p00``P ` `= (]\\ p-LM@P`00, 0 0PjKpaa -L M@$9   Kha|a 0-LM@P, 90$0  0!K0a a0 00-LM@PU x 0 @00 000oT 9 PK0ᓪPU^00H ``t!t A-M 0@  p  P` 0S  0 C RB0,,0 C.SV 0 Ѝ R0 XR  9S S @ `F V0 R8Q<4 0 3?0 2 -LŸ04MP` @000 2 P%P@pK0@0 :U00 0H h2 Lp 0P0 0\p  pP`H 0 KT X YM ኂP0 pWΓ/000  0Rr(KZ@H0 0H  H PfPP0:YFW T0SH0L P0T P:U`H00S L X R:L*$pL HP Y\p0PK L0U:*$ L0 T0S$ L R 0BSL0T sS e 0.Y`\pL00PKYPL ʅL0S9< ($ -L,M`p @8PK0l  ( !P * #( 0R K&@00<( ( P-Lß|M| )K 000 000 PK  ἒ 0@B,0K1T0, K\ N"T p  q R 0S q w00\0S  pR qp w00 X0S X00pp $2`K✀ 2K0 0 @T\ ` VN*WT:00V PI1 7!UA@T W00S 00SW@:00Tw㜀0 pW S$*: 0 S* 0C \:@ l0t0/ 00 0R1(K 0b 0 w0  `0S S 0Sl ?R0 Iᜀ P ͍0d0S ;d (} -L⤕M,K @P00SN (XV U| U U 00`(K 0`p0S 0( >$ X( ;0=`P),KP8/0 QP  00P @ P D00  0 0 0Ƅ(Kmp pKP0 0* RD ;0L UX,K-KZm   08/0 QP 00`P\ <`VX0  0P8/0 Q`Pp0 1 0 0 `VR <`V,KP 0,K0P]0Sli,KR0S 0`p\KppBPd%K K K 0S  0C`p0\K 0<`80@ V0 0-K K mKVj*06DL0mK0c` 08/0 QP' 00  P @ P C00 0`S0 00 KP0S : 0C0```张0A0  V0-K`p_mK K `pP00\`C0I00 @0\ C 000  㼃`㷃`ɐ0 xS -L,M < \0P L #` p<`D0 L0 D 00K8p H0 WPPU8B0P 8 p@0 @0 8 T^ X H0<00PT 0P@@V@TU 0ED   R% DQ DRO 80Y5* 0 LR0.  PZ CYR Z PCOoU0P B@S00 Q%  ED Q" P@ @@ T @pZ  R0@<0P0S8  (KSy P0L\  @ R:P\9 S00 8 P@kL0SW ~P 0S  DPL@S%S$ 0 0S00y8 <80 тB80p(K @P rL ^ 0 0S S S S P 0@000SV S 0-@0LP0FGwp 00A00@@@ 0TS @0菏 -L M@P0.S00K -L0K M@#p@K R .S.S Q0B Q-R/S  .R0 .Q AAQ0B Q//0*S0.S S /0S ! C]R.S  .SQ \S  0 "!C]Q//]R0S! C//0 0 /8 0 00/ ( /0/ / , 8  0/0 R @R /AS0S01!// 5-L1EM40 L4p0, 8 ,L@0 0 Q PU 80P P*@.00P0X@U Pp ⴓp\P  0"C!C:QD9B7@?>32;:98-6543210/.-,+ )('&$#"!  X2P0@^p4]Z0`f Xd1`q ` 0S pP@TP P @90 @U:X 89pPp0PSP @TP@ 0U:X !9@0@00`@Q|0K0p@@ KP K<0 0pg 0N4 h,)hggf `f  0-PL M@0 P XK0H  ^P K0K0fP -L M PRP H10D0SD 0q@,,p( $1 000 #).0@S+0a0000S 000000 |000 00`0  (Ko?(00$Kd{tKKKKJJF -L`p`0S @P0S0P @iP0S  i0@ 0@ #Pd,d -LlM`|0 ?oQt 20R#x 0S @c300 0SSP0S00 t ,K|ß 00  P W @00@0 P83 pp 00 $300 VA2 Q/ p Q* P0S@ x l 3/0 10p0PUp@RP00Sap" 00C0T@(K,K 0@ 3P 0S 0 PKtP |L #P 0 SA@@@` B10\T `0QD 0 R? 0Sl!,0Kh <#0@0d &P] <@@h0(Sd @ d 0@h0Sd @ d 0@Tp p1S MP3 0@0C0 ,0K <#0@0d ", K<" d0  dctb XccTa 0b` daa` _ _ _ $` _ G-MrEAE?dDc l\d 0Sr x:Si J JB ` X@dD?gFfFF0c_ceaEf0`d0CpIbI΢JseDn?^E1c0@PHp加Gf0C`0`ZBSB^ `$A\&@0AT ڎnNS^0U@0 @㔌(00@<,0CL0 X  3cΠcS 0S :S 0Ѝ0@0@;S0C  0@0CDC0-EAE0PD/2B#b@0/Q-`  R1 0RP0P 0 / P 0V0 0R 0/0 0S 0 0S0 0S0 0S00C0 -LM0 0K   @0 PU0@0 R7H?2c<#bQ L! BS  Rq0SH/b< 1cR0 10CQ00S[ J SJBS: C:JCAQDP@0E`P!A^ b 10CP00SC\ * *BB0n Ql ! BSZ,0J! BkR%Pv> 0JedaEn~0C\  F LKBaPn$daT!aQm P SmS 0T(K eaEI Pe/d`@ǂb#b8hn2b@ \T`Xoob`&aVZ  Sv>C 0C0 ;Y0刀K@Q`qĠK 0 ̀ UT T0<P,K`p 0@PϠ 0 0b `X 00lKT 00LK 0,K0   ?OTh1DQ00;>P 0-L 0L \ࠓ @0L \.^0T 0^00 0 p-L M0@-S` +S` PK0 P& >00:S V00c0Kp;0 P <0 " :R P 0 00 0-L0@JS MS 00C S  m1 P 0/S& <000 m1  ~  0 wP 0.S0 mP 0.S0 cK0h S-L$M`pH cK X RJAAVcKUT0L0 K RK2;0h0  CR000L0 !0 @K{UGQE[`pcK??G0CS00SJXJe/ǢB#b@TJeϠ"Ll@ cKJ@a V?#K#KR03?d"cBbR3c.CcS'Kn!0P0'n!0Kp={`!0SRP#KR0T1dQ00S 0T (KKm!0P0`!K @0P{KH\`pV0! @0`PEpVU0dEd 0n1b#b@aBbQRnm10PZT@Dm1/K\zoL0 0$KL0 L0 0$KF0ß! BEmd cK?rcGgW3cCcS U?o21`0TPER@ BX [Um1 Un1[UTcKs0{DA$I"IPT"#K/00v>D 0C0L1b1c0AfJ%!EϠ"#K"L00@3l0w?CII0C0/A!b!b S0 B .0iz.0bz`p< 0[z< 0TzL0X 0 =%!Ed"a@`P7a>AdT6  000S PE0  0S0PH  P$ 8!d?OR0@-`0 RT`PpR@80,0 QD2$0d/X/H/ 0-Mp@L@0P0<P U0S VP.1P 0!X$K0`Xq? pVYyX51@`p`pKdK! `.p"&.`p X!0#K:[bhv0 0P 8 F^PRl&"V, h @(@ Q A  b (K 0(K 08 4K.0Pn AX `PpAPUT`^}T 0 Y`pY`pE EE -L M@P`@p50S@0 * K -LŸ@PM H2  0D 0P2 000 0S0 0a}#KLH2 DL T  1[0Pd QhXu \#>K 0C  P0Sbڗ^00P` S,KP\b@,K!@U^N >Kh0CX2  @2 <" <2@"SB @2lpr@2 0S pXb  o0 B0C 0<2S 0PR R /o" @ L H2D_01[ Q K |T20?K P200\ (K|T 0| 0%ȭ ( -LP 0SSBh6p`P0VlV@T0^g4 h6"yoR -LM@P `0d0 | P00pW <W 00G S+pGW 0S0 C+C RQ 0@h0 h R 00l0  S ,0R0R0;R00Sd0>C`0 X?o20S;R,R R0d Sp0 t J:l.0p=W0|  p0| 02\ ^|p0ဠ 0p |0 `0ᄐ t`l2 Fn`p 0b @`V`Ÿ` p`h&^00cp0 |0S `ᄐ倠9` tf b`x&h l&|p&t&u&&&+l VS 0S>S>S@V9d hʅp b@@h& lvpvtvuvxv|vvvv{ `t p(KdKP ` V0 >SS 0S>S>S0@h0 T0K0 P 0,S@0K0 P 0Sd {O b h&, Kt ʅt`E| ~Ol6'p6`t6u666p  f|& x;0#a0 t P@ pVp` p0@`CKx 0d ``.@aaPQ0@tP |@ P@p0%p!E> p0 =` 1@㔠 0 <㘐 1@@ 0 ?` 'X0 l|0%K  i0P  V 剑0 |0%K R0P .V p @@@| t@PAp0p| S<d ` `0@0#d 2ascS0#(KQ0V JD Q@ `KP80hh`@K`0GS000Ś@KX` g>f΂06@P| p0 YX'" -LTM@H@4 +PM T000M 0:S0@/SV u320@P`?@5$ʟP p 420@OI.h0P T  S/R .R0S/SPPP& +P@ P@,(Kz@(K(YP z@PH2 0@h p0 00 L0 ,0d0  0$4 4\0 1\0 0$4 4`0 1`0 0$4! 4 D0 1D0 "0$#4% 4$P0 1P0 &0$'4) 4(H0 1H0 *0$+d44T0 1T0 D01SHPT7PQ1\\0PS` PRppL@,0D0P  5#XP 0x` 1#@@0 0Sw00Q =l `0t` <0 X j p@4 <$ YP W00R 00G1!R@pP0X0000`<0V 0HplW4P^t0` W*@\ S00x0T@ 00Fh ^0T\ ,  ^0^P ^44 ^$0^! S0@p 0$4y@PlH0ST0S d00T V<g0 P T0h&0D0S00K phL0 Pp `T 0#KL0S p@4 <$ XP 0 0 $4ČP0X0#K_@ P0T0P 0B S 0\D0p SX0K`P ? ITH@0PD0T0" \0t"P R q 0T00H F<`u0P R _ 0Q0S @ 0NL Bp0@ L Wh0S!40@ 0R00S 0 S H0S< YF:}00 ]N1JpP `S   Q R0*@;0 "l R 0Hl" R 0S0Cs"  RT$Y`d0B RkH Rk ֜@㸐@  P0H0 \ :@0 `6S00 hvG[ J_< 2D 40 pV<0pOVK tP@40PSD00T `H ..PU0^0NP@0`|Pap⼖^2 R0-P UPhf2TG; r>pPH 040K00  0-@L@0S tK0h h(PP L@ @h@P  \0 0 * <+l* * -@QLPT 0S\)0ʀ0` 000h6l6p6t6u6h; _`P 0:S  &P `V VLpg@_p`lePT`Vڄphv "@@@3r PsP00`Z` #`P H,4 -PbLR M`P p rP@@W sP(KW@02`PUe wP[TR Qa P`!U1  0l0a`00F<h0hvR0 P ` !nUVL^%p1 l00 lvgdhV0 40  0"20\0 1h600 00 0c40 ^Z)Y,00 @(K, `'PP 0 0h000h00\00 0!L04 0 ( <' L( '$' 8''8& &p &&& 0-PPL@ @0 K0hP$ $0  K0hE$%l -LX@`pPP@Pz@,i40 "Pl$ Ў l < 0-L^F< p0hFS0\   SR 0u0 0 -RL F h"0SP| ju00 0-L @@)K0h##  -Lh Kh  0-L(@@hK0h @#  0-LP &@P >PP0@ (*uPF0 Eed#c 0-LP@ 0K0hk 0-L@0 0E?K0h]" 0-L@P 0 0E?K0hL" -L@P`0 Kh=( -LE!P KhX" -L4M@@K0P LK -L4M@0K@ =0P <K -LX@`TP@PvD(h80 0`ph \<Q 0 0P0 0 0-@PLP0 0d 0  K0h d-P0@XaAT 0SZ/=02 @TP/ -@LP`0`0 0S 00\ 0"+X BT0SZP=02 @TP gl L  < lC-` M€@ˌX PERe@TZ pAHPRpWZЀX$u AIPXZЀX SR00P Ѝ@ЀXR u PAIPXZЀR  SR00 Ѝ@ЀX}Ѐpr@XM@B@P@ -P|L@t`jl0`0 0S X00P  0lP@4W g L<T 1 !0-LxMp@PP0(0 G 0S9l 0 S8X`KH!0  ᑒnP,$! `p`K 0H  n00UP@@' k@( 0R!$K0唐 S   (st0@0 0 01sT00 (lTh04H0@D 0-0 P000^ N 8T0 P@P0-@0LS (000S 3/@F $ p?0-LLP@T0P  0 3/P s%@T0t0 -0L`pP$@P UP ps( p?p `@tE -L@Rp`p @T @Dz%@8/PP0 -`0LpP@W #P 0`0P p0"0 \000#Q P R(00 01 0-LMP1`㔁0@ 00 1q0p 40B4< <#>40 P1080 T U0 R7 S0# @T A@@420C4242SV @$T(KS 0R0P3/02 S04"R4 0T 3 # T 3R`0`0@S8 0  3/02 S @ , G -LM PQp `0(0 -@tKe?K|@ 1 x@ 3O`1U/{KTA/OXAPE\A>K!  1 1 0Q Q q Q Q q .!0( 0R$KqT 0 h ( -L$M 00 K} -0 - L(M 0 K} 0--LM0 K0 0-L@`X'd`00C`0S vPX0 X `X$dp SvP UX,P<} X0X 0`00C`0Sp X0X/p Sp RX|  -000-0LM  X K4|  --L, M( 00  X K{  -LP@Wc0S000 `PP`+P.0`VPC0 p00 c @i0P00+JPH V : p.i 0 B  c Gmc G  mp --L M  z K -- LM0 0  K 0-LM` KP*PpP) 0@P& !  P(?R!ʤ0 p@ 0$ , ( 0 0K 0eK@K=p0000@y Tx 0-PL c@TCc0 -LP`@k RT0U :T:0T:KhhR -L KhrT00 -sL@P !R ! 00 0S uP0B`Q0AP R 0 UPPU`P0:`P `4`P 0 o` 00 R-L`  R R ^  0 A A0R00S000LA 0 00l PA000A 0P L LLD u,P0ST0X 1!P!z`,@@p@p`z`%uP0Uj*T0X 1!P  uP0UT*T0X 1!P  uP0SP KTKp T0X 1!Ppp` p`{` `*R0 0B@ Q 0B Q uP0ST0X 1!P 0B Q?` )) 0B Q0I$R uP R&T X1`P{` p`p`R 7 uP0U*T0X 1!PNuP0ST0X 1!PyuwP0U*T0X 1!Pl 3 uhP0ST0X 1!P]  uYP0U}*T0X 1!PNP KTKp(K ? uAP0UP*T0X 1!P6 V  u0P0S"T0X 1!P%u#P0S\T0X 1!P # uP0SP KTKp T0X 1!P uT\0P P KTKpq x uP0SP KTKp T0X 1!PuP0SP KTKp{P KTKpP KTKp^zP KTKypsP KTKrpnlP KTKkp:eP KTKdp^P KTK]pWP KTKVppPP KTKOpIyP  RT  X` 1  Xh0 :h0p3$R` J usP0SP KTK&p! T0X 1!PbP0U*T0X 1!PW@A0S\0P B(Kpa@@@A``u5P0ST0X 1!P*O u&P0SP KTKp T0X 1!P`0P00TP KTKpuP0U*T0X 1!P X h0 h0p`P KTKpP KTKpP KTKpy@ H uP0SP KTKp T0X 1!PuP0SP KTKrpm T0X 1!PP KTKdpu^ 0B QI@ $$ 0B Q0@D$R uP R'T X1PuP0U:P KTK<p7 T0X 1!PxtvP RT X`1y Xh0 h0p Xh0 h0p$R@ 0-@LZ0000 -LMϟM   0& 007 ~000  1S0106K4&0  R 0 S /K0 p ' , ,L' & 6 &  7 & 6 6 嘆 & 6 6 6 吖 F0S %SF PU %U60T &` J& 0R& p06 S p6 Uf P0 `&  @ 6 6K5K` 0BZS&F9%3>.4GBCX\XkzF[P 00 SIv0sE `GK @Y>Kd 0Cd 5 ^^KO PE&5.@ETaXa\aje `,p0 DCK&L u `Pf ZP`f 0@&0@00!iKP  p:60T$6S4 06 6S 60@0S 06 =K0CPP 70 0R (KtʟPf <` P   Q k>K 0C^H k>K@ 0C    RUK0f &R &K S06  k>K 0C006@@S@T R  RSnK@`F06 6 T6 6  6[ F & S& & %[R& & & P & R& 4 P@U1U 8p0` ' @PEU R & QPEU '@`pD8^P0 0L6[pS 6jK @0S6  00pQ? p 5[S 60 0KS6 KkK 0C A r0 -06K6S6 6 06 f <0 C   QM &   6[ S 06K V006K6[ SR&  0S  00B QPP%0@ Q$P Q06    6S0c6 +0 6K6Pf S0Bs06 06   6Pf r S& l06 pe (   P l 0 @ L ( h 6f @fJ V &6 0 1& , KF p5b& f 0&K@& & & &   N f 6  S& &606 ? 6PS, f 6 & x 06 k>K 0C%K@@> :@! !06 6f f@C^KPE _V 6606 Y>K 0C6 64p ?F 6 f aRf P: $P06 X05K6&S06 6@ⴆS1600 & i.K BB 0Bj.K`P &6B X  s& 05K6S f t 0*R6 0B` Q0 #0B Q6 ꀠ @ @@ 6f  #6S6&`0a6 VІ   FTI mWPQ HX? 6 $f 06 6f 6S @6S6&06 Z 6SAFT!pC^KPE _nK ^`Fv @І vP @0  u0@svІPPV + C>K0C  ^&iKA  0wp &0І 0`hPf Rf P YnK0ἆ @UK `F &K& & & & 60㩆K6 Y.K B& dk.K BAQN 0 @ L`L0R00&S dLFHF H000F ` dXڻiK\P& p6S6S6&6@J T@T ڌ6`0@S 6 pQ p 6T0CS@+S&K 0C @6 0<  & #66 P `  Q| iK2Pn& 0'P   _.K B pxiKPY& 0iKPO UQ >Q jiKP9& piKP/& 0 R`@&  bQi 0^iKP& piKP  p$iK6 P 6Q. p6[iK ' P p 'iK ' P p '&00 ?R 0& 00pQa p 6S6 '6  0 S6 pQ p FTX6&06 60 7 S    60NS `U6[n`@ 㼆 & F F F iK6 YP6 iKOP pV Q] A^  k>K 0C @P Q 6 &  At@r@4 Q 6 & At@sH@ D S&6A@06 t@BiK6 PI6 p0S&6E%K- C0cB+ S S%KMBNK @DDWeL ^>a00LL D00Qps@*0_.K B C 0\@D0D00C7 Q6[@f/F F & F k]@/F & F F f_Q& 6 6 A&  @06 6S0 6KkK L!Q& 6 6 @0A6 &  iK ' P6[ p 'x06 /& &f@& & & iKuP& 0Y>K, 0C6 d6[`P 6 k>K 0C6` 00d`H G Q  & kK@ AP@ i { Q  &  kK@ A_@s     S& 01 nS01 & c  S &uS &kK A? q : * Q kK A ? _@  . Q@A Y>K 0C6 d`k>K 0C 2>!B 0 f6Fd HkxhІ ``Udh`06K\!Lh`WiKP p괆6 6 &00 ER_.K B0K0006 JkK0 A P Q< P`6[6 k>K 0C@T0Y>K 0C& d6 6弦 v pЦЖ  0:\W`H0  H 0S T  S00S\0 #\@P06弦d6vHЖF6 ^ kK A @Q !& ` @x05Kp06 k>K 0C&RS 60C6 ( t&@dU㰦PPp @DT0S 6 Q p > Q  & S&6A@06 t@% 9 Q& 6 6 &  @0A6 8 D Q& 6 6 &  @0A6 )Qe  &  QA@ t@Q0 kK A &7_.K B @& <6 6 0 d` 0QY>K 0C6 c0 0 9%K P@P6&0CS?6 ʓiKP 606 z, KKLp"6 p 6Q2& &  .3P@0 0 0pFiK ^P& p?bІ `@iKOP piKGP p  & qf @& & iK3Po p:kK& L  &  akK& L  & T6kK A00 & w6`H0HZiKP9 pwiKP1 p|iKP) p@  kK A GQ pFUQ  kK A 866 4Q TQ Qu^ & @skK A0 * , 0t  Lл C>K0C  W iKA0_p@&0@00N^06 00m6 6 Y>KF 0C 6 d6 &  0@S6 P&  & k.K B@@ ^06 006 & 0@S6 P&  & k.K B@@ $@S S& 01 _.K B0^iK0PlF p &  & k.K B@_@ _ &  & k.K B@_@ R|^06 00[ P0B Q4`&0@ Q$P$ QL `  s&0@00,  S& 01 0&R#  `V Z$EQ 16 ` P` , K=K0Cp6"p8 Q60 6 & , KKLp"6 p% 6 V `+`6 06  #  -L`D@pPP4@0  @P0 -L@P`pP0 PP -LkWMP0 JPz 00 @ (Ko{0 kG{&{ 8<@Y:0 SA.@0c< <  0cA0"33ѐ:0X0 g{{ H$K6@ ?aCoc?`(?yPD?+ <^(|0 )PP 0T0 |0ppp Dp l 0@Y / RT R X RCN4@@6@d0|0 L0@0PX0 |0 LQ S  R Q  @D0CAL dQ T R9 Xd0 0PX0  t P `d0d0 `P `d0QDT Q h `R`L @0 L TS\0S-ZT0S@ L0S`0SX0L0 B E<0 L@d 0l 0|P h0 XP` R pe00T0 P8 D0 PSPR\  @L eLQP @0hS\ QHWPUR,d0PST00@3  `P  X0Z X 0PX0  P @P0 t _P(K@0S0@0 0@0 l3Z  0/1[@{;{'kkKE{{:N{7N@{0CB:N:0q0D Sp0S @0S S {7{E{{:x  P T  l Z |0 PP D0S@0  S00p0 S|0p  T Z@@T {Y{ H )!k, ,"[ {KQ "  {k&[\ R m{[ J Zkh{{{ 8 K Bq { AT@ T@kKF{50q~ R[kCk6kG+G[2[JRp  =KG[2[JTg ['k&{;C{5{0qZ T W>lp zL  BL id ` 0@0 Xp@P    !R0PL0 P(K $@?@?x( k{{{ 8 K B{ AG{5{Fk{Z@00  R P 0 0@(KKKT L@X S D i{B"[['I E{k{' \G[9d0P DT Q h `  d0 !\d0 `d0 \d0`P#UP<0QdQQTplL |P p0S @0S SS RTplL |P>p@L0S% XPS d|0 |0`PPKZm[{[%{[gL @100wL0S LrpT0]XAP I`P& T0Sl0SD00C0Z l@`P  0pp0DS0S \@0S S ` PX0 TX L0 @@(S  S@9R0D  |l p:D00C0xZ  X0SX0@L0 @{K$>k[4[TEJDK6K@0T D0S  T Se S@9Q0D k[6Xn0PX0 B< RKQ R !**R@0 `` Q R ;@k'{[E{6@{0q DDPT0 T0PPi D pl R  p  T  = T Zg l RڎKI [%k{kk 8K L0  0T P; X >r X0L0 =PX0L0 P`P! 1P9W: `01p T T@0R0D X0X L0 100 m X 0PX0 l0SD00C03 l T X0X L0 @0TpSlL |P} 9Wpz9 @ D 0TpXl|PX0 0Tpl9WL |P Se< R0 R ?$@@l<`OS Q/!Q0S P/\Q0S////P 0-L@00@ RP@0 0-L@PP00S0 0 R U00 @! -L$M0@4 Sp@DP180 0<0 0T0P00 4 `pD L @P H@ 0@0`P pC R0 R 0Z `*D80@PH@0LS< 0BX *0S 0B RX @D0C:@4 2P&00 000 0``Vp`VpZ` 0*!1R CX * R 0C RX @D0C:@0(K P-LM NK.000 V K0 L!! ,  T P L 01 00 {X 0 1 R?K D H @ < 8 4 2H4 (0 -L뼜 -LĜ -LQ -LP @T0 S`P  {O00@Q  R @ -L`lR@6PP  ^O-M ЍpFF|~pq1hpqpq1`p -ML KP 0-0LM ?20@P ?$K@PBK0 0K0V 0 0 00/h X -LM 0KK #   ?p` K -- LM0 0 AW K  00-L@Q r P 00 S!P000 PP    !N @0 -LMP4K 0Kp4`0 A4 Q 0 @05V% 0S{ Sl 4P8 J Y80y0 Q# RL 0 0 V "0 ?0SPP (K0S Qu00 Q A0 V!PPIUSQq    P 80 U  0U80gS0P 0P   0P0 0 Q=0S ِ cY4Q 40P80 7 8080 '80 i80 @ 80 P0  S 080 0800 a 00@ 2 JS 0 80M`0@ 0Q/ R  B / 00-PL@RS0B@Q  QP   `2 0@@Q  P -L-pM0 l>0 0 @P 0xp t K -Q, y0 S0p `K(K00 PxP Q 0Q 00A S0 `@ "T0`Bڜ!T00Ax @0 A R \   EPC  xp x  +R -R    x  0B Pxp -0Rxx 0R 1BP!x0B x  0B X x 0B0@ XLP\Ӵ\`x0 R00 Zc  R@   R /o" jTg{ @Z pp Z{ *:0 fk01[kk 05SZӨ0S 0Sڨ %0jS0*0jdK{A 1 [ K0k {' {'{ P<pK0|0Q0P0 ?0XS$ xS" PxP 0Q Q' 10#0S5 t 0xp 0 Qx000S000 R  t 0  xK000t0KP 9 t Q \\QTx  0B \\ x R    P RQQMZ Ӓ# x  pKpJpW_  8{01k{'{ pu |K Pt g | p0BXppp  pp p| pp 00A S0Q0 pGW'0 Sp  00St 000P00 0S 00P00 5S"0t 0JXP ` PԐV!00 ʜ0 @0S@T pP  Pt 0@ 0  p00C| p0 Pt n 9 `@['Q05 pHC0kh0/@ BLS:h {0\{'{ h QRzG%pG&ph _   X5@{00k {'R{ G O0Rx  0R 1BPp㨠  I B%RL1,0  lK 00K00@Pu00 0 쫟@00 ˟R0bԐ 滟00 ?0 ۟ `PPW    !Jt0PL t0   !J|`pp0F0 pP< W00``C0 ppG0 BS B0ppW  V RpGH`FSGQʑ0SX!V  P  pP 0S0S   0P@@S@T 0S@#X X, J i!00 0 0 0| 0#pR00S00 KKH F `P Q  H `0tS  !8 t Pt 0S  B\]0 S0| 0  B| T| p00 Q C/o" R (K{9Hk{gZțkʜ0S rp nl*0xp St 0p?@?AV瞯ʜ0SJ | 0 | 0R00 'tM Pt p 0 Bp 0C0 t00 8@/0 S00 t P0S0P 0CSSM 0 00CPP Pt Ԑ0 @B|0 p@ MPt 0S p0  0ljhfd p0R" 00S S S tV0 t  00 "!Q053*R00 0c1300t Su X0 00 000 Λ@ UI^aZ0S{狸/zKH9W S*0S ڼ0 00 0 b :狸@H{H:ɋڀ0 P P0Ԑ0 ?( pg  0[01k{{ p ' \ T0 pHC  0kh ?C0C@R*h { P0{'{  h0\SzG5pG6ph0 s   0@{00k {'R{ G c`@tFPt p |  Bp a00 t0   O "00000X  b p  l00 00 2  10 00   R0t00 0p 0  p a i 0@ J@ 0 t|0p|p t ,spK0#dK[0  A K k  {{ %PZ !   Qʛl 3Rp 0  \h0dK6 0(M ` 25R{dK   0 kK {'{ P" ]0t S|0 ;s0|0 00˛ 0QF00A00! p (K|0 0B0 Sj tgڜnt p00C p0 _P PԐW0S pK5 `gXP ` PԐe 0S |t 0S*0|P| 00 0 0#R00St 0" X^V.  0 RPQ00 00S%0S !SP PԐ!000 0c?(}P Pt 0Ԑ0 00 P00 p  0t 00 V!00  0` St Y0! S0S000 P PԐ B Pt M 0|@@d@P|00|0 !00 -L00z  -L0RppPP@PI  Q 0`s #8v &8 `"80 U#0 C Q\*PPE P r0"(0A#80A^#Z 0X 1  PP    !rF@@ 3-LM8 0@00S 0 @ 2 140 040 8040A  AR 0AP0Q p`0 P@ R PU0 V.\ # 3Q R3 \0@PVK(K`Q  0 \LpL  0`  P b0 P0P a <  aX<PW< XR P0) @V/o" RH 8 00\0#03Q0S a 0 @a0! W \' 0 X *  X*40 R 08SY00(K XR^ P0[Y=0(K4@0 S 0c1# )P Qh  Qc )Q0 8 0\0 T -LM`< 00 4 8(0P00Sp 0000P 00P R^ P@\ @\P  0X@0X P0z^ R  B!8 P^ p^ Z@v 0D0CSڣ0S#`Pg 0 @ S  00QY{*@ pD` 0 `TD R @N S00T @ TD`@0 BB! B40PDPp$408 0S48 0S@CU 0S Sy Si =LP@"00(K0 @\PR ~@(K PP pP 8 @@ 8 +QB -Q > AP rS 0I0ZP] 40X 01S  S  SW 40@PB``0 0s00T` 0  TV<  Pe 0@SU40P00 S S0S L0`000 b@400`< 0K"00qG PeP408 0 8 SuK@"00(K8 A LP @0  0>!L^A@08Xa8 r@W 40 0Sl Sm S @008 `<0 (K@@HpP D@p 212 Qp80080 }P  \ PZ P@Q Q@E`PLWDpX p@2 PE1@8pC40080 80p0C80 0@0  @00c00S pT`0:  RLPD!@0S+0SM 0SI 8 9p @00pjUUEP @ 0000S0S Pi ph4   BR"@I P15!@"@A T P / -`L9.(C@PϠpl\ \ P U0p00 0V@`F`V 0 BPp PU  0 B0EP V@ 0-LM@KPK  0 B0CK2S K { BK( ZBBK k K0-0AC^ 0S RA0@- S *@@Q@0A0C00\00\0  S  13S / 01R *0CPR/!3QR:// 00 x 00s0QX0a00s0Q40A00s0Q/ T-h/h 2A-R`P !! 1R a31 p@800R31 B B  `S000 CB!S 0000 R 0R    0B! 0-L M !S*0S @0SR @K@K0 @K@ 1-Lq`p0S3 V00AT  R+00 0PV@T `PR x0lPV0!@ 0D1S  $00d yW0S 802 (0R0y D rdl\`qq 0-顂`PL`@Tڃ0T pP X 0 0X0 i  @ ^ @D@: )  S2!:R @@D@(-0P!0^$3 1\ : -L M@P p@DTJ 0 \I*32P ?:P6 0 @00 `p 0  R0 R0X `p Z4 0S Z ` p0J40C00RN00 >0CR 00 000 (K@0@PpeP 0! -`@LApDP1 P 0`0 V `5C5>#11 +CV @*P  D0V?C `P1> 51Ό1 +CP5 6+CC0 -LMPkWP WJW0T,` 6V(0 (K(0T0 1CN@@D@` $K,KwP `(0,"K"30 (0  S0T CND50`@D@ @0$K0S0/0 R / ?-P000SC 0,$0 3/0:s00P    0@000000P @ P 00< Q 8000}f0PxH5P00s0I6 D0  @00 / -LA \S :S6@@ 0 Khc6@@ 0 Kh D006@@ 0 Kh000 0 0000/0 -L M\S`p@ C$_o᥂P/$    (!P) SS(!Qz0 ᲀX (QQ  0 0P  K R5$ !0$1$(X$X$ $!(1s(Q0 0(QSV 00Q (1 (  RQ:0 e P(Qu0Q ^  uP㲀R"0R CP `H`(Q0 pp!pP(q$(Q $!rCPP,Q 0S00 r -L,M @TL D /H0  1@`3/,0(P  Q0P P@ @pP\0K < p@B ^A p WP`VV 0 P) 0p PR/ WDJPD@p(K 0 anpPw < 0 nP9 00  P@P00(K0 8  8PD@T T< T- ` P\Hp Y A@P$K Fj@PP(KD0JPH0  nP   (gP$K #jP   gP(A`DV !RT(q $A (!@$Aջ@t 0-L@  S0 K0hB,0B00,1 0-LS@0 K0hB00,10R 0-L@1  0K0hB,0B ,!P 0-L 0At 0@B -LKM41@SA @e  Qa@5/p`P0qKp 0/K.K -K,K+qK*aKp `)QKQ(K'1K&K%K$qK#K"aK@ @Q P P$0pP`!K KK1K0qKQKpPKKaK`KKKK1KqKQKKD `KKpKKPK`K VaFL 0. \ \ \ \ \ \"           V       0V  @PP@PQ 0-LP @41S0 P0P0100u@ 0 -|yQLOMP`p0 wh@P) U01  WK V@0Sv 0 pJ@`P%E@`(K Pc  0p '0 VJ XG A/ᇪ Y0YxYp 0` PPQ|QPRRR$S  Qp\| S S4Z \\Z0ZpH P<$PxPQQ(0Q8# ,0pZ|Z!0P<"P'Z$pQ|%Q&\+P(0\8)10L04/Q,p^|-^3\0^2*.74pP5Px6P;Q@Q8Q?D=9pP|:PQCP@pBABBQ(J J Qtp^ ^C^CCC\0^|^p^AA AR\tp@XXXtNNpNḀRXNQQx CQ C pC C岀XBBZZCZtCpCCR^BBYZZCZCCCpRWpBB`y' `AXZa50@ZULPQ$  q7/@PI(0P 0 p D N⇑I:~q!V QVU0$QP4QP$QYPP cßp#3 @Cਓ 0p !(K|ß O`Z>>P{>ĀD0S   8P  8 40pp ql>@ h>V Pj 0R4 S 1\ Y  YY^@4p;P31 D H $0 :dPI!I20N,0< 0(jq Q|P1X8 ( 4  Dp q>@ >KPDP C@Q ;>8>@`P2>P+>0Ҥ̠ P  8P4p[>`3>p>p꠹ > Lh -@L M(`10p1fPS(p Rء P. (01`a ,Y !DD X051,5(Koeꂑ #P  0 2" Is=0ء(K 0-@ 1L3/"R000 0-L@Q ,00 210= 0 -LfSM `, p@ =@00(KX p ئ@7(K$S !@ 20 271!0@D<00RKp 20 2*P\!0X )0X)&<00#<0S<`K 0)P  )`P pWp0! 0!; v* r*90SԀ*CKKHA0 H4 D4 @4 <4 a<p@ âp  ~p U p  G( 0R Khs*0P6 P4e@6P6@?00 (, -LşPTM @ 00p`0 0Q00  =%00 20ZX :X 600`0 0 0RP(Kwo0 0S0d0 X 1S $P䡄 {0!0 00@0Ps:1Sh `V``Vh0h0  P`ʼ`h0oXT `iP1! C ^:B|Z *0 N0 C!1 C !y沑 ഑ 0d 0(0 0S 1S R10C00C S  $ X 20 2g0S0B00CQ !$T K70Ph0 Xh0T` P 2  0 p l$;(  R3wo Pd0 ?Q0XKd0  pt 0 D 0d SX0@K d  HpKH @0 < $ p] 0 L 0d SX08K d  PPKP 80 4 d0  P #`P9 0㸡h0  0Rb1 S0"1!]h 0 h RZ^{/0W #0h0  P\z {?尠!<b500DP ( -LMp(`P 0@SO pഁ0gl!  H v1AQy0x10 pp R N1W0!BqqQ Aq  R~ 6 S! B!(0 0S (K0 R1S0C1 0RX 2( 04@ cK 0  4K P (00(0 %p0  p WP V'10C0S4K 04@ 3KP(00(040#[0!0dVQF10C00CV Y4@ 尃K4K0H 4@ 3KP*(00(0Q v"P 4 Kp4 sKP5(00(0  "p000 4K4@ 尃KWP 1 C  BV* K"P 14 K0C4 00C3KP(00(0  " " 0-@LPQQ0 "0P  "0 "0P  "0 -L MP,0 10C0S-0S PmPja V0FS S1P !@P] `V0ഠ p0 7p0  c"00(Kp刀1 pp JL1FVw0~1 p0S001 W 0`L0s0S 0Cs000 \~6SL )"00 R 0]P0000(K0(K000 "00(K1  1 -LM@`Q !00 2(Y4 Y+(P( P 0) O!`P 10C0S 1 ! B R0P 80 !80S  "0 "(KF30 (K0K f PP 0 pR  ”1 0C0A\*P 0 P  080 !80(K10C0Loᩒ i P 0p% \\ L10C0SPSP 0 Y!Y8 Q!80/o"| H!~00K p80 =!  P `0 RT ,< Zq )!뼁Y9  H!R5 p1X0C00C^ S!뼁p X0H S1 v `PpW0 :1P`1``  [ `P  O `P 0R A `PrYo0)80 80M2 0 1~P P!< 8 c P,`N 0R Z  q WB 0G1S> 0WS , q W0G S1  `P#QX1PE PpPEuPP! P 1`pn `P!0CXsP0P1 Y  `P 0-ML K0P K -L<ß`8KM Mp `P$ P @ O 0 1@0040 0R(K G@T R B @ W/J P 100QB Q1?0040SXS  ܔ(2GT P0p@ UXRP>  HZ4@ pT CB>KCK 0C 4 ;l0 W *0/S0HK 0C/RG WhQ0P܄ l=K 0C`4 d dV" -ᣛp#:10S X 4 `C0 S00R0J Xx P"100o4S ՜p @eԜP 1@@DOoBZK0 A0ẜ/00PPP4: S 0@00G (\R -L Q0P:Q:0Q: Khg)r, 0-L @@j ! K0hZ  0-LP@ 8-@ ! E K0hm6| G-`Mtu {F `2@nPbG C0 ,4 0e@pF8  DH`L@PP \$(``40@<0TX 8 @   PP$@( `` p , lȠ!p pp``appp "pppb(pp p0#pP%pc:@$peZ ,. pdJ l̠ pppn!` `p pap "pb,  p@$pLp.0# pP%<` \ ! " ,app pb( lȠppp` p pppP% 0#@$c:eZ.`!dJ "anppp ,b,pp p l̠ ppp` p pp0#pP%p<@$ p\. pLpW pfp,$@e@pF<P(0n0 C `2=b9G 0@0P 0t0 FD0$( 0H ,L0 0`P `0`P$P@4P`(@08@X T@084 \,00  <0 `Ѝ -LXM x0KhPK@p `t` x` ( p` l`  00 HK  '@  ( 0R$K=v ( T1-LLHM @0`KpKPK 0 0 Ȁ   2  0KXp*  R'" Y  ! h   0 0 00  0R(K(8u  p-LAM@A0S tQP @P RF KpxA0S4!44 PBP<0A0a` 9+`  0 0  = p@  mp ὭTh @9 RHKpP㨭n p  L -L M K@( 0T KK D2 @" Q0-LM0p0 000 j @ 0T] 00 0Rs(KY`K @ 0TI @HPK@00I0 W0 0): pGZ?00 '3 p C #S 0A@ s@ @x000 S000 X@p0SZ2  0 0 p0K 0 Y  &0ꔬ꒬p0K 0 E   R    q&@ rp0K0 q (0  -LM@`* pK`P D P:000 U *KT  0-L @^ 0T0K0hA| -L`P @K 0TKh.0 -L,M0AL !0P BH sD Q < 尠 00CT @0 P0p` 0 Z 000CS}0 4 !0@@@Zs@ V `@ 80 v`p80@D PuPR4 0QR 0  0 < pVwp:0T0s0L!0P 1(0  0RP 1 S0"s0&1!V0CL0 P0P 1 0 WXCWC p  %WV,(W(( 币&! Bx X 40 4KⰃKpl4 4KⰃKh4 尃K4KcW> p  W  `0PE  40 ( 4Kp尃KJHx,40 尃K WRYq YG  X ;0P 40P H⨀Hx,p40 尃K관X! Bx X#弁 XH  Y 0P00ⴀ p1 0P p 40 4KⰃK  Br n각 H㨀Hxf !0崀 pi 0P -@L`PP 0 00(0`0Q0(0 ,0-Lp@$M@ D H0 1 PD A@D@T8 8 < ` p@r` @T!  P @DuPP @ Pp8 0$001P @ p8 0V PFuP 0!0P< <(KD 0<0(K 2  V 10C0SQ\D 0<0`(K 2 < `Q` 7P4 ` 14@K@0C 00C3K PP aH 0RD 0% 0F1S  aH P0FR S1  P @VT 1@DUt@ @!n  P4 4 K@8 PSKZ @PH p80QH 0RD 0E 0E1SA  P, 0UNNS WPQH @0ERM S1P@T0 :1 `P`4 0P `J 4'E 4`!6 " @ 1` wP APU1@D @`@Dt@@!s0!0s008000/ 0-@PL L  0( @ 0% 0"0h 2 G- MP(`0 $ \0p  0?2D @00 0p@ `P Šg, ,!>  &e  R e   !  @ 0)1$N0 0 0 0``p P 0p0 @10䥠0 N1   d*c ! * 1@^ 98# !#0 00# %0 0  0* l 0l   0@  P  `0 @p P `0@p Ѝ -@PLP` ($qW8 C$0(00 0` d00 EA03?R0h +$ 08R(@R )@ b$8 $)8 b$ -P L@`P @p`(W1 `F"(@* ?V@pF(?p@pp@ 0@ 0T " T?`V( "a?V@pF?p@pp"@@ TR -L  T 0-@PL P Ό 0( @ 0# 0"0R -L z} - -`PL \0@0]@P\  0 Pl# 0$$ -LM@P EKAKH 2LKB0<0 FK!C .K40KLK1 C"< OK`p܅K &KfK`p,K%KK,K1K&79&)D0 '7'9L ' ˠ@0 <0@ 'H EK$DK(Π $<0 $K@$ " ϠP% (! )Π%K 0 K! @P P)&K̠ K0EK P# @" K,K! 0CK %K 0MKK K,K !EK@P.K0#AK " C?KK  "0#@P/K 0AK@PK@P<0\,K.K,K/KsK40$0K=DKkK K0 Ji<eK1K lKfK KKlKkKKKfKcKCKkK -Kp 00N!QA 0 i᠃f|` `Qol` d^lt` iP fx` `dKcKQ$CL@ @Oh@ "D^ L@p &P  & ႌMhKᢓ L@ #3@H0 'K "`0#pmKcKGK' '  K KD@ D@!dK !ԉK`&p'(K$N " 0#ԍK ܉K)@0(2KK0 #K @0P@fKDKOK "0#K q!^@P p PpDKP`20 '10 3K0 %KLdK !$KSP  JK0jKK@$P%lK ` p܅K 0eK kK()`&p'@PmK`pLK@PdKP^`*dK `p!܅KdKKaK" 0`CpԆKEKKDKKa`@pPbKKEK#K K"EK@ PC(K -@P`LQU  0pRPQp bx!p s!0P0 0H @ 0 0KhR Q b[!p T! -@@LPP `PY7 d!0 0 #0#0 $P H P0XHcp【 $P QP$ UXP dሁ 0 #0#0$XHPc【p  P $ QP$ UR -L  -@PL M PA78p,`K@R0UK   K -`PL \0@0[@P\  0 P 0$$R -L =( -@PL M PA(p,`K@ 0UK t  K0-1 @000/ ,P0-L`M0d0 ` _ P 3 P] fP +P aPD PW 0D @0 2CP >8P 2P" 5P U3Pq 4PA  0 ` KDK Pt K0!P BP P PG P# 0D @0 d0K DK \ K p \ R K0[P2ZPvHPwWP  IP VPi  @ > 0 0P P P P 0D @0 &P )P| 'P (P 0D @0 3P Q7P: 7P 7P4  0 ` KDK P` d0K DK \ K$ p \ K0>P=P:P1  u;P <P  0 ` KDKPc`wAP_. @]GP ZEP,W 4 P^P KXP YP!F y C 0$K<0  R0` $KM 0$KI B0$KE 0$KA  0 ` KDKP .P 0P+K P P P0D0 @0  ?P P P8 0D @0 sP xPd  P* 0D @0 e#P x$P %P ,0D @0 XP P 0D @0 P! P  &0D @0 D*P +P D0D @0 P3 P 0D @0 06P 7P  0 ` KDK.P  yPd0K\ KDKd D @ 7p EK ? 3P 0D @0 PD 0@0  DK㷊PuD t )0D @0  *0$K +0D @0 yx  0 ` KDKP U 0$K 0D @0  0D @0  0$KDK~P ; 0D @0 K 0D @0 E 0$KA F0D @0 ; G0$K7 0D @0 1\  0 ` KDKP  <0$K 0D @0 y  0 ` KDK{P  (0$K  0 ` KDKiP  0$KU 0D @0  C0D @0  E0$K@0 0D0 A(1 R0K \ KP#DK@ PDK]00p \   %0D @0  0 ` KDK&P  0$Kx  0 ` KDKP 0@ D0 8h8@( -PL`p|UO A@0S 7@PA VPF l 0S2 +P0 W`= @ 0S: P8 pU ! 0S@010@V 0 0 W 0 0 8 TT x, V@W T T d@00XX ] t \ X 0-L0@T 03/@TMaoPP H00@T 03/@T\09H00@T 03/@T$ś0 D H -L\@M@P K0K #K  LpK -L MR Pp a@  = 0 S 2 M SV: m 0 0S6 0 0 S 2 / 0Q70 T 0 0(K 0  00 P 0 0(K  P00 (K @0 @ @(K 0 0P  00P   0-LM0P @ RP Q    R0 0 Q   R 0 0 1K3/K0s/r?  K@P10  0@-P@0U 1!^  QN \SD0L00@-P@0U 1!^ P\0PU000 -L@`pP@0S:ؑI Y P1P! p  @T  `P?pP p@ -LM؁p00K< H@0 PD 0<0p^ PU @< @P U00 `1`!  080 >W 80D PUp0<0 8 (K(K0 -LP@ 0P a`F  0P pV @D: P/0@ 0A0S*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0@/ -P8LP@4 ``#P *T 00S84 #`@T:%0802 -@R"0LMpP`000 Y 00S80S 00 0R(K40S`  yP8 01\ 40K`K8 0K `Ġ0 2 R? P8&YF j jJ1 f0` 'à40  4`V 80  P@R88P`0X 00S P02,"SRn,BT wK'02,"SRh,BT 42S00SXb/8`u" 8 8` Q`0R2 04P08pKS4800\S4800 bP \`0b @ GTY`0㓤$)`@ T T 00S`<2P`N ` 8@P@@ wK @   w  @ 02,"SR ,BT 42S@  (д \ H -Ld@MP@p`@` x 0  OPl(Kܪ -LHßMD `@PV`0 JSQ@ r5 rE 000V``V20d0``0V `R`0" p0 n0X@ Z ! 1@T X Z:00 0R(KV 0 4S`RU @z0@@G0V 04S:0`SqK0 p ~.A Q @PPK K0 P T  V@7`p W4 P V  RX( QP 0P0 @0S S0` p0`~S _W` `pG`0``Y~``Y`LKQ`Y`V@q -@ 0 p8 (    @-0A 0 2@0 2@a 0-P@LQ 0P !  2!0 20K0hp@-@P` VP p0-P@  P 0S RP0/OP *0?c0 3??oPP0/0/1 p-0LM @R0 0 0 ^0  0Q0Kph6 KPUP*`KPP `K1Ev0"@^ R KQQ*KQQ  R 0RKp RD x0@@0 <0 80 40 00 T0 013"000 , KDK P,KE00  @ >R0-L4M@D @0 <0 0 80 40 2K 1,", , KDKP,K00 0-L@zK0hzH-M  0ЍR q 0\/S/0 00-L0@0S- 0 ,   0 P @P 0 0$0 s0 00R 0   00  0c00X080  -LM@P`ppP pKzP04 :CRo  S L   H0(0P   ; 0K; 0K x "-LRtM0P@` 0 0C 00 !0 0R(Kx K|K0pZ | ṿP0 D倀@"x0 \  ppAP぀0000SpK!@ ͜ Pf F0B/SKDIHGFE9CBA@?>=<:9876543210/.-,+$)('&%#"!  00 000000p0{0 0 x 倐 00 t0K0Et0SP| p,OP겶( $t p-L M@0PQ00TaV( K 0T1S Ou0T1S 0`0U0TX1\1\1S -Kp0%Kp0U\1X!0 \1X! 0-@0LPU0 \A\Q X10CX1S K0hT1O10K0h`Ό00 000S/| d0 0-L0P@T0ڋ00TA埌0`T TAT@ ΋X1@0X1ꎌ0T0`X1L d0 000S/ d0 000S/Qx d0 000S/P dL0 H 0-L4M@DK00  0RKܵ$ ( ,Dx -L M@PQ4PKT0@K 00@p`  QQW V0&`"(K V0 R0 Q `(K`(KQQV(K R0`"(K <0-L4M @0`0@`K@ 0-L@PP P _@0@0 -Lp@P`P P HP  JP@3*N @"00I @00@B @00Q:// BQ://41 -0(L000 A!@00QP `PP[0P  Q  p!@P   0R` ?־@V`@0@S ;000 !B B!$Kk  $$ 0-@PLP 8P0U0 =S00=S0@ 0-L0@@@PP0K0hwP 0-LP@P (0 P0B0080 0-0L@P0 P3#0踊1 -L0 M4 0p00 @T_ `P ]P0=SG @PT40SJ @A@P P)Y - R@`@@@R*Ya2 1  奼`P, 00  D ! 00 0``@(K00 YpQ1S (KR@`@_`PP $L 0-L@,  p 0@00000 $ -Lp`HPP@P  bP$0@00 $0 0-L⤉@P0 0@0{ 0 0-L╉@P0 0@0z 0 0-L↉@P0 0@0z -@Lpp uP%`e0:0 p-L M0`@P  pp 0t0 QP 0p:p0 Kpht| 0S0P"1#Q 5Q /  T% @ @1S 1  S( P  P    K0P s100K0hi0000 0/ -L pU` QU @ @E6/P@ -LT`ppAT P PD6/PW PPGP -LT`ppAT P PD6/PW PPGP -L `U@p)1S @P@E 7/P/@P@@@@UE !0Q00000 @@P @@@@@PPpT!R 00 0U000 0@00 P1 S Do@ 000@@1@ 010Q- "!RP 0 \0 R 0P 1SB0S  0!B0C -LP`@T0PTP  Th U00Kh{\ = Rc   T  0 0H ^ P_QQ0QQ00000#00#0000p0P1T\R /oT"!0#00#00!0 0aT 00Q T  P0 !RPPPPPPPs RC/A 0\R#R! R/R00 B-~x` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA\1 X!0-L,M`P@0U00  pXY U< 0SUD0 0R7(K0 0R1(KoL PKo P1, K0PX$S  $ CY ,0K 1$ S0 P, K!0$ R00S v (i(i -p BLW"R$M4 4 P@P-T`e +TP@00T W X ?$K$K$KK 00P #KTHUT QP?CK`$K0 #@R0_CK00@00 0Dq PaDQWDADQ57DW2v X$KCKR!UT QPCK`$K0 #@0_CKP@`" 1#K`" 1#KZ0P#K VE4 4(KZ00( 40 00(K p 0$KXt $K*$K%Kir00XS00 C R @ 0P$Kp 0(K A BRWH 0p$K ?? K 0 0 0| 0 000/\ 0</0 000/ 0</0 000 / 0< /0 000/ 0</0 000/L 0</0 000/ 0</0 000/ 0</0 000 / 0< /0 000 /< 0< /0 000@/ 0<@/0 000/ 0</0 000 /p 0< /0 000/, 0</0 000/ 80</ @/ /H-M 0Ѝ -LP@`p `VE$0p` -o@ "P!#M T0 RL0@(P( 0! R0$K  0S RP/O0?c0 3??oP/Q -L M@P Y0:S \0 (KRY0 TG0S F0@ Y0B CQ0 0X 8//o5200 0b4"340 ԃKS P @(Koo?o`FV ` Vt f41%0SK (K0I H R 0 9o5/o?o B!` VI V@ 0f4&1p ?@Pᬯ  0 0 0@TpP`V 04 0 CK\l   (Kaoo?o`FV` 0f4&5 @f>45 H)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO08 0-L@ P00000;\ / 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGOȼ 00///Q R R  // U /Q0 R 0 000/ 00/00/Q0@-P@ S Q \@ 0SQ @0\  @0Q@-p% `^P# PC0 \` NT^0 Q@E\@E`0Q ` `S`0Q- S Q P 0SP 00Q / U /Qp@-`@( S(  P0C S P QP @P P 0@U0pP@U @p0Qp@-@P`# S\   ST P Q@DPPPQ Pp0U0pS @Q@-@! S P0C S QP  0U00Q   U //q 0/00/   // R0  S 0Q 0000/ 00/ 00/R  -/R0  S 0Q 0000/ 00/R S Q 0   /0 /U/R 00/-P 00 0S0s R S  0  0/ 00/U/ 00/ R Q 0 / 00/ 0U0//0 0-Lt0M|  @PK00 00 Jl Jl00 DlKFl 0RK0:ȹ (0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$0$ 0 R / d -LL0 H 0-L@0P :p`p@`ꤷ //////P // -LQ4M`Pp@T 1 (0TK @0T@ KL P0 B F > : 6 2 K6/(K, 0S' ؀PX S@ S0S S4 S P0SQ6Z8U00 0^0X R 12S 0A@   Q C 08@ART !l0 0 0X0 @00 400 (00d[@[XZHZ,ZYYYxY/Z/[/ Q-L̟M 0 P 000 000 +; 0 0 0 0%SS  SR 0 @   CZRzta[p[K} x+tsq&0 00 *  0p0`0 00K0 0 t00 0&".'`p c  BD0 0 0`00 0 `t00K0   000T0Sh@0 T@P@ \  J P- U5P2 \7 0 UA5P2Q R: U5025P2 R*# 0@C 0 U@D05P2T0   0p0`0 t00K0 00 # 0  l 00`0  0R0`v-0p0 0 C00 0 C R 0 0 D } { >w@u 0 0lS 00p0`0 00K0 00 x00 t> 0 0 \ @0 ,0K   c@ _0 0 `0SM tB  0 0 PQ  B` Tdb O¡ 0ꀀ0@0+0 0 0P ` P0 0R  00 T500 0`0 `0 0,< 0p 0`0 0 0 0`0 `00 8 0`0 `p80*S  0 C R@90 $$0 C R20:S 0 v ,0K@ c h  U05 P2 U#3 0ZPŅP \0@ U@5P2Pʼ @ U@5P2PʩR Rj 1> p0 `0 A0A0R  Rc A0C B0D{W0 V P@ 000  d Q` Pp0@ P 0C0` B`ADV0 U0E000 0R(K0   S 0W@ T `0  0 l 7 0B@ ? `p0 d   0/@ , `p0 p0 00 `0 Y0 ` 0@ `10  0 `p 0 d`  ``p0 `p0 $`0  03@    pp0 ``0 00@0 T0@3+00 T00q 무 (`SXSL1h0 d 0-Lp`P@PU J0PEX@S 8/`upWx  -L 0S S S 0R o 0R0@o -L@`p0@@@P ᬯ(0( 07P\ DF -`AML@MPp000 0`0 0R`/(KCK JEK  0 0I4[ P ptt 0 P0+ 0X4 ]{X4 040KV{054K^ ( dE$ -L0S/ S+qW( Y%`@P U 0@SÇP00S0 S 0S0S0S P PU0 R 0^^Î ^@T\ \ -LBM M@ P 08 @<$ 0_uP`D4 U0PE00 ) C~KpGPU$:4 00kkP@V: kk84<$YP@)]PD40 0R(K꾣` ( -LPpLBM M84 `  P 0U@0O@$ t@00 = 0Q::0x0(S 0?s0S @40 0R-(K0x0(ST@D CK< IPV:kk84 0<4 nP @T:4 0 0jPc@ ( -LϟnM M   ϟ&  06 000  @T 1S 0 S`1   ?\@X@0W0& X@ @06  >6 0S6 S+=Kvo0CP☖ @ pR )P p CK ID fP  R!Rs P PYʔ6 @嘖0ST~v_p ` 岀0S`V6@  ^ 0S @ & &  <  & D T0¼6 06 ڼ&0& &S#& X1S0T t6 0SU S006 &10 KA2 K1 AT gnKg^K`FPE*p 0P &4/P񏐅6 S006 V0X6S66 66 60SAT 6@PP PPP6؁xs 0; F ᱢPW6pS6s  ]penK=K `F 0C@F 6 0C& 6 rWPPf^K v PE? cK N N p` ;06 ;06 !8c^K0PE 00FP00p c@P T0ڰ& Q{ ^`1 [06 .66 6@CT0ZLiK6@lv #Ϡ @ 6 C)l$"YcPN 0S   6 @0&T6  & 0& & S 6S 6S < 0 x660 0R(KpW Ah9  PXP0 0 R  >0 00d6@C  6 +6P `1 z 8 Q2  0 0 P$0`1 ` \8 F6t6 0S06 f0P@ bP b0 Po p 7" p@X@0V 0 R  U>1 01& 06 TCNK0@D 0 04tP(0& X┇#" =  0M 3 'ꘖ &0 @0 !c6P0 y  T6 X06؁ra @V0D6  CK @j0 DRcKN P 1 6 ڄ3v@ 6 V DP 0☆@T 00V 6CK A;6Fvp Š6160 0 & 06  ğ6  0@X0  (06 k06  aP0&؁ @4@Xކm@0+0CS 3 c ~tp00A QS RO 5`1SG 0   0 R0 @6 #F 0xv  RI`!!! QE   (3&@x&X0  \ 4=0&RL J ATL g^KpPE*`& 0tPp4/P=:p06  h2@X@0 0 R  =`V A2 @X00`!S06 1S&06 60S S006 1c~K`pG06 p106 06 P1 6 _bPZ0&0$aPD101eNK6 @DcKPD Hs H& g]K PEOH&H `60P06 0 P0D &ء (@?=`=;997887666x54422(2P1.L. .-(-,, TP0D Br DR `PO0@6 Kx f *6TW6ST 06 !x 6 9gVC0 0 0X036v D6 P TP0D Br DR w`P06 X&R!6 0RT 0`1   10XP0V0   000 P^080L <,G SbS000; 0 0 ```p P0V8$ d8$L400Qs(K0 D庂0 0; P0 @00;     PS D8$ .8$8$ d8$ 0P+ P3 P, d o.v0?s0S 8$ d.8$;0 ?s000/?r s0h_cd ^d Yd D봈 () (P'D' -L\XAM M`p 0P000 V ; 0 0 0'V@ @ P,CK0@`$0PU 0 000 0R(K PP @@0.SCK@4 P,0K@dD,  cD (&0% - L@P`^P Kh= -LßPCM M84 00p@@4 000 0@c R0 0.R@ RW<$ % S5.0B2?o121<4 5T" <$d1`0T010#S<4 b 0 80 0JP`V @40 0R(K<$ C.K4 BPy<$d1@  R<$ 0u @D D0H4 Ro `Ld Dd 0SA .S< 080 0P/d0=S 1S/ S= S2 T0 xQD4SSL4S Cc`lLd Dd <4 080 0P0S`00SL40L4 0  H4 RH4 D40D4 <4S0<4 Ld Dd 0 084k<4`Ld  Dd b_b[ޚ0 80 0P@TK0<4 bp ( -LdM`x20@pe WPPTPUP PP V:\"0 |@ 1xP 0p 0V V V (KW P|K,0K 0 0 G%bP0xP sbb0V㴐o``V  B R,0K B0 0bPp Pbbbzb뺐E(K 0Q5 50 M 0 pG 0S0  P`s[bxXbYb 0sQb 0S  `P<E0h \ -LpP@`%0D@ S*)-bV`p&b0  b b0?0 @s0?0$++  -L@`Pp帐ἀ E0S@P0WU! Paa@ _DGpaD+t -L,M@c\`%px\|xL 0<  <K  cK$ `p0 bK[xKШ, -LM0P4 8 d @t億`p0t$  0 S-0 S S  lP%  fP/ `PZ  ZP10c K+0  SR 0  SRS(K1d1P00d10 dt;s1P000 @- 0"P  P  P)   P&090060 B1P000 ~|~lp 4 ~0000:0@ P ( P090090{ P010q  P020g  0P<0 8 R\ @|8 ?P01?0# @0 o8 @00< "H4 0P<0 8 R= @8 ?P01?0# @0 to8 @00< (#) wP" @ oP010  eP010 @|ldxT -LMAT $KZ$0000$ 003[K@@ 0 p-LtM`A0T 0  KZxPK 8[0#0;( E(p( 0RKp@@u ( -@LPY1 !01n0SuOPpPp }Yp0S -LQ@U x3s|p ʡ01P ġ01000[YcZVxTYP //P // -L`P@.V00#\…^#  p僣 p0p p V@SP 0X+ T;- LM M& P0@ 6 000 z_0T2 0H 000UnK̟p&,d1.q05̠d10 0`111100O5K[P@ 0TTzτpO06  d1 2d1t Pe `@ ` n`0D@H S_ab S\"  S S00 Q@ `0S S R: C0SQ 0 0CS00S00 090}}0P5 ) 9CK(BK00 $6 ^>K @ 0C  & 5  +5 (Pf 04[#S;S  P *4[ S S'6S60 S S @CSOoB@T`0 m_AP`@` P*4[ S S  P &4[& S S00R00S vP(D[ T T d kP)4[ S S64' 6uS& 0d12d1 AW|ԧ1|>YAp Z>KƟ 0C `0Sn V `0`H`HpSD .S`0SVP@ .`FT00V0S 0 eP % { 60 0Q00^(K6S160 S S pCSorpW$`@ l_q PpH`0D@S \P?* S S00  R@ 0S0`00CNKIP.P `&mO` 1 x#|#st'DQ `dD@`{QD'0  SR]F h6 S6, p$(f V T T@ 0DT?o20;T@@TR@T 3`&0 ;TL  00@@T^  -PP   %Pu@p, 56劁h PU @@t0;TS&p20 00@ 00@@t0;TS00%P' 5l1 Z@(f V,U%Pp 5- p1613?S01S40!0P&-013?S01/S40l1u@- p6p@ T T@@ t@0S S 50EK0D1@ @0@@@@  SN0J Pu RP 6Zu 6R@ QF `P`Ipt2  ꡔ@r (Lp 4 4  !-L(M1 P@7΃`LWV T 000 K pQx#r c_WV p  \0x00<0KUPT (000 K   A-@ RP0`P pp P0\^Î ^ P  ^ P(0 $00-@Lz0 ܻ -L,0KUM@T A#P HQU `d0P`1 Q/Kd! `!0lA hA pA X!  PQ PUpP TwP 0Z\1 ( \!RPXQ0i ,0K 1`FP0X1 #ZHl 0PP TP wP0S 0Z\1 P0P1 IY"XA  `F  @8 PUh  d &/ @QU #T *P U`F HP 0H1 0 `P i00(K h0` 0CQ*\!l! \! X!X1 p! P!h! Pޤ 0 PP դ0H1 Zg  0PhlS X  :0C P S:`C0KTA p @ Q  p W`F0P!pp0TApZp `FT 0! P QK pW    V `F *PuHQU 0  y X1` 00ٜq 0 ` P Ҝj00 , 00-L@P0W000_ 00/ 0S ^L 0 0\_  0-@LP080000  0-@LP 0  0 0-LM0@KP   { R V P 0SPP 0 K0RK0 0  p1 l0h!-LM`TQ Pp0 RpGS, `Ncp5 K A@TvP! 0NvP 0S@0S0@?vP0  `7K|0x t  +KX0T H `] `<T   0 -0LPU# 7U#P7UP!q@@0``F70P $000/ P E0`1$ (`P 02~P P7-LH$MD' @G0@<0  70  `R Ɵ0@ 4 $ (& 8 & @ SF &Q  FTڨ d(p! 0CS/+*&%<6 0( ,6A(@d0 P(@( P(-P` @40A0P80@0S0S 0SkH6S 0S 0SK S 0SS 000SP005 0P0 p( 0 W B03*PCQL TA QU $ R|4|$0x @C(@( 1  P@<0  U40(@(K#pKq4001RC@!R*ßP 0CP(P@0(0 0 0S  1 `30( \58(09( . 3 0 ( (  (0 *( "2 0( 2 00 ( "2嬂 0 D bpS ( x2 0( d2 0( P2 0( <2 0( (20( 07S 0S'10GQP 0\ *P10P1@(8p4 ( 81R3P1SCD0LL! Y0CD  $p  \@(K1hp  3p@0( @\X[ XD4 T,4|lT(t\L L4! 1G-0 MX/*@ 0@o_^0<000 00 R  \:P 000^ R/YЍ$0 0 PS 00 , 0$-LusR < -L@@`V 0 CQ𨝈PaᦘP `F P_P 0`00 -L@00 R ^^ ` P`1PP0 0D@ $  T Q  0-@PL0T  0S  T0SK0h#RK0hR$P@-0p @0 00^,0@01P(0 0$00O  -L@`PH 0(0 `0S  1T  0"00P -L`0P @P PP 00 - @L0`@S  P 00   $  DPP$p0S @`N : -0LDM( R@@ s *`0<0 :@* 4 0^pH0 <80 D` :ωP0/0 pLp 40 800SpP@:T 000P0 @:TU69Y0P PLl)p0  X < D000JH 00 S  !$RPxx)  L l) T SeU T( 90$ RE 80, R: ( 0S  !R 80`  @`@ $`< gHD@$`P 0!H Q < A<ȟ  B QP (@ X , '@ $ H0 G0p@<0P,0P9<0坍@PB @pPD`d0S*'0 00  `' 000S:<7B@ 0@<00(KA(K(K(K(K60  260p0PP(K0< ` 001JAh \ ,Q$ L,@ < ^9* T&(Dd \Xp&<0 00C?00(K(K(Kd\ 0@ Q`01,Q& d RAW `P l` @\`XP\p p  P @  AQ9\BB$ X 4\ 0 0A!, Xh  0T\0 Q0 0<0 QJL40<00D0 `Pl`0\p Q0 1*#S\0 ` U #d0 \P 0Cd0 0P@@ Pd00~ ` Rv$冝p `@ $\P\ 7sPv\ `0@AT# 0 S\ 0h00`T0P`}<00D0 @0d `0 ሕd `0P 0C 096\0BdP @0 $rP + R6'P$` $0 0rPP 0 dPA!T 0dPAA0\0 @$d 0A!B0\P @0\P @heb1Lp 0 pL@h0 h1h0< /0S00 0@T ^ό000@P!< /@:TD  T00 )0`00P`\hM T00\H4,  8, X\<0x0( -@PPLP00 R  ^ `p p`1<0 00@ $  A @ -L|@|p@pPU`P!V01`F`1S ( 0$ 00A Q -L`pA@TPQU0n@P 0 p``PPpP(P,P0@uL -`L@POP UD0N  P  0000P   RO  0-L@^K0h0/ 00$/00,/0 00/> 0 00/> 00/< 00$/t00,/`000/L000/8 -L``PU 0AP pkp80AP\@0@ 0    ( $ , h MMM/ L-LDM@0 < 0 0 P K|= `  0-L@$0`00K0h& 0-L@Q 00 2 20( 0 -PdsLM@p 0㾩p T 0KP- P       l`P 0P 2h "Z &= " 2*  0 000 QP Yv YRKLPP%K0p 0PF 2 @0 2{ 2011 10 01 100P# 0 R00  0 T 0 2 13/p (K < 2R"00@Z J|`@(KT`0-00ۢ`P P 02 2p 2: 2 2< 2]0SzY 2: 2S00P@M@400`x<  \ -LM@`pPQ 000ESdZbD`_E\K 2 13/p_ R0 R0S 2  13/P"?o2R03S $K EcP> (0$P ( p 2 00  Z"P?o2(0"?oP2(0 $PPU0PU "U0000$K$PPU00 -LM@`pPQ 00U-0PU) 2S* 2 !13/`PE PP 0p  2 00`K K`r`00` -LMBP1ȑS.:b, V(@ &*,pK@T ippT   0 P $K0 ` PXBȑ$K pPȑBA`V* 2< 2$K -LM`8 Xr=*40K<0 Q̡P@!p@ W ZJ!PE >P ̑1PE0P U40  04 K P (K0<  PE4 0P P80S(K80X* 2< 2(K -LM"`1S3:r, W( B R"*T$*,KRU  R00U00SR [0 [ PpX U"B$K 2< 2$K̐P"!$K -L MrBW Rb,*T *4KU4@ #0S 00Q U@ E0 0  Pp@Y U 2< 2(KDB(K(K -p@Lⴑ`P 09 v`! I!V`Fx0 v`!  R A1^`0 A  B R Bq  R~ 6 S2A0C2Bp -L@_0P P `P  _` -`PL@Q O00T T(0 2S $A@P$00C$0@000Q 2S@3:A@P 2@:0 2 -L4M@`PQ 00 V] 2+ R (K 13/p3 0 f0+ 2 L`K@  DpKP0K$D0 #?40  0 08/P57O:hS;`6OoG"4KOq3J4HAqXF(f .Kh+ ZF!j,HnVF(ʮh+w&I ^TpCOx#`@.KKhkJh;`J+R#7K@?J!F7(wEb0!d 8< 2 D El G (УmXFh !j%H=0+?3F00+?(F%@(F(,L#h[0+?ɭ+h#Kh+?­,V'Z0V' I pCO?,?R d t -OFh FnI `FJ!F(FN0СI KMh@8L`jFKc 0HKh* 0_ԖI"cF `(bbjI l FLt`j#bKccbH K@+mVi^00! D0@aOrcO@#F "(b @`k@!OOr[hF`jG#jC#bbj+gHp `00#hc` #Cо #Cоy0CO ! kckAC#j DkiGTM0@SIJSM#BB(FD(Рi+hD `(ф)FFH6FI EI DKDHORU``HhZ `+@=K=JhB@d0#BB҂!`h"###C.MX Тi! h#!hDi#a`g#C =j-@1k(FiG0@*h+$I^,%" 6%%  %%0  8 x % |K {KP yM#g C EEY? !80 [j(GFFF #:(sIo$ ?vF^H4 080"(j#GP$QH0#CHIV#UCV0YE# #u"##}#gcE9MB#ѐ#C#PC0#C##PCZFcF#L##!C M FA2 gF0 D0KhG JBѽpJBxkjhG0 I t( @ 8 Mg%-OFɰhFI _LBF9F0FB icj*#j+I.i(:a(,G(O0P(@IFH (g(h(#ca#m($k(l(#`n(t(#hzI #`#caOCaa##b#caOc#caO##acbP +x hIn+kxo+5#(FO c`,!  FXO_d `@\I # FJ[,!(FjF#j PIPK!FKIW(0 &5FD Bg:M .O & 2B I@pC_(D6I$pCOѾ>(h @^C1DȹhѱYBF)h(H,5(h(" ((hھ()h8FX0F10CF2F)hHF 3 #O \\ F5$BF^, ']'г'3'C''(5(R( '(,zp( @^Ci+7УhBHch#Ho# HoYH#H 3 /j3b+8ѫibгOгojj{K|H*F(chckj+JjoгtItK+c #kcrKkiqK+c#pI(c)kmH>k# #a#KA #kjB+р[KOq[J[Hjk :YH+kFXK+jVHVHj/SK@LJh.S#B8FBL1FCFYFFPFFF#B8FBD1F#FFF#B8FB>1F#FFF #C:# #@!##_4gBFKF(H 9F0F .9F0F.9F0Fg wH(((0)a)&')))3 )^*&i***8*R*~**&#gHFHhzQЧaJ 'h\Jh WJ #C# #@!##_FNH+j˱ #c R{GHVF2F;FBH@Hn,.?HF#BNE81FCFQFF8FFFHF#BNE01F#FFFHF#BNE*1F#FF F#:FCFHIF0Fx .IF0F.IF0F #3 Is#!2F;F@!_z*1$*&*y*-Ah(-hDhx-+9#41B-+`#p( E(S(IFH$ fs( x(фIHKhK`#41#L1##b3;  (SvI D! @sI  `(B  X(F  R(J  %H(  B((AfKh ("F 0(_Jh +"  ( +"  ( +"  ( +"  (GL#h'F!EH <(``lBJ#h+ѣhG0>H^FxK@BKhS$KM&U$1F4, O:Kh3K(R0K0S4Kh;?KhFgIzF(Oq(F F[JbIWaK F_Ih< F^L #3# | D*F UL p  PH2OI(F"FjùKI h#+ " LEH2  AIAJFCF F](FB(" ( 3I2F 2 HAFOr"H(FF(FV 8F.F 2.F Z"HD!H@ch;c`+= FF(F (09% N-^8!,H(8F=FM`!4, X0ZX "p18@!<0x -O'@FF=F;F>Fww JFAF FCѬJ , 2l-!"H ?F0ѢJI l( a(ܠQ*xd(Fp(n(&r(t(#FJh-d-r- !!!d-=R-S-)Q-@m# "X*IXF p0сI p-gr-/l-@S"DX*XF2FA "X*xrIXF J0pI"X* h mIXF <0kIF("! "X* R'"9FL,f\F2F\Ib  W BHe TIXF 0RIFFOHPNIF(FFX*HIF8FF:FDI(F8FAJYF(FlF(F'=J9F ;IFP(F/JF4I 2I ,@𘀌tF&X*-H!F,H F\; PY'O H(BF"InZFF?1F(F7\sBQq(~D]Dj{Dx|D(˵}Dܵ 7 gqEBFI $F(FKB=s@3BQF(FF "PFF(F(FIRF RFF'*FIgqyaraT|-O㰲LFF#8z6{2222222222O3 3JIF(FCѠKh(`(@Ib(@E('2(y0(Kp1(q3(rA(ѐJO3F:I8h( :h3h\3"|2B@IS(pF(OhI(2T(a(#2s(vi(c(f(#2l(Or(nK`nKh2v(St(tu(#2{w(z(cKh_KFX`taI"Zag"XK"WK"WN" #20hBQKXa x(O2hRI 42F#2BNM$NN+aY0F4Zh6o c232+#2@pCO#22K232)C2%+!!20i+r,O@C:Fb(`U9Fh+)%H%R-#'U*F0F0<HF(9<-<#c#C$@#cFFP#CFi@P/(K2+ݮ+H   K)F4PFAFCCFE T 0F(@2B ## B6.KoOb"RH!!8!!!(sOP!#BqOc|22P*"2j{KZiKiB󞁸I*FF+2+L2+HHj(AOjO &'OgCFHF"^Or##CFgH"M?"##"##CF"H;]H((ЉO"b*"QF0F2 2 2+W2+SzK?&F2+@)zH(@!xHOO &'ZF#PFgFkH(Д11111111^JO  0c 0B `23222+@׀PHx2O088IHhHH8GHeGHb* "0 ( xi?A;IXF^:Jd!:H9I@FO 6I(D@F`<FPOal*F`/!(F,F FPOaK `J d|(FFp(FnFHB FfF( Oal``F(@À~Il n(Bd(2P(GT(JwKwIFwH Df($l(0hnt(_p($q(эbHOx(~y(v(^JShC\JShCS`c0C0UJShC S`RJShCPJShC0+?F:!XF>OI #pBJHYF/YF( F!#h ?I3h x =In*HO=Khu! (8I 1KhF4I &РOp(f(n( P(x(y(q(#;`#+`"J`!K"`#+`;`#+`#;`KT "AFT y TPFdT FFXF B>F=0F,!0!$!Q(KJ-OFF ` 8# # hJO#I$`FJ;pKF ```J1F(FfBF?ѹTKxKx#H$FKhMЌKhK"`! (ЈI KhI I \O-󹀁Kh+ @F d+o3U+F+nP+B+wKwIhF(=A0a+2X+pb+OjJ4c+9p #hhIshK(6`p+^m+>n+Qf+#;ptx+^q+^Jh3y+Yz+[J#`aYIFT(@C9p #TIh@SKF`SH K!QH`E030?#@J#JIh$IK` c#FFI FEH+Jx3p*K"p030)K"`!(f,!!\!h@!=X.buT!9FEFPF d9F8FEF-OFhF&|I f0,u>nO FHV0&їI #h 3hdD4 #ĕi3+H*0уIH#0сIlL-hрKN""p~Kp~KpwK (FJFPF?FQvKvNȁh3xP5{+Xm (SjKx+OfKx+K3xP5#L (@2x -<јP5 +7  #"F3` c[F;(F(@TJUI ih F-hdd6ܸNgܸAUиC߀@FC@aBиbGиWAO $oB###"#! "8h0p`+?l:hu=O ܸl&иs+иh7sXw[.۸zKp'KB FFG##LC"H?#3r<#sr9KpL5K"p1rKB?-0p;#r% Kp"(203=h2`h2xhH3""l"m"n"zLc(2h3sL $PuoB#!##"# " h600`c"hgI "fKlOT ܸLиa`KCFsܸmnwиzWLUL%ULF2hXF0RI\3hk;"SC[8)FXFKJLI,F F F#?F&0F0AJCI Fn>J@I0F:J>Ih3=KOJq6Jd(f(D$u(* r(t(ѸI Hv(w($&#0)h x+ 1D(h4FD4030O NFgIPF`PeIPFZ(dIPFV(AFh(_Ih(:hYFFBXxh zhVI BOaq^8F PIq #3h #F (5FY! *FBI  AF(D0 (D6B%B@I QW*F=HW*s @W* ,Ik ( F0FHh%I8F#`(>F %7Oa2Fq^F(#3SBF 8F#FFPW*FpW*F@(@xxk]Xx oxMxu"F(@F|F(.ieI0FphcI0Fj@bI0FfW* _I'.h_I0F\hW* (?n Fh@F (W* Oaq^DF(?  JIW*萱HIHHZ4#31F3XF #FRhkAF0FBF1h+2F:I1FOb P/! P.頱E(F0(DBr#!+p PCF U<9%J(F%I((F I(F|0(F0F0DI #x FJHI!FAJEI"?IDH2CO{(F@M+h[h+`1F*h4H W0%1J8I"3HIIF(iOr4IF8FH( 8FB !J*I+h'J3#`Jh3 h+`"IB0*#CJI䨯I8F(7#kb+I(;M " " "ؕ ""@ "8JoE ""< "+kj+ѹI8F(зKKJIO6*0s*#BB Ij a^ЫK#`F F 1 # D0@# I#*F\+>b< la FL0)FHOZQF Yu(RFI̮JKhSC 3DKh+BFKF)FH&RF#yYJiFh$ٱ+'LE FyBFCvIiy+F *ܼ+Ob OS0o!ObeH^J OqOr SJhB+ 00$0K_ORQH0SO0( IJh0`GKhF* 0+#CJCIDH#0BJhC0)Կ` (F"F1F u|ЦBw F h+? ,aXhAFj(mF+Jd!)M la ,`<( ,b#IX qObk_qObORa0(R@ "3 "@[o " ""Җ!8 "<:e4 "Lx90F `Ё:HYj 7Jd!F" F  0H/K:h ,a*HhT-KhSC B@Ux#8$0WhS P0xZ" ,a tp8)F Tp(?<" FRBI tBCC  (?&Yb ,b IFx I ӻ+?a"Lgq( " "1ʗKO2-O- , NF`" FFF BF)F8FCFѠKhh3#`/CZ,i5N,iF,I,D," 0h&J x"+гЌI S,OSV,gO,"#H##"1hiKX`m,f,O]i,lb,OR#xH##Ob1hMuKs,tv,n,#oB#nH##"1h5kK0O yiK"`h3r#`mO2#bH##Or1h_K`CB?[2h\I"#[H##"1h`IOR#TH##Ob1hHK8oB#MH##"1hJK#$"c#GH4#1h5K`O2oC@H#OC"1h=K3h-J4x+8I >O #"!"!>U&`!KhOr`0$K@!#*s!@0F CI2F !052FI#(?^șx "##&#rN ##Ť"0+F0OM;#:h#*FsF4P:h#I##*s򕀜IRMOcQF0F*F_ڕJIzp00RF9F(Ft*FIh! F*FI_")FH h5 > >" ~Hf0'{JIE "}HHAFN(hOr4AF8F(8F0mJqI . dJh#` kI!>*#C_JgI CfIj\dKZJdIXNG>*I c!>r*#BB VI`Q 9h#3 F60@# KI#2F8a6r F01FCH(O[YF XF(ZF>IԱ;hh+BFKF1F5HZF#ydPFXK?h$F*{ѺjRFa#Kh+F@F FIFV"F0FdcB F ##ؕx "8oO@[o##E FyQFBFB)I 4iy~9FO:!Ey Oc4$$9FOP$!EyOS 9FFO!EyPq9FOP!Eym<Җ-O&- FF2F! 'L[pFBڣI 2F! :(9F0ћH0јIOn틋|FO6GFJQF(FHCюJh턋{@{џ{+H{{+oj(jIC84(_N25:RY?]aJhCC`"0x ( ZI hCc8;C8;yhCPKh?qHHK x#  FI XS+ AI"x ( :I< ?hCshCSh3I C@`0@;(hZChChC8;C"xF ( IzOsBIhC_hC[hCCW`RMb@A?{Gz?#5L##q<^wЮ("LxF( I("LxC+ yI[hwJCcvH`#hrJC rH`#`mK x+ ?x gIO p{{`I/<;+\I&PQ |F F###CA 8G( {( JIhHCHH"b<;D2=GBKhB'oCB=FOs"h{HF5DD*@qA"hB¿7KD 9"&hx1eapVrCӀ[0+#r/KhF`D haQ1C 6! "@8(#I[0k% [ "!((I h;# "!;F(0I+ " (#I$y##հ`##}x?0##$IWd %chIFHK3FAOq(AKOq%I K[*F[&#a [#[UaL+'U&)U!F Lv<;B󐀩M )F@z퍛{ A 7 :˗LI v@ДKVz{ A 7 :I`"2BXڵS݆I`t{ @xKi[h{I`@՟bHHI2"pI Olz0@kIaJSiSSa+?/gI1F  5bQJ{^Ip7{( H{ȿG8@HHI > AF({*\F- Ih+D@FAI6""Ct-#p+t( rh+&@F3H2HB)I t;x2EVh @Fk#IFF$H&d2"B+?h$@-C6?8~A@@H#lEEA##8####DẔгձU#0+@𦁪2B`N8-눦 BKsˆV#Chd2?d2𛀋@*FRQh#OzsXC H{K7{{{@{{{ Ճ {Nj݄!"D3Sh2F Dh2d2;d22[EY#FH zCFF8FP2Z +/(+:; h3nHC;$&01 h3ScE2FF~"yZC;hC WH;IFVH&!RMKCDF +h 32JHh@Fh@Kh?Ԏ#&&F$H zCFF8F BEhB0I HDID.(5E  KD D0B  #FH zCFF8F !hJDzHD pN\chE,& 3+f. | H#E%Pu$#y$x=0F4 HF  z,;+Yd #:F1F(F(?ix):#%')+-/1357H9F(F&OHHHQFHHHHHHHHHHHHH#:F1F(F(?H#:F1F(F}(?ix) H(eFHHHHH#:F1F(FZ(?pFFH#:F1F(FE(?[H~#:F1F(F8(?NH#:F1F(F-(?Cix)~Hz~Ha~H_#:F1F(F(?0)yyHj#:F1F(F(?$uH#:F1F(F(?pH#:F1F(F(?lH#:F1F(F(?gH#:F1F(F(?cH#:F1F(F(?^H#:F1F(F(?)xYHh9F(Fu,&0++𞀃+@   0+.г H * D  ;8Fi3FS}\(FWbFV)W/DDdp(X WQIF `$I F(хK"@Z`d8( '*!$DtDO 0 DdDD4D$D$O OXFjG(FYF(F%)F F~bI .ўF(UphUKhb "!QHWWI2F WUN[h "!+OHW2FQIMHW-7+F2FMI WLJMIMHWg#IJ#IIIHW`h!F! ! ! ! ! ! 07I2F7I!O00h+1H*L!hF,J?F(FWj)I"FF x  & !O0r0h+H .H)F FH0F6#$ _^,Wt8)Eζ+[q1(-OFM FHHK(FH@K`nh3x-+6`VF80FJ0VF0! J`U+>FO O- ?ùK4;p=U?D;+ѤEFIDH2  i8I?H&"#8H4H 1H   .N4TU vQF FRXU d?FFX ?G)(#sb{h!BFKF84_%MгZ%FFZ%ŠxNa[9(?](-OF F.ݞNOL)F2FPFAќKhK `Kh*D"!HK`Kh+>ڔI f(S(&L( WT(#d(ьK"s(n(q(шKt(v(цK"#;`K"`K"K##`K"uK!" JU&p/lKh+Z8F8F_(J((dKh#"!F ! 'V!  V!  V! F V! V!F V!F Vj[3иАRI f)(Ѓ/(ރ ("!FPF0U&0GK`xg*:K9FhCKOeO  7/>KhF@F62FAFyH4DxKh3wKhwI@F);h0`.>F6 F2FAF4DiKh3hKhiI@F ;h^4`.ـ>F6 F2FAF4DZKh3YKh@F;h8`.>F6 F2FAF4DKKh3JKhMI@F;h@`.>F6 F2FAF4DlF6 F2FAF4DN-Kh3,Kh1I@F(Kd,hK&Kh3;h e(F(Kh+}'K"F)FhCF@Dh7+@hFH*F[F#F @p&c&c&_&0c&@c&c&c& d& c&,f& ,9 f&$c&RL& &(&D&`&|O6@h+@Cx+?+<iQh)8 2a  h0^&,.X F'F:HS9KPF9J!FhhC8JhC7JhCC Z""B1F2H^Fh3+h+xg+,+KhK)I*Jh( F'Hlx+$Hd.h+ XhFHT V- V* V'V$V!VV0  d&4f&c&(f& c&,c&XxF-GFh F8OL)F:F0FA$ѥKh.)$&B4&*<&"<&,&*Y8&*UКH VIF k(7d((D()b(f('h(#46r(O(n("p(06x(!z("v(@60 6#$6#(6#,6#686<6D6H64&r<&Z0mJmKnH) FFU#PgI(FV6(ZeK! a##xh`I_M(.]NOhO W(@E #3p#spVHSM#CO`FOHBH&T"(?h1!oF\(f.@;bCF@-?HV `+x++!.F0F77H F(F@O 8`E~ub+Jhkxh320Z`<"MPC#OyFeIk 20 Ѹ:(3xFyCFOb1(F`(?̮+x BӵB #5#5NFBFs+F9hF 5dHcK cH0F "!_HV#Op!BqUOgHB#BAiڦ @SM8R5Ov'U U#BwaOU 58U#C<6+C46+A0>J?K)F>K >I1V :Hx6[8Hr  O5Bw۶ #"D#HEq0F9FFHFM%JJ,6{Or@a!HD"I(FlH2 hH H&<646+y! .Hg&X_WTg& +M` +K,M@6+I*KD&(J3C,H&%J3C,$&#J3C,8& J3C,0&J3C,J `$H`\"F(F*FIh V)F`H3KMY`1կ-GtFpFL&ODRF9F(F4CHKh-*nm(h(l(H(D4s(t(n(&D4DD$D00W#P"/H)F@8 !,K,J-H+M!(F,*F(I 8D0d &L%OJh3`;Jw`BKhBK`BJ9J7J2J6hn"F!F# F5L h@5InF "h 3I:2L&`#"FF@FF@@F.,Kh0 +x+9F(FU--9FX = =Jh "2`+?eKJ``-^OkzDn&o&o&m&Ln&Hn&o&m&m&o&(o&o&O m&o&x-GFFIFFML9F*FHFjA0ѣKNh7-H4iLI F I F NLM2F9FHFFB:eiKh.( @3B)a( t(#i Kh#aO 獱3i{M>N (_AFFh#c`;h_M#s;`{h# {`YNOsO3asSHvRHtRHpQI PJQK1hQH)FFMKB`({KL1#@FHO%,,l0B-e(Н mF0Ųc0230B0300" 8hs1+Н3hk(Д BѴ0[ 0 ( (" 8hP1KJK ( FF%+(Д0BI1|&&&&&|&&Z3f3 &Zx&^,*$-O]FFIF йK"`OLĂ:FYF0FCџKhBDћKh(;Kh4I(F(I(F(ёK"`V( ܠ1+ِJIH*FId(O l(c(`08c``JIH x!xM `3x-+sxkh0[?+ѫx!4FO  FFXh#!h+ F FHD0T/FeH!F:F  xTF]H1F pCOYH!FO@ah+ FQH!Fix8F<PFT,88F.FH!FR.xOb!FpCO0FH0F6 0B IF&HF"8F(0!F@,Hh+kh+)H!F3#"8F#hkhOr@!0F(FpF ?1FHO khk#8FO9p&B9S6Mг9Q9`9Ur999$]4FIF8F8FPHHFLHh1?0F!FEH*0!0F8AF1F?H yIF 1F0+~YK"`XHXN0`xCVH0`x TK3`THSK`x RJ`RKh&!QHF=, ;hCع(U8F1F@F 1<F@FT( 9KhC8Kh+(Kh6H6L:  6"h*0K1IhF(!-H S h&(F&K1?#Jh`qS" +(j8'8'i&8'{i9'i8'i8'j8'j&9'-j+'}}Wj8'l9'P+'1-OF\LF&ZMhXI T&`JF9F@FC)SJTKhh2CW# 5/(h(=U(GK!hEFH(yDI f([)I(K E(E>IFF>H Ha(O Be(2K(h40)h3IXFXF8n(<i(1l(#"F&H\((H*r( u(#"FHL(!H#c`}+hJ+F#`#`tKp)h &j+h J+F#`##0^xyh L'(^,T'T'x%г$BfT' T'-OFF I(ڰI pLMŔ 2K@/! FDJ F#xIh320T K"`IHMSO,@𒀛O&F%FFFDJAFHFC@𥀕Kh X# >F@a| Ox0Ii 0:`0 0*( ;`(F"F1F*U,"mIkHx iJ! L#BFrIrHs"!pH X"!nH S"!mH NӱkHF(hI8 DfJgKgI(FfJFBFeH "x-*eZhx-*_bxe*i.Wx,Si*k*e*L`I`G`Ee(BQ(^ E(?JI(.-( O Ba(*d(-S(?<n(?7k(3m(?i(;hx^.+[x+?'?+@!r(3s(4p(9h6HO 9h4H9h2H;hx^- [x+??+;hx^,[x+??+9h ###%&$@V'wV'($b -OͰFO$hFKJF&F!F `O1AFJAFѠK +.E"0FF?ژI2F f-/b-e-&:p-(z-*l-O2oC##"9hH  oB##"#9hH[F3F>h;h047FZ< 8F|FP$vN"#vI#"uK`uKXFrJ`0Z (FdnK0* P"`RKF(thIpC_(##,к/v2F_I ^I .F\I P"FOq F( " $ "1F F(MI S (IIbGI 9F  6 4{! !F8F ( $:I#F:JF(?e8I(5I03I)F !FX)&X) )I(I "O0:#QF8Fh+ :Ij(@(((@ @0(ht@D(xH(L((A@O@@A A#A3AyA>ASAѬ A #D C|ZFcF#BF  (h+ :BF I} FFxOyU+FJE #{нB%bh+B :! PFS.0F@Fn$O eAK(-Oh FFeO*`Lh|I FBFXzHXFehBͅuI F0F(sIsHsHOr! FrnK FD bO30430$1A#FeKF # bJaP`ICFPF F9FA9\M>k>+h Fbee#FFAF(@ # aPKJ 3hBȁHK+!HJ F3 #B0F V(eN(V 6(;?(4(O T(MRP( #CaF ##c7k(+ g(,j(f(-Khbp("n()K&Fxq(x(%K&FnO kkSKhcbK&^#[CVK&R#c###(XXNWC[[\ WW^,X\(9VV1VIVHD # aPHO O>;0ѺIH=)*@AF@=>R@RAZ'R5K"<=r5$=];J&<=g@T PќH== Rm##C?XFPFSF! F@S( #O l[ خHRO +JхHH*h 3BAF F@)h# FFW!@MF(?kFSF! F@B)-O [pH3 FEr5jH FLgH FO1 #2C B +3+ZFcF= ##! PC@=WO |  C?VMH0CIKH=%=k 8 (N=IFH'K2cF ##"@@R#KB#!0P/$hm(F( $)F`2H=B$/K/JFS+!,K F,J# aPvQ&K"$K%I=b0I#H8=p0 IH #!]F@#PXF>01IHX>C^^\)\:\G\gqr\\ջ ^,}X\l) DC\\W@N2hREXF>~lnhIHo Rl(#03hW#=F! R;FH=G3hSE+"W#(FnZF@hBa`0 +x#(F$(D<6+O O XFC\\\\]!]=]]]]]P]k]]mO S&=j+mHFS =6jmnBh۹*/ # QPI   =3 #!PѭH=j)[hnh.Yn F= #!PUn&h/W # C' 2#Cd3.#.o 'Vi v'Vc Q PI   = F;( FAF@qnNh,Y8= ڀIO H=aF?3j#:FQF0F;vh F;(Ҭ;j8F;0!32#P{l3&h&nh"."#j#03Rh*s 0!C]I!<#j3d"#!IAH=@H= #FFC@ #2#COO 6K7NhW#`C 3JbFP2K1FcF1H: # @ )OD! F=0?cm+ ! PKrcF ##FJ<# F=f(?&\..(Fg*^D^k^% >C^ ]]WWWU ^,^ 0 0-0LQ0@| p00\@rpK0h0 ,0 010#H <#/x 0-LM@TPK@L D0 % ,, @0٨K0,= ii00@-S* R  @ @ R R @P ST 0T800 @,0 0 000 @t<<;; 0-L@KM,PP0{K0 x - LMQ K 0K #8p 0 S 0 /O0 KPܗꈳ$ /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/}*/_z*/\w*/;t*/bq*/n*/k*/h*/ce*/2b*/_*/\*/9Y*/V*/S*/8P*/M*/J*/G*/D*/ A*/>*/;*/08*/Q5*/2*/)/*/{,*/|)*/#&*/#*/) */=*/*/*/"*/*/*/ */////^*/*/*/<*/*/*/T*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/4=*/*/d*/(*/$  0|*/ eu*/r*/ o*/fl*/i*/f*/Kc*/+/j^*/O[*/hX*/iU*/vR*/O*/L*/ I*/F*/!C*/@*/=*/1/ 8*/5*/I2*//*/,*/)*/&*/#*/ */*Q/*//7*/>*/ */6 */*///*/@-@@*/xGF xGFEnxGFExGFxGFxGFhxGF?HxGFxGFxGFxGFxGFxGFyxGF+xGF?xGFxGFTxGF9HxGFv2 xGFыxGF?xGFooxGFxGFxGF@xGFxGF"xGFאxGFxGFȰxGFnaxGF{ZxGFZcxGFsxGFښxGFUxGFVV, xGF%#xGFHxGFxGFxxGFOxGFxGFcxGF@ xGFxGF)#xGFxxGF-xGFYxGFxGFxGFxGFxGF/IxGF@"xGFxGFxGF?xGFxGF,uxGFxGFxGFxGF5xGF`xGFAxGFx#xGFYxGFxGFAxGFdxGF}xGFOxGFxGFI0 ps_strings missing )=e*1,3z8l)@CCA>EFEL5GOHOOH K 2LSPZ9QY9Qo=T`iV]}Vc}VJ-Yiq`V`od (suw+(1y:|m@QEauF(0ϐI1yA}}wWdUe-O-#AM -&=] ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory pY$-$#^%@@$5H=$u@@$$e$mI $U%@@W@@%unblock and -DNO_CONV?8OFHoflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat%s %6sCan't get mount information1024-blocks1K-blocksonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-agln] [-Ghkm|-ihkm|-Pk] [-t type] [file | file_system ...] aGghiklmnPt:only one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %s Used Avail %%Cap iUsed iAvail %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %10lld %10lld %10lld %3s%% %8jd %8jd %4s%%Usage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s ????????????????????????%'*llu %*llu %s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)ifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... 1m =mOmYmemrmemrm ^mmmEmZmmnn#$n $n_6n^6nF6n<6n>Kn?^nqnPATH= N?zt9)4fBQvdXvQvsqy)4cevQvm^vQvllvsv r\gp{vqnvQv vvcC b   EOF reading here (<<) document96{>{B{F{K{P{T{X{\{a{f{|yj{o{v{}{{{{{{{{{{{{H{ {%{_t*{0{0p/tt&}tf }-+?=kN_@`}}}}}}}}@)t}5t,t/t2t}}abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'!0ؐ!1,!1!8!0?!0h!0Đ!0$T!0-Xi T3<& 3#*j- s<% O  :)=Y ݖ !V}kz                  -)9l)9Na:'33"f]yiqsqu:ȁ:΁h:\x!Ӂ z ց e'Q܁Q;k: llE'բuDsz"sсO TU)k: Gs EQ uuu#AkAlias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directoryerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcfrsuv [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dCannot continue job (%s)[%ld] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%ld] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%zu more than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchp:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Illegal number: %sCannot set mode `%s' (%s)HSabtfdscmlrpnvtoo many argumentsunlimited%-13s (-%c %-11s) unlimited error getting limit (%s)error setting limit (%s)internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeIllegal number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultIllegal option %co %s+-Illegal option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Illegal option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Illegal eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sBad file descriptorCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# PS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... illegal signal number: %sunknown signal number: %doption requires an argument -- sillegal job id: %sillegal process%s id: %sevalreturnshifttrapbgchdirletfcinputrcgetoptshashprintffdflagssetvarumaskunaliasulimitwordexpPPID20181212 BUILD:20260802140802Z SMALLNETBSD_SHELLUsage: %s format [arg ...] incomplete escape sequenceunknown escape sequence `\%c'format %s too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed@H dNRwW]a f' 2' I N>/::#4;x@oGrRE~E%I3EYq1l` To-]EŠƊʊΊӊ#Ҋ3ۊ#ڊ3233#. @,-@&6?G̋ԋŋ{ @<5 tC$sCyC$xC ;!)@@2  FN@V^ ffenm܋ @option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gTIOCGLINEDtcgetattrTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together./?pڠ!4?կ_@@@Ţ@̢@Ԣ@ݢ@@@@ @@@@ @#+1e7>DKU]dkq}@@£ʣϣ֣ݣ ͡ҡ %)b 1 MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes failed to read bootarea from sector %uread sector %u len %d looking for labelno space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] VUsage: %s device %s device command [arg [...]] Available commands: rwnot %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. forcesuccessfully scanned %s. %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s Wedge dk name too long; max %zd charactersunknown command: %sstrategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s'unknown command `%c'  3Tg  . Y u T?dx !r#r$&r1r2 3r4r5'6r82989?:X;r<=@ABC3DZEpFGHJLMNOPQRS1T:UBVZWt\~acdefg'h'i'p.qrsrtruDvrwJx^z8Xt+B^v8@1Mprrrr'4F`p1Nf )D_rr !;rN~rG/%lu/%luusage: %s [-aBFfIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1Can't read %s partition table%s partition table invalid, no magic in sector %lldsecondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld decimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. realloc [n] write_disk(); wfd == -1Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Sector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsExtended partition busyExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionOverlaps another extended partitiongiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d Partition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Nested extended partitions are not allowedThe data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafiIluvA:b:c:E:r:s:w:z:bad disktypeBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s size (%lld) is not divisible by sector size (%d)DIOCGDEFLABELCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]I0(zB$O0(0)3<CRY_fksxb *>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s CLEAR (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %lu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %s** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** starting CAN'T CHECK FILE SYSTEM.Alternate super block location: %d conversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'MISSING '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%ldcg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONG (TRUNCATED)TRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****cache missed %ld of %ld (%d%%) cannot allocate quota entryffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-*}22222223'3bV30 76666677h.0.....//0/L/d/(0|/////0)3<CRY_fksxb ;+A|nQn- q+AA|nQn- q+AB|nQn- q+BB|nQn- q+)B4B|nQn- q+BBKB=rGy=iG}WBbB;Mt?mBxBmWC 3KOOBByD<#*=(BB3Dh&ǭBB\ M}-BB-чHB-чHBZIчH0(CIчHB$,CIчHsB7C2IчHRCS'@ )Ѹ^CeC*1@ )ѸCӤ1x )ѸCCa:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuidCan't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:partition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size]New size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverError reading backup GPT information at %#jxNo secondary GPT header; Run recoverNo secondary GPT table; Run recoverDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:sector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidGPT_HDRgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps[[[setifnwkeysetifchansetifpowersavesetifssidsetifpowersavesleepsetifbssidsethidessidsetapbridgesetiffragsetifrtsDaGaJaMasa0raH3za1yaza H3O]h1N]O]* H3u 1aH1a0aH3+i1?]+i* H3YaH1K^1a}^^"]"]^^asetifprefixlensetifflagssetifmetricsetifmtusetifnetmasksetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandusageprintallstatusmaindo_setifpreferencedo_setifcaps0fzi3+yiH3@Z6 H3fl`7@s078Z6 iwc6a79jH3g5BjH3Ljh6Sjh6KjH3RjH3qj|jjjj jjj@jjjj j0k@ kkkUfk#k )k@init_current_mediasetmediamodesetmediaoptsetmediasetmediainstlh lh`ll@lllhDmedia_statusmedia_constructorllAl8FllAl8ll7llll7llk7l@8paddr_matchss]#ssesettunnelmH3m8print_link_addressessetvlanifsetvlano 9on9oo^,SIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockSIOCGIFAFLAG_IN inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeNONEWEP40WEP104TKIPAES-CCMPAES-OCB%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211BSSID/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211CHANNELSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: BSSID too longmalformed BSSID: %sSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS CFPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM ???unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAaf_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6link0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtype [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] mediainstSIOCSIFMEDIA mode %s instance %d media: %s status: supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno networkno carrierno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctlSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@GyTy@`yhyXVloyu@|yzyy yHy vwyyyyyy zO z@'z8zFz]z@~zffsI0(zB$zzOz0(z5zz%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousautomountedextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdup||k_qyq33|vw hyy wTy-Uw@|} }}}!}&}-} bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.||k_qyq33|vw hyy wTy_@`-Uw@~@}yzymount table fullincorrect super blockspecified device does not match mounted device%s on %s: %sreload||k_qyq33|vw hyy wTy_@`-}y~@HXVUw@`y@softdep||k_qyq33|vw hyy wTyUw@usage: mount_kernfs [-o options] /kern mount_point "%s" is a relative path.kernfs on %s||k_qyq33|vw hyy wTy_@`-Uw@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %s||k_qyq33|vw hyy wTy-Uw@Ӂ @ȋϋ׋݋!|  @8A% 0@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s-||k_qyq33|vw hyy wTyUw@}yzyusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o ߗ4lޘ2H{ә)<]њ#Xě%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%uCannot resolve "%s" (%s)%s only supported with IPblocksignals: sigprocmask%s (%s)0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot(){߿ۿ׿ӿϿusage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Checksum error %o, inode %llu file %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%llunot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYSf?_%MmUPBROADCASTDEBUGLOOPBACKPOINTOPOINTRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printbitmask_scanbr~fm u$7< Rlz= 29X\x5Ldim m mMMlV %07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x0x%0*x0x%0*llx%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)%s: this type is unknown to this program ...(%zu more bytes)Invalid port: %sPort out of range: %s%s: !returned size wrong!%.2f %.2f %.2f hw.ncpu%d = %lluuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu 0x%llx %lld.%9.9ld %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d regcomp: %s: %sregexec: %s: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpfetch_urlsendrequestrecvrequest^,# #####***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbervbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20170803malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gzrr|rS- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: filename expected%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: extra characters after \ at the end of %c commandw commandread commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-ifgY$ϣ'r{'^,'^,̥'P'dO'N''''4OM'=^,k'F^,j'P^,ү'Ya'n'u|'^,0'0('f'`'y'y''''#'5O'>^,ǣ'G^,Ƥ'Q԰']ӱ'n^,Ҳ'yԦ'Oѳ'^,'^,'0)3<CRY_fksxb ;+A|nQn- q+AA|nQn- q+AB|nQn- q+BB|nQn- q+)B4B|nQn- q+BBKB=rGy=iG}WBbB;Mt?mBxBmWC 3KOOBByD<#*=(BB3Dh&ǭBB\ M}-BB-чHB-чHBZIчH0(CIчHB$,CIчHsB7C2IчHRCS'@ )Ѹ^CeC*1@ )ѸCӤ1x )ѸCC1 >>>8B>A>\>> ? ?-?inside_ext_partadjust_ext_partmbr_init_default_alignmentsmbr_create_new} ! = ŏ Չ / Q m uM գ q U  mbr_get_generic_part_typembr_get_part_devicembr_freembr_read_from_diskwrite_mbrmbr_write_to_diskmbr_add_part/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6) [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 9.4_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksmount point (or 'none')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-9.4_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-9.4_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-9.4_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-9.4_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsSwitch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Bootable flagSafe eraseUndo changesUnconfigureEditForce umountAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionCannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (ADI_BRH)Kernel (INTERGRATOR)Kernel (IQ80310)Kernel (IQ80321)Kernel (MINI2440)Kernel (TEAMASA_NPWR)Kernel (TS7200)Kernel (RPI)Kernel (KUROBOX_PRO)There is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] [-p] where: -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -r release override release name -C bg:fg use different color scheme -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog9.4_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-9/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/9.4/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filesysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)%s (%s, %s)%s (%s, %s %s)-t -o disk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2 %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %d %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.craidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi/boot/dtb*.dt*./netbsd.ub./netbsd.img./bcm*.dtb%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10schpass -s %s rootsource for 3rd-party packagespasswd -l rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousdisklabel -r %sinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %spartmanlvol%.2dvg%.2ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%lliPartman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.c/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c%s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEparts->disk_size > 0parts != NULLgpt destroy %sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt %s %s -b %llu %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1138: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1100: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2100: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1743: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1773: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2067: internal errorparts->geo_sec != 0t != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2198: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI Boot***************************************************************************************************************************************************************************************************************************************^,# #####usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_handle1control_handle_datacontrol_writeonedhcpcd_reportssiddhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_geteloop_event_add_rweloop_event_delete_writeeloop_q_timeout_add_tveloop_q_timeout_deleteeloop_exiteloop_requeueeloop_signal_set_cbeloop_signal_maskeloop_startxsocketif_discoversplitvadd_environparse_optionTb4cdfez`ffg*ahPaikjfkflflmfno"fpqir-fs4f5tauvrt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleteddeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinTESTSTATIC6ROUTERADVERTUNKNOWNPATH=%sinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=%sif_down=falseif_up=trueif_down=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid=%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'%s: executing `%s' %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%snd6_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtsrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_USELOOPBACK%s: SIOCGIFALIAS%s: if_addrflags6net.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6fwetapxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: %s: truncated leasebootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s not foundNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: timed out contacting a DHCP server, using last lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: dhcp_open%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: %s: short frame header%s: checksum failure from %s%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired, extending lease%s: DHCP lease expiredDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired address %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %snd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_addr%zu=%s%s: delaying IPv6 router solicitation for %0.1f secondsreachable againunreachable%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.cdelayingunicastingbroadcasting%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f secondstimespec_to_double(&state->RT) != 0%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: DHCPv6 DAD completed%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: ignoring unicast option as not master%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to request information%s: DHCPv6 lease expired%s: failed to request address%s: failed to confirm prior address%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%05d %s%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6DUMP6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\Bߣ 3 !3 93 Q3 i3 3 3 )3 3 3 3 4 BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ,ȠРߣ) @40,/etc/group/etc/master.passwdJPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pid !#$*0- ).+(/, '!% #34 :./, .   :       , /.       .  .  .=                               9%'A)*& , ./(&-0;51234<=>?C"DEFHGB$21678 !"#6$@8&&&&&&&&&&&"""""""""""$$$$$$$$$2222221222111\+GU9U   +: januarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresv0%llo%lld0x%llx%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME/usr/share/misc/terminfo%s/.terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist