'V2i]0_t#NetBSD/earm ramdisk 08}i<  }iCt$t t}i@@<@T 08}i<  }iCt$t t}i@@<@TU }it`A}i}i}iA}i}i}iA.}i}i}iPX`A}i}i}iA}i}i}iuA}i}i}iwA}i}i}iA}i}i}iA}i}i}iA}i}i}iC}i}i}iA}i}i}iA}i}i}i$ }i}i}imC4"}i}i}i (08@HPX`hpx$Q}i}i}i8@HPX`hpxG$\}i}i}iH$O}i}i}i@$Q}i}i}i (08@HF!}i}i}i a}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}ia}i}i}ia}i}i}ia}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}ia}i}i}i a}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}i!}i}i}i4!}i}i}i!}i}i}i!}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i B!}i}i}i B!}i}i}i!}i}i}i"!}i}i}i"!}i}i}i"a}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}ia}i}i}ia}i}i}ia}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}ia}i}i}i a}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i!}i}i}i!}i}i}i!}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i!}i}i}i !}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i!}i}i}i!}i}i}i!}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i!}i}i}i !}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i !}i}i}i!}i}i}i !}i}i}i!}i}i}i!}i}i}i!}i}i}i?\!}i}i}i>\!}i}i}i=\!}i}i}i<\!}i}i}i;\!}i}i}i:\!}i}i}i9\!}i}i}i8\!}i}i}i?\!}i}i}i>\!}i}i}i=\!}i}i}i<\!}i}i}i;\!}i}i}i:\!}i}i}i9\!}i}i}i8\!}i}i}i:\!}i}i}i7\!}i}i}i6\!}i}i}i5\!}i}i}i4\!}i}i}i3\!}i}i}i2\!}i}i}i1\!}i}i}i0\!}i}i}i7\!}i}i}i6\!}i}i}i5\!}i}i}i4\!}i}i}i3\!}i}i}i2\!}i}i}i1\!}i}i}i0\!}i}i}i2\!}i}i}i/\!}i}i}i.\!}i}i}i-\!}i}i}i,\!}i}i}i+\!}i}i}i*\!}i}i}i)\!}i}i}i(\!}i}i}i/\!}i}i}i.\!}i}i}i-\!}i}i}i,\!}i}i}i+\!}i}i}i*\!}i}i}i)\!}i}i}i(\!}i}i}i*\!}i}i}i'\!}i}i}i&\!}i}i}i%\!}i}i}i$\!}i}i}i#\!}i}i}i"\!}i}i}i!\!}i}i}i \!}i}i}i'\!}i}i}i&\!}i}i}i%\!}i}i}i$\!}i}i}i#\!}i}i}i"\!}i}i}i!\!}i}i}i \!}i}i}i"\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i \!}i}i}i \!}i}i}i \!}i}i}i \!}i}i}i \!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i \!}i}i}i \!}i}i}i \!}i}i}i \!}i}i}i \!}i}i}i\!}i}i}i \!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i\!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i!}i}i}i!}i}i}i!}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i!}i}i}i !}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i !}i}i}i!}i}i}i !}i}i}i!}i}i}i!}i}i}i$!}i}i}i4!}i}i}i!}i}i}i!}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i !}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}i!}i}i}ia}i}i}ia}i}i}i!}i}i}i!}i}i}i!}i}i}ia}i}i}i a}i}i}ia}i}i}i a}i}i}ia}i}i}ia}i}i}ia}i}i}i?\a}i}i}i>\a}i}i}i=\a}i}i}i<\a}i}i}i;\a}i}i}i:\a}i}i}i9\a}i}i}i8\a}i}i}i?\a}i}i}i>\a}i}i}i=\a}i}i}i<\a}i}i}i;\a}i}i}i:\a}i}i}i9\a}i}i}i8\a}i}i}i:\a}i}i}i7\a}i}i}i6\a}i}i}i5\a}i}i}i4\a}i}i}i3\a}i}i}i2\a}i}i}i1\a}i}i}i0\a}i}i}i7\a}i}i}i6\a}i}i}i5\a}i}i}i4\a}i}i}i3\a}i}i}i2\a}i}i}i1\a}i}i}i0\a}i}i}i2\a}i}i}i/\a}i}i}i.\a}i}i}i-\a}i}i}i,\a}i}i}i+\a}i}i}i*\a}i}i}i)\a}i}i}i(\a}i}i}i/\a}i}i}i.\a}i}i}i-\a}i}i}i,\a}i}i}i+\a}i}i}i*\a}i}i}i)\a}i}i}i(\a}i}i}i*\a}i}i}i'\a}i}i}i&\a}i}i}i%\a}i}i}i$\a}i}i}i#\a}i}i}i"\a}i}i}i!\a}i}i}i \a}i}i}i'\a}i}i}i&\a}i}i}i%\a}i}i}i$\a}i}i}i#\a}i}i}i"\a}i}i}i!\a}i}i}i \a}i}i}i"\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i \a}i}i}i \a}i}i}i \a}i}i}i \a}i}i}i \a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i \a}i}i}i \a}i}i}i \a}i}i}i \a}i}i}i \a}i}i}i\a}i}i}i \a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\a}i}i}i\ !}i}i}ii!}i}i}i!}i}i}i!}i}i}i a}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}ia}i}i}ia}i}i}ia}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}i a}i}i}ia}i}i}i a}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}i!}i}i}i!}i}i}ia}i}i}ia}i}i}i!}i}i}i!}i}i}i!}i}i}i B!}i}i}i B!}i}i}i!}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}ia}i}i}i!}i}i}i!}i}i}ia}i}i}i a}i}i}ia}i}i}i a}i}i}ia}i}i}ia}i}i}i}i}i}ibpf!}i}i}i $}i}i}ig$}i}i}ih$}i}i}iN$s}i}i}ik$}i}i}ip$}i}i}irA}i}i}ivm}i}i}ix$2}i}i}i $}i}i}iA}i}i}iA}i}i}iA}i}i}iA}i}i}iA}i}i}iA}i}i}iA}i}i}iA}i}i}iA}i}i}iA}i}i}iaqtޔ4n\PT?L@=vo|}GRL޿Qh01^50*> +tQv{~_zD!f3Er*d/4"x6Xuuw 5[J&(;exT}5{poHsVu-e8k,sV϶$}x+~[_$9[_ > *].9T1j5o~CwN=H;_5<1wyQhvq812r 1&[Dw7#y9PX32,Q|F6W]d51j9p?t"s<Qxȳ1~0'3Lukzv{1mrU znb/>{qUUTL0$=`L'2G.FwMJ.KKtbx:w 3_jǺ/XRo]%H"2 X=S&94pQI QuӶl5$zt . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.2.102.1 2020/01/28 10:20:24 msaitoh Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=vt100 export TERM HOME=/ export HOME umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? echo '' # mount the ramdisk read write mount -u $ROOTDEV / # mount the kern_fs so that we can examine the dmesg state mount -t kernfs /kern /kern # run the installation or upgrade script. sysinst || stty sane fi  . .. catchmod cp dd df ed ln lsmkdir mv pax pwd rmrmdir shsttysyncchgrpELF(4"4 ( H!H&H& H4H!H&H&NetBSD5NetBSDearm9 0-D D0 @@0@TL0(P0PEPP03/T0p%,G% -l ll0 @0LT( R@ppGppP`03/T0@S p`Tp% -pL M`QK \1 T1`p0\0: 81 0S  /S 0SP 00S5 0@0@T*P0PEPP03/T@0@0T*P0PEPP03/U 忣L d0 00 P0 0 ~o%L`DF%,F%l& | -xLtPl@d`hPP "ylpPOU P @|'T P-L@ KhnH0`  BR` pR R>X X/'P' -pP  b L00CS0w*p@ ZE0S TX 0S7  0T0R0S p ||sx16@' 0@ LA\r000`00816@08 0S !U16@ 0S $p @ T T 0S ^p Ip0S TMwp -sp @000 ^ip T@?0 @ ' 'P''t  -@Pp`0L M00S 00 cmP 00P@P p0 P00S(K @0 P0:T0`00 )' 'obt -LM1Vu/ @X$0%XS(0SKXP<0 S(0(` VB P$崄$0S;(00$0( $`P  \00 KH7p$ P`Vp' ' 't  -LMPXqXa@T1tHLL$H00SE 0 lP0@tH$H) h R r@PKp0: S {O0 P00S(KU@P0 P0c0s 8#8T ]T b7' 'obt -LH 0 2' 000/ ( -LM@`P l0 }; T0!u; 0 "  `@(K (Y@' -L$M@4K00@K P K=  d1-000`QzL@ 5 -PP o0SP P0V;0' P P W+ 0X'pnV  pn0-S tP`PPL@p ,PP0SV  t&JT, (^ -LM5  R  @P (K hpp |P@p5X`0S `50ST50S D50S,50S+ U%@E%00CS0s(P줟 Pp  PYU G@0 P00CS0 Z(0 YKL }ps8\'00 fp 4pPe 0 K \@P0@@ K K 00 30 -KP0 00 0 \00Sk 00 0 p  VHp ]  p@T T1#0 C0 P< @P @肟0S 5P T\10: S200 HH/ l+  T+ pP.K ?.K0@DS .KKQTT&@ 0 Hp  0S00S ttN-K ?-K0S -KK.( K0P  0T-K8@T \@@0 00R0S 0  0 0RKP @;P ll @0S LP@ 0Rt0l00eP 0 (t&t (H (L (@ (4 ('j' (D (y$ ( '( (8 ( 0-LMPAK@A p  0K0U4@ h0P XXK0AK<@PAKA,(0P Xt&D ( Q0-L@ X P HH00P$($0P0K0ht&D ( Q0-L@ \P LLy0"0EP$($0P0K0ht&D ( -L 0 P'0$/p (0$/ ( -Ls4 -Ll4 -Le4 -L^4i 1-LM  0 0 K ` ( 1-LM  0 0 K ( 1-LM  0 0 K(p ( 0-LM  0 0 K4!( 0-LM  000 K`~ (p ( 0-LM $ 0 P2 KKx& 1-LM (0 x00 KV!( -LM800 0 0 ^0 Kh (b ( -LM800 0 0 G0 Kh (tp ( ,0-`LM!A!qPU0 x! R0B=00 B  PZ0H!@!7 Q8A 40100 KP l3=ZP 000PS  $K 0p P4  04 00003/Q ! 7000@080L73D0 (p (h (#= !() d`G  0-LP@|P00!QP800 ` p0 A R0SR !(p ( (0  /p ( (  - L2rt -L  - L2pt -L -L M@qMPKh' KXPK -(PLU@𨝈80 03/`P28003/(`  -LM80@0K(3/P $ 208 : S( 0p K3/P   00 0K00 0 1/0 QPj0S 00tm8@ p-@P`LM, KL380 (0(3/@}j P,K&wjPKp ( -L$MhCP` XSD @0 $KZ#K@30F 0 # p8p (1/0 QP$ 52! 0P܃KR K0 <0`Mr<  ?P#K0#K0$ T2!j0S$ < 0#K0 r# 0#1!Z#! 0 ԃK40`# 0ԃK#$K SRtq!ԄK SR !$KDq P0!YX(:$Kq!! 0!#KKSR 0 0S0$0u~ 0$ #KKR 0K 0  AM 000L0! PAamZ0 4(Ko9(K (P (h (  t!(  E -LM2 @  l  0  P_K|0e0}s'/b%1#H}*K/*K@_@XP0!!!! d K !@PKdK " StRp d!dKKdK " S$R  !dKKdK # SR  dKKdK ?8p<` !0Y/0cd0 /]dX dp`KKdK $K` (!( bH    N @-LI  -LMa P00@4p! %@8@0 (1/0 QP$ , $K`尀T 80 $0(3/P 0 PUP@Dd 0S0C0Pr00  Y$?$ m0p (h (tx&C  -LMxQ 004@  "80 @(04/0 QP$ G0=  (0 80"K0, K(3/P$K80 $0(3/P`p#SR $ 0P2K80(P 0, Kl(3/pTP #SR !QP` p `p (tm P-0L 0@M00 0K0K K .Km  -LMp K}(`P @PD/KdPKPNV@t  -\@LP`UPE  _PoQh!( -ML M<1` Q Q  Q 0S)(Ko0(0P@╦&` 0S00S 0  P p0啧'S D $`0`N@T(KK@` K>K0CKKZ r-P K Ah!( 1-PL@ 1 QP p 1 ɼP Kgt pld1P `R3P000@1U@@@@P,gv 00CS000   9 0@0CS000l00 V0U0 fG< 8L şX$(p$(x$(t$({'!(!(5=!(\ 0-LR RS 0S Rt0X$(c 0-<<@L000(!S& PPP P100 PU0P0SU0T@'00 q 0LPPP 0Pp0P P0CPU0P  0!(!(x&%(X$(!( 0-DP@L00 00@0@000000H'(%( -`LPP@ Lf< 84@0p S@Dt0S  姻P)fs ;0000 U0T0?x` 0 fV< 8L  @ {'5=p$(t$(x$( 0 -0 L?0<PTYP@@aP  0P/S0 @PtZ3p` `\0PH o@ %(%(!(!(/t$(t2 -`LP ^P|@ @e 0``>\8P PP  = P@P 00@t$(!('Hp$(x$( D0P-PL ,@, P  0 0t$(!(  -DL@fP(0( 00000 S%('X$($(@-44@@00  AR   !($(//// -P`0LSp.@l000Pe` 00CS000  #0`0CS0P000 %(%(%(!({'5=!(A- px0x `t0PF@0P\0U00VXUp00%(%(%(H0-D @00^P0 0Q0%(%(%( -PL Mp 4K7]Ut2taP4@K 0K)@P(K@8b P PUT  PtP00 :  R R1S7{aP 0KP 00SYA嘑S@ @@  P?Kd\ XT00CS0<10) 0`00SAaPT 0@0@00S P P  QP 000CS0\00@0  \I%(H'(%('!(!({'5=!(_vy -@xPx`0L00h0@`0@\0@X0@0@0CS0800 !(%(%(%(%(%(!( -L M@p0P U U[(K `P 0崀 尐RP00@P0S1P 0S 0 J0 0 oP P@TP%(%(%(%(`@-`0 @CT`@ pT00 P0S@XX0X ' -L M@r崂0SX pP_0`^ `Vx000l2Tpp`2pp00 P00] 0p0CS0 20d Ub10P 10 10Sd 10S` V`F]Z 40`0CS010?PU0 Pd1@ 00CS0 0 P U !Q00 000T````P0 b  }w00CS000 0@ b l hfh``(KT (0`0   0 #(%(!(%(!(%(%({'5= -LM$R< r000 040 200010S O@1a0<@0 0P80 @0(<0I?oT20SU 400 SRP ;0S RY@T  Y 0 0  4 00$10S@@ @0 1 P@000CS000 (K VS  v0P  BR p 8 @0S Y04 0(%(%(%(#(H'(!('%(!( -0L!S@`PPa= 0|EpP0!S yP a! 0HH}H<00S ,q$0@'"(H'( -P@lpL`V0S vP a$ JD莠#({' -L MpP0` 00 R O@ȐȠU00U0S 000S D@@P(K 0R R L R  0 40 P40P@`#(%(%(%( -p0L!SP`@P`:a 0@' P0!S P ag 0LLL@00S 0T@G@!'(@"( -PL M@b00CS05p \ @T࡟A܁00 001UppppP0 #` |v00CS0Jt10 P0@P@0 6 0p0CS0100S00 R 000 0 0 (K0@ ` h2|, 0`00\0 @`0T00T  '%(%(!({'5=!(%(L'(%(Yd -L M$p0 P0 SPEUP(KE P 0"00@S0 Ub  P7`  00C0S.h20 & D00CS0$200 X 0 C00S P䡟PEP  R R  `V' V ,x4 P4  _0D @< 00C0  BR  !  fXY PFP 00 C00SPF V0000VPPPPgP 0P0CS0<00tv00`A%(!(!({'5=!(%(_ -@LP`p @`U / 0@S@@ @^R00\P0S \Z lMP h0 @@P*0@00vx&{P'  -LMT @0D K|P 1[S( 0C01[S 0C0 K!(ht@x& `0` 0-SP0 R0LRP$ S %(%(%(%(c -LMPpP@ `X 0S@ @0S @T@@DT 0 rP 00S 0 0 0 P(KH'(%(%( -PPLpb t0t0S`@T>P 0 PP@ Pc %(H'( T0-0L0084 ,0aA!R    '%(%( @0-0L00 $0a@ Kh  '%( -L M䂟Pr0 ` R  36㤂嬢 @-T @%T[ . T $T T-00  R ,#U\ 4 0^4  @q J4 $^4 "QD  (K``+T ('Tc V YB! R=9T0T7*.TI /TQ3 Y /DoP Q  ?T ^T ;TQ 0;T000 0!0,^T-T b @^T-T  Q]0 0O!@r] "RQ  .T  <0Q 00-P%( 'H'(%(%(%(c 0-@p0P0`娀L00*P 000000 ,R;R 0S  S   0;SRp%(H'(%(%(%(p@- 0 P@@ SR@@\ paVQ B0%(%( 0-LP@P F], ($ 0 00{'5= Q-L 0Q\SAo 0- LR,  @0`S! P}PpP XPP D@P w0 S@/R/    0 y!(%(! ,0-LQ  @!( 80- LR\ @> !(@&( -`q匁L10SPW h1P00S S L!`0`00P0S00 S@P0.S0 S 䐟@ 0007PP 00CS0$0 \ V  T d0 00CS00 `PH'(%(%(%('!(%( -L M 0`R`FppVRQ0 0@00wtp00 1 10S M l1 00CS0M=?(K iP00CS0+  R  YP A R#;`8p p  R000`00C0@\0@0  p`%(%(%(!(H'(%(%( -@DQL81 0R``S`qVPBP@PD`B@PU.000]P 00CS0)0 {" .Y P  h0 00CS00PU*P`%(%(H'(!(%( -Q 0L0@0P` 00CS010 5* {PpH0SӉ00S c 0@D@@C\0pT0 0@0CS0!(%(%(H'(%( -L M2`0pSROPB U$t0 @Sl000P2XPPPPPRZF  00CS00& t0P  R/ R 00 P00Z ||v00CS00    BR   LS0P0 P0CS00 7S P0P0`F`05P  P  X0 00CS0(K%(!({'5=H'(%( -ALpXP `0C AR1 0 C000 `PKZ 00CS00  Y00CS`00 \R pR p!({'5= -L M0D00 0@S 0S $0KePp(K00$S/T SPPP ( PY7 00CS00  0$P0CS(00! P(0( 0 S- R0003U````pP0 0`0CS00 (=R#0P  !@o!S? %S $ Z)0(0043U?P}Y $00CS00 k0$0CS(000( 000\Q0 0 PR$ $ R0(002UP 0$0CS(00WY0 (0 0S 0S꜁p0$pS Sp|  ( P 0$p0CS(00*,0(0P E S:p00  ,0S pT$0 P (00PE0 BR0    P00(0PQ 0$0CS(00 !(%({'5=%(D'(%(y!( ,0-LQ  @!( \00-0LS@ 0!S 8UP /+GP 900!( -LMA00 S1"Q,q`WX0|0001PCoX 00CS00. 7000 @P R8 R  KPK0!S #P @ e 0 Sڼ P0,q0CS00000 0 0  \00mP 0  00%( '!({'5=%(  -P?L0@ @T@ "C`hV  1QVB EVO !Va =VE V??P? HV PV GV cV WV aV VVeV :fVx gVqV 9lVb jV1 (o Pp  @ 0n\O p\H l\I 00 SnV f:pV|>qP 0nP pP lP 00 S ? quV1 2sV8  >UPvn NPo>0SH pW=0W@ 0nQ  pQ lQ 00 SCh=0Si vJwV /:xVs zVs<=$=P<0010CSx 0nP pP lP 00 S<<00S@0 0nQ pQ lQ 00 S   @@<<0S \<2PP@NlP 0nQ pQ lQ 00 S;0S ;;dP@0@@pkP@ 0nQ! pQ lQ 00 S;0S <;;;P$+0 S00@0@@* R *4!R@ * R4 000@ `P @ 0nQ, pQ% lQ& 00 SmH:Px Pt|P@0S!S  UN0S i,0S,`\ N@0@@KPRk t9 0)0)0t) R000@ P< 0!S( @ 0nP pP lP 00 S0S NIq@0@@|x@TD8PG@oGFBoP㨂VVP 0nQ pQ lQ 00 S000C@0@@70SH 0nQ pQ lQ 00 S@'0S! 44t@0@@h70S( 0nQ pQ lQ 00 S,'810cS81@0@@0S@@0 0nQ pQ lQ 00 S\60S@@@06^P 0nQ pQ lQ 00 Sa50S55P :c@0@@@0@@x50PQ 0nQ pQ lQ 00 S 2X505vP@:@0@@4 P-tdP&40SXz40Xv X@@ X@TH 0nQ pQ lQ 00 S 40S@0@@3P 0nQ pQ lQ 00 S  @0@@ 0B  30S3@ 0nQ pQ lQ 00 S3 R" R#  @0@@30S0 nR pR lR 0 S20S@ 241SqV@@000@ t20Sd2 X2 `P~ @ 0nQ1 pQ* lQ+ 00 S_10SR,0S0!S ,ML0S,0S a1LPS 10S l1 @0@@la0 9R'0Rf* RU T( 8130   \  R]\0 -LM⤁`Pp0 SS(1PG(!RJt,000d1U````@P.QE4 0,00CS010 [S@ \S @p@P0 S|@ 0(a0CS,A0t00,A YJ P0 0pS 0(Koh%(#(!({'5=!(lF%( -(!L0 PB@ P00!@R60A0S S f`P@ P0P 00S,'@0@00 tP0A p0\ 000AP@0^Q0 ,(%(#(] #(#('{'5= -L M"R0%Q Q0Q0(K N`AQhu Q@%PoA2 Ry 0001T````P\PD 00C0>\QK@ Q10S xxaP2 00P S,00 S 0S00  T````}P00P a[00C0S{00z 0`00@hp@X0`00CS0400cH 0@  V%(`'(!(P'(!({'5=%(%('X'( -@䀟@0@L Y0Pp`@ P" 0 R00 R000 1BQXP@ @X@pKP0"S,@gR000%(X'( -LM@40 3s`0 80 80#0 嬃0FSP Tc0003T00PP 0P0CS0H30?A 30 10&SM 0AQ 00CR@:` QP\@0 < P< @0O) 00C0S @(KH20  PAQ \S0H 01BQC40 BR?  AQ 0J R@+` QP\La@ <0 HP<0@  O +%00C0PAQ T`<0  T  PP<0 P P  BR D ~  `@N`'(T'(X'(\'(!(!({'5= -LM2 @" 0P2 40S 0 0 $2 00 ?KePP (K@b8R 442S PS202 2pW 2 3   W ,(" P("N7   B R30  \3  BR P3030S 0 y "XG0 Kz@P"2Q Q 000""2 0 0?K P 2$"Ph"PEp0ZnP" PWppp 22 BP2"N~N %00C0S pW,ڼ1 (2   W , " P "(22 [Np lh2  B k<  BR 010eg00S 0  F@|0p0CS000HJU ڃ?K 02 X00S 0  F@ <F2S%(T'(\'(!({'5=!(q -pLM`ḁA0Q0C4 8 0< 1< 0 0C SWQOp~  80 4P(K5 LP!000 000 _P00CS000  X  00 S00CS0x00pP   P%(H'(!(%(T'(!( -LM 2 B b@ prD0  0s (KQ0S 1 !0 000 PP@% L:!8PK J ^ 0Gt10S Q0D 00p0@0@!000CS0B,1: X (\xx     "     B   @  CL %(x&H'(L$(%(!(%(!( -PL` 0 C,r 0h 0 `0 \   BP L @pT Sp@L$(H'(x&%( -P0 @0LRp` d00]0P@ P0@ @04(@0 4"@L, (*$$0@@L$({'5= -LI0 ' -GMLM\5p PR@`<%QGK454A03/P (K:K,0C1: S@L00W K+ @)DtPD2L?0GK4A\P:K,0C1: S 0S GK4AAP:K,0C1: S 0S 0S 0/S.GK4A,P ?GK4A0G-K0P8 B00S IP0 `K @P  K0#,@PJK,@DK+ @CK @0P KD#P @GKK4A @P z/`Pp/p`PH0P="GZ9HY6U.0B~K pG0 G-K< B0 ;D,0K G=K<0C04JEKAPT.00 'D,0K ICKAP K,LL)LQP!LSR G=K80C0 ?oR2  R 0S= :K,0C1: S7P6   R0S/ T;XpH DX00CS0G Pp  YX  X0 X 00CS0 .0 F0S ppWP 0 hA R;c 00d'(0`tV{C oP'''\\ H\0\HX X0-dDT V H H0R\\G/0X X-dDT V HH Q\\G/X X0-cCT V 8 80R\\G/0X X-cCT V 88 Q\\G/X X0-eET V X X0R\\G/0X X-eET V XX Q\\qG/X00-GX0'RT00\\]G0/X -gX 0GT V \\HG/5S %R R S R0 S%S D\L\S R 00/0/0'('( -LMQ | 50S50S50ppP 0@.K.K-K/K/KP P P P P P P T0SY \0 0Wt X0 s /K&K/K&KL50S0T0 NK45 B@_?.E%KK^E4T 0S$0@B?ET 0P0 0KL0 .K $wKHE0H $KoK@Ex4D 0S0@0 -K KT$`K1EH4@ 0S<$0@B?E@ 0Y<0 8 4  0$KIKE 0#8 KAKE8@0 \ 4 @ C@Q8 CtK03/0 0l30S Xp]5 SS $\ L] 0!43 @^!RS3 00 R0!W0 X`'*K K.KR0 0.K!KQP.K10 R0!0 '-K K-KR0 0-K  \ (tŸ0. S 0dŸ. Z0 /K K 0 K/K/K0 /K10Sk 2QD 0! K0K0 1Q? 0! K0K0 }D0 S00 vD 0R t!P h1 PgD0S00 1 01 0`P\0.Sv10Sr 0!f "0P0  "0P0  0   R 1?`000 ?(K(((('((('(((VUUU# u'('('(((ob'( -L M@1!0S ?PP# ?BO1`V (Ko@q0S`l||@@P AH@u@=H@;H0SJ D!50CS,\\$o\ \00L0S \0.S00S 0S 0S 8A0 00 00R0S  AY @0 0(K'('('('('('( -L M`p. :PY 4 KP3[S&00&0&0 P P6ȆF  &p?66`F0S60S60S x;P [{D6`6` \Fr  P6 0RS8Q ,Q QQPQ QP 5 1@GPx$HT ,<`lthXȭЭܬ 4DLd|4 4 0p$0t$ H4 0P$0p$0L$04$0X4$0s0 0 $00$0($0#0# 3 0#0#0#0#0 3 7 3 0# 3 0#0#0|# 3 3  |3 p3X3 PPX3 P3 P208#00#0 #003 2 22+2 2  2 2 2 20"222`2000h"02 $2 2d22 T200@PU8 4"S QP010S Z 0/S 040!0 R2 S" S# S1 H10S1 10S|10Sp100S`1`1V L0(K81000S$100S11S S S00x00S0`00S00ht@x&'((('(& (('(:(((('((('('('('('('('('('('('('((((('('((('('('('('̜ hlп8x& ؞@@tܜ <00-@LTP @@\0'(U <00-@LTP @@\0'(U -LML \0RK @rK+AK@]pE.K0 B? K 0K0 @X 0K04@lh00S\00S AKD00S AKAKtB'C O'('('($0\ 0S '(C t -LM0L0S 00S00S 00S ! $K~pt $Kh]KШ\0\@ X0R@`L0 B ?5 0I(('(((m}((Ta'(`@-`0 @CT`@ pT00 P0S@X<X0X ' -L$0KMcGP؀ @Y00S  X $K"KtP@`pV#K0 #K R0P0 X @T'('( : S-L  S  S/ I* S  S%|@= -LMx1`@TXP !\@T10S H10S/ ' ,,KpY , K@00S00S( 0@0S00S 0: S@ K0p d0Rp0 B ?? 0gT00S m(('(((m['('('('((('('( 0-P@LT0!SR ,} @ -L0M@ȭ<3830S` s V$K!SR{ 0XPS !,0S '20Sk 4 "; $@Kp @ K 8KѴ00 8Kd\20S 8H (8420S  $ 0 : SI("2!$!6000 0@0<0?10SR 10S10SO 10S10S : S0: S f`yP1 H1R@1 B ?> 0 'Q @Kp~ @ K4}`^4 t00S00S s'('((('(((m[((((%+'('('('('((('('('( -LM10@S,0010S 10S40 0010S10S qP0S(Ko|0taQ 0P 0 `Qp   0 lpPQpt140 W-1!SR` ,  80 R4   V 080R4 0 X P < 80 <  (K(('((('('(x&x&'( -@10LS,0@0 10S 10S40 0000S00S 0PU,KoE`눠PU ,KoC!SR V ;`0,S4  pY`P +p(('((('('(x& 0-@0T,@0@SL` (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (0 00S40 00@P0p0夀S㤐@W $Kk!SR U ,P0 00 S P0,S4  ePp (('((('(x& -L$M @4K)p KTP 0@K QQS  (04K0T P P' 0-0LS``P]=@P D>P T @P8  4PV'(t -LBMP5= `IKAA K=A@ĐU *FI?K JKpP(K@$Kw K? @IKPAw0S K?(PnPK?j@P' -L+ ' 000/ (( -L0 ' -L$M $ 0P ! 0$0A0 0P0!1 $$ϪZ Kq/pŪ K "$ 0P @0 0 0ph0#K P/pX   DHU"$  (0U ((NSH= t[g -LM`@PQ `Pn @0Sr   u`-P 0S) P e Vd00CS0?pp W 00CS07 p7 pYW `(K0S P KPpPK [ 4 Rd`k0 K0 p0 P 0S  K|P 0: SPDKk P (V0: SP P٩ `0S 0/K  `PC DMP``    V 8屩P $媩/K ?/K0S KeK00  10A?K 0AK @l/K `0 p|  p|} K0KK0K  P 8k  P ?0S ^0;0  P S@ P ?0-S @ F nPQpPh`V  <D` (((j''\ ݔtY@y + p-L M@$K`P P!0P8 U $$% #KpU $\@$ 0 P4 @x& -~ML MA~lK0S,`F 0pKPF,H t0F~UP?X! ~,P >0!3P(K0 0F~8P> ~,PP> ~,P0pF 0F~PYp  `Q `H30 00FP>>$ 3x&mBk00CS0 0 / -LLMDPp n000d$t000 0000S@Ud4d$P p P4Q !0SJ^,$*P]>0$=3U0#03 p 3Q  # P0 0<>0#3U0l#0P3 P#P &>0<#3 3,# F$3PaP>20"20 0(Kmp 0: S|2 2 S"d K?P000PQ+(0pUUyU00u U!424"00,"000 S0 0 0050 QP=0S0 00 01Q>~, 4Up! R   `B^ PQU 00 $1~,s*~<~lp00 ;0  K08lVp0YU 0W,U (U&Kሀ|0`V K ?80\0``x&@(((}&د(x&ܯ(x&x&(X((/m8@((x&} -~MLM@00S 4@0S~K~,APK@((x& -0L Mx@$0t00S K0 0050P =, 1pPx&@((` P0- LR<1P 0 0 {1@(((( -p`P@L PPEU`@T@ -p`P@L nPPEU`@T@ 0-@LT `ڤP0 So@P 0 Q @;;S _@P00T@ <(0( t1( 1x&@((( -LM(Rp@`TQ W0q@$00F P000S S1TIT 0$0Pڀ;;S 0 0074P0 P?P@@00* B<0S@@<<0ES7<0SP0<0 S@0@K$<0S <0S <0S $0STڄ00Q Q`0T( L0;(00 0$x&@((2\p( -LM\1 R*PA R& D!  BR8 RQ:QQ6R   K $ KP000S&B0% Q`PV Q0P l3P0 0 7 V0P3P0  $0K@((x&}&mK{ -pP0 PL M` (K@PڼAQO3P0 0QP 0pp<30P0R;< 30P 0Sx&@(( -LMA`pPP:x10S8 SV0\A00,V00 3P0;!/ P0R(0S 02P0; / K Pڌ0V 0?X60 dq/0( , KL2K.P:(0, /x&@((;`(km -ML_U ( D e t   400-L@ap0op`0 }& -L MlL!\PV#0V`@XP@% P PV 4$@$PUP; rP8T00S P,L 01#00 3/P0  QT00S |5,@ETh Ad 14p4s'@0p(K(,|&{&((|&}& ((p(  -LMQ0@p`0ᐡ0@ G80 80S P`V4PX+. PT-810S0 ,+`0@"0$0 3/0P& 0 R T @ A0 0800 K3/P0P0t00Sx t+ Q < 480 2/P80 <  (Kp(((( !}&/!R!((x!!( -LAM`/K@PKpA^K PEpnP/0P0 V`0` +L0o"./0P0 0PP0 +(!((!00CS0 0 / -L,M0C80 0PY BP(Kk P0,03/P000@0 gT3K0S DsDcPP  PP 080 30SvY T P U1!PK#P ꤂4 CSR P8Kl!d (P8 [67<";+ H 0/SP1  AX 8K 10S 8P0S !S$KL!x000@03/`P 8KT X `1  0S DQ0S ,1;008K Ph04 KD083/8KP 0S ؀0S 0 `U0403/Y 00S M"*KP0h0CP0zPvPp((((((E"(( ((((((( 0-D@LP5( *0O10((_" 0-Lp@ K0h5 }*0|" 0-L@@p50 m*K0h" p-LM`p@z50S  S S q5KPp 0: S f5PKpS NS@ -LMWP KQ0H03/P0 03/P`plAPB 0AS0, K@0a3/P,1 C"K\P)3 P/P P0/SP0 AL0 00$06@ 4t )0(03/ X$0 CPp(((((P''"( -LMP(KTE0H03/P0 03/P P㇞5 K0S 5P 4$)40STjE$P 0(03/ S!_QP 0AS0 K@0ad3/PX4؀C,Ke8P (4Ѐ CfP 40S KP s0S30S KP 3R0 S =(KR03'KR0`(PLP 8{S@3(K0/SP/ Ass0S20S KVP0SU 20S =(KR02'KR00S "SA-K<%4S P P20Sd@20S Pp4S S/ 0CS)KC 0S%q  GX G0S% q0S! 100=(KH` l1 $ L0SpUpP 1p$Ѐ G G0 K@03/0S3 0S p0S 000ZX0؀C,Ke4S 0S 0p(( }&"(((((((((P(@(((((((}&( -bL@`PP@T  T 0 'H03/P0 03/Pq0S0 X P0S t1t p1޵ d1 PL10S@aMP  P0  DP0(03/@Pt(P0S00S @0S 0 000P@^ t᛾0S PX Pp("((("((((r( \0-0LScPDP$00H03/P Kh(p( -MLM0TÎK$< * P`10[/S &'p0W3MK/S/000p @D0`P208$j'(K<: S 5P PP30S$;f< }S PԜ NP30S30SF &P= xx[ PH+f/Q  0*<P &b0P0"2 0RŸ S "P0%R0S$tP `D L*PX0S'L20S#@0S 42  $2 "00020S, uP+0Sw Q0Ss 1 00mP0S 10S $]R0|1%R0U]$LQ$R R00  BRD E P E < jP <17 |& E E1PKA EG   EyP  EKA$9 ( )#G#n#((((((# ((((((((P((E" 00-P@L00S0000 ~ R~<Ôʂ;;S <|%0l0 h0 d0P L0 0 000P 1((.(p(##(x&د(( 00-@L000S0 R ~ R~<Èʂ;;S K P/`:8!$P[?K_K R0 d!R MP0PP(K=]K!SR 0*($WK ᾼPo/:8P N$G?K(KSR *0( (x&.(-%U%z%%% -@L 0SP`pPP 0|000 `` 0S0 0P$0 0P .(x&p((( 0- @PLM"K0$K@a B?P 0P0 1p_0 k*G1"0, KPlP"K@T#KP 0@P#K 0 0T0 @P0P00 P 00T@P.((( -P`lpLV @P[PPEUPP@@  >'`F.( -LM=Ё0`QP 0 AKֻP?D@TL0 q 0@ 0 X0 @P PRX00K0 0KP$0V R =P0 X040 0SP(KG. 0 '#L 0 R   SQ0XZ4 S <"V0 0 .( (-%% -L M10 P0p㴑a|Q9 @_0 Z p0-  & 000 SJ P08l" 0P  1p 0 @00000Tp(K00C0P @_0 0 0PBp R&00t00Q HQ 0 P0   0 SB((x&.(&(p( 0-8@L0P0P E;-0PK0hl.(x& -pPp`LU @PL0YP U@@0 &00pPE.(x& -`pကLV0 @PX04P_V0@@0 P,`V00p.(x& -LMP =@a  UK%X10S UKiP-:8(!! V00" J(!8 @P0P`$K?V  ᶸP0`VK4PJ,8X E?K'KQP J(@ J,8, !`(.(G&x&h&6& 0Q0-L0JTUPP,0P !P0ϹP,4$ !\0 400&&( -LMPKùP\0@T@ K [bWV *KQP ! K@(& 0-LMPK@ឹPK000S0: S|s)PظPU S,0D 3!kP 0D,0 (E &(& 0-LM@ K+K 0 S 1 PR 00SKRP#0S'Kt,KX 00S&Kd+KN KᖸP ,0NS ,0T  K0+08 0SKBp}&}&.'' -L@P`8P  P $0&+0  (Y' 0-!L@׷P0$0+0 K0h (w' -LMP0p/S`/;@P: 0K0͸P/00 p /00KᲸP&  P!0S  ᒸP K᧸P[0 KD/00`v (K( -PLP 00/S ,AP 00Q ,Ko JP;+00  `0S 먀娐p0 P +0S@$<cPPH0d4< PT (' '(((( ( -LM`PK@p$P210S K+KQP *KQP g0: S'P PP*0 PW ʶP * P W@0 ((E :(K( -LM:(4P: S=!R `V000K @0K⹷p 0: S , K00 Kue(:P/  0 g -LM`QHZDT@<PX*0H!8@1P @$<b$10SP-(u00S00S 0 00! "4S `*P%*`0 >0p 40 K(S(LpPa_000(&((}&}&(( ( -KMLMZ#Q30`@ (tp; 04 40CS񟗯0S4(40S0SD00S 0(3(( ((((}&y,)}&()/ -p`@LM0 V00DP 0S0 0000SPP0C00`F0S 0S * 0R 0 0 w w0  P; ( 0 W5@?@  P0,( 0 0堀0唐S OP0 p(K\\0 40 n 400000@b)D) (,(T)((( p-RL M`PKp@0@ A P0X(08 8 PJ(0 z)(b) 0-LM@PP00<00S  = J"K0( -j@ML,MpQ'T U [# ;K,0C K@0 ϳP =K0C0 P=! SR J(~(KKA9PJ'8| ==K<0C#QPJ(HP0P P0ȤJ'8 ))) -ALP 000pPU*`00CS0pU 0 0S U 0 P 0` PS0SP 0S0 0 S kP (|&'(( 0 00-S00@L000S00000S0@000S `P P0P40P000(((( )( -PPL` 0S| n@Pd "@P0/S0080`f R P`@@@@*+*(h0 RX R  H R/< R/ $R/Q/ (((( l0-0LS T0TP@0L`T R S0c Ⴉ0@(({'R* -L,MR@ 0S0S࢟0@(K0 0P50C S>..........x20S X<K!4KP 0 000#K #K R P`P   0!$`$![ 0!0 㓝 Iz X B(4 : S@  S:  S  S05 S7  SG  S04=! 0410S ̈́!!" # "0 *0 J  !0?#@P@g 0 ^b040+04 ױP&0 00  0(*(**** (y -`p`L'P;S+ 8  {d({+++ s=+6+ߔ -L\M@="TKp:hK(t0T KhKKE+ 0-LM@Pp @P QK00 K9Kdd0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//@-Pp@`UVUQ.0C\`p0S*0 \0W0C& Ό' `p0 0CΌ `p S*CS*`p PC-a*0 @X`t0? S YXJ T(\D\0A  Q R 0 S* 0 B^QA^Ÿ 0B@ T RB(^Ο\AB@T RB(^ Οa B^ RB(^ ŸR0@- 0C\0!S*00P@U T0W0C  Ό! 0 0CΌ  S*CS* 800-@LT@@  0(N+ -PACAAAAACACCCCAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAA8CDCAAPC\CAhCtCAAAAAAAAAT>hBAAAABBBAAAACBAAT>BA CACA,CAAAAAAA@ AAA$AA`AAlA|AAAAAA BBB4BB K0 T@Rb0d0?o0cs00CS0 {H(K G8c(K (Ke1P 6 l2 (K 2 2 (K ,2 1 (K % 1 (K 2h!  \1 (K@  1 (K  H1 (K, (K,(K42uP2p0`A R(K+ a@BT~hM$O$O$OpM$O$O$O$O$O$O$OM$OOOp!00000pn(3l($(x&"0&}&'(P'(/د( 0(}&0(H((}&(((+r3Z}&P}&F}&<}&2}&(}&(({&0(P000ob'000|&11l((}&0(((x&h9p(01 '% ((,1C1(i1x&n1(1ȯ((((((}&(40ܯ($(0y0w1(K+j<0\Pc(K*b 0 (K*\ 0 (K)V 1 (K)P(K(Mp,K0,aL0 01 0L0֞D1P(K(< \\h\#pp͠L#ɠ\'<1! 1 (K' daA1P0 0!0 0,(K'  1 (K&(K&(K1p bP00x QPsPg02uP(K% |2 (K% 2 (K$OL2 "0(K#2P(K#2P(K" 3 (K" 3 (K! 43 (K! H3 (K0X#0$`3d3 h3~p3p#{t3Q P00i? ) 0HK!PU@T0 paUT00> QB Px00R?  C@ 0 fHKPH 0S0 @+SmSSlSlSS@0Yd PG00000YOI 0DPP00000 S <0 = G 0.'p(<|&& 2(x&0P  /H( p00-LP0\0\0 ~L@LPP@0@P ᑟH(p(22a2'(3 -` PL @*R7 R Q. %?R& [RS\ !^@@]P2!NoT^ 0S/S RP PS\ PS0*S S 0PS 0 P0P p-W p]WW \\ @\ ( 0-L@ /TN@@N P0H0\A\*0C0S*0Sa3 p-ML M1P@`KP-KDP K P <[S}Kp.SL[TxsKh`m.KZ P @K(484h44 4444 5 -cML Mc=K(0CKK3K#4@Dp`^KW: 000c=K0C Pc=K0Cc-K0 B00 ;RS@X 0cK$A0cK; A 0c=K 0C0T*cKA00Q DXOH(K&Q< \Q401CP)cK A c-K$ B 00CRc-K B2P ! R0BSc-K B  BScK ,L0Zc=K,0C0@&S\ScKA  @c=K0C c=K0C dc=Kc-K 0C B0 0CP;TG 0S 0fX 0TP* R00;T 0S X 0 pD JKX,@D 0 8TS llÝ8TSo 1 @  c=K(0C0(0 ( 尝K\( 65P5s5'5 -LMPP R`p ug\Sp RI p0S "00p0Sዷ\Sp RK pSS) GS PS! uw 0,0C5pS sS gS0000S00 R @@@$K0000ٴ@P"  ᕭ`P B.K; BB.K0 BX:`  P *,5+66\(55 -`PLp 0Sl㛴@PP P`P80 PP p@ @@ @I6^6\( X0-@0LPL`LT  S, ٜ0@\({'6 L1- LRD jDT@ (PU: P7\Q Q 0T+᷶04#∶P ~0S/  00P0S/  0P0 @0/S000 0DP0 QZ\(((66 0-j40L@PTp 00S 00S0 00/S @Tt0oPL0D0S pP040 \((( |2-0LS@P' 0`.S0.S0S/S 4P0   0 R CR S.R S.R0S/S 10S410S P:4 CSR ! xaPU 0/S20S.00 p n00C0U00 PU>_ !P:$0BRSR;  P ᨺ((797(( -@` P1L0S"᧖Up( +P  0 P0C0 B,#0@P@ Ugggggg@hg ggLgU.S PP 0 00C0 B#,D\< 0 00C0 B#!d v>C 0C0 0B0@"000 @ 0C #10C0 0 0C0 B #@ 0 0 0C0 B #@0 0 0C0 B #0婖p`d0 ' -|ALpPW :@P ∲P " #K!800 Aᣲ|r (K d  4 S0 0400CS00< 0刲ᆲꈯ( A: 0-@LT:8$R𫝘4 CSR𫝘 clX!WV@"UT QV$KkRꈯ( X0-@LT`D'L@PU p><PWV舯( -@L`V!ӰPx @d0dP \P0p@]04 = v@ꈯ(G_:((: }&: 0-@@L 0S 0$垰P  0舯(: 0-@@L0S 0$凰P 0舯(=: -L o` -L$M,2@0Sw  ;KЃbYXK4  K H0 ~PP H01#K0W VZS  lPPP 400 000 WV0S PB 0 " 00 KcKQP7  Rp` 0  :P#K0 QP /P a0 ݮP #K 0 K0`$K b#(K , $ Kꈯ( ;[; 0-@@L0S 0$ѯP0舯(=; -LMd`0S PPp0@T ! (@TPU$K舯( -LM` #K!$K00 @T% OPZ 0QP QP (0S0a0P40  0媰40P KKa(1(Kİ(Koꈯ(=; -0L@`Tp AT ! SR( SR (@00哰ᑰ舯(=/ -LM`0P0pS 0/S AK A6PP EK(@P  p;T Khc7P 000 00$` @ X(;<( -LMP`@pTK000S$0S 0Sh00S ! 1<00S ~@ꈯ((}&}&}& @Q0-L@A0 0@M@!QT\1   K S:0ZK0^@K^K^K^K -ML M1`@8< T/ pP!AT t0S" @T M@PM 0D0 0 P0? 'P1m" 8<P0! A$! !QP   KP   K Pmb R0`ı(KD y( $Dꈯ(G }&C<[<s<<< -1L `Vp/P. DX@ ڬ@P) $PP! P  A@T  PP`P 2P8 (&Pꈯ(<== h0- @LTP`pH ATfP > @ꈯ(C-p`QX@@Q@T*0C\`p \N@ P\@NPNNP N@N\*00000L1>`p000\:0L0  - R 0R$ -MLM0A R0\p.@0X!XaP^*K$ B0  C0/S+:K40C$!$K⨓KP6 K *R K$H0@C:K$0C 0 C?R*K$ B0@C 0ꂀಀK$H0pC:K40C| tK|KP:K40CX LKrKP:K40C0 KgK 'C= K=V=d= 0- L o= -L@Q`e\ 1e #Khc  a P#   00S  /ᨯ(x0-@^\Q 4PP䨯($(  Q0-LP 0S   p Pd @t L @ @T@000@3$}&= -`pL@PPP@ P 0 X{H0@ Hv8000CS0 $ 0 =0=>}&6>( -`LMPP$K4"z:0J840K0CS2"`40 !01 +  da (lZ <tU @ |0 Q}P  E=-0B0C2P0 1P) (5P/\+ $ (8$K@QaKP  v⸀ B` $($ *($ /R00C0 $ 8$($)Ёpx0`(B$,( ( ((( -LMZ@0@S' 8Tdt30S $KJ(J(J(J(>>>>?("???//  Q-LP+0S( l` $@P  P x00Sl0 R \  `V0  $@3d?$((l?? -PLM`PP$K#:0J84YqW V#/ 0 p0K0CSxx3It#P^p0|X#0 P3 T  d ( |0 QᒍP  x0}JH1P tg@0 B(1<?P lY<0 㓝 I 05S4 1S:2S? (4$ :( 9 (40$84P~LSKS[*6S 0p pa400  I(49 gSc xS!04(4:(404(4P9(408400C /Q0PK($4S**00($ R44 @$<$,:(0 6,0 "K 0  0 P  PU KS 0 0P4`pT@p 0 I<KSH  @8 $ ,( ((((?@$(w ?? :40-0CL@S D  h00SJ(Tk0Kd h3i/K00 0P J< SiK"L01K3 0b JK"K0A 000 Q:0A Q*J(X S70001K=!`rp JK"K0A 000 Qu:0A Q*FK @w`0m/K<.PJ6`0k/K@$PJ,!0 ` 0`f/KP J=<@KTqYEK  @-|X K'|}"K.`0c/K `PJ}"KP P@ PP P P0 ``X s 00bR cP$(@AA3 vA(A(AC C FA(JAPA 0-L@ PP oK0hWA -L M0P-S0S) ᖎ`P%  0Q K(0p S0 E(P(K@P,0V m`p mA'A --L M(@P   K輯( -PAUL`<0 R A?P @ @P@輯( --P LM00 |0 x00Sl00S `@0S T QJ00D0D 4 $۟ CJK(((('(m 0-|LPPlAh@P \:P 0 000S  0A!((A -0-P  LM00 0@ 00S00S P0S t I00d0d `奍 PT<< 0噍( IK0((((P'(m' -L⶧ 働#A' 0-LM=@P@K00/Sx8Pl3PQ_Kڗp K@՗p *KQP)KQP QA6E 000/0( -Lr ?ߊA' -Lf 3ӊB' 0 -@LTP 0QQ0P0T`0000000CS000S (( x0-`P@ dp L 0SP'U00CS0(00SKh(T(( -@PD`L0S@'T QPT( -4QL0@00p7 `1S 'RT P10@00CS000S 0 cPp吀AT$Kk70;V0W00CS00 U 0 (T(xO(O& -0PL2 R' 0T( -Lp`PU@ @P` 0-\PL>@P _DP0P 0@00aT,@0+( -pLtP`000T6@c60 0^6000@0CS000S$Kk(( -LP`@T [PV 0@@ -LP P-L`1P=P#P 0 pUP@TsU"W00CS00 T 0 00P p~&OO& -LMh3hS@`c` 0 (KS43(0 0" (0 ( 000 B p2 2 00`G5먒 S0p$K+R 1!Rv  R R% Pp R000 R@(Ry %Rg &R0&S03 )R7 *R0=S  0& =R, /RI ,RU -R -R0( :RH <R0<S =SI ^R: >R ?R%|R ~R$ #000=S& >S 0|S0 0=S0   +R0' &)"0 0 '(H((O(O p-L M0P0`0X0`~0@S P 0R@P@ K _@P0S 00S 0ST PK80 0 0 R  Kp((}&>Pp HOP @-L@`PQ Ԫ@h|XL,d80\ URq4 P 05"R?  B 0b4?  b4 0R UQUR0V0V0R0SRSR"#sPPP -L Mp`렠@0P%SJ000 Z0&S `7=X0 800 S00 0 @P@P(KX(P( -L0M0@ p$KT` 0 DK@PK0@P SW@PV D@ 0 F'@P@ 8Kⴈ 8KD~V( 0-LP@0)S0X( -PL(MP`p[ P2 P82 ; 0*P(2[ P 0 @P$P[ ܑ"P0@#SP $K'0@SRO 7S @P'0G\SpX r@P'W 0 !@K> @KV0 r0  p0@ f0 000@0Pt0 V0 t 0MX4`/'U@@PP 0@PX(P(PP -`L$MPq80 + ,K a@< %0 <C@0DS )00S^^* PU @ 0 4 0DSL0800S Q` (KUU (X(B -L Mp0@ PB\`0@P0SX0` P00 0@@U@P@ KX(( -L`h0@0PSP0p 000  00@@PX(( -PLMp0K2`pLP 0IS0NS@@ P@G@T0T@PPp0`Sp ,50K2K((X(P P-LA7P@4 p!a 0 P Q B Y Rp0 R ԥ å:3 0 P @230pR å*3 B2@@0P@ 0$gQ0}&}&((k@ -P 0/SSS00( 0-LMPPK00/SQOKLp Kp *KQP)KQPE -`LL1PP 1H0Kh110"S@ Vt`(Q -\@L PRH0Q < `P 1Kh`(d}&Q -L M X0c 0S+ SP *C000000000CS020S @T  S SU(KK1t2th2hR0dr00@/SJLL9PQ0S /00CS0ĥ@<2@X00420001A  P P ʠ001 |S pS00CS0L10S 00CS00X0ĥ@20X@00 R0S/S0@D00 P  R*0000t/S0S P 00CS0/00ĥ@00 100@0H0S 00CS00إ0ĥ@10@0`((((QQ(}&(}&E -PL0p0@0GP 00CS000S 30`0CS0X00S $X @06 R0S V$0$pO&((}&`({ -LMp2BP7P'0@T#S@P% 1R@0.S00.S000/SSB10 Kd `PA|ePpZ% `PUT`P@ P 0P F0Fss@P0-S0S0@T0@SP .0KP0: SU 9P(K}&Q( QE (QQ`(-Q9Q(JQ -L$,0Q   Kh[R Kh`(Q`Q 0-L@PL-70P000SLT@PP 0Sth@NX@00CS00 bN 0 0l(Q`(Q& -@P@pLW\B00CS00 @N 0 o`PP hP`P`qJ\T Qc @eT] aT^ 0TG \T \@bTN cTrT @ 1fT @ nT @00CS00 M 0@ 0@ T0S 00CS00 M 0 0S tT @ vT @ @0S  0BPA0@D@@@@Xm @M0& -@,` LRP 0R 0S SM00S0 R  N0 R NU  MTM |Mx Tl@00CS00 iM 0  KhGM~& (8(m&$( t~& (0-0LS6 (( @40-,Q0L00 N(( -LM|0@x0T   $K@$@ @ @ @ D00S 8060S K(((}& --LM 0 R    |( --L M  0-L|( --L M0@0  + -L@P`  @--L M   @-L  --LM00   K 0-P@L K0h --LM  K  0L -LP8 4M,P  BQd(0/0( -L@APPPP ]p` a`P Qp` U` p-PL MP `0``6 F 1T0@T;ND0 @0 vO@Kp}&B 4(( -L MP`0@S'A<0 TPᔯ 0`p፯0 ᐳ 06S 00S T  K 0p0S0P.S p(N@ SӐ0 0 0 0 0/((D(H(@( 0-LM@PKTK00P 0CS @@  _000@P  T0 @5 0-LM@PUPP0K xp ,P  PP0K<p  ,EK0Z00p(h}&kdp}& -LM@P 0S0S 4P 00 0 K5 K( -L Mp0S A0`00S$P\U0PaSP'00CS010S (K000 S 4KP V&D厝   *P00CS00S V*C00S40"C V04`P((L(%S -LM8s@P`VP. UP\@KT,0S 0S GQ񟗬Lh\8hLx||||||||||||4Up2PP+V0S#L20S@@K+,TV0S 20S1V0S10S10S@K5,10S !I0S\ 1PPUV I@PP%PtV0S 10S 1 R @T@   @0N 0?o20El0@T   @ J4J (K}&0(:SL(((4(~& -PLM8Kp@+0 oP㠀堐@P` 8K+U|0PW V V0S W GP00P0S8Ke+$K(~&}&L((( P-L?PP4 p ` 0 @ Q B Y Rp0 R ե å+ 0 @ P+0pR å+ B*P40$0 0 }&}&(<(L( -p`P@0L000V0S0S 0S00CS000S00CS00000CSl0`00C0X0` H R0 S[0`SSH(((}&L( -L,Ma@KV0P S1HPK*q@DP TVD q@AHP  U㔑[ 0S. 113wI|uI sI00CS00 I 0= bJ00CS00 H 0 H  LP0VP Q QAQP u R @QAQ  B @Km*(K}&L(((~&H(@((B -@L$M@Kp`* 0HK D 0ȀH@T+ 0S0PU@ 00H0MP 0tt R VPU 0 SP00@U0, @K0'*(KP0(((}&L( -`,rFoL@0婒S' 0S$ 1Q12HHZ/HVH00CS00 =H 0 HxQV0003! 'PF V080! |$  dC yDP!P00CS000S A00CS000S V0S0S@0@02IHHGH 0,KoGV}&@(~&(JS^SmS(L((qS p-LGM$2( 0,1 0$1 00 1 10S (10S 1 `1[2  HH(1Q@T H1GGKEPP% t1,! 1@? 1S @T D1D B@ G4G 1lG$1S  1 KpAG/K0 000 (1EA$Q 00CS0 (1@0w0,!00t0 ?00CS0 1S GlGL07GX00S @00S (}&@((JS~&S(SL((S( 0-L$M00`o00 00V PRPp5@8K(0@K00P   &P00S @<%?00 <@0 000CS0(00S 8K( K}&(S( -LiM@? 0A 01 ? 0SK1 |?! 0xA 1 l?p@A(`?K@X?`P!l  !@Tvl1(o@1 ZKP1d @T 00'0Ps0d!1 0p1Sr'p1 S!n01 >60S >0S1S10ń1 Ť!11C1 X>0S]1S phA0ShAX G4800!P1 4(@00CS0 ^080S IKP 80S'0AS777 h! I/K K`70!Y1101 0! $0hG01S! 7 70SU uS60S `姄\<&060S c1 @1 @Ft _>NK0 0<01 0C01P0042P!RQ1S 2!   B 1SVSK% KP1!SS|1 @0! |1 @Ip101 1S`1  1SL1 @1 1S (1 1S 1SV?K0S 0 00S p;PF@T1SQ`1!\01! 0H)F(((p(0((}&@(C@@(~&0((S(((dB S(L(|(!( S((&8(4(((40&<(&~&&Q 0/@(0/((0 /((0/(( 0  /(( P0-@L'PD@00S S cR 00SH(((0P /D( 0-LM0/0@00 7P KῃP g0: Sl  S` PK0K⪃P0 : S# KPP(4J BS -`x0LMP@`P0K#@O@0@808@0p00k"p0K#KL(8(@(D( Px0-LG'`00ST00S 8 0C 0BS(0  0   L(D(@(((// -LHM*4K⒤TK4L@Kp0DPK,<`K(,` PT0K SB$K&T 00S/( -L@`pŁPUV gL" 00(P(8( -LM0 QpI R%pP@0`S:S70E4 \  04S0 Q4   G X/R/  0f Q@` R:R 0:R ` `04 0C(Ko"S P8 4 %#8 (K}&}&P( -L M@Pp/ `P* 0 qb@T0 "T# "`VZ0S 0 ^O0S K0S G@" KoP@<> DR~  P 0  |(P( -LM @P`Rm4T1$K0p00( ?L"pWZU lhA @A Q T;AP9AQ<YA 04AS 00CS00 @ 0* 00CS00 @ 0 $KQ A,AU P000LK00CS0P00S ^@@K@4,~("T:TCTt&LT((VT\T`T -`@HPLpP 0S%SP @0N -`@@PLpP 0RP@M- H0H1S RQ QP 0}&X( 0-pP` 刀 L |@@ 0S0 S0S00PP|U00CS0$Kk8@(}&X( -pP@0` L 0S S:Q `:SQ`u00Q %Q00S  $PPP0W :S@  <@/P R00SP('T}& 0-`@ 儀 L p 0Sp00ALቐPU`|V00CS000S$Kkg(X(( 0-pPSL R.J0AaT'oWQ p000? 0 @0 0 d00CS0L00S .<0`P `@X(((T( 0-P(@L@P0 0P0M 0-D@L000400 00CS00K0hW(T( -LMP/`@0 P @@@o K^P00š0 40S 00S ,000Z300P@ P @\P R R R     ,Q R 0 #"  " /R0  QpP=Z0 R"000  KpPZ w 2 @# 0h&?00(K H2Q  0S/R30SZ U#P pP 1 @ RؠK R ؠK pV1#P R  R KP * RF01 R$ @ 1@Dz( P R  9 0  00 @ RؠK R ؠK   BR D R T(~T}&~&P(T(T}&T( -PLM@p`t2@0 &P@0Z 000@@2 p`Z@0 n)2 1S*Z(KbIY                 (`p@PQPT QQ D @0 D @00VXWT U0 08K0 eU 3[s  P }>V 0SX@0@0 Y  P 0S| WT(}&X(( -x@L0`000PS SI000 00 00000CS0Khg( 0-LMl@ 0P0002KP0>01KuI K 00CS000S K0(}&( -LxP 0SI -pL$MP@`ሃ%P0cS   \pPp vP@ VP`` ,( R\cS# T3=0S@0 P@0 W+P 03K000 3[S񟗌<(8H QPTf\=&TP H= [P% 0<P=U 00S R00CS00 < 0 0P U (K<P/,P!00W@0 t1 ,0K# H0 D @00S@0 H0ZT1Z<D<}PT<T~`b嬎T T TT<`~0 8K`@000TTT({TUEU/U=U&MU(TSU JZUpUUU - L$MbR@Kpo0@0@T T T*/T :T< T-@K (KT$T*AZ   0000S(T@`P5|~P` `@KsVp~ ZT  BR @å0H H0@ R  }W 0 BR  R  BR   BR   }&((}&J -@AL0PS,1 `RqP0S`P000300CS00S  0Q" U R`p00P UP 0000 000CS00S R00(((( p-L M0@!SP 1Kp*S@S``00P Q0C RP00C S ` KY@0S 00S=STT00 D0 T 0AD1U 0 0S 0S}&(( -h@L0pS`P  R R00` P(( -LM,s,S0`K0 00 0 003 0 "@K @ 0 DKLK1`Ÿ2  1 0倢0  BR 0Si00CS0D20S , KCzP}0S 0Y00PIؐ 0KX- X`* V. R@ DRA/@`F0 SR t! BR  R @ B ~  D @ B D 0 B `F BR ĥ@ C @ V RJ@PzP ԊP Q00S 0DC0@00CS0400S (K}&((((}&(((J0( -L M10S0(K@p1 1000 ``00V :YW0S @Px00SFQP p0W) Sp>40 40S@, @0040 40S0S$ SPP`00P +P@P040 "P 40TDoPQ0 @P@p`((,&(]d -`P`@LPP00`000`0CS000S (((( 0-LPM@]H0@ 0( -QLMp `0P 0S*00G@P `K7PP `R@ K P0P@@0`SP0S0 0-@LDMP0 X0 `[Xo *XI ?X; XZ 0S0S@0S X0S (KX \X Z0 S@0S@#0HS Z0 S@ 0R R@`Z0 S@ 0Z0 S@0 S @0*SS x SR?S[S R S0S P@ X` 0Z R R @@0^S!S  00x \Q ]QR0d  d0 R 0B?oZ20S0`0 `@ `0p0T0 0x RW~  [W\  :RD\h0 \0PPPh0:PU*\WWP \Pp -R_0]Qp \QQ0 PT0@KH0 0HKh D0 @p <0 \0 P T0h H0 \0@KHKD0 @ <0 sP 0]RRd  R` `@a' R\  PQ  @K U, K\P*@Kh0 剉Ph0 T喉h0Q U  ,K\5 2T0WPP00S P0X`0P0 @R<TWp_UH -LMP@ 0?S*SL [SA0^S!S00x \5]P> [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR6@P0P/P 0S xPS@ R0$Bx RP 0S 0\(KKqxPX;P 0U0/S 00EP 0S/00E0S``0`@ xQP 00 10S" FV/00D0x RP000Q:0 p R /  70 pP 0.Bo.SQ 0 0 P V 0K[(E U( @-00 S 0 @^C\B@x R ^ @ ^0  -@QLT0S0@@@?S*S  [S00S `0p000S" P d.0000CS0P00S 0S Y0S (((( 0-@$PLT00@@@(A- 00 S@QA0 p`^   S. RxPPU!^  ^p0 ^S PS =^^ TR pS @0C H 0-PL M $`KG0fCK ㎆0F ,@FP Tp X-00D@FL`@DPU$K`00CS0PP( -LM R@@0P*Sp #S $S !S<8 ?S @S. -Sz 8Pp8H(K777@A0S 'g00CS00  PW0000Q00S l7tw `Rd'0S00 0@S00 W0CS00 w 00CS00 v 0S &V00CS0^0 ]00w00W00v00 000S 0DV 0CS 00CS0$0 ~ 00CS0 0 000 0 U0 0S 00CS0000 0 00~0000 0  00 00 0  000000s05 0$50P50S00 7 0``W`V80 ԔA̤帔0  R? 80S   R  BR d ~  BR `0 0 <4$ BR  BR 7 ~  BR 30 0 0  R0S U@ V㜣c 30 0CS 00CS0,0 ~ 00C0S60 P ~ z0 0  q ~ k0 0  {b00~00A RWb0S_ "lb00C0SN00PS00C S20 00KRP*0S000S=S{U20 v1 Rr0QE1@00 00WppW" aQ000S` 0A 0CS 00CS060 ~ 00CS020 000 0 a Q000S= T 00 S 00CS0!0 ~ 00CS00 000 0 00~0000 0  0000~0000 0  00}&DD((L((}&(J((,&( -L4M0 @0 6p04 = 6 88 `H0 @ 600F: P Z  2PP00@S <6 0 70P P " R PP 0&U%  A0 %~ R *R@R   " X R H R F APXU PD ) Z= T740  _pAQ!W@DTZ JJ X6$00C@0C0$000D0S240@@@9L0 < L0W<  @|$h4 X BQ@ @CR<@ <($<0@T<0 S0 S$ <0@T<0 0@S30S@@40@040 0H S0@/8/d0d0/////3 AQ AQT~AQ(@P L L~P P L LP @D P @P~@P@P L P ~LP L }P L@|r_T?0e_oRUV40}800SN PX(KUE !A00CS0)0 tp0 pG@0000P  00BpC0 ,!p0pp01D 000A%'0000U 00 qP 0h~PTR ` R0 R` R` B\U   R0SH,(((}&}&U((J( - L$M< 0p % % 0 D$8 @@ ~Q 0 Pd崤4 QLQ*=Q "Q :Q Q00000CS00  0%P 800 AA P0Q (Q< R   R  BR ~ 00CS00 RNQ Q QY  R(KQ1 L:Q00CS0?0  R  R @R0=S P2P P 00CS00 w 100w00  00CS00 u 00000u0000 00y10S 8 0 @ CR SR0C0g Ye 00CS00 v PY00v00D0  ~ D0 dD D 00 h &<1 D0 D0 0  BR  " 0~S=Q40S 040 oH0 D @ DH0D D004(,&(}&(((( -pP`1倁^0|Sx1Pp l1lA 0 0\1L00L1pD1 p<1 V0 Sh000`0`0CS0!0 p0@@Bp@ D 0 @  0 R 0800pN0p}&}&((((}&(((( 800-4PL@0 K0h/}&}& -L,M\A\q0H@Q00CS0@0``@@K'0@0DK@KW 0 0C 0S0$K '00` R"Z 0C 0`F`F000`C`(K00000(}&(( -LM,Q80 (q0R00 0A40 0`0Q< <00040P080ZP Z 2 0 E0CP0(K0S P L/0< F40A0, }&(((}&&{U(U -LM c80 s000 040 000BSP0B0SJ̢Q< )<00040080Yp> Yf Y`0*0`HV(: 000 P00W BUW#*VQ  000 PD偐IoU㩒Y`00`V:(KPQ: F``HV: P6FUW * VR P  R:F` PU R``V:`pH F  0B0C 0pGHV00 `F  B BR  0 B0 0 }&(((}& -pLM8K`P 0@ 0嘀00000py00CS00 p0@D ;@8K$KJ00p}&(((}&( -L`p@.A00CS00 - 0 P Um.00CS00 - 0 P UP*.00CS00 - 0Pu& -LU -LU00S/ R}&T0QH0 0Scq o/P0//(}& 000 00C0/(( -@帀0P000` LRp$ x0 t 0U0d0P p T 0 0C `  S0(00S$Kk(}&(((( 0-`P @0p0WL0 P 0X S S0 000 00 0 p0$`  d0 \0 00T }00CS0,00S$Kk}&(~&(((( -XBLpPR 0 Qcr 0S ((,$, 0bSA0@@0/lP3b000r0Sh00CS0!00S 0Z #R  l P   lP$- 0 00@0 P   PDR@ S @  BR 00D0CS0000P0`00S ,L0],P0 Q(}&~&(&(V}&~& 0-X@L00CS0@ 00Lp000CS0K0hB(( d 0-`@ 0L P 8  D    @ 00000 0$000(}&(( -pP`L000$ lU @0P%P0pS  0L 0H 00000CS0(00SKh(`A}&((( -LM0ap00P0k@P KKmP(0: S$0 0 KkP KPk0 000 kdi$TkL00CS0,00S iK(,V:V?V\VvV( 0-` Q LP @ @T0PJH0D0@0`00CS0(00SKh=((((}&( -@0P  PL `P$P 5| 0S00.|0d X 0L 000CS0000SKh}&(((((0/}& -P0`0@L0SSU}& (V 0-P@L0S0}& ( 0-PPL0 @0P0#0P0}& 0 R/}&A-@ 0@1 ^P U `pWQ Q 00q A#^  r B.PU 䀃0(5rO}& - bL0pS 20SPAT p #jpPPPU* 1F jp I#o#KNxQPj0P 㥫&&&j(1PP jp|  Np,| Mj0PP jpq| Mpg| 0#00&&&pP((}&AV}&LL((VV -0LSP`Ѐp@0000W 6p 0WVv|V$0S `p` l0S *00CS0P00S$Kk pGo PQ`(W( 0-@h0 P L P z@00CS0000S0K0h(( -LTM@pP 0 #*(KؐY PY   0SPs  0 S S S PQ 00S00S@0S22 G! 0R+  ~  !R -  "lK)lK ` l0Kt"0 ) `0l KsUD Ml0K`lK~) 00CS05)0` V l)k p0S 00CS0)0 00CS0)0 | 00CS0)0 0p0Yp0 Z(000t!lK) #40  {)  v)P S#4V{  0 l0K`@ fx  B)p0`0Csp0 0㓉(0H`0(}&5rO8WBWGWOWXW]WlW0@-0  R#R0 B  0P\.^0\Q #40 Bo4SQ#400000@ -L MPPp2@ 0%S^ P @@T$1 R 04!0@S (K0S  R+S -S %S d1@0@XZT08W0@.1p>  ! #@0S 0S 0?R0  00 P00 T0$@` 0 P] P 3 d0 @  RJ0S ^#0S 0@}&rWW(WW -(AL$0SaP0^0pS0@  O(А㼠0Sʰ00CS00 ' 0 )0 R  0 S #%(((WW5rOWlW& -p@`QL.P00S|x10P 0S \pjPp pP@ gP`WP 1 Q@1'@V Q@T, 0SJ '0 '`00CS0 ?'0S 0 0 00S0 S 0 0`$pWW(X(5rO4XR& <00-@LT $P0@@d0(W8 P 0S/AQ //( -RL0pS P`VQZ0000SnZaP000K:@0 4(00ST0Q0C  S0`10S D1 P ,.0! Q0001 0 0WЀ000CS000S i0S @@0 M 0 Zawꔂ! P00A R 耈(((}&P( -`!@S1p@!LP O$Td1@WV2 T1F0S. U 0S0PgPfV 1Ipax ,""060S$ """V$$U 0S ]PPfPeP @@WT ,0 (((P(}&}&V7,V(0< F R Q  R  P h}& -R0pLMtB00 K p` 0S0S (KPP " 0002@" #T):U 0S0 10S  160S   UIG RG E1p!00CS0p10S \0S  02  8 08\R Q 0S Q  {@|. \ ~ Lo ^ \ P  P 000 PPX@~  Lo ^ \04((((}&~&( -LpG@ BP 1F0St @HPfU @fHp5w `P@0S0S 0S0S `@Y 0 Z  3Z 0 00}&}&IV( -P@Lw P06 R0S@P|@|`00S 0pC 0 0 SlPPPw^}&(& -@L$McsA PPT  r&P *P nU pUT px@\`H V XD300SpN pLH H0#0pPZPY R V p0D0 H0 Q8ZPD ?X ^ 0 L PPL  0S00X 0STp ' 260SK(K0DP 0`0^  ^ D D/o"? TY '^ Q D VQ, K"p"pD R RL *L RQ ԐToQp 0S 0Ct 0@KY p@KD RXVV `V SXppOXX(\XrX;X((}&u -L@c`\Q000 R 0S 81EGp u!z0S 0 00D  S x Bo00P0R ` R\ `` R0 @0Sw00CS0000S (}&V(5rO( t1-PLUd0@SH @#`p00S'$a00CS00 # 0 w$`p0Sږ Fp 0S#mu #y#`PpP000E0@0CS0<00S (WWtlW&}&V(( -Lm 00 Kh( 0-@L_ K0h} 0-pPL P0S0 0Q0P @T #0 00 0(~XG- 0h"0d2P @XrXXXT0S  T"0@D0P0@0PЍSQ =S^ $Sp 'Sn "Sl 9S \SSF S"0!- $0!*0! S$0$S< 8:S 0S   R  000C S0,0S0!"0  @T0 R 0 R00 0  }0)0 !"0\ 0 a 1 }SP 0 :0 0b\0 D(H(}&XXXXXXX[`ٝ -LM@PcPsTY 0SV0SqLsqqqrqq8r|rrrrss Pg Pd Pa P^ P[ PX @/H(uXobYXXXXnSٝXXXXӳYXBYXYY YYXX&bXX%YND -@PD`LTUHU 0S ?@\ -x0`t `6LPP@F0S@2@Hp@0S. @D0   0 D(}&H( -P0L0@S`p R 0F0S P 0S0$aWX0HPT P000V0 (}&}& -LP`pp@ P 0 KhrT0 +Y -P 0LMQ00S @K1ԁ 100 000 0S KpPK@(K0SH  0 Q S/R CKgaP 0%K%KaP000Y0S)  Rp 0CP:PZp"00SEpDZ p00CS00  0 %K @ 0 SH0 p0 0X((`(((P(Z -LMf@P`rPPr0S 0S20XUs @Pr儢0SF(KSP` aPP HP@`pU0S (t$PL 0 @$K/\ 9\D00L@0 #?$K\ @0D 2"0D BP<K\p,wmpC<K \ CK0 W  UT4pCK ?)@ 0P@Q@PX0 CKSCK<K[P>mS CK1 UThtCK ? 08g0XZC(CZhZ{ZdZZkZZ BR00/0S0/@0S/ R / -L M0 0 0@00C S Kc 0SS 0S 0 apWV KШ?[*[000C S0S//Q0@-D0 \ @P U@R00}& 0-h@L6`PvF0S0n@T0Z[ZZ@Z$0P  K0hh}&(jmXW[ -@PL` R\Q4 aq!1R0 0 @TA00CS00 F 0 @aq Q 0 pR  @TP(aHq@P0 R R$ @T@00CS00  0 Q >P @1@VT``pQ +PKhDpW0 8}&[[[ s[C&[z[[[[[[ 0 @-L\ Kh0S 0 }&[[ 0-0LS@P@D0PK0hjj -@`L1Sp@DPU 8@P0`0 P`( -PPpa ph1L  0S-\#\= -\0S= @P U00cP00S$oP 0S U+\ 0P U00U `0`/c@U<0PPU0S,Ko|((([[}& P-Q00`0AL 0S 00S10S006X pW P P6p60S0S60F0S60F0$1 0QSCSCS 0p @R Q  `0  000S 0S R  R0 0`0  @T \$Kk(}&((8([( P-L PP@0S~`0C p 0XZ0_Q0C R 0 0CS0D00S 60S #0=i[([(( P0- L0K0h\@000D00S 00CS000S 0((( -0L00C S 6P 0 ( -LMpQ` 0S5 R 0S @0?P0CpC10@" 8K,8K8PKP@ 8K 7PK0m PPW-Q\   -R0S 0 PU0:SI0Q@4T3P:U'8 K8K 7@K@ U0:S 8 K8K 7PK@?Pp0p'1@:^0 0t#Z00  P@00CC10p 4 }@p(Ku;\ \\&$\ -PLMDf@0P  Q 000C? KB\(( 0- LR0 QQ0 -R@ T -PQ P0:S0S\ 0\ DP8@:T0000((x\e\( -\@L`080SuP@ 00CS0P70P 800C80~&(  0-RL0@T g0  B 0 0-@L0S0@ 0-PL0S@0ڈ0@0 0B2 ! ! !!  !!0 0-@L    @0~&0S/x RS 00 S/00 00 0S/00/H08 00 0=S/S 00/H 0-0 L0^~&7] -`R`L@PP  0-S0S0 0V 00080@L]~& -LMR04 8 00 p@0S |xx"tp< 40S5t 5R@<  BR  @ɥL @<0@B,20@00@(K  B Rɥ@ 4@ Ta  p@@ T T`p T+R) pv Q P Pp P  Q R P   @ 2@ G9`p 80 BS \TR @ɥ@B P@  BR ɥ@  1p@_}&E}&}&(~& -L@M0P0` R@C0 Pl l "LKLK:L0KVL 0U<0< 1 0LK01 0 ~&Z]r]]E]] -P@LM0K0t ; 0`0S Pp@T*wp`T @TePL` @0 `0KK@}&}&(]] |00-0L0S d0P@U U L0UH0@0P 00P0 0 0~&(](}&( 0-L KhL( 0-l@lPL\P0| P 00008  P8 F MK0hf}&~& -8RL0@T @ 9 0S 0 @ 0q8 쁟0 葟00CS00 `#V4  V v v^ $Kk` V' V )V< &V' (V0@@\V3 |V% ;V&P0 @ ;P0 @ @0 Pp0@000 t&P0@ @0k|P0@ @00@p P  00P000G 0 ~&}&((L - L M pa0P0 U U.`,0S,@0% `P @ >P@P  \00 0P00@DDAPPU 0 (K~&E - QL0$` P O 0R', (@R   R`!PT    Q  00000S@0 R@ BR Kh=080@ ~&] -Li0 000~& -L^P 0-L@VP0 -L @KP P <0 000P ` PPP~& -L M Q`P0 # p @%P" BQ  R  0 m0 @WP'V/ (K10S @W Z Q@@pY %  D @  PP    VfH0 RprV k 000~&E -LKM@1 H5@0< 0P! L1 001 (50D1 5H 0KK0D81 xP H01S 0c< 40 D!4 t$000810 Sp48!p0 rd4K/K `$00CS0 @1S#PAPU4@!0RPPT `+@1SP P| 30S M3cP3 3儓 0 0S } 0 `P@D P; \P p+03L00 P0@000  #\0@0 $P <1<021#20#"T0"@ 0AS0\00ťPs\0P0"00CS0@ťPgP@0000 P"00CS0 0 ťS 0 "CPn: zi@h100@1S 10 A08!SKڐ!堁W@0 8!Ჾ818!@00C0P000b001 00CS0(10S 1L!0 0D! <1Y`,V`>P0 |P000`$@ 0(K P10 ,  0`0 &P00 0=<Po >P9 &P00}&~&K}&}&((^a^x^^>^^^^ '(H(^E _LJI0@00 ((0 @ -P 0(0   0Q@0/{PA@`   } {S D@ A@Y^#P0`" X}P0N  P``= H}P00 ` 0   `0A封. AQɥJ&0=AQ@ɥ0 90@Vk%S` :S/ #S0[ 0 g``0C P@AQ@ɥ@V0 0@ Q A006`0 |P j 02!R1S `0IS0@`0 `Y`o 0Y2 P !cڤ!!^0 0S  Fo}S㪢Z `'S02 4P w000@"0 P!|$00 00C0"000$2  P!Q 1 00C0v00WP@X -@L00S`Đ`0PU ` 0S > 0 0   B/o"h0p 0S 0  0 0 0~&K 0-L^M1 0! l1 p 1t 0< x1 10K|1 Ͽ1EK01 0h1 呖PI@1E/K 1Q!@p>K0K| dN 0S Q. 4QG hQ d \! h!X1 0` T! h!YKf00h1 !0 0x! t0l! 0|! h1p!S0h1 hK0ph !p0 `0x! tlH0l! D0|! H00SlAS,02 0(}& (~&K}&(._ -L M F,`K0 00&B P" 000;P1444444444p0$00`amPP 0 R 0Qp     <0P0S 0 00| P0, ReP 000P0 0Z0 R, RP1 00300 0000    BR   00p P 400000CS  0 P Pp $4pKpDx 0 0008 P0C 0 00p0 SpȻP \V0 R   L000p0SA0 R Ӻ004 3P 0 R000 0  !P 0@S P 000 hpPp0P00p P0 0000000S$ U 0S E0(P000Po|00SP00S 0000P(K0$00`~&F_6H ~&}& -Q@LMQ$`Kp0 0pK@&0 P0 0X@` 0NP R$@@pR(" V0 R`00 4 /opP =0 08 00C0)04p$K Q  00S PPP0( 00 000 @P 0~&}&\_  -P`@0L JP0 000@AP 0000p@@@,Pp 00@ U000 v00@0SU P~&}&n_ 0-@PP0L;0 @P P 00000S0 00~&_ P/0S/ -@L `P00`P p-L M@$KIP0S 0`ᱸ P P  H$KpP ``P$Hpmjg d0S 0  $J  S 0/(RQ%H|I -LMrP0 U00000@0CS񟗌`@ 00` wH@PV H {HUL20S| T |X`,",[H@P 2N0S' `PHp@! KIp}P[HyP 1 t忻 `0: SHHf00`\!l`L!` P P U0S00  uP @GZ 0H00CS000S ܺ$K@ H@0@%p  xT  BP`G[Z 0ܺ(}& |(` ]`(mA` P-LP@ G P `G5Z 嶺G` -Pp@\`LT@Q00C0W PG~X@( -`@``0P0L000iX00CS000SKhM(,(( -`L0L@TVP @PoGPU,( 0-@h0L R 0C T DPGP VGᲁ P 00@~&( -PL0@ S 3G`PT 6GR0S 0 S G`D0S ( 0-PL @ P00  0(( H00-@LP  Q WK0hF0((00S  R/(( -L@PP Q0 йFp`U @Y FpU 4Y 005`` ap -LPp`p@V`   0ẀPȐȠ 0S WT  ,Ko    0@  W  T0S@@ PW &8\F^+a -PPL` 0R UFp@ / LFp@  EFp@ >Fp@ 7Fp@,+P03/3F@(1a -LMpP 08 K0S*070K0@0  $0`01 쁟U70[S!1 60[S1! (K`1@ R@00CS 0S  EPQ VX L׸@0S> P90$000 Sl Ep R R R 0X U EP  EP 00CS0\00S lT< 8K000 P,((&&~& (`(`( -P0@#cLMs< 4P 0P 00 < 2p 0U80 @D:TR] ;sP vP WUP0+S -S 4K0`K 0TrQ D<<0K4`K S,: @0 HP@0%  000Y*PT <08 `V Mp`00S0SPt p0 U@0S(KU= 40`p0      r % 5S DpQW 80 Dp80BW d÷X0  T00 40&a40 (YaEbaaaa -PQL@T 00CSPDa10SK R 0p0CS00 p01L00<S0S  0aL00CS$LL,@>S0Sp R 00CS0f0 - Eub 0-@LrTP0 R  R 00S 01S0 $ [P00S|0!R ! RT  1@DOoT!0B00@060S@T 00S0 0((((4(}& 0-@PL 7gP00 9 00u(bb Q-L@ 00CS00 Pt`tp X?U UP@U00CS00 t 0-Pp @ L l0S 00S Tp@T: 80 00CS0 00SKhj((0((L0P @0,Q Q0S:///0(( -LM02@0pS21S 0SPP20S WUT: T T5 P PT T1F0SPPTP 16 R'! R#0SPPdaQ4 Kᴄp 40S(!FQ DTQ56 R2K060SPPPQ0 Q U0 U0 U0᳧p WPUKf0@D>T40 00 ,0 (0 '00 4KB2 K1 @D@0(((}&(8( P-Lp@4`\PPL:H44 PP#@ d t1S 000ST ;00CS030S @@T 3 P6`P@PPGU@ tճ`P]PEU@YX @4SDs 0F0 1ST$x@ T@`@VT @rP`1S 10STW@ T|@P@UT \@XRXr1S 10S |7@@TPdX10S oP `@DP㜑$`0-S0S`U@GkP A?ZX# \q01 !Rk 4pW+$VTP dP1 oP ' 0J000V0S0V00 `hp 1S RZ a  P00CS0(00S mbb&ob(((0(=  gbqb|b] bA ~&b -`P 0@PL pD0S 00S Fo0D0@000CS0<00S ],0@T:VKh0((((( -D@L0PS`00CS𨝘V008(00P,00SP/0S//(0( -`LM@p1Ȑ010!Q0@S10C1(KaQ< !R8 4K2v8 TPP<8 80RfP 40S 4Ki(4(0(L(@ 0P/!!R /( 0-<@L2PS0}R0( -0LJM01 1"R !R "R0! 0! 1 1"1"1 10S CKPl1C/K yCKwP P!CK000o@P,1C/K /0AT0'B0C/K 0PU`@T 0S δP噶00CS0 KK ,A;01 1 1 1 0D>S 00GK `@B~@" K!031(L(4(((0(  0-L"t( T0-LP'@#P0 @P?T00F d00-`P  PL @ (Q0 0000CS0000S0K0h (~&( -p@PL`U ?PPEUp` VD@0S 0-QL@0 Q0P0 BP1Ա01ı 00000 1-sL@ 000010100C0 RP0000 000CS0h00S sDP`0000 0C0x((( 0-@LP@0SL00S0K0h00CS00  ~&0~&0~& -L M@KP偲dPK c --L M  K --LM0  K~& -0- LMp0 ( $ @P(K0 , $00CS$0 (KU(0 ( 1[0@0DK0 -L@'PP$ 0S! pዬ0S00CS0/0 "  h00CS0 0 " 0S pW `Pp 00CS00p ' `' 0'X0C! S00 XV 00CS00 ' 10S$KkV S00 00CS00 \ 00CS00W ` `V 9`P 00CS00 8cF~&0O~& 0-@LyK0hu~& -0rSLx=c]c 0-`0 @L0R.0pP0=00(=$H@X@`@DS0ԥ0ťP0P0 0=RR0CX0Sť @$Kk薴}&(}& -L M D00 4@ 0C00 0 04K((c0@-P 0S SR 0T 00@PU U 00R0C000H 0-L pAT0'S`QU @'TP@Q  0S 0S   3/P `P00T( -0LS@KhCPိU x`xp0S'S3P@'cPP8Kh& E"ybccc t -P0LS`p@    3/@PP@X W p0@=SPP00 00CS00 [ 0 00CS00 J 0 T Q&_ -L MA0Sp 00<`P 01S `'V0 Ί@PU*(KX   R Q ʁ4 00 4 001P00 e(T( @0S =0C?oP2/=S/ -P`L0S=SRPEP'`0VqApT 0S  vPVpPp@T( -LM1P0@S @ K$KpPU   `|M J `可  `BKhnMPp\ L0x >L08 s0v0 t p0 pp AX0@ P0lP0 t0  |`0 R00 [80H @ 1    Jt v t   0t 0#00K堥0 0  0qt 0i8)&(&&ggg 'd*L(T.tg -LM0$PK\ %p` 0 D$@P 0 ($@PB 0 pW( PuY <Y۠PP0' 0ES4K IP m Ð400S00H l^^YPH0?S0 -S00H0,$K8gh,mNmTm\mmm P-L dkakn!n p-L M0@0 0 \%XPX` PQ RPM ,Kph%00 %6nhanhn -LM`8 :P8 0䡟80 80S(K8KWPP 0S =ΑP@@0 K wpcWp;P000 X!5iWL0P000 4)P0 K w00$0lWP00 0oWP000  P@0 Kaw00(0 @Q P< P<   BR0 K<Hw 0 0S}ning nRn n0K00M00P0D0 0C0D080;800,0/(<0Q00<008 ,0,,8 8 /@0D 9K<@0(080$00= 0D00<00,0/+$@( R 8 ", 8 <  < D ,-D  , /咟 -0ML0$ 0d8 K 0-@L4&0000 0-@L40000 -L M@(0S00 K0 /0,0K`t -L@ .`P 먴맵8奵<壵@塵HPD\`❵V\嗵`, 8-P.U0,0%& 0-@L480,00 0-@L480,00&/$ 8-L Kh$$귽 (00-SL@ K0hD8@0<<@00,00 -LM K "'/Pi Ktn -L/Pint n -L /Piot n p-LM0`@K0P-S00(0(0@0 @  0| 0C"P 0( RT  0 0 S40(@R03/Kp>in,m -Pp`@LQ`-VPQ~P 000 0 `qP-V0 00p 00- PL@0@P ,0T 80$P< D0TP$ <0<P0jkkl 0-(@L0PS #00P0( Q-0L&  BR "Mt 0-`   S^0? S00^@ u((Tm -l@LP`U P#xHP4",""0( t -LM`p@PU % "TP" "XP "PW "PU "p PkT X8 T88T 8 T7T 7T 7wT 7nT x7eT@ X7@\T  87 ST  7 JTUU@BT 69T 60T 6'T |6T  \6 PH T<p g eSo @qvZ~  Y X W0S PT0pS X W P`T;S < S S4 05 Ty W   T`lt P@Td(K!$ 0 T0S|Tp4@TX4TZ<8~T|,4 wTwY pTrXiTmdTj0S\Te3UT`3NT[3GWDT_Xlh=TZ\36TUW@</TP0W)TLW#I SL S  SLJ2  TIWTD2 T?2 T:x2T5`2T0H2,0@0 dK K%PTq쁟 0SU! KKT   WQ K  k 00P~0K  `  UKKP pP0 P[U$UDWpqq*q6qoooooooooooooooo p=qDqspKqZopRqYqhpppp!p(p0p/p5p=pL\P\48`#P4`F 2Fa`L厒`Dd 0SD4 80D4 0S P4 `0 S HSL Sh SHI뼂D4S P H?D4@ S K`|2ST4D  `2000!0@4  0 0=KP pU@@4 S MK0@4 P4@$ 2 S S SHP4a D4S Pv HD4@ S HD4 SeH D4S| PZ HD4@ Ss HD4 SHD4 S({8z9tu6W .9>#9C8([(jڠ@(P(ǁׁ #7Rr$( z\vv '‚ 0-`LQqU V F0@P0d幪`!!0V<0 nPpW2\vLQ 00-0LS Kh+#ە00P& !0-1LSP@4 0S&P K0hAP00S 1S 1S ]/P01S X `P0@ LP0 $P0|](8(,dedArdA9 -010AL M 000 p`:kQ U5 1S Pl0S h0S 0(0 1S ( KtPX30`1S P K\ \_PL+P 4UPWEV(fdJmd[P&t8(gdl 0-@ LP f/ÍK0h8( 0 4P&(md0S/!   -0-PL M +P P 0S S@@ ԩP@K0' 0-<@K0C CgP BKAPUBK@SPBKAH(48TdBK( @vp P B>K0C CfP BKAT(4(0DT,dBK, @\p P B>K0C CfP BKA(4,0ScBK0 @Bp P B>K0C CfP BKAo(400S\cBK8 @(p P B>K0C CfP BKA4U(480$SbBK4 @p P B>K0C CfP BKA;(440RbBK< @p P B>K0C CkfP BKAT!(4<0\R$bBK$@pw P B>K0C CQfP BKA (44QaBK$@p] P B>K0C C7fP BKA(44QTaBK$@pC P B>K0C CfP BKAL(44K0C CfP BKA(4P0P`BKT @rPB>K0C CeP BKA(4T0$Ko4x)P'Ћ *Dgˌ6Ux؍8Wt -ML M@@@ q8TK @0p P Pt`V4+<[S,<[`S@,\[`P8apEbWWnF`0E `FK8ġ  @⺉ 0嘃!S0#K1`  @p P) Kh @P`0! H᠌ K @߈P P0S K@, A3/K @D< /PD<, 0̂RBKx% AB.KK B @p P" +8[SA,8[`S>t@,8[`P92a0C" 20< S :K4 A0!SK Ax5BK|% AB.KK B  @p\ P6 x5< K B A00 QPK AK0 AP0P0<0PK ADxP0x5< 0R 0K A|K  @eVP 0 000S 0`p尀P(V R s  S 00  0`PK APf(K蒎X&4xǎ=hN )P'( - BR0 RV  -PL@ R1!0 0 X0 X0 X0 p` ( X, L0 @~8 4z4 (v< r$n$j$f$bP ^T Z~l0 R`V*\ M p㔀\P pDWpf$Kkyv &-8=FXkё:j  -LM─@Y`pR a S 8Q ,Z y  t  l"0@K080 d0,   ]  ˋlK0"@ 0Ka   R1!`  0 S` ISM SK S^1 0 08QU 坋t <0P+8Q* 80A0 @2<0P+8Q *(K0a 0 0S S S0 0 0| 0hp Xk( H FOyksxɒ֒x] -PL`p(HK@o@8SKh~ 0@ܒ 0`( "4`#/ -PL@ "44 0"440   ((,,004488<$<"44$4"44D4$D4"4$44"4$44"4$44"4P4PTTX\`X\ppQp`pQ(4"4(84"48h0`@PV@P } z0T0E0T0E T4"40E( 0-L@h40Pi080f/჆WEV 0-@PLP NP8#!00QK0hWEV( <00-0LS@ :080f/U)* RP0// -L*P0 HM@@q<@0P  Q0P 0P 0PK0hO 0K0hH #@hB K0h%1U@@6P0tcidyara˙rbmngnts P O ktęL P0@-@ 3@5C!14!8!<@P0p8)p@-π@Q BaVp(a  …?@@  \P\ @0`0 P#3pa  …?@ P@ @ @D P H ̄ @ )L0 R !R "R3S////) -PX0Lb2pᇅ@Ⴥ, T @@DA??@@@ ) ?00-@@L204 20㺃P0200P20 )> 0R// -PLbB0 p ᘃ HC@`T Q W 20CS20CS  ,KoA 0 )٠Ԡ p-L MP` K 0@SKp 00S0"S1Ds@ -L M$@ᇃ00 0 0  %ݠ' -LM쐟0PpO@?!,"K(0 d0(0 0bK`0 00 QP  0 R$KkhL e0SbK @D`,5 $Kꨀ&M ) -@P00L``pph5!14P S ?oD 2"R0S 0 !PcU ) -QLM0P@/K`p؀~pP K\ K0 2 BMP \ t02S 0S "`  HZ  !SR K0PPأ ) 0-<@L0PS#( ῆ0 10p8) ) -LTM$K0#80 0H0 30@Pc< L0 H0S< r203 0pLK M$K ? %KM ?K=K 0 6$K  0-%K<r"dwP N$K< ! 0p  0 R00 $R0 S p2000#1-R0" 0K0}0p@P0P8000S ȗP  —P  ἗P* 0p²000 0 SA 02L pi5$;%@PD1L  #0|"0 ⲁ@P|2CP080PB80 2@P80 2@TP80 2@TPp0p T000P 00S  0t  0>DK(KA^ )&$8)'V{ ']dvy} -LM@RK!0P0 MR@ <0 8 #KR08 <0DD B $j, }U 0X !U !@#$sO(@, "!"",!0 00     " 0  0 0 04 8 < 0@000(K{DpsO@s ~X04 2`B `F&$)4a!ڑ&(1&l)8)!a1ݑp8) ) -p-L M@  {00CS0 L?P|` Pp pl!M0 P00CS05?0 Y@oKp'Ǥ -LMA~LP?!l0ep K0|0 QP(K  R(Ko| 0S#K|0 QP PE ` ,~} 0S ꨀ&ͤ ) -L M0ㄡ00  0xqP 2S0 K`PTvD!p@8 2S  0`0S"@ R`\EU${p@R000 0P 2S0 KPB(K @ᆔ \p@X20` 111 0ꨀ& )mdap8)p) -LM@p2S*n+^   2"~ E 2"w0Khqol"2pbd_E"2LW"|8KhQ )&@Irp8)ѥ<P 00-"LRP  @"n/|0!$!"$!U !U0X@U00 @D⩃ 0D⥃  D⡃ DK0h蛃 )p)) -`@PLpT`s 2Fq|  B B$ h00C0p8) -LMQ`@P p5 0  ԀLğ R 0*LV$ 21S 0   Z 0 0 $ 0( 0,0 T02SS W=OPß20SQPX & QP 0 2S W SPOKW20  0@P@0`A0Q W 32 R R01S 2SxPp(K`b0<0 0 QP  0#KX(ZW 1`WV   B`F RD1aSR148<$Fg00C0x1@@PAl`d1S 0P0K!14!8!| -QLM@(KQP pxx R0#K `KP0N #K 0#KK!R0B 0専0#X00SP PUJT 04!@0 R acK@0U!!!!!!  AV cK\ X R t !J )p8)> p-LMP P ؁YX 0 RYX ǖ Kp`T Kz/K $b b p!S40R00\ ᧁ)bP -LMK B Q P$P(K@ad0hpl   K QP  0K 5,K 00U 2Pt!p?K ?K  PP%?K 07 <5 G?K`` G ?|4"R2 P?K``Vp9-^?K?K Pp ,)Q b0Q QH F42S @!1?  !<0 #u!1?  !< 0#h<"`81   S R h#"RR RS# Hc@2SL#`L @?K⋯K Cp,r[0S0#Q,30$"9 S?K 1 1 RS$b2S2 0S BT"?K/KYp 0<8rpP倒P0  Pp?K K@T 002?K ?K N d R0 S!Q10Ѽ!d12Spʤp"[1R 8l!h1Q08!X[l2Sp"R00W0S 002S~00/K  R S2[)S 1[)Sk f0K0 0s`0L !`P>H )ͨ,9t֨&&Zp8)ЩU Be[`,5 -LM`RpUP@P@7 KPPd1BP1P@TTTS @ Ki>4<!14!8!< 1!14!8!<`p `#1 1!1<0 1 1 ?0 1!1<0 d1 T 1D?0 Ki )p8)EªѪ ,=N` -LLMԀ0P`@80 ` qh < RlPTpoK,00P0S4   $KZ40Z“ \VԄK 0 4 @8 < 000 0 8  0L0 00R0S +0T0 ؀0p#KPT0SYʠ;! R 0#KR0o }@(Kh[ 2o0pX$Kp 00$KPp 0$KP`0 t@YXԄK 04 8 < 040K0 QP 0 00 0 0h:P 1S #K 0R0!14!8!<!14!8!<p\#K 0L08 r20X0KL ]ԅKp 21S 0 $0 P( 0T,0 X\X000X 00S\8*.X :RU6JL021S" L0240  0$400(40 0,0X0K40 p P T p%KX 0X0L00L0 L0 S00R0S 0 72SiT@p0 p p?P P\ 7BT 80Sl \7K0DK 0A 0T9 P 0 X0K 0  R 0%K80S P6p@WN#KDK@TP0 KT0P 000T 0SEKK6r|"0yyS0KR pSW 0A %KPԃK\@80S 00  0R5P"P RBT E5 $K0V. 1S+ #KR0$KP000 S#KR0!14!8!<!14!8!<#KR0#K$KKPLz8ğV, 21S( 0 P$0( 0,@#KR0࠳$KࠣT0ࠣ^#KR0 @  @  0CKT0PG 0$K pp܀m800  0oꈪ R80S00  0 P f}TZ 0  0  |80S K@80S v @ `p WV`  04oKD00H#$0 #(#< 0 0 0 0 #4 0 0#80 0@#<00 0 0@x2Sf BT80gP^ `p040 !0, 20C0`?@@20C 0`0@@40? 20@0@d040 !0, H2??0C 0`?@@20C0`4 0@@`2? 0@@0H??`80SH02P SN ,0P@@TIJ041Sp8)E )q) ūXt*;KW -LMX"pP2@jS<}P4r(b2Su 0P U2aS 0S- cPؑء0"S'R X/t 0댂X2S F0p 0P0S2S 2S<1!$1(1,(Ko#dP"R S0 R(Ko@D 0(KoSP 0(K )e8p8)v֬-7 0-SL@4 PxP xP xP$0`PU0000xP p00?o2S \0`PUPxP P@@P>)Ā&>) -PLUp` ww@+0P %P+PZ -CML4MKLK A ,K B0:K,0CP5@TE IxP'@ZK,PEAx P40:K,0C 4QTJK,@D0 0+C]K(PE0$0P0S @@C K4@C K4@0@`P0@ t C K,@ }0PE:K,0CPPjK,K,`F B0 !01P30 3Q# K 0CC)& 8)>  _Ȁ&C %  -LPp`?*@**000 0@@@0/t9)0/t9)0/t9) --,@LM  > 㦸' -@Lyq0 R P0S 0`V`  T\W<@0S l0SV@ t9)m$>)' --LM  K --LM  K --LM  K --LM   -@L]M^KMa HpH@SP(KBK! Ap@P,0KD@hBNKd @DU.K B% 7P%8T5: S"HQP0 000PPKAP4: SpP% S00S BK  @00Pxm<PPU BK @K'0P  5 s5P@t9)UW9)tfv -L0KMc0PD@  04  y K!K pt=) 0-0LS 3/ >) 0-Lx0 @(, 0 hx@0\(>) 0-Lxx@lhhnx@0 -LMp @L`PP0 7/P0 SK l00>) -ML M9 0`) & 0 & 0 ;P= (K93/0P 9 / K  @&pPK A4`9P D9% Y0[SU 00 9),>)t I >) 'Czd@ '-Rk -LW $1' -p-LBMt1@0lQS 00R0S@Kp8剣0 FK1 10S0SQ`% 0Q FK r@OoB0 @!00CS050 P 0  0 0 SNT FKlQhrf00CS00@ T @YTY@DOoBH) H)G)'P' -0LM0 |3|C0xS00pS`" 0S`P R`P w 00V| PK0S 0S KP  0SH0SH 0K/K @ H0Sp0K K@s0 K@Nip0S0S幢K@Z0S客K @Y K @R0Sh圢 K@FD @P@ @0 K@6,(K @ ^"%   T   P @  0 K@PP8  x @PJ P GPH) H)H)#*Lq}9 -LM~K M pG@,` P.&[-[URQ  ~l t0X[ ([![UH0P P dj h[([8[Q40 @ 8[([[$8[[4$08[[08[R8[ 40[8[4 0[8[X4[8 [<(0 [ 8[4 [8 [<,0D00D0DPP ([8[4([8(["[8="[<@0040k04  0Q P bK H, P7[O  5K9P 4s `㴑 0R  j `eVXZ  p0G`p  !#;;S`@ `R0 $ R,0T T0,0T0 RCApD0P20Q 0L0 L R0 r 0#10\0\0P 0Q0h00l0d``z" RRaArrAaUD[{'O -MLMP@00P0`Dk00  0Q P KAK+ A Pp<0#$42K3"K#(#<12K@02"K#$02K/"K#(#<-2K00."KP0k00  0Q P (AK A PD -L M@ L0 R0!0!0% Rl00l0 rp00p0KRP0R3# rࠃ^ L rH00L 4 0yP000dqW  -LMpX0`0P00  P00m (K &0 0 0j QP D\ oX0 sX0 P$ -PL,M<0 pPlP00K`8 P P@B P3 0FP` >r0@0 LR0#S!QŸ P\@:p.\F\C\@\= \9P$\ P (Ÿ P? pD  P@PPL0!0@S s@@pP0S'0<0 0< 0(K^\\\\  L0 Q$ 0 q(@," 8 P p"8 @P*"* 8 P0P S "!"0 8 0P@7WyP p 0 p// / qW -P`p@LM0 00P0S (KX  H r0A8 B40 40 s-8  r q` & TP0@ q x 0p P 220 P 220 p P s 0pP pP00 Pp<P  ASf-I^00@-S0P^0BPU02 -LpPx`@P  LP 0PR*"0R R 0 -L M`0pPPPP0S(K† R q  Q R 00Q P@T "Q  PP QA BTS tD q  9 0 TS0000  Q  0 0 g t0P ZP  F BPTR2 Q PECu -LMpX0`@ PPh (K o0Wl0L 8 0R00 000 r 000 PP" ` p 0ST Rp rppH 00K/ 1P 0 h  L2 Y#t ySl0l#2#>p0 Sll0p Sl0l0P0  ^lp20Bp.20BlpX p!#  K0 g#KQP 0_`  ZP -@pP`㨑娡LP0S00S <q.`@q8VO"0S 2S 0S 0  0 P0S P  BP`l Q P l0`<0P0Q*l0S 2Sp  l\PP 0 RQ@0P 0 5B p@-XP UࠓࠃPࠣ^p@^`V @T?@?) -LM@4 TQ10`p0 TP0S0T 0S (K1 0p0D` # 0 K0 0f#KQP0  00P 0X:0 0#Kf#KQP PLp 00  jZ0T 40B@>)y` -P/t0L%A?k@0Sp pKj0FS `C >g@P0U?  C0@>)0PK %/@>) -LM P@LOo U`B \p @ ŗ 0C F00XP 5U@T  K V@>) -LcM@ 1Tp d! `1  SP0`!S@0`pt1 A 1 l1 h1 xA D0" RPX2P 0,,aK ! #1 pfe?K0 aKSR Dh P`P`10C,> pP0UP=" U|! 嘡 1|!SD00S.  " |1p2|1 00a?K ea?K QP  x (100  RR R0(1`1xQ 1 1 P01 H  h ZP3  (10(1)y@?)+Y`WE s5)Qu -PLRUP`@pdP T P,QP K/iD8QP0Q:" 0PS00 Q PP 80"8 B 00 00 ! p@80@>)H) (\ 0-@L5%SQ% 0Ŕ%SPRP ńU UQ0  0Q Q0@>)H) x0-0L`pX@TP @0% G@%RH)@>) -LQM`p#P> R5S2堢005ET/  fP05ET \T5d 05 !dP,(K RR6 @ST 5" R %P0S`0d 0 B 0  0,a JQP d d0PEd d0PDh0K/0h0VKh 0! SK0 r d<0 `1  SK40 8 a j  h`1  h80080#40L0s3[050[040040#403[010[0 0@@0 000 D` DQP (z@>)H)!CpC) * $00-LP@ 050@>)0/pC)0/pC)0/pC) --,@LM  E 㭧' -@Lhq0 R P0S 0`V`  T\W<@0S s0S]@ pC)mH)' --LM  K --LM  K --LM  K --LM   -@L]M^KMa HpH@ZP(KBK! Ap@P,0KD@hBNKd @DU.K B% >P%8T5: S"HQP0 00PPKA P4: SpP% S00S BK  @0Pxt+PPU BK @R0P  5 s5P@pC)UW|C)tfv -L0KMc0PD@  04   K!K wpG) 0-0LS 3/ H) 0-Lg0 @(3 0 Xg@0H) 0-Lg@[WWug@0 -pLMnKM `F@P,~ Put=(~ : Sw/<|0P  rR Tg00d K0C P<#@K @',^ WF(>S T@ KA $N UpPVt=: SI^KPE$>"4$^ @PTfPW0 KASR000: PF,P U $ T@zKKA dP( PP@^pP S(^  S$P@p-p$P@ pKA$=KP!0#& PU00`q> K0 @K @x@P.K BPf0S`Y K@(PPx^K PE E`PHP},P 9X% (KT\ FjF F@ 0`( "4`#/ 0-"44 0"44 04"40 @4"40LPIE $0 $((^ XX^ddhhllpptt0 0-"44 0"44LP0@ EEEDDD@@DHHDLLPPT~TX{X\x`\ `^p` p^ K0h{^ -`@L"QU_@ 0-@LPDDDD0 -P@L@`Ep@Q->CD->C6X3X\0\-9>D9>:>CD?n:>CFD?>CC>~D}C>GyDmFuDEnFqDE~GmDXJX ` p Q  $$((,S>,KD}S>GFDmFBDHHLLPPTTXX\\ -L M@Pp ! "44!1"441 $$((,,0044`TQ\50 S L5s`TpԐ}0  $0$S-Y`, Ih(KTcT`X_X\[\`X`dUdhRhlNlpKptHtxExC Z <`9 6 $5 S\50 S` PP%@ PSڲ  4 4  TU 0`( "4`#/0+P0 C@ / p-MLM@R0 ANK4 @D8 PK0C Z 0pH8 aZ@ tZ< [  p6KP L ? GR0 0EZ`pK `p ?6R81,%0  08 0>K0C >K0C CK9>K0C@Z2 X`xuP0 c0 C1318 >K┘ 0C R0Z 1'0"(K`p ?Q81,%0P `8 01S !0 8V;>K0C 00 >K0C K 0 LX p 剑''ro0 khɔ da  >K0C K 0 L ᘨP<ᜨ L, l9P:>00 X85   @5 L0 #0S04 KFY00 >K0C0pS K8Y 蒟 000 Sc:0 02^e ЁP0嘨 Cpᜨ p c7X0^85   @5 L0 0pSL DCK^) 20S= 刍0 0 0 1"]K0 PE0 $? <8@(; 08 ( (0(0(0 hh(븈  U  fD!0 ؀ k5P0p00@8Q '' 0'PDP>K0C8 7 t0 !8( 0(xPuhx@vhP)@O)M)Ԁ&u$O)P) -LP@7P0S 70S a WVP7P0S 70S!WVP@P@ -Lp`@ba0 0@$Kk -ML MH@Q  (#0b2PE ? 00 ş 0Z 1,%0"xr 04P04 d`PP "`0 R(K020S, 0$ 2r04VQ0n. n  , P 00 0" RP0```00d`Q"R0 PB~K pG MC0S10S%4[&$[&4K%$K@p03/`- 0ܠS 00S0S%4[&$[&4K%$K0$[00@ 44 "C 44xp *Cd080S 0 0uO)M)N)N)hO)O)O)M) -@P`pLAM' @ 0BK6UTp0 SR*BK\'M@3P 00  P(B.K {'KQpO)&Pj# -LM0 K -LXMpP`$X @tK^0,0KT0fKp0 &KD00P QpQ( ttK$ KX@P)QP-D`WVSRWV\/pO) -L$Mp )q QP@PH 0 c04 $? 0 92  BQ ("(0` b80 弡ᴣQ<03<0420S04  X2Q t0004 V 0R  @P/(j  <0 B40ء  O<0``0  4 V: 800S<00(UT6`5 `0\(K  <0 A40 <0` 50S  50S 0> p p$550050S 5 ᲀ5000   M)O)hO)Ԁ&N)P) -P@LKGM M A K@ X \:4 $5 Ru5&0eSJ 0SE !000SpG|R=K 0C 0 =K 0C=5000H5 005 H0@4 0<4K5GK4 0 A QpQ8 tK4 A㸄 G>K0C 4 0^% 22Pp|4p(Kl%0S$ D L000 0  HtP $0000S 0  01PIKA SR W !@ I>K0CC 0 0S z>   P2 s%1P `ܒ L000=0 H   00GK<4K2 I4 `}4Iv400(bo40SH_D2BK H00pH0HBK J W#000 S 0000pP%WG 0L  0L0  g  0L3400C04 S p*Pq   4$ 0001 p  s oZ 4000 @ 0$0 K AQP 0 00S Pj&$O)P)HP)Ԁ&u P)P)7U`pO) -L M@P^`(IYp1`V |10S p10S 00 05 P`8(KoL8`@DT= SR1H 0  Pk$P I 0S$00S T IK$0S 傈0S G @(KoX0P H0 (KTM)$O)M)HP)Ԁ&&Pj P) 0`( "4`#/ 0-TP@0L8v5 0 0@ 00 20@0 Z0M)00S 4 /hO) 00S/hO) 00S/9hO)P000 R0-SL4M@P (KL2ЀX0`BXP0b0K80@` R C Ÿ Sß Q 0C0 0 0@0pἀ ?%KV #K\5S`9 0 #K ?#KK܄K T0)#K ?R 0;00S  0 @0\5S 0 ?!@PA ?  0#K%KcK 0R 0P00Sw  0H@0 0800 0ih8P)M)N)2TZr -QLMP`p1 SR* 0"Q@ xSRQKQPL ?J$K̟)#K0 000 \%@1R 00ß0 2",0KK#KKJ`䀟 l<, L:0> #K 00S   0 q100x@ğ 0J 1,$0 D00x ?J400,00S(KpO)M) H)TO)P) -L,MK @P@KSR3 SR*#K|H"x3K SR$KK\3pppP3` ?gJ#K_%#@\%P 3R 00ß0 2",0@Px K?IJ` L< l80>00 <40 #K ?d0 cc C3H0 t2a8bQ`2`2X2X24$K ?DRD 0H ~/(20Sh 2< p0@0CW40 l10X@(10S<40XDSJT P 0S0?SD?QP 0DQ 0<0 <0Sp@ P 77p0<0 7<0 S0<0 7<0 S@40SʠH 0/ 0 l0x 0S0<00(K@Pp`P)P)xP)lP)M)TP)TP)hP)PP)pP)XP)M)xM)P)O)dO) O) H) $1-L⸐`_ 0pzI  0D!@PP@P 0`0`0 0S8EH0J@0`0@Sp|U0 pQd` 0@P8 !M)P) H)XP)`P)xP)lP)P)hP)pP)P)PP)TP)8 $00-LP@ 000XP) -L Mp1P`ZW A1KԃK00 B? S PIP 2@8j@PU `1 ?HL1W0VA0 000.a"40 X(010 #a,0 \# X 0 ZX 0 SPp0`Qd0S !Z(00d000 A(KP)M) O)|M)M)L)M)_ T00- L?@PH800P 0 W !SR0 O)|M)~ -\PL0SL0L@`1F`a0SSQ000K|M)M)M) 00 /O) -MLM`!KA H0@S 0L8 3/ (K`4L8 u0PH8 KP 0C  H0Q3P0`S( 3Q7Qp<(8,, <0✀K L8 8( 凁6pW0 0 3. 2R࢟0t0S=r܂H8S;000p Qo   Xt"KT8 K.PH"T8 R! p t R1-p10QH(6 !08D8H@( 0A?oR20SO 00CK .CKxt+P@]<1@0S- !=K0C  P0à 1 P P8S L83/ 000!=K0C Ps!=K0C  P0k>K!K 0CA  P0!KA H80H8 MtJM)M)P) O)P)@P) -RMLM0 S000#85@Z@5 & 8`pb$:  P T S$(?V04<V 000R0SQZ !0h0S RnK `F  FNZ RnK `F ,FN0 `B ?FS>K 0CS>K 0C SK R0 A @5R~K 0 pGZ 85-  LT ? a Q2SQ S>KZ0CHp 10w85SX"08#80CK -CK +Pc@50S00U ͂ 2 ` V`80 0@50ST 00`t P?SK A \@5QD 0S.K B("0D xS>K 0C h,0t  #bpS>K 0C SK R0 AX Fy080 01(P KMJX 03/ (K0S.K B("dP3S>K 0CP000H R00S 0 0CK `-CKi*P@5@0S S>K 0C  P0l2 d0 pS>K 0C  P0P)M)dO)P)@P) -L M@@a#YP"KR0"K 0# KЫ D gM 0-@@LPU DQP P 0 QP00pO)C-A؃p@W`VX0 0#00 0-P@ L0$UT01 SR087@0P0S 0SpoP0SpeW00S 0S V 0`0S(G<K0htpO),P)P)Qj $O)m!, -LMp@`WP 0  P  0p`W) 0S C `RpH0`S 0 0 P0L /p00Sdd, L,00Kh`<=)P 00pK&Pj s$O)<XO)P)M)L)6P) 0-P@MLh @  +0AS yyyyy00K00\GV -L,M`pD5@ @0`p +0S 0#KcKePp KSR% KSR ؤ0帐 ?aDq`D H DSR/:0 S 0 S PP htK+0PS #K 0#KH0!7D0 0 S:R H0K30 Pv+P30 \œ#\   s0Ÿ0 0*0| K0PS`30i Si P0S 3S 40S #+0 00KS0\p ?pC0 " 00C 0 RL3b0*0C0b;728,l20S /@0 : S) S-  S;00000`B*K ` 2@pWK (-0K`K(K0bS 00p10800@0 0X04KnK$! T @` `a8b  `p`00S@0C600,P(` @0 ndp4K;4qX  T @` `a8bg ]hN)pO)M)N)mT(O)xM)hO)U O)M)P)XO)N) -L|MR2p@ K?C0\%2R 0   嘒`0 0 0)0 Jd2吐 0\S0 S Hr0S 3S ,@X KQ20 (K'K`QpQ8 tQ4 Xd  K< K R, JXK*00<0[S K 0 0 408 d-@ R 0T 2 K0S0\p ?pB0 " 00 0 @PL3@0@00*50*0S P@ P)0 P(KSw 0 VqM)N)T(O)xM)hO)U P)M)L)XO)O)M) -L$M"@P0`40 eZZ8 40 40 l Z0 U0p 40 (K g@_ T DK c8C SBYAQYS T0Z AG0  (08000 @4 M0 $K T0PR#K0J0CK᐀ T0R#K 0J#K R 0#K  #KR 0@$Ka 0  (@ܠ$K qL0 L0 0KiLpL `R0 0 04p 00800` 00 v(PU@0PԄKZ0PPM)P) -LK0C 30Sc ß3 X 0  0SN P`,0Sß9!.0`4 0p0L `8` ?)$KA0@P P0V20 0B0S R@TU B0S R@TN @|2R@2b@t2@0S pPTBC~*2<2'020S 0 0B0pS 1 '0,0W!00810S 0S \ 1 0S(K @ |@P p0 PR<;0S ,6P >K 0CC2P( 00>K 0C 0C(P 0SM)$O)M) N).M)LoO)O)XO)1N)SpO)8P)L) 0P)O)O)M)hO)@P)P)N)P)9DU d -x@L`Pvd00S 0S Ljp P0S Kh-$O)N)} -LM!#KH0@S#K R0SRK pP #K X"TŸ  R0 4020Sa $zP(KP܃K b<000CSW-0/  1!. 1 R#K0 #K R0  00#K40Q l!H  R0 @  ^P P  004 " #~P0*"P 0 &|0 S0\ YXYX P{%0H)s$O)O)(P)(O)P)N)00S 4 /hO)00S0`( "4`#/hO) 00S/+hO) -LM4M8KD0CP$8KD0C@$l(Kp:H BW0( 8K<0C: SWW ` XpP5 D8K(K<0C8 B0 000PP#!0 00(K0 (P X8K(K<0C8 B0 000PPh0S 8KD0C p xl !P 8KD0C40S,D @E 0; (;(KD B;W1 S> K<ASR:0  R0K<A0 K<ASR:0!K<AQP00*  R00S l:0S_ 8K\ <0C fY 0xK04pG (K0 B?0000?0  R09* 0yS R h!P8KD0C0`@4VI 0408K<0C9 9R00kK0 <AB``?<8K40C0P0 '90S 0 8K<0C 8KD0C 00"!P8KD0Cl80S,x tbD3  Z8K40C K 04A 8KH0C0 Sk7QG<80SC 8K<0C  R0S:R;h0S8 8(7d 0K,H0"0 !P *70S 8K<0C008K<0C 8KD0C 8KD0C(@8K<0C (/60Sh0 0!66(PkK?H0S  0 # KDAP0L M%hP 80 8hP)PN)N) M)PM)6M)L)P)0H)M)N)$O)hO):O)M)N)';dO)XO)bL) P)- -LM07 0)Kgǟp,0S)4E>@C0A ?ƟT0_X KI 60 0  V唠0, Rd |6 (K@唠?J*@$\0Q @ ?@_PIK@P @_)KT0)K 0)K 0 p1R(K0p (K R0  00(K0@P0/ `p!. 1`R0 V`` `0@& P0  K/0$\Qc  ,   d00 0* 0 fAh40S`40V SV P4Pd0S0x000KS Kpd0,P0 0P O0030SQ 30SM 0#S 3S K0#S\0?0P!. 0K K1 @A. `S ) sRPK0 l`pHK@TPHK`|0 僑20 ` (K000^ K0!Q0SR 0D$o0P0 $v G00iKWVC])KK`p V0QP 0QP)KD1K0?S\^!! K0QP`3p3: `P0 @ `00 00)K 0)K KKQP 0!SR 0 P (KSR* JlGN)M)T(P)O)XO)M)(O)xM)hO)P)M)S'$O)M)U {N)0H) -LM @p 0P̐00 00 00CS(K Pp`0V QP p @40 40@ R0Sp` 0R @PHH)O)( 0`( "4`#/ -pLlMX KG0d`<0KT10 P1 L1 0,0SI8A0S 0 ,Pd0p 0P 00@ P 0D R`pUT@PP 0GK 0RpQ R8 tQ 4  R K  (KM)(N)HH)M)'P)hO) 0000@/00S 4 /hO)00S0`( "4`#/hO) 00S/%hO) -ML M9P@@XH9 90S P h9 QP*00#0_`04SD9 ) (CP$D9QP (P80S= 0S: (00P./(0~KS069K0 pG< ,D59KV>0S@80S69[5)[59K6)K5i[0``S`  cCP ; 7 #R0hwgc0哮KS069K0 J< ,59K">0Sp70S69[5)[59K6)K59[000D9 #0#    5D90P9@ -*-&00C0 E00Q0l L CpPL9e 00$pS 0S X&`000,P$6pQ cP.\V0P% .P%PAPP5P}{ PgP  ),@ )#`0 0C0FE  P4`@ Sa 0H9 BP 40 e 0" p4 !D9Px40 hQ0 L4b0 0D) 0)P#P ib00C0(K 0#\0pß `SP` 300isP@3 0 0`D V PQ`444-p0AS񟗧ԵԵ$$QŸ<20S40000>P1 d2 #R0~ `2 0#R0sQ# 0ST20SH 0 P` v   P000  !0 #R0  CK K 0p@>K0C`!CK\ 810 S) Hq#R0 š!ʡD90S  0R %KA 0 0 00p0P`000C0V& BxP`< P)O)pO)N)E B[P)_vhO)cs7$$O) M), -ML MP0AS񟗀D nP 7 e aP 7 00QP  t7LP t70S \70XGXg]KT7  PEd.X C0D5K(7p5 0E 15 5W2:7 Rp5SF5@PQU`V:(K l PP hp& TG PF0S : 5 0 GB  0 =00@(0S S蕟腟%@(0P, P5 2  B. ! CK50S\ 0C.K0(0h00`0P X50S Lp(0H?(0 50SI Q(DuSK,@B$ RKR@ ) HZ(, H: _ Y 1 #0R) Y $ $ $ Z 0=Z@ ,8< SK@.  (  C.K /S>K0C( $ Y 1 #0^ Y YK L S>K0CY>K 0C ' RK 0 H5 H5%S5p( 5 R , uB"Q@,0Z(5 0@H  5SZ0Z@ ,< M(5S '@0 (0S "|QP 00S"0P!P 1 !00C0P t00000C0!" !rpd0Sr@0q !SRm j00@h WP)GU,N)M)M)|N)[^wM)'P)O)M)$O)hO) 00S0`( "4`#/hO) -LM"PĂ1EP Q" 2@T(K0S x 2@Epd0DAG@D`0p PP{00@!SR !0 Q2Y 2Y Ao1婒0SY QP000Qꨡ0a  R R@0 S "1P <100C$o P -X K'A <"K/K 募K" tb pr Qp@ `Q8 t[K4 F !Pc l02 K d000M)M)M) '$O)M)M) P)HP),uP)Su -L4Md0p<0 张4 P@<? <\%d4R@`  0   0`00 0 b@00 940S30] S] 3 H0 R 3H S  @ 0 pL0 2D0 0<`堣80 L0< 00CSG80TS! P3 80R000 A`pD L3`A0 00?+<` a2! Q,S Q0 p@0B*$220S P PB8 P(KS @0 X P080 0/ !0. 1R R  \"o 1Q_0T+ 0H S`? 040 |10 ?;40P0K P0  00#K04 "  R 0 H0̐S 0 04 $ b? P0L  80RT $0A0$0 @ 0 @L3D 0  SR 0< 0`pM)N)T(O)xM)hO)U {(P)O)M)N)O) 0`( "4`#/ -`LlMX K?2ܒ0 0,0S(KB0S p0p,Pd00P v00d20@@_10 T2 00S`UTIg" p "WpQGK W8  Q4 tQ4  W4  XQ   0< K ARRd0pW! 'P 010S  0@PP 00S  0K0Q SR  0 0 K W !000S X P  0<M)M)'N)P)hO)N)L)$, -MLMDn弍@P20xK0,pG >0t0=0S5X0S+$5S/\= R L 0S 0 $5堝= **#='=0S 0 0 'PX0S$Y\YYѰY<`0V\0 PT0! X \  Bn> 00B(K1/B08K?C\ 0K00B!L100$Ŕ`\d0@h0;0Sh`h0QBQ00h0 1l01d0dKA@<KzAV000=S3Lqo QT00B' X TS0 BB$51`R  B Q1- 00Q  T$: R( 0S  G봐0- 倐B$00B1Q1 `R)B!!@ L0 PP4 0 sPT t:P\ *㠐Y"H:V<:0S M0 0<8K!>C0(KA?/B08Kz?C0(K3A?/B0 =(K{/B0T0`(K~/B0(K>G/B08K?C.=89 0KLVHRKLX0S8K(K,0C>C.B08K>C@ |=8=`C Xa08Ku?C8Ku?C V0m 0KwA 8Kw?C0(Ku/B0(Kw/B,0 Su8K>C?^ PG 880S KAA> CKA˄KALKA|夿8K?CEP7 8K>C@ 6000t7lG*!`7T70S 0 0(K0(K{/B00S8K{?C`0/ !. 1R0 X 0`( prPf0S pd8Kw?C0,\8Kw?C0 008Kw?C8Kv?C (Kh?,8Ky?C`8K>C0.B00\5Q 8Ku?C008Ky?C  ?KyA 8Key?C  ?9 v550SD50 S 450S(Kz/B0 S (Kz/B3 S 8Ku?Cd0S t0 0040S 4 0S0Sy X4x4t4 ?s&(\0d^ hKuoF`p` ?`d  B2h b:"6>/K h?)KyA`KALKyA``p 0`AKAR`KA 3pW=S(K,A(0K,H08Ku?C0(K 08K?Cy/B0 W`C`(K,0u/B 0CS=SSb 2 \2 ?,(KyA 8K>C0(K0.B0\2Q 8Ku?C008Ky?C  ?KyA h8Kay?C  ?[0S 8Ku?C1a410S Kx@P1`p1Pq0h  \10S 1P0 11 ?s&(\0`^ hKuoF`p` ?`d  B2h b:"6>TN)M)$O)PjP)dO)JO)M)'TxM)' O)M)GqxO)(P)N)O)M)M)hO)`O)U P)M)j(O))J@8K ,0C! t $5S88K,0Cp 8K,0C $  ( RV ( , RV``0 `RQ W ,`0 xp x Qxx hK,`F 4:(Kz/B0 ST8K{?C T:K(K,@z/B0 S\08K?C :W =SL5s(Kz/B8K ,0C#p8Ku?C⸠0hK,`Fß? Q)8Ku?C0S!8KK,0CzA R\ ?0 K 8K,0C zA B  R\ ?0  (K, B 00C 0`㨢KA08K}?C  8K}?C 8K?CA0P   K BzA  R \  pRB0/  8K?C!0.0(K/B0 1 R R KAQ"0(K/B S `000^  ~aR8K}?C0(K0}/B0(Ky/B 80 HS(K}/B SvxK,pG0008K{?C0S0 d0 ST0T00! !8K,0C P RP%XԀYdp0   c000$5S`0V3S  K,Al!s00`R3080(Ky/B`8KKy?CA R0;D6(K0/B08Ky?CЀ0(K}/B08Ky?C0(KK,L0F/B0{(K}/B R(KK, B}@$0c$ Q`VvaRQ0\04 0$5S(K, Bl0`0hppWS $%S0! !K,@$0(Ky/BK0yL@! `a(K0}/BK0}L ``(K 0/BK0L! ̟ L` 0 8Kw?C0  `tP= l80S  0K08K?C0uA 0008K}?C00008Ky?C0 傻8K,0CC#P8 8K,0C  i 9*9}(90S t0 0H9xK0,pGS b8K~?C %Pi0ST0TST8K{?CT P! GP9 8K~?C D0K,AST0TST0z8K{?C T30 0H:0SxK,pG0S\0S\8K?C P BGP 0S\0S8K\?C j0 08Kw?C  0 p0S $S00pW`S8K\0}?C000S\0?000+ (K1y/B00+ Q\QKA0K8Ku?Cy@0#8K?C q8K(K?C/B0 Xp(K/B 0RpK(K,I?}/B0(K!.B 0WlS`0?00S8K`0}?C0000+ (K1y/B00, Q\QKA0K8Ku?Cy@0#8K?C "8K(K?C/B0 XpK(K,I?}/Bp0 -p`@HHLT(3P P.U @` -AL0 5 Pq 3S5(r`1 0" 0SV 0S 10a0  la* `1 T10S 0 0U2031 PR5 0S d@ 5*< 5000S 0 0@TPUKhP\0UX PH0@ P,0M)$O)$& O)M)hO)=P)!0/LH)0/LH)0/LH) --,@LM   Fv㝷' -@LF7q0 R kP0S 0`V``  UTu\UW<@0S 0S@ DbLH)mM)' --LM  K --LM  K --LM  K --LM  , -@L]M^KMa HpH@P(KBK! Ap@P,0KD@hBNKd @DU.K B% P%8T5: S"HQP0 00}PPKAP4: SpP% S00S BK  @0Px PPU BK @0P  5 s5P@LH)UWXH)tfv -L0KMc᮴0PD@  04   K!K LL) 0-0LS 3/ uM) 0-L,60 @( 0 & 6@0xP) 0-L6@k*&&6@01Q0@?o-2 P  R2 P0S 00CoS00S00 \x PPP TH LQHH  0000TTTP)hO)N)M)xM)T P0-L@0,00S NK0h$O)mf 0-@P0L000 0 0022=p 000=000X0X0<0<0@0@0\0\0H3H3L3u/L3P3P3T3T3 h K0hr 0-@P0L000 0 0022=p 000=000X0X0<0<000@0@0\0\0H3H3L3u/L3P3P3T3T3~ zEEP  t4K44K44h 4h 5 5d0d00000P5P5H5H5 @ A H5h H5S>S>K0h 0 \\L5SPPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//P) -LMH8 @T 8T8t0؀ YX+ 8  ?#K:T0#K @P @(K0\kPc0S0 30S30S G ? /:K TcT00 P0\CP434#0S, (#S*  P S0S 80rS tB*p0S i@异\hp I/o2" W ڜ8Y 0R00 4<, 04 K0 4000 d0C? Kj/:Q00S8,0 0CY    AŸp 0 ? 0pS]0S |A吁0h X10S  P L10S @88Aqm 0S * 00S 0 0 0@0@ `hp帠ppHQ*0 R A ỵ O)$P)O)M){xM)$O)lO)P)hO)M)TP)1M)xO)N)KM)M) -@?ML M@0_0K?A`|P4X T3 d}(KT0S  3 g 7: S "}P@>^0SQ 04(00S I > > > ?   ,8 C@ ?T0  :,8Oo,  4,0(QB@R  P >R0(  /P @T ᢾP  勜ᙾ48P0Sp=0Sx 88 dMR r>K 0C0>K0C p8<.00P @=0Sw0St@Tqe>K 0C80>K0C p 5[S  ZK @/P ZK @/P Z.K Bd k)YL d"7S,8 4  4Z  X  pW   KV. @*  .0  (5 RISH ?Ѐ -` \ P `5, S<(0Q p,t  (5`# qP `5,(S>:*0:0: 0:0 0'0p5 Q$0Qp5 0Bp5@0  p5 y.T0Ht., t5 n.!KA ,(0D-G  ?00 |: IP`pI)0`\Q=S.30P 5` ' 9RV0 S @\h SX i 5*< 59 90S 0 0`8:0S 0崳|9 0 S` V 880S(8Qm 0g0xȟ-B ,K) 0 NBt D ``b(.`(.`p .K x B 8gR&( R"=S0S ' 0Ї<<00P%X30*]7Z 70S Q0 00S5h70S10=S-0S D000: p 0L%000P%X30,0v *#! 60S 0 00 <0S P 6 %PF0 5*P6 `60S 0 000SP0E0*5 50S 0 00<cQ<0P 0\E<0*`5 p50S 0 0D0Sl0L%r8 Qڨ0Q2ڠe 0 0S l]0S t*4 40S 0$ 0 0 P P?P 0S/0L%r+ 0QQ%ڸ(0 0S xP]0S C*\3Y 30S P0# 0 0WP 0H00q&  000cH00S $]0S C*03- 30S $0" 0 0+P 0L40q& d 400cL00S \0S TB*X2 h20S 0," 0 0P 2@T p1E~Ⱑ p\  P@TR 0 @R 0\0S lA*p110S 0D! 0 0M) O) P)P)M)lO)$O)M)0P)HP)M)xO)7,V0N)\  3ZT8UnTN8P):6 D_tP)*SxO)O)M)`O)O)O)M)M)'N)xM) O)hO)(P)gN)P)pO) O)M)L)M)|M)N)OP)M)P)$P)O)M)LBALTkr$O)-dO)N)O)M)N)O)[O)Q\ N R  H4PU XAQ,5SڂKSΌ A SR( 0.KS> B0S [0S q*110S 0! 0 0,P 0(0S& xQ* P0S< x 0(%0S [0S |r*x2h20S 0" 0 0<QP H= CSR( k0H  ? A0S [0S Ls*H3830S 0t# 0 0P L= SR( 90L  ? 0S P^[0S t*j4g40S ^0<$ 0 0eP  X4 0S640S20,5S.0S $0 000.K BЀH ,5S> <0(5? @L u ? *(5%50S 0D% 0 00SJt50SF0L5sB0S %0000L50P5?T5V>X50$ő-00  B00B1\!`0 P0BQ@5,F00L 000*P6@60S 0|& 0 06 PR 60SF*660S 0h 48`P@PL, p,x 0x `H   ? @L  ? d7;lPG|P|,8LS@D00ET@A,8P80Ÿd 8 B2 b>@"8<_P 08S 008 80S  <80E A d ? B2X b>@"8<x80S   0,(00p0,8 ,8@TPD8O@ 0@P?`@;9P( < ,@1<9PH 2 P9 Q\@_ UT@9 @99p9 oPrp9W @9P @9@C  Pg:0( ֬_0 5 @: pH:0S 6[S gKd @)P 8: K:PQ Z @ 0P@@ 04 8 <*c#!$c4"+S :Q  4 P 0  0 W0  0 0 0 0;a(!"4a#Q  ; R CY0S 00 0 0 00  0 $4"48#8 S8 (< R D Y0S 0 0 00l0  00 $4"48C8S < R X0S 0  0000D0  00 $4"48#8Z$: A/oQ" /Q Ry = R X0Sh 0*000  0000 4000 P $v(> R 8X0SE 0@000  0 x> >Q>+,>N 0S > ~^ 5<00R.00.@0.0P'5PFSPdv$|Pw<uP 0 40#400#0`p R W !0B8#80P 7@PUa0`[PVt0lpSW0QN R  408 08Y @D  @)O)N)U 00-S!4!: SL  S  S  S <0P0 S  S  ShO)N)| 1-0LSp lh'@ ㎬T L10S@10S0¬(1 10ST00S 屬P`媬00CS0 t@ T @YT XYT0 @00CS0] P 0  0 0 SNT$O)lO) O)M)PO)'P' -pH0L0@S` " 0!|Px$O) -PL M<1P81P4100pXP1 P PKP 0` P P`` =P 0(00 6@3oTP00 UT X P(K PY` @@  0O)O)M)(O)O)O) -L4M0H 00 1p _%#HCK8 080 #K 0 500P 0 Pi0 [)<ӫ0`040 00V ㉫ 0 00P40 4(K?P#K 0  H  PP ! 00L0  ?$KL0P SR ,@P?$$K 0<呫40040 0`p$K凫$P)N)$ -LMp0P`80 @ ?#K0..&#K00000 #K  ᷗX 0 (K 0WPxX (Ko#K ?  8嚗P S ? >0P$P)0P)2 -LM 0`S@ PU 816 (U$$ P0 PP0 0Tp0@T(KР0 @DLc0T@S`  80E A ?#K00d 4 B2h b>@1<"d0S  0P00p$P)^iO)M)hO) O) -LM`pdQ A\ a2PAl 000 SR P0D D000p 0@pKM)R) O)R)M) -LM0P@T@Td `L l0` WV @   00P00@@000$KO)M) -`p@L\MX tK'tKeKT@ KШ 00-L@S,($(d($(0H0S  T00S H>U0004,VP000$O)t -D`D@0L P (00S KhM)N)hO) 0 /M) 0-LT @UT0*<r80@400 ?1Q0pO)N)M),& -LdM`SR00WV0S@ d `Q 0S  BR 0(KT K0 G' 0Y0*X49 0600S -0 00SS00S 0P0`d0 0 40宱$Kk誱xPO)P) O)M)O)M)O)$O)uM)$P)P)M)hO)ZO)(O)O)O)O)N)R)R) -PL$MD3p00 8Q03A @R _3CK40 ܃K_R 0a@ Vd`@ 0^ PŁPXU@TP  \#KP 0#K ?#K#KPPR  ?000 2 0;0S 3P P <0 P(K0bS 00 <0墿$0A0C$0 @ R0 @ 0@C @0LM)8P)(P)TN)(O)xM)hO)U {O)O)M) -`pl0LPPATR @P<P0S @ \$1p0AO)80 0 1S/0 R/O)`00@- 5< ÒH0\ 9>@UT :. BSR000M)^F -QLMPp` "K< P9 P40P0 Ȁ0S 0S  BK @P@ @@P0 0S 0S T0 sBK @P@ @@P 0 $KO)L)N)Q 0`( "4`#/ -LM@8 01 00 08Q(KS@Ppqa8Q0Q 8 40 8 40Pdt`pP  `0-LS99\9H9@o10 0000000B!000!  0`-LQ<:(::9o0! 2B1   P"1 0`-LQ::::BBZ 0`-LQh;L;0;$;BB[ -L M$5S`@Z UlQh T  10t0pcR40C<X001$0 p40 0 0 40R !S`V+`F0DS@@ @ C@.Q%@C00Y T  @V @(K ^`  @ @D -LM`R@p PP \q_K, K4"DkP`(KP(  p`"0S Q<08 (00,0 000040!04 04$0D0(0`P uW `h |`}`h20 *" Xgm Lm @m 4m (m ᫯p ᥯p < "K mp 42`#f0`9`a8SzPb 0  *0*0P0  0* *d@edA !zd@4 -PLCM M`B.KpP; B p@P E>K P0C0PحULT!P0#  K -pLMnKM `F@P,~ Put=(~ : Sw/60P  rR !00d K0C P<#@␣K @F,^ WF(>S T@ KA $N ͮpPVt=: SI^KPE$>"l.$^ @PTޮPW0 KASR000: bPF,P 3U $嘮TT@zKKAP( 劮PP@^pP S(^  S$P@p-p$P@ pKA$P!0#PU00`q> K0 @K @@P.K BpP!0S`Y K@⠽PPxZ^K PE E`SPHNP},P X% (KT\ FjF F@00S 4 /hO)00S0`( "4`#/hO) -L M`t1pl100 ? 00K @X_` 040P00p  !lRRQ00S" M% 0%D@L !0ZXt000Z ` 00@@@P80(KM)M)L)u$O)kO)[P) 00S/XhO) -L$MP8 <0 @`pሡ0T000(K00 ?V00P 00K0 08000P000S 400 ?00<00 0  0|^0# :> C0TS0S0P8P㘜0M)^F$O)R/- -LMԀ#K@ 0K `pX0P` `0 X(Kf  ecK`p 80 80 -@LM P`p 0W0(08#8#48#8W00 T< !<04080? K :^FF^: -@LP`   ~ z -`@PL ((UX0 c#!$c4"X0C-bAYXQPYX QP#P00@-P40@00 P0 SR0 -LM`p02#W 010!00 0 4 CKTK 4 I W4 c>0 S QR Q0 R @P@  %P$!#K pG04 c>0 S Q\Q0 R @P@  P CK!@PbT  0 (KD/ V 0-`L3S t0t ttbATpAS`0C`pX0Tb V -@PL40S:aSʱd0d d30C800S   0刷0080PP80S0 tgV ,00-SL@0\00  PG,f0,0080S $0$ $$0K0hUL){ V ,00-SL@ ,0, ,,TP ?K0h; V -LdMd Xp`P (88S0P P84PE2PE1PESPE50  00 0儜5X  /\Z㋴PE` %0P@0 D5Q <iO0@0 ?U 0XR P(00,0,0$%K! 0HL(0#$K#%K0@p ` $$K0@ 4$f0IKeK`Pp 0l840  %K %K $K(D D, 001"SRS 3S`4$`V:001V#%K 0`F34`D0 ccK#KKQPd0@ #K,<0KD JPP,``3Q 0Q+ 0CQ܃K 0PpS #KT$PPP _TPP! P0޳TPU !5MPP !T,0PPP 0p ?&K0U 4 KeK#KQP LFv 0R3`0 0$KL `0SPp&K܄K#K%K 0P YX1!?%K!< K 1$K 0コ%K!4000!R 800800 p2K0U0XZPp$K 0P 80S0ո ո0C800S   0庵,OP:^@P @(K0@0 L)LBAW /V9w NBAWt  -LM0@,0S0 $`p40S* x(K00QUp! #K40K :`P  o`PPV -Pp0LS,0S`@d0d dd)Q L0< H 0P@DT: V; -LM@p0C,0S`P0 Q x0h t 0P ! "K,0K P`PEpU$KK VM p-L MH0P0` 8@ 000 W `KpL) O) p-L MH0P0` 8@ 000 < `>KpL)M)% -0LPQ P plAP=.@L`Lp0P R   T0!  @lO)R)UL)u 0-0@LP0,0S /000R) -LM,P ,\  ? KR) 0-L@P`p00Sh0X0dSX0`( "4`#0D006.8 Q= SR00P)hO)M) 0-LM20S S+,|2 xR0 EL% `Q0 \bXP㹗Dfpu f K 0 `p V0Y" $ 8 z&pZ 0Kh K T  0K $PJ{GPP 00 0bz' 0 QP ᦮P(K 婝P -L M@$4cr'@P  0 QP (K l P404 --L M 0 K --LM0@0  0K --PL M 4 œ 庋 ~ Km -LMP`pw@P(K ~P P 4S  0d T0P$ {$QLP 0S 4S $ X 4P S $SW1V!` WV000 0 @ 0 P $WV  P WV4 T`嗆#`P&" K+K R0+K4S 0 K+K " KG" ` KlP\ 00pP0S p أt -L`C$$0 0 x00`E؀E$T0   P0`p 04S `P 0 08p P$0KP#0 0zp P 0p~  V0pXv d@0d@G]s -L M@P 4B BR KDgp 4^4 iKd@ 0-LPP@p P@ T 4PS "04 0Jo -p @LP0T P ` X`p@0 p@@$$ QR "( / 0T 0< /$4 0T 2 / $4 0T 2 / -LM`PP@ p ԀԐqT! 0 00 D 0 w `吐P  `0 00l0T0X:(K 10 00`0( 0 E+'2  C-$$L0A P p-LM@ЀX P`00 0Xg Kp,KP 4"KR 0 S40 -L|MP_o!R0`@R(0S00S "R0oU (KP PU 0SMpWJ (0WSFP0 QP>P0 QP6pG)00S$00 P0 P! 9/p  9/p 40 8 m0 K$8K0 P P( -L@pP`sP 5/p 4 5/p 4 8 -LM`0PS 0$K$D0  0  0P@| 0@ 0V 0BV - 0LM 00 P ~`pZ(K0  8 40 ! P 408 0S L0@`4~@  0 40H -p@,P,`L0 0@TH -逐L` pPp@ 0 0 <0P8  @THC -LM`PQ@#K  00 (KP P0S* 0E8 nP8   ` pKp Ec` pԃKp  7 p-L M0`SPL@ KJo 00SP Kp40 -L iR sR aR  p`B>sW 0-LP@P $0)P0^040 -@LT`P,0咨PI40 bR0-0L LR aR 5 sR tR iR(} 0Sڈ&0000p`00B @P 040 -LM`@$Kp`P0 $0K0,ύ$0[S $Kɍ ㆍKШ -QLM@` Q  (KA^p P$ڦP tB^dp0 00 ` 0P  P -L4M @#KP H 0#KK(KP 0  0 00`p $V!9# SR @Q`p `p 0`p#K 00b VR`p0SH V0 SR$ `Rp 0bp $PP 000 0` 0pPᗧ4 u\4 !#K"4 #K R0$K R0#8]pu $ $&#K8 '#80 <0#80,0RP PP PT0PP0 S&Z^#K pU 4 0 00`0$K PE 4$$  ( 4  !4 "4 $9pP0 +[vأ 0-LM0@0S K0C^ E$剌E$$0 0~7Pw7 @x("(!o"`#X80P K K@aP8^&&%6H]tu0$ 8 -pLLMPdK4 h 1夡00 ! zp h0S# |! Rp!dK(KfR lRI dKHh0`S ,P ᩌ@P  )[h呦@ Ph Ԁ h僦T 0  0@  T p up0@h  @hDP@hKp40 &ob&' -L`p(@PP0 `@00! 0$0 0-@PL0$0S /K0h+ -L,M PDT KX*`` pPcK%` SR#KSR00S& Q UQ 4 04  0{0P 00P$0 @TPzK g(KQ UQ000 Q1!!U111 Q[P  tPPH 0 Q 00P$0 #K0@S0PT#K P KP`p`#K 0cKWV0@S0PP0 X00DP `` 0K؀ #K X0 00P0@SP=< 4$ P- -L0M@Tp0`" 00  0d1"p 00  01,$ 000XC P` R#K0[0; #KV05#K V0#K KR 0K 0R0C"KR0? 09T0 K 00 1,$"K(00(0 0K0 000"K #K 0 $KT0K 0#K0 K 01,$K0RKcK "K -LMԀp` @PEJCV@@P(K0Sl@ #K 0P 0@@000Spd 0L H1"P#KR0@#K @K T R0 0  *0  0 # H1"P؀T 0%V@ Q  X0P Va  R0 X0V Q #KK T 0Px qԃKX  T0 0 0000Sp@^>Y}-P/0S//P/0S/C-؂ Đ\ @ `pR0\ @P  0  0V0@@ P Ѝ R0P@P -@(MLP@`puP8RK`$ <KψP0  4- -LϣX@P HHH0H喉@@E@8`8P@_T*2 ',  R-L R R 8R R R0-0L@P# R" +:R! R! !S 1 @p0  0R R 0R R00000000\R) - LM0Pc@P(K0!S R `(p`^P4S 0l0$$0KHH00 80 S4S00r 00!S1 !@10  p 003/p H08  0( $P 0 0 KR 0"`p V0"က00000 0S  0R0`pWEV(3\R) 0-L4M00 0@`pt@0 80 <0  H~pPL30S0`KqP 0" fU AU 7P(KpU sU080 0KEp0@0 0<0 0D0 @$KB0 QP 4 `D0}p0ᴐ0P0 0T0 4S 0S200  R RR*R 7:R W R!@11 R : RRRR*R :0BS<0SPR R2 R80S$1 +10` 0`Xpzpu ypq D0o_P@ @00$Kn 5pPP^]Z8 H00$0P T0 (  R0"`R&Xȁ&\rR)P -LM@pQA^p  PP`|t`fP `P KpP 00 P굣P  -L@`pP* tV0Anp `Bn $$ :0 P ! p" $ppP 0 0 P굣P,I -LM@`pԂ |pP920S7)`pPk 4S $R4T QyP N S$ 0"SR  p(KrU (KoQ P` $ 4R  4S  0P  0SS P P 0Kp 0 0 0  0P+, ?o  010 00 0`pPth$SP V0p&i&U -L8M@P`4 TKWp0pp 0   |p P00S 0@ TKTKpKBM&&  -L#KR0\0r/s?¡á[±< "( ñXpPn(X0܃K 0p 004 X 0 00`00Ph 4$$  O&,&E \      !D!K3[ >K3K3[3K040K 030K 0  0S0sS@04)  H0 PH0 p0lS@h噤( P p m(K@T@T  -LDMpP<@K 0S  o (K-0K 0.0K0/0K000K010K020K 030K040K060K0 80K5 P40[ R 0S P0L哥&@0 P@0:PU%  p-LDM`P 8@ ] @\K@ \K6/TKp  -`@,p,PL 0 @~ T % -@P`,0L4'U Kh  -LMpPP 4  0440 00 ,0 (0 2[:#:92K,0[4K@0<<@,0K  p@`4K K  PXx @@ R00``V%&%&&2& -L8M@P`4 TK0p 0  utp T 00S0| TK0PT0S 0X TKiT@e0KTKp6(M&H& 0-@RLj 8g0S) 0-@RL\ Y0,S) -@PX7LAMPgPw  $1  tp ,70S  (KoZ0$1 6VpP 1$P P WP 8@TXPP N|$PF $:~@P $!h%00CS H UP Pa P  VP 0KK o_P0S U`P K?K|P P VP ~P Pz VPu tP Pp dVPk jP Pf @VPa `P P\ VPW VP PR VPM LP PH zVPC BP P> pVP9 8P P4 fVP/ .P P* h\VP% $P P DRVP P P HVP P P >VXveP fP>M 9MK?K  0KK SRP\X  x VP #M \VP 0 `3UPO PU MUP #80K5KF P UP PO P UP  UP L@eP TP` 0 P,1 1$ #U : D UPN L (T`PF ,{O PA U!0KKMF P5 U!0KKAF P) UhO P" UP _Op UP WO P LUP m0G/K$8Y1[SeP  LmGKF P kUP,1P0,1 840T ᢳᗖ=obC(40&؂&F(P'!Y R%R(](j(y((((((((((u() () ) x -LM@`p[ rp ;0S  (K0FS iSPC>`C$4P Y)P$P YX 000@:PV0P0 ( $TP$$05OPKTPP TP (0=OPKTP N$   PQ0h00 zTP EKP80P ^  P0-K0AK0 0 0 -K R0.K R0/KXTP TT0P0 'dP⴨ LP+ L0$UPP 00 QP\ 0S$I,<, 00 QP0`KTPg EK`PP  Pwc K⽾P TPN eN`SPpF ]N/KR000A/KV 0S @ ;$4P $$0$4P`0VS`P SP ^&SP cP 0嘦#81 [L`P[Lx&?  0`A0 QPvH<SPM pSP MrSP MSP M~SP MtwSP MpSP MiSP MlbSP MpLZSP Mq?0RSP Mr1S -KR0 ࣴ-[r? ñ! ás?s? :SP M3SP Msu$$偃$4PbpPp K`PK$$؀0` 0 QPX KoSPe DKP x RPU sDKP@RPJ LMK$RPB DMK\RP: $$峂$4P-K! 0".K`$G$` 0 00 QP$$吂$4P` $ob,)40&&0)i!)F)F((g)(()) ( ))i,>!i8> -@LM $K $K 0`( "4`#K 0-@LM PK K] Kpp@ @) K4剃p(!0K0+D>'iP> p-ML M1@0S1`0`S` B.KH0x1 P h!hBKBK\7xP 0`0?o0c Pc U %P PP "x0 0B.K00`0 P BKBK xumx0 0B.K00``0 P P PBKBKTw000@ 0K3K0wKpEY)FY)`>i>p>}>>> p-L M?PP ㋽ K2%P ㄽ ` @T &KpP  00SYV  hw@+>R0 R !  -LM@@ Ppp`#IP"  F BPP1 [< PP>PpP [pP0P y[0/ Kp80 >P/[80) h  <D0 8 . K@pD0! / K>Pr /0[SohQl @ Xpal F["[ R R RS 0PW l S \ʼX (m<W 0d80S, @ h"P@ `pd HQ L 40R !_01Sp0S 3/p\ R 8 Xp \ Y </@ `p (K(+D>>H >>f>t-?>?C? -L`8O@P@OPU qHpP gQO P F@gHT -OOP -LM K?P K -LMPp Kf?@P00vp` KP K KK K0ႁp *[0 w?>i 0-L@p K0h0 -LP`aOpP00 ZP@?0GZ  F -LP`AOpP00YP@:?0'Z ~ F -LM K$>P00 K -L8M@\ K(P>P1!OP# YTK܅K@0X 0`xpeKX0TK@0 JYPP"  O@F$`$K< KlTKKheq-cqt p-PL$M@` 8KRKP8 K,bK P p@@YKpiC -L M K8@8P(0( $ [K$C S,AB -L M K8@8P(0( $ [KA _,AB 0-LMP "2|@P|XK0 P ^KPE+zP8Xz8[S8[S1iS-CGC -L M KP@ 9P@0@ @@?![Inp$ȶKA k,AABVC -L M KP@8P@0@ M<![ Mp 㧶KM u,ABrC -PLMM`K @\0K(K,J BlWJl 7JPPy(K7Z B00'S0P(K B0 0K`PE( 0R p@P8K0C0(KS8K0C00 B'U0 ʰ:(K0: B0: 0:0:0:0 :p(@K !0!@ Ɋ P ?L0CSj 0     @$@!#   0A^ E0y900Ipp0cpp0Cpp0Ppp0 Spp0@Bpp0A/0 P`D9(K0`P B 8K0C 0p!0(K@"0 B08K0C0SG o(K B 00B(K B00'S(K 0(K B0o8\ 0C\L@|8\  0 kQ  9F0C0,(!%,8\LL!#xN L@s00R r0S S }:S ' R #S S S S 0S< *SL70Sl T2Sr S`V 04 8 <'So60SQ 0ofo 0 PTXEXx'x0YK1 AQ  pTXEX`F(0`(K B0\@6Y(K B 1P(K B SeQPU31Yo-50S K0 p@}8K p0CHo(K0 B 0K BA @\% R %SP`2ou倅P`0FU>n0\ 0  oH40S4 o40S P`0  o0$0CpWP0  B n`P nV6 40S  !(K B0 dn8K0C0I0LP $( P($ $$P $ ğP$ K@0n8K0C`I0I#S0S Pn 30Sa  n\Sn20SS |nP`ps  0 "  <#0 4`nVPT`{nT20S. 0hrnnTmn 0P pT82`X1 p 0F`(K B0|2Y`(K B P%"1R(K B 0C Bn8K0C0H $( P! !P! P! K@0|#n8K0C`Ih0 S ST  )!Sx "Sp I'Sd %SX TT)SL H5:S@ S8 3iRDD: DmDDD;BD`S)D $DY) DCCCCMDEP!Et&E+ECC2EDDCC&bp@DDDDEEE \CPCPJ@>ECE\E,CjEECCCD)DDD D9D2DBDGD 0-LM KTPp@@!UK09[$C<@iEE p-L M`Pvp@$ K@@6P0 $<@Pl'P P@ LDFP 4 Kp8F 0BFFF>F p-LM`cFP0@0Kp Q@@TxFPPd0 Hp@ٲ8 K@ P (@P ᤇNFFFiG -L Mp+FP00KP`PPp 0 \pP㧲@8 K@(@ $` P p$㤲ntLG1GiJG -@L,M( <K[< K0p $0 K8i( S-L,R( Ml K&fWG 0-LM(0 $0 0 ( K`wp (@ᮄPPU( K$@ P wpp @(0$ `pR$0 $0bS Bl jT :lxl@xi cG|GGt p-L M@`PP  Kp }{jG -LTG -LM K@5P0 n KxGp ܋K:[X 0`xpkKX0 K8:K5p` KЫH 0:BFii -LM KT@4PD0D DD<0 K80 p$SKP 0BFi H -LM KT@4PD0D DD0 K80 p$lSKW 0BFiH 0-LM K$0 0 P ㈱ KiG 0-L@8D P,0, ,,(E `0"H,H0BF> 0-LM KP@p` `\XD PH08 DD1[<80D `K00>"H,H$BF> 0-LM KP@ph h01[T LD P<0( 88$D `K00>>>,HBF 00@ S-La0@SW@A0@S=@00 -L$M@ 0K00 K( 0 6 pKiJG p-L$M`P@9DP ,OKp< K\ DNQl P W"0H ,H0BFF -PLM  X@@K❜Ka 80妃P0 K (yjK?&fS 0@0& -LQp0GY)$0`0S/ R 0& -LK 0C C]pt&t T PA@NAPT`L'L㈮RAe>K 0CC4P ㆮdVp x U 70S }h99df^K @7^K @⑖  R]>K 0Ct6pS PBx6S {P:  @1P4 0x6 (6 R  + R  % R   0Sp60p6 5pWbp|  | a pp%{P Pp6S hL$eK I IP%  0YBK00 %0 @ℜB.K B5hUK @U.K BKsp!UKAOUK @U.K B;sp DQ |hcK Ig Ip($LDQ <h 0(4XY[UK @ڕb>K0C@5 @0U.K BD5 sP@g  fK•f.KP L H rpJ L0P6 6|:BK d# @➗BKX I0S:00c>K 0CBK! @#南BK I0S  g  g 03/6f.KH6 P rp HgHp2p0S0S |6Sn2`pW 0 3/p K @PQ20-K BrKKp I!1QqPp"% & # y' thr' \3gp#Pi% & _$ X$ Q f0PpW 03/p|6 03/G1JRFY)S) 1D>P'JJRKi_K~i{KKpK&i6LiJLKL)LdL|LDY)Y)iiJJ` LLCQLLLL -L(MpP=`P ?P@( DKLD Kp0S hv L&.P400@ @j0 (YK>OX)8i(O0:OO -@L?`P0 P@p W㜀JQJ Ề`P$ wpT @00  %P/PC:.00KP e:P 0@ K@ @ @ Kh@ pT;L>P<>P,>PK0 X)7iPhQ}P%P p-L M@ h\e  P LTeHPH` K P ! ,IeKpDe@tP P -L,MP@Ph" (p-pPD"D( LK LKL K;D>8i(OQ\ Q ;Ct: 9tQ2Q;Q 0-@LP 4 K0h -P@p`L0U0S! 8w|P$P$P 40S040 0S 0S(0p(P8`0S$0(P~ P-LP`@ <P VT4< n=`Pv4`s4 00 -LMPpP@`00K 0K #  KP KvG0P 0 p 0 `P0 -L M@PP00( 0K0 `PpQP00Z!V0"R0 "00"S(K60P 0, np 0 @0 -LM0 00 0pS g00BQ_ Qb0 KN,PPP KU YU U}P ,K⬀ [`4@V`T /@P00@ K00 0P 0 0K KP30 R 00T` KK0`S 0SV "00}UZ6 ZS0J<P0D<P Ur U0 0 K P!>T:KᬠK}v "10#Z 00 `@0K0 K0K8P] 2BQX0AST00SOh2K:K8#<4:KᬠKPPzPA ` @P FFPO}U/ 0 p( 0STc  PPG` 0!k K00 C0PK@T 0CS ,0K0 xC00K K`:T 0CS,0K0xC0 xRaD\W@DAD\7@D@S 00@D@ TSS0E@|Tl p ;P2U< D 0p 0 00(Kp Q<QFF -PL,M@`K@H  L0 pX) P W0 HL0P 00p0 HL0> p-@P`LM KT K` Kp -MLMp+PP!wp`h!l UK pP!X  KF/ @. K  @g,PE(TPh (K}P8 0 R4 X5 =K 0C )X5<% 0-K1 B85 hp  <5#70S0 S0C.K00T09P 04[S <0W8C.K0\]@H=>D>RiEY)S6R p-LM`@EpP 0+SKp K K R #K K@Hhp 01S 0/S D [ꭒ i S (0-0LS Kh ]FY)S -`@pLTPP @ 0SP '*S -P@L` cFpP  dPX0 000  <p`VrS ':iNS -L,M (K@p h8 K%Pu00K 8(K_800S 4 KHZ%P401K ( K,pB`=D>SqS9iyS -LM(@K p [(0[QS S  j\KSS -L$M (K@vph h4 K\%P"00K40( K,1Klpj=SqS9iyS 0 /&/ -0-@L M000 0PK0%00 P0 K0P00 (@ $@ @ @ 0 8 --LM  Cx?x K -L@,x&gS  -0LSY) --LM  xx K -LMh00S@ 00 0 0 0K #  K$ Kp@$@KY)S -LpMPP2P 0S 0@P 040 000 000K0 04Kjp dP@L KdK`P \P XP TP PP d@ 岦4 KdKᮦ먻`P nf@P  tKt@ p@ l@ h@ d1 |0 x@ լ|K嬠V~fvN P LK| 4KxdAdqP`Q |K}p0S 8T4V | 0A?oR20S Ed0S PU LKK 4KGK|0SS  Q  R S0t0 p0 l0 h0 tKdT LK( Y)BTxTTTLQTU&oU=UPbU -p-P`L M0@ 0 0 0 SKp0C>S`!031 -LuP0@ ,K[ o D[X'sVVeW 0-LM0K h|PP \mrL@P @ PP0KiP020K0&Y){PC-!Pp@` @ #@h,P$SPL080$60\ 000 0@0P.VCVXVP-`0\  H ^@0 6 0Q (0000.VCVXVP-H040#^0<\ 0000.VCVXVPD0 40#\00Q 00/00.VCVXVP@- @< :# T0 0^ 0000.VCVXVP@- @< 9# T0 0^ 0000.VCVXVP 4 <# \,4Q00/00.VCVXVP@- @ :# T 0^0P@d0 :0# TDD#^<0\ ,00$00.VCVqXXXV -(0ML 00WP Kf$& -L Mp(KϗP(@U` KKMP` GNP@ P 0-LM@PT0  (KsK0[Z -0LnS@0oS@` `KPp`HPs0nS0oS%uPP uPP& -LMs0 Y,WZ' -`@K~MMLⴐ─p 0 4XP(oXU  Vc0E Ÿ " P`0 X0S 1PPXdPXQ0S 'P`| X0SL \1PL\X& X%X%DX0S;00(!NK @D @00 FPP ,8[S PP X(K 0  Q Q 48 008 P0PP txX048P `}\0PX(mXj[X&fC}[[tuY)[[[[[ٝ x -SML4M` KCK @(J @p P勲PT 0JK,@DY4 S K <@X̄ S K<@ vYXS K<@4S  PPxI UG  Kl,K0P B0Ԅ8?(K0 dP0 0,K B0,K0 B0Z PPPK 0CC pnK@4S}KS(pGi  [PcE4p4SP @Pd< K@zP[d,K B4 !$4  0 0\d?o 2R0SP0S PqWH4 jWU %W0S S K0@ap>wp` Ph P qq0SPpPE4SK Aqp>MP0x#x#V0ISʉ ᖅ`Q K1L-Q P zqxqP0S a0S ``]apc>RbpK0 @sVK@ 0S K AM>0S0S0 A>~KQpGd`  ?`P0U0SK 4A3`P0SRK(@;MPEp\%TP0S0S KA ĸp  >0UP r  K@dPd\[U\z\Y)3\\P hZC\\\ b\_O\T\~1u\&C \P'\ Q0-LP@A0$P$00Q 0o0pZ) P-L@ 0nS0oS 0 pPP0Ex=@,WpW n@P`<=pPpP,iPpZ)P_ -Lp pVT9a' -pL Mt P@h0000 00!0a0000 Lp0PEU!+ e@ Ppz$zz$z$zz$z$z$z$zz$z$zz00000 00000000K {Ppci000PB?0000000p0(K40&ia40X_^a -LJK[KA=KBM PE @D 0C80CB-KP@t0x 0B=K\_p0 H*x0   K?  @⬉ K @^}S-qa` 0-L@PᙯP8<+P0K0haa b -Lo UTS9a' -pL M0 @`00 000 P嘠00 ZKp0@DTQ oP0 T؀PDƀA0(Ko;40&40C($b^a -LMNKA>KM@D0C.K B0@0D00>K 0C(h2_p0S SH p80,00(vR ccc d 0-L@PP89<+eP01K0h,aa b -LIo UR9a' -pL M0 @`00  000 P嘠00 Jp0@DTQ oP0 T:PD"(A0(Ko;40&40C( d^a -LMNKA>KM@D0C.K B0@0D00>K 0C(h^p 0S SH Np80,00(ؙCR ccc d 0-L@P]P8;+P0K0haa b -LR'f -0@`LpP0 +Jp00@DT oP0 P㑙  QA+ P T|@+rP,>$,Ko9C(40&e^aa,g b @-L;K[KM 0C PE (>K`@0( ]p KQGEg -L3n TQh' -P@`LM P r0 P x" Ip,d2 0S00(0x`0&`0x01p0 )00`&0#0`e K3^pS lP3 MP> 9P0 GP$ UP. gP0t0 sP mP$ oP0 @~P%0ϘtP" uPp|00|0|00|00|00|0 0`x~yP|Y0p00S0t0X0;;0x0UKk:KN$00|00|000(K40_i&Tg^a -LKK[KM @D PE>K.K 0C B@P800>K0C,|]p0 he< ,KK? @D < <@0<$,0( <RPqahqi 0-@LM PK: 0 B/oS" ? 0 (K0i 0-L@n\PK0h0~ 0-L@^PK0h0C -L M@ K: 0R R0?S  Ki 0-L@PzP89+P0K0haa b -LMl40 0,0,0(0(0$00 0R+Pmmmm' nTm 0-L@ P\0 ~0(0RlPP0㫗PPK0hmlxZ)P_ -@L MH `p0 ZH ?똧嘗  Hp70`FVQ 2@FPꬋPPPPPPPPPPPPPPPHTPPPPPP PPPPPdtPP`PPPPPPPP؋(<PPPPPP PPXplP<60S 0" $6 60S 5 0<0U 4K9400S0?S 08:%000x0000tU 4K940P 00R0S H0@90;U 4K940P 00R0S 0(80@00800K |PP–00       +  @  B ($ Rz$  $ Rq# , @ (     )            <|300  4|0$0000 l*|0 0000 H |0$8000 $|0<:000  |08:000 |0@9000 {0,0000 {0000000 2|0909 R 4K840P 00R0S 2Q 4K840P 00R0S 0$0000 0kXQ 4K840P 00R0S p0,0Q 4K840P 00R0S $0 0P 4Kl840P 00R0S 00007000'+ (K谌&Io&&[)9n[)40Un[)lnni^a"[)% nnnnnnnn&noo2o -LJKRM$@D[KQ=KM`D(PE$0CQ-K00C`P0 Bq唁H00Q=K00Cp$ZpO}0KSF04 C R@Q K< p0@040$nK?`F  !܃HP  0 Q=K$0C,PC.KP0 BDTP' b 4`$04<$ 04@04040 40$4 0(40,4044eO K0 HpyMKD4 A SO[)hlsooqa#p 0-L@PቩP86+P0K0haa b - LR R ֔p -LM0@`Pp 0 X000 YPPK0P0 0 0KY0 X0P ui p-L M@0P$0 0`$K  vXP0 aKp 0`( "4`#/ p-L M`P@00   Pd00SPPP @{@y 0NKp[).mp(0P0'0P0&0P0%0P02P0/ 0-@LBMPP' $ 40 00 0 00K000$0K 0 0P @j< 8iN9H00K0K0ho꠆6m -LM`p@ Pp(K8#<0 00 D00 $$ #  <D Z00<804 40S0P,M0(00x0@E0 0J@dp PH00@5P1 PD N[)ؔBmp -L$Mp@ D `5K@PKLP0IT0<000(K @0D3/X0p @" P*0 M0@ 3/p0< <0PL5 0KK R0T#K#K :h=5#K P0R 0@ P#K@P#KpKm -LM⊏K`p/   P@1L#Pd8$#4d4# K(2 D0@@ 0@?K0@0 xp9$KPHBTd$ d 4KZ) -pL4M[ P@᧹@P :@Pp(K` `LK 0L KD0 p\0K@P  P@0   ``T \  X X R V0S`\0X0 X  X  XKip XK`P@X0 R !!D0D0X0V 0 000 0L c#!$c$"0 0@ 000<0<[)p#qZ) -Lmg :MJr' 0-LM K 0"0@0K0P $cK zEKrr -pPLM$ 0 0 0P#c0#P 0P P # Bp20A0CS g@Pԟ4dġ00 00P0 K孔p 8 ,K 0 xP x@ P!@K0 S Q  ڑ .P   ϑpz_ K,K! `P @K0 S Q $ P    P KEp 00 \+KVp t 0S0娐S0夀SP P(K4040&tsHq^a2s7sbssssBst -LMANK>K M@D0C.K B0@!=K(00>K 0C@(Up S@8 <K>K 0C K>K0C K$zW0P$(hK U0P  (PxKHuKK4oK(kK`/t;tHtXtitttytt 0-@LM PK3 0 B/oS" ? 0 K0i 0-L@BUPK0h0~ 0-L@VPK0h0C -L M@ K3 0R R0?S  ŐKi 0-L@PNP82+P0K0haa b 0`( "4`#/ 0-"44 0"44 04"40 @4"40LPᙧ $0 $((- XX)ddhhllpptt0 0-"44 0"44LP0@ VSPDDJ@@DHH>LLPPT~TX{X\x`\ `p` p K0h -`@L"QU_@ 0-@LP  0 -P@L@`Ep@Q->C->C6X3X\0\-9>9>:>Cۦ?n:>CF֦?>CC>Φ}C>GɦmFŦEnFE~GὦXJX ` p Q  $$((,S>,ᛦ}S>GᖦmFᒦHHLLPPTTXX\\ -L M@Pp ! "44!1"441 $$((,,0044`TQ\50 S L5s`TpԐ}0  $0$S-Y`,ph(KTcT`X_X\[\`X`dUdhRhlNlpKptHtxEx Z <`9 6 $5 S\50 S` PP%@ PSڲ  4 4  TU 0`( "4`#/0+P0 C@ / p-MLM@R0 ANK4 @D8 P Ki蝨7,`p`L02X Ob 0$wF$D K[)[)[)\)<`) -LM@oX10SP.@q0S41 4(! #0a P` 1 P000?>C?T00S UG 00$K=zK$pG0* pPQ 0 S Y P01#0*[)[)0`) `)[)[)D`)u -LMD`p P ?#Kd00 @ؓ ` ̃0<0S  + 3 R 0  B  R\ ?0!.0S   d ?#K00 @ `0 < R2 00C0,0 ?SQ 0E j ?9#K̟)#K0 000 \%H2R 00ß0 2",0KKKx ?` @L<4 l0><d@ ?K D 0dᜁ0D00  R\!|04 \x P?(,1傃0S U(`(pXQX`dPUl 40 00 (Ko ᒻó00S nppp0`<0 ס<0VpPϡUP,o0`)$`)\)U `)$TD`)T -L$MpfH < d_ @Pv `0 <460S  0 8 R 0Sx  ?X0 08 S` `0 b8 ?0 RYQ4 4 UY0 4R0P,4@oP' R4  4 4  4L4 4 D080ß4 0 0$5SCK00/0 @P!.CK@lQT0 @T@@ 0D@p`00C0 A@RP3@A00C0<0  0?00 @P@00030S\d 0@ `8?b08 ST0T00  B 08 SP5X@40 4 00<0 40S1ڨ0 Kd 0@ `8?8$K4_@!P#@P$K 4@4_,40 ?<0< 00C000H R410S 1 1 1 dP 0E1 e0 < (K  ;A! A!4! !.H8D*4H0Aे80An C 00 0 FA@_0 F$0`0$0q4004000080P08 S`0/0 ό@P!. 1@R0 T@ @ @0`$ p,0`)$`)\)U Nk'`)& x0-0`SLKPL L00S000000B0D0[)& -LHKM,@DKMDP`, p&60Q| S iDYP0\D00SLL0\D48KM?CP} /D͎` L ?Ġˌ(K8K=CM/B d004 60  00 0K C OL #p R0S000(KO/B P2(KN/B800#800(KM/B0M5@0S5 4t0K00,H08KPO?C0 P 0 `8KQ?C8KR?Cp%&` V M8K=CX V  004#8KN?C0@K@,HA %8KQ?C8KR?C LH,Ϡ3 \ß0 ^9    1?ppp QP L3= `pL04;0]ML 30d0 0KMA ?`p2 r018KM?C0(K0M/B0U PL\8KM?C 200ML8KM?C SK YP`p .D-D-D,D0?D 0\DD48KM?C 0)D0f D= ` pLd? $+4.D8K=C (K.B 0@(KM/B `4 KML0KML<$10LqL9 ( 0 8 $,4<1?!pppp0! 0= `pL04;$0 LFLL00tdp 0@ `Ì 0>IP(K&[)0`)T&d&[)\)TA -MLMh CK @4 7L>n0S@ >pW<>@0 > g?뚡0@@ 0`@ `> RPP 0 ,> F!LxL 0 D= 5pP <=UP AZ ^P@ 9Z=P <}<0S (5,%0<<Q04ʴ @0Qʘ @댌,0 04 0A l @040A L @0 4Q, @00 Q* @00Q( @004 Q @w;@ 00R0B \;\X媄YC*04p8@G  ?ID ?C `?t`# 0`K 0 L? &H@,KN @N`=K@ 0C  0p@4`DH$呎2"0`S΅ ] E p_R`@?(08@E.Kxp B-B-K B 0d$ d$8PŸS Gฃ K?A =K0C 0 0KA  GK?A  3 P0=K0C QP * ? Ὸ P0KA D4PD@4#'0SRE>K0C  =K0C$e0V- 00\4 \4P D4D@4#'0=K⠁ 0C⁎ᡑE>K0CP4EK/0 AE>K0CT4P$1>1\4 0GK AV [`L4 a3H4 QSQH4 S0100GK C AT4 0B P0 ᢭PP!@H4-K B? BD$p4嚂# d ?`ክU*PP1P#0KASD4UPKE AЀ 0  J  ?B Q=K0C K R0A  0㼐Zp,\4  B!00BV!0`0Y3B11 T4S B!IKB AЀ?  ӷKA P01p,0\$B BQV`` aS2 0B0QaT4S s>>s@帠``x Qz0̈́ L0 E HPD4 PXŸL D4-  BQ  B!ʡ$%,PR`Sf`B `Q!a@ŔL     " R| D4P000E>C 0R4 0 016Ap'Sx0<0(5002 0,%S00 5 \2P0\3aPPT``0 S㠃p1\5?>C00!#4t x00T0 Pl0,% L1.1< 0   =K0C) 0\)8`)<`)& &ف[)[)3\ [)G_[)`)\)&[) \)[)[)^F;>v[)@`)[)[)˄[)0v[)#'ht@,`)H`)4`)(`)\)D`) `)T[)P'TU [)^$`)0`)&04 P 0h Ht tR 4  B @%LV.  R*h $! < ,! X 4! \ K 0CBK  @ ,B>K 0C+sV.偲 60S 0=S,∹0Sx0S0ӈ4 ,A,\t ^   ?d A a!1<80 '{; 7BNK @Dp  $FPP0D$0 t4 R0 St$ Bt$ St4 84 0,d4 d 0 K A 0D4  VpQ  B>K 0C+BK A hPBK+ @u-ᴠR㰡 , \ BQ 4 U400T0 10⊠ಁX0\L TTR\ ?0 ` 0  B  R\ ?0  00C 0808 0B0 PB 4 B4R0x0``Tf8 0 RT,989 $5S0|9 @@90T90S 94 I9 dY04 s:04 啸Yz00@j TJ rH:0S  ?0dj0 HZ @T$ T*@pT$x0p 0Y\%lh_!h@PR  \@_ dŸ 0@{+Ì `0 8!;P@;\%R L;0S@=K 0C K 0 A L4`K\4 0L$,0Sژ ˨L4Ph4 H4`l4 L4Ɵ#Lͅ EK@ P40P4 LKL 0R 0̱,\u@WL\`| a#Td|4 |4@D@\4S 40Ay~@W ?  R 0 U(!|\0 ӷpP\$$=Y $0T4 `0BXpQ<48$帀0x0 0Sx0xŨ0t\000B\Á0`  BYd Hh - Rhh   h ` lS2 0B0QÑdd 0R%~0  \$R 4|$0C04 4 S T4`R`   $%R l !P`   . R3d} T4RT T  T4 RP%R X PP%PR$ d0|4 T|T |0 T$}  8 T P`?0Tt lR@Ό$00$020T$`S`0 0$5S V00 l1vaRP000\70S2dk}0T$ST0T00! !0T$SP5RX0PP5PS|4 dS먐 S  0 S|4@}00080`@0C40dƟ0400 T TR` ?0T  taR@ $00$0l0P0@hp`TS $S0`0S $uS0qpq0`VP@RlpIꆇPT40@|8@`0xQ|@| 億 |4S|4P0CV`T4Pg4l0P0U:4lPh? ,h4呃\h4 Q \40I>K0CT4800|I>K0CЀ d?ğ 0L l 0 8@d4S30SD4d$0D4 D4S.(8D48CD$3R|d3lhD?$hD$\Ő04\ \ @ ?d @_ @0 `>4< $<8D40D4 t4Pz20Sʤ2\$0,00C0Sd4  20S #8D4S 7`20S d&|d 70D4 TC^K PE P20S AC 10S30304040403BVX*}QV.RpaV.HVc0S p=S,TL1?~ G? 0 "0(qS 04 _ dLĒH 0@ `Ì014 00S0S 04 E0 d04 80B04B(KSoh&$`)@`)0`)T[)\ |[)[)D`)\)[)`)4`)(`)H`) -LM`R@p `}PP \}q_K, K4"DaP`(KP(  oBp`0S <08 (00,0 000040!04 04$0D0(0`P W `h |`D`h20 ᦴ X L @ 4 ( 'Bp !Bp | }K Ap 42`#f0`9`a8SlPb 0  *0*0P0f ◬ 0* *d@edA !zd@4 -PLCM M`B.KpP; Bkp@P E>K P0C0PT@ULT!P0#  K 0-L@PՐP8+?P0 K0haa bR/; -LMԀ#K@ 0K `pX0P` `0 X(Kf  ecK`p 80 80 -@LM P`pij 0W0(08#8#48#8W00 T< !<04080? K :^FF^: -@LP`   ~ z -`@PL ((UX0 c#!$c4"X0C-bAYXQPYX QP#P0 -L,M#KP `剳0 00K r0 0SC Q 0 W{SS9 GS BS: 0XKS3 MS@kS- #bS, gS @ @ @V00 0Dt dsD0 8r@ Od"Q T@ D0U6WWQ QP 0 mS sS@V@@@@#KV0#K 0 `L{ R0 ` ( 0 (KHvgvvvv -LO,@ (5N3'yw 00- @   L፫ 0 -0@vL xᓲPd`@D TB㔀#ᴐ000000`IB_d*pd)P  /P P00P0S!bP P00P0S/ -X@LL`(VVP d0 P 6V0P \0<Pd* 0P-L  C  _zco`p p-L MP@H`!00 V P@ JzKppd*\d)v p-L M@\P`QH!40 V P@ (zKp|d*pd*\d){։ -LMX1@0 PS)DP4aP0V Qp ᩮ 1` P00 0 T :0S ╮ 0$KB>K0C+`\ $0K!00 S `8 #4`4# 0^ `$0K dmB>K0C+|d*\d)d*pd*d*Pd) -L$M@` pLPP @"yW V3( 0 ㈢,6"4  R`!y0 ,0C `!|y00,6&08,64 0  B 00C0( QS`͑! V0KJ,#K$&`?KBp 0#K06s4 C cq0rc&0K$&?,0ᰐL0Y*S%  0: S (0( dX&0d&(KoMd*ԈCat& -\QL,p0S@FT:dK`P  0 @1@T@T MQ @C1@  RM1 S p px21,6&0M,6   B ! ! 00C 00@d*و -@PLIM0 K=>P@>@0D >P0E1 0 1   xl?U*0 lx T;3 1X5: T8 HT0 84>`0>V01 S ~ 0@0 D?a @ 0d 6FPPEVv T$= RlHx U e2UPSQQ 0EH1 Q 1,}0 S 00 8jS05< 01 Ӭ 10 ! ̬V0J! $ ! 1 rP1 !$ LQ  E! !1 孬1 娬1  I ࠬ  L!001 6 ᓬ;(1  20740; 800V0@ $(P, <0DH 4 L`\```d`8=< 0T00;0KK5L0S0KK( N$;PU lP ?  嵧00400L0 S1 / \P,  0p0B AKB``p`#QPAK``p0mF0D&$AT@h@hJ1CP@1:TP\PL9JPIP`,  / 0 1 d0p0(1 \00,1 12) @C$1 0H1 1 1 0$H81 1ZT:!hI !` R%"ʠƌ04! :C8 0P 0870 n1( 0 ( *d1 6  0TX 0 08oPp   XҮ0SY,8ЀX0F 0\vL0`0p\0f&1S (1S @P 1S ,1S811JQE1C1 `01 1$S1F01 1F01 1pp+I'X0 o4w0S= 0S 0S01 1 0C #0&z0 6 Kp ;PP0 ?[R1 0 S10C1 P SN1pP1`81 Fi S  JɌ0 01 Z1: D务! Z!:,6 6(01 1 1 HUㅢ 0! !0 S,6 0 5&p(6X:40USL0S d0 gP Wڜ40Se`VvP1S iL0S d0 NP&  !#S 0+  1 Uᜦ1&," 0 B! 2(6H4z 0! 喭60CU 00C0CSP: B 㰓0P1 11S0! "! ~!d!$6Y:,6 0&<3Rp\"./hF  V!#0002!/1`Pr820SDvpGpW@ ,20S8 H/V l/2QtRL0@S \0 K$1pK P0C0P6ULT!P0#  K 0`( "4`#/ -@0L` 0@Y <0,^ Tv 0 \eA4 - Q0 . .< D0j*-@=B'v* -LyG F-*' -@L` p>!>04P W0 0  P` $KkcPP`07& 0PFr0S 8?r0 W j*40 -@L Q -L MQ@ 0`@p 10W  2   $Kh,W  #   $W 8Ka80[S[ 0!$$("( 3[8#! Kh+Kj*Ef -LL5pqj* p-L MP@ 0  048 Gp 0llQ+dKp P ` $( G0  :+j*tj*ǐ -LM044}Q  K }+ KϐsP@- 0 R * 0 #  @0v*`@-`0 @CT`@ pT00 P0S@X`,X0X ' -L`@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hEdC`0P <10C <1$0 810S81j*&P''l* -@LDMT *B`*d*hQ *`RU dU* *d2S l"} h`RW`p 0 \K ,2QPP`p #KZ#KZ 0EZ 1Z 0 [`p 1Z 1KZF p1Z K\1 Z#K <* 0* ,p `~ 0C P 0`pCPԀԐ`sW 0[dlW 0[ 0^*(KE`W 0uZ`pYW 0[ 0PJ*c l*אj* #40m*?&@@jHm*hm*-C6?Y@W- -Lx%0d2SE(j* D00-0LS0@d2S``2"R20谘&j*( -@L 081 QP=p@4 20<4ᾓI,K(0 4 Pqo00?0 0<-3P 0 ,0P00 0P i4Pi40<024 0 c PPXm~DPHPUPPᾓ  Q%400P0 0 2Up  W@兗 2 `"R009: Ÿ^P`" 0 d' B X2p`PP X ` 0 " 0 H(K0 H婻!1OPE 1( K q嘁嘑nC#K 0 ;|!0S;0;T 0OP0 <0 Ua 0!ZMX;< 0& 0k 0VXk`관 0OP H `p( `pQ 0 P00;j*v*בm*m*1'&xm*l*v*8u*6eɚ;u*u* -L$MP` @@p LZ"0S HK$[2RP00$ 0@ - o(@(Kj*m*R -L MP`0 @ 00 &0  R(T N(K( 0x   h0]X 0L:( 0@$@7 ,(Ko(Kj*e@@' 80- 00RL(@@B0 (5&v+^;' -LBPT@ P( D( 8|( ,x( t(&'|Ԝ*ݝ -@L 0 R R p`  RQ\RP RPXs0'R"R @00S S:(P6' 0-L@Y P l00S\ 0@ !0R3 @00SP P99000v+,v+ -P0L000`@?< 0S-0@ 1 0S !0 0C!0R3^0 :P 0*0 00 Rt4\4d4<4t4<4d4<4H4<4P4<4\4<4l4P 0C^SBXX' 0@00=0#0%0WP/0v+v+,B' -@P`L P0 SR 0SP0B0Q3 00@ 0  v+v+,v+`@-0 @CT@ T00 P0S@'0 ' -L`P@áP  <ᏜP:,z0 R4S /Q C0p R@P /QQ- ER .R@P ERaP @D T0t/SP00/S00 /R/\ PE 6 0-LJKSM,@DM<484@0(4?K4 ?0A4?4?4 4R=K0C@QP R=K0C0<4SI0.3.00N3R=K0C084S3SE@`O|^ x&l^g 00 4>3 S ᪟@@ 0T S S00 0=NK8R=K0C0D0S=R=K0C0K0AC_l0R-K B Q K<4R-K B @84E_h]O0S3/SaR=K0C0CQ=K K 0C @0@^PPR-K BL :K00C$b&u  u  u  {R=K0C044S&  RKA<$84R=K0C0R-K8DR=K0C0 B 44$$0CR=K0C0CR-K B0D S84R-K B Q K @<4^0<[hS ;aS ?S DS .KK0AKK?K<R=K0C0KCdS eS cSK| K7PR=K0C0C0 R=K0C0P C4  KC0@sS `pSa qSs lSKҞ KR-K0P B0R=K0C0C @P :0S*0 0C!0R3 :0S0S  K0@ `PR=K 0C@R-K K B0@ K0@❞@ K0@♞R=K0C0@L4PR=K0C0P :K00CK R=K0C0P儞R=K0C0LR=K0CRMKP`@D3wS. xS vS`Kq| KⱚPPX`I$0SX X 4 PK_@ K⟚PFR=K0C0C.@P0q QP 8 80S 8 00RKAA ^R=K0C0CK5 KuP K0@ P 0R=K0C0h C*%@X  K0@K< KW@P 70S 7 &K KAP7'<07807L407007,07(07$07 0707070707 07070707$@2 PQ 0h<@PTR=K0C0C1 `P% *K0 B(h$K+0ACK8CKCK⯝R=K 0CPR=K0CPT@ pP # US >0S%0 0C!0R3 0S0S 0R-K0 B@0P R=K00C0 P ,0K0$C 0 Q+ C.Km$CK R=K0C0R-K04 B0R=K0C CKMR=K40CR-K0 BP0t5 0E"R=K 0C R=K 0C0R-K B0R=K 0CR-K0 B0R=K 0C0 SCR=K0C0SR=K0C0S<4pW R=K 0CpPKR-K$ B00Q0P0R-K B00@gR=K(0C 0R=K,0C R=K 0CR=K(0C0 S+V R=K0C0PCTLM PE QP1 01X10R-K SR=K0C00 B00R-K SR=K0C00 B0 peg0I%R=K 0C2 R  <d#   R=K0C0S 9  $R=K0C0S +  R=K,0C0PR=K 0C0S  R=K$0C0 SR=K0C0SR=K80C R=K80C Kt$ KⴘP[R=K0C04SS  +K/ B?K` K⠘PG(KKV KQ K⑘P8iKF K↘P-q_K<` K|PP#@P0S<8_000KKh48iU|2x+v+v+'c,i2 rɣ*"v+,v+ 3k}v+Ԙ&\IJ3^2F kݡ,\¢ؠ 3E L4h{m -@0L0iS03S !MPw v+v+ p00-l@L   L @0 0 0}+ "+}+ -LMp0B@|0`0@P@P T00S D D0P@` 0( "KИ&,v+4P'9 -LpMp@1`0B4! !0R3@P  10S a"$KWV00iS00S 00S ` dKm!U@K 0KhA P ᡜP000 PP 0 U@\000И&,v+DP'v+v+Ԙ&Y d00-@\0 B0@1 S"@L _ P 00000S j 0И&, -t1L PR ``@P 0S 484a4q0 0P0C!R! 1S1 ; @U`pP̀ SR@P 0F!0R3唠0S O  X!0Ss @T`p00 @$ v+P'`},,,v+}+ -LM0B@%` pQ0U3PP0  PP;000  w@PP 70 C/o T" R 00S1 ) P   R  R PU ROhOPOQNNPPHRHR(R$Q(RN(R$QZ00 R  R @# R  *! 500030SAIP0 00 S u p 0W@700W0000 00020S 0S z 0 (Kp 0p 0@00T20S P_0 8( 00BS   00 0WP0000S @;0 W     Rt @ (0 `0 Pc R80S =@Tp 0V@e u0 @$ 0p E@U0Pz 0 dq xXK )u0 \8C !m @h꘭,v+P'' פ9}+[u l1-0LS XXH`pLQL1 SR <10a PU @(qT*$P P`p0S 0F !0R3 @Ȁ T 0S 0S  |N@0S0S `s0S o 6@v+P'ѥv+,}+,  0-0LS P `p @T V @\PTA$@ 0S$p$00,`@v+P'!}+B -L M!1 RR0aS @Pll SR:(KS 8D JlpP 0 ^0000@ SRP 0J Q BpPh0t0 000000v+v+v+P'[,,~'ަ -LM820S ,,50$b0 Og2K R}q\@PKXK p#KSRc SR @@ ) SR SR*0S+ 8 }80 S Z SR!00 UT00S 0P80 8080 Jg80  0Z T8 I80Px80 8080 0` \80  @P(Kv+P' ,,v+' -LMw@PQ 0S  0 000@T0S `p㼀 SR$KPPP@`p0 BK@ Y  BK@000@T v+P'%4, 0-0LS C`p|P| SR𫝘@T`p0  RF000S @v+P'?,X -LP`pB@P PPD_oRP 0L 0A?oR20S $fP n' /0-0L@P 0P0 SR0~+ -0|@00/000 SLPXp ڤ? ;c0?+0?o )0o0?~+, -0 ML@0 0庒0@0K -LBM2`PUq qK_K Vn*X B/m0 S4(48#8IK,1 ,  IKM%K`d1@Q  P1b",4b4#04 40010S 0S Q0000 {00'{{gW0S0000R&*0S C0 0S :0 000R*Q l\0S H IPY$K0PS Av+v+ ,$,P'Ƨ p-L M@P`UP @TZ TT0/  0? !Q + %Kp' 0-@L%pP@ (L4@P0P0%0ޘ&  -L]MX3`0S HHDsDS0@#0040#00RSC 0#00ngp"& R?S"aV 0"0000RSA 0"00tlGgp\"`DRP`@" 0,K1(A?40KK  0$R$00PS : S RSwP7 3V CSPU(Kt|<㰯4pPH eK /091V0e?Kq " cKeKe?K " ""#e?K #!@08l1 0K0CPPp/UU`   P @T@ KU` @ /0-LPᱪ@P@000/00@P 0S 긫 -P/p`0L@oC 0T@@DyQU pDP@Dԑ+ϫ -PLl4pP04@Sp/`P`\@0@0C0 VP4 $d`Ѝ+, -Qp6LS`/@Pp10&(0C0T%Q&F( $0600nPPWVP Ր @$  (@/ 0P0 @ PP\0`0@0 P $ Ѝ+, -Fa 0-L@ᖐ04D00Ѝ+ 0-SL@ &0S 0S  0S `0 |P   T R 6!@0&F$ S 0S00rϬЍ+ -L@`PP0S  0P0 @/lP%咑0P 0 00ެ -LlM2P0 S =20SIt'@P _2X TL/0D`00`0p QP0*`p SR@*`qQgʔ0T \0 #K10 $K1\K $K1 0X 40 00@ &p2 p M(K0 Y0`p  0 0/Y`p$ K7x0儠 00 0 0(p0 0KS0h0 0S0l0  0S0d0 $0S0`0 0ʂ0 1S0K0 0ᾂ`v+P'v+!m' ,Ѝ+,,,7C -LM2`0S Vؒr 0x/Px 0 00.000$K YP 1\ X4P] K P ~1, %N L@0@D.PPE  +Pe1  5 ;1RQ rQQ K1 QP P0`0 KP X1H -K -KD @10S,K !D(@0 (C ^ ((00(CR(( ^  ^  ^ ^ (0,t aV,v+P'q,Ѝ+E n'ȭҭ*v+,>X,,v+s 0`( "4`#//28?8Z1770$ 0-LM|0@[Q0TX0Q L0LP   8dK0T ,I,' 0-P LM,' -LMH0  Q0 0P ((7 Kh]+,' -L M0Q 0@T0$R ||@ 4ASAK  FKH0 KDPX0( ؘ&v++'&m; -LM0P0S 0 003/00S@x@ ?p0 QPP0`PP%o0P 0,,iKv+,+v++,L' 0-lPLt4d@S 0SP LL0H0P00080 t4S0te?+,,X+ p-L M0@0PS 0 00x3/t00Sh0 pupP0@P`ʑ0` 0,,nKpv+,+v++,ʯ' -p@0`LPPP /P@< h0-`0L PR@𨝨H0x`P I.+Px  ]P謭,&+' -@1QL0|51q0aS :`P 0 D0P.P@&qPPS/ 0ltPE/T 0H4040Khꬭ,+v+,'obA'7`+ -LMdA,pK g{P L @#K0`4! n $A$83実S1徏?" 0P/Z, ,#KQ  F#K0`  E 8"@Ql000D Dpd00@ PX(K,QP';,bFs'v+C$PaȬ,r 0P/0 4S /&+ -MPLM0E`9t44S P tt p50SP8X (K988 HuX 4500RSP 50SPP+9S3404$0404>ܔ :ЄᵀBK  @00 ,4[ S BK @P#X80S" 9ဉ BK@ @49S8 B.K 0 BBK @ X k #렓iBK  @0弐 BK @Pq,4[ S BK AXvP堋 $HR ,[ y #Yꘒb2K0 @0|5P p 20S )}H009  \ 0o00.J>Kx 0C SRIK A؀ATYX K @ `4 T  N 9a<98890S 4)>,8S H10S10S^ 4 =KU 0C CW) RYPER0PES L!UH1H0Ѩ PUJBK @LBK @HPEU,8S F)t4S 0t4<4W UBK @-PE+ְv+'v+,;'Pnϱ, R C #`+NO&w,v+P',, f&fE,X+ -sL@M0 |5 xSX0㐣 R_PP) 4xSZ  4`S Q00P0S 30S 09$R U00V0SPV[05SJ R6 HXPU2 RR RH RI t|x20SLlPPH |%+0r909909(K02 Z+"+R ! R  7?V0`Fei0+x0|5r909909PXxP pD `0PU x 4S - P W,  00 ?.pU00S x4S 90$;#;S %Px+Xdr+,v+P''ó,ڳv+&v+ 2Kv+p+ p-MLM7@0SWPP P P Kp6 PR60S 00P 60Se  "4"42l004488<<HHLLlllxx|]|~l9^EzlEwl:^Esl"E4"4"24"42T0ASĕ,ԕA^K PESPl PK {Pet4 `Rd40S XX$00i f c ` ]!  4"41V S" 4"4"24"4"24"4"24"42@ = : 7 4 1 +Č0$#$9? A $4 0? 1#04K0222020?"#3H0?%#?&3,0僅20j0 0%?"p200S" " l" R \bR@TSP"P :NHq D 8,k$ !0 x30000 1R 9? |#:? @  ?  ? A0 ?%8 ?&0 %0L0<040pe0!QP! PQ=0CSЖdtĖ$K 0 9-0CS  Y R0 R R00=0- 9 0 Tx^0Qv+lT ,v+P'd$,kv+&5c  '+شTA -2BMLMP0000 00 Qa0S 0ASl80q封=0=P SR =0=00S BK@p0WPJ0`P P@qPS 001 E0S= 0 00d1d00PU&@1@q0T0 0 d Dop-- 0-P8!P0L00@ P @P P P * P*@ P*@v q0  CSU # 3P R0C0000P:P1:P*B4 8#8S 0S@@D0-4`00CS`0X  X0 X /' -LMM? K @  7 K  @ KP' -LDM`QpV |Kx@ PPKV201 0B?oR20t0@S00C00qp RpaV+ W1X. T T   lK⛀ lKyh=0 .  lK⋀ lKpy.0\ dKL p W|4q(Kl- t-P' 0-LPM3@0S Q K0h |31Qlld00CS$$$$$|$|||||||||||"<K0hK !0S SL )  d0AS&\lt|T} HD@<s 0S$K0hif b ^4Kx1g0CSDTT/[20[0[3 [1[4[E K0h'[20[(([3 [$)[4[ *[+[,[-[.[ /[0[1[$&1jS!K "KQ Q PP( xSK0- m7=FоZyLkDs -LDM@rb,PKX @%@ H0K0 0 @0D0 "0@0 @@P0K DK<@ 8@ 4 0@ thP\p 4PPPp pP[G@@P0K DK^hPPPP܁0S 勬0S HPP @㤡T:(K0S 0L  /> 0:X #:0( 0S y S"010S00\0 p.$07S @(00SQ Z0@x0 `0 5x`0P@PX(T%0S@婓-p--l--K-A! P-L 呓0  i#}' -L MP3 `R#|P0p00* P P@ LP" P# P @@0 0{PW W W"0000 (K@@@00Z= "Z? -~ P0`F0Lp W aL^WLAL^7L\QT@h|| 0"U 0 00C0 Y0K/l0G?o P2 0 S H10 S rp  (KoM3Tp/00©P W00S `{PW _mTp P PCP0 00   %b Ep-&-[- -p@,PL`P zP@& -0LS $  R R Kh% Kh0  y-  -00ML 0$0 0 0 K<P P P -L,M80KD K\S@3@#:@$KR 08 0-PLM   Q ,XAuPK0  K@P .kPP RzP[-- 0-LM0Q8) @aDa!!T @$d@Oo@cc8##4P  ! "P  R  P Q ,tK0@T%<@ %(T h X%T @ ,P" @$ -[Q @-.`pt0Pp@"/?0B!B`BBGQ R:0 0-0- p-L M0@ `R  P..kP ,t0S ,}tKp t0!PU U 0H <F0Kph Kphꨢ&-[- -L M@T T 0, (% KKhKh-Q"!   0-RL@P TPK0he  (K0hZ0 K0hSt%+? -0LTM@h0 "0p d0 \ p@@l0K hK`@ X T@ dPlP A`P C@@l0K hKdPlPPV@|O(KP`0p  DX y R?x   :y0P t ?y't  PK\101 0!S00C00  QPP p0 Hg0 Lpa ,t tl`00CS`0 X 0@T:(KoLX0 X )&ob8' -LM005 K -LM0  * K -pL MP@aU QE4 0 -\P0 4 P Pp@@PE`FQ@@0S@p(KA 0-L@M K0K0  K -L m' -LϏF -AMLMa1p0W 0 0@P0qaBK0x!x@BKl@-0P(4 0 Lo(1 0RC A a0$q00!1 /0R01 (!R (4Gi%(@P=kF(].F4k<T0 <@U<Tl0 0d(X0(PPyK-0ao!uZ,-\&f! -L',- 0-6LS -A 0-Ljjj|jm/pd0@P0" \X  @8u0 K0h/AxN -,- -L I'-  p0000@0\0C0S @C ' -@PL00S8PU``84 #U:0X 00rX0X40P80 0X0`P -0- LM0@P 0 P0S* 0C 0K0 -LdMPP |Ky@PET |0[ S |K(K`pK |0 B0K/0K 0.`KK!| vK0 x|0K  ?rT 0  .0, K V0B|KP |KDy@ ' -@`PL Mp尀(@ "!023 U 0 (K⏦pp pXA (KⅦ(P@T(0S0P(    ( K菂 -L(M% H0 $0@0080000 0(0( $$0#-' -0-LM`@ PXP0 R D0D0  $ 000K0踢&m--N- 0-PPL@ x0S S S0S00S0x9 K0h*S+S-S0SH00S x#0 0U0$00S0--(-W- -@LM` (0Kap K( p @PP pp(0K ap KiPx00Sl0 d`(0X2TpT(0 @(0S p@ D` @|-& C8 0 R ( 000/  5$--&(- -JMLM1p0S$=fP@PJK0  @w 04 c?4 4J.KKnK BJK0P`,1 B A ap10S K;G~K pGX 4 wA7|4  K0A1$JKx$  $`0A.K0@p0 B @$D ap xSd d4SDLD00S800SA.K$-(--$-- -LMp10PS@p10Sd! RQT! RT  81(KofTST1 a0S T (KoTS ἐ张0HS T(Ko0  0S  Q 0S  (KomT$---P'& -m)OO -LM@1`0pSP10S! Rk! RU  1 KiBfU KSUt1t sl1X U * Ki^U4b`0S) S S 0KoX0  0  IU# KiC 1KoX1[  8  ,Ko"KX h) \\$ KiU$---P'& -my> O1u8e# -L$Mp2@ `RP T< 4 sP 1@$PK e@P<0K4 K_p#o Kv 8K 80KS Tw0S0Sv0S@,PK PU 10S@0S 00S#KSR 04 KU 0S 00SK1 QP 0, K00 00 t0 0 0l-{ZA$--- -LMb0PS@ T㠠 pA ,Kd)5v 0p Kpp#_p (Kz A&0sY 0Safp % _v0S @`K@`0K K^po`V H10S<1 Rp 1 R 0 KkV 0S00S 0 K00[@K 0K0 0dK0 KK0 0 0 0K0D 0dKy0 K00x-`r$--- -@1L0`SP1 pRp10S d10SX10SLL$KkM@10S! R? ! RT  1$KkXdTST0 0ST A$KkuTxU@E@Ppx0GUT `i $Kk$bT$-----(--P'& m -MLM2p0@S jYK,PET`P P@"@<JK,@D t ` V:0@0E ]p2o(Kt  xp0 V <)K8 Bt 9K80C"R0P S P!031 `0T 10S1` `R00S 0*T 0S00S K0*,AP2p`0 ? K,@@$p0 000-t$---  -L(M@0K #  , KT]pSK00S  3<00S00S 0 ,K00Sk o#@P,# 0'`$p# 0'(# 0' 0P---m -LM`` KlW00 0 0$ K0"0K03xP01 $K0 @8PP$0K|@#@ @@ \p$Kk 0R  D;0W4000 @0 K\10S00S0@T 0!@0 pK0!0K0K<@0Sp倀|00Slhph`E0S T  @(---&D-mC0 -LDM`PVp20S 0, K 0"0DK0pwP ( D0D L0 L @PU(K0D0 (0H D0s(  H0K ?\p>(KoD`L0v(  0CH S  ;v*`p】倡D r00R0S X 0H00 @K@pK410S(10S. 0( rD0(`s ( r(V(L  L!L!L"L`00SP "!!!! , -(&D---m:  0-LMP0K #   K[pK0 0S  :00S00S 0 Kd0 @RT0 L0SK*VP !K---& z  0-L(M@0K #  $ Kd[pcK000S  C:"K"KQQ 0 $KdQ X0,KP 0@sQ0n$i---&+k -LM!p PR 0p! R4 d! R0S( P10SD10S @40K@@ [p 4Z C `P ,0K# @@ Zp 4 00R X  (K0J(Ko00CSL \ h t D80(-- ---(- 4  -L$M@0K #  ( KZpK,0S  9x00Sl00S 0 (KH00S80 00$0(0---mX -L(M0 80P0pS/0唐  _Ph$Kk9P`@ @HKi$0K`0HK$0F* 'T$K踢&(--U -L\MlPpBQ``$ 0@S 1P @0l K l0K9000 0l|0Kh0P 'K0'KS R (KS @0l Kl0K P- -lJML MP@l x 嘄 ll,h|0pCoXrp  B$ c/ BW 4 $ T L,1VIK0 ,00JK@` V`{䋟0S k KZ0IK @0+; A0 @0 KZ @0+;JK0@|+`; TRT \;0S ,L  IR@;@18 Y00   @ 0`tpp0` ,rZ,nZdȊ`p0pS , dZ, `Z딊p` ,t XZ,xd TZd`  ,D LZ,L4 HZ4l  , @Z,  [ zEV`--iz-& -`LqMX? =P`-\@P U#*0T?SD0@0DWP.0p0.80>9p 80S"  0P>0Sr ` K m00 SK0 帡 mc?K,ᬡ 尡 ǡK[P 0 p`1 VXW p T=[@P01 00A AQjP  Ta  ,[0P1 00001 >jP,Z =z-  =0S=gT` m mKᣫ1pT ( 0Sm0Sa jPZpjP,T iP iP01  iP01  tiP diP01  HiP  0 ,i PT ! l!mK G1 T  0Sl0S i P$T ! l!mK pw?K1T l i0Sl0Sw?K0!QP10 yiP:TX A 1 Rm aBQ'd       t |                01 <  ! p   31/XT W 0HS񟗤0   h  l mK p1`Tp  0Sl0S0!QP >K0 1` Sa 00  x 0H0u8X(  k mK o1`Tp 0Sk0SWV 01Kq?K0C0 1` S01 aV@ ]g YgV*, k mK 1coKT ~0Sk0S `  +K1S0 uW<X 1Sxl  01 X0S@]AT 0H?oT20S0H?oT20S0H?oT20X0S @X< 1sXp0 ;p01 uUP.00%800% 9018@ P  Kc1nOKU01 1Sh&1 01Z, K10   !`01 00K0 K0SK Tp kU   ! c/! 4SK @5k/KS4p8 1 {450S (50S5" 5 (K 0PP40S 0 GKj 0t1 c?joK1 p`4i/KGKSpH30SX Khj, K0A1 @K  `0@1 0 0GKp Spj x30S30S000CS##1" = Y@P 3porlc0S tY00d3_oK1 01 c?1 40q?K0o?K0-K\3 5Sp9X|f RT=00D@ 2bP0=S "8 R0  $bP 0=S] !8 R 0Y  |bP 0=S !8 R  HD!TPPW@210@0W1@2@,,q0S 00S~U( P X-: p 0xq 01P01 0D08/00PEU`! " $ " % " 1000!-6&-zgf -#6XpO^W\Xz> 6W $Ec'C\w$---ND-&J|9-Pb(-0SQ C㘡 šKơKzi eK0 QPF ni0"S ji 70 SE1T R +00S/ S! S0 F1 0Cs! " (0"0g/K1 K f?K ,RpX)R F0001K0q/KqK1  BA0 K1 aKi0S<@@T T T40g/K000@.K &@q/K0 B@00q/K0 B00 K0`0}0a/K00dQ@PY pP>K Qp X(Ko~h0S0 0180 0L 0100001s_[ -LP@ J F xB l> `: T6 H2 <. 0*' :Uh x00-@LTP`|e P  p@00@1 \-i1 -LMM @AK@P ('0AK@PKt p-LIM M PAK` @PKpKKAKA @<P4 |4 ||x@0S0S AK @0S0 I0S AK AIPt"\- -LMM @AK@ZPHK40 R AK A$Pt\- -3MLMpNK@D$+PPXY +Pa0(8K d`PP ) dP LPP  KPx2  d K`P_ L2P DdP ,VPP0 0U,00P`E/0S|W K1!P@"K@DPP |K@1!@P`10S T< Nd0z <`HdPPq WP! P 0 OV_3KA<Ph\`ZZE_oR0 P  /(8[S K@P t{50 `Pt \-T)v]  s#'spH -LlMx t @p0 "PPX(KB>0P`0 4  ` pP.U  d{Ta Te Ti;L0 7WT0 00 ?bH p0 ?oR20Sd0 0\0  `0@` 0\0 @T\*x7P0p7p' 0l7\0d7d0H0``P pWP*p0S 0P S?%KP0kჄኤ  PGP@ 0<Kp X0P4;0 DKp D K<K{`6L0 6VT0 1L0 |6|VT0 0SLKHKn'\6PT0 0L0 ,6DVT0 a\0BnS01\0 x0S 0t S@P0 @ 0P0 d0S6 0S3L P?va H0\3L0KI?Ġ&Kea?| &K^a0l 0"@ P 0K 5.| l  Bnb0 P04 0P0DKp ?4 P$;<Kp  0I P$ P$4K;p D0K 0\H0@00@ P 0 34 K<KL@X0P_ 0` 0 ` T0/0SR P0Ëე0S?%KP0 @C% p `Sp`P 0DKp X04$;<Kp ?4$;4Kp 40K< KDKL`X0 0` P0 `T00? 0`T00T 0PVXP0劄;d0 P04T0 0S;  PAD`KP@T d0Vp> ?4p& '@PP# 0P 013H0K0CCGd0S 0pp.KK B@xP.KK B@p@PKA xK0}-"tc -`PpL@Q0  0 `PP RX#%0S D%P 0[0( 0$ 0X&7.;.(@.t-- -L<5800S ,0 0$p ? 7.7.- @T0-L@ 5@00S(,0 $0R  (4&.7.0&.@.l- -MpQL MK0CBK0C+A?P @0($@0 K0$$[000nS ?S aS pS qS@x0 |@@h0 d@ P0L 0 87. '. ' &.-h-Ph$00S 00S/h-&. d0- LR L00S 08P8@p`0Pp`00.7.h-&. -RLpM@  Td \ R Q ğ@ R@S1 4P @ @@   R0TdTt@D^ Q 0 R R\* 0BS0@00S 0@ K0 S 3^ \000lPU5P0S@K $\ \\!\ 0P0U`^ 1EK $Pl P$PV^K H 0\ \0\ 0K0$0[U " \U $U``` 0\D 1LK$\0 lH` PCQy A0'\0" P $Q  \,\Q ]\(A  0\ D R \? ]\B} `K1L $`VJ lPH` CR B0 pp\\ $\PPP 0QD K1A$\ lH` PCQ A0Qpp0\0几C\\\ QppP0,\ ]\  ' '-;.7.".7., P-@@P@TL @.|`| |P2S@dM \0 T P P00@ <$0@Kh}X&\ 7.qA;. X(@.H P  -PL0S0@0`x0Qh%)pW 0L 0S @"Pp`R "---X&j?. P-L. 0 Kh2;. P-L|. 0 Kh";.~Q P-Ll. 0 Kh;. P0-L(@ [.0000 ;.7.- P0-L(@ G.0000 ;.7.x- P0-L(@ 3.0000 l;.7.. p-AMPLM0  4 0@0 4@S$ . 81 KpS@ 4SA>K 0C!CC+=P 4S$4}@PP $4T00aS` 0` 0R`T0 0 0@00@@AK @ @$4 Q000S0?(A>K 0C4 CC<P ;.-&.7.  -1ML MX P\ - <4 KP>K0C $CC<P @4@1` ~ PY30S Sc \ 7@PQ`13 @cX<S0S 3PUd30S5 \<P/ T3\0K0D3 0@ ,3,(3Q\<RQ300?o2'Q20S  2p \<P0002p@\< \<R R00 R P 42L"0K0$2 0@ 2 2QT100?o2{'\,Qw10Ss 1@P0001@f, K;_\ >K PQP<S\<T.tK@\qU Q 0S 0S1 \<QP, 0BK0 000@r 00QQ000?o2$'Q|00S  d0 \<(P000<0P;.#.9 -7.0&.-7.&.-h-7.?./ -KMPLM4 0 4 0@04@S y, p 2 (KS5 4SK K! A@;P 4S4>PP T0  1 1 0 00BK @Z`' P1 pW D1D壝K K0! A@[;PKK HHZp$P^0S lp)04 R000S04 (0t0P4:70 QP #R0p?|;. ?.7.&.-7.KfP&.{0 0 00 PP&.+0 0 00 EP&.! -KML M P + 2 KP=K0Cl"CC:P @L2@H204 48S[P (2 0SD 2 / ~ P4 !aQ0S 10S 00 5@P/p1@0S 7PX1 l4P H1H!0BK0<1 0@ 4pS KKHH P,00 0 00T   /o" 'l0Q00S 0@4P000`0@\m;..P&.-7.K9 -7.0&.-7.?.&.!h-{7.f -PLAM@ + 0 KSpP0 4A^K PE `E |rUx0` 0l0l``0+9P04[S P0 C;.7.P&.! 0P/[ P0-L0@*0000 0;.7. P-L@PS/o" P`ZP0U0 p0d0dMPU @0<0}*$0 Q00 7.[ 0- L 0 &.;. P-L[* ,0 $00S0 Kh赛;.-7.  0- L 0Ap-;. P-L` Q!0?o20@0`Q  h0S 0 `儛0S P *00@xP T0 LP80 /7P400 05;.!.[7.q7.t&.P 0- L8 0-;. 0- L, 0H&.;. 0-,@,0 L 00S 0 0t&.;.!. 0- L 0h-;. P00P0-SL MP(a )00 KAP0q?oѣ2P%XP00\0 Q R000@P ,SP :`0P0 0R0@00,\  ,;.-7.7.[-- 0- L 0?-;. 0- L 0H-;.P00P0 S-Lp@ *)00PP-`P 0 `0 S   S  M0S00hPL0/6P <8 0?o20;.7.-&.[~d P00P0-SLM   ( 0 KP KK7P 0Pd00}S`00S T0T#0HP 40 0, 0( 0;.-7.7.-7. 0P0-L P000;@P0p lK0hP K0h(4@ 0S80 000ܙ;.--7. P00P0-SLM   ^( L0 KP8 KKz7P 0 =P0 ;.*7. p-LM P$ ;( D1 KpP0!$K KW7P @1@c,(  P$0 @` $;2PP(Q,0P0$ S0 0S P P l0 Q\00S  L0P $0pP000$0P;..9 -*7.7.h- -LM P ' 0 KP 0Sx KK6P 0S0TP0@P00 ( KK6P;.<DL7.2 -L MP@ppGoᩒ P@WPK10Sc1(KoQPQNpW|)PPtQ h1RPUp7|0@ 0QP0 001$ WP 0|S 9@P 0 T% (KoP @T V 0P`0`TT TP0 T2' <0 (KT08` -7.^ob!;.fYT -L M( P, ' 2 KPN(0S!,K(K*6P (0, 1C  0  VP 00|S o9P jP ,0tV@h1$ d@+4 PP @4Q"000@P 0 00x@0t tS00Pd \b0DP(0 4P0 ;.l-.[7. 40-0, SL$00T 00 --L;.7. 40-0, SL$00? 00 -&.^;.7. 0-@PLK0h 0- L# 0p-;. 0- L 0}(&.;. -PL M@PpoRZPY`TPQ .PbTJ .@PP[%% UL1H1@W <10S 01$!1 0S !  U10@W 00S 0 0 0S   % %`PKP`pP `P L P` A!(K7.?.-7.[7.7.  -Lp0;. P-L"! x0 p P \00}ST00S H0Hv@P 00 0( 0$ 0;.-7. 47.-7. P00P0p-SL M` 0 Kp0@ 0S PP K[WP0 00S  L 0. ;.-7.KP&.9Wr P0-L $0 00@P0P0;.- -LM0 P4  T2 qLR0S@2@P:00S 20S 2@b40 l K衟P0@c"`! !    @`#! 0X0CQ00CS0G  PJ00CS0K  PBX!4K0Kt/PS0 8 pp8  0夑0p(K0pp Wp0a, P 000 XP00d0I00H0 0 Sp(0Lx0 0 S;.-7.h- -'..? P00P0p-SLM` $  00KpPp $K K/P $0*0 QP@P @$0( $0 T000;.h7. P00P0p-SLM@( ,  00KpP ,K(K.P ,0*0 QPK H0$KP,0`Cd+ 0("KR000;.7.q P-L 00 P Khe Kh`;.w| 800- L@P00 K0h!7. P00P0-SL M쀟( ,  J00 KP ,K(Kg.P ,01pP !PPP 0RPeM@bM@/` I H; ;00a_;. \ P00P0-SLM0 4   0 (KP 4K0K.P L!@P@ 0R@M`_/|0P 0eI0pp`p@p00004 0 D0@| ? ;.!.P&.-{ P-L@Pp 00`nP iP dP@+p0 ` S P@@ @000 (0;.L 7.7.l&. -Lp`P @P h0hKhP 00.8 0 RU Kh7. -! 0- LMPP  R Kh<PX@X`Xp0S00K 8R  i@;.&7.8 0P-Lp @ Khh PPP` HKhGP N00 =00;.7. A P0-L L0 0D00S808K0hI0$@$P0P0;.-7.R- 0@S0-L h0 0`00ST0TK0h& @0PP@ ,P0;.-7.- 0@S0- L l0 0d00SX0XK0hD0PP@,xP0 s;.-7.-0@-@CT @ T00 P0S@>0  -LZKM,PE,MPQ U 3 (KP#EEq,P @3`p尓W 3 { 㘔!GP@*tG0A-K B00`A=K0C A-K B,3 A-K B 30A-K @ B100S  2@0 00@Ђ0S0Ă00ppV"^p"p0S@$S \SE00H@0S@D"  p  @#0pC  BR0! B MG0 JiQ0@SAK A0! B9GA-K B0 J0A-K B00P,1D 1 R ! R0 ! R Ԡ  E  G  2/ R 0S l0*\F00000mA=K0C0S 0`S9;.- -7.C. '?.!.0&.-`&. &. 0-@LP 00P 00P0000  -l0LhM P X00S H 0dpK P00pK0p L4&.7.Z7.p- -LhM. T00S pD 0dpK_ P,0pK0p * 7.t7.p- -@LJPp `0 0C0S13  _P0 S 0C0SL13P  0 0C0S13 P -`LP@:<P O. 0S1PS !E.tKh@..,`j*P %<P00 40.S!0R 0-@LP 00PU I MP00000@-@CT @ T00 P0S@0 P0@-00S@0\0%\#0S P   R   0W7 0C200W70 0C0 ' p-L M`P0@P<) 0K*/!0St 0l R0 0  8bKp B 0 R00S 0C0S130 !. -L M`P@pP> ^PP P0  ^P 0 00P10S&" p^P0P 0 U @+=+:+ 0 01P1 aF(K/;P0 A +@ ;P 0PS 1 P+:;P P +%P !: ;PP000PSU& 0Kဋ0S 000S0 @Rđ.0 a@ * D 0S00000 0* 0S S Sx0 PUt d0P*H0PU *,Px&. .U?. 0-@!ML M48 >K 0C `P8H K $p \8S 0S @HT 0S %a@! KK^(K8Ph 0Se ;?a`Pa P P xPha X`00@HT 0S 8HT 0S /aT4(RK@D놮K@J48T C/o" R D$PUp 4( B0pPZ P PU p 86PPTp pW D-6pp44$0Q` h8 h80BnK `F+C@(<P( QL( L 3H(  KAl( h8 Th %+l(h8 R.<(3R @x~048 )@@ T:P @@8\8 ,3@)@ :@H:P 00)8 fP  @z@wRX(\@)P X X= 0"oKArZ %  R5 l4(R /:P  4(R R + ^C KAL( Th P R0S10}S)KA)ZTO RL U K+  @4CK+8 @85K+ @35NK @D+H$C 0Th PH L( ,Q (1@p R+CKATh p0@@DcT@@0P/_P0H8 0KSL A @`&7?GO|U-0&.x&.-7.*;.'h&.h-L&. -cMLM(   t $ `       VKK L   x  |     d h l   5     <% P<0]K0[>K 0C (5p1 (l |(h x(tEV>K! 0CTd `E ! P 0S P(xP 0S#T(  T`>0S(P#_$6s 6s6s6s5S 6s 8^( z=0S5  /,_PO( L(=5S 50St5S(|  0lMl 0 SK A AK A <=0S ]K PE?P' t5Sf=- * 5S MK @D*PP=K 0C<L 0 *00 AP0t )p<0S'd< R* $,5 R:<FP4<5 3 50|S/ w   5S;5 ! xTL%h; < 娈\%R %SR  Sx j 4;l+u 5S 50S =KD 少Z0P 0S} ' P+E`]K@K@P@ 0S :\^PVEV :FZ@PU !F 6St5S 6Sa : 0d U%P E%7P4 0, K " B1P5 T5 X5 0[>Kp L50X5S 0S PET& 0S ?FP  ]UK@F 00=K 0C C 㰇0S 50S P @0P5 ('P  K(UKKN00Pt5 KSU ]^K @ PEE|eH8,K0 B5 05 ]>Ke0P SH*0 |]PV 6SZ|%\]cdU0PEK 0CC.K\860 S00?o2T%P\P G P<6) *P<L60S"UFT$x%p(Kei(|f( 0) Gd X[( H@6(&45@T =K10%5@x%=(VK A50S U; P5%+( %5Q"((u6弅S`et5T4UPX 40S 5 H@ 8(V d40S 5 @ 'T H'w(p 凱ca30S 5噆W5=K0K 0C 0C 0K0[>K 0C0-K=K 0C B(P< PV P g65SMP@S>K 0C SR P0S>K 0C@C0 UT2 SR P0 20S0 6 3L00  00 p`S>K 0C SR@Ÿ UT%(  5ST35  1$ R2"A2R P 1B%220c>K0C6s 06 4BVU %(P[G0K0 A嗱0&PR G0"0C?o2? F"0 0A嫰06 6 R ;R CPj d06 6 R Rp-`'L&.NtP&. &.h&.&.-l&.obP'!/$ZUd7.} !..<Pe -xCx +t @mP-m7.(!.t&.7.7.5@&.ZL&.U [nKP$ `F0S0 R?0  F6S F?U F F FR0cF0\0 F5 H'P&P 00S&`P ZK@I  FR0F86 5, p0wx'x,&8<6 p<6 @6 F @6R #R X Q8&0 8& ,& B,& ,&R20S 20Sr0 6S PEU0S2 }K pGYK@GY>K 0C CP 0PZ R= 0 R0= `  #2c.K0 B cKAR0 6&U00R0SF P6S6SgP%w'P@txBPU S30SS3P0N33 ?P03 A #>5%4R!]K PE SR RNK @D} !5e 3/e pt4@{  4 R04|%y$  &5S- 5%0R/ KSVK @P[K @[K5S 05 6S 06 5S 05 5S 05 (K5S 53/5S 05 p-L MP @;VP  5VP0P KpT)`P  "VP 0 Fx U 0S S TP 0S  , V0PP Kphy -PLAMMAK(LA-K0 BAKJK,L0,@DA-KP B4@PB *3P (K ,D4,0P R (5000@ :K,0C4"p`JK,@DA=K(0CA-K$ BP8Z A K@0@P 4D0MH4P0400S Z Z pA KX@0PE A KD@P 00*S0 AK A&HP0,0-SAK A0HP0 P0,00000 /R0 *R0 ,DHP0,000000SP3 0DXEA-KA K4 B0@0{P A=K40C0A K0, @CA K @:Ps 0 00SnA K@A=K00C0fA K@YP 0!`\A K@OP A Kp@IP `|XMA KT@@PDsXC0 000=A K@0P A K@*P1 P [00 !'A K@P U KUU U WL AX1U 0UV 0S Xv1 0Hq W6 )30!0S XW) 1U0S 0 0 0A K0,@0 r 0S 0 FWV  ' &.'P&. >Fi}*1--7.E 0-LM, ( h 0 $0 bP P10S 0S$00 0 K  aQ @T$0, S 00S 0s w$0( :u1P 0( S00$0@xp @T h?P 0|S {00 0S$00 0 $00$0 |6.0&.$% % -x&.L&.ob -`L$M@@KP :000 04@ (0 ,0 pD <>0P/S:S X3>@Er  D z: DD,P% 0p:DP/4@ ZW@P/:UWpP &W@D#,P  K@j /0, 00P0DK<@PU@P04K00 l0@@DcT@@M , 4K00 0@0CcS1S@U&;.PP00/ 0-L#B (0@  000B@04&.-  t0-L `00S T0 0Lp 8 00000$ 0 0I4&.7.7.--.-  -`0LhM@ vd DpK9<0 0pK0s x $4&.c7.-00CS0 S0 S0 / @-0LhM@D0 0 00 0rS sS t d hpK9d \pK+T0 0pK0s 3,d $4&..-&.7.- -LTM@p  T?t x &K%K+  ?&KXRT LKreA&K`%K`%KR0T b<Kc$KKP 04DPZ R= 0 R0Fd `@ 0KP %KptP(4A0S 0A0#S ,A0PS H1 R KR00A#P Mh1AyP v(K  `p 0 %K R0%Kp x`P@0S @0#SIY0S KP0 R0 21} #%KK 0%K@&.@B7. p-LM`PP@ @0BKs8#8,0 U 0 Ks8#8000@?,K P V[U 0KA0T00Kp 0-L@ x0@ *h00S \0 0Tp -@ 000400S $|@@04&.7.7.--- 0-Lo@@d00S X0 0Pp < 000000S  S@@07.7.--- -@,6BML M@6D @ 0 5U84 Y00W S00G00@4S7BK+ A$7<4S `44V @40@4 44S044 S<400CS0@P񟗯P P 0 t400CS0 0d \q00 400CS0 00 s`93`3sP6D4S 300  0= :00(K@x3@P30S VU@@4SD3D!'/0300 V S$ " R 5X Q Q#Q V RV"x H4 H4\"H4 zH4V h" 0 C " T BQ@Rd@T Z " @ S)S 8  @ !8@Q 105 28$ 5T dT(S@V-S<$R  <$ <$ X- KW05p20 04d1X 1 0  0VR 00 0RQ P 043/`0 `0RY P 9/0H50St00S BK @3/-- -;.!.&.--7.;.@.D-@..N '-d- --LMP@TPS 0 K0p03 ` xW}. h0h ;o,0@S BP 6/@.;.- -w -@FML M` tD > >F>K 0C >0p4 3G.K0l4 F>K 0C 0ChD &[0P S 9>0 8R 03 =Zx4,Q63"xD 4 T  R 2x 0Z 0 PE~K0Pp2C.KUP "CK5 50S x40S \0C.KT PP CK,圧@0S00?o 2Pꬑ  m60@x0Y0 P4 |14 xD pp4 pP1pP$ 0S004 0 0C>K0(a(0APSp MRP RP N 0 0S 4 0-2P@F>K 0C0C @4 n4@,hh4(K-t-7.1;.-.-7.J&.!@.~ -lg0JMLM4 pPGWLWHg D45470S00p  JPW 6 5 7PЦ60 0 0K>K 0Scx6x0S. lpW*`6`&0S0P0$  R$Q0 P R&4 咿4 R % BR5{0000S P(0S5 5{p00S04 B>K 0C0C0J>K0C0B>K 0C0C0B>K 0C0CC.K@@Pa 50 (5pW 0000R4k{40pC WSY4I>K 0C C0C 0F>K 0C00F>K 0C00F>K 0C  CdP84l \!<!>p$0d4[hK0S  K>K  pA TPP20 0 08K>K $ ;J.K Bpp 40PP嘥0X[ Sq:10S: 0S6 xJKl4 0IK [1C.KJKRP"hC.K04 P10S00 04S0 P 0S1!S0S Z 000S 0 0Sr Z0s0p0A Z]W  SW04 0 0K>KpNl--p&.H&.t-&.-0&.7.--7.;.{;.-.Ahz--'Uu -LHM`1ApWk pPH   pB 0\0 0TK5K6ԅKl1Q< ?%KDK+K$KP<LPZ= X Q /\Kp ;0S 廤0$K0@0( 4Kpp:0S PO00 pp 30[S $0K< #   $Kl-p&.!.t- 0-\b@LT0d H2T R ,B ^$2 2pQ ,20 E0<3 E83 A43 A031 R$!$! 1 (!(! 1 ,!,! 1 0!0! p1 4!4! `1 8!8! P1 &(P ( 88(l80sSqp8  d!Px10S !<Pm0l 1SP 7 7 R0Z W0SB|1P 7 1 <7 <7 1Kp 1p 0: S0&0&0`7 R,T7T'TT.10|S  ,K  1Sp6 l6 61 $  1S66 R P |6F +60SP 50S 5 R05P50S 40CS10S 5  p +P0˝1%p1 1q 15P00 8(PO30 SH41S 1 3/0 1  0Sl4 RQ 0T40S !4Rw 0 QPK K.K,K0K0 ps4K@Qӱ  0h`g\gPHa0Sc!00CS0p@b T000  T$C<C 0 0 0 0jP`pk V00 0 0\P^ !00CS0 ppT P `p !0`##܎K0 ?.KЀU KX0 0 !00CS0C@ T0S* 10@ U.10@ 030 S61 10@- v!0@  PT< mt{j B!0@k.K@T01 /#,l嫜@ `囵TqR @00S / } 1S 1 3/7.&.7 @&. &.t&.{-7.?.--t ob-7.;.p&.UE (&.-tt-P&. sP'l&.@2J!-!.7.  /0cq7.4P P0-LdP X0 00.T0 @P$' 0 K0h &.;.A -L M@<0 KQ G0@-@CT @ T00 P0S@肵0  -p@0`LPPP `P@踣& 0-X@L0SHP40 0R a 0-dsm- 0-X@L4SHP44 0R B 0-8-PC-! 0`Pxp^ Y @Y X BR`P0Q & -L$M`@pl.T PT(KT <<@DT0@0 pP@0  P' E0 P0Q 0`7@P{ j%0S 0TS s@X 80K @0 _)@0,K0! 03/0 00  =7.87.0&0@-0 P$R!R!\6 \> 0 Q Q Q 0 T1 R   R  41 0 Q 'Q Q5S S 0 Q Q 00 !R0@0 0"Q \Q Q@T "T0@0&.- @.X&.& h0h - `0` `@ X0L P0 P w`V000&..-|&.`&. @.?. -aLM0AS o0 S tR 0*\\ P` D D  0S  <^`oq0S 00pP U 0S 00S 08K  Z(0 03/00S 0S  \0R TL (K7.7.Q.'"`&.?.0&.&. &. $% % P/ 0-@PL(P  0V} -LOMOOKP&`P50`V4pPZ V0`p= ? 5n0 0 .S?K4 ЀX00#P  S?K RzQ?KY$X40$ KK 0t$媱S?K@j` P  i(4Y$$ KK  0d$吱@UY KKd 0#@<K?KP <BdP1 # n0@Q/K`P  S  RS0K/KH#d1@# 01`pV0 `Vp`p`pd#삟/ ` 0p&%@1+ / 0 QK``p&5;G% 0" 'U@m D2`V0hSK 0UPa L2ЀX0\<2  0X0SXe`S?K  0 S?K f`cpK?K`!dW@ KKd0X!@<LK?K<pd 0D!ϰO?K`@!4`VApQVX0K?Kd 巰 @K?K d౰U 00p KKz(KQ?KQK 40D!@"% +LŠD! @ 0(-.A@&.&f&.Q &.P&.7. 0-D@L0s,00p :0Co0蔪&7.00S000/h-t&. 0-L.X0@ R0D00S 80 00p p.@0@&.7.7. -L MK,K 0K κ K 0-L0M$ K< <K80 40 00 ,0 (0 P$ K -pLQMU`fE "OOK<5 `pU?K`!PS?K 410CS P0SK d5UK"R0LeD\U?K " 0SK 0S z,0S JP KKi40S@ JK$@ⸯ@4`V08U?K  4) 0 9edP`d`KK0dD$嗯@4@p 4Wp-pGP _)pGWd$0 #pGKK dp#z@U?K P࠳ࠣ\^\ K?K#d`O?K` `Vp@04PZ V0`p=  43 0 W?K2QK R0 0pP Q?KW?K Q?K0Q/K`P  S  RK/K\"QK1`" 01``pV0d8`Vp`p`pdP#/ ` 0p&%@1+ / 0 QK``p&5;G%0 !h1@`V001QK K?KP R0d WK 0PU?K V0f,!j\SK?\0L1!00KK⵮0 0KK0s n})Zds"Ce 0ំ-@&.!.t&.- {d&.t &.Y@C$@.JT.Aav |6.7.P&.?~Z D!@"% +LŠD! @ 0>Q/K0CS?K R0x W @ZK?Kd O@0 0KKp (K0 VQ?K`pW?K  0W?K  1`Pa0P 45PP7 .0P1  zP 10C 1 <P10S  .PP d0P1 PE xu<`P10S p1 P P0" P PPW @P  (  (PP (P 3sKd0p CP 1? ??|3dZp P 0SH83sKd0p !P1? ? p P 10S120S 2dx&0 P Pd00CS0pp P|2|si R`2d 0TR L0 dL\  ! 1 Kp1@S PD d00CS0ip0 dL\!  1 Wp1! P5,. ^0(U^0C 00E>```^    NR%    #t PX Q0<0\n---. :7.7.k - '.. 00- L@0SP 0 000@ (;P t0 0pP P0 0PP ,0 00P  0 0 '-q 0@-@CT @ T00 P0S@0 1 0-S0QL`0P2V "P ڀ100.S @pd1l+ `L:X1P@  H,:P10T0!0!00 (1( W!V 0 !  0Aq000 000000P 0p0S000`0T h0h0 @V t0!P$0`h-- ;.;.7. 1 7.X?.-t-(@.H-d- 6 A  00-LP@ 0 00x 0t 0p Q0 `0 0X @0P 0L PP 80@0S, 00@.0&.-?.x&.p&.7.7.`-7.-  P0-L k<00S 00 0(p n4&.7.7.|6. -LP(A`M0S p0S p j00pP㚴倴00000S tp0S p K000080lU  ]z(`0&.@.p&.@.  -BMLM2P 2p0SB 20S R$5 P1  R 4S4 Y$ (K4St2BK+ @2 ,0K4P/S BK+ @1BK+ @,BK @PBK Aޑ``!0< 04 0f00@$ 44 |1D4 8 X \1oBL1LBK A0 0Y100CcS``V10X 0o#<40$BK @44$ D48$ @ 壪BK @4SU00<$4[Po ]P0 0u-.0-0&.8&.U  -!.t&.7.!+Y;.;.  -L M1A pR0 Q`00S Q0hfP "P (Kt+(0 R 0000@ ` KPl00}S0s00X 0S$P,9f ---7. % ;. ';. -L @ Q0*0@0S0 0 0S00CG RK mU.RH T:* @0GSp0d000C R9 T+* @0GS%@P.@ @@0&.7.-ob.`-/ -p`L P@kWP0  T  `00T  ;0@ R   `FVx`00CS0  PpTL000`000 0 ST002 @ 'R  -@LM`pP0尀U-bx  00P$0K*aP#lP`0( \bL00D P 0 $K.7.i  '  `&.?. -MLM`8 @ 0~KpG.K0@p3 B  :P Kx#x@ h`30S, P Q PUP p@"0`00C.K00 B29P CK"@"CK`A呌(K ᫮p.K0 B||偌@ ᜮp@ KLAs>K 0C8 0(th 0B$2 8 R 帯88 @_ 0 |p@U"0$SBK II 8S"0AS K A80S  ጯI8, RdPZ=  R ( ( /8C0C8 ,p8,b"0S 0 0x8 8 PC>KP 0CPp |8S J"|8G" 0 p@@b.K0 BL0[P3"<00@. B  !.w 0-@PLK0h ޭ 0-L@SP0   -LPB  0-L@p0 k  P-L{P   0-LlMPQ@0K|0 0 0  T  40S P 00  P y00  |0K KKPsJ 3 @0#S` 7 |R@$0KT@#P tKdP/X3x TD 03 P H00 PU , :!P 900 |PU  +!|P * KtKr P 20S @@@` H HM  I P ` P@l0S @P@KB   P@  TO|0S @P@K%|   |0SP5]Hh|@P  U 11@T  `0p U0PUږt!P*000S0 0 0@B@T|Q P*Px&. -;.7. 'H  -S] `-7.0&. --؛.?.`&.-7. 0-LM P  1 K0Q0S 1 1BPʔ!KK!0 CRx @R hS \1P 0S DY<S0R0 P 0S 10S 0 0 @ @J0 @0@B0 @<0 @60 @0 0 00S 0J;.0&.. 7.t--7.5?.-R~Q (@.t--yx-.-,&.Ѱ.7.Q?.\&.- -L4M0@0S@K, @K@0K  P@0S04@K[@00@@KS-/ --LlM @K L0S 0@0$KQ0 0| S` HK{hKϬ&KK0r(0K@q/0xK 0徬'KKP 0%K`0p 0SP0 UZP=9K =P0 %KR0<00@N0X K0 H KCp0S0S 0 0 0KPv 0r0S n0#S|0@P0C|0 0 !./(/ -LM$0S  0K #J K 0-LPP@ 0㞺@P0P$00 p-@LM`0 @ 勺PP  `$@0+0 0KKp 0-@PL ǻŻû0 -LlM(sP0S@|KK0`gK @0 T  T@!  00C 000000C0 吢0S 嚪pp0#S) 0S% 0(00S (KppP|0,00TqP @ H @@@p0 `L0KS"  "w  pp ,0K! 00 00S0lK⏫K&KQPtd\\ 0@P0 n<00(0RP 0%Kt0d 0CST0 P=9K =T0 S00 R\0K0 0PE0S A000C0 @Z!.7.  -L M0pS@  jP;P0# 000(0(0S P K,0S Q 0PPEUPH 00 0P PP 0 00 0%KP(0S,0S 0 %[`0V``坹PP `%0[ S0S -p`LM P@P,0S T000(0KT00W0@ R   `FV 0KP 0[ ST(000(0T002 @ R / -LH@.<0!R/P(0<18C8S/婟10/H@.ĭ& -LBM30$1 0 1 30S3@TKC  tP   P{JD#1S<!0R< 03/@ 3 cpPQP FP@BUQ $10@SR&R@PRI$$10S $10,S$10S$1 $!   103/P 10 1 $10S 1Sr !2R$10$1 $a $1r P$1 0 Sz0$1 $1GK $! PBa$1V P$10 SP^0$1 $$10S $10,S $10 S$1`0S$1 $!   1 03/P _5$10$1 :0  - 10 1 TpGoK HPPE01 03/L.L.8L.XR H@.ĭ&K.ت&LL.@M.]dm/S{PL.0 K0C(4 PL.tK.e K.L.DM.K.K.PA.DW xĭ&L.TK.t 0-LM,EK)P GK⢦P6@PGK0 ,EKPP 廥 ᦥ궥 L x0EK<  D KoTPn堥EK FDW ĭ& -LM3@P `pspGl `#8 P3 LWT@D,QK$C00CS03 p00R0S0 gP18C8S5 P1 P8C8S 000 0[5'3P|2p2l18C8S  0K 0 P^S,18C8S  00 S 18C8S <18C8S [l18C8S 0㘑0i1<0 x1 0Kޤ RL<0P+ Y Z 4118C8S V`F(Ƃ`p8v  <18C8S0 喤 (KS 0R   R%QP1K8VC8S 0LLDEK.K0CC⭣P孀AK$4!@⿘맣PPt1LAl1T@ƢĢ㾢A>KP0C4!u净寢孢婢+凢@墢BKfU $[ 0R0R0S $  UTd$$  T$$lPt  10D0 S BoQ 0CN:9 Yĭ&1QB.'a|9 pPA. -LAM1P P lhl l;h@PHX嚘K,EKDP 傣,0< EKL.K.ĭ& 0-LMP P @'0@S|lCK0P55*\ \PPL^AK5< @AK, @gL.PA. 0-LP ppGPP0\\ИPDLK0h3@@ LOl18C8S0 0K0h迅K.ĭ&PL. p-MLMP P @0@S CKp5P5t`ᖘPP`X AKl!5(B(R@ @  @⏗A.K B, L. PA.ĭ&(0M -PL$Mp8 iGPd~@$4ܤPP0 4P @ <0 4$8ᣋp0G$T pW W4 Q804 x P40h$h40d4ppXL@4 0$$$1$Pj p g 㟏T Tx3 X!  ! RT ዕeS %FSJ 0S9SES7 0SaSR cSU PSX3@@6P ,1Pq  ,@P~ !nSp hS[ lS@ fS qpS. ZsSJ tS0t"0x"x"0a2 P000 Up2 p PE  \ PA PB 82@ 00;2 1 040 4<00S1/ XP<0& PA!1rH01 1 T T@ 00C5%0P 0@ 0   R C "0 l K0CZAK Aך18C8S `0S RAKHAK @   |PZ 0@^S0C\ \00 P0S 0 ;t K.PL.ĭ&DM.K.\K. 0-PL@LP@0 P P  P @ĭ& 10-Lo -L@PP" p00CS#؍ X H 8 H H H x `V  PP]1P0 P00XKh; 0S P0000 !0S0R 00 L-`0 0CS`0pSX䶑X0X ' -`AL0P0C!S` 0000CS1ꤏ x $ 0 "S 0S!nj0 0P0 P 0 `V0"S0L0KhL;,J0 0P0 $J.tO{0@- R RQ \R ^R^@N  @0 N@T 0N@T!0N\!n0( ^00@ 00S@ -L@ P1 lql =`P`VPP1 00PE 0P nA @V P 5@0S@0S:00@ PP?P PPP P  0!SPᝏ a$J.{ĭ& -LM@P@AK\1  @(AK @PP `pAK  @ APu00u0K 0T P 0T@ 0000S AK AD]AK  @ "P00AK @Rԭ&ĭ&lK. -L`@#PP 0 @A( P@a -LM@`p@T!KP 变> K3 R , x((R( d喘0 PfP O<aP K(\P f@xt PL.yt (J. p-@LM(  @ *0, (@,000 0@P ,Kp0,|0 !K\(`!@[P@!@K(30EP 0S  0T @ ꬖ (J.ĭ&PL. -L⦎ (,(J. -L M@ 嶙 尙 |_P | 0P3P xztx Kd咙 X{ 兙KPL.xt yt #&=f@x 0-L0MP%PK01<18C8S EAe@K80@ K980 { D姗<E4C0 埗,0E R 唗 吗.P *1PP {0(0S"=R00ESt pd`\XT HFĭ&~PL.P'{(J.A  0- LC Kh*PL.{ --LM w0 R   KHN. --LM w̋ --LM 8 0 R   KHN. -ARp`P@1LT pP`@D -LdM @ Pብ0Pl0 ゥ0P0 0 \K 8pT0 l0 X0 0`@ dP `P@'Ktp hp pp `0SY W( Vp% d0 ]0 d (c֖p  u T9 @p@oop`0b0`0 'K ?'K`0ST`V rT,  D h ̞ ܞ 0 D T x  d Q 'KR00S凧l內0S'K  (KD 3  d 0C`0 BJ0t @p0 d QQ * 0Cd `0 @xd Ql 0Cd `0 @md 0CPh d `0 @dU@a d PE h  d 0CP@d `0 Sd 0C@Td `0 KU@Gh  @C d Q @0Cd `0 ;h  @7 d Q @h0 @PP-U @)80<"dK.P@ (dK.0S긟    ؟ T0S00&S `dK5XT08s  lt0 I0t  l0P Ttp00p0 ZdK5@l0X0 8T0 SV d tP0CS`0 00 Sd @Sd pPt0C Z`0 d XV #>[HN.u:Rb -LtMp l t `h oV@@T 8PdK  M  |2 0X0 h2hT0 d2 0 P@0 ]F P <@PIp@ PT0S(lP ht0(KX` T `0S(hp0P|  hx0 Hpx0h @_d `0  AP,dKAPXp J lp  ZPp0 SX` T dKEP$<0$800$4000 0'<0'800'400\ 0 ъ lP$&`9 |9  -LMP1@ R` x 6000 00p`QP ,K ᐔQP -`p 0` 008 ?@PPd@VX0&0 0QP(` *ɐhpf`R0 }>)?@l ,Ke$ K0@0 S$K @. @ C<, K50崊$K0&8RahP'] p-LMK㽕P!0: S0D 0 SPK@` 000pKp p P @TP0dsHS 8$  K  ͕HN.nv0 R R /00@-\0R@ SaPNU APNU @S AL^ T00  `0`P@P-L@@ d0S 000S  8FE뼋.XN.. -LNP8 0-L@Ux0 000/xN. p-LM@P 0S`P,K=x,Kx,KPKpPU PO r0P0OxN.&O 0-L@P K0hP; 00SK0h~0xN. 0-L@PP000S0K0hxN. -L` P@P000 P 0S00R 0-L@yP 00SS000S0K0h xN.0 0S0  .L xN. -@0LQS@\0S@p<`4P8 pe ( p_ 0 SxN.ȋ.( p-L4MBP0SI  |2P tb HK0S  HK00HKvPk 8nP_ 2PV KPW P1PW "P1 $ 5 [1 3 [1 14 [ <0G?0<0 D0x00D0 02K0*0K-0K哒H KPKpP4 KPL1  P8 <1P. KP1  P) K P0  P( K P0  P# 0P0  0 0 0 0 |0 p0 d0 X0 L0 @0 40 HK xN.Ћ..00.̋. . 0-LM K㠓P@P1[Q[S0  P :xP0S00\@UP PP 98P0SP00K0ht@ȋ.4O .: 0-ALMLPPP + P" PK P PKzK0P P PK P (P 0L00M0KhK`KXKPKHK@SP0ML0xN.:OCOLO=O@OFOIOOORO -MLM0PEK@0% P00_P00Xe8X4ԄS4tNKH4dP 4 0$S0$0$0$0$0$0|$0 t4 p4(8 >K0CPCP P4L Pt4P(4x0S 40S||4S4|dSdP 0S0`00 S P 0S0 `0tP 0S00P34HP<3 R  d s  0 P``4 0400P4 0400P4( 040$0PkPPe 24x_Ppa0pS (hq Pu(hy( " BP\a0S 1 (h BR 1u(hZ( q z"P`Pppp0PSt _40S ,1 $K0|44, P 0S : 9txN.UO..XO..[OJ..܋..e ԋ....؋..N.00fP.`N.^OZ*#Pċ.R.aO ]pRDoodO(K ȋ.{%p? D]. 0-`@L4S0P00SD0D x|800S 0 s040xN..ȋ.L . 0 fxN.L 0  0^ȋ.L xN. 0 VxN.L 0 OxN.L 00-0LS0 0|@x00S\0\ X0t6T00S@4P 4@0S 0$0贌.ȋ.L xN..t./ (0- L^  KhxN.L 00S/ 0 xN.ȋ.L 00S3H.0  0ȋ.L xN. 0 xN.L 0-|@L4 l 4 P 4 4 4  040xN.L 00@`/ & 0-LP`@ \  D  ,   T0xN.L P00-0LS 680DTK0h5K0h`.xN. 0-L@ 04 00K0hxN. -L Bo 0 axN.L -P/o"Lbp)50 QP U@P U$Kk4p P`U PpGWUdp\p7/pP V@ P@T*U  $Kk!hO|OOO @ O 0 0A.0 00S/DS. p0-LP @ 0s  3P0&O -L MPЀ@0̠B>C`p/ 0@P0&iv0 T (K0  R ЁYX40 H0 #40 30@PDS.O&`00S T R $ <0/=C///DS..P -LMЄPU(K00Q`C !SR04 S05:?0 02@0 Zo@U !SR' 04 R $ $ R R0 q0P 4 0 40@!0P000 00 @0 0 0Pa @@,$(4vyf0 KqlK000V 00`S KB> CSRD 4? ` 00 QP22s!SR'0$0PR*0 R    @ @   @@04 S@05I:@_0 KB>C1 qO   0! R!S / R  0 0T! B΂L`S`L K<1-0BS> U6,K!21PUP00)KlP)0+KSR0,KSR  0 0 4 00*b0p0 P \)2x 0L00Sc DS.|.& P.&.t.pN.. .(.TP.<00@-0S ($,ē04VFY00DS. -X@L0Sp 000$R C.@B`p`B 0$DS. -@L0S𫝸|0Q 嬌0 0\0 p` -؀BYX 0 2(Pp 0 &DS.dN.#P. -(L@XP10T0000P 00S4 $B>`CWV ?0"0ˆ ^0T0t` !QP }p 00B> CR0C>C0 P@0DDS.. 0-LP0P0 0R AT 0 RAC@A000DS. 00-@LT04 MD0 QP4@ K0hu0)p0DS..0@-0S 0$R BCNP $`Pp ? ƒ "\AUT`N 0$@DS.P00  ?P/  /& 0-LM0@PT 40 0M DK00T@ 0MDB @C @004=@C @P@C404@@ 00 QP K0h0DS.5P 0-LM 00y K00-B>CB/DS. -PL`pw@P!֚ 0 AC A0 400 At P 404R0$rd$KkqpN.DS. -`LPU4 @ P@ Dt4 T 04 0  00@KhDS.pN. 0P/DS. -PPL`@ 00S E0S *Sn0S 0Sn0*S x0kR  dR   0C^S0SP@sR  uR  @@LS. &- B 00^2:!P* C\ 0-L @0@ R S0(9R0R*.R p/bR cR S :@0 B,, LRPS.PT.EPUP -@PL`' PPpQ PP@PlpQVTx/YP P0S$&l&mP t0-LodPP0P 0S ~40!0%,(!(K0h3a@PPPPPPP0 0 @ TPP |}PlxP LmP PPPPPT.PPTT.PPP 'PS.PPPPP0/LS. 0S-x LQX  SLLBnDS@#0$  ! LS. PXT.P 0S 0S 0S 0S P////// 0- L0S@ P0PR00`30R 0 CP00 R R - L@P 8 X #-?0? & )? ' ? ? , $? ?  &?* / ?! ?  ? &?* 0 00P@@00 0-$@L$P0 $8 0T. -LM@7@G0`S(hP`. Q008(h 8" 0S0S : p(K0S08 Q00((hʤFP %p0 8 0 h 8xW080F?oP20S| $Q (6Q{ PP P0} P P 048bP[ P48XP ]P P48 8tP P0 $48XP 4P48US.8P 60884 80 08S$8Q UD 048 D(<8R DP 4@Pe 048P: eP_ 48PpY<(KoO488080 SJ488SB0S S 8S<0S S9 ;904880S/ 48,4848 0p48!488S0S S8S0S S8S 0S S 484880 S80 S80082堢 R( B 0 ` U`XF   00 P 00`! 0;hH80S IG80B Q( !؁ < 8 0  B@ SY0 R  S 0 4D0 P@ D0 Z ( 8QS``V @K 0CwK  @o*P >K 0C@`pUU\&UD& 0-LM ,0Q0S/ PP, Uy@ET% Kp уP 0: Sp X X"yP Hy@< ,y0&K0@&!U{UH&U`& 0-@L0 700000  0  |0  l0 \0  L0 @8800K0h\.UUUUUUUL -P@0L@`@p|0@/00js 0S nW DjV V Kh_\.Q obV\ -`@P(0LAJKh\. -Lp| @P0k  ' P0;0 $Kkx ) ` y/0pP     P $&V $Kk$  \.V -LY,P Kh% -La@0PSP  SE SKh S S %SS #S, $S0 )/S 7S!Kh.0P S+S@ AP 0S0p0 #00 0Kh400S Kh00!S P  \00S LPHKhu00PU$NKh)&\.tN..VV -L'P P@x0QP  KhP0Q@ @0Qp`P@ p`蠋.(.t.. -LP e>rUp`  0匀 @0SU V0 0040S U82 8...00SS/\. -0LM K0!% K&#V -@L(0S 0(06PKh2$'P 0S S S ,P P`,P3?o2(0g\. 0-@Lx0@, , ( 0\. 0-LP@@T08T -0L,M؎ePN~0>00?00%0 !0 S 7/>0 S "a,0S6N&"P  P >P>0S P l>nP ܭ Rc 80 SP "  l$]P 8 S0SeUU`ZeU@0S& SS SP S V VyBA),P  F$Z 0S:#\ :$+/S 7S0 S0SH`KG0KHK Pr [Po 0,K0!hPDP HU 0EcS\  < H  | $    x D  D      | p       T d t t  @  X L    | | , ` t   D < | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | 00F.V SYdPT n0SP0@ _V0 0Sh V V00K Z" :0V :0V :0V p`!V V@0#0+V -VR00R0P @ 0 a0CS004K@K0!P 240@0 @0P 0Sa0@S @P@00Z,K!# 00@0S" aFQ0(| s$90V 90V 90V 0S!P,K!HP 0 /6PV" V V/ V07S <!V V: 0#0*V @V70S 07S ;\50S P!R ,50Sq !R   w(u}!R0 0!ı 6s!R00 !ı0<0!eR00d !ġ0<0<^P0[W!R0 0!ı3 yKaH&,K!"A>30SD0S7NK @ 4 P+ 00!R0 0!ıH0430<0!R0 0!ıh P0000!R0 0!ıVPP000<5(P2p P@ 120S HD"D {|20SPP2 P 20S "8"0 0O1$8.Pl!R0 0!ı2P P P  !RT!010,K0!@O.P0J!R0 0!ıP !R 000,K0!6!R0 0!ıy.P+ Pl.0 QPf L0 kb.\..ȋ..X.,.3VX].QViV`N.}..D.t NVHVobV4].V.V+VVWW%W1WAWpN.\SWNW.ZW.Ћ.̋.DbW(...@.\ .!R0 0!ıE.P|!R0 0!ıP (0P PXP  000 0,000  $10S  !  0 `*{`1`0S p10S |10S P P 0 c1`0S 10S 10S P P K20S (%F42`V @2`V L2`V P P`.`0Px"$` %30 .P02 R2 բ/ ?!!\0 ı0L 3 pP03 R$3 բ/ ?!8#0000S 0 hyxx30S080J?00S/LS. 0-L@0 S0!0 -LMSP@`PPp0` 4@ 0X:W  0#1  W RpG Y@G @(K40 0K80 r0 40S  P R 4 BQ4  R Q R 4 Wp10 R0  0  0 < >P< 4KZ80H C0 P 0 R:p@-PP HPV@^^)0S gSd0p00dS fST ^g\ 0\^  \A0 000   / -L Mp 0 P@䠟&. QP~0`PP40 ` 840S ``F0Q@0QU*0@S0S000S 00p0(KPmW Q-LP Khe$].oW Q-LP KhT(].W 0 E$]. 0 ?$]. 0-LMd@P K4PP  0S K $P K0$]. -LMP2@T @(K]PyXP0`py@WPP 0@0 QPᢊ yyW V ᔊ0S0 MR +R GR  SR 0SSZ SER SnR0SdS0Y CP,`KP&P00 0 0eS cSp0800 vS xS p0:pP  0 P0  0 갋.0].W 0-PLM@P 9P P@ QPK@!$rK0UvW 0-P@Lqq 0 $$ K0h&X X-X@-[d`4P-@Ḛ0Sꀌ..VobYX -L M0p0`S-R ᠚PP% Pڔ Ki@@@@0 ph@ᖃT  Kiv K谋.YY 0-LMKPsP@@JIDOoBzK0 0-LM 0P @RP R@ WWKsPQ@SK0@T@0: S 1*@Vꔌ.&!& -LMK@sPKK0 00V/ 0-L@ P0 P0@/R000SH. l0-0LS p`QP fQP@P UT. -LPP 0SR0 R/ 0. -L M`p@P V 20St20S S R L200CS@0S (200CS ʈQP P*? QP D`V5 1`r`P0Y00 SJZ.Z@PVl10S`10S 0 UT 410S010S$10S1 1 000S0 QP@PX PPl0AP QP Y  00 (Ko `V 1ȋ.x.t.L&`N.}.$~.0.,.YH00S <0P/000S $0@///D].T.t.ȋ.' -L`p@P@T 0@T@@PUJ0ZspU ,Ko5 rT j PT 00Sȋ.`. -LMPP P @SP! 0 SRU00S$Kk"KAjP"K $KqP 0@`p 0 @{QP 0 .ȋ. -L Mp`0 QP@PV KiM0 @ 0S K0PP/P&0PP/P& -L P Kh 0-@PL0 t0S0 T  00S < 00C0!K0h  B 0pN.P&H].0/H]. -pP`L@T0Y@a0 "000 0|0UP0(0@0@000 GP @   0S 000P&H].P// / /00//0// / / -LM@P\0 UT@P(K,30Sx 3 3 0S000 0,P`p0p PaX0W`p@ P P0t T]0 00@SPt" Rp "Xl0@P_P10S 0 P00P *V10S Y P PP p ^(Kol?P@10S`Vp0mo 0 !0P00 00Xß0S:00 <00 TH P0 0Pڜ X R0FH Pp0@P\000 (00@P_5@q0 ,..P]...@.d.\.X. -L,M`pRV0 0#KK(K20S2V 0V 0 00PD20S V0$K:P20S @ T T P P; p 0 P6 0#KKPK#K#Kᄑ儡K#K$Kp @@$K 0 P$KP(0S%0S"C@@T*$K R?#K0 pK P0KP 0S0S 0 @e$KR0KcKP[@00S^ 00K$KPV *4S..P].d.\..@.X.0 QP-L@P PVp 0 P P @0@`@K@PP60@@P&H& -LM@PP! @Z =0000 0 0 000000 j(20S3 (KoOP (Ko`p r  T0 RK `p400  X, 0J | x0 0@(KP 00C S3ʮ 810SD`1`0 0`0@d#KR0Q 0 000 @0@#K~QP@P 0 QP@P P0000 0 0t\ꘌ.Z0.(.ȋ.t. -LM`p0 QP@P P x00S `0 (KV0 @PH(0 SK`a ꘌ.D.%ZFZ -LMKK  K -LP |Kh3 `p0 P@QP  BKh@3QPKhdZȋ. -L@P`VP P p@P400S  Khꘌ. -L`pt0 QPl.j0 QP@P@Kh0 P0T0 KhZZD. -L?08000  0$  0  0...܋. -L&08000  0$  0  0.ԋ.؋.. -L MPp{`{?oV2@@T P *}V &} 0 00 00} }@p(KP]. (1P-0L@`P S P@@SP&VP  PP @@R 00SP0 0Sh@P R w@@sP00SP LS.P]. 0-Lt@P 0S\00XP 0S<00  ;00ZP].vTZZP/ 804   $ ( , 0  R 4 /P].d. -LMQ`0pSp1pA0S 0  P1 V    (1 V0@00 000 00S< K8<K5PP!P3 <0K nJ0 0  CR00040  4  0 B4P `p`p0UQ 0 Kp.d.P].&&[ P-L0P]. P0-L@ P000P]. -LM@Cp4`0 0C BS0S0P<0 8p <0 W U0 `0C00pp(K20S 0S0 `   R0  Q 40 H000 P`0 400P, 020Sq 0000 0 Rwk4 7<0PC%48P 4P Y p 8  `PFt10S 8P040 V 0Q S ҷ 00 |P  vP  00S   eP 00S <0 CR40p80 oᨂ0\`I PE 0P]..LS.0#P]. -BLM0`$000K 00PP U , R   `@Pb0S0 000  00R* V0SP P0S0S-  00 00 C p0S X)0K  `0 0CR$ 0 0 LPY `0Qp `pP5PpP`)0`0PP&&NP P wpPp PP0 000   00 SP0C 0(KP].8... -L M`pPKt0t@ @@ H@L00PPE K` 5PPP]. &. -`p@DPL8@0S 0P @@@P]. -PLM`pSd4@T X 04P S \  R0   0@@7T`T @- ,`K00& hp 4 R0R000S0 000 0C 0Q 0 0P0C0p0 0(KS @Tq 30000c 0 0 0 X@>_X@]@$0S@@@2 RXP:0S t20S DP W{@DR@@  y@ 20PH^P ` fP T_X@@ X10SmS$Si10S SU0SR `W_P@@ P $@ 0k@P @ 40 BS@RPByPE  H00Pᜀ @S0CR0S*QHPPE`  PPEU  0` .P].LS.. &.&\ ]. -0BP0LP`p %> CP0 0 U1X(0QS 0`E0000P@0(ꘑQ 0 (Q30@08P 0L 0R <10?P 0@X 0S @00S0S (0(`Q0S@0 Q0@ 8Pʈ1PlP ET EU0(06@,000@00P(0 P].._.LS.@..]. 0-,@L(0S%>0(000P]. -AL0P 0P0X0S %> C0~.^P/0S/P 0  // 04/}. -LM04 K! v K}.^ -LMP@`'0-S0 00C  S0p ` T00V K`!HSp  0p@0A ^T00RpgK^ -PL$MH  c4P 00S S03/040(Kg40 HK@P<<@ H0 R @H@ +P9  P $P P @0@80 ZF]apDWpp@T]804 S4KQ9P 0P,*-P-P 0H0 @0 nP0Sz@n@+P0H0 PP080/0 <KPH <0+S<roTH0 z@p8 KapGW@KppL0 @ L0H @0 0@ =SP 000C0 ,K\!s H 0<0 00 CR ~ ~ ~ ` ~ ~ ~  0U?o 200<S 3/<P_ U W 0R00R0H00S4@<H H0 S 0 <KePH .H00S HKp}.tN.(~.>__^ -L@PMp0 `@P U0@ vK!2KU  kK! R RU0  Rp  00 CR < U0S U03/U@`g 0 Vc 0  1 U< U U 0?o20 0U- U U W 0Q0Q0W  0R00R00ESU U U( K0KD(0S0 0 wP00S|0000K00!V`00 SS UVm_|__(.__` -LMpP@7000C S ࠓ U00T K@!|g0 0 @B00C Q` T 0 @DTU0`0K ㄗ@T^ 000S/P/P.(~. h0-LP 0S H0 D@$0TS00S  0  03/$@`(~.&<0 R0/R  BR $0& -PL$M@0Ta8 < 40 0P 0S0 R= Z   BpW2$`0 4@0 P@0#4 AAQ-P % RQ H P0  RD bD @P@_oH@0R0   Sp040 80<0S T@<0@(K& -L M $ ( P 0K     6\ K0 $0 ( @\x00S ` P101L01S[04 P0h0S d0#S ,~.̌.. -L,~. -LMK: K -LMPFn`@@Ep`0 RK -L`pW <0s@PO 0Ⴣ 0J먜Y@? -|@L`pdK@ 4`p7 0J $0a 0(놜'.A? P0-LPLPU`@40 0S[P 0@ D&0.\N.(. \00- LRP z8@80 R:0 P0 0Ԍ.D&/.،. p-L Mt0@@  d0 KpX0P@ K}`P g 0V0}@.(.܌. 0-L@@P0 0-P/L`"Mp"`V,@Kp0d 00  D0 `p0D X0-00JD ?(K @ 0-pLMo $@KoF0d k0D ㇕`PPDW-00EPD? K@ -LM0P@P K%P pS@0p0nS sS dS<K<K<K@`D@P 8< K -L)  R(00320 P00S Kh -0L000`@pTP 0@T 00S>i0@0`S p00S Kh\6'T0@00@800S ,0 KhЌ.\N..`..H&܋..(. 0-@PLV2f  0 0Y&Ԍ. 0- LRP`@ t00S 8J 0PS @00S f 00S 0 \N...(. -LM0p0`S@ d000 @jPWl0 /o"HaPP j@GPT j$KP L.`N.-k 0-@LP أ000o/ -LM` @pP  0S ^S P P W@U   $K @ 0 00040K8RP4000,0@@p p p@0@(0@ 00/0@ȋ.0.800@-00 0^ʎ1C0@ @ȋ.0.4040@-0 C1R0AC B@cȋ.0.0@- @P 0000CQ0@ ȋ.0.P00@- @P0800\0@PC000.ȋ.<0@-01P`@PUT0. 0Aȋ.L0@-D0@ P0 BQ@`WV0 0`ȋ.0. 0p-LM $0 0P@"K 0R`V ,Ki>0P0@"KSR$ @Kp 0"Kȋ.0. 0P0PSC@/ȋ. 0:Q Q .Q ?Q0 \QS/0S// -LpD 0P`;Q@10C"@C  <00008. -LM$ Kz$K K -LMKqK K 0-L@PP0Ts 00CSK0hH@0 QP0ȋ. 0-0LdS@ PS bS 0PjS BS bS0 00P lS pSmS tS00000 0`D. p0-LdPd0d@;0PN},PVyv00M.(~.Lt& -L4M☆0PS@P `pt0S P Y PP @ *D(K:S9  %S .S D0K0C0KDK4 ?S \S0DKD0K0T C0K(T @@0S ,K!T0 gT0@dSH PSd DSF LSD BS0bS- 1aS# @mS= fS, ):lSpS= nS P4 sS xS P4: PP 4rx4t0S OQP P PSQP <P00 4P00}0Sy ,K!T0 T0@B0CH6Slꘝ D ` H p P t H ̝ Q0R 0 +QP D Kl2n M0P0P2 RP B?RQP 0G0EP90P01 111 P  l10  0SR0P0PP T X wX T0000P 00S 0TX 00K _ 0SR0P KQtSA Pj ePHH(0P,o8.p.<..pN.@.obȋ..SѰ0Ct& l00-@d0L0SOoBoH0H0@0<00A400AA( 0 0舌.(~..t&..܋..(0$00A00A0A..܋.t&0@-@\^ T0 0^ !R 0\  A T 0!@!T00@f p-L M@QP`@ P&P f0T0 ):`PK@%@ 0T X0XR   QKp -%gP  @.L. 0- Lo -L$MK RQ+ P@p@ ` K0@D10`FA V 0S7W P 0 000 0000 0GP(K Fo^Q K  8 3 V8  K P&@. 0     /@. -0L0`S 3@V PU0 000S`|$ P0 QPp x P`  BR;0.@.ċ.ȋ. -LM0 ЀYX?  @ 0CK0S(Ko00S P@Ġ  BRU% (Ko=080 0 QP`p 2#KV0 r  X0 R -PF8@(K&&ċ.0.ȋ. 0-@@LP,K0h 0?o2 0K0hb@.=k 0-@LP00Pe@.&& -L@P400 `UT 0S& -LDM%K0@P40 00 K儓30KP T0000T 00R0S 0S@(K 0< KS0C 0080K, y$K0K $K 0$Kp`K0 QP 20S D0@CT@d T$KK8Py@l2T0S S@$K0K $K R0$KDp@`S0@@S@10S,0K@ 3X0 \0 8P @X0 <0@ &P 0 00000K040K080P $Kp `!($ P 0 00000K040K0 80P T 00040 080d dDK<HXʈ00S  00040 080d d0Sp`53@..p...T.&H..@-\^p`@UT `P~T@^"`p^AP@SR @T@\00<00S 0S$0 0Sd.&&&.@. L00- LR@4  0 P d0 0K0h)@.L.H. 0-@LPT 0S D0@P c0,0 0 0 @.T.(. -L  Kh1T. -LRP^ս 0@  |`|Pp 0S0S 0T 0?00] (0 (00S㪼.h (..ȋ... -L` P帼@L಼50U0P >़ 5 0-@@LP ,0   0 0  08a&x. -AML M$R4 6G`4&aV 0A 0pB>K 0CBK  @P ~0S0000(K,4[!S BK A -P,0K04S S S 4 0S 4$0 QP44 48 4 0S B>K 0CC.K8C0\  ? 44 4$  ^Q044 444RP S$R 0C44 44  0F0P0000\P044 44044 &x. -`Q`P`LCMVPp (KCEU`3#S csP 0S PEUꜹ d T \ TSEP[`X U ``๻0 `.Y [`~vPU`U"0S000RRRKK-P ,0K@1P S@ > Pp K?KQ 2U wP 0000@ 0Q @ 0P @ Q @000 0Q @ 0Q @Q @ ,1[ S 0S 0S P  ?Th0 0 000 KKP Xl (0U vx.&k'. 'kk&fk 00-@LP0P P pP `ۿP NPN00000&kkkkob 0-L@P 'P P P,0K0hkkk -LMT!0@ SN A0 #@P(KK 1p0`0:0 Kl#K0@P #K 0#K0 UTg00S K 0.@00D0 D00 .P0S 0 SSV@P@Px..kp.0@-P0PPP^0R @T  @x.&0@-P0PPP^0R @T  L@x.&0/x.0/x.00S /x. -LMP 0 A./ -L MH@ K3p P㸹0[S00KP[K. -L^0\^1!0 㑉 ^ @Q 1!0 [\A[^^ ^\00]Q00 Q]Q 0 \Q\ 1 !0 ]Q [Q`.FQ 5 `p0]X V0\\`[V0 V0 nV@0 \VR 0 0`0\  货..lClzl 0-P@ 0L RR\P L L D@D@ K0hW @@ '..l p-L M|0QP`P @TP L0PD0`0 0ш$0 R Kp...lܧ. 0-M0LM00P/S $S- +S00- 0 0 9S%\SK A@P0 0 㙈0IS8[@S0 K@00K00@00KS0 0A0H괧..ll -LM@$$ T(K0rS aS bS @tS {S000`V Fp` 0S0QU02p0W000 kP00  S0 404 `0 ((P\ا....m -`Le-KeMd? M B0 TTPPoV @?@/0 800$?$_0 R?/0  pW>.0  W Q >.0 Շ Q񟗼L  X  ,   R @     P R @0e-K` B00`S U =0S @S#SPPz ;SP ne=K0C0@e=K0C0 P00$ 0P [P < 0Se @,S_ 0S 00@<P  `<0S  00@AV < ,0 1@` PQ @;Q }Q ;+0  P} P @\P T;T+0 pQm PUs P@ ; +0 ,\\\ \0\ APP000H Sp `KP >K. P R @LD:0S00,*,Jp 㷆9)0    R @  R @ P R @f0S p @0S@ QUT 1@ P U8(0 \2p0W 0 卻Pp8p(0 .P0p\PC_oSRPU (8((0 x8$?K 8AP7'0 8'*K, B (RpR   K8@5 p0( 0Ye-K B00S t'   e=K0Ce-K7 B0e=K0C0e-K B00P\ Q&e=K 0C0PEe=K0C00C Se=K0C0e-K B00e=K0Ce=K0C.KP6&0 \QA ZAe=K0C0Sm0S 08S .K 6P00e=K 0C0Ee=K0C ZK,PE0p 09S50;S c S GS 0x%p5 0pZZI) e=K$0C  ;e=K$0CP  0@^ Q4$0 LLP5 P\Z&Z  PE^ Q4$0 Pe=K0C1 CRZleK A d0"S YD4$0 3iS: IS7 gSZ+ 3#0 L$pS& wSY3,>K) QQ. S /l3l#0   ))0Sf 00@a909T90C9 ))0S 00@  Y2 0S"Hp '  8U@S0  K8@Y8 H20S @;S PB0110p\SSP1!0 TJK,@DD P1!0 ꃞK @P pp1 0S 00@0K,A AYp ㇄1!0 op0eK Yp X 0 0 D]@10SQ000 S9Q|0 P0S= @;S }S 808 0 <)09)꬧....8m '&lmEqm^mmm nfqq. t9nqq.Tninnn.Qo pnoooo8pppp'qS񟗔 4 4 4 4 4 4 4 4 L | 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 0 H 4 4 4 h 4 4 4 4 P , |  4 4 8 4 0 @,08lQ:00  0p `p{p:0(00$00S;;0S (0S[0$ 寥 40STP(0S$PU ` E ဧP0(0 A E$ ݚ0< 8 0  00$  0  0R 0 0 $0xz0 t:R<000s\ ߩ0P0 0S- %0 S0K0`0S,0`V: ($G D00@ 9@G0S BT 0~ KCP<[S 0<00K KbS0P0s0 :0 0K0 ҵ00 ̐ Y0`V:$ `0 00 00C0 SP S0 R:x`0 `Y 3Sp DzP 0S:`8I8 8`00 R:`Ԁ00 0 k80S `l70S (0S0$ 埤  P50(00 P(0S0$  } ~(0S `$  HXpP0G$0$ 0 g hW0$0@60S (0SV0$ S Tk%0eQ:00 " 0p `j0 ` R  R  Q 0 50}$000 P 00$00pW W @5pW,u 0F 0 0 00 H-p4W -KQP 0 0 40 QP9 pX`X0 0 ;0P  ßK p``$L0pK$0 0` 000S 0$ 季 ` P2 000P 00 pd3p0 -K0-K 0X` SR 0 XX0`0 Pd (0S0s "A@p0 \|0$  @$0P0 $@P 0S 00P(0S0s"@p $ ?$0P ?P 8 R0l?HK p``0pK0`(0S$X X!p `RP0 0$ 0Vw*00000S0K!0  K S0 0@H !   R0 yP0( 00 6H갧.L.l...ا.Ч.ħ..$&P': ȧ.ht@ lzss~s.sԧ.X. t'.l. 0$ ($1 0X`<K p``0pK0X0`L0<0 0R0((Q 0{Q  ꬧.. -@`PLT0wS {S sS 0p \?P 0 H`{0P@p M?P Pt -LpO`M@oVP :{P1 R @ P@@pPW&$KkOXPP0=S! !S0 <S :S/ 0S0S U00 000 0W 0S p>S @S 00 0  xz0 0 00 00:፡P 000BSꖄ.ss -`0L@0PT P P# 0S t 00C?o2S `0S000S000U0U@.00 0-LMPn>@P  XzAKA@>p8zAK+AT> Pm>K0tsH0  BR R R5 /''D0 0CS0S 5 0/' 0-4ALU0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0K0h .0-01S \00P\ P0\ S0S Q0S R P0S0S0 00Q R  00.0@-  \Ğ\ @ T\    %R    .00 -`AL0 5S <0S (04!0<P a q0U'0 ! R9  (P ʹ0  ,P Ĵ0  4PP 彡Kh轥00\P ־P D 㧴04 0塴P$$S00| H.'. 0-@L0`  11T  3t僡h lP`PT 0 ẟP000ST @''s.s p-PL M yPk_@P0?S0S@P` K)p Kp/P@nP  0S S @Ұ0Sΰ00x: 9t%tt -LM j3 1At' 0-0L0@0TQ0 T00 R30001S R0S|K0hhTdl T@0$ XDK0h43T0@  8K0h*3..tit'00ttttt -LIM 30yu' 0-LM@P^ K U0S 0@T P00K0J0"S p` -L M@i<P Kp xKu<0A-dps"0QU"RŒU<0x&PEQ @L8& p # L @ "L / p # L  "L / p # L  "L / p # L  "L / p # L  "L / p # L  "L / p # L "L / p # L "L /0S00//00// P0P 00-P@!LR@0 U0 ,2U0010/.01//00/00/00/00/00/ 0  /X. 0  /X. 00/00/X00/a00/00/j00/y 5005/.00/ 5005// 0  // 0  //X 0  //a/00/00/00/|00/ᄊ00/ጊ00/ᕊ00/ᢊ00/ᬊ00/ᶊ00/Ȋ00/Պ00/00/ߊ00/00/i100/00/00/2 00/ 00/(0 0- L|1㷊/  0-@PL@|!媊)1S 0 e/ 0-L/ -@`(PL0|At 冊/ -L⏍ -L⇍肏 -L 0-PL܏p@ ] 0 0-PLˏp@ Lވ0 -L MB K@%PcK 4 -Lp B "e ` -L50H/ 0-LM 0  K  -LA0// -L .C $-5L4c / -L  -LA0.. -L .' -L. $-5L4c . < -L a. < -L . < -Lwc. -Lmc.  -Loc/  -LcY.  -LcO.  -LcE. -L;d. -L1/ -L 'b.  -LA0%.(. -L a. -L . -L&.  0a- L(. 0-@0L@0. 0-@0L@T0. -LM K⋥ Kn6 K -LM K| Km6 K -LM Km Kd5 K -L0a Kh5 -LM KQ Kf5 K 0-@L@00 0-@L@00 0-@L@00 0-@L@/10 0-L@10 0-L@F10 0-L@00 0-L@0 0-L@B0 0-L@90 0-L@50 0-0L,!*Q/ $0-0L,!@1Q/ 0-0L,!Q/ 0-0L,!Q/ -L2 -L2 -L2 -L2Z -L -L -L$ -L  0-L 夋. -L2 -LqR -L -Lz -L4 -P@p1S0Ű!21( L "S` &0,10 $1Ux  U0a wRb dV80S  3/1S$KkL0ۉ( S0cp mꦌ4\ Z -LMQ@0000 ePP%PPP` p0 40 יP 40 H  zX` 0S0p1 `堏0 1@ QHpS100C1ġA10P:1P;0C40 40pP00Q0S1 10 Qp(00 0@1S1S 0 R! e `F(Ko臣Q010C?1 000 00S 0 0 009 0-(@L*P 孆0/ -hPL`)1S P4@ |A嗆0 W )/J -L@` P  0KhcS 0-L@Q9    X d p   54c K0h  AsP t03S lh d d` `\00S  0^8 0/.C///b.H/ 0-L@Q6 @ L X d  54c K0h   Ax P X03S ` TP L L D04 0...'... 0-L@Q:H! l! x! ! ! ! ! ! !  0$b K0h:    AҦP \03S  \X T TP PL00S  0(.&..a.%.C.B/b.H/Q Q Q$ /  c..a.Q" " " " " < <4 40 (  /./c..a.Q Q Q/   ..a.Q# # # # D D<0 0 0,00S  /.X.b.H/Q$ $ ,$ 8$ , $   //d..a. -L Kh -HLD@04S  | |// -HLD@04S  h| d|.. -HLD@04S  L| H|B/(. D-@LP ,b0  // D-@L⧥P ,bl0  .. D-@L⎥P ,bS0  %.C.00//00/00////00//00/00///00////00/00/00/00/00/00/00//00/00/00/ 0-@0L@0. 0-@0L@0.K 0S00/ -L b. -L/0H/ -L a. -L . -L . -L a. -L . -L wa. -L lb. -L5/0H/ -XPL`)qW @0@ |Ad0 $/J -``LP)qW H0@ |AH0 /J -@LPP 0S `70P /`1S0P $0P 0p Rv m/` 0-@LP0a P Б 0 0Qy0000A-`A\%X<0p " R\<0h%@DA 8& -L Kh 0- @LK0hQ 0- @LK0hR -L&'_ -@L`V`-`P`) why륤P Ԥ Hg㠃tP`@ AP` 0<("!0%S00P.|008& -L4M@0 0P40 T; R0AT 4011!0 S01  R401=>zP o,0S  R03/00S 03/0S!P 00PP <0 |0P80 <0 Rc`p:`80 ! 011S0`@R ` @0 < 啔@0Pp< ᚡ< P``P@0pU< PeUP<0S009 0CL R RڰDPCPE_ C B R@ R0 y8H 1  p00P( b( 8` p0C0CS0V`0Z `1Z80Zڑy80 0800 0@(%0 "P P *V`x CȀ  S CU(8P PEPE_P0 P ^y80 0 P@0_jP ,f΂1 0  t Q x70`/@ B0R3 4 X6 6 d6 4 !0 RPfr<P P P P PRP0!R0c !ġ1S 0C" !8C8R11$PUf_p^0 xP  奏5̅}|1P` 0YppSpW` 1T_ t5'0 " ڦb@ujr P0ՀxP) dP <P >P0S  400CPY$` Sx블H1S` !0C B/!?1P0EQP0 E/R 0U0@08!C8xP00S118zP`PxP@a@1S-020( (P"JP P- 3000+P4P PL3P ?P 0CP >PP 3P 0PqvP P1Q^ P ӎX1Sʰ1 ^ P ĎIP @00`B0R0 w 0SpW 0 03/p P ```^ P 喎 E `@00H10As0M40 R P j@00`40040 14 R40S 03/P PP  P(KqP uP APʬ0P0CU \000CPEqP &{ ϒ ~T0^1X0P 0P N0CPP.#' 9t00|00{ ' 'R 001/P.P0 R0//P. -%@L M$pa00 PU!4 >0P4 @(K40 40P0 P0QP#<~>P 00W0000 0 000岁<10, 00080040 0$0 0p(p1  @P. P0-L0D0 R00A1 0P a~< K0h蔢P. -L M⌒p0 $W0 ׀ p   t0(KP0 R  R *P r   1@@@``Q @ R R R P q R q      P R R P q q   T @ FR R@@І 4 ӆ4 RΆ*CP q e V! B R@2  @DqTd.VUUU ' @ -L,M@ oSQ0@ <0 p^<@T`>\ 60Y0 0S @0v ᥝ@n8 m0 r00P@0@40 0pD0 @00H0 2 0DSpDU404pE40\U00ӧ?0pU0 CR pC4 0ER 0800 FW 20 8,008 2 Bh2po P~ P7 + P[ P" PJ 0JSnt2000 h 0D0 0 EDH0 ܅H0P@D0 ( @P0D0 AP4 P1P1 0P1 X 0p00@0p00@X E@DअPE D0ST!D EPE@FuzHT@D0 Y @ P 4P@U@°,H0S 00@  B08]p0000<0S U@0 0 <0 (Ko=<0Y S d. \ 'c' -t@`PLp `tPoP0U 1;`PP P =`0000d. -LMP@p 0-pTp ,P@@K0 00㧘 0 0`` @{,Pu 0Ý@P d &d. p0-PL@\`0PPs Hp R :KP 0S@@A@R&d. 0-@L [00000d.0d.0d. --@LM00 :? |K --L M00 *? l K --LM  ` K 0-@LK0ht -L Kht -pP@`LM0 0 v> 0`0 0K -LM K -LM(< p8 `q@lWp0<00 K>00 !0pS_ 0S\ 00SX}Ppp00pTpP80s@DO@080 V\<!` XPRXJШȀ0 S80J0 0坉@PH800 0;X`0<00 z>00 000 0eT #ZY  Y {܎{{(KP 00R0S 0S 0PPP#P3P`V`ꎏ؉P 0 (뜠r`*`|| Y80 G00F00>`pW``p||d.t00 -LM,  K p-P@`LM0 0 r= 0`0 0Kp -LM K -pP@`LMv0 0 P= 0`0 0K -LM K --L M00 3=  K 0-@L4P50d. -L  0-LMKw@"`+yAa$+rPU Kr% P!`X00h@PU Kb%T @!PX00000S$$ZK0\...' -LCMP@:!0P01 K_KN  0-@LM (K1@,@ #P @  P |A0$*!P R)Q%K000KR00S 3/P 0$003/0(K$1)(Km(Km@P2(KP.pP*lPP&(K_@P" 0@啔 qV協,K n,0S 0] X&P (K1@P '(K)./U`t00|00 -@LM (Kk0,@ @|>rm#P) @d  OP00*!R00K$Q (K((Kp@P ,K !,0S 0^ x&P'(K(K./ -pLM 0 0Z#V*0S p 0B0 0 SS@@@P @ 0 S0 0p0@0 S:.P @` 0P00 Q %Si0S dSN %S%Q0@ 0S0 aRe cR0 K3/P (KiS sS 200 P 0 倐ಐ@Y, K @`  R R 10 R @ 0QR Kv0T K`\P0S  S 00@@Q|0 @$`R`R`V0R@ KEЀTh ,0K0S  0! S 0@S$SS0`@V:Q 0 炒 ' 0-LM@KIPU KL! w ͊:T00K0ll6P \e K4!L _ 嵊a8( 0$Y.!k{ -@QLPT<0<0`000S   0KhR.\. p-L M8A`PTzq  qx|xx|t fx|R|x0Su~0 APPxxFKRP [Z_w`w ᐒKp|00t' -LMpPVK" `͌2 0KV?KK!<p6 0(KaKVK腟E '0S  &P R G% &0S  t&pP `P ݉{p@T Pae%c% $G%(&nmY%aKVKx1B?a/Kx1 ilEP   S@P  S00fPpaP: P  L: :0S :m%P : v&003 0f(|3 zKј2,K"!0311`01   0K HrKzK?K0/K rK  1 $P,0SVP,0K"!!03 KK$ PM  XU $ jKqh2P jKzjK`Ș0S$P0 Kg$T2 <"QS $$1P  1 Q 5$/pK,Hf尞0堦S |V:, K4e0 w=C$ C<  @h0 0@>-K0 B0`0QIT!!|..6Fk P 0R//B -鿏L!MP@ `ߍP3S$2K p?K 0pK:00 0p@0p00IK0& K0P 0P/S/00 0 /S 0% K0H0a@?K0p0@ V$K -LBMp`xPኍPl@#d0RX@@ GK@0W<`G?K ((Kd/`. / 0-L@- K0h(. 0-LM K0!P @0@ 18 0/Q00 0 K`/X b.C . 00-LMK@! 0 P t t0tP p0E@k10` /S0000H`104 /S@0@$K0h `/b.(.C `/. -L#M#=KM0CCQtP#=K0C@P  Ƈ ‡K0K 8 Y8S@`0` `W@P L0 (0< 00 ~.`/a..d./ /B -LBMBX6S KP \8lPXT20S H~1\6S 8y1424"GKL(GK1`Pr 0G?K jg:4S / _\\PaV 0G?K Q:4!SO *00 0 BF|C||1PP) 0l 9`6X3H00S 8!8)0!0%0S    HSP\6S V HWK 0 Bꌩ.E K /|.X !.i  6.{ + . . Q{ . & :   0@-@T^$ 0RC# s@ T\ \@B0 PC_UQ @0#3000@010000@00000@ 00s0S 000\SQ P00Q 0 -LlMP`p 0S K0 KL03/P t0 @ Q (K1/P p0TK℀0K8/P 0 0TK3/* RP0//!01000/ 00#0// -L,MapPA@T ։ 8 P800 K ` 4K40S 0S00S(K -PML M`pp" *0JK$@D  X\5XX SS=S 0 \3R 0 (0  KTT  -LMPP0`0U"P(pP .E@Đ0 R ~* p(K K0L03/P Kt0儡0 0 K   |K0S P |Kw |Kw@ . -`L@n0P0S 0KhF -LM0`Q!p0 KL03/P< 0t@T 4/@K0p0 ψ K0ʈ 0K(0S KMw0 KHwT `KBw K>wK0SC0K, K EK.' \ tP P00 S 7S, R ,0S R : 8 80R:P#3/// -LM`p@,K ,P PP ,)P'P,TP0, xP@$U@@,)T (@K H20 @PK8 F u 00-SL@P0 0000K0h -L|MPp` Z(0Px0 )W)xU)(K@ 0S0 !X T 0S0\ KL03/P L0`@'Px0t p0  Y@00 0X1 00 0<000@@@@0$p` x0hKh0 d@ `@ Xd0S (P 0d  !`00 0S0 !Z T 0S0\ KL0 3/P L0 p0, @0p0 t0 0t0 @ꔒ P -LW P x0P 0@?oQ20S QPPVPQD !P 8040P/(/$//xB `w 0-@@Q0DPL@AP0 "QP0& 0-PL@P  寃 u0000+ -Lj & -La & -`LzMP@PN/E 0  0S1 0S@$KmoKP+ a<,P@1 11$11(11,1 1S, `KP& d0K0`0K# @0@N?@@T0@F0S B0SAT KwP |DKIP `@\` ݊ OKي0`<1K?}K @a 4 0 ,1 Pn (1[Sk0)#0C?o27 #2RR  0" R6p7 'S$KA0'S $`K`pF'Q``V0$`K0A(\`K C Q 0R$0K 00B,104!,00 001aK 0 0 ?`p0! ,104!,00 001`K0 0>`0l!w UJ` V}K R KO01K0aK0K1 0 00 00K Kp ` 0KP 0[SvoKN/KaK0!.K0A.K{K0,104!, 0 T0K0 0>0< ( R .QNEFX] ǐ'Q`i -@ML`p@@ 0K 2spK u$PP @@ 0K `"sp&H(<@P 7/P& y\ 0-LM  K0KP[ Kt 0-LM KK0 P K -LaMPb-K4M BQ@0C(ZnP> 0b-K 0`P3 P3 Y KV4@TDY K+4@sI K4@:I K+4@s`]P@``V_9aVY K+4@s+I K4@s,P )0 Q'4PUNS0$P 00S 3/p0p$QKI K4@~b=K0CImK4`Fb=K0C0 S (K\QQ00H3zP !> ,! 8PP 00S 3/pp003/NoQU $P 00S 3/pp $QU ` 0 `` I-Kx4 B;9/ 0 ``Y-Kx`4 B;6/b=K0C0 #b=K0S R< a K4@b=Ka K 4@s] K 4@a=K,0C 0Cb-K0] K 4@`Pq匁U%IKa K 4A4@s+PG  `yP?jWY K+4@rI K 4@N+*b=KY K4@PVޅP% مP ԅP υP ʅP ŅP Va K\ 4@ra K 4@r`b=K ,㧝P U(y /:P/x tP | 00 -LM@$q@P0 `APKP @> C 01/PP  @T003/003/$Qk -LNM4MJKWN K.p,@D@tI KQ4@9d7`_TGP0N-K( B0N-KIK, B(W4J0N=K,0C0S60S2:K,0CtCN?I-K4 B$"@6 0}10  A  " p, $(> ,0483 @ @7$q1W(1)qs(1N-K0 B00, $81> ,04 N$1%Sp4 0!0 NR0,W*,1#MK,A(pA p; 0M K$1,@0 @0 4;$;5P p>؀C D p$100$10M=K,0C 0C0M=K,0C(0C  090pK,Hp3M=K,0C0Clsp3SX-P $003/$q|0'V00S `TWm/0X##    N3IKL34L0B,NKA⼓0\>P S?X3?D0x3 L30 00  NK00000A0p  M=K,0C4C W t3S0Ct3mk`B "~2@(K0A N? t3RV0`0 V  ӣ? @P2pW0W0S }1S 0}1$1S!> ,! n6$N=K,0C0N-K0, B0N ڃN=K(0CPpq00 0 N=K00Cp S$1M=K,0C, CPlPB ?<@S> 0$10! A04!8<00S @a0N-K( B RQ   N-K( B 0!!N-K( B 1b b/$0 ,10141810 @0(1.|00'/..\. ] t&P/ 0- MLM9 0\%9 0p*@Q`5)QU5 BK0(% @ BK  @*P Y P` B.K B*'0K0$ @K$ A`(`P 4.KZ B;(Kl4p p0S`p0  @0 4`000V0SU, RR 000>K 0C0x.K; B89/P< 㑮K0 J  x0.K B;8K 0Ch` 2"VjP00P0)42YP0 U @&K A'`P 0Gd0S K!@%\0S K!@KKA@"`0S K!@KKA@X0 KS @>K0C  H @ML0@0S#"P 0S -p 04(04 0000xB.K; B8:/ P #%P !CK$pP 0  l `d$b$0 0n`0p84SW#p`0yb  B_:q      @yx m۶ Hy9 8.' /t  0-LM `2p \ K(,^0P @40 PP@xp0 ;87/P   PB.. ,00-L@"Q P0K0h. 0-(@L2S0  020. -L M0  PP@BN`P@   PP@|e#pP@㰠U(K;EC  40 FGP40 C?GP R000 $RR00S@  p@B>EP ': 0-@LM0$K5P Q P 0 kK -`JMLM p㳀I=K$0CC 㭀2JKP$@DU\bkI K,@Pp`CPX N? I=K,0CW  }P I=K,0C0.,1 0 f0P T2X"T PT2X"TN_UT2S0 0T"XpPZ J-K BJ=K01P 0101P00 0A00000P PPJJ=K0C"PF0S6 0S&X>$KQUPX 0 RUT2$!QQP0P 0 003/PT2X"S0 S(0S 0SXd(0S003/PT2X"SPP/< H& 0-SLP@` !a(0SQ 003/@QKh R 0 -L0MP`p@0SK0L K0L03/P $K`p@180/ -LM@`p0P @@p`.Kx B;9/P$K0 @@B.Kx@ B;4/P B>K.K0C Bco/ 0@o/b 0 11/.10/| 0-@8P0 `Lw11110. -L MP@p`АР0 (R!  !00  P 400)S0 0  )S P0*SR0B `p@P X 00,0` 00000(K.L 0-P@ML -K~1/KK00 0d0@00 0T0@@@81 0 0K0@0PK1K0 . -PL4Mp@` 0SptP `Ppp R00V0#S (K0L0\ K3/PP`0\ KL03/P, %K  DQ 0S  v0 0P  P %K $L04@H0H08p0`S,00T00@0T0<0X080\040`000d0p -L0 `)R  <@Q@*QRpB   !DAHAP0 \Kh17)Q     TLA^ @@.9t_ p-ML M`qP   oKpP@  BKↀPP!AK+ @UvlPPAK+\ @VhPAK+ @OhPAK @c PLQ}U@- D@0*SP@ )S 0   .   -`LMM@K c00@K @p W K@ pp! 08: >K 0C CK P8:S PKW#K^P AuP 0 a0CS0S(Kp'KH @% P U8U2 RPQ RlK✠ a0@L:  K@ pp %)=K0C>K 0C0P: s Y )=K0CK A + p0H: w H:SL: $t >K0Cn0t00 00S 0 P }C0PH: )=K0C )K+0A ,([R>KK0C A (O 0 R*,0K 09BUa0 (5h  d@edA ǐs 0-@LP[P K0h0 -LMh2 P!RT"PT!R4"\TP!R TAT(K BX!X!R݁`x!P U T!PAXP!  X!V% !0B 0 0B0 ƆP 0S .R  tK$ p Xq@W"PP w 0PX  0>g"Pr|TyP !T@g|@ * Rd P!rl XATq1P!@XA RP!0r,  f.x& . d U -LMpPAK L1\10 <  "R \!0 S 051DH<LHQ@wD` wV P1<`1 wV P1L`1 wV`1 P1wVP1PH0H  8$Kk(0(0\1\10 0.Tyqy_ Xygy -LM@KD P @oK -LM| 0S pP \0 T0T 0PP0L0< 080<( Kh K.y /.C `/ a.. 0-0L M(0 P0K000$ K(0K d"K@P$ %K0y X0-LX@4PQ]$NbK0hfꘫU --LM @K 夨 R (C0@.JK  0-LMK0!P L0L L@ D 0@8G@0  @K`/ b.C `/. -LM#=K M0CC\_P8  #=K0C@0exP _xoKU-B_ -LMM#KA_P KU 00-LMK0!0S@K0h0h h@P T0TP P0P0H H0D@0P0( (0,./ /c.. `/a.. 0-LM K0!P <0< 040400 00  K. c.`/a..0$ 0S/ /.0$ 0 S/ /.000 S$0 10 1/   .. 1-1L40@ Q !0 " !.0 10 1/. -LMM -K:z/KK0l0d 0 6 0 P 0008!K  0 "@KoK|& .H H0 (Q0/QQ Q 0.|& 0-$@L0S0000/ 0-LMhd@ EK%r EKP@P@00 0`1,^/hK00 . /? C -PL M@ 0P  K. --L M  K --L M0PP0 /@P P<  3K+L Y 6 --L M0PP0 @P 0<  3K+u  6  L <-L(P "P    0-L@>uP@ ?o00+ <0-L@vP 0 P0 0a... <0-L@vP 0 P0 0.`/. Q-ppP`1`#WLP@ `wP (B(Ay::VVPPqKhq|00. 0-LM@P @*yt 0 K0 ' 0-LMEOKDGK,PGK p gP0000U ($$0`2@K0 /.) -LML{HA pt(1Pm0`! eLJi<D0 00P00P0H0 0 00 00 0 00o`Pp4bE042&i`2d GKwX4 KpKKGKK* . / @ ? x&f 0 -LMPP !0@b`ruP  `P 0`bPh 1A PK01M@04P@T P qK.x& -L< KhC 0-LMK 0  K 0-LMK 0  K -LM0@0( (0K 0 00 0$ K0 K 0-P@@L0(S0Q  uP0@|& -L 0P`.d/ -L M@,Kgp`P쐟,0K (Kr(P'0 rPPP0P300 @,0K d]PP+0[PpySa0+0K,0[00+0K,0K$K} X. . /b. X -L,M@8 Cs$P3f`VPm $'fp`V50S` &sppGWY l1l!llq ,K !0 K0 !  080V A/oQ" S  R s4 0BPEP`B$e`0,K0!00K0!0 0  00V A/oQ" 8S # 2R `F <0 o<0`Ar4@p$ e`(K y -Lp`sPP@T j a@P 7/$Kk11@ -L M$eAP`pP$K0$K0!(0K0 @` o( V0B?oR20XP$ le --L M0 0 KG --L M0 0 KG |0-d#LR dd#%\0X!T0PL0HD0@<0840. /  /% /( /2  / / P0-L@ D 0K0h'o. -@LM KA A "v0 1 0K!#! @@u/K{KW_mK<@P1: S uK;nP An =nKG_K,u yKuA A `Pڬq  V``?  |1|!||~pxyK1Sg P1 0yK1 ATT OoBS|P@00S lo t`  R 0 00000 00jpP@ k}Kf1C!.`/a..T./ y  ./d. -LEMR0@S0 ` Hp4 0p!KKsQ0pS.KKP1 V! 000701S 0SX"X2 0K/K@.4Y+ V ! 00 0K/K3/P (KV 000 @ K/K R h R K/KX L V     `/b. /@ h t H/ . 0-LMPQ@0 S S 80 000XK0+S   U -LWM$p p! .4Q ҳ t#ß0(SgP3S0̃`1 @(Tj3  Q0P0iWxS@ A@ hjPX|P D_<\4Y@1 WW_KDP>KP,KQP P 7KWppW T*pi^ 0 10S 0S3 0 1S/a0h1 0l1 `1SO 2\Lm 00 _0!K 0t1 `!t1R R@ 10 1000PXR 0*S R@B  0 P )S  (SPR (K@ 1Ph!d0`  l!PE  0000000 v$ . /&.|& + b U  + t00|00 `/ -Pl`lpL@TUNU P  ^P`&t -PLMMJK,@DpXPPFL DРP P6P b 9P(K, DⶠP$ D⮠P!APk L`P APZ,Ph;- Y.\ɟoAK  PkPA=K00=SP  W P--U  PP KPPf PP\  3PP HP,xL t&F ^ !{#% 00-4 LP@r0 PK0h -LHM0@ RK`p0eKSeKP 0S0L KL03/P <0$K%K$K%KPT K\K3/P %KR0 0 %K1/ 0-@L P|rP  K0h 0-@L o(mK0hi -P@L0S 0 R!Y$KkUp` 0P 0hp00W20#00SR Q0p 0h Php`  P 4pW000S 3/ Q0p 04 P4 -L M0%pP K@`僾p `p  (0K ሻ`V(x0 t@(T  `jL(fP <bP @9HWc}D v -@LMMpA.K`@; B(pP  @pq`q`K -@LP qpP` P  0R P||d zd@ -@LMMA.Kp@; B`(pP 0 @S`Vq`K edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/ 0-@Lp PHj000/00/ 0-@L8#8S#0Q400080,08 S0040803/P,000403/,, H0 , 4 T 8 X !Q  0\ SR:00400SS QU Q408  0y40S80S001/S S S S0/000 ,00-S1SL@S00 800400803/P,000403/,, H0 , 4 T 8 X 00CS$ 1 0408 080y -L M14pP37W00@`㬡嬁00 Q 1SQ " Y(K  0SQ'W 88SSSQ R S,0S p 0 #00 0000S `S00S H P00P0 S 0 F`03/PP0 LRR00<R0S 01B   |  d- XC J 000/ -L@P; p`쐟쀟`Vp00`l00 00 000 0 00 0 0KB`P <8 R$KHz   ` -LCM@P 00CU#*0L0 K3/PP /K oKC?K0ܠ1 0X*0 KL03/Pj /Kg dKAKE?K R0A?KC?K P000 S V0E/K00V 00SA Q0@ apCK `0|a@0  1 1`0 PKPAK 0eapEK0 `^a@H P@`|K|0K K (K.. -LK 0C ! 0!0< R 0  0 3/ 0@` S$ 0' 4' K @ =K0CX4 a@04 4'004 04cd ,KY=K,@K 0C4$4P4 P704   P`U Q vPX@ RvK.K Bl@SoK.K BeUTp% B>K 0C0@0 MKd6@ pv$ O.K BP , K-B D % 5 5OK A 0M^JK  @T 0S  MK4 @0 0=K0C050F0 4S vKJKA @_PD 4[S[$`Q00Q0S 0ENK @DL0 aA 3/P @M>K 0CKK LL 1/KK A؀AYX` $?P4F##$0 0 ]0F1"M>K 0C@404 N>KMK 0C A P0N>K 0CM>K 0C  P0R 05%MK0@@K 0C4 =K0C4 2K.K0 B4 D O@KBK+A @KBK+ @Kp W`*U 0 (MKT B>K 0C0 0MK0 MK44 4$Q030#Q0S 4A4 MK A  K@np K>K 0CCMKN>K 0C A 0 0@P3/K K0@ A@M>K 0C0P0T@MK A R0&N>K 0CM>K 0C R0MKN>K 0C A MKO>K 0C A " M>K 0C(K 0MK A .   .% #8 < 45 ( -@!Lb0 !P 0 0 X0" -LMaA|-KK1/ MK@TP 0-K5`V-K R0-K@ 0\ @P0z\ @TP KQP  0n\ K KP0 0 ˱.KR 0K.K/K.K tK$ 0` S 0$j0$K0K0 t0K0 4M00 4 K+ @`T N+ K"@O% KTPK 0 DKٍr@om4 00 0K   K@ ! 0 /K #qT. 0S+ 0 Kⴍ0 01@K0F0@ Y0P >]P7(KK8K0 K⎍00 0S 0[S[ `Q00Q0S 0\ KL0aA 3/Pc %KR 0P K+K-K.KVKp= 0+K-KR0-K.K-KL0 03/KKUT`N@-K@P1`.K R 0R0.K 0T0NK K P0 P`pT@P.KR0J80 0@P3/ 0@KK K1+KQP-KR0 I@B K.KR0 Ԁ?AK 0 2"0  0 ;[ #F  ?0[1F1"Pt T0 0  T0 1.#  .5 8 <  -LDM0@L K0L03/PLK" ! $KPP0`p 00!R R0`pbKШ p-@LMM MA.K`@; BpPPNK @_NK  @NWN.K B @4oKp{dЀ 0-@PL H\\P <W\P ,R\o00UH? 0-L8MD0 0@PK,0%@0 p`@@0< KDKHPK<K+\PVJ0@0 0H0 0 K00"0DKGPL@o -ML M\1X PQ LQ0`P *1SH$A T )1S  K Q 0 1/P@PE>K0CC 0S%0E.KL0 B3/P @4pW<lP  0 p B.Kxp B;7/P BKX@rP/. -L 0P8. -LM0 /PR KP/R0 R/R  E0 C . 0-@LK0h 0-@L K0hH -LMpPPN^P@P  N`0S  6NU $  ㎽$ KT PLP  0n^PK\.Y .c {' 0-L@ 0K0hj 0-L@P0K0h -LM@ KU~ EKUE?K/K Kx 0-LMP@k KUe EKUKpTPE?K/K]K0 0-@LJK0h| -L MpPQY`@P P  BV0! 47PP Q K0$D  . 0-D@L4S0PU0$ PP04T0. -pxPLDT`` |ZPp@0 0`P$0R04 . -\@L4pS`Kh4P 4 0/U +U T. -@L4S0tp4TU TU T`040 0 4. 0-L@P0 K0hSt 0-L@P@ o0    -Lo -Lo -Lo 0/. 0-@ML 0K@@tEP0K @@LEH&AP08@4AP 00K0hW{ . -L Kh -LMA0J?PU;`$qW 0 P K p`> C  01/P $P0Ό LP0L0$0 R 0S P P 0$003/0$Q/$ 0-LpQ4͵"T R0/ p-L M(@T@Kp(}0`y0 0A003/@Pл㝵/ -LtM`P@@) 1L0CPA0!K,Pe(P PK?000PvQ ZRnQ 0 0 & F 0  000 EK b@;᯵.0& /..# /.  [ \. +| -t00|00\a >` -LM`$M@P qQ-@T  (-wP( 0 (KP (0 H(@ DPPo KX\\% T p04 (K !\.   n 1 Z  h//C-M C` 0`pa^Ѝ@T@T, R* @p`@PЀV ЁXЀT ЁX@@UT@P@` @T@D @B`p@PB 00!/$ / -L ipV   R@C, / -L M`X0@Spg0 P\0S0 h `0S|0l i d0Sh0T j h0ST0< k  S &0 K\ l|$ t    -LDM\K&K`PP(K@P >TX0th0 &5#P0\ 0P`P(h1!0P0 0PLP H0`d0h0|0\ 0X &K! `$P`PX0 (04H000 0䀄0 00;| -LCKBM M A x@P 0pn B.Kp; B pP0 tQP(K P 0 0KA xC>K 0C !=K0C "! 0X00p; S PiPe +RQ0 RP \Q SP00S RD S ? S S( R0000000 0C>K0B>K 0C0C00P 0S  v?:, < yL4$<Q0 ! "CK L R0 0C>K 0C R0"piedA 0-L0MP@0S>C"R0K0 0R* 0! 0!$K \P 0+R0#*S Q 0S, / 00- LRP@o0 C!U00!S @0<00R0( U40 0.$ /( / 0-LP@P0000 -LM1P0pS`7@ 0QSPPT SM r#K0TȐ0 #K  ^0 0"400(Q $FP,0QX3  T vQ K0  0S P S h0h dM0KSY 0 0S3(K 0WP!:@ . p}$ -pL0PS`p@;S S@* +@" Q pBPT.@T&RQ0000!(Q $OQ 0S T v,K 0@1 00 0TRT Y 僲p0\"1, /y -L\MP $K %K0 `0 0`T0 0Pd0 0!$K! 0<K @PP0S (K#K$K 0$KX0V V >`C V0 0 FN1,&K0R`pK#K P0#KK%KR0K%K$KcK$KV0eK$K%K 0KdK`pReK`RpdKᠡ0SU + RtRI*`0 PA\Z7Z/QP\0 0D0`0W(Q $ OT0S& Q# J vaJ d0 Ơ 1 $KP0dK`PpbdZQZ P0SY 4寱P0TL"M, /y 0-@TL0PS T P# ,0! D0R 050#5403$0(020.$ /( / <00-0LS@lDP0ЕK0h.{ -L M@ p0PSU T P#0 P `SW 04T(0(K0P 4p0 p P00  0Q0\  @  pH/ `0@8 0'p(0,0`(0.( /$ / q? P1-0LSPp@` 0QPP: S30 TQ r0 0 !Rv?000 RV ^( $0X3,0000 QP0 00 0WP!:` .O -L M@ K00S T 寰K8r -ML M0@X4 X0S2"K\0S2" `0S2"b d0S2" h0S2" EKJH IT4[S 808`S X4lŸ C0XBQSS80S @0 K SRPPIPJ BK @ֻBK @`P2 B.K B \0d 0`0 00h X p;S"| X4h!0B>K 0C\WPBK @_oR(K0:R 00  `4 \$ \$a  `4  00C  ;0CSxx|Pp\ }$ t     '6G !Y h    6      -LM#K0p@T(KP`ȐȠ@D0S UK0 0  01/X S  `  R 0 0`0Q#K 0P1/P R4 /| -LPp@`0SP8p0 S7/P 0403/0S0D03/0S0403/ -L(@P`p1S 3/P @`VTt0@d0P0SP000S@000S00000$Kkf}0 /4 /| -@<`Tɬ0pK@!0040忬p0K !+pP0 R L7 PH7{(K 0`!埬0i K  K 47NT0 0D-`  Y@ NT R p ..  .@ G .Y R# -@0L\0P3/ `pV@@P@]P10BV . \ W  0  !   0 00$ 0        C|  0SJCT h0h hh$G0DTV0@.oȟ  s ^ }y ` p-L M`,P@] K 01Kp. p-L,M0P0,03/`0@ S:000 00 0 0  0.p` 0A0w%Kp 0ꀢ -LAM@0K p0 OP(K  P P0R 0 K0< hKK l@ Z&0H03/40Sb 0/KP @ 0 X0 AK0 0 STj 0 S0010 40 jpP0@" S"424" 2G0C 0 0 000 0A 0 0 0奨lK@ ~@40S 00 KL0 3/P K,K`poK40 S 0/K0 q0 KL03/0 儠K0K:/P8 0!/K!)K R 0  0K3/P& -K)K0 0K3/ 0 p 0 KL03/ K)K`pAK`p 0F 1,(/K000 000 V x  -LEM pQ<0PE 0@(  R R KoK`d 089/0 0(0 0``  08pp07/h0 83/(K -LDM@8qDK! $KK0D KL03/P p-L4M`8qTK l0|%K1/@%K R0@P!T0AƱ Kp0T KL03/P 0-PL@M%K 0@p`%K 0S%U U00X ?I U00SAW0/ 0S T K\K3/P700P 0&0L KL03/P < 800S %KR0P $K%K$K%K`UP0 04VK00S 3/ Q0-@L@P 0A0003/P@,ɩ  K0h t -L,Mⷩ@p㳩$`K@&PP U  00 (  p@@0 5 K  -LM@D PhKI0`l` 00 @PZ  @0H03/1`0p>ЀX000 dK40 Il00403/ 0P l<!0` R 0  0|K3/P: 'K&K'K%K0 000000 060 0 00ウp`lKUɦw,0[S l K0dK03/pRll0 0S001$Kp&/.l Ċ -L M0@80 q  K003/P-0A0@0K -LGM@P, 0@0003/`P$0I_KS$aK bAp0 pPP00$1[S 0JK0@03/P(`` K -L|M@pD hKH0@00 0$``l@ 4 PP3 P pA0h$ 0 S *PP 0X*0d KL03/1 010100 060 0 00㾥p@&\0lK⎢,0[S l4 0Q*0d K@p0K4/Pp+[P l2l0 0S001 Kp&К &l Ċ -LlM@00t 3/0H03/2`0p>ЀX0Zt 0! 0 ` 0lK3/P^ HKWH&K%K&K%K 0L0 0 40R! L 3/0H \K0 3/pB 0\ KL03/PP; 0 R8  %K1/1H&KP%K0< 80@3/H 0 0\K3/p P00p0 t0U 0㕮.\K 0!%K` lK p03/P P(KP/ -LM5P0S J?0S_U 0Sp5p%ppB`VR `%@T! xKg?D@ 085005@0(5@ 0F00000x 0q0ὤp`p[0 W T Q` 㤔pK $0㜀K`.!0`'00 00 000e0 p$坧0$10&0 $10 0Kx0 0t0 0| @ lKp0 mG00S< l0K PÁ ,|3 000000 000 0 0lK0@Cp` 3,3xK,0ኤp0S= S@: SN@`$ KK3/P 0l0 06K2 `0 \0K0l KL03/P &K0 \0X0S 00CS@` 0ST D @P02Q $(K@P00S^ 3/@@OoBS :0&00%01,K0@!R!@!0d0 `0 @P) h 塠h0S`0X*@P* PQ 0!@d  0T:d0S@ h@OoB@`0dT:@@/ } ..x R08, < 0 /L s+ \. > -L[Md! S8! $ TT @``! 0P@1  pP@Q`(K0PP1 zE@CPa4D!0T1S 0RO d1SE(1SY!SK 0W ,1H4WKXL!!X SK P0G   X#H1L L!M_K4;$嬥 婥 0PKK,KK PU @!@1R"2 P1@ 0S 3/PD10D1 h1D!0STP0$0c81 v h2Rt hQ @D X`N h[e,H!L0# M_KA`,a (Q QK/KH` AP AL AL10 00D1 ! PU A   L! J tAL!AiAD1P1:1!@P0 000000 0000 0@bp NK981S`#P!5Aa7ZUX PN@LPJy ᖢC@aj0 /4 /n \ m' } -P/0LKMMKKp@ I0ITK4`P+X=P 0S p0|"%!l/2ZP TP  I+8= P:BE?00@T* P/R 00P2E@jPIZ0P.$* R"X!E>00B~K pG!4 P,0K44@,4[/Spp0 +< RP]K PEBK+ @< P*5!P 0/SP,4[_oPRS @pBK @@0%00 PU+x. P*BK+ A. P*PD@D@X(KE C  U -LMK@P  n@P Ka P {y0#((R (c(#"c 8 #8SK  -LM8 `PIpPP X`P㰐ONP>(K0S @ xL<P08  0K{qpL0P XP@00  0C  T): -LM$ `PKAP'KAPK+@<KK A@R@PP.K0 BᱬP.K B Kx@7KK A@+PPKL@pK+@;K,@g.K0 B㌬K@]K+@;K@T.K0 ByK@J q@PK@@ g@PXK+@;KP@/.K0 B T@PxEK+@;K@ K@"`K@ 9@P]*K+@;K@pᤁ夑1BK0>K0C @VBK@P B.K0 B(@ TU <$KKK A@PP9K@K+@R;KK A@@P K@.K0 BtPK+@9;.K B۫P 3u>K0Cd hӫP1 I R ] c m y J     (    &C X   M  /00/00/00/ p-L4MA?(0X) 0i>@`K` T0T0H` D0 065KH KB@P : Kp.#.. -LM1@1c20 00 p!00  000h 80sQ0`P0  )K0壯 KpU K55 0>x%t500h%\Kr00 0UH5 "85l`K00 0\0K00`0 /モU xKᬶ4Kx0ZX @Q%ZRQdPRP,KPP! |0S K0803/PP (K0800Sp09&80s $(K 0X:8P0\ KL0 3/P %KKQP TP\E_oRo)K0Ut3v0x0 P0%Jo0㪢0K0H03/U KԇKYX  0#)K R0)K i=0<,!(K000 000000[S 0 0  R0 0pP^00000(K0)K(K(KP000 0SK00 a0  R0 0!Z p0 Y1K0t0 1pP 0,!<1tK(0K\K>P9 R 000 0S) <>P$D0R'0Rp080s SR  R0 ! 0!p0 b"0000K(KR0M(Kp` t0 s>P00 0  #&000p K".\ . '/ U -LMQPz0Swp@@0 0K0 P K ` K" <"K0 `T0 S!V0`vp`p"&|K``,0SPcT`K0D"(` !"Y`$"&|K0K01 0Y<!00( XTڴTpK0!(p `0@00+0@080s=0 0 x | K\V |X(KpW pP``p  0!T`K(} 0 h0oT`K 0 40 0t0S 8q 3/ 0S00XT儴 00P0 hpT`K0T (N` H؟ K` .} e  ǐ    p-@LM`("P0pQ-6 *㳟`+㰟0 PlK@ )㣟l K|,㜟0 0F00K-㒟0 0KKp #.0P8 r@0T*U +wP lK 8: .ǐ~ . -L4M@  "(?(0 p`\Q\1T1  200400<1041@P 0,1,00000 1800b"`Vp 0S0p\) 0!,P(EAo(E@ K'0p `BP00T KL03/P D0$K`p0`Vp0$ ~   -L MP`pp 0W,Xcp 0#!0 EpP[ 0 p@00 .?Q R  c7 00 8, 4 $0T0 0X08@G#@,0S2S P Q 4 00 b<P004 "8qT0 PS840 0S 0S0P00P0X00 00 (Kp -LMp2x`K0@$PpnPP0(" S{22plK0p 040 ]? 01p00 0A000 00ppp圛lK@ u@40SV(PO p (01噒!0PD 4 0P  b "0 " 4 0B" f> b>p 8p0 Ph lpᄾ0 04040?o21000(K 0}lKHk/   -L4M@ᤑ夡0@pKS0 00 00.p 5@0[S(K/S  ?K"/0@0K`p0PU0(P p`0c!P 0% (! = =0`40 0T ,0X0 8`0100"H0 2;PH0 ,PKp%0s jP`.Kz -P`LlM&K4 =Ё&KX0P&K R 0"&K 0'K! 'KR0'K P0 0"p<P9w(K*.p60(QP0pQ ",^T ^ 08 p0@㌘匈l0 0 h0 |0 pW(0S@b@pp0  ,4PP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S0 p,0P 0 0 p,0S 0R @S  r:P|@   l:P R0h00h0 l00l0 T0S0T0T0S0X0@( 0S0\ KL03/P H00S @0SS0p0\ K0(L0\ K3/P L0H00S K&KP0 %K'KR 00\ Ki@ 0Rp@H03/|0p@|0KW80s !؁'KP0'K 0!0\  BR60 S0!R'K0#Ԁ'KR 0h0W&KK R0(K&KX܈K *8'K p0h d0` ,,d 吂 Ђ" R 0|0W 0 hWph 0PpXKWp0 ?U00S$ KԇKpp0PP p (K&K 7ԈK`0d 2"d,0KR'K 0X'K|0U(~&K R0'K&Kစၕ᠚K 7`0d 2"d0吃K  0R'KX0    0 'K R 0'KP!R'K05 (KK$'KR0 0( 'K 0KP0!0h SXl SogKKp00PP PK0000000000 $ P0ph080s   'K 4lWEpl呠 >|0h UU 8 r   0ԇKXKP/|fK`Vp'KKP&K%7'K p0h d0` ,,d bp`'K h0W|0W08 r 0 P 0T/@~/U . -PLMp -KPU pPp@E00P0 T> (K00$h R 0  80s0PEPW p 3h0S 00  80s`V p@p 3h0l`0\ K0L03/%K `h00V:p@pp0Y:P@TPJ@pP0 0T=:`" R0P@ 0ppAX[pPP p @Y) 80⨐p0YXp0 XW `Xk:@pW00 T0#S} pP"080\ K0L03/P %K0p`\ 8xP SR$08@H0@T/m۶ O   0 80spp ` 8| 4 V0   R \*p \ 0 ]0080s0\ KL03/P 0840L0H0%K H00,0%K$@0T0<0X0p@r 0 80sV p 20`@j p-L,M@P50(0S(`,`m0P00 0F0 @ PP`0(PP,((PKp000,a(,`(P0|00 .R -LMا )1$AS TP T(!0 "PPP(K0 @0> C 0 1/@P0$A Q 0 > 1/P@P` 0U:@1S<1@1 @0> C @6PU` ,v!p0#K;&0K5p&0K/0V$p%p=090K 00K00K   00p)0%0K 00K0p0K  0&剖00 0K0 00 0 @ lK0 ]6V0l0 0 6KP5l0K`0 \0K @%` 0 (%P  (P  %,  4lK 000000 000 000,p` 4K,0s`V2 0FSL(> *KP A*K 00S KK3/VRjKԊK0<!YX803/ 0lK6 0lKd@`0hQJPp3V`@PHP0l KL03/P \0X0S 0S`PV003/PQ  01/ 0S 2"Y0V*KjK  0lKlKaPPlK1lK Hp0  Dd0 h^60^< lKPPn㔕`, R0 2P0 Pp@H0l 0H00 KL083/P 0l 0d0 0@ K084/d00DH pDP 0,QQTQdT V``XQ 0p p@l0 KL083/P 0l0d0 0P K085/d00P  P h00d00`00\0 0P} 0lKd0 `0 /.p408$ @ 0 /P 0 s+ UO  .-L4   --L4 0 ,$! (! ,!P 0! 0-@P`L4M#ߍ@0S $T K0dL03/P #dK 0 `#8PXV` K R00S 0 // -L MpW`@ 8 0 呣, 40P002 |4 r pP0S(KQ,  R) 0 #0S Q000 0 02 X480T 0 哢"0 4 00000S p  p3$0!0R!/S01/.!0 /. $10-SL@ x1SP $003/K0hx1P$1 0S -@0pPLiK,`FGMM{FD7J0S  0{CGK L@03 G?`AB  CuEFG -LMPW`@X GK)V(Px0D`qK1K @0S GK GK8`V@5G?K P- 0_K(0St GK⒳@,0SL GK∳@<00S, GK~@\ 2x 3u5 6 -LM0P@1KQ*`l GK|) GKq0`N 0S (0S GKt GKp,`VG/K0KƐ GKX) GK]p0`N 0S (0S GKP GKL,`VP妐$0 P坐 0Pt嘐0P㓐0PP厐0P@剐0P0儐 0 \ t     -̦@ PqMLM0G P 000x R0 00'P0pTT,vK,sK8`  0@0S D` Pす ` {Ps%K%KpW00(0S rK% @♲rKbK% A @00,0S rK|% @≲rKbKX% A @0000S rK@% @yrKbK% A @0/K 0b.K0 B3P+ tx``!R00,6K<0rKSn0y0$ @OrKbK A @u0rK00=,0d$Sn0y0 @<rKbK A @b00$00;8rKQ40 @ $(rKbK A @N0rK00=<0#Sn0y0 @rKbK A @;;0 0 R rK# @rKbK A @( m`0 R rK@# @rKbK A @x !#0= 0S rK" @ݱrKbK A @x`0`00=$0SrK" @ȱrKbK A @0``m(0S rKd" @ⶱrKbK A @x !#0=00S rK" @⣱rKbK A @x`0`00=40SrK! @⎱rKbK A @0``m80S rK! @|rKbK A @x rK!#0;! @K#LB_K0e/K0 _?K20S 2ZKT1 0P1 2@L1 0H1 0e/K0Z?KD1 U?K10S K0e/K0 =KapB0 -t!@"l!0  z-1P!0 SD!0C 1š(K0 1 g- " 8 $ 040m0K/KL03/P 1S !_R0k 1 C- " 8  `@p040pSP/.  /(/C . 3 /$,/ /L@ L& 0-x L@-+0 @0p0.d K0h= P 0-L@-000(0,0000d K0h%ꐯ -LJM|A`0Psh!  0 ډ1SC8P $娆K@0P 0PP@0 Ս(PoU@@TGoK0 Ʈ0 00`P軍`P`,P4p0P,pPpD&s7u9: -LPM0a@0 $0@sP!  0 (m$1 SQ 0L\@(1@$4K 1 @K *@0S$0!`PoU@@Th|0 00 P0PP 3 0/S  GKQ#G?K!)&@@ 0/S  K1?o21QU|1N0,!@<1(0@`1?o21P 1?o2 1 1S 1SIOaoTPPUGK0 0 00pڋ^P^ 1S 1SJOl` 1S 1SKOL` 1S 1SNo #G /%u&' 00-SL@@0S000 @0S0h/ 00-SL@ 0S > R0000 !0S0H/ -Pp`L]MԂQ 2P2@D] U(K0W/KL0 3/P1 L1.DZ+ 0S( ]K]K&,0KI1P/S 4]KL0]K0 01 1SwV p`  ]K& &1S1 0 p`1 $ 0 SAT2wV 1S x1S $! WA7% 0KK0D! @41@,!Q^K⡚1S  0Q ^/K㶒& E 㭒00!15:% ᡒP n Q 0, ($!` ^/K⎒P\ 00 8q4a101Rd/P/UC     -L0M@PT4`p!PP 0T KL0T3/P KP000T0SX0`pS@, XT $0S("!!!$"$"b@ @0S00$K@D&7!0"/ ' -SLM@pP 0#00KSpKE`P q/KXX&T3P /K8/K0f $ 000 ]Z,0 0" P0S, XZ)00KK42 řPP Tq 0 x0K/K0 C"T0S `㋏K,cK |.t0p⇞ 0S K: K6`,pYV KoK$ 0c 4 分/K0`0" /Ko@v 0  K0Sa  KK `pV a 0  KKN1 PS DR 0  0N 0S; @0S@? r0<0!04000KK⤨@0oK$ 0DL03/00 R,K,K,K0S 0p!K⊨8qD` 0S KK KK8` V0 + `x0 SX c V0OK  `_ 0@ KK/K3@ 0  j R0t 0KKF     obٝ \  )t ( w0 1 -L4MLPKbp@Ɩ X 2 P0 夅!X ZP0 Y / 080001P111@ Pp勅0 @Pe@ (K Pp}1PeS` 1S !N }!!ܧ @p@ddP0  Pp\1PeS` U01S  1SJD!0ḧ @p@d( 1S 1S$1!ᨧ @p@d 1S 1S(1 ᘧ @p@d" 1S 1S,1 ሧ @p@dt 1S 1S01H x @p@d8.ob` .#tu!" $1-SL@P` Px1S x18xA Px 0-@LPMP( @K%$1L H0 00 @0@00 00L0K0(00 0LP D@ K0@h/ ?  -LM08 S $0 0 0 Kh/?@  0-LMA1 AdA 400CSPU 1S ބ٬P; 01l1Ph1P  X幧4 0 BR 4444854D5x5~ 0  00 0 0 0  00 0 0K0 0  00 0 00 00| 00000d00`0./\.: / T$!H/ 0/,/D0 /@  -@P`LML pKtP J$P wPP1 00 BP P< "0 4 P 0!KI KqH0Q K |QPP(`hq000C R  R41$0 000"xP0t K88/0!0 00Pt0KKm V "PPP000AC, \ \ 0!̓P^ X^ ,0 SL $0PK K">S/N d/_ '/[ -L4M`$pP@ QP@0\ KL03/P L0 @P$ 0S(K 0SK010.\ @\D\W @  @H0S0,0Ԑ @PT R,P PTZW0P0 0R> S|08P0p @^ B @YdYW0@0 R<0S@//C(/ d00-\0L0P H@P00QSP0!RQ./P/ -L0MP$@0L KL03/P T0 ƒQ  RK dKƒQQP  RR$K  08 /0@-<^`@WV 0S8 / -LC{0,0K$8{000| 0-L8MLKPop0@P08 @\ D0D@0L08Kd0 p00K00S. 0-L8MPLK@GP0, P\H00P0L08KT0000X0 F0S0000000 0K000S. -L0M@$P0`L0L Kp3/P $1 0803/P8  $0` 0,P @L K04/K/ 0-PLxM|@8 K 0K$< PK KPKSKỷKF0$勺P 0|! oK0/_ -L0M40@S`Pc0 00<KⳢP 003/00$1V Vt  KS0 000 0xp< K7/( <0K$X h %&y / 0p-L4MPQ@<0K$ 0x`0< K6/< K87`Px1Px1a1S0C€1Kp 0-@LP 4mP  P00S@}0 ZP P00S 4! B! EP  P00S l5P R 0 Hވ 8وP 00  '   -oML M C  01/P 0$0>@CP C/ 40-SL 0 VO R  -pP@ᜐ圠LX0b2 S40S00 00 S40S0|1 @8 S$100S00 0VUO 0-L8M@8 LKoT P $Q/$00SU LK⍫ LK˸LK 00 |10K0UP ካP P. -LM`8 \K7VP KGP $A003/0 R   01/PP 003/@P$Q0H03/0 pPK X^ X XU0 803/P  0<0S KK3/ 0!!!5# p P0 K3/P,K+K,K+K0K0 3/p 0 KL03/\K \K7\KOpP 0SXp@ 0 |10y0 N0 KL03/P 0 x0RuPp0 KL03/P 0 x0R (K KQP  x00p 0SxP.O   -LM`R@p PP \q_K, K4"DfP`(KP(  p`0S @<08 (00,0 000040!04 04$0D0(0`P oW `h |`x`h20  XVh L h @h 4h (g ᚪp ᔪp + K \p 42`#f0`9`a8SiPb 0  *0*0P0w   0* *d@edA !zd@4 -PLCM M`B.KpP; Bp@P E>K P0C0PǨULT!P0#  K / -LK0C @0@WKA VKA Xe tP@ 0PK A ,UKhU 8 KpPL%H 000 0SRK @PN=K 0C VK 0A d5<0L50@0L51800S UT 0@% 000T0S!@PU =K 0CU 0Ph5 ,5[S RK  @RK  @}RK @PV>K0C  X0WKA }RK| @P=K 0C  0UKh5Sm RK < @@PR>K 0CR^K P PE@P DU>K0C R0& .` D2P=K 0C #00l5Spp&W CP``PPX5SX50@@ 0XE 0 0.0\0婲 0!U>K0C !W>K0C " 000B.KD0; B @P0`VS.K B  #x{0000. p #`Pz #QPu#QPp⃃0 %SDD P #p{P[4@5 Y @ 00 0p{P HY#p\z{P >  5 #P1 P* 0(& D0S 5K D }#\  `G{@0S 0 0#@L000@. ` .{d@  ! j : v \ \ -Lɛ 0P 0 / / -L(M0$00 0 00 00 00 00 0 00000000 +$ Kq% 0-LM@P0K0!  0K0a  0K0a 00 0 0 0P S K0 -@L$MK 3[ >K3K 3[3K040K 030K 0  0S0sS@04)  H0 PH0  p0lS@h噤( P  p m(K@T@T -LDMpP<@K 0S  o (K-0K 0.0K0/0K000K010K020K 030K040K060K0 80K  P40[ R 0S P0L哥&@0 P@0:PU% p-LDM`P 8@ ] @\K@ \K6/TKpG-0(pSGg*PBQ] Q^rq`h,`QN sO`@SH@`#`3S`#V; . DQ>*t> 0DbV3 B^: ^QUQ3qrⰠ ,Z& QQ!sOⲐ@S#3 S#^ IQ*0S*A\!^PU\  S*A\!Xb0Ѝ0 SR00R0S 0 $ 0( 0 ,04 8<R#3///A-!@RP40B 01S+ \Q  SR( 00 01 SR Br_s? 0Q(`p qO@PH 0`pB0T0 0  T0"\Q0D , P 0 S0//P P P P/ @P/PP*P/P P// -LMp@0  !R Q oό4  p4/ KR\8" 0SPU"R P  `aV U VX Q0oό 0p0P"/ /0 0  -LM0 0 0 0K KL0@-O@@ TC "@PAL@@@@@?@@D@ P@D P H 0$b 0#b 0R00@?A @ P @ @ @DPH A0 -P`@L,M @KZD0K DP ,@ >PT`0 K#KQP0P cK`1/T 00 7! -`L\Mx0 >0p t `0 <0K0L0K0P0KT K`lP`#KL@R_CK40K0@0K0H KD0K`ZPCK@Pp T?%KX\#K?!\D8 <0A. R0H&K T0_d0 %# J0PdXd \?!\d,T0 0hlQ[ K0PVuW d  r" ?{ T1 0@>`C0R\ `p ?h 0 e ?$(0@SR`<0K0L0K0T KP0K`PT0SP #,\ 01" 0L0#KQP@TL0p Y0t0Px0XYVE(K// -L M#KcK4( p40,0 \ Y@ \T PR@PHR@PUT ^ Q0 \S40,K000( K40P($K -LLM`܀V4 0 PP T !dK`pdKpBT@R00p XX0 0&K0T000T W0#02SE 00X00 K 4K04P:4`0X @0@K 0  1,(0R  `BZ0`J4 0` 00 0 K40 K$K$KR0KP0  #K p#KK 0P0(K 0-L0M0B"T @PA@P A $KrK0000C R / -LM 0  0K  k K蜩 0-LM 0  0K ] K蜢 -LM 0  0K P K/ 0-LM 0  0K ? K 0-MMLM@0sP0A.K0 B;0s NK @6 NK @oN.K B ƚK0{dЀ4* -Pp0L4`@ *0SD10>ЀX0@(@ 0 Q RQP YXW @1<<1@0S BT0 0"Q 0S ,Ko虱DluєP,lP1<<1/ -LMP4@p!0 P- W0\ P\' P"U rq?`0h2岀`0s  PP \80 4 P4 80`0(KpWBTUU -pPLD|| @ 4``0ᆎ 0 `/ D@ 80p UWZ*  @@ @/@ (. 00-0LSP@U U\0 XU000T T0,00 @D #(.?/I/RX/ 00- LR@0(. -D4 ML @0  'tk p p0d (@0p @ 0 @嘡%@@(K/ q? (. H00-0LS@eD0(! R 0K0h(./ -@LP0   04 8 <`p` 04 8 <00 00S00  SR000 0-` @LM#KPop1S PUBT(KU  (R  SR S"0` 0㓥!2S R02Y0(2 0 KQP 0-L 0D@P0S4j00S00ӵ0ŵ0P00(. -L @`PQ Q OP  j{0P00E00 E0Q  _ 0PQ/So/ -SLM 0 0K K -L MP@00 `؀  P0 RQ 00Sl   (K `F&4 0&8 0(4 0 (800` 0&l<< ( `0T/ -L\MP\K@`ps0PS3 0„\  \^V 0SQ00Q0S W0l0 l(Kw8jKR 0E  <%1#R  0%K40p0 0 Q VX QP08R  RW 4 0 Q Z QP V 0ZRUp0U0X 21 SR܅K%KK8”\%pPT0 `0 q?r l0 0\8"`0"HRQ0d d 50` Kd0dKPMW 2l` 01S ^  SR q?r 0s(2 0PXR 0&KR0^œ"!`VR  l  0S 2 "  023%KR0W? }i=d0`\0 %KP0X` Kl0尀0o"0\K0Pl0 $ L0 d02S02D0S qPS D偦@0S 1< R0!p0S q?r0 8S 0 T%KԅK ^\ P|0 ` p0~Ȍᲀ  X00 C "( W,0~! ! O S " ؄kA-pP2uSvw_10000“b\œ@FqL@$H @ - (P \P ‚!S Q   (0 8 Q S 00SP00// l0Q!R0-LL0L HR€;IPT0@0020>>"  " -L8M P` Q @`qdQ2"@! P0 * 0S$ 0T KL03/P K%Kp`  P`Rp R"&000$K/ -L0M0Pp` 0 9 "@P0 00K 0R0 ! P0"<0?020x 2002LKߖP @02<02802D00HK" Ј " > 00- LRP@0S DH^00U0S^D 00"0"@(./ -L MPp @`@"05 0 $ 0( 0,2Q 2R0 002S R02S0(2@ 00S!S8* S S4*SS=*S-S+ S0 SS$ S! SS S*  KS S BS SS S S00S  CR  0S0 S S000 @-LP(P8@PH Kh 0  (O ȉ " 08S^]/,/5/ 0-L @ (  P0R0PS 00Sg 00 0-LM0P0@S K'FPP 00S T zfK0D0 #! R(./ -LONKNMM @D`  Pj``NK 0|  @)B.K`;` B YpP <囔p)& 4(Kk yd -L|MP Kp@` P@F0K!@P 0S X 0 R8L1L!LLp00S 00(K (KP0 0S0\ KL03/P K(KQPK(KQP 00   x@ 04/@(KZ:Z ZY X ᦈ @Y@  ( ᘈ,V"  "   0 -@PL_onUKhh -LM@P0 0pK0'4Po0S  `VRU p p0P 003/8_o;V7Kh3 j " -MLM@0P 003/0A.K0 B;kpP pỡ`P   3K 0-@^LP8Q @ 2"0282w -p@CMLM`/@4 B.K; B(0P44 0 i0 L$ H 0$ Y@#;$  4t P!14"S> B44Sޑzo@ U01U01 (K -PP =K 0C 0   4dt CK? A 0SY 0I,mᅢ0CK ASY 04o_SP 1 SR 1S  RS1S1S2pB@?↯<4 Q T<4 SPTJ 04"0SE04S00D04 P= 04`0D l 04 8 < QR@ Q@$ r"0@$0 Q031 Q 044 8 <" 0嘠D 偠D40 FDURX -L0M0Pp` L1L!LL㕠@P* 00御 0R0 !?020 20 0002?4 p¡@K5 0S0"P00L KL03/P 8P bP003/"  " > -L P@^T@@ 8^ @T$)d ` ` `b` ` p Pp`" "0 q`0`~``Pa [0p`T08BP082@T^ Qp`82S4@0 8~<`p0hx R  @Q" "40T8P 2SAT8BT0Su  h" -cML M86 0 QP& B.KP06 0; B7P@(Kc.K4up 08&PF<6 P6@ 2bK, @D6 D6S rW !R2"_pG.K  `  `  ` dhl#V!bK Aaaaaaap@W8C.K Ukt@bKp` AXrPxBTᰏQP < L& D6 81b.KZ 1! B,?? <@`8T1V`!a&a??``aL&D6ڝP<  0KA 0e\6 0eq'X6 e>KK 0C A 0    rK?AQ P0EbK, A =K 0C   q =K0C S R @d@O  " U -L MR@U|0| ||0`0P \ e"{PD04 o K"  " "  -LMp\K`W00Px8x(xxbyPWd8< 0@(K'K2TQ\@Q\σ~4<0K8K RԈK40x0 'KR000X 00S 0PSWw? 0(K0$ &KK'KP0K'K 0KP(K0 *K 0)K(KR0W68B4T%@2r/0 q?080s?0 0KR000TQPM)KR 0PHWD6u u?vτ0'K 0KRnBo_P0"\KD0S SP Dt0  8x@ }U x0x o?0 R S RQx 8 0^(K㎝`PW50c%%? 012U |0 0o_)KP#  ԉK|00X0܆K@PK0 20\KD0S SP D凞B|0܆KC)K Y|, 0 0)KP0 K܆Kl 20C K (KR0KKP K0 \KzD0S PS vDJx0T82SK0"P0 @Pyt0"2? 08B122bDTW (K02y?0"P0, K40"0 0d 0dK04 P `PU0d0 l0 0%K0PSb0 F 'K&1#KR'K%K%K'KKl0P%KU0KUK40o04"\KD0S Q<PS Dŝ<@B#38d0 $1 0dR !R  "#(Ro_x0PP 0SPo/ @T \ `TV U \ QԉKR |wτ \ KP" . " " T/U؄ -L`M@Y`p 0P 003/0PU_4T KP.Y) ( LKw"V 00%K  dK; P &K%K%K$K0 TK@0 T K P$KY K0 0 %K1/P0 (@00S $KR H %K @1/00P 0"P25/0PI/| -LdM00 SQ H,`DA0 P|K'| KP0Ga|K 40@>SPA0 P|K| KP06a|K30@S`0p> C(KK 0R(KK ? ?K?Qd@P\ @`@10d p07/0@`P(Ku/ -LM`0p048!PAX@@ \^0@RX d 0PP࠱ࠡ? 0^  0 (Ko//> 0-LM@0 410810!P_0K K KP0 0P0PU_0K K K>0PU K5/_K0/  - L S  Kh[ -LMc@(0 00+$ ' 0-D@L0s,00p o0Co0& a/ -L MK,K 0K Ƌ K 0-L0M$ K< <K80 40 00 ,0 (0 P$ K -pLQMUf= "OOK4d5 `pS?K`!PU?K 410CS P0UK "SKR0 ğS?K " 0UK 4 @R z 0S^ xP[ KKdo40S@ JK|$@Ⳁ@l4`V08S?K L4$ 0 4`dP`d`KK0d#咀3@p3Wp-pGP ZpGWd#0 #pGKK dp#u@S?K P࠳ࠣ\^\H K?K4#dZO?K` `Vp@04PZ V0`p= ⮭ 2ݱ 0 ᝰW?Kp2QK R0 0jP Q?KW?K ᾱQ?K0PQ/K`P  S  RfK/K"QK10 " 01``pV0d`Vp`p`pdP#ᰁ/ ` 0p&%@1+ / 0 QK``p&5;G%0 T!1@`V0a0QK K?KP R0d WK 0PS?K V0@ DZ"Ce 0?D!@"% +LŠD! @ 0Q/K0ំ`/a/`/a/P{a/ta/Y@C$a/# JT.Aav a/a/?~Z U?K R0< v @ZK?Kd` n@h0 0KKp 9(K0 VQ?K`pW?K  0W?K Ἧ0`P0P !@@ `<K?K<P|d0P!+@d!%@ 0-LO@K@0 -@RL R?700Pp:@`W:00WP0 ~P2E -L M@pP`耟0*@K(0 0S -S :S S  ,0K+K00P  0  0@0( 0R QT0S00W  ,KvgpG@ K0 ' -LMP`P0@# pK$0 0'0 $Kwp@ $@P 0S$0%0%*P@ $ 0S*$jqK -#MLM@@K0A40 p 0 R K0U -LxM$Qp0 K 0 j0`t0"Khp@3 Vp.  Pp( Jp"  Dp (㨖0P ` @p  $ 00< 0R $t (K0$&    0-PL@T@ @T00 S $  0 0S ܘژ0 S   0 0S ͘˘ 0-@0 S   L0  { K0h貘 -MLM8q00!CK 00 將0S0 0R< = ,0K0$CC>K@PT*)>K 0C @ u`P` @ 0 R 00>K 0C  p `0S 0#S@U@Y700(K04& 0-LMP@0$0 0 0 0 0 0$K 0 2p 0S 0#S oK00 S   000C000$00P0$PS0  H& -LM@Pp p` j  0W0 h 0?KU00P Ph}8 ob;8 -p!LtM G/oP`0"K(0 p@ KKF Kp K<@( 0R nKIp 1S p @0W ) KU !K/p K0 .0-L@Pp00D I U 0 p 0 ; 0 p-LtMpP0 K 0 _p@ KdK ᛆp`ᙆ@ 0R Kp0 -AMLMQ@ӘP0p00 `ڞ7000 0R 8 5  X8C>K(@`V CK'(K0 -PRL`p @ X 0%S @TR' @0 S $  0X ,R  pPP00P @ @0 R Q*U*  dR<700  㒕@PR U P Pٖۖ  0-qL@0 000 #-`p0L@/0s` p``q j Ѕ0p0 p`PU0 S   0 R 帅ዖ`8 0-LMd@P0$0 l00I0KQ0p4 0R  K K00\& T8 -P`p0Ll0@TT 0S V ♿P @ Khw8 0-@PD0QL1l]0UK0hC8 8 n -@L P,`|l080 C0llH, 0 0 8 `| lD #0Kh 8 8 8 p-L M@P#l000`V Kp 0S 08 BK K B 0 -`p0LP@ @Pp$KkH8 尕@H, 0@Wp3 D Dn& p-L M0P 0 0l0@T K yP 0 F 0al0@T0Kp 0S) 0 R Q H R0 0 \P 00 0 kP jP 00 0 0S h1S }P 00 0 @ 0S .+p @& D0-SL@L0S)\0S4QU?DQUILQUSQUaVT#a1CD00CD0D0HS0H01CL00CL0L0PS0P01C\00C\0\0`S0`0_ 1,P0C 1 aVaRH1,P0CH1HaVDߔDaEP1,P0CP1PaVLҔLa81,P0C1 -LM@0 PP @0 0<0Ѓ0(080Cph`Cpi Cpi`C C#$Kk($K -p0L#h0@l*H0S D0S080 C0D0S SKh*8 8  00-SL@0080 C0 D0s0G080 C  QPFkK0h| -LM`p2X@؀D0 0* D$ ؀D 0  ! D؀D  0 0  D 0s@0 0S D#K 00 0 0 0#K 80܃KD7 D0*X 4㨁c(#"c(,K! =Q % < P0 ' < Y  i  DDdX= D 0 0S \P`` iP, (K 0b"!4b4#,K0! d&   ` `0S  `60 @d6S@`p@& 0-SLP9080 Cp 0`0$0- :0)P 0 P@@@ 00$0 :0 X 0 P@ 0$0 zW@`%@P@ -Ѓ: $0l0L`%$: 0 OP$9 0 WP$: 0 `V0$0  : 0@Y 0  -LM0c@ %0K0 t0 0l0P #0" Hl  _%P P 2 P D P{PU%P P1P4 0!c 00)0 # $KǂpX XpP P  %K$Łp<@F $܁0 #6ʙ P / J$ā %K 儁p# 幁p  品p` rolខ# K 9 \& 8 8  9 ' 69 x9 9 ?9 H9 \9 f9 7 -@Lx c0l0\`PUKhZ 0S~(P0$#KhJ8 -LTMa@0P(0 l0S 0$I0@hK+p 0h0K p0h K1P  i ( 0R UpP @ pB Xp U㰀  @00<09 K0!' 9 9 -LM@Q`p` R  P00 0 WV L $Kk~$K9 0-@L 0S0 0K0h -L(M,Rp `l( @P| 0Sy 8،0&0s 0Sp V"H0S$pN0`P v D0sb S  $000D0'$J L( 0R@ $p$0A0AS`$0 V?D0S<   H0D`S lpI` 0HK70l RHKᘺP 0@ <y'RffY( 0R$Kk$Kkz( 0R$Kk( 0R$K09 8 :  -LM,`0xP00 E-K 0@  Dqh Qo -K+ 00 0d0S JP\ 0h Kd[ E  0n E 07 Zp Xn E E E 0' 0S!X E0 g E0 8y 0S؀E 0 6 0*yp = ,0 0S SOP 3K T 00 0RI 6Q/P$0A0AS 0,K1@0 K0 0$ `0 Kr  d6 S}0` 㙃#᪹P 0 K0 0T 0 @ (K06: a: p: : >: J: 00-#@0L 080 C0 AN p K0h6'  -L MP`@T(KpW4 gP4   U W R @p RX 0 80 C#K)& *#KIx@OW   :: -PLMP@5 P PP PRX!XX.< T00B0@0lKP# P- P< ! P P ph0Kh P l0@T @x xPA8,p\KhPKh@Kh Sq : : : : : : : : : : : O' : ; 0-L@.$ 0K0h 0-QL@0  0S0K0h -qLMpP@( $l @Pu00$K 0S w,0 Sl   0P(0K ,K3 PlP@P G0P0PC l`P 0S ?$0$0= = =0S ))@0 S   000l0  @  0S 0@ <&U, K 0S vP0 S   0:; Y' Q; g; -@LM> ^}1-,pxx# K0\!5X0T (K `Pl0   PpcP 3 Rp耟PU gl( Kl|l0 S   0l@P  0!l0  P  0S Pp 0{; p' ; | 0-L@/p0p07SK0hxh0 S d0VS0K0h' -LDMp@0l(0 PP oP T G70 0( 0R @=0)`S 6P <0d K  ,M=@  K0' ; -L$MpP|@%0P h d`P 0,@0 `(K  `P 0# ^p`Ppp p` ```pW0P Z)``Ix<0 <0~ 0Xr#KT`0` 00K0D" 0fp"#K :0X 0S1#Kpq` D0 < Dp < 0p0`D0nP NP` kP#K #KpP xP#K:#K*cKp`dK00 00SlP 0S cK A`p$K0`A00000 0* AV 0Sl0@ 00 00SlP 000@T*0 0C0 0l5; ; ; ; < < &( ,< -L4$@KM`0dp P (042KW@YT0 T0h(("4h#$K! @= )=@$Kြ -LM0p0`00 d0SJKPP6 U0d0@!2;S@$ K 030(D ( 6D 0-@PL0"0 00 4080P PP$P00 S (  00 S   00 S   00 S   0 0-@PL D xK0hވ 0-LM$K"yp@K0Pu@P P0P0000 P00P 00$P(00L0ypD@ p-LLMPP1!I0aH0H Rk,0S , 03/@T0S^ 0 0@D0KDwp?0S ` KpdKx&KSR\\\ 0 S   003/00(00@(@PP0\ K0CSL0 PK0L0 T@KP @ R<0@D3/,0R  R 2/L(D ( 6D ʚ; -L M 00 $@ _*p t@K' -`L0PFp P ڣ# "P  RP@@#C 0 0(@0   ᢉ&' --L M  K -ML Ml@p0P(0 !`BK0 @ldB.K0 B$( 0R g K0 --L M  K --LM  K --LM  K --LM  K --LM  n K --LM  K --LM  V K --LM  ~ K --LM  > K0@& P-L,0 V00& -Pp@\`LV`0P@ 0-@PL0AGp\NK0h 0-@Lp 0v0S0%K0h 0-LMPd@ 0K0  K)0 K0wp9[ $00R K00i -LM@p 0`K 0 p 0R gR0  K0P K,ZKNwp :[$0K0i 0-@LT0xFR@ 0-@LT0GR@0Q/ R0 /R -L$M`P@0'0S  P P P:C`P 00K0!0 0   008S0 000(K080 00S # `p0PKP` 4K 04P 0iS.S P` 40P 040:S ' p-LDM0@P ` P Q@TJ00\Kzp@ 0R V LK KP @0SKp0 -L$Mp`@T@(K 0S P P0S S @ R P0 P E0S 00S㺀000 HP P00  uN P-L000QPl0P/$0/ p-LM`Pl@ 0K 0 s K0@U K8P v 0pR Kp0i~i -L0MPQ0`(0 0p S@ S$0SRR #PK뾔[0 00 Q@Tl0@T"t00( 0R Ƅ)S0.S /S R W R $R <K,0 S @$K0 -LM^up@  0K # ( )7up~K( D 0-L@6#p0 !p`0 -L_M1 5! 0F/`PSK00 9<1 KpPP50 0Rb Zp|Cᰄp@! p 1S001 X 0S 0SbK0P1 P ^K P PU1SMڠ1^KPB 1PSP@L0SP0 ^K PGL0SP@T0SX0 ^KP;T0@COoSB@TP@D0SH0 ^KP*D0^K@COoSB@TP7#P^/KJ1SPP1s1^KP#0PP@@@10S1 D@T^KPA  00P1 ^K"0PP1 㨂@P$s: ` ^K / 0Z$0Q  SK& < MK 9<1 0S/K1081 rtp <1 B00 RR*R R 10#U00SP A 5R R1S P0R 0 R R0(0 = 0)]=)(P!=0Q0R0S D0S NPP#0000U0S !p "00@0O"p0H0@0 Pd0@0UDP "D0000@@@(K0( D iE D @7E C-@$0R ؀Cpe  @$ P A E@ @C؀Cp`  pn  PK@C؀C`p  K"Z@C؀C` p  AY@ClPA0@ P 0 A -LMpPނ@P$K$`Kℐ@& \P ΂PX  [P,z0P ( C -LMbP0@00 0p"S8` 0W"SpGP Y !0@s`P700800 0R KYP T00@010KW YT X0#0%* X # 3T R\Q``nQ 0Q< bQ QQ ` tQ xQ rQIT  T  PT 00 @T 13 K   4K  ``3K3 [R) T'  4K2KP2 K4K`0PLU R`2 [R T  4KPPT T@(K0 'P /0 S S /S/P0/S 0 S S/0/ -LM0 4 ́`P@(K=@P \\PP8 X7ځ ᮁ`P  Z@P< 1a 00@A Ɓ@Á@ P0  ὀ@P0  0@ 0 0P400PqZ 8  P40S k@P"( CE -L`H p @PXD! H!p6 0 t60 00= 0009 00J@0@  PL! P!x6 0 |609 00 : 009 00J! !h6 0 l60 00 000 P00p@YE ]E -L MpRP` 0SU00000VK/P= 0K 00 0 @   0S V <PU P| T /00DV 048 = 40 8 0TU@dE }E p-L$M$0K 00` 0P X$@ T |0`( "4`#K! Kp0 P@P00P@@P@@ -@P,pL 區` 0e SP,p儀$` PP(0e S${0(0$0PP -LdMX0 0\0 0pd0 >P0@00 X010CzS񟗚lPx<x<Px<Px<x<x<x<x<x<x<x<x<x<8F\FxFG8GTGHH8HHHIItaJtaJx<8KtatataHOOx<@Px<x<x<x<x<x<x<<<|==tata=l>>> ?h?ta?XAtatAABBLC4EtaE Fx<;Q0QlRRRtax<RTS$SSUVVPQR8VXVVahV](_(_@_|__X__PP_H``,`RR@x<`HV`dB`a0apTI `Pp DK`PHT XXP T6X T&D !@P<0 0 RY [X, Tq X  <P 0 `P a v<` 0p 1+}P  0 p 0S P 0 1X, T8  BqTx, 0 px P 1.S 0 1@AP0'' AT l  0_p@L tX BpT Q80S~8bX, [T 80K0 0 0 V80XSu  DT 80K0!0 0 80 S_ < .T @0K0D0K0H0K0L0K 080K0P0K 0T K<0KM00L0@0P 80<TpPPD000P 80<TeP 0@00P 80<T[P& \UTu @0K0D0K0H0K0L0K 080K0P0K 0T K<0K00@0@0P 80<T7PPL000P 80<T,P0H0X, Xp IP GGTX# 0S /G`P /B`P00 )V /0P0 P,,,000X, ~T 80K0!0 0 80XS (gx?0 aBpXP ?cPX@?30?KT ,`P 0S<TA 0 ApT.X,@ &x  0@4  80K0s,08@Y0 d`DK@ PhX700@ A DKC@40A;A@@dPA[B@40@@ 0A  Cp PX؀A pdT`A P 4P 4P$: A06S 06S, T2 80K0 0 0  80XS T QH DCHX,`plX, T `Xx`,P `<` zpPf04";b B}YX,`plPX, IT10X 2B]P0X 29 TP 0X 20 pKP `FPX # @~X, X, 0hT3  00p@R, CX, X, 0E 7E E E E F )F AFF PF jF F IJ F i1F F F F F F G %G 2G YG RG HG EG aG {G G G G G G ( AH H H 9H hH G G H yH H H H I Q I )I R%X, X, T P@0K0D0K0H0K0L0K 080K0P0K 0T K<0KL000P 80<TPH000P 80<TPz0@0D0mT P@0K0D0K0H0K0L0K 080K0P0K 0T K<0KH000P 80<TPWP6T =PE$ 0PX0S P 3,  ,- P   P PD  P  P  P  P6 `P0Wpp @KDK|p 00 8Ksp 00 P DK@K|X8K8x L P  A P! DKLp  pP ,`K&WTXDK8P $ P Ab PX  P80K0-0 0/ S80S ~ j`P%/ @P`` @=PT00f 80K0 0 0 R80S R AL @KDKP/P0XL P@0 SP L6D P! @0L&0- @KDKP/P0XD H@0 SP D6D H! @0D&0T Q6P LPX, X, 0,X, 0,X, X, X,  X,  TR @0K0D0K0H0K0L0K 080K0P0K 0T K<0K0P0@P80P <TP 0SL T* X\fz:zP\T QpX, X, |X, uX, nX, gX, `X, Y U00WppW IX,0,P pT /pP004Kp$p< |)p 40[dX0 30[1`[\0 20[``0 Q, RP dT d& 4 [`Pഀ 30[@020[010[000?o`2V``V0S$ 00 T 0^  ^ ^ X\\\`\0S/m@P` @;P   {T 0S80K0x 0 0 AQ80S H 00X, TX, Ao⚏ Ao'Ak➏oAk⣏)n0\ X0d 0d0`V `\0S `T X `\0`V$(`P `\ \  P80K0P80` S  E@P =0`0 pP0:0pP  80K!00 0  P8Y T{=P |LzP @PpPb:zPP@PpX +zP @PZp(A4zP @~PVp/zP {@lP\pyPP pyPY \yP\DyP#PZ <h0 h0   7\?o2= WwyPS yP yPP yPP lyPP XyP P DyP@P 0yPX yPT yPU ~yPU \ wyPU qyP\ kyPW eyPW _yP\| xYyP\v dSyPVp Lp@P0(0AyPRp wpP X0S0@<0 , PPAw `R  R 0<0 ,0@ <0RRT  @00,0"0@0 0$0(0`0Y` 0  p   i P < ^ eqX00CS$3 \0  d0@T" DpP0080K0 0 0 p$O8`V@<@P$ 0 fpp 0S< :wtP 0 TX %PP %wb<@ 6< &!倆TT XNX606H0X,`pl?X, 8X,`pl/X, (T ]fP0 1zX, X,  T H%XpP G $P PGX, X, X, X, TR l0 pXA@T 0Y0D  pT0 X0Sm OPJT5!(KBI XI VQ aQ ^HHI @I I I mQ +Q 2Q 8Q @Q GQ OQ Q ~Q lwQ Q $Q H Q Q /nnI qW ( I J " &J di ^i "BBJ G H -PLM`0p @00 280 0P 4 wP4 80 PcUX(K@$0SW4 00 0,0p(Ko( ( hJ ,m -LPtP~ fp@ D 0 D 0+ 0,l0l 10 0605Pc0*0 D D0 DD/ E / -L$MpS`P@5 0Q  80 CKᴐ崀#000K0 0 Np0   l    P U ,dz#K 0,0 (K&+< ,< ( 40 -`QLpH1SP:1SP?l0PSC  1PJXWuHUu\SuhVl6SBhMupVt6SCpGuxV|6SDxAuV6SE;uV6SF5u`3u$Kk/u.u1PP'u%u1PPuX  oP T0 ST utl6,P0Cl6mt6,P0Ct6f|6,P0C|6t6P0C6X6,P0C6E -LMP 0 `PF Hp G G/ 0p0 0 00SR#0M,esP0hl6H,[sP0pt6\>,QsP0x|644P (rP +"`(K0ԁܑ0 0 P$h61l6 1p6hlD1t6H1x6L1|6P16ptx|161\,}Z0P0 Z, P@gtP0 S* Р ds0P  0 Vt0`0 10 K0 P 3 0S 0K00K00 0 00  0@0S 0 S S0P\S  @ D)F1 {J {ו/ E YJ K,{dP(K 0@o@ @ 媢@  KKQp& 0 Q Q0 0A?oQ20#Q0;Q0S@ Q0 0 R \R0 "R! #RQYؐ ڐs0 S00"S P 0 `0)hKP 0S0(# P<P- 0S! @0  0@0S 0 S S0P\S  @ G 0 G@\ `yLPl @s`\@KsP@\@ P0S P P0 S P P@M@ LS0 0"S ( P @ X>0K00K00 0 020PZ GG0Q3#//Q :/// 0-PL l@P0 s -` 0PR!0p0 L@1 P`P T(  G$Kk0 00T:T( G$Kk -LT\l0l lvT0S`0T  DDP `@@0P0Q3#L $/ L L p-LDM`Pl@ 0XK 0  <K XK <K<KXKp 0R 8rKp0 0-$PL@p$K0h$/ 0-L@P 0 -LMhq@Q0P00 T1T!P `K< z8lK <  jTt0Q  P 0 0 0 0R& q P Z  0 t Z  lRh0@0 \HRD0@0 <(K0M X/ L L M #M BM WM M sM M 0-@PL$0$ $$pK0h'N `/ EL P0-Lh0h hh P@@P i co@P h0'N k/ VL P-L[$0$ $iQ0  TM s/ L L m 0-@PL,0, ,,SPP 0L |/ yL P-L808 88=T0S Khq KhqM / L -PQL`P0 !U0t  @T Vp 0S 90S@'N / L M  0-LP@P0 T0K0hP/ 00-L0@T @0 T0-SL0  KhM / L -@QLpPT2T"TTT0 R" 080 C0 2UU*PPt t0 t0 x x0R`9@0#P P @T T0R88P `)|0 |0T T0RPt06 t03 88Px x0R` p,0S >p0S 3p0S l(@V `P`@M / L M M M M N -`PL PpP@T T0pS@ -L(M0p ` Q0 T0S0  @T0x r Pp@PP 0X @KKU@K 0R oK0M / L M N 3N -P`L4M\KLK<K <KA00#V1 V< \KV@PTx  \KN0SS90SSLKnPT0pfpP| H 0|0  <KP" @\K,P\Kp<Km(K\K <T T0R88PY0Sx x0R4\K/LKT 00 /XXmP <K P T T0R88\P `P pp @LT/00KN / VN 0P-L0 } R R R 08 R P Ro /00KN 0 VN -LPt0t pUP P P/000p oKN 0 VN (0 0P-L0 -P P P/000X0@o R  P R@oKN 80 VN  -PQL@`0 R0  0S0P SQ0h [S0 Kh70 Khs1N G0 mVN N n 0-PPL@0 Q0  0S 0S 0P 0R !P P P P 0@0 BR #K0h< BR #N R0 VN N  -L$MaPP0(0 1!zpW W /0@0H! `!d8$#$d$"0b0?o0c @cTR 0@0( 0R; Um R0 B:@A܀Q DK0DK0CpK.DKoP 0  Q @ R @T R$ @T0S * 0R K0KN Y0 VN (a/N ' -0LS`p S9 /000 @0WPP0w0cR/0Q CU%X0h3_ 00D S01AS`P@T00KP@ 808 40@0(a/N e0 VN P-LT0T TTQL0< H !>0 04 8 <0#80KN s0 VN N  P-L808 88Q00   00 KhKN ~0 VN N  0-@PLQ0LR0 N -0-L M P dp@@K0p R-LP`@B4p p0SN -LM9 @0 TPp 0 I@P@9:%P̐GY p0Sr,BP` `x-Pp(p p Xp  Dp 0#0Q 0F?oZ20SV w3p 0h1SPwܿp@P` 0P6S# xP h`P X~`P Hy`P 8t`P (o`P j```\ 0pr D0S& S& #pe @ p_ H pY $ pS [x pJ dQp0l00B Sp px $Pp1 080 C05% p" 510 R%P S%P0l0p080 C 0 xp p0S p Xp H0S l0$0I0KYp Kp 0F?oZ20S0F?oY20S x0S |   dUp l R  0 IQp0  0 p00sP P P P[p Vt0F?oZ20S 0S FoYQ V@P pVL2Pp0S0pr 40)pMj#pLdW%PpW%PI pCT0Sn   pI 08!p^@0S    p5 08!p- Vn@hV0Se h1Sb RP^ t0 0p0LTTpP 1 RRp`0PU0SS x1x!  RU RL1D!H`0V nCP ` 0pPEU D 00 0R jQ 0(K00 O LQN :O BO OO 5c tO %O 8 8 2O 8 8 YO 9tMN`O mO yO O O O O P O O 0 P %P 0P  O O O O O P }P 0 :P NP 0-LP@}p 00K0h D0-sL`@s!S ! !p0P`S  R H R pP41P pP?P ?P l pP0S h1S  RP 0h!pP8 2O O %O -L\M0t0 0`8 1pSPP  p@H< K ( !R3 @ 0l h@ TK`p@ ~p" 0TK 1聟pd@ `@ \@ X@ T#:dKTK TK l0K l0`T0KpK Y@TK~T @l \h0@HaXqt0 T=s[10C>S00@"$K!@03@0p@t T tKp0S 0t0 t0#40 l x SP l@j 0Hh0 0 p0t0 @0 P ' ' P [P P P-L? 0S< P@0`0S5 S P Q \ @ P.S0.S.0_S-SPP,  00  ?R"0T00000 ' 00- L@P P0T0000Q  D00`@-`0 @CT`@ pT00 P0S@X OX0X ' -h1LS@PhPPE @ 0.PC_oSRPUdP TP @P ,0 .%PPQ 0-@PL'U_ 0 tM0 dM0 TM0  DM08,0)(& #  @      hM0  cM0  ^M0 YM0 |TM K0hC AP#Q H Q% *Q 1Q 7Q ?Q FQ NQ UQ `Q lQ kvQ }Q Q Q ^Q Q Q -(6ƒ \ 1 Q0^  ,0\  ,0 -QMLM`RNK0p 0 Pxp0 0 0L 0R &g.K 2.K l d0L0SPE@D p 0S@K0; Q 1B Q -L,MP80 ) +g`4 Q4K@PKg(K0S  qP@ k PpP@80W Pp W2/gv00 Pp,P R |P 0 K 0 0 >0 R RQ 0S 0gH0 XP 0 K 0 0 >0 R R p,P 1$03 C< BR 001C]E Q P@-0S- Q0@ @^ .^^QRQ D B R @ Q@ 0D0CR000 -`p@LM4 < 8 0 VZ:W 40W00G<0S00T@D @BV00(KRY"0T?,SP0ZP8 `YPU`!` V?U0W 0 R70 @0 +.0 000p C0B00 @0 V:D X~0 0 4 @WR  GS` -P`LM0p!0Y* @ U WV700(K$@PpG`  B00U W 00  P     \Do   ( T/T%8 4 00 8K\TU W@@U W\$0@00@@pGP`U W @pGP`0 ' -SMLMPd@0P P 00 ppTe A SnK `FDp8P%nKp T=p C ]KpWD    CK0 t@p P7 CK@Bp C.K B0x   T50 0R d   K  CKp 0@ V @P0P@T*Yp0S4 Op @pT* T 0 Jp @ 8p    F0V$#$("( FJpq @   F0Vp$#$(B(   FD5@!c#!$c$"(D% JpQ @@  FD%0b"!4b$#  F@Pf   C.K.0 B'P- C.K BhJp& 0S @00S HJp00(K0t& us -LMP` @0Tp(0  墿( 0R! dR R 00H0S0K -00Kl0#0I0K$00KW0$ 0  YI$K0Q Q -L4M@` 0L SH P (0S `0 Lp0"(K 0  0K   rp000 00SpC\ 0KTc6p 0"000cP U0 0!000  4`0 0L2p0t!00|V PE,p 0S(0SU$ (0S40K0P<0K8 K@KH H_P@ )]P @@0K K֫@p@@_ KXPlPx Ke ]Z 0@ T*00Y00k_ @T@(K02 p-LLM@P`0@ `K 0 T `K⍺!> VL 5K3K,  R4K< 080V` K,O 0R ^Kp0ii@ -LM@`P0 (0 0Kp KYKH00xKPK⼙K!\K 0X40 $0崖K00 40 K0O( 0R ^$K0kii p-LKM`@P0.QK 0  QK 0KK31KMK0Q/K0,nO 0p4R r^Kp0Ii -LJM@Q.0QK 0  QK0KK31KH00MK0Q/K00AOp (N+O?Ka $  P ``F$` 0 0 bP B$  @V 0R $^K0ji -_MLMR~K0 pGP%00 zMp_ P@\P R 0@0R*5[S)5[S= S:SSwR5S[K ApQ@V@T@4S8 :0CSR E@ @l`P K_>K B A p 0S NS0 8MR1S S  @0 0R ]Rlb0P Q Q 0$%C5[SH%)5[ S0S@%[>K"# 0C  %5S@%@)[Pk [K% AtfSd S05 5S  R0 085 5S  R0 08[~K pG@  `5  !>15 5 K 0C0C0^>K 0C 0C0_>K 0C00 _t)5[Sq[K 0 @9[>K[ 0C  5[ [b)5[S^}K pG5 J0 ep0 01S )5[SB0)%[R= %[R%[ R  )[ 6  ` 6 p 0  &&(K0i@2 z[ [ p-LGM,|@P0` 0 l0JK0K!#  .K RP>K, $B 0R \Kp02 .E p-LTM@PH 0hK 0  0hK`+h KMp 0R \x0h KX0 |0\<0Kt0H0 p0P0 oMp0S0h KX0 cMKp0liHmiH -Lp[ -L 0P[ Q -L 0P[ : -L ML0K00 0K# K Ѩp  K2 / -LM@pQH 0(0 0p0eK`y eK⳷e/K4 Mp 0p!8  0(0*000R e/Kp1 Lp080 C0 .SKI SK⃷S/KLp0VS dS/K\Lp}0VS <( 0R [$K0liH[ WiH\ Pi \ Oi (\ (0S/ 0-(0LS000@@VV000 0-(0LS000@@EV000( 0R </2 -LM`LqP0@@(0 ` Jp@@ K$` pLp <[S<[SlJ@.8/P K K KRLp KLLp `aPP 0S ZP `0$ K0"H5Lp ( 0R 8[ K0G\ @qB@P\ lBfB@pB -L,Mp0@0H L 0 PU  HJ R04 P0` @KP0 Q8P尣[   R0P0 ``c0P00Y0 010! LP0 6P0P P Z # % % % # %s (K -LM 0K #  K KgB -L,M@0`(0 (0pS H D  0 )2K80 3K0&$8PK$"KHP D0 0 HK<0 @ I( 0R Z K0 0 %J -qLUM@ (0S\YK QKͶ00 0 YK0 K$002 0`( "4`#/R0@-0P0@ D^^!Q0 # R0 00 R-@@Q@LMT<0  0@0(K1Q V00P0`pQ : RPSO  l(A PC P l `0 p0 , `0 lpW  8  4 4 R0 4P4 RV``< P4 TP ,!R *(S0C@0 SYP @0(,Q0S(1 & 08@4T0@cSc -LM@ 0K00rP 0S00K -LM@ 0K00\P 0S K/K -LM@ 0K00AP 0S ԵK 0-@0L8\K0h 0-80 C@P0L' =Q$ %`⮵0l0 RR 0S ``0Q  =0S 8 KhLp08 b0Ѝ`\ -Lp`KPBXP@ 04 8 <0P0 004 8 <@ (0? d@0K0cSc -L$Mp0 !(0 hp@ 0P$`K0&P0 IpH@( 0R XP0 Ip  8KE070K;X3K  4K$ 8K|Ip K0 -L MPR@p1!Ƕ  , 0P 0`@ R1 0R00 0N 30 0 0P0 0:0 00P00;0 00P0060 00P00(K P 0000t 0 00p0 00p0 000\ 3 \ \  -LMPyp`W1@tH$H0S y (P KyGp@p y0S(K8WP GU U( yXp ly \0c!`p050 0)K0.(00'\ \ 3 !] ] -LP\P @ ^00 ``0N\"0 00 \PU0, -`Lh0Ps 2p@hd0S `0`08 `pl 440$ @&9] 3  p-LM 0K080=`P@ PU@ @T nU@P  dz00Kp -LMMtRp0D1 0`@00 )P@Q R PPW L H CU`PHL1 FW@10 0RT(K0,0W600 0MK40MK0P 0 Acp051K,0 @S6 U751[TQ8@0K0@!,0 ZV4"Y0 P P 4 YEW`P` Y P`0  m@10 0R VUP  DMK7xPV4XP0 X TXP`0 4(Ko8W0F] 3 @K] ]] r] ] -L M@pP`Q`,Q0,P !,ERP㤀U`,@(K<,P  R ,00 x< 00`,P ,k<P3 ] ] -RL Mp+00P`U:p U @ YPQ00V *"0 p(K0U00  0 0Kt@0VX 0 H<p  0K⌲0IX  <pP M -AMLM aR0p(0 ֹ00@TPB T@ ǹ00BK0  @p( 0R VB.K B|p CKG0X P<p  p PU K0t -LM 81SQ S  0K0 0{P K0S K 1[#  -L4M0H SP@ x@@ `0D0 0@0 _0? @0o0 <0K0D 0JpP4;@0T0 @@0P0<0K00D 7`P <0 p8 4 W$P  0K8K4K0K8HP`@<0K0D y0pP3 P0 <0S0L0 @K Z00pq0L 0R*"0P 0W80 4p  0 8KX j 4  0Kt008 pS  S S000 040 408Ks0 t0[4KX0K8U H:P@L0S@0h` F0 0x0P   FF(K<0K0D !0pPQ <@LXK 8K% 0K!00pS yP@008S  S S000 040 408Kst 4K0K8 HP@8P4 1S 2S0 0(0'4 0] ] -LMP4@000 0pT2 40K0`0 AIKpIKX; X8l0S,0S,00嚘 1S,08h0嚘 8l6S,00嚘 !RT28X2 X2h 1 S0㸣P2 X2P"l6S H AV 0pd30 0R 0T0 0K0p Dv 0$p 0 0 K0sp D2H V 0pD V 0pD@ U 0x}pI2[t0,0Ll0K?K 8kpfI2[e@0"0,0K ?K YpWW^e0T"!P !X,l ,aS  R/K  QP 0P2 <2 010 00}S<2S Kӯ88 *P <20C<2 00  00T"!P !/K  P <2 0 0 P2,0P2 (K0] ] ] ] ^ )^ @8^ 0-@LTP0hq 0 ah0h0l00l0pq 0 RpB0p0 0%0 -LM`@p 0尀SP$H` yS000 0 0 `00`00 6,#K0 ` $UP 0,000 4H0#0x H(KoW#K0,0 $T 0003@0S3H000s8040$T S l000800S e H3hK840S$0e $3hA4t0S) $0P%x0"T00 PS:e 2h( 8s8 S0e 2zh 4xd$T00 PDH0S0Sl x i 0R<0S 0S22H000s8040 14 0P0i18 0P0a10 0P0Y804 00@0S,0y Li/<Ap`%(p0s 0S*  0R% $1s tpp(Ko70S00 HAAx0t (Ko(KJ^ i^ O p^ ^ ^ ^ ^ ??W_ ^ _ e t_ l#_ _ 3 {_ _ <" -@LTPp \0 $Kk08،0 0,0 \ 0y0yBD0S0S <0S $S  n! #`0 `Q ``Q000` 0`HpDQ0`8 `$`UCL_ -LYMd?@0h 00 0Pl1 0Rt1 D0S`X,t0 ? /0Sh P  Rl1`00p1 p%p 4p1h` F0KH?PPP t0S h! BRh!R ( Q  R 8.Qx 0 000(0S0 S= ) Th1SS F 00 0S\00` F0p18|1 pp-0H/h!X= 08!L1 R J R1 Z= 8  8!1  $ RR DQOh1S St0S x0R, 0JS62000$ 01 < Q-  JR&6 1 0 <h1 S"<0S 0JS60 0 <֬h1h!0RSx 0JS90 00H( YKఀᾬ|1?3S 0 JSM |!p?#\0 ᪬|!? |1 2S 0 JS< | "0 ᖬ|!  |1A5S J0R:^ |!pA%0 |!A h1S |10S 0JS30p0|1p,K ! ep!KKp1p( 2 JS P |! |!0SQ0W0 0 2` 0000W00 `p1x@4S 0 JSi+ p @$0A @(@d``6S 0JSV|00[ ,K !vp1 p6JX:0JS>70000, S:`p1xh6,0lV*l10 , 0AR&lWoK%l10x%R Ʉ T  0YD0QT SX,0 7 W @ 00 ShR PU@` pCb \7rf 07el1 `00 P-p =뗏\L SK ?> CP 0D0 @QD  R0 60D1 _K _?K SR0|1|!8#<$0Ł ő"00 "9 `" b0S` 0   Q`Q0p00S [Oe0  :000 0# %(`p, paap P` hP:LP YM 0,,S\ Q:(,p P  hQ:@Q Y& `,000I0C0 0  0C 0CK/ pWwt1S @t1W/K30 0R N Kl1x`` pv  wM`PF \ll1t0S l1 $ P l1$Z <X x @3,1 K?KL1 0H1 Y?KD1 0( $a a $N  000t 0%K0h]a  m\ -P `L@t800  B`00P 00 <00%08 culKhva a  @ 0-P`L0@ M0h 0R0; P9 (k0#0H$Kk-p` $ P"0# 0 $Kk|  P $   .  Pd0d ddit  P0 $$Kka a a \ ,4 \ -L MP0 @ $(^, ^ $^9 4 8 (l 1N  %y<0 0@ R  P  p0 nN0 whh`H 000l (K,00@ 0b 8 h -L0Mp@#h050 PK 0S 0 (0!hP 0! 0Q00 @K,0< K040@K080K K0 cDM  w})b 00-8 PR@L  . P   8[0HK0h#BP0K0ha a -LSMT尀0@00 8`h1 F 0l P#0 $1se $1s00S JPU ZJP 0Ph0p00P 06yH00% 0 %0㰐xЀH,0 ;8K 8! Z:  IP8v i، 0 0'0^ 8 K0s  PJ;0 %hK؀Fp0 ppZ XQp$ 0\%YK H 00 Y?K 0+0 0hHP8+ 81 8 08h d= HP8 ( 81) 8= =Q K0)  PL Dl10 0R J 0  8 0 E 0S 0,K01! % 3\ F 0 P lnh1,000s WKy<;P0 QP pG?K0 X0\0  J0 00$0H408L0CH04080 SPU 0S 0` 00hp؀G%0 DQ X0'0,0 $'L  {,0q 0Sn 0 Sh$L   0< G؀G0 @Q 1@0, F0,0@\1P 0\  F`t0 D S4"48#8YT:QP0YM: 4"48#8SE 0C \ R  Y 3R:0($lB>D0C$$ D44040P!/Y, 0B.D0B-K B0 ;K,0C,$ -K B(C=K 0C0-K# B! Y :K,0C0H  s@Tk0 0R pFTAND0T$#$( ;K"( B,0C00C B!(K0$^4 |d d -ML,M`QJK0$@D(0 ;K$0C0C(`8 ;`Dp  @\8嘩0@8 ;K$0C<0CX80T8=K$0C 0CP80L8 ;K$0CW,0CH80-Kp=K$0C0C B0=K0C$ D{5p =K0C\ XxPHP\( 0R F R 4峾h0s0 K0k4 x4 d  -PL`jp 0|l0@T0S R `0S= R)woP  { 0 .@d -0L8l 0@  $Kk蓾t婾0 PTyi6080 C0 D0S𫝸$Kk*e )e 8 -\ Q pLn0 t\ \0.000 0S /8 -PLhDP@ 0y`h0 0<0S 0< S `08 HKh.4 @e 0-@LPT EE E8EE@l0S 0R $q <$40$1(uE0(100S 0S0 -LM@PX,08 P 0Sz =(\0؀C  \pgpLaC(Q QCp$aC؀C`t  Cl0 30F$KKy#KP`,  0UQ4 0 $Kh,P t`pW h0[ 0zZ 0H Q@80 P ʚ;ɚ;6eeAEe   0-@PL00 U0x0S0K0h  -LM@`PU Q Pt0S  0 +0t0(KP0<Q+ R( 04 8 <PDF  4080 C 00#0 㰀80 C ' i㰀80 C #K0 0 S [ P`02p 0K<0 E <0 1#K#K0 0 0SOD0 00S $0 pW ! 03  0 00 0Q C @Rs 00ppWX0H0HX, 0` 0060t`<0ie 8 e i^ 00`( "4 M`4#S Ѝ/0  @R-0LP<00@`a`F@@@@  PePU\ePP/<0`( "4`3Z1S P///P/P/Q 0 4 8 <\R/0 4 8 < \/-P000P b8"#4b4# 0S 0-Pl0L@T0 P0@l0 R/0S 0 4 8 < 0# /PP/x0St//0o\  R/oS"P / R P/Pxx00 SR P/0 8RS/S/Co//cSc -LlM`t5t 0 0 l @T. 0S PU$ P  |Kₜ XPP@0Sx0S t0S4$厠 |Kht0 0S! 'pP00 0R {B|0t 0|00 ,K0T0(t0 00 090|K P^  pW:$0 00 pP 0,KT0(t8}tXy|K^Hp |KP |K|0t 0|0Xxpa\X" 8PyP Q ||K/ ⷜp|K9pt0S aP 8p\P   A Uc  P < 0$Q  " Q  ნP0 x (K5 LlK<   固XpP1 t0<0t00,KT0(080 txQY X MP v|KU |K<pP |KeY $Ȍ L(K 0 x (K5 LlK< `  4E033u(K0/ f 4  f bf :f -P L Ap`01S 0S 0S ޤ0S  0 @T 0Q0 PSP 0vAU t0S0x0t0@f 4 0-t R 08l  P@ 0S / 0-@LTP>P@$й000 0004 -L MpP`P 幹@(K080 C0^ O@P00 4>@P p 0000  0 48 B $( !0 % $0$(0 pp}B0 'jp0S W00@ @ P  0@4 8 < R 00000@@}4 M >f f -LM@PTH 0S080 Czj W V x0S eHKhKh[$`  P (0Q,0Q 彸 `P Kh80( 0000,0P0S K 0x tt0S  $0R 0x0t`0SHmKhf f 0S/0S/   -LM` 0R00 0 40 l RX00(KP pPL0  6V@ VP  0$(, 0R0 S   0LP34h=@Ph(Kok ⻛  ⷛ    @@  ⬛ $( cA $( 0 $  $(, RX  ₛ000000 04 8 <0Cs4 @Vw(Ko?4 M -LM0PS@ (K`l 000 0@0 @0 @@T 0p P0-L0@T0PN?K0hJ?0 S   0B? -MLM`a@0X 0 圥P4y0S ,!,,廷41?S@<P@0041寷 0R4 >0Q@p>sBK$  APW%PP .p ;B.K40x $p[pW4P8 88~U [P/041K0g 4 !{ -LM K⺚K Kh  -#ML M8 0xR8 0 8 2 0( 00 00T20 0R U>8 0C0PPB 0Q@0@1@S@@ T8 v >K08 0 8 08 (Q00.K8 08 B008 ; KEp g c8S  \ X TK @|K K @j}KK A @m} C8@e =8@S-8t 0 n`pj QP0#03 WV00Sp^p`dZYX0#03YX00S 000p70jj(K04 4 4 4 -L M@P0Kc K -LM `P@pE!@ R0p'ppW KP#r00/!(`P@ V0嘳^ \00-@ L@@P\  ` dUU000S DK0hU0, \   H HR 0b O $g 0- U0 S   0 HP  0R 008!6`0 &Z  Rp ,0Kc 4 R@0 )@0 0X000U@U (K -LMp`0 0 l0PU@ 0R' 90S@P0Kp H00#0  L00#,   P00#(  T00#$  @TK0 -LDMq`0 P00 PX`7@P 0`B`\`\ X0X93 ?o2"2  0 Hp8妱9@   0 0R, 8   .0 ` K>P 0 0.0` H``PKwp  0 0 S .0` KH(K0,5 M 0-PL@ P0`0 p0ah P/0$ S/\X0H -PLX0`S0S0S@T2 NP  0RX0' 0 <P@ @0@  \0;0\00 0$0800OT@ @DO -@PL`PU RVhV <1SKh(0S 0>8;80 `Kh 0-@L<,80K0h(8 -L Mp`P@H040 T? H0 400 ^aP \0H0S`0@W W\0 `0 僰\00\0\0 0 S   0X \0@ 0 0\00PSP 3/\0@0\0V(Ksh -LM1@ T0 0 Q   aPpK7k k  K❓`K< KI(PKKs K᎓(0 0(0 `P  `P2S `P0l0`V$ 0K i0S 0S X K [00 0R 7 P0 `P 0 _(K095 A5 I5 0-@L ((`P zK0h;95 00-PL5P@D̯0 0 00S hP M5 -LMp`8 R0 lP P PUPP @4 TW (K HK`PX @08  @(p08$0(0 0000@@000 X0\009\0H0S0I R S: SH0S5I00S1X0.Y+ 0 S   0 03/ 6#0 3/#0 X0\0@0\0##W W0 S   0# : Y W 0S 0S 80 C 0v #0q4000Ph (KoK -PLU`pP@T3P H0S 0S @ 0`@0 [5 -L$Mh$0P00  P08l0 Dq 0#0 (0S=@0D gV0)` c_P  ]_P W00`0 0R 5pWpP l2@ @0 @K 0< 8 4 @P` 0D 80 C0$` `H  D0K 0 0=pD0`0/5  ᷑(0S= R)0P0*0Q0+0S`R00T0,0U0-0V0.0W0P00#P0 5R)P║5V00`V  .0` 0`0@@" H ^P!X0 080 C0D00D0 5Ș10o` dw5뾘000S`b` P  (K0u5 }5 h -LDM@rPPK0@K00 0` `H00dp ! !0Sp( ( ^PP  P ]  x^pPr00a XK ,TKX08  H00H0 4 T0 D00D0 0l0pW1`1  0X0D180`0(S80 50@$0P$$0 7 0S 0 $0S S"'0040S 0SpH h0 ^Ph0Xp00d00 0R _40000(K095 (i -LM@` <$K$$K@P $KK)h 5 0-LM\0@  00S0\ !K0$K$$KPP00$U 8}h 5 -LMP0Ā00@ 000 T @(K\p  $`V  0]PZ 80`F80`V00@p\p\00\0$0S$0 #`p cKbz ?cKV0 08` 0B880 $0SY#$`p cKbM ?aR0cKV0$08 @$ -P00`@LT\00 S@0S/0S/Q\    \ -LM0PS@ (K0`00 lf$00H@ 0@0 @T \0p -p`l0|@LT<1h@T! lpN l0SP @\00 8P TPU0SP @ 0S  #P |00|0<PUl0S P PP x0x0da 8^|00|0S! 0`( "4`#/ -@`0LP 0 0V 0 S <  0 HK0,@D00 0D08@`0D0D ۑ D   DP  8KG?C0K P BA8`p 0܀`(K.0 BPYK AR 8KG?CK DBAOpP :=0 0R[ E. 0S080 C 00 0P R\YKA 0S (K B 0S 00S KA 0  %P  P (K B  嶦8KG?C0<1@T,@P P 0W  WP @ pK. Ay0 ` 0`8KF?C`` P(K0I/B0`0S``(K0J/B 0| )X0(KQ/B0^0lh00 $4"4(K8F/B#8 Sl00"0Q0S   0S@0|0 0 0 0 :pP0{ 0 00 ?t0 t0 0000x0 0ScK IA (KI/B PR(K-B08K>C0S 8K>C0SP P8KG?C0D!8KG?C0H P8K=C(K0I/B 0# l0S Pl 8KF?C0SOv# 00 (080 C0 h0 8KI?C0S8p0\  \ 0(K1M/B0 8K>C0!S15: 01ʃ , 8KG?C0D8KG?C0H0SQ 8KJ?C0廥8KF?C0S 8KF?C \ 0,8KJ?C090R R RP t"K,I I0(KK/B00(KN/B0`0d0h0l 0Č 0Ȍ 0̌8KK?C0S  `I0I0YS S0Y0S  8KO?C8K>C8KO?C0 S \`V_8KN?C0@ 0(80 C 00(KK/BK 0 A _`P 8K 0C0(KK/B0580(X000`8KK?C0` S6  H> P0 oᩒ(KN/B \00\08K>C0(K 08KO?C0.B $0\0R0 S} 0(K-B0(KK/B0 SK A UP `Se  P` 0@S]Y $0SX 8PS@ͤPPK8K>C0S <048 #0P -8KM?C0(KP8K>CM/B 00C(K.BN(KK/Bᇦ8KK?Cp0l唤Sx0 P x8K>C0S ( 04 8 <00PP0001=001 8KJ?C0 , "8KF?C0S 008KG?C0<1  @@8KI?C0S+ '<8KQ?C勻PP0 傡0 |@8KI?C0 S! pS ٣P#H0 匡8K0C LP0LY TP5 h+0`(KF/BP00P0S0 (PL'h8KF?C0S Q+\080\0X0(K06 j "6 j j j k 16 6k Wk 6zk m O 0uk k k k l *l Al Zl  onl l l ?` l l l Bm Rm rm -L M@p`,DQ0,PH!,ERP㐀U`,@(K,P  R ,00 s 00`,P ,fP] -LM<1S0  KQ 0S00 0冠d 0-<1LS`pP@0S PU@T  P@ <1-SL`pP@@TPU |P@ -@LTP" `*@*0@<1P 0pS /@l0 R 8q -80810S 0<10S/ R R \XQ /0<1S 0S  R RQ l R /0<1S 0S  R R RQh   /@  -LTM2p0dK00 V0<1@T 0 SRPUO0x" PK0P Kd!pD20 0R )%4 P Kp &K P K p ,00Da0e H!R#P,08pf0e 08t6SP`LP`FPV 0h0 0h i V*000P\aU8@FPCP0 Ɍ3(pƒt& P `F^ 0,R0DH!0R ^0, 0h1 0000P K0 0;\ , ("(R  R ` P KⒼpp 0P(K0m m m m m x 0-0L<1`SPp@T 0R0 @ -@L<1S0 0`<10P  PR `0S080 C  Q PKhG%O -LM@0 080 C0A K 0#K]#KP`,  0UQ4 0 $Kh,P RX`pU; `0? 0I> 0@  @00 Pʚ;ɚ;6eeAm t <1-SLPp`@T  QP @T  R R Rl R00S0Sd V`0 0X `On<_V<10SKhhn n *n 0`( "4`#/ 0 R 0SQ/L6 -LM@Pp"d$h&hU00U00K  K(1[PEĠ#Č Ƞ,Ƞ\K2[SW @ PE -L MT`  U g0@0(K0K2[$#$("( 0PEU*S"0#[4"48#8000L!PQ \ T@0, -LEM`hF0TP00  0@Q pT:| u0 0RU t'!0 @K)pp@p@Y! :N_K08#<4  0ᝃ0P@,K! ᒃ&0R v尠PE&p R  (",  {0 v 0W (",$ EE h K d(K07n  -L,Mq0P00 1R xA @T0K4/P [_Ⱐ᧊00 0 0RJ &e[V $ RK1[D DH$HTEK[_@ሊ@VT01X0`[ R R 8''@m000h PK5 P0KF$`PD妟 000(K0Wn D6 n ln 6 -LtM0 0R0 5P000 =000p0 X50 0pRO &00 0t0 0S B x |0 p0 $\\00`00 x0 C0Bx0 6[D#DHDHx'xTvK T T @T'0 0|Tx0S hK▂F[x0$(XᶆKx 0S0 0:p |0R0S00 `@H`K 0 LX0H$Hd6FKSS0#0T K 0`Ku  tȞ `" R 0 OP0 W \\ XPQX T K 0dKO0 0X0 0\0͞0X0 \0 0 P 0Xt |0 n1~긦[Z\ RX0S{ t S # 3Q Rt 0pp j0K PXd  噞[6[ `BS IS0 0壞`H`K 88 4Q4 @=00408  p PB@T0 @,1岩0 `K⽁0(0000@@08 480R\   \ S$0 S05 0S S0Z}p00t0?o2R03St0 s\00\0\090\0(K0n n n n Ko o &o  -L$MR`p P(@Ɉ 0 0P@0 @00000U0<K0KEP #[R? 460000000  SVL xp0x0t0|0h0hp0l0lt0# 00 0c(0 080 C 0 0Г(KyGP%*?h1S5h1h1S5h1h1S4h1h1S4h10S 㬀4X Z 딀吀0Sp 40 43뾂0Sp (0h$h43벂\r p R 3 #P R ` H0 H03h1hK(P4AQX@|P0@00 CrS00C00 CrS00C0Y0 S0000Bs (\$30(0ݒ 0Bs30P0ђ r 20P0ƒV9 `娒娢V4 \ 0 H0   Q `  L $ \  $ 0˒H`Q`  M R    `R0 8 s . S Q$  ʔ噬L0( @p Ti/H pp86p@Thٲ偉R ᤔ0 បt px  \0  R @@ H3P\0@0\0\0@xǔq q q QO q q q q q r ??)r Gr 2r ar {r r _ n7 r a r -L$MP@U`p `0S ◔(K0 S 0SS  0 tP 倔0L80 0,<0 ,0I@0 < P1SN Z| Z Z0S20KR OP #[R0Kw0 4< @R0 %M0PT020KS 3P #[R0Kw0u3< @R0 %10X\00 00ApG, 801 :01 (0"(P0@  =t, 801:01 (0"(P @ 0 <0,0<0 v00CSdx@0 PEYO0  0 00pX28090@ 0 P 0 00p0S  CRn1S S00 PݓU Dm0 0ߓ8086 0 ԓl0S *h1Ph廓 h wlp0S0S 0 RS  倓\  0` Xt r (s Ts DQs s ts s it s t +t Jt 7 t t -MLMHK0,@D00 0D08(`0\0DP } | x D   D  UK @ A` p 04pD.0 XHR0 0R RU` K A J`P50 P0DP )Th0RdC0P    P   0 S xҒl0@T 0S `0S 0 @0S ` PP Q. l @TS ` 0p  ✒ R ` R PP Q @  D僒`0 q(K07 t 7 t Ts u ;u {u )0% 0-@LPP0 "U0K0h -LM@PU M1`vh&hC (K` =p` Kt p/ KlK`V(p R00t p9p> p (KlK`VpP0080 C0 '%ppZZt UP000#?PUt0S Y  0 QP Km p0p0t0\ ' ] b -LM`@#P0 @1s&p@`(Ko0P#9 *` PQ QRX "R   ,,  Q (Ko " Q!) p0hp0008d00 W*: PRT0 Ѓ(   00,0 pHC|0S ?|0S 偑(Ko00`VW#P0S R  R R R R S0   ;P  t090000尀p00`vr, \P 0 (   P, 8 t p \P(Ko&D00@ 0A(K7 7 7 u 7 L -@Lp0PS( 080 C0  R)E`P 0 `Kh7\0$9\0  4xIt p0| Sx0p t  xu u 8 0-@L ͐K0hv 0-@L0$  廐K0h((v 0-@L 宐K0hAv 0-@L 墐K0h_v -L M@p`,LQ0,PP!,ERP㐀U`,@(K,P  R ,00 R ᗯ00`,P ,EኯPv 00S/\ H R0/ 0-SLP`@ @ P@T -`pl0LPU@0S@P tP@T/ -PLP@F Q  0Q`080 C|0*P`080 Cw0 0 S@4C@0`lA` 0̲ @P$ 呏 Q0Q80 C@0 P .0%%0 0@ v 0S/[/0Sl  0-SLP @ 8 `pP 0 ь@Tg  Q 006 X;  00b Q  R2 Q Q00D R00S& Q 000,0(080H0p<< $KkJ0S $Kkxt p0| SXx0p t zj W V Y ɬx`h00@l0S R @q9@0@10S 8 v v b 0-@L0 ?PU00x 60d 00P *@ 0$ R002000@4 P-L`@pP#X0  0S0#0080 C0 0s Hp 04 0崊Q0 Kh -L@ `Pw 00l@@;<4 5PU P= pP 0 `R0 :R `0BK00p84H$CK @P x@4S 8V +P(K PP ;<4 0H@4 H PP84S$0 080:o pBK HD `D4S$BK+ A8 @P@4S 8!T =w@9w@P 0P84 0@4 B>K 0C0BKD4 H 0 RY @EPY:RWPp\R R R <$@T:BT4 P@DT4 @4SN 8Kp <$ @`X; x:0P0fL , 0Q :Q00$ C B  RpG:R:   F JD$ <$D BQ#T4 <4 CP @D pG `FT4 s@4S 8,lv 00;P <$ @p`  DT4 ZT4 ZD4,@`HO `@4S 8qDP$0A0<4T*FP`:L4` :RpfpW 0 @p0p84 PW 084 0 S@ 0#SS pP P0a/&) 0-LM  0K K 0-,@L P 00 000a/ -LM0xB,8 0pS 0S`,0PP %$KK A ;d0P P 0@P/0 PP U ,( B,(R#000S  R  ,( RB^KPE0C R*K A d0PF PC @/ ! "# :P #P R R 0Q\S0 Q\R  :R0 0,8 S>K0CI R  0 A0S@Z\R  ,( B:R|R  0a/= ' 0-@PLAK0hL -L`= k@P@ dPuwu 00@^S0S:S] p00@\Sp0S:SP 0C^ 0@0LT1 0L\TSp$ ES/ BS CSNS RS" FS 0fS cS eS bS0rS tS nS 0 R@AdP 00Pd @0:SS0AR0@A P Pd : -L`= pP@ d2PpGPd0t 00@0S @AdPPd0 :RRAS@A P 0-L@# P 00S 00XS@ 00B ^a0BSW0BA0BS70BQ<,00 00-8@L0P 0Q0Ha/ -L M`pQʟ 8PV00`c cP00CS0g. Pp0 0 S,K*D nv@W00S( aqP  `v, \vP 0KղP000SW@0XP40S 047σ4 ,Q P04  S 4 ?@T Q P0 ` (KPHa/pd/Pa/ T00- LR@ R 0YPiP 0Ha/ph/ 0-L@HP08G0Ha/ 0-P@LPP0-P0Ha/ 0-LP.P H0@QP 9P87SU00Ha/ph/ 0-@ LPS P@0 0 0-LPP H0 @RP P87SU00Ha/ph/ -L MPUp``@oP@(K R 00C P 40 0 upP0 40T00ST!`@R ////// 00-8@L0P 00h/ -L MpP0 PW00p aP100CS0- Pp0 0 S0,@K0$0 ru`X00S pPTuHtP 0KxP000SX`Z``VtP 0KbP000S tP tP0 tP0 htP PtP 8tP${ :44aPvp(Kh/} -L Md0 @R R AP;,@0@00DLP0D Kh/h/ -L MPt0 `Rp@ @T 00P@0 'P`  Kh/ 0-L@P08D0h/ 0-P@LPP0+P0h/ -LM@p`P XPQ@ 0@84ST@p$Kh/ -, LM0K0B0;P Kh/ -LM@p`P X PR@0@84ST@p$Kh/ -, LM0K0B0;P Kh/@    / 0-P88pL0@ R0`0D'Q@-@S`P ^@ ^ p\, 0S'@0S^ p\ 0S0S0S@ R@@0@0S@\ 00SW@+ 0Sh0 P R  R 0  \0000 R ^P ^  @0 ^ 0S90^3P QR  Q0Q  S  0 0 0 S 0 R  R 0  \000^ 0 0 R   R  R 0  \0000 R PP P R R R  Q0Q  S  0 0 0 S 0 R  R 0  \00 0p@-PS  Pr0S R 0 p 0R5 3:p 0 @S5@T `V `@T@T@0@T@ @`S@00 0 P@T@ @T@0 @`R00 0 T `V @Q@T@0@T@ @`S@00 0 P@T@ @T@0 @`R00 @-@S`P ^@  ^p \, 0S'@0S ^p \ 0S 0S 0S@  R@@0 @0S @\ 0 0SW@+ 0Sh0P R   R 0 \00 00 R ^P ^ @ 0 ^ 0S90^3P QRQ 0 Q   S  0 0  0 S 0 R  R 0 \00 0^ 00 R  R  R 0 \00 00 R PP P R  R RQ 0 Q   S  0 0  0 S 0 R  R 0 \00 0@-0S000R 0 |@ 0S  R 0 \:rQ:Sn0 0 S5^ PUP^^ 0 ^  PS0 00@^  ^ 0 PR00 0 ^ PU Q^ 0 ^  PS0 00@^  ^ 0 PR00 @-@S`P ^@ ^ p\, 0S'@0S^ p\ 0S0S0S@ R@@0@0S@\ 00SW@+ 0Sh0 P R  R 0  \0000 R ^P ^  @0 ^ 0S90^3P QR  Q0Q  S  0 0 0 S 0 R  R 0  \000^ 0 0 R   R  R 0  \0000 R PP P R R R  Q0Q  S  0 0 0 S 0 R  R 0  \00 0@-0S000R 0 |@0S R 0 0Q53:S  0 S5^ PU P^^0^ PS00 0 @^ ^0 PR00 0 ^ PU Q^0^ PS00 0 @^ ^0 PR00 -LMp Hdi0`@H`FPPR0T +:0 00 z/ S9#4 80 00 JIi0 80J B P: S:4 \= \: `P@(K@@P` l/ p-LMQ0Sy A1` 6/`1!6/  ! Q10P! \`6/! Q 10P! \^`t 6/4K` 1!P6/4K`0 06/4K`~0 6/4K`u0 6/4K`l|0 6/4K `cX0 6/4KPZ40 5/ 0@ 4/Kpl/&% <F [n+ !R {>" S ҈ k r  x -L@`Ppg g g }yg Khu00@-\ l /o@ b2%", 0 10 RP^ n /o@ b2%@ ". 0S0S R 0S  P0 R/-$0( 0 010LQ\   $ $0000l/ 0-`pPML00`< @PEp00KTT qpGk@ \Ke|,0@$0\ K 4/0 0S Y&߆ l/00,0S/ Q05: 0l/ -@L00Ps P$0$`p0 ``FV`0P0`4p8`pU <PPP P48Pl/ L0?4 0-8?@ QLP:4@4@0P 0l/ -L MAD0@`H0 0$PPM @0@ @$@p T:0 S,$Dp0pW R# $0HP L0 Q(K " 00 @00  4 C 00 00@4 J   0 @00 00PQ(0( 5/ 0SL0P /Yl/& -Pd@LPpL`1T00SPL0PL01SwPhgPPl/0T0S P/l/0XPI X /l/ -L@M@AP\0`Sp)`0S&`0S S f`0P00P@0`$K @㸐T*P 00 \@$pi@ dK{\0@T0d KP4/ 0S X 0SP 0P0:l/(m/&߆ -lq$@(P@`@6e2U 0冑0C001$  0LS  h0S *0s0`FP0Q00Ql0 R1 *!$q P P$  QP 0R 00 0S0`Ss 0S P J @ $KkCl/- R 0(0# 0 l/ -BMLMEppWp[i0,K@4 004 0,4 04(0 ppCKARp00HH0@<00`o`U(Y Y +CKp~ ,0K04@CnK`F0S}Y%i@400S $0 >Q 0 x1D(CA3^@0HC3< 000 2 3!l < !|C $2hhh 01C0 0@S 0 <4 84 44 P,P\0`dP XPRt0 0t0t0S3R05 0S#11:PPPPLp(K)\`P P 004K2`V~A C9R񟗏&@(@(@(@(@(@('@('D'@(@(h'@(''@('@('(@($(@(8(@(@(@(@(@(@(&@(@(@(@(@(@(&@('$'@(@(X'@(t''@('@('(@((@(,(0 0=00 0800 030( 0 R0C+0)0S&0t00Ct0 t000000S0C0( 0 BR 0 0S0C 0( 0 BR00 000 00000000<4K0;4K0 :/E 3R00S?00< !g$L00S0p097l/&# P4 D0C 0p0S/l/ -LM4"@$P PP`r (0 @2#$`\P] BSpY  Zyg0H@DD)X!@җ X-1(@X@< 2S051 0 0S0 U00 S " 1X0威t@  dSU QP$KQ0S  PYS  Zg , <K0@,Y  Zg X0X@0l/tw  -AL 0pS 00S PP900s$P`d0SPV P}X0X`0\0S`0S PP ``0`$GWPPP0 0`0U 0d`V`p U01`5:RTpV 0S:S*G9X0X`0 ``l/(m/ -L MpX`(1:P@TU% `V P v`P8 h0l 0B1P $1h@(A  R  !P!@Pl@  Q :00 @00 $~SJ(KT@1Q*Pl/ -bLx0Sg:0S 2@c@Oop d0㓂$$@PU' 0S$ 0  B SQ0 @0R`A:|p p@C7"} @p0D d@/oD@@@D PU Y  ^ 0 B P GP  @0U 0  b Q2!  0 P>>>>>T>t> -PQ0LM0R0p@00,`K0&4娄080 40<0 40@0 40D0 @aP 0S nSl a0CS񏐃ES~}|{zyxwv&srqo8 \PY T000U000 \P[Y T070U070p [PGY T000U0000 [P0Yn T080U080 [P%YT000U0000oS [PU000T000u0}` [P (K@ [P , [P  [P]YI T080U080K< [Pp @ [P D ~[PJY8 T000U0001U080T080(U000T000U070T070U000T000 (KU080T080U000T000 4[P t -[P ~\ &[PxYRb4===$==L<<;;$;;:::H9H98 -@PL0<`K`M>Spmc0  CQHLDX\ KK KQ P   R S) 0$0h0xh01CP/AD`h0 \@ + h y \ (K Y  @` 0S!0=S 0SX4Y :0 $Q]wT ʟ! \ \[ Tod SZ*h* !h $Q`\ (K B8:y0A T jPl\h0`PA0P'* C!R̂ \ H" Rd Uh0 \ R @[(Kh\gh `\ $ \@)`' (K0 00 H‘\gp5 h0\@(Q 0H2 Sjh d0R*\0g1@Xh `$\@ (K  QHAd1H QVP>lgpl( ,0 0( ,0$0S0 0##0 20 >0 *K R0"ό  0Šx $0SD"x$0S  " "x$00$0!D*K0 C^HL  Kh0 00 0 0000 %DdR| 0D&$D%"D$!D$ %XK|K 'KP D H@v. @ L?% ?#T X?$ KP?%*K&000\@t D0$L^%zhh #c D#^ !X D!R D !M!D% #H"DdRD K&*K%<D p*K!D&*K r0#- DS R5 S RQ, $h DD*K  Kh*Kc 0yR " R >01"ό0 Kd 0 kR KP 0#!DD*K D%  Kh ##DD$!Dh% 0$%h 0S !p!D*K D%*K#$0S"x$0S"x(\ KU  RR $ RO D% #$' r0'00 $\ P"  0 x'x00 u(00(0q" 0"l,00,0h000d % D#_!D#R KD1#*K&S!D%!D#L0 K R04 KdP00(0i 0$0h06Qtp h %*K# 0&% K&!j'% %$DtD\$($##""l'd 0 K|Q K#d 0wQd 0tQ K%T 0oQ_   K Q P RlQ P\  0$$%_lm 0$d K0DQd  K0?Q$ -LM@ U02 U0X0 T^ 0gK2c ? }K pP# 0?K0`0@ v K_?K E# 4 @`H`X`D`L`\`a a |a xa ta pa PPt1Sp!RʄQ|!R00 1Sd/` `Vp!pFV0dV00`$`p0f1 bU#Q PK 004!R0 SR P`H@$ $" /KЀ80 FXp1<"R:1@"R60 YXx3 Q9Q2 @0>C 0C42 8 'PQ@x0S Tg0K 0J3xPQ@8|!R qW T20 (KD2 T rK WYXD2 /K`"&`Pp!&/ SXrKK$ P: 1!v> 001K 0P?Kvn@ `F 0a P0R! 4"0!& R1 őT 0$ 0 QP`p J 00 QP xT0S tT0SXxst Ϡl V 0H0}K2 {pP 0 KgK }npꟆlt5Q0rK1 vΆ, a`\8T KoK !rKp@PKP  0 TO@P P$0P" 0 K ?K R]?KPA _ 0BTR"^C@T0S ]Pà̌?K@@ P 0 @M0 QPQ ꃏK᛽S#00S0S@xS00 (K0rK1 HxЀQ0a12c1XßD2 S D2R 2$2#?K 0RBT"^SC@T ]Pà̌0S0S 0-@L Lp0$!T0L0at T00 R PQ R  /  4|p#`# 0@- DQ 0P S@@H  ^ 0S  Q 0#0S00{""H  Q j.0 0#  Q/{t00@-0PP X@o> 0" P0 0z -@LP`p @P@0%  P PP0 0iy0 0@y -L M`HpP% ؐ0  00 @`P@nN@  0 pP  `P PX M(KXP Pp(KW )N 6p< Ty -`PLQp @Q P@D 0DB(000S  < * -LMp@`P@( MR K ּ 0P0S BR0"S" 0@000S0 4/K.R0"S1Es\0@T000S PK1Es$ |)t ) 0-@L K0h -L MP`U4  PP2S.pPD xP@H BPP M \1000 `0@P- 0nS: =e@P00PPQ! Q P 40R 0 IQ0 @Q0@P(Kt000S UpR(K0oS@GEp h& -BML M`pPzQD bP:@@P  bPn084 8MP @c8*`B>K 0C`CK@4  0@@ C:p 00P<4 p @@ 0<$5:p \<=`P) H3H 0K 0 9pR  :@P HM 0KK #  K  "9P K -L?M 0KK #  K  9P K 0-0LM K"0K2TP K!(0 P000  00 /\vh@v 0-LPGU@ O?( $ 0P 5/0u! 0-LP9U@ O?( $ 0P 5/0u  0-LE@P0003/0Du  0-L@P0003/0u  0-PL00P0S@ 0 0 03/0tD  -P@LTPQ` $ @04/8t 0-PL00P0S@ 0 0 03/0s -L@P>S`PDO,`0 Kh/st 0-LP@P 0 0 03/0(sP --LM0 0 |p@ 0 003/Kr 0-L |p@0003/0xr -@PL MԀ(0K 0`@pCB(0S N@(0`$ @6/ $Kq0 -@PL MԀ(0K 0`@pI(0S N@(0`$ @6/ $KLq P "}yuqmiea]YUQMIEA=951-)%! ///x/p/h/`/X/P/H/@/8/0/(/ ////////////////////d@,|hX@,|hXH4  -LLM@pT00PP S S S M00 (KH?0<0 0SJ  < P Y0J"p p0 T0SXTT` < @ 8  0A0 4 D V; `Ff \`3`"V= R0PL @D 4P Q>3@5 2 T *`L0  J < Z L0@@ T p<3p2 7X` ( V 80<S  Y>0305p20 0R 0(K8@<^P0 0 4  T4 85`%5`5p2 VP;0X, D Q)R00 L @D04Ppp S>03@05 2 T *080 J < 80 W@ 0"  p0< `8 g@ T`502`P Vp0,8 X` VPT`P VP@ T !`5 102;0<0 ;0<0  &K ` < 0 @T X \ 4 8 0 QP k * A<RdD  l2,! L0,   S3"QJ 4 RX 4p 0C@D0T0 0\PP S>034 5@050240 5 T * 40J < 4 A004@@ Tp0< 3p2 7T R4 \P, 4 t   ` S3" >L b@` L` lL L` L8@`L B@ 8̠@H b1̎D` @ ܄KPKK`I 4 RX 4p 0C@D0T0 0\PP S>034 5@050240 5 T * 40J < 4 004@@ Tp0< 3p2 7T RW P FRs ` 4 ` `R  P0\ 0 l \c P\0 ` 8@<Q  RX  X \  \ 4   T4 8 5% 550p2P FR PB0 p04PX` W- S+UX  B@D T  P\` R> 3@ 5P2 T *00 00J < Pr00T @R  0< p`0 40 0 P 08 @ T5 2=QF  BP  Tp400 `PV Y+ P R(XX A@D \Pp R> 3@ 52 T *00 00J < ,00W@  ` < 8 Tp 00 p4 d@ T`52 p8@<Q  R\ PX  X 4   T54 0p2  B8  04P0 p`V W/ 8 R,UX  A @DT  P R> 3@ 5P2 T *00 00J < P00T @R E < P8 \P p 00 P4 @ T`52 P0 J&K  P@ T # 3P00` %P!p0P1` 50@ T!`512 T , 08 XP0 ` @ T *TP+@ T*`TP00 0 Tp 4 p` 0 4P Rp0 @ TP=03p20G5&KJ < dP@`   T0p0Q # 2R` T , P8  BR4 RX 4p 0C@D0T0 0\`T  S>034 5@050240 5 T * 40J < 4 .T00 S40@p 0`0 40 0< P8 f4P pP0, \P 0 PT` 8 Y R6  BR34 RX 4p 0C@D0T0 0\ S>034 5@050240 5 T * 40J < 4 T0 40Q@p@ T0*= 4 pTPTP`X@ T #0T %x*= pT r`0  BR-4 RX 00C@D0T0 04p \PP S>034 5@050240 5 T * 40J < 4 T00 S40@p) 0`0 40 0< 8 @ T0 #9*# , ` pPT 8 @00 TP *=0T p4 0G`4 T040 @ T# 3, 500T 0%5p2` 8 4 < 8 004 T 4  `4 0 00-LM@0@K0 p-`PL M@ 0 / 4/Kp -LMpRP@\  U`PC/7Pa` T1 0(0p0. (K0S% 1 0 P0 p03I0S0`0 P0 p0"I0Sꌠ I0S 0(Kd 0 ` 0I 0 I 0 D8   -L M @@K} -LFMGnKQBNKM @D `FPpF+4 @ ]P@)T  ]P@T 4 0FA` 2 2V0(KH 0 (KH 0  -@`LMp Pt@P /j]0SP 0rS(0rS00P 0000@ @0K0 Kh}0rS @ 0@ +0KVH 0 p -@LP p` 0/S /]P @0 Sp 0 S o, @ p-LIM M@AK` @PP KKA4p 4: S \0 0ip KpG@O00Kp@G0@0 p-LIM M@AK` @PP KKAp 4: S \0 09p KpG@O00Kp@G0@0 -LM 0KK #  K  0P K80Q 0 080/ -@|LPP` | PP u |7P  Kh%cP|P --LM$0 0  K --L M0 0 K -- LMgI4P $0 0 K 0--LM@eIP0 0 K -L,M`@pPP @PP'` TKPp( ?0S W P@ @ 0JWP )I(K00:1L0  0-`0L0MP0HF(K0<@K@ @ K000 0  -LP@`Hp Kh -LM,, 00  K 00 0 n -LP@`Hp Kh] -LM,, 00  Kp -L(M`@PLpKPEUP( ? p0R0d 0:2D0 U @P0 @T zH$K 0-\0L0MP0DKK0<@K@ <@ K0\00 0  -LP@`EHp Kh -LM,, 00  K00 0 }L -LP@`Hp Khl -LM,, 00  K 80Qt 80- L80 8X80@08 0880 00< I 808800t/ 0-@0@0L0S t00l0 Xi` PP0L00D>)+8000,8P0H 0-404 00L0 @>P80@08004 0-L@>P80@0800 -LM0    K -LM0    K -@?LmM0PQp1 p `  P?p!K͌Z P}t?p!QKK͌T Pq0?p!KF͌(X Pd>p!GKF͌(W PW>p!KC͌ V PJX>p!KB͌80S P< >p!|Ǩ0S P=p!TKB͌l=@ 0St=0SDH0\͟ \@4 P$͟ \ D  Q̟ \ P̟ \  h QX̟ \ $ P̟| \   QT˟ \'( |  P780@1 T0 P0AlA  |1 0x1 d1t1 tx1PQ,0Yx!10 -! `q tP@ Z,000 V?j f`Xʈ`0ws!<11 P,0|!B 0 11 00p#=S1 @0C1 |1S+` 0C 1 A 帡 Q @Q0P nZ,0!0 0W?f  1`SA帡Q1S S `|,0封0pD,00xJ=p , H0 ?3p3 Z H0x1!0Sx1 b01 I@P@t0A 1 B P 0! 1 ;PPPL0Q 1 40P0`1 .P|!0B BR1 0T! 1 fʄ01 !t1 =a! 1 xA X @,0tQ0p0P` pW,00p0T? d@X Px1!0Sx1 !t10t1 xa V,0@0APDX,00x<pH , H0 ?3P3 V @0!|10C!1 R0Q1 ʁ01x1 1 !=a! 1  t X" @,0t!xQ0p0P` pW,0t!0p0T? d@X P1!0S1 !x10x1 ڀq嬁Wʈ!,0P1Q`AD,00xp<p , H0 ?3`3 W P0(5p 00R 1S$ ,00!`0Ap!!1P0X P(U,00`p0X?3 #h=01S!| Q(,0 A0` p t! @0Qp!!1P0, `V,00`p0Z?3#h=0R t1X!R& ,01-pp! 0Q@!!1P0 @T,0 0p@0X?3G #h=01S!|PQ,,0 t  A1@1x! p1 `0q!!1P0 X,0p!00U?3#d=0D x1@S ~,00` 0 ?33`00wsD,00x<;p(K#! x!10( TKH:( [KC:{ ( QK>:( K9:( GK4:( K/:( K*:( |K%:hZp1 0KA a P@`pPP  U1AaPv R:Ka С A Q @P`PP   U aСAQ<@!R! z.KЁ A Q @P`mPPq 1 U `AЁQ_`Z11112@Qc q P`pNOKAPPE U `qJ@1p 00Rd80000S`ꌡ11 1Pp!U000Kx @ `PP@ 0V  ` xx pR00t Ppp`KPP 0U  pt@0T0D0p `@PKP@ 0V  `p0Ppt!W00H0K|Q `P@P` 0V @|Q -L[MpC`[?K@p Pp x1 @3?K͌l1Q?Kl t1 2?SPK͌D1PDQ G_K2?c`F͌(1`a `K{`2?spF͌(0p0p pKn2 ?C͌ 0̀ 褀K`1?B͌80 ᤐ |KS t1?̌|0 0| TKF $1 @?BM@T0T `0t!xp(KQ?Kt1 j G_Kv `K 0pK 㤀K |K 0TK   p-LMLL `P @0`0P @Kp| p-LMLL `P @0`0P @KpT0T 0  D@Q 0Q(00?H/ᴦ00 D0D @ 0 R ,  R$ 00?H/<00 - 0DD  0 L R  R! `?VH@PpqU,010 0RD   (  \@T 00Х000 00-L L0 H?3\0 ,,  \00D̤00 -L M0XaSP`(KPx@P"T= @00 Rp @p0R0 T0 P X@0 @x0D0T pB@W`0 ?3Q HQ@   0?33H0P @xH000 00 00-SL@P ,P000 00h-H ?0 00S 0 0 Sx0D S   R 0S 008000 00ꄡ P0-LP T@T0{0T0@T0 00 /ܠ -L$MB2@0P`00 V| t2*lh2`\‚0T80 ‚@24 8r 0< (Ÿ  2 H0 0"$0 @ TpXppD \p H0p`pphp pip0pjp0zP吂8 4嘂<$h0 T@jXD\i`4 04  1 0 %0  00  W(K舠| x|p 8 pl4p d< \` @ P P0D H0D0 400(8$@ d(4 -prLMPPp T@P 0`  PZ3$20"Å"bbbdbhb``c ````cc`FPV ci pQ p|L 0p RS `b0``` &P: ```0 &P/ p+ !p' ``0 &P  %OEZ000S :3S V$K|$^\@$Kh0S 0Pj4x  0-@ZL$||:8(0( 00 R  K0h,4 -L MPP10`PC+@/T->  | ! _|o#*:!Chd1W?Ch3:| R 0S 1qȌ0 S Q(KQ  10 S>t!?ph`pG( P3 U(0 (K>v<s^pvm8#j:g0'd#az #]H#Zp-W-T`_Q|NoKpHrEyBz?{<@|9h}6p@TT!,&+!%nvu#s#o4%%$%#d"e"D@ -808 0@L_k( @X3T(PL -L$M0070ǟ 0 < 74 080 70L0 7J0H0 6}0`0 pD0 Q00S[  p #p PP] pTPIQ Ĕ0 s 00bR SP 4T P60 P0/N 0 ;0  TQPEPaU 0 ;0 4p@ w @0SV 4@ @ P0u0PPcRTT 4U P%5 0(Kp PP  4P 40 s 00bR$ 4$ 50P0/1P~Q  q lRQ $ 04 T0Q00S<0 S0 pk 0P@6 pb 0  $ `0Q0  40 n $4Rs8 R  P0u0PPcRT 00S<0D S{ 30!` p4 O0P@h p+ 0 $ 6P 0 r  ; `R $0 4p Pl pp 40 s 00bR44 $RJ0P"0 0(KS0P@-  $ `0R0A 04 04 0 s 00bRS44!0PR40 0 ;04pm4|S0P@c `000P D00 s 00bR A/o 4"x1x0!`:H00`0044 0040 s 00bR44QL 10! 0'Y4L 0 s 00bR4k00g  @0s444 00TP0u0PPcRTT@ pĒxAp$QH 0-P@00 0L Pu8 T TT0$ -LLM4 8P@$ 0P`V e :Ó\jQ A300S(K30h0 X 300S  8Z %P P@ \0-L@n4P @h4P 2PP0QP +/P P000 mR R0@0R0 1BQ;R" S0S0mS0 C ;S R00S0 S0S0;S0C  Q0R0R0R0 S0\@ -LM0tSPp䔟 J|P M0m 0Kr(<`0"( pD|2S #R $ lH*PK?T0 ^TD=*P UX R4$44 |0T`# 4XS0300SJ p0SG 4S 4S> 0t#W2l"Q匑T 5P[ p3l2Z; L1S80 7 `P3 800P, <0 8 4<018 R! 0p22Yt2!2Ux2  PK 2x2h(KL%R4S 4S0?o2 8p2l2Yt2 PJ H2t2 0D p$l h $ <%$]U H3P1l2Y @3Pl2<l2Z 73Pl2?;~0l2Y ,3P1x2Z $3Px2?;~0x2W 3Px278x2U  3P1t2Z  3Pt2?;~0t2Wz  2Pt278t2q|200S0X00 r(0"([C|2Se1S0% 4S!hH5S^$hH@$ H0 000 0$  T X| hp  ` lT pH t<  x|L@$ 88 80 0Q $0X 0/0~  -L M\`pP@T 0S"!0S S0S0YT0(K 0  -LmP 0, S0 2 h< -LM@bdqPpQ$K p` QR  0 $K00$K PQ,0 ( P`( ,0 ,0 ( P( ,0 PEᰐ帐 少帑P Q8(0(0 0#t}Hм -L@PL0Pp p@Pp `E`PE0 0"@0V@0 t 2@  -`\LP@U 0S1 RU0S@"0@SKh -lLp`@S0 SpV0S"Q0S 0SV -LMP0 00`P@ @ jJBK0pPPPI0|" QU /P , [X$Kzxеy - LML0L0 P  K 0   K,y \0 Q0-0L@D00S :T "0p00x -0 0`L0PS' :#CRQ# # po0@P: #Cs## B0:#!BQ##Xx - LMH0H0 P 0K   Klw8 80 0Q $0T 0/0w$ -L`ỮPp@P 0@ U30SP0`0:3S 8 80 0L 0:#v@ -LM||#  t3tS0l*`d3B0<0 X3P08 0 p 40 P%Wu 4p p P@q \p   0 @s 00lR00@0ϐ1PB PR RZ RW00d S 8 `2`0!`pt u @@X%pk t00 ?R 4` 0 S[   r  `R R  1 0 (K ! \D 0 ^(K:p P@0 ` (K@0s 00lRS  @0 S @@ ` 0 < 0 @Bos 00lR00k s008`0`0 0M!㨲@  0vxuuuu$QtsHlr -DSD3P`L@P? 80$ R, ; ʌ3SX#3Sp 0C#3WQW " Rp 8L !0 00@ 000@"PQ 80@ {p0K0P @0 PES 0 $P(KDOP <0$C02@080)(K ``EN -ZsLW`@C @P03Q4 Q'W- Õ@ @@DP00  W#, BO@\  D@L| @W@3@TKh 0-@PLP T0:|"C02TP0:CT 000P 00 6 /d808 000S :3S /xB<0< 000S :3S  b/0B808 000S :3S /A<0< 000S :3S  B/A808 000S :3S q/PA@0@0 0\ ʌÜ\ 0  !/A 0-0 00L@T  J3$S |B0pQ 33K0h)P K0hk0@<0< 000S :3S   /@T T  P 00R0S*P4@//?000 000S :P /h? -H0H 00L0S :P p Kh ? 0-0 00LP J3$S 3S p K0h|B0tQ 2K0h{(0>-$$ 0  >000 000S :P /= -LM008 0p`V# ,@K [$P0wp AP 0 0p kp@ (K 08 @@=P  P 2/ -jLP R3S @P4P30@SKh} 0-@L J 0s3$ PSP"0P |2 $R 02S 0L3H |20"1#3003000x0P :3S// -8Q@PLP( ?0S&  0S  0S0$,"0|00 R   R   R  P   4T `TT *2S Q P Q0 4; T0-:|bL0PT!@RN   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @ &  (!R 1S ^  08!R 1S X00S T@ |'(@ Q0@0@!R@  @  T0-:|2Ha0`T1LSP@/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  X00S L00001S@078@0  7t808 0 P @0?30Q@ 080/\6(0( 0 Q0/6(0( 0 Q0x/5\0\ X0 0 T@0ʌ|œ78@0\Q0@0/50 00050 00H 5 0-P000 00L@ :04Q@0?30R@ 080/R/R/ -PSL` 0@H@?-$$ 0  3TD0ʌ|œ  \ @0R78@00@0/@/X 0-P@LM00 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/3t0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/X2t 0-L@ 00 0K0h01 0-LP@ K0h -RL M@ 0P P S CKh p Kh 00 0 H0 -LP@`#p Kh -L M@00 0  @ K/ -LM K -LM,, 00  K\/ -L0@"`  (  P \ GoD  Q\<PH    BQ   Y(K0GS18&0 00 000 00   P 0S006 , W10 000(K00C?00(KT0`Xp`00pGW%ڬ` 0W00 0 p`8 0  000000000``00 -LP@`3 p0 00Kh -LM,, 00  K4! -LM K\0\0T  0 8Q Q @0<@0/6S/ t< <0 0001S 00 @0<@0/d tP0P 00008!R !R @0<@0/6S/ t,0, 00001S@0<@0/t\0\ 00 T0:|20(Q Q @0<@0/6S/x0 000@/T0:|20(!R !R @0<@0/6S/0 @ /D0D 0 P0  Q ARLP//| 80-P L@`P! Qp LJfY C<00`V $00P40 00\Q 0S0BSLP //,0, 0000P//t,0, 0000P//t -L M#3 0@`V 300S`H0c`0QL zSP HR  H4 4 pAWQ ,  X    !60pGWPEC R0 6q R*0 ?33Y0",0P D `Ĺ,  xPPp(KP R4 4   BR 00pGAQ0 4PU 00C )0PEUP  (KSaa BZ 0 0 PBU4P ,0   ^  0   !Y0 40R) Rp W,0几0D Q0 `O,0 0x0p0 ?## wp4000Q40 P00S`0 0CPVPpW x00P0/ 00Q /p@-@PpP`V0A(, ,1C Ba00V00@PpP 0S 0@//P 0S 0@///// /// -,0P!PL3@A,0p QH`@?cq``W2800D嬸xp0?330 @WD圸Z0?#R RwsL\ 0 @ 00C ,0 00?oT 2 R0S P/(00!//-(,^0R0SQ!R@ -L,M<l |0^Q0P ,!0 8C8SP H0 P00S0x0  H0 PT P00|0 |0SP0,0t0 T0 @0 =0h0 P0@@0,0T@1X0 P1L \0 `00,01L00 x RL 00P `0Dw h0x p h @0Q?330H0 `0\0,0000,0\0`V0V 0Zp@Z1Ad P `\Pp,pLpP 0A @D08` ?388l p@0P0 H V8So00S4{  0 \ p000|PE p0SB 4S 8\  >l @P ` 0 Pp 00pS 0P 00P fp C 0p` 0 0 B0c 6 P080\00S0\P0@@ 0mp000P   U P! f;1l  0  8 Qp000P f't1l  0 8M RPlp U  1P 0 1Sl@pP6 V 0` 0 L5S( 0\ 00RPlpU 0P 0L pP0V0p L  `4S 80S00Q0So L5S3r p-LMP0P`@0 R    80t p  PZ80  H00  0 B 0C/? 0 0 Kph0 00 -LM@ @ X\ `0dPPhlp`]\P  $K80 8000 0BPCp`op`$K( 0-@PL0@T0 -1!00L0PSHp0?sppS,, ` !`@aT:pDx4p0?330 @V DZ0?# R0 SC 0 00p P0-L0@8T0 p-L M@PP U 00T00S T PP @@KpU  Kp`00`@PT ㉠P @KpP/  -RL`p0,S@ PPP 0S @ pRQ A@0"2"#,"Q/  00C0/ ,0-00LS  -L$Ml9li0h)`@P @  p4P P8 3 0)0<0 ^ Q  pqp!gRUp=40 CR PPx8p0IS0c0PU XጐPPYPUP ȟ LL  R"4P^0 q  `RQ0010(p RV ( RQ E P 0\U70 7ا؇ؗW0 00  P0 P R|' R  R  lP R LP470 R4  8  (K40Spy 40PA{  R E PvpQPEP0P0xP[  rPQPE`V`vPp 0 0 aP 0 CS<00PS 0IS5%5 0<0 5H` 0D0 5`000 0P< :D0P00p X 0 ~qpnR pGpWp00P0S 0S yP50P$  4P0  <0 R T$04P<0 $ 00Q |40 p40 4PU001R A P XYY $ 0P0C 0<0 R60\300S V0 P0CSXH`#00P # t30l3P0p``sp U 0PE0PxP  P U30<0 3s000  0 p@@ 0S @2P0PP0UXT00P 0 ]P2  ,0@110? ^% 00P <0P0S lP, ! 510  H = 8R.#=SS S@ @  0 ,0101P\1dT100S i fP0S a]P\PP0S M QIU,t@40HLd<,|0 Tlоľd -L MdSd3P0\C @00 p0S0  `W_ # 3p@ T10 Th)P b` @P 00 00CS  .P ʔ2 n0Sx20` d20  (KP<BQn(   @DR  T lPT ` R ! :10@ `%`@ `|l1 Q&T `` @T  Q P%     lP l@T  `   p @ReBF @D`@ ^ ` O  p ` R  h R  %P ~꼶<@tD,| -L 0 萹 -L 0 XG-t1t!0 lA M*⤂X5 PP!0 @ P0S& Z0( S!`,ppG\0  R     \0 \00\ 0`SXЍS,P`PEpqV0 0 0^  Q\Xꔲ0 00 0Q 2S0l%R h%R //!R!RtP//t 0 000 0/ht -L MUPP; |5p 0q0  Q࠱젣X2`s. Dş8#8 S1005@0Q 0P\` 4  0P 4 $0 :l“@ 0@lQ hQ 0ʀh20d2s% |202,d"d",d"d"+d"d"+d"d"*d" d"*d"@d")d"d")d" d28d20SS\ RfngSW RoYc0SL RoZ`SB Rڪ`ZaS7 Roi~j`S+ Rڪ`Zb S Rڪ`Zc0S R[-²S 0Y[=.0  0S 0Slp" 1=,,0  0Q10 "7! 0:/pbV. !1 0 pA0S! X100S 00H0Y 0H0删 X ,01 0 0 00Q ^2`V(K 00 (K0  00Q 0ʀh2Q 0ʀh2Q t5S 0ʀh2$td`9 \1P0-0LBH P=P00 Q6\4 00ʃhœ\ 1:p“ @T pƒ 0@Tpƒ 0A\ B\  0    Pd,1P-0E 00` P?ʀ :h“2\0 @P)#0000CS 00000000000000000ܨ 0-@LMPP@$\U Y͌x#3 P |P 00  (0 K0ꔧtXP- H\P Y͌# Ԧ 0-4410L :h2S! @10@ 00S 0 ,Ǡ 0 *?pB00 R  00@S0AS h3d0 000:d/ 0-t@t0@0L0P:h2S S0H0000P000 $ @0 0@00Ԥt -Q1P`!@@0L# R#p碋 hQ! Q!͂,Q:0S6|20 01  1Q;@0 78 0@0!-, Q#0S|20l 0  刁Q*|20h x0 } 1Qt 1Q*|20t</ 0-t0t 00L0@00CS0P0 0 SP UnP\ 00-0CSL@0P0 k0 SP UPP 0-000 00L0@ᆛPQ0` 0-LPz@E0H H ? ?  Q P//?? \\ //@-Q @0   0 B0CJSR0 p@-P00`@000 0@\1000C1.T *\ /\pR00p00 0L 00*\p -L$MqS80 `pP) 8K 80< @T  F(D @ $T  5/8 080 @TX <0S  0F8#8 S00S= (K <R !  "! ".P  RH >L0 PL0H  ,K !0 80 bX00S P00@  R0SD0?D@P  5/@TD0`0<04@P  5/@T؞ L 0-LM@ RP !R "R Q  (@0SK0 -LM00 0 K,X 0-LM@<<<0 0P0 @-K0 -LM@@@0 < 80 @@ 0@K脛X0@-DB000 \S@R ^S? %@@; ,S'S \S:Sb{cS10LL A0}dA0C000000000 SPU. 00ES0@P00 01P\00C00L0'000 zQ -LM(0K .$d0(CcX112c0A!!"b L0(!02!1@K赁N g 0-LM 0K w. `0C@2@0L0 B 0LL0 !12@K0kL0 > -LM(0K R.($lL A0@ 0$4ƒ!b1cP!b1c 0@ A 9 ,!#3!c!b1@K-?L *S0%p - 0  -L$M8  㒕PP 80 `0 8` & 00R0`@`  xx mnΊ@ < ,RH6Ty \ 00@0 008 0 @ 8 080  RS  Qc%R 8 p+0GGSK#IHFEDA@?>=<;:9865420/.-,+*)('&%$#"! [     iT0 S\R 0S0\S 0 S000 V @0pC0@ T$ <000 00 0 0j/>0 0000 00 0  00 (K080  "!.Q *Q080  @0 R@90 SP0K@% 00dW0 00@ 0 d p00@0 8 h90 S 00 @000008 0 $0 S k 00 @000008 0 0 Su<0 00 0pK000008 KD    0 oH  00 D 0 pH0 @0@00@000 8 0 SBPN %00@0 c 00@ 0 S2P00pKD0 6 8KZ%+0c 0@0 0Dh@0 000@0 000 8 % 00iW0 00@ 0 p8 hdP 00(K0pK4D 0K/|` \ l p-L M@0@P`0S PS"  00 K0"P 0 Q0 Q`00P0H0x 0 Kp:0 Kpxt ȕ|  -LM0S 0K0 0KK@0S pKU$P0 `VP$@U @ 0PfS=PKKD`Q`-P0 ' 0K\t -LM0S 0K0 0KKP0S pK4 P0 `VP$@U @ 0PnSPPKL`A`P04(0PK@t -L M0`S(0K0$$!'0K&Kp0S= (PKP0P4耟AP*0< qW# X $@刀0sSPp @TWV 0S h@p@@ Kp Kt 0  -LLMX l ᜒP P0K$ h0 0X K:` R0K @P Pa \ 3s0p0 >0pl0 0SM  R T0KS K`Vz #V =V =`P 000`d0 l4Pw  XV 0 0Y*S\ Ɠ0P\0 \0S0, \0 phVP jhd0 PSN :`4 @P\P@xr`,p\ h` V AT@ 1 PIhs= 10PP =h g` VP0\0 (KT@KZ$P 倁 0Pd0 I d` ~0, K$0VT`K= P 4倡 P 40`d0 @[TK"0Pl0aP P 0`@d0 >d0S (K kd`@0H p0<  Ll jD  400 0S0-L@,08QP P2P,0P0 Q0-PLP@P040, 4P0 -L00 -p`@PL0\ %\0pS sS lS@ 0\TT  1D!01 CR0@CUPW  -䯟LqMQ`P G PH 00 40RQ yOK$ { =KpH qW0 qQ R K_Q %Q rP Q, 40,(K@P%T . ,pK>g01 0DXSXaVU^SRQPONMLKHGFEDCBA@?>O<;:9876543210/.-,+*)('&%$#"! ( 00 00D =P@0A?S@0@0^ R!1! D]R񏐲!~}|{\yxwvuvsrqpPlj hggdE"a`3p]\[<YXXU^ \ -00A|l0@01K0]P(KJ@`VP` 00040㷏P, 0000@T$ 0D, K!@00 Y 3  P ,40 *wp 40P4 0pW 0G, K!S00 夐 pG,0K1&@D0p VT)s'&%mD"> 4!B;Z    $30@T @D,0K1S0@ POQ9 ?Q  ;Q  Q0 0%Q a0A RA0AS00OS3 A, K! ,K!000 1S101 1Sx10x1 0@T_ @Dp,0K10@ P ;OTYw10A R0 OR,K1PT  T 0 0 R ,0K1X@ BT0 ! Y1 *P ,40 4vp 4004000@OS ,K!!000 0'SS 0S'S'S00S  0C, K! 00 RQ  ?R ;Rn PeR~ Q %Q0  01 0000 0B 100 OR,K 00 0}SS 0S}S}SVJ0@T @D,0K10@ a0A R/, K1 90pW pG,0K1!T0p ' ~T 0pOW,0K0 00  R  B0 OR,K1 ,0K10,K1 0 00000&@D0VTm|yH00&P @0p0 ,0Kq1@ 0@ 100-00< P$ $0!T0y ~T F  G0060pOWQ0, K1!p夐0p ]0pY0pY ;0p @0p0p00pY0pIoᩒꌄ'0pY r0p)0p P0pPi 1P @A0AS3AՕ/o"P  --LM 0  K --L M 0  K --LM 0  K00/| -L M`QPp@. 0S0T0 00 KW& 㺍P X * 0x09 X*T %Ti K`P Ppp0 0 R0S TD T,T T, KWp 2[S "[R1 000ST00`P x\00lUP m\00@๹4൹ p d ht@ 0R -L MKF@P ?K -pL@P% T% I`PV @P|/PP0E6V ᐷo ቷP -PLU`p@ &ˌP T  -RL MPp 0`BS@%  p7 0! p0 0$p) 0S `P ` .`K B[@ 2[@S@@0 2[@S@@0 2[S 2[S 2[@S\ 뾂[X $ P $0(K 뾂[ 0@X $嗍0 $0 0$Xp 0S0 $ ა@g[ A @nR  sR fR  0 (K @R00W0S0 0 0 0 0(X0: 8뾂[@X  / ྡྷ[*"[@R AW H(X@  뾒[@Yo oI ) ਂ  ྡྷ["[0 @ YT 뾂[@XC H(∀ @T2[ W Qp‡X+000 02[@S@W   @~0 0?o"[2?000 @0n0% -Q@!LMPp0 qt P 000S4 P(K!`P 8PK4pK 0p>"p 4 RP"(K80S! 0 qPP PP 0 00PP+ P4 *!`P 0KM0 0!P84  p 0pL0SE0L/S'%$#"!    p@r @0@Sn HDHtP  ` fPP0 0 ,KAa  00P000| 40@ 00@> 00@84| 0000  P@ \0\ P(<v 4 (K@0P0 CR |  00 0x l 0VqV0pGWp\0@p\ p@ HDHt (B(r@U Pn&Py P $0,KAa  ,K$0!a 0x l0P0P 0 lV 0\ 0 P\ @p 0\ 0 0\ 0 0\ 0 0\ 00\ 00\ 00\ 0ĆPq (B(r@ S0l  000 f0 !ᨆP\0 0 ls 0x l P@k=<庆 (Kl   0 s0  ?U0P% 4 0 lKl HDH 00@ n0 ,Pst`PZP 40,,KAa a40,0,K40 aaX4 80 04 80 0 l@lX  PZ p @  d D P/ p-L4M0H`K2P@P KpmY0 00S !R2Kp| - Q !P 1`pPL@7 0 4S0 00"0 P,GPp00|PQP`  5YPpgŅGPQ  )Y|0P0ŅPPE00Ot 0-hP@PLP ԅ҅Ѕ ΅$̅,ʅȅ00 R00Mt0 000/HMt$0$ 000P/ /$MtxW$P00//d -LMP00K 0,0圃c!1!1"b2c L0@ 0 0D0`@B!A@C0P$K赁N g P01cK//p -LMPB00K Y,00 a` B0C 0"2@0`AB@C1dKP$KkL >( 0P1//x -LM@00K 0,圁a L0@ 0$4!b1c!b1c L0@?AA0 T0 !S1e1cQ80PB0?EP$K-?L *S -L M`p{ 눀 00@0Ps ᫕P 0P K 0@PI -L(M'rrM26f=>b9|{zyxmMutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*0c\D0 p|+ <@ pPUZ"<"KDKb P(0S% !00,0( $K0c\D0 5+ (<@ p0S0"<"KDKC P0S; 0 0!00,0( 0c\D0 [|0 "K;@ 00sSt0L*0c\D0 E8* L;@ p0S2":"KDK P0S; 0 0!00,0( 0c\D0 ʰ) :@ 00S"`:"KDK Pp ,0( 0c\D0 \) KX:@ P0S DK P0S ,:@@@.% 0 FS"00,0( b0c\D0 ( K9@ P0S DK Pg0S 9@@@%h0 +"00,0( :0c\D0 ,( K9@ P0Sy DK PT0S 8@@@$0 "00,0( 0c\D0 |ʔ' Kx8@ P0SK DKZ P)0S L8@@@$80 "00,0( 0c\D0 Q& K7@ P0SW DK2 P0S 7@@@$0 "00,0( 0c\D0 Id& K87@ P0SZ DK P0S  7@@@f$0 ~"00,0( 0c\D0 @50U@0 0 1"K600S DKP= ,0( 0c\D0 lş 0 @ l P66"K600S DKP2 ,0( d0c\D0 ğ 0 @ 嫘K5P0S DKP60S50 0!.!00,0( =0c\D0 hğ 0 @ 儘K5P0S DKP0S40 0!00,0( 0c\D0 # 4@ p0S"|4"KDK^P0S\40 0!00,0( 0c\D0 L# 4@ p0S"3"KDK:P0S30 0!00,0( 0c\D0 " t3@ 00Su"3"KDKP ,0( 0c\D0 3p" 3@ p0S "3"KDKP0S2(0 0x!00,0( 0c\D0 ! 2@ p P0U"KDKPl0ST20 0Ta!00,0( pc\D `@ pQ* 0"KDKP0S10 00=!00,0( L0c\D0   K`1@ 00S DKP ,0( 6HP ? X P X  l  ,  0 8 h    X ? p  P t $ H 0 | X L  G4  x Ծ Ƚ 0 8 H Ժ  L | l  \ ع L @ 4   L $  ȶ c\D 0@  L1@T" 1"K 0㣌PDKPm ,0( 0c\D0 ʸ! 01@ p0S"H1"KDKP0Sh10 0er!00,0( 0c\D0 @" K1@ 00S DKP ,0( k0c\D0 ʔ" 2@ 00S"t2"KDKP  ,0( U0c\D0 " p2@ 00S"2"KDKP ,0( ?0c\D0 ~< 0 @ 冖K2P0S DKP#0S 30 0 !00,0( 0\D0  ~\ 30@0 p3 p0PU?"KDK^P0S3 0 0!00,0( 0c\D0 `$ 3@ 0@T 0؋"Pp404"KDK3P ,0( 0c\D0 $ p4@ p0S"4"KDKP0S40 0!00,0( 0c\D0 X% 5@ p0S"5"KDKP0S850 0q~!00,0( 0c\D0 % 5@ p0S"5"KDKP0S5(0 0MZ!00,0( i0c\D0 h& K,6@ 00SDKPc ,0( S0c\D0 ʼ& x6@ pPU"6"KDKPL0S60 0 !00,0( /0c\D0 2D' 7@ 00S"d7"KDKwP ,0( c\K#KD ʠ`pbKx@ `Q DK^P0S70 0!00,0( 0c\D0 (( K8@ P0Sh DK:P0S48p0 0!00,0( 0c\D0 wʰ( K8@ P0S DKP0S80 0!00,0( 0c\D0 8) 9@ p0S="49"KDKP0ST9 0 0jw!00,0( 0c\D0 g 0 @ ͔K9P0S DKP0S9 0 0CP!00,0( _0\D0  \H \:0@0 T:pX 0"KDKP}0S: 0 0*!00,0( 90c\D0 b* :@ p0SO":"KDKPV0S;, 0 0!00,0( 0c\D0 0l+ p;@ pPU";"KDK]P 0S; 0 0!00,0( ,0(  0<UK!00,0( , SK"00,0( P, 0XKx!00,0( , LSK"00,0(  0UK!00,0( , SK "00,0( 0- 8- @- H- VP- +X- (SKk!00,0( z- - - 'SK"T"00,0( c- SKF!00,0( U >0. . _ SK2"00,0( AP. u 0ጓUK!!00,0( 0. >"K 0PTv"00,0( V . o  P>?T"K/"00,0( $/ 0SK"00,0( T/ \hSKn!00,0( D( \0SK<!00,0( ( *SK !00,0( ' UK!00,0( ǟ ' xSK!00,0( h' ,\SKF"00,0( 8' 4UK!00,0( ' SKq!00,0( & Ɵ Ɵ & dSKdW"00,0( fx& RpƟ (<SKwF!00,0( U<& eDKPi ,0( K60@0 60@0 3Œ0P %Q5 9㠕$KKᴌP $K 5c 0fzP ,5"K0S!00,0( ,0( ,0( ,0( ,0(  ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( "00,0( "00,0( "00,0(  0K!00,0( !00,0( "00,0( !00,0( z"00,0( t"00,0( n"00,0( },0( z 0ʑKa!00,0( p["00,0( jU!00,0( dO"00,0( ^I!00,0( XC"00,0( R="00,0( L7"00,0( F1"00,0( @+"00,0( :%"00,0( 4"00,0( ."00,0( ("00,0( " "00,0( "00,0( "00,0( @10@0 410@0   0DyP 0"K  09yP"0"KE00 0!00,0( !00,0( 00 0ȶ h  ̵  < d 4 ` ! @-DT? | H "- L@0P Q?Az `@4G6pG/60 /0p!P0C`@T0  P 0CP0C B@0PU? 5 SPX P^! 0 SC%R0C  G   @lpC04@P056Q0@P0 0j 0NP t` 0O 0&P t@`P _0 @0 0I0 n0 0 @Yn? !-A*?B0CSL@Po!S5H!R#  S QÂa@ 0  0 @P3S S 0@P0A.B B32 00Q10 460n0Ƞ#6PȠ7 P 0@Ύ0 َ1@_ 4 /0S P /? @4@P/ -@08LPp` P(  (8/P87 , R 0(40!, 00R40GPBV: `V# G 8,04`00G,0400 40, 0S4004000R`0`` P0-L& 0S# $0S P0I R 0  SpTP0  $ < @ *@˂004? P-L 0S $0S e0P ,00040 Kh -PPL@% 0S" $Y LPQ`@aD/T@0DTSpp8Q (0T (9/8p (@$Kk -`RL@3 8S1R  -P/ 0 S $ (R 3/PP p0P@8p0`P $0(3/pP  (0 0$ R0  $ ```4?0  0-@PLP 0S $0S PQ0 Q @  \  PQ'%  00@Ddh` 'wf=L.00` SR: 30YL0|0J p@X=0Uy 0PEt@T<'<'$p@0(0L-000 0S 2=L 00P00CSTP ,0L 7s@ Q<0(0 S0(0 @d<,K0a pL<0U0 0PEt@T0SpH ?N?O?5? A?H? L?\ J?9?:?;?0X p0P0Xp0 t P l5L,%00` 5`05L\%00q@D `@80pD0 E@ 5L%00` 7p` @ s Q`:00 PlU R~0PEt@RxU`6LP&00` ZP 6R0[`LR  R0PEt@RU='''<3K2K 4K4pK10K#8l0R` 1YU d` ``U PEt1@Yd`7s@DQț7~@DD@p7`00S<0Cb  0t48L07p` @q d$ R'400  0 '4 4K4pK30Kp8@0;8l0'4 4K4pK30Kp@0 \7p@D 0@D''q10)S ?0S%T9L00` L<0 080P0`0Xp`p0P0d  0VP <:L008:`0bp\:LT*00 `Y`Lq@DT p0\ d dT0 \0` 00h /P :L00:`0;@L`p6;@0 ;L+00 -@PL 0S $PU `P(80S 5/$P(5/00` -@PL`P 0S $0S pP@0 QR 408 B400 @8U000p -@PLp`' 0S$ $0S! PP 0R| S  P00S   0S  00>?R? 0-@PL 0S $0S KP0  $000 -LM`2`"0`PP0(0 0S $0S -P@pT7 2 Rv @< Q0@<.,K 0A+ K S 0 <@ P00cS R#2^ SࠃࠓP0S@0S60l0@TP  N Q00cS R#2Q S Q0Sl0@S@0AEX0@0( 0R $Kl0SohPS??? P-L 0S $0S P0 Q@oA? -@QLJ `VG $0SD wXP<!(P6/`P= 8pW  ( 0(3/pP, 8   P0S0S *p0W0C0p0  (08#r8p`o ST0C@0P0T($03/ P-L 0S $0S P 0:+ 0-@PL 0S $0S P Q 000 000 P-L 0S $0S P0D R , RD0+0BD0C?L? P-L 0S $0S P S>p0@@G-M@@0@>0^QR APQUA`Q |^ `\X PU V`! V! 1PU `vZЍ-0  0Ѝ^ 0Q0P0SP0e`08#8V0R @0C 0S P0RS`bC0P@R@0 P2 0 PSЍ0,4000000@?o280@0 0<0 00 $  B( P 0S03`05 :U`03P340%PE P!0'050%00%P!( p490C1pp Rp`P00L3 0S C@ $Q0 B("(R$A\Y   \?( @$ T:  Y `(\ L (*Q BR PP BRPU : 8 Q  Rq, %Q  Rk

# 04ᾀ W@pH0局&R Bp08P<0Q*lPt `Q *P0CSP18 PV(K, Q*PF\0CPSP18 6PV(K -P`L@0T@!T  0  0CS@B @000 -LM8@< tP, Udl `0pp8HPXT D`P4 H@Q x0d`p P,BA@@\S`Q^h0S/ 8 6\f PV !9096&0CR \0l S8 B0l0\0 l0 tP0PERl0tP(K0tPPE Ulh0tPt0 S< R S Sl `0px0d`0l Sx0 PpB QS`d BVv!fA0Ct0⾀pv0A01I>Q2L0!8ӗ1х1&=  tP6xpl P0CPEG40 8 0 tPx0\Al0:8H X`T&" D`4ᾀH @ ᰀ0Qx008 4p0 pGRlph`0\ 0R8 G l0\000Sd tPPP`}x0l %hl QR010#<6P) 6SK \0S8 B0l0\00(K8&VP0 ) )l h0\0S8 B0l0\000S(KlpT H4-0 L$M4 t@pP@0C8#8T0ƈ 0C 8!I.S# ;#8җ1Ӆ1&=  `t 6QN0C^0C?ol \2t0 8X`Tpm0 `lH f"`H`S= 3^Ol08H XT " D4@@QH 0 , CA/B BPq`&PF8P0ƈ09096&0C0C?otl 2N Stl \0l S8 B 0l0\000Sl(K It1Q40S Q6 Ql0P@D A8 @ L < 4 @@ @H @ 88 <`D H0 l0L&# P0 0\H P`D0 H0L@8lm l0`l04S1#*\ &R \ R8 C0l0\00(K\ R8 C0l0\0u00S(K$pT -L M` ,0IY0 !20X0T0X0S0D SpHor 00 #4 B $ B B  0B/U"T6WC6@*01T[:\ lPPE@D# 0S0S@1TP1 T:XpD pGopr \08  \ 00 00@DA TPP\  -W  B@  @ 00 @SP ,08Su A k, l 6\ AQ@@UF (K00 @Szl 0 \\@R300 P V0Spӏ S00W #̠ #800#"0 p0oS0c0ŧrj0S=0 p000` S *SC00 6R;Cl ͟R 0 0C0#2 2c0# 0l0S  00#  #800#"0 q000Q0S09S ES IS! [Sg gSg  R]YV$ 90S0(0(K/0S 0>QK  J Y:3 0 X 0 Y %*I ࡿ0 ,0 JSR  B00V X; R( RdR@0aR00]  |, RZ0 0I000S.  0 0S0   0S,0SQ: R,0S  R0 B0200 0[00$0S,0  0$ 0S0   0S,0SQ: RM t00   0 0  RC 0,00Q0Q0$ 0Q00R 000 0 0 0#40 0  0 0 S0 S00ӈ R01 0 0  0S 0 0 0#40,0S E0 0*0,0S)  R0 B0y00,0g  S 0 Q0S 000#40X0q000S 0 B0J00 B0C0/pVy 0 H V 0Sqt6l 8`Ƙ Რ &!909&tl0 BI0Qtl0Q Yt0SVF :V㴖o 6S9 \0l S 8 B0 l0\0k00 00#400 03 0  0#400  0 \ R8 C0T l0\0*00S~J0 0 0 0 0 0 S0 S00ӈ R01q 00 0S0 0o020 p00060,0 J0[0L D!B xt0S*l0\064p p0pt0&l8`Q  A R, *6ƒ᱀9096AAot0l 0C t0l Qu St0 SV} S S`l8 R R,  00 ZZZZZZZ0J?o R20S00 B IR` `0 R 0B&Ɛ0 0 01I>001&=  AAo`t0l 0C `t0l BpT\0S8 B0< l0\000SN4p\0l S 8 B0( l0\000S00/*V4p6 &R \ R80l0 Ct\ R80l0 C0000}00z00w00t00q00n -`PLPpP 0SM $0SJ PGq@A Q00W0S=0S 1 0!1 0S yp* 0S1 U Qj6S S L D!B 706| 0 1 0P |0p0PL D!B d̙ -@PL/ 0S, $PU) w`P&0(pQ 5/0$P(DQ 5/0$P(@Q 5/0$P(8Q 5/$P(05/0qW`0` -LM`20 <0 0\0 Pp40  08Q1S00P 0Q} $0S 00s0V00 `f0V00`FGQxFQRt4 0 QRoFoS㪢Z80 gV @!( `4/@Pn *! ⑂80@ 00A402P  CX0`,L0T  0 P(`3/ 0 8,(3/ 0 @L(3/pwjD 0 v(3/68!Q ( @ R% D PR!  0 0600&040$0(Koh0<0( 0$0S|d0<0$0w(K@ @0 < 000 -LM 0 P 02 K -@QLPm `Vj $0Sg oUP_8 pݺ!(6/@PZ l!@Ӻ 0 ,P(3/ 0 8,(3/ 0 @L(3/D 0 (3/8P4 @0S1 ooD0bS`V*, 8 ᧺, @ @墺L D D坺 噺0&0C&΄ 0 0夆$0˄+RC-`  d 0 R0#01&d#R PB$3R@@0B  ` tlap |q`& `&&, ,|,d `,Ƞpl a ̌   ̌ t ap |q`& `&&, ,|,d `,Ƞpl a ̌   ̌ t ap  |q`& `&&,  ,,tap,Ƞ| q`&̌`& & h`l | Ġ aq̌`& q&, ` l Ƞ q  ̌ p' a'T`&lP RPB%Q@ A ` l 8 q 0<p'a'T`&P R< 4 00#01Q&d# N M @K J G-RBM[B(0@A0T0 `P0S p,0V @p0S P,0Y P0S @,0U@ P0S   ,0 UB!0 BߍP 0 0P 0 0 /H 0Q /0Q /tsRpC-&`P咆Ǡ 6l2B@ &'!8 8b" N 0C0 L  D A R,A B4P C$0@P @@ppqG-R* Ƞ Q R RIVB0 N@W]0T`TT 0 `T 0 T ` 0 T0 `T0 T ` 0T0`T0T ` 0T0`T0T ` 0T0`T00@ 0UhH7F`FcV2 R0JLRR RuB. @B0P`P PP ` pPP0 `Pp0 PP`0 pPP0 `Pp0PP`0pPP0`Pp0PP`0pPP0`Pp0PPP`0P00 0T>n B"  0 Q 0C7'bc"2JL 0 ZJJ|0 \LL R  0Q @08Z!7&cJ2JL 1 Nq,/Ld U/ 0`0/Y \G-:PT0/SM %pQ͌0!S /\˞U A@`kṐY @11: W: 0@Q=0@T! Ѝ QQ Zࠁ -LDM @0 ` P 4ZVT TP4p QQ \0P4p\+ VTp σ pT 0R  !QP4pT XA   A&SP TÀ qXQ=0pP4!\ 0C` P4 ` `T$`; BX T$T;! 0QQ=0 Q0"0202 0 `kd0 Td>n 0\ `SR0/ Qh P\0 !ap0100PP0 \0P 0\0 P0Z0pYpp` 0NP0ն0P0 X0vSP0s#6 X0v`00s.X\ hRK P Y> 00`X0 pn@Qe  ^0BQ Y> 00A .0I000Y0C0PP# X0X 00aY^ P@ 0`FqZ 0S pF0@C$F^P@XHX0d LK ( 00\0T r 0@AQ , K"^ "N Q 0T(K 0=A-P@\A0RP0@+}n\( \ 1>000R R# P0T0S R S PR00 P0 S0Ѵ000°0Ѵ0P0G-鲀MXPPRJ@!z00k`0 Vᶠ?Z3 V:৞ @@@0 0@#4@06`V cP\ V &028@aC8RHPA$H0`V@6Zw Z @P0 0R0 ЍX&0i X" @28C8PlU! ` P0 0P#40&L0bTC 8@C8&@28C8PlU!p P0 0P#406 LcT !&`FhA&hRN0 A 0#406Z cVb0C`6@ P V+7ʰP28C8@lT!  R&AI )0"(B(   0#406 cY 0C⸐6R @PU &I &P28C8@lT!%  R&A8 I )0"(B(   0#406 cY 0C⸐6  `&O @0 0@#406 LcU ! R&A `Fh&h & @0 0@#406 LcU ! R&Al`Fh&h &G-Z M6k SƕN ,4`0 0 400400400400&@<@N0d( S"(0    0#40ƕ@DlQ.( Nƅ6 ` S08QC8 @|pq pp<  g`8C8( V"(`   0 0#406` cV"G("( ƅ0(AaB(V! t1@fN.,(B(8 T#8s@000  0@#40ƕpF0l^ (B(ƅAQ0003ӕӅ0`0,@8C8pd( W"(Dp   0 0p#406D cV"("( ƅ00CTNm `4`dA!N( V"(J6 S `ƅ^@0Nc( Q"( k> ƅ Ѝ ƅ| ƅ0ƅ`kp p  `"$` 0C `0T" 6 ЍV V V V V :&@-R Rk.  k &k.@@ "$ :&@-R R k@@&  B&k.@@@@!ƃ0@-P0 @ K@ +,K( J&̀8+k. $ˀ0PG.V 0S 0 ,S0 + Q0I0&&&&0v -k~L@ƞ8#8 @ \`P(8 ⸀ "$ &bS1 B0&[ 0  8#̠  4##<00 ᷲ0PP⸀ƎT0@-@k΁6 S#(B(.+0P  0P#4P06 cTB 0C@6 S0Ҽ60k.@@0@@@#4 06 0C60@06 -LM RpP0 , R I.0 40 0`&M80 @+(+N 40 BR7 pQ j \ 1! ^3 "Y#0kS\0*! X8%8#80ἆ( 8 XC8< 4 /A!88C8k0 00#4 0缆0hQ38#8 H0ἆ48C8! X8"8C8k0 00#4 0缆0hQ38#8 H0ἆ XA0B8#8(B(k   "$ 缆 hS28#8 H0ἆ, MkΆ00#406cR! 0CZ 6ڼ0 / ! X88C8!Zἆ8< c4 ` C 4 P  \ I0 ,  R3 "YQjk>&MI.0ἆ@0 XR!0(B(k   0#40&0bQ3 B0&LN.V 0G. 0R < S >+ 0 Q00W0&&&&(K(Ko &MI.@0 j 0 ("(8k.0ἆ8C80 00#4 0缆0hQ38#8 H0ἆ<A!88#8k0ἆ0J8#888#8k.0ἆ8#8k0ἆ+R+R,R I.0 EPK R  EI 0 AM hK I :Ɠ0@-V@Q@F   !I.AQ!ѕ"х&  & BBo0) )F -LP`@? h0P `0P @T @Z@V$@T yaratcid -LM$@K`p( KPP K Dp (HTK茷P 0-SL@` Pp0Q C `0QpDW p#pDVyaratcid -L M K@P W@oK -LP I -L M Kt@P >@oK -LP 0 0-L@P '@0 0-Lx@P @0  0- L@P @o0yara -LP   0- Lp@P @o0tcid -LP  0-LM@KP /Dp  <O@PK0Զ@K0϶@K0yara 0-LM@KP Dp  <1@PK0趶@K0豶@K0tcid -LM,PK`p0 K@P  Cp 0OS 8@P @ K苶@0@STtcid 0-L@PP 0P 0P0tcid 0-L@P (0P0 000loob -PL`@PP  P 0-LP@ \0P 00 P P 0 QPrbmn 0-LPs@ \0P 00 P  P 0 P0rbmn -PL`= @PP  uP~ -PL`5 @PP  aPj 0-LP*@U d0P 00; P: Pp 0y 0 QPrbmn 0-LP@1 \0P 00 P  PZ 0G P0rbmn -PL` @PP  P -PL` @PP  P 0-LP@d0P 00 P P 0 0!QPrbmn 0-LP@\0P 00 P  P 0 P0rbmn -PL`d @PP  P -PL`\ @PP  P 0-LPQ@|\0P 00b Pa @P 0 P0rbmn 0-LP0@[\0P 00A P @ @P 0q P0rbmn -PL` @PP  2P; -PL` @PP  P' 0-L@P$0P 0A0gnts -PL`@PP  P 0-L@P$0P 0:0gnts -PL`@PP  P 0-PRL@ @0 0-LN@P 00 000] 0-@L0P PP0 P-L 0R P Q *o ܃ 0-SL@P T``$P8KhjP Kh<0  -LP@P ုp`NP  r `T@ 0-LP@P Pe0 000 -@PL 0 0R iPP 0 00  00PM`P Q $`P[ -PPL x0 0R9@P M`P Q #`@@Z` P/0 0R /4ZP/0 0R/ Z 0-@PL X0 0R  M0P Q #0000Y| P/,0 0RP///`Y@ -LM@P ?o  2P0S K0S0 P 0  P`@MpP 0 S  R L  4 PPp O00  Yx[ H < -LM@P 0 0R KQ" 0  k PP`MpP 0 S d  4 PPp hO,00$0$ $0 XZ `~ 0< < 8< oP- ?o02 ^0S 0 SzW P-L<0 0R P oV|} -LM$0@S`PU  K KP,0K P ,pLP 00 (0KP (0, S N8P mP P ,0 0 0 //  0-RL@P 0S% R:   P0M0P  ,0 0X0X X0 [D0D D0 S000 00 K4; 9 @; x; 9 ; 8; 9 ; 0-@LQP P0Q0 0-SLP` @ 0S P@<P QQ P>Kh 0-L@<PzP0/sP Q lP Q>dP  K0h] 0-SLP` @ 0S MP@<EP QQ :P/4P >/P  Kh( -`LQ@ 2>Q# &Q P Q' <QP&PQ  PhPPQ PR(0S0$00`>S@ /S~ `(`  R R00/R00>R00 B\00S{ R `R  R R00/R00>R00 B\00S0FU0 S IvP0/S0$0 0>SH SQ  0R R R BR  R  R R BPQR 0 R R=R BPQ1 R   P P=P @\Q! P|`FVy0S0(0{r0``000 0` 0 0 9 0B00"SX0 S 0R "P P0J C  >RE00d1 h3 2 @-\ <\ AQ R\ <\6 &\@aT lTt\% @mT pTo\s\;\'gTt\;\>@pT@;T;\<S0SqTu\o\t\;\" Q-0L  Suo -LMMMK`X1QK0H1 O?KL1 N?KP1 SSS@PiK0!S0-S0-S0@S@S -S 0-S>Q@@p/ t/ FK -MLMPR`p^P 0S "@0W 5 sWV /R /.0BKH0 0 S* {p@0  :U< YP7:u;S0P KM? 0  K0CW /RW  C B/QW0@C0@T@!BKH ɦ0$ K@4D% 0  K09p m:Pk:D7:p 9 :p0P-  -LM`P7H@PE3 ,9pE K7;pG dKe0V@p `0 0 ` 9p)  T  `0 p 0PP$K0`p `9p  2$K:@\J$K9UJ@ 0-@L :K0hEJ -LzP 0 0 ק' ,* 0)  -LIMMK@ 2NK00 kPX @AT{ 0 R 2/0pPzf PB0mK0 3/U@ 5/T hzT T@AT8A 3 p0S7 03/P Z :/Pz81pS @0 R 2/0PMz$ P Z :/W8 003/U 5/mK(K 0 0C/] 0 0C/T 0 0C/K 0 0 B| |0| 0 p9h h0h 0C/\0% P( H' % <( $' % ( ' % ' & Fd% ' & <@% ' & ! -LP@P-  PPgI$0SP  RlrP P IPP 4 `PPP& 0\ & P0/ -@LMMMKH T! L 7T0 HL00D! S@! ,S/KmKQ_KNKOKP! RK T%`0P! \P4 HL0 @04/@PSoKR_K@HL003/@0 AP(KT@D1L!HP <80H SL D! @! (KT!R00 0 0K/l0" $ #  0/0/ 0-@LK0hH ((-L; Khpcc (0-@L H0c 0-(@L@m0Tc< 00-0 S @ UT:0/S  R0P0/P0- 00#0 A T0!RSR0/T0!R0/ -PAL@pᮡ`P (EP 1ᕡ`P  HX`(0( (0 at\:! ! ! ? p-L,M PP Ao/ -PPL@C@P@DP`p @C@PMFp4_h0,p0P4080<0@3($Z ((-L Kh(Y 0-,@L@ ☟0Y2ol 0-L@/K0h+ p-L M@P4 00RBS,0 S R$ 1`V/ P` 00 P! 40, 0C40P- `KpS 0 0 qEEKpR Kph0h h0 `ZX0X X0 RD0D D0 aJ ` \ b   q      -@LP,`8DpP V 0 !o,p0PE,p0P -LM@P pP D!0  T`P (0S; 0  HP (0S UE!0`0(K$`V00 00KP 00S`  P  P X  `0 7P %E( (0( 0 ར` Q  `  < 0-P@L@20S 0  Q <0 0K0h"A<. 0-SL( (0( 0d  KhD   (0-@Lc0T -4PLUp ,@焑Q ` 00E`£P #A焑Q PX@ @X@  0 0| F $  z 0-SL  P< P 4Q ,00D D0D 0 80 000 0 |,   c x  0-PLP X0 0R @P|0 0  0 +X 0 L { -@PLP` 0 0R U ^P @T @pO MP@ @T C 0  0 ഡ+t  h  -0LS@` dPPqPP Kh 0  0,d    0-LPB@P H H0 0 40 0RP <0 00p) -@L MP`40SO &P@(K P 1 0R0P00 00S 0O dd p IP P zP P 0 03/P 0pP 0 S 00R 0(Ko!0 00CS 0 0pS pPH@4 404 0.( ((J H  0  $  40-SL , 0C!40R  Kh@ @0@ 0-4, ,0, 0- ෠    4 t  -p`L,4PP 4 R @, 儑ᄡ  ,04 儡@ 0T:804 80 -@LMP`80 K KP 4 0Rp` S"*,P'0 B!F4 <0 B04 <0Kd d0d 0.XGP P0P 0.D>< <0< 0.05   F   Gx  l H P-L@Pp1 `0VHV. 404 S S6 H000,  0 0,0 000,0P , 00/o00"\ R `vt`P* i g d b` RnP`D D0D 0^/}ʟ, ,0, 0^/ #   0P 00R/`" 0P-L (00RP80080(" 0-@PL80080K0h  0-@PL 80 0R@ 0P4@0! 0-LM@P d0 0R@ K0P 00S@#:K0@D! 0-@PLT ,0 0R@@0  -PPL 0 0R4`40S @40S,0pP@`B`d  -@PL` @0 0R@ P @z0P /o40"0\ R00\/L -LM@PP t# Q (K40 Q8 `H0 K FpP @P9삟 ⋚pP 40 Qa 4Y3 <0,0pP<04  ՟p,WS<W^Woi>Xj ((0 0p 80  QpP: ,00 QV  < 80 P80< R B0 / I@ I!20 4<,0 q1P4<Pb},>mX* yp< >!4 <0, 0pP4 <0][| |0| 0.p h h0h 0.\T T0T 0i/UxED        x -L`SPp@ T  P 1@000 $Kk@ 0 0o/ඝ|  p P- ?o82 ^0S 00 SD0P/ 00R/  P/?o, 2 \0S/00 S/P- ?o02 ^0S 0 SP/0 000R/<-P /o800"00^ R  R 0-LP @P P 0 03/P P @0?@0 0-SL@`P pP $P p<0P  pKh7L -LP@PP F PP S?蘢`M?딢` 0-L@P $P0P 0-L<@P F00 000, 0-@L0P ??0 P-L 0R RP0SKho808 80 $0$ $0   p 4 x P - 0LS@`5 LP. @X1|qPpP P  P XP0U UB#10@U"B< P*0? H@,KocX% XpPp@%1< $B @P 20000P X p=P =P ,Ko  H , -P`OLMp@ϟ40 000 0 <0 0@0 080 @Q pA QWpp Q <Q =Q 0#P Vr Vr V X YxA Qo Q Q Q Q_ <Qg =Qe Pb @PY^ 0A!2 0QR Q Q Q Q <QJ =Q@ DPA X Y<0A!10 Q0 Q Q4 Q Q <Q( =QP P X Y 0A Q@ Q Q( Q Q <Q+ =Q L ⠏Pp(K`PaPQ 0A QSS Q <Q =Q ⅏P`Q 0A QST Q <Q =Q pP X@QQ Q Q Q QE <Q =Q @ ZP @P`Q 0A QS: Q <Q =Q CP @^XP<F`Q A QR Qg <Q =Q( )P Pf@Q 0A QS Q <Q =Q 8Ps`Qo A QR Q <Qg =Q P_ @`QY 0A QS7 Q <0ASPPSLQH 0A QS= Q <Q@ =Q L َP7PQ3 0A QSr Qv <Q+ =Q ĎP"`Q A QP Q <Q9 =Q ⯎P> PP`Q 0A QS Q <0ASP @P`Q 0A QS QU <0AS ℎP P@PQ 0A QS Ql <Q =Q4 mPPQ 0A QSy Q <Q =Q \XP`Q A QR% Q <Q =QB CP`Q A QR% Q <Q =Q .P-@Q 0A QS} Q- <Q =Q lPwPQs A QR= Q; <Qk =Q  PCbPQ^ 0A QS4 Q2 <Qy =Q <PP @@QJ A QR$ Q" <QB =Q |ۍP9PQ5 A QR@`PPQ) A QR@`P`PPQ 0A QS Q <Q =Qq ⪍P @P`Q A QR Q <Q =Qs dⓍP@Q A QP QI <Qh =QE ~P`Pp0S400P(K`Q A QR Q <Q =Q] ^P4`Q A QRt Q <Q =QH HIP`Q A QR Q <Q =Q 4P3@Q A QP Q <Q  =Q P}`Qy 0A QS Q <0ASp\ PiPQe 0A QS= QU <Q] =Q PKTPQP 0A QS= Q <QH =Q P@ @P Q <Q\ =Q ҌP0 Q <Q, =Q TŌP#@Q 0A QS Q <Q =Q ⰌP@Q 0A QS Q <Q =Q ⛌PPQ A QR Q <Q =Q d↌P@Q A QR Q <Q =Q~ qP@Q 0A QS Q <Q =Qq \PH @ 0 $ $ D  X  P D T T P T < h  p  X  \   t x  p 4 `   8 < @ D H @ ` @Qe 0A QSe Qc <Q] =Q  PLTPQP 0A QS& Q$ <Qk =Q P?PQ; A QR Q <Q3 =Q p̋P *PQ& A QR Q <Q =Q ⷋP@Q A QR Q <Q =Q ⢋P@Q 0A QS Q <Q =Q `⍋PV @Q A QR Q <Q =Q uPPQ A QR Q <Q =Qt `Pn@Q A QR Q <Q =QX \KPhPQ A QR{ Qy <Q =QJ @8PFPQ 0A QSo Q <Q =Q #PA R} X( XzP<RP  0A QS Qm<Q  Qf<RPE $4 0X ༖PQV 0A QS] Q <QN =Q PE@QA A QR Q <Q9 =Q $ҊP0@Q, 0A QS, Q* <Q$ =Q t⽊PPQ A QR Q <Q =Q ⨊PPQ 0A QS Q <Q =Q ⓊP@Q 0A QS Q <Q =Q d~PPQ 0A QS Q <Q =Q} iPw@Q A QR Q <Q =Qa TPqPQ A QRx Qv <Q =QH T?P~PQ 0A QSo Qm <Q =Q> *P8PQ A QRN QL <Q| =Q PTs@Qo A QRI QG <Qg =Q  DP^PQZ 0A QS Q <QR =Q P I@QE 0A QSE QC <Q= =Q ։P,4 R1 0S, <SP) C SR S0<SS@Q 0A QS Q <Q =Q ⫉P @Q 0A QS Q <Q =Q ▉P@Q 0A QS Q <Q =Q , ⁉P@Q 0A QS Q <Q =Q | lP@Q 0A QS Q <Q =Ql WPv @@Q 0A QS Q <Q =QT ( ?P^0S @Q 0A QS Q <Q =Q; &PE P @R~ 0OP@Qv 0A QSv Qt <Qn =Q P&e RPa =S^  RX  RS P0SL L -LP`PU@4pP  ޒp P@ 0-LP@P0P0 @00 -@PL 0 0RPP 0 00   `V S4pP  嬒pP00PP/0 0R /@ P-L 0 0R P`U V $4@P  }V@ P P0P 0x D+@0 000 0x $  ( B F P-L\0 0R 0S P4 404 0 WP$8  P- ?o02 ^0S 0 Sx P-L400\ 0Sw_oH -LM$P@U`  R t!0 P 0S1K$0K P $PP3pP 0 0 0KP3 $0R/ kP( @P% PUp5P$0 0@& P Kp$   0 P0"S D D0D 0 8f50"S$ l B/ 0-8P8@P@L0 00P(0SYV P/?o8  2\0S /0SP/ 0-@@@LT(@@ @+0@@@$ 0-@PL (0 0R000P/0 0R/P- ?o02 ^0S 0 Sr 00-SL@P 0$0S 0  P 0  P tth@@ @@0LLL@@808 80 ࠒ< $ `T( X -`PL@t2@P@3PPp @f2@P4p \P@GK 8P 1 0RpP 00S 0/0 03/@P P  < 00CS 0 @ 0@S  P\Kh @w@, ,0, 0 s  L < 400 0-SL@P8S t4 <0,04Q<00P0 0 0 &C | -LMP`Up@$   P 0  tP (0S @l @0 PE00KK$ $0$ 0 < 0 B -PpL4cP 40S @,0a, 40a@T:8 408 h -L MSpP`'V@ T 00Q @00 K( EQ@?T (  Kip 0  0F/ਏp  0P 00R/ 0P-L (00RP80080d 0-@PL 80 0R@ 0P0@0 0-@PL 80 0R@ 0P4@0 0-LM@P d0 0R@ K0P 00S@#:K0@d 0-@PLT ,0 0R@+@0 0-@PL80080K0h 0-@PL8@@@0 -@PLP |0 0R`w40S,0AT n@@ 0  0O/ڎ x R -@PLP` 00P@ pG8040S !,0X <0, 0a<0@0@8@D D0D 0S/80 000 0S/Xx x T @ 0-LM@P P0 0R@ K0P @K0, p-L M@P 1 0R KpP  4 P"80,0!aV# P ,0P <0@04<0KphdKphD D0D 0W/8+0 000 0W/$"   P- ?o02 ^0S 0 Sp 0-LP@P P 0 03/P P @0G0@0 -L M0@S K  ?P  $0SKh -LP@PP  PP 0W` 0S` 0-LJ@P $P0P 011/ -@LPp`P P1S„  0P 1_-P1 p` P 0808 80 Ae$0$ $0 B]  -L\ ^ \-QRS  0S0 0/ QL R S "  0S € 0 0 0 0 Z|  -PR0L,M0Q@ P 0 ` p Pt p `᳿ 00R0S00(Kp`0 0-LM@P0K0! 0K0a  0K0a   0 @ SK0 0-@PL0KM    ![  0![    SK0 0-LM@P 0b",4b4#K0! NJ K4"40a ⿊ K4"40a ⷊ  0 @ TK0 0-LM0K@P ដ0| a! $a$"  㓊![4"40 ㌊0[$!$    SK0 p-L,M@P`P 0S R00o$P KpKph.0-S 0  0 0  00 0 0 f P0U00 R 0S U00 0-@L BT000 0-@Lmp00T0000g 0-L@T 0 0-L@T0 -(0( 00L0S " -(0( 00L0S  -(0( 00L0S D -(0( 00L0S 0@-1!0 ?^@@ !0S0&\ 0@S ^ 0S 0\ 0^ #0 r? ?PPlRP ! @P00 |? ?P 0PbR P  0 0 / 0 0 /p 0 0 1/H 00-SL@1/000 -L MT0T0 0@0SNP K  ^ / -LQ- -L -(0( 00L0S >4Ao// -LM K" Kvt -LM K$Pp Kwt@ -QLM Q Q E 0  K  K0 Kt ^t 0($/(/$/ 0Y.<+ < 0/(/$/R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@I P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@PĊ8000 0@0 0#2 /UUUU3333R/  BP0P BrA0A/  T: S0@- N S  Ss00  Sw00K r0-00w0-00!=@SP@ V F SW ! Ss00D r0-00w0-000S> ) SS Ss0'r-w -  !P> 9: P3 Pt 0 C   0 SC  Sd00  S@ ?00S-0 0 S-00  @x0x00AS00AT 0 C- 0 Cx 0 CS0 SA00za0-00uc00rp00ol00lb00i -L_PPP3 dP.  ᤂp` 0@0bp`QU  P0=S Q`Q@U1Dq@VPI0Bp0 0 XL -LM42|K0P 2t 00 N @`lpKw@S P0r0S00S$ 44H 00Sv0S 4H0 0+ C :R :S?p%:p#48` CR0 R T0 0 pSpp0S@(KPd3H 00S 0:S T <"?p H 30 (K3H 00S 0:S  ;S 0R0D0 0R=ʸ"2 H 00S 0:S W \2H0 0:S X Xߜ~0T0 0R' :R$ 0 R" 1H 00S 0:S ⻜H 10@0+ Cb^L !T0 1!0  ~@1H 0 HS]L0< T!@0R0 0S H R :R ↜0 R  H 0C0"00@t^ P< L0d H  4H^<^0^,^ Ш ]\\8 |\d\D\,\Px  [  lW L Vt x V -L Mb2`p00 S" P@T P2P@:T60S" 000200S 0:SG?(K0X000P1j8Ÿ -Z cP @P-T@" TQ P PuPn -@ uP 0:S" 100S000(K0Sx100#\1 X0 @10Q 10P10:P W00 0 000 0  :Pz 0Sv #X0 x0} ?ljX4 UTTTtT S( HT XS0S $SRL R, l @2 -Ld# -LQ* Q Q  R !0 0R 0 0 R`q@V PT 0 h0h h0 ɀ@PTi 0 cT 0 ꌜ x \  $ -`0P @ 0X00 TLp:@DV@1 ~ 0 0R ! 0 !pP   I܅0 @p -OoPB@LMT`po!P K PP 0@0 @@` 00@0 @P HK0@0@p"P@pp""@܅pTH00 0 XZH-$$ 0  XedHQ0  EZ0 AZQ  ;P --L M0 0 X K -- LM 0  gX K 0-0PL M Rw04PKS@'  S%  10 0 B0!  0K040  H00 0,0 ( O0$@KS4PK 0000HH$ ( P 4000P$00///GGD -L,M@ `p% < Wk<%  \ o\w \4V- @0WWQ>\ \ #&\ \! R P U _ U  \ R  R *T   _\ R(K\ \4 \ \ \H0 >3 SR$K D04 SD FT IP40!R 0 H0 0Q0D @\V PR@  Re R  RV  R T R  >SV‚ P @k PRF UT \I R*T_ Y  \ R Uu 0>#0!> \H\] \2 \m 00DK>SR`40 cKcK` P0cK`U $   L  8 D0&0C>SP40 P  P0.!!># R% P>S P!>#"RPE 01S400C040 0>S0DKR` 0cKcK `P0P#K 0p0 0P>3 00 0040A>34PA0E pP00C00V ꀹ -L,M@ `p% < Wk<%  \ o\w \4V- @0WWQ>\ \ #&\ \! R P U _ U  \ R  R *T   _\ R(K\ \4 \ \ \H0 >3 SR$K D04 SD FT 'HP40!R 0 H0 0Q0D @\V PR@  Re R  RV  R T R  >SV‚ P @k PRF UT \I R*T_ Y  \ R Uu 0>#0!> \H\] \2 \m 00DK>SR`40 cKcK` P0cK`U $   L  8 D0&0C>SP40 P  P0.!!># R% P>S P!>#"RPE 01S400C040 0>S0DKR` 0cKcK `P0P#K 0p0 0P>3 00 0040A>34PA0E pP00C00V |G-MRP 4@  lD8Ȓ`Fq>SU7 U :U nUT U[T 0 SЍUg  U L&U7 UF0 T0 U<  SU 0U U. >s  U U U >s < P5  BpB Ǡ \ T0 V 0 U  "U>s > Q UpW 0 P PPP  >S UP >P>s W  X 0 rT >sRP c8Ѝ -LDMpPL A/P P00QD0 9@W< 00 0 L4 0Xc 00 P3`@ 0080 03H0 9 T 80000  _T  R?00_T@@T 2U  X 80_ X00 0S RwA_EPEUH0L 00000 D0WPw 00 4 p@@0S6 TR  Ta `P XD  X} V2U X@ 800000_X0S6  TQl 80000VQ# T@ Xp 4@p!0  `VT@Xp T5  T@ `PP00<00!00U` VQ Tw<00 T<0PPj <0P,`0 0 4 jP000(K<0PPP00<00`P00`P,`P0$P0P000 -`LM0Vp0 6*0Q>3Sq S1 Sl S@n S S04  E0@P0 Z4`0 Pp0`T:(K@0>3@1># R@004P  P I0@000 U4P0F>SP`1`>SP1>3"SPE P0Y 0P  p~`;>S@04  E0@nP0 gZ4`p 0YWP P 0 pJ` S S S`p0TH:(KS  G>S?R ` >S G?R `0 p`SYhG-RM,@0 lD`Fq>SU; U DU UZ UeT !(PS P  ЍUu  U T&UG UMpŸ TUE P  S U U U4p P>P PP U "U U p P>P PpAPPYPU B V \ TU  "Up P>P PPpQ >S U PUX }PPY P \o T >RŒP bpP>s Wp >SpPQ> Xp o -L4M@ 4 < 0 40 D #(0 8 Qp @XL6}0A/4 00 0 000 W Y 804# 03   _Y RP T "80   _@DOoRB  R 2U  Y  _Y RQA_EPEU|"0@00\0#Rp R0 Rk R@m R R0  H0@0 Z0P0 Pp0PT:(K@>3@1># R@  I0@000 Z 0E P> P >1>3"SH0 Y00  p~P=>R@0  H0@j0 cZ0P0@ @@p 0TWP P000@ 0pHP R R R~Pp0TF:(KR  G>32P > G? P0 pPRWe -LMϟ` ^ 0 x   l?  R(000   0  Pl 0 $S000 0 0 0 0h |0 h0| S<Qp  S*t ` @pB`YpGP PR@@ W:p]APt`|0U P0lp`0 h0吀T0 |0d X` P0 \P HP P@@  `0 00 p ` <@ 8 4` D \z0 z A? d 0@ 0@d   ps0l0 0t I U" 8-x0   _UPW  _UPPU <TI  X  _X RQ>AOD@DTj|0h@  C/oQ" R :Pd   wsd p rsd  0t h YPh0P d`Rp @h Pl00 Ul0 R  Uh @p X2  Xr W9;T Xa +x0 _XQT  UtK   00 (KS0 *v00 0X< Rh " X* @pCl p t` `YpGP PR@@ Rhd@Plpt`0S 0T*\0 H0 @0 <0 80 40 0 0|` x d X` T P 0 0 90 :0 p A?p  t  0 x 0h0 0l 0|0 0 0 0 J W @P V{  V Ud9T V  |00000_V0S  W0I  |0 0000_WppW 8T  V |0_ V00 0S RAOD@DTg00S l0A0 0xtp0l X`lRh00 Wh0 p0@@x V  V | 000_WQ  V00 !Uu0h` |0 10 00 #00  00 p00 p0p'00TP UTG WUDG p ` xpt` 0 iPUp`d  60 TpWF td` 0 pW@@ XN  XL` 0pW\F UCi0S.p03 !/ 00-SL@P* 1ƒ!#S 0S 004000000 zPP0Ќ 0-LM0@SP0S* P  QK0 P 0  -LMP `0 0:R00 40 ):q 210S. yP) pyP 0 W 0\ .#2\D fup00 塡*) rBpp0` V< 0 0 |m P&  tm P X :Q 9 000(K0^S D  ]S -S-00p-p0-00H )  8 )  @ S* ]P3 R3#-PQ\ -P] [PR:0 `S! 0!*-Q 0    0 S H :R? =R0S0:0((S0 00  0-S]S0S007000= 0000HSE* V =R~ 0S00 ` 00]S 0S 00X}:08S000]S-S0S00vfp`| lP 0S `V0S000S000S    000S`0S* p@dP  I  0 0pC;p0S 5p 0SP 0S 00HS* V :R ]R00  ]R-R 4@ 0&   0V0F|CzR  ]R -\ V0S 008000\0<00 -0 0-00-000 S 2* 0]SQ0$  SJ4p0c  c ^ ` Br0C0D R! 0SJ   ` ` @ 0S * <00 " 00 00 0C00SQ p 0<b  pRWB00  0R(Ko^`2000(K 000(KY0S 002000(K]0p]p0]00H  V 0D   ]R}  0 R:3Y0T A/o" R S `p   Q  \ SY@0000 00 DB"(Ko1_7 )w0 0D RFSC관`\ H\ | ؈aPY l0@ -L M@  1 `0P8p(0  0 0  0S 4040( 0R  K t  0U ] 0,Kp*K,PK+ K*0Kp  0$puP@l -pRL@P`P 0!Nk0pp -PL@`  aH0DP"%T R!0@B @@!V 0` -@p`LMP0 S 00$K0SV 1 V00U U0SzvNMLutsrq#mlkjihp`F0`FPEp  B0  B$Kk*`0 F  B0 SP "0SC   PPEp`  B0` 0~  B0 PS "0SA  $Kkp$K \0 000$K  B A   B | -L4M욟: 0 RL0 0@`00 y0 Sv 0T0 0<0 :8 0P0 H p唚P0 Sz*|Q Qu $LXP2"0/.,)(&%$#"!      y^, 00L00 0R/(K0S008000( 0S:U0S008000<0S0S 80 E Q*4(H00000 Z 8 000  0(,(, R*A?QP{Q P>Q:0S00|700000 0 0D @ G 40K010K0 740 @D  00S 006000Q:0S006000 D0 Z 0DQ 0 S*0)S T ) Z 0! Q*00)QL 0PS005000E k 0(0(0 tZ 0 0Z0 0S 00l5+Q000 :?Q {Q D%P 0+Q ?Q {Q>0 S*,Q 00 S *0}Q0$0}Q R00S 00P 0m*Q0 S  B0 S  B0 RPV*A?QP {QORLHC 0PS 0 009P*hß@ H @ Z 0Ss L3000 0 U < 0R0p 0S8p Q 80 E0S0H80 2 "0<0 0 S]  B0 SO "0SB  0 0 S/  B|0 } u0  H B*Qn0 S\  B0 T g 08p P0S 00:  B0  A   B   B0   B0 *>0000 E P H000< @ @ 0RQ Xf XpP@{ {Hy8y yxw^ ]Lw wdvuusE0CSM x 0JR 0S0050000H Y 0*Q= Y\Q `0P\U0@ S000  P4\Ux0S  < Ri*UP0S 4 000P4U 0S 0R  B0 S  B0Y  BP`h 0S 00W0  % 40K010K04  0 S-*R \R0)S H0) \ Z d0{Sk/0 S*,P 0PP$ Z*0Y\Q Y  S\R` 00Y0S 00H2P000`^Q @0 w `(,,( @01P0000\S0)S  B0 G Mx  D`F `;0(0  (0 }R Y0S 00Q 0L00000P 0 < P0 0 嘀 @ 圐 0KX KPS(P0P40p PP P(P,P0P#R ,RLP "R>310>#R R@0P`@RP (pp(p 0>3S S0Q>31S B R R R SRdD `1C Lp(p @ 0 81 00 0 A(KR(D 0L @ 0000 0  V(p@` @X P<@ 0>#R0P00L @ 0P(KS S4fEecc -LMH K -!MLM@<1<0pnK`FP@ 10 8KqP 0 0 R6(K腮KJ  k,0K0# T PH ?P\HT PCK|H04TK 0PP 0DPThP @T\HT\QK 0CG~KCK$ 4 pGI pPP#  Poh00S+ h0=S0`S(X  V``V `ሀ5]xDh0#S@ @T }P40 0R(Kt40Ct4 h0 P44K00 @4 P$h Pe0 @44K00 3 P |3 FM}# `# |`t4$0CRt4 e  0pPp4 lCnKP# `Ft4 @d @ dT0D00lT dt \h Pھ0 4CK@CI .(Z34[$SX SV dc dc dc  Pfp$[R&M 4GNKt4 x4P@hY|$0  0p4[ S  P t4S P 0  p`  ~Pᗛ Pᓛ P|4g0S |v4xnhk|\ft NP0 0 / H. . . I T , h, + + + + -LdMP !px!P@K8`#8 x 0 M  0d l0 ` \ X T t0Kp Kh p TP3t0Q @,@K@R_@P 0S t0 @thx00 0R(KlZ0  @@E 0{@|GP A R* * \*  -@ML@K -LTM44A4` !p!P@K8P#8 0  0d l0 ` \ X T t0Kp Kh p ԃPtQ @,@L@^t@0 @t0 0R (K@݂ ({@|EP? P -@ML@K  -LM+Kß̢ 2 0 p2 " 0 p0nK2 -0P  UPW 1[ S S S| S ``# @ Sq S  000 S S S Sb  R 1[R@+S1 -SlQ[U: @U2S  Q+ 2 0_o2 0`+SR%0S* @Sa2"PP  PpQ[U @UO2SrQcP̂Ȃ 0+S -S/ 'cPPUxpx? XPr;@0 S S@0 S S C0SR 0 C0SQ ^_oR0S @S2"PP`  C_o`R20 0R(KbPP2 o0_o2 R@C| CPl -MLMB@  0 0 R 9  PJ K A0A0C.K;NPU9SR NK +l]+pOpc9` 9 j9'P@ #=K 0C9 P-8: S1 @|1 )00 90 0RJ(K88`P 0 @P 100S@0 )0@0}iP 8S ) S 0 )0@00 )0@08 d0 )0@00 J@P?PxP# ( " t' T" " " ! ! -L4MD@KP`p d H0K< 弁PH@T@T 0 !PPHހ KH@؀P KP 0-L(M!^dd@0 @0$ 0  (KKKKKKRK 0RK0;P 0-L(M!^``@0 @0$ 0  (KKKKKKRK 0RK0`;P -`@ FLPdp 0 ` 00A ^aAPWAAAP7AQ0 S A@P 0 R:0Bp BS 0ą0S  0R:0B00 00 0-q@pP?0@XL`P ?XD? \0ST?02:4T!2*0qa p `R?p??` S*"" P* U Q*.  0RS* U |00?0Q*00@0 22 0R ? S*: 0 T!:JdJ4J0J,J  I -`p@@@0@PLB,00 @97 0-LM @@0P ( @PP GK0H -L,M 0K00K 0h0K0$0K0, K(0K7P <,@($ K@ 0K (H -L4M0K 00K0@ 0Kp0$0K 0, K(0K7P $K00,( K(c 0  -L\M!` P0@h P DK !@  @ 0 p` lPPO @T1Tq0pd0 0   G@P7 _P%TKPP0K0X0K0T`0 dP LKXP XP0Sh00 0R(KLK  pP  (Psb005P   t l -LKM1!00pL1 000 8^hdTPPN @L1La0`H1 =0   @P6 _P%OKXPN?K0=K0< 0 HPM/K@8 @81SL10 0R(KMK P ]_PBb003P    0/C 0-L M0 0@PQ00  (K⡍0|)K  0 ""C C^0 0 0R K00 !HPP0\1P( -FML M@0 0pmK0(0 / PPBNK@D4+ Pʈ$ a@a$@R( 0R K!1P -LdMp`T0T0 P@K0(0  {( 0R K(0P44 0-D@L@M@PK %Y 0K0TA  00`( "4`43MSZ!R Ѝ/ p-L$M0 0P`Q0 0  4@Ky0x( 0 ""C C^0(0 0R Kp8 )`P8/Pt -ML M@` }K pG( , 0 `P70C X04+0R0# T @CK P  T0@T_0a@ a@,(50 0R"(K+`@`X@ 0 XP0QNK @DD0p F@8<.P 0-LM K -LdMp`T0T0 P@K0(0  >( 0R K`,P -LM@?00@ 0 0pK00 AY  ppl *g'?eaP  .P @ iH)gt.P$D],L d nQi$@b")b) h*̠ ` (Р! xp `t!&|p 썈`@ lA|p% pj*\.`,Ġ `hqj,$a!  X )` (naTa)P-P'ࠐ P@Xj*,Ġ bQ!.i, &`A h(j.% "p L,Ġp`a!.ht,` $Haa *Lp Dp` P,n*("  agX'`(@* &%T@匀 \a g%) jH*$D ` @L`$aq ! %0"Q0 ?P0%0?SL`@@e SPePU*K0W@@pG $KkS -LM 1P0@`0)K 0 R001 13R0 0~? S pp 0~? S (KV `F0"01 13R0 0RKP@  p-L$M0 0P`Q0 0  4@K0x( 0 ""C C^0(0 0R Kp8 )`P8P< -QMLM@` I~KpG0 4 0 $`P70C X04+0R0# T @CK  P  T0@T_0:Z@6Z@4050 0R"(K+(Z@$ZX@ 0 QP0RNK @D[p GkcP 0-LM K -LlMp`T0T0 P@K0(0  >( 0R K9 P 0-!$$$$ $0 0#EgܺvT2 -@LtM@ lK_R 0l `* `&i{@ `h@j *t  "jdP | b)&,`Pfkȇ" .\@b+nP,P%X@lˠP] .`@!n@T`dL% !P` X`e[bhp 吐 $ 0l| `dK ` L !, 0#t0cpmvmzNS  $Dp " 0pl0eYpx0`pl0m4n6*=30艄@X0 +>Cp3C(7C0!H0pb+>C 3C7C0 0a{ 0ᄠ i` `&@Ixp p`k ` $a\,`P+A0AA80e[m46*=30ꬉ <0+>C3Ca7C0 d0hL p`p'+>CdK 3C` 靅 P7C*0 " . `;Pxp T)0 0bpjX0 )p \p (i 0荄0 @%@a @$@0 hpe[ pdL p(pp' p`h `z `$``& `@dK fiP'.0Pg{ PnP&lPP%fkP e]@.nX0( @ dIp %D0 .p+>C4x3C7C+N0N∀0Nc:< "e[ g}`$``&h`-d dK k 'aa. 8g{ nP&PP%PHfk [@.@@$@Pn dJp%pp'pDe[ }`$``&`4dK h' <,g{l̅P&c; P%Pb x 0fke\ ,@. "`@0倀 )LPE刐 lˠ!D@ %.p@pb@ ጥi 0 "g \px0e[*@ `@$b{@`` hpK0! p#0 p0 a;Xgz$P,dKLP'` `,g{P`fi! 0aT0c=&@P dfkPe\# pc;8py% e[4a'`,g{l @!0f$T@i`@ 0`aȅ@ Px @$ `@0P` 0# HI0 `P,pP%c<Pp@ " lg8pZ-x t|``lˠ᐀) p$`p'xpP cˌdK0@ pipp (K -`p!!?P@eZL@U@@ @ K@eB PT @PT(  G,KoK@0@0SP -LM`@ 0 P?@ n##|(0K#4R &K!̠!'0K$K!4 n"K B!K#0K%pK (KT 0F ", S "$   0R` KheR PX Q() 00 R3) xB@-d K@4  R  *4 8/ᄶ x0 S\ R `0S Р@- d'@ 4 *8/+/AxB/00!8 /Q//0  0c <c -pLM,@K4`K $ P0pp4 0 +;pQ pp0,4 8 0 ;pD pp 0,4 8 0 ;p7 pp 0,4 8 0 ;p% 80S0C  BRS 1 ! 0S*̠p0+4p 0 8 :p`(KQ0 Ss -ML M00 Pp0@.K(0 nKp`F  IP"#3( 0R! KK ADp nK`FPT IT"(@D@0*4QPHtH' 0-0@L@+PP0Q@PH -LlMP= N|MPt0 l M$P# Mp|MPt0l M KSP 0@@MM(K(K'60@B t- L`rb\0\ 0P`@P@@T 0Q OP@ PX ?P L0P00 !R 1 R/@P//dP0@>S 00 00//P p-LM4@K` P*PV0E>S 0!31 00 0  Kp>SH 0!31 00 0 P00P00/ -p-L M}P@U0@ ` ` dP t0t 08 R;0Kp a 0 >( ( G` <a @-XQ -Q =QR-@+@R +QoQ uQ gQR   +S -S =S000@"    000000 0@-0P AXS@ oS; uS6 gS 0+S -S00PXST 0! 0P \PSPQP\     0 !#  I@ -LLM@wTPp 0<`K LKL0 H0 D0 @0 y@ q@`P 600000$X0 0 \ 0`` pa0HS  v'}pC~p `+X@ 0-Sa=XX00X0 0|PXA@ Q񏐀~}|{zyxwvutsrq%onmlkjigf aII00W  |<W  ;I?S R:``Q h0 d P d PE Bh0`  \  =Xl +0H?oY20S Rv*W\00 X00 R:``Q d P d PE B`  \0T0 00 wS8X!=XQ X R:``A h d0 P` h @D Bd0`  \ a Y R*W\X0 0 X^ ,X4`P =XXX 0X0 ``Ad jP+ d @D B`  ``Q d ZP d PE B`  xN 0PK  P0@0SmN0"S1Ds `` |N@`1xN0@`0 `(K>0SV-+`` h!` @0 (K`X` p+P-@ +0B XR R p0+R XR  -Rpp p X0@PPQ`!N00N0`@ 0`` N0`` 0  0-L M K  6p` K P-L 0 Mo`/00/00/00/ 00// ///00/ // / -@LPpeE<`+A<V Pe 0 000P@P P`rpbP T000 p@000~MP\ZxMP   -L@r\P` n0p0C80p0 `@_0p04 0-0@LTP` &@T0rS PKhP0+SKh8 -L0K$M #, K_D!0P $0 ( J 0100SBp@$ P 3B 0$K0( 00S.$00K K @,0 /&L@Bh0( 00S d$L0@K,p$0kT L @ jlj -L$MK 0,, 0 K 4 !0P $0 ( A 100S4]p P 0$K'0( 00S($00K K;4 0,dL|0( @00S d%$2YWuL0@K, $0@iih -LMT1T!0p`0S6<1PU 0V:0S P@T0S8BL0P0000S  0K(0 3L0S  ( :pP  PKKdĺ\0PUL༺80 0@ $఺Pghg8lg 0-LLM,PKl`KD0%0 mp@ pbp@ (KpK0S @Wp7pP 0   Mpp pBp@ ~(K*0Pp R1@ -LLM0 PP/ 00 S 0/HD$K@0040 S0+$D$K@ 040 UTU0P 0 RM Z00 0X0? R 0 0`p 0 0#K0@D0 0^p3@0@0 G0P0 0 S"0@UU dK0 @ FU00T0ScK , 0h"pR0 0402@@d 0 @FD"?PL<,P@ 0 @ T(K0+4B$K@040 ~0/$K2040 w20@0 P0PJQ0QA d 0`p!&?`pA 0q`p2`Rp 0X0@TP X DK 0 LFP0ZTP @UX Uc#KSR d 03F D ?!(0 4 @0 @p0 X02! 1`X(?pP 1(?! 0#K0@D0 %GzGSQؽ  ( d Qgfff 0d #K0@D0 4000 x0d 0#K0@D0 @(K:FP00 P"`!_reD0p*40@!CQe/I1b 1 @ 0E @0 0 !0 @@2`pIG-0@Q帡MQ:\f ` V2 qV3 1pGV \* 0T TSQЍ\` V 0qV 1pGV^@T @00`p 0W``p```W 0X W0p`d0W` 0\ W0 Q0#0p`*?[!]-KR 0S0/0 R P// -ML M @B^KPEp`+( P @ 03/( 0R KP -L M@`P``a V00 p!5SP+ "PR 0SQ  0S0 B@0000 P00$ T3   P- 0   0 (KwP& T  00S"Od    `V *o`(K0 I 0 @ -KML M/P"p `@0 T( /T  @@T/T  U0 0Rc(K^7/T3UU0@/T p=K 0C4 @$0 P 0   R  5 0W/S 4: S% S 0 0 0,0   'CNK+ P 0@ (03/P4: SW/ 303 101:H/0@@08P -MML M`88   4 0尠P@ 0 p4 _HT&*0U@& @R0 R 40B?o24 $00RU4 0 S4p00E0+0S004 04 4 4  0$ SrCK +@ 0@ 0 3/ 4S 0@3$04 :/PG   ß0 S00  0.S V 0S0 SYY4S 4S K4$ A?P4: S $P I0HQ/03 10I10$p 0 0P00:/P0 @4   2/4Sz  0 K$0 AP4: S 0$0 Q(K X:0S0Y0S  0}0Sd CK +Pd 0S + P@yG 4/P 0 4p 04P0 40- e 0.Sb0SL 0.SI V\ P 4p0I0 ;P5 40.S0 @4 :G 4R~  L ,G0/0 00cYA4gzP*| H -ML,Mh5hş0 PQK~P@0  kK{K,`F8pGQKL0[P! *P 0P! ?P $ 0 S  SP  0p!W W 0 V 0FRQ=K0C0 `Q `` Q=K00 0R(KQ K @ Q K@@P ]P!WQ=K0C ]P  0-P]\ l3 0 ]P0  Dß 0 0 s kK,`F pF 0 /RRR;Q 0K0,J 4ZSZ9Pd 0/ @Q+S *P;Q V FGQKJQK JQKL\gQ=K 0C0 C0B   CYT SRQ CYN SRK 2KA+`P^SP Q-K B 00|1A0 0J0FK0C.K;AP4S C0FK0C.K;AP 0+ l V# g` [!W 0 >RxzQ K @   B  0Qv R r ``Q=K 0C |P?**[!-]8 @ -LMMnKQpP  0PPP@PPP0S @ }R& R [R {R R  c(K @]RR^ @ ]^^ ]^^ QAP?{S }SQAY  B0S088  388 T#:0 [S ,SQY 0 E S:    0 S]S S  T*00(K0]SS -LM 0` Pp 0S0 0%0{S @(K S 0{S@p0 DP 0 }R R  K( KD 0 -LNKM @DM0  ^K     pk \\ \ɌRB \  KP \K\@ -`LP@PTQ@D PEP@DP 9t50000 S [S \S ]SP/0S/*S ?S/Q0 S 00 0@-@@0 S0 #S3 C SP0 S "S@$ T\S 000S \000"SP @0@0 CR S 00000 -QMLM 1 ! A0P@ Q`  ` 0R/K Q~K pG G0K R~K#  ,p x pB~K0 \P@00  0HPX ( ȡ  -LM5u0$pP e500S U0KP#S#WC0 0 0P@$f 0S h%` @ 0S @#S (u1PKp " 0@S0 0 40  0Sn ԔtԄԤ p 0 S 0 "#0S $ 0000@SN  );P  #;P0 S 0 "#0S $ 000)CP}(K ;P0 S 0 "#0S # 000 :P)0 S 0 "#0S P# 00010[#S 030@ R 10Pg  (K0 S S :P0 S 0 "#0S " 000x :P p :P;0 S 0 "#0S1 0" 000Z[(K0 S 0 "#0S ! 0@00CPd60@S0 /@(K| ^:P0 S 0 "#0S     [>@`B?0p0D0`00 2 0S@C. ` `@`F v0` [0 ;`0 0 ?@Y0`0`00C0  g [@` @`@`똰P( ȋ   L l@X @ 0-LˠM0 K 0-LM@P@Q  0ˠ0P K0Fp,K0 P 4 -@L@0pS`"@@Q%PPR @P  p 12c1NS@*   p p  -`L`x@խp0@P@T \0\0 R@@ƭ8P00ậ$4h3 -pLp`@Pᩭ @0@0S @@: R"@dԮ@@rP00>@ᄭ|38h$$3 -LA0 00ph -`HLMP/2pP- 0S 0V "  |U(K 0K00P$0  R@㰁Y&IS 0 ㈁ 0R 0Q d7SX3SHH-S 0@0(  ZG B&R/&hFXKHA` |  ح D h ، 8 -BMLM 4ܔ0ğ       0L D4 0H 0 @4 +0DSkP08 4H0 4"(P BnKCNK `F@D\ @3P 0S 400#S @T\ #P 0S 3S0PP\ P 0S 3S0PP\ P 0S t30  \ 0P 0S bq<30\ 0P 0S Uq 303@F0r +,`K~5pD& \ @P 0S !9PZ PZ :Px" p }:Pe TT2TT0 $RZ 00?^0 ^; *^ 0 0Q?^ 2^& *^T T 00 0 *Q .W Q1 /Q 80S |*P ?^ ^<0 /W (K[^ \^40S T0 [^W /W TL ^^!^00 PP T X0  ` 04P/S \S U T0  00Sy -R Y`T0  Რ00]SVX0L SPPPT] pe fT ``ᶠ``]Q``V \Q 9 Y YW= /WZ .W D0S @0Y3 80S 0Y/S- [^ \^+40Ss 0 000000 0 0mUT  `(KLPPT\^ *^ 80STB 80S0S40D0S @0Y 80S 0Y/S(K H0TpC<0`040 00 0  0 P/Z T00 40S <0  /I)4l@0c P0-L@ P :0@00Q 0Q o@a0{ l{ 0-@lLP70PT  0@70PT   0n: 0 0{ { -LMp0!@  H"  0 8 p@\ P  H20 0R](KPU 0 8pD J  vP; D2S;P<2 #nK<<2P P+ < 0 8p! 0 @ P@D2PU*@ <~00,0K 08Lp@9@-@T@@DB @@븒P -LMp0!@  H"  0 8 pp@\ P  H20 0R](KPU 0 8UpD J  P; D2S;P<2 #nK<<2P aP+ < 0 8@p! 0 @% P@D2PU*@ <00,0K 08Lp@q9@-@T@@DB @먐P -LMp0!@  H"  0 8 p@\ P  H20 0R](KzPU 0 8pD J  nP; D2S;P<2 #nK<<2P P+ < 0 8p! 0 @ P@D2PU*@ <v00,0K 08Lp@8@-@T@@DB @8똎P -`P@@L@PP bPPdt -`P@@L@PP PPt -`P@@L@PP :PPs 0 00 iꄋL --LM0 0@ Q 0 00\100M 0 0 R   R d 0RKPP --LM0 0@ Q 0 00\100M 0 0 R   R  P 0RK눊P -- LM 0  O& --L M0 0  --L M0 0  -`ppQLPp @Q 1PD@, 000Khk@ P 0S 00 // -LK:KK2 K@LpKD`K"P XR  H K@Kp  D H3DX4K up  D) P [R D% 0qY@-  X3K7K;K?KCK^p   L X8KTpP <K X Mp X ` XIP T?DT 0@1q00p`H#(Ẉ4K\pB K XC@K(p0@P0@5T0TAT1@X00d00 0R(KX00X0 X p 0%[0 0fb너P` o o Po Do (o Xj Q n بn dn ot$n @($ m ȧm dm p=8;8H50 00K190`Sp" 00S 0S650"S !# 0 0WV0(K0 VQP05 0 (K5" 0 ~l  0-@PL/ 0S 0@T0)0qT& /S T'*0Q/S$ 0 AR! R B/P@Ct0@T@!@`\P;P F0008@/S@$@@CL t p 00-@PL@M4 KD TKL0 @0 <0 EKp K0S K0 -L`Pp@ Pp! V U h Mp` ,)&VV@ @(e , C- 0: Q?o?o 0@c\Ll @L,$% \* \ `2 pf0C22 P@@L8$ d PP:L949 P(! /@@ P$!/! .C-@P0 M /$P!Qoooo `@f\L ЀlLDE Ѝ\, \ p7 h7 Ѐ@ P`F7P@PP@L d8d`:L9`9t```P&p@(A OdA N@C-`p0 M O&P'0 Q0oooo `@f5\L 5l `L l246A Ѝ6\/ 7\ p77 h 7Ѐ 0`7 00  70L c8c`WL9`9s```0&  0`Av "0ᢁ  0 A-pP`':?C0CS?S%@P3S`v4CNT0C n0Q" ::?C0CS?S 40c @c0 C773#$ P@-;0SJ?S@SC70CC a0A$# 00SJ?S @0c03 " PP-L ` Kh200 -`L@P DP 0-PL@ DP0 -`L@PD DP 0-L@P&P 0P 0 -L8M0Q  $00 K0 Ks -LZ! -LMPPP @T p00+K0`p 0`: @$ 㭿t@] 00 R ℿĞ 4-L2 00 0S KhD00@-C"a0!s!!@00nRR0c0L1R aP ( 0B B``C00Q$IA-@0D \P`0Lh@SQ@:0pD W``U`VS^!: -L MRp0  @`BP- 4CP @XY  00 @(K(K -LM`10P@p( 0Q1 00K@ )KQ 00#30#\0#02S00R(2[@0( 0R$K蠯P @ V($ ᪯K|pP -L=<;:987643210/.-,+*)(!&%$#fL7,K 0! @7t80v>C 0C`< 0 L00  W`<  ;0 Y`<  W h`< L0W0 u 0L  080h `W`< e hWf 02<  ,K(6 !+80W0C`< 0TWP WJ 0,K 0! c080T 111v>C 0CR`< 80 %/"b!!!L080 0'0T0 c0 8KT0`S<  00ş8  ?2c11180 0L0 00 `< q 0 8K`80$/A!b!b0C<` 0_ 000C S`<` 0A ?#K000C S < .`$K0`FX < `\? R0`F 0 0P 0P$K0 0#K$K 0#K"0N ^X 4K⻬P! <`#=0 W<Wp8c0s0 c`<  < TR <` ^ D  @R D0^0 "#  R z H/o "<KPuzXFe X  D8 R:Q ``"2RX0S0 b$ 0(0S X  R  D  @ 1`0 $ (0<  MRp/ #b!!"N0 K/ ϠlR3l11R00  10 1 B000 `Hp<` 80DSd080 `HpX<`  ABLB  QPQJRm| ` <0 (0b$0]D0  DoDV U $Il'Q nP P $N Q<`K Q,Hl`<` 000@<0 S 0A8 RXD0000FRX RB!2gqqq@;W8p 8d< >p"HP@ BQ NB Q$ M b"b"b"$ <0 `(Hp< `8 <0  RD D @7<  CR - @ R @ R 00@  q80KpD0  0E0P  8<0 B `($ VHpR D < .0P Π8 <0 A! `( $ "Dp <P 8 2 0!0( 0c$0< ` 0 0 0uL] p-L4M@00P0` 0 LKD00D0 L KQ Q Q ,00 0RKp@0 ]Pt,t,t,0@P/ P @/ -`LVpP! L(@0JS  R@ D0JU R  RS0@0D@R B/0S00  Br/\R/0 0R/ -L M0 { XPDqPpF ~!PA   p`A '!@ 1q@W40  00Ss!0(K0 P0 0 t @P 0 4`P W 0 @ $=   $0, 0 A!0ZL -fML Ma`   Pp0 R зpK 00CSN K A8p? 6: S8@GKY>K 0C @5 D D uO⢚_^K5PETAXA\A?; 5 5 C>KE 5 5 pU  0 E E _@P P 60 0R(K+O00@+0@0+0@0XYP- 0   W --L M0 0 Q K -- LM 0   K -LMRp@` R00?t300P @ P 00 P! !  3x1WP5 0 K4KwVP Y409 V[WP0P`0 0`f`0` 0 00 (K4`]P% 0P0WP C0PP 00 (K80 ?P80 V 8P80`V\X -@LM(0S1 0 +PP 0(1/0 QP`p0&  00 0`VS <0`VK 0S  0C`e*0`p0} -@LMk(0S< 0 1PP 0(1/0 QP`p00  00 0`VS <0`VO0 QPK 0S  0C`e[*T0`02T*0`0*` 0 0-RL0 @T0l0 R00 0R0 P P <P K0heE -`4@L@(PØ$0PFXKh躘 Q 0-0@L@$P寘 0P?XK0h觘PQ 0-8@L@,P團(0PJYPᔘ0QA-M t1t!00`00S0P  P XQP 0pS  U8 CR8$0D0 pS "X 0^ #R ЍU   "X ^ #R.S A a  00Cp0@  NN!RR 00RP4  R  *4 8/ 0X\S 040:8 R РS /xB -Lp`P*L0L0@D尀 W  ɽ 1hሩlNHd4 -LP`@/)0 \A-PtH @ \ -+*)("!%$`\ mJ rOv ?Q00000 %\@ 7010pS;^ cThǟh @dT 1U QQ00^^70A00-Q ^Q0000  00N00W0C0 0#Š,\Q @\0@0%Ao 00&Ao  00=Ao#4~ 00z00NSP0<00C0o50000 I G G70N3@oP7 nHn,n=m - bp` LPPg !#3b!b GaAVJ 0S$ RQ 100S 1003/P.!@0$p 㡧0U0Nl100SO\10 0SD 3/D!V 000($10`03/P, V@ @$p 00  0S00 0S00SU@0S P0 @0V@H  0004004mlH4 pl3$ji0i= -`PLPx s pPu A@ Pc  00 Qc,1咃3a1a0BqAW% X !PXT $00\! 0S7 <1003/P0 0 $000! 0S 00 0S0 3/ W 000(㼾Pp0003/P 0000 0S00$0S 㾿P 0$000|hgHgTg| SR-Lp`P4 000S 3/0Y @IOP T 00 00 Y @IOP T L00 @ @0 0p`P,feeee SR-Lp`P5 000S 3/00 Y @IP T 00 00  Y @IP T L00 @ @0 0$ p`P edddtd -PPL@ Q {PPp`L@dP lP`V #0p"S N#0P0P -ML M@P` Q08  QL /QH P.00F PP:p᠂x /Q1 Qs P P /RR.Q4  J   BRm/0  I0 P@E#K Avp@ (: S( )S /Q Rn/Q @@P-#00`(KIQ .PQ V 0z/S @0W8 <8^Ku PE@ ɮP4    P/  8/Q0#8 x V/0 P00P0(K"?0 V0/0 P00P0 `P h U">00"00"?00"00"0`0 -0Q@PLP6 Z0a`0P9 0 0\0 @:\0 S \S 0@ S @ 0:S@ 0L0P 404  s" 0 $4@`p_P_@-0P:P\\ :R^0@S@0\\:R\@^ :R^:^ 00/0@-A@\  \:^|^00^^ R B|S0 0:SS  -ML M|ǟ| @d l !Th P$ H4 0 X } T KD D4 ;/0D$, K <$4I H,0K0$Co0100M `@@ t0@d 0D4 CKDd0S:SD4V F0g000D4 P*   D 8V L  $U 0 00 ,L -0-L M0 @ 0R 0 0 0P0U100M 0 0 R   R ,00 奨 0RK0PL 40-LN @@0 dH -L4MŸ P`p 0 ދl20 RA dKD0K<@KH0K0L0K 㴃KNPH YL0 P0 @PP0 I 0 L0 P0 T H I P0 I PH  X100s !&$RG 100S @0 0RR(K X0sL P 410P0 P9 5SX"WV00#  @ P0PT0  0ST0@ T R"@3:  |0 &ft0`p 00 ` ڝ0S"@@@ 9ZPhtG$GGP  \ X ;-,@ M@L@00:PK@E -QL4M@ 0 $0  " , 0 0 ( ,KT D KP00@0#D  K K 0-L M K, ,K(0 $0 0 _P K 0-L M K, ,K(0 $0 0 NP K 0-LM K"0 0 0 ; K f m0e -`LVP p!P@PV XP/ -LsM@ p` g?K|K0 1 @ @ O0Qa a TA}oKXA\A0H  0 @0 0R(K荷PP- 0    -LMϟ@ p 0q3 0  1S01 `̓ Г $?03 ?03 P@U P0!%Uȃ  $ 0S0 R 30 0R,(K P0 P 0C `S303 @p0zSE8~}|{y(pniedbpJ 0 B0`p B `PO 303 @3 03 0SI3  @DT񏐦|K FPq0 BP 0`0CS00003d0CS/K10PP[ c c# P M# +@MQ$"$ 3S03 3@P UK303 @903 ?K3 0 o3SPkU3P03 303 3S03 3@03 3S S @PEP U0C @`3S03 3P03 63S3P@S  ,K003SS 00C003 0X0 0S [P U PQI 0#C  # 03`03 )  #S`L 00CS01000X3c cS XR    0#|#0#        #3 # #0C`X VM# hV h@ @@HVL`  M 0,K03SSo 0P 0CQ g S P U3S303 @s3@<3 03 l3@03 g303 #!000C3 @[ 0@3 W330903 0@3 K3;3 330;03 #3 # p# 0# `j#`f# #+`^ ` Y`W3@93 03 3@<03 03 3:3 v03 V3:3 o3@93 03 3;3 d0^S0 3 0# 3 ?K,@@3 3SpDj #S # P $  c ` !  # , K BC TpD-Rt ]RJ R 00 0 P 0C `S P @ P 1 P c 3cC 0D S(*0/K0Q# 3 3 @0C c `  s  APR+ E  P BR@  T 1*PNU \0U IU\ P BR Q *P@sW30S 30SWW00CSpP0s T:sc 3@DSS5*T T 3 #@Su 33P3 K 30l000S 3#0CS3S 03 3`03 <P X @  :96 MPmWk*@P XR sWy `P 0P0CS0 R00*@Ps KPp 0@0CSP00T .*P03 p0ES3S ,P} 0p0CSP0@03 3 `Fs0S񏐗\'P<p+0E P 0P0CS0 X*pP P @0P0CS0\/0AS00P0CS003 " PW*@P(U0P0CS0E P T *P0NSp0P0CS00@3 PS3~S 2P! 0p0CSP0@%03 3S 0P0CS@0 T0*PwiU nU3 sWT ~PO 0P0CS0 0R-*Ps @PAQ 9Re*P@ P BR @ X *PU P BR@ `T *Ps&0P0CS0pW 1*P@Sp P3U#0R0C SP00X :*pP@0P0CS0 u0R*P03 3S.p@cs3@ 03 wꃲ04 K03 ?K3 0p3 U+3@PC 0 P #0C003 0X0 0S P 3 3 S @C P 0 P 0@ B0Q 0 R0@3 ps  xP30A0VP kPT*0pP `PT*pP)Un0P0CS060Q*P@pPS3s 03 03 @X8K03 _Kc spw0S6W8 ዲPJ 0C , K0 @oKL  0:p4 P ;p 6,0K3PS 3pGS303 3@03 P TcsSU 3S0303  3 P3 S0 0@00S0 3c 03 9s 03 _K`s3#S # pG0` R)W9 P ,0K B@  L(  0Kȱp P p 3pGS303  P Xcs3S303 C 0#岖P0 3 `0C 3 3IU!d # lP#JRH*0 P `PT*Pl3p3 M SPW*0P0@3 p5 0#&" ៱P^ 0C , K0@?K 3 N 3 Mp0F P p R6@bSP00X H*P@ P)X'* pP/ # P#)R'*@P PbT`* P, PX* P N_0U0P0SK0p0CSP0s <30_ K430WT< P,T**sP  PQ*P#]X p3 pP@@ T  pP P3# /303 0Wcs 0P#U B`# 0O oPT*0P03 :c0cs3 # YP#7R5*33 P@" KPW* 0# P @PsXq*0@P%0c@s3 0PxXv*0pP@ %PT*P(csC @ csC @#S C# STs0c c @t t3S30C3 mTC #@t e3S:0@csC @QcsC @LcsC @Fcs @@cs @;-00cs@3 3csC @- @\pcsC @csC @@} -@P`pLR0 VPS- 0    2p-0LP@8 !00S7 )0`v 1S010d B00PP0! pW@0P? `PP 0  00 @ C PC0000%  Q  Q* PR&  <0@08BP )P00`0 9P ; BA@ ?#0@0 P 0-@PL AuP0 -L@`pPᡮt0t0l尀 hT  @@0 $ UHH@ % 0G -L0PT1  b`60Ph1 W 0SH1 0x1  91 @ MK zU Ta@00PU`p T U 1 # 00P?0S} PP P@6@&@0 8 T1PFEQ U1D181 5 P0PX1  0K 1 :1Sa U 81X!0C BPX1Q  50 R  x50 R 00P 00P 00P "00P@\000P0) e`Y: TQhXqY5 0 p6/P=0P0XhTxl10 0R(K1S@AZ  \d`1 NKXwp XQ̬0QP.hPPhL1d S 0S`1  d1SP 0P1 h1匡 0C\1 &#|` P 0IS!,H!PRP 0 S* HyP1`!0SP1 *d10Sd1 H10H1 \1T\1 0 QK P10t1 \1 Cr cL @c0tcQK@@P@ PP@@\Q t`AQX*@ P@LP43152H!0\*@L1S L10SA PH1PA0Px1 X1  -L $0-S`LP@:T 0@@T(0 0U   0SQ 00(pȦP$p  B "!"""$"(-@P`L峦P@ -LM5@0SXP 0KU.  *0 KSPK"0 P0: S& S 0  S00KP 0$0 i  0K0K `חpP$`  0p\ 0.R`dH0 L0SL0S #QP$WV00]0S \040. S0 -L`pP ⭤@P \0 00X0`⣤@P 0\X0 0 0P `$050%@ -LMPR`p Kፗp@ Kp K~p@ *KSR+KSR $ 0@0U P P K@ -LP(:P,0<,04 0%$0ph ` l Ĺ  R-0L% 0  -LL`P@p@,0<!% R@ RP @幢T V,0`<,0L0`S00/S ,0@ @@h ઑpp@ ᷒P@ @ ꬑ -x0x 0PL0@S0`0 0S (]t([t(hfKh苑(QtP -LBMxx R  ``  T ANK ㇢ P,J  긿P  0- L -MLMŸb P`p~@( P TI "  nKⰒ"`F @ J0 ( 0R$KBNKP"@D0 `3p א0 B>K0C. 0($ !$ 0  姣100A@  08 |P08 \  AL+\ -<+*)>'&%$#"4    p \Q d     QD Pv PM< lM ,4 xL @ 0+N-'Ydvutsq9 khaB6b` {l s| 0SjtKt`Kr K0 SRV r0 QPG 0P? |0P, 0 ! -R ?S$̟ o!0Ȃf KY!aef+1aa <0Ha0 IQG \p  HKu0|   00 5p0, KH0" 0 | t0S 0t  pR05|0HPK00: 0 uYH0[S0 0 R Sp0h000| 0p|0HPK0S00 : 0 auYH0[S0 0 R SpY 00Yp00Džp|tKtKqt)HPK !uYzH0[S0v 0 R o Spk0  0 | @p^|00 S0ڜYV 0R  I MQI SpEYC 00Yp00Džp:|0P  1H`K0   tY+H0[S0' 0 R Sp|0ǟ0 / b !S 10HPK0   tYH0[S0 0 R Sp|P'1 0HPK0  tYH0[S0 0 R Sp|0 1 (0HPK0   tYH0[S0 0 R Sp|d& 1 0HPK0  dtYH0[S0 0 R Sp|0%  1H`K0  GtYH0[S0 0 R Sp0, KH0" 0 | Rt0S 0t  pR05g|00 SW 0Y^0S0Y 0 R S YpO|00S7 YG0S0B 0 R < Yp80  0 |  p+|P 0S' `PoP Y0 S0 0I0Rp QP 0|    ?p| H`K0 00C# K `/@!b10   sYH0[S0 0 R Sp0000| 0p|0H`K 0R  B00C" K  B!`1 0  jsYH0[S0 0 R SpUP|0" 1H`K0  HsYH0[S0 0 R Sp0000| 0Ups X|0T! 1H`K0  sYaH0[S0] 0 R V SpR|00H`K / b !S 10   rY=H0[S09 0 R 2 Sp.|P^ ųhq u 4p gX 0   p  B/A!b@P y0   00 p  HKwqH0[S0GK0 R Ypdn xp1H`K 0  ZqYH0[S0  0Q YpomP} k  HK=q곋 -LM@`HKDP@. pPpP0 PU@@Kxf p-@PLMK`@,`0 7V@@Kp -LMp`PL@L0@]l8 0 P@]$Kep -LMp`Pl@l@ P]lT ,K 0`,  00PU``@](K(ep -LT0P DQ4  dT@4] 0-@L@@ 0舔d0R0@-0 T@0PP0Q 0@0@ T D00dl ]z0@-L00 1@UT00S   0ؓ0@-@H00 1UP0S   00 !0谓t@-@PT00 1 ^R`WV!  00 !H0@-H00 1@UT0^  0 !0ܒ000//000/00 0/0P /0-@PQ@0/0P /0P /0-00S |0 \\ H0 0000 00 94pmNA -LM 0 0pX!G!`00FBK(OPEXdIABd`)YIST000H 刀 1X@@T$Kx_ Nx 0-P@L@P 3\0S 0000P$ K0h&\tD -qp L` @P\ @DR000CC110 0XaX 1D0   p [?X0H!H 0p 0 0_1000CC1100XX0  00p0 00  0p@0 0?p0p 0 <p 0H@ [8p@p0L -! LP @g`~[ AR000CC110@H 0T`F# 0 ठ0 PTP ||00 Q PW[< ,pgqpA0` E[gfffX8U 4  0-(@L@ @3[P/[0t -@`L⹆P# 0PaP`pT0a0Jh@X 0`AAZ0O&[pG00wZoTAXA\AXP T 000  D. 0-L:,@@0@P00S@08 -@P@_}L`P(p0@aaZ0OZZO00TTaXa\aXP(0(  0 0L`YX 0-0 00L0S PZP0SZ 0CsX@ R`Z0@T P PP@ZYp( -LM1!0P@Q0p00 `O VE V8 0)  `00S0K0 0K  x`P$0K x`P x0`SV/0KT  KxP{x.0`00 0R$(K ` 0 ꀐ, KⴀK␐"ixp`  0 @`[危0 0 0KKxP꤇4XP --LM00  K -Lp`L0L0@DP mW   Kh*VH< @-/ 0SAS/0-$(0@# A  A A A0/Pp@- P^ 0S^ `@S 0TT0`0`pPPpp -LM4 Q@ ! 0匐匠 pP4`0 0 U`@D X00 0   vlP:04 0(K(KDb ^ M ^ -LMpp P#NK` <0 JP  #Xp  kP0 0R:(K0@0S+ S 3NK 0 .l0S 0%  0l 3NK0 l 00S3NKP 00SꏆSPL 0L -IML4Mğ @PP `p0 ` 0S SJK  `0 0R(K JKR JKRV# JK A 0J-KjV0S; SQP00 S:0! &jWV00|z0 zt F jV 0K0  j 0S:  QU0 UO 4  ibs MPE 4E D dD C C C -LKMP @ `0 P pJ DP 0 SV  P:x'|txS'x9 0@S,0H1 MK'3K0 K4KC HN/KO?K L1 P81 S:H1 <L1 CTL1SH1$!$("(W 0 0R(K0H1 Y  R ⛭PH1 d`IP -@P`p 0L0 l 0Pi 0-LMPK@P"P Q 0S  R0SP HNRPK0@PP@@ 0-PL@tH$H00. AAS0C .S .R Q P-S /S /Q P_S 0p@-S J RM @\@E ^> S R 00eS:@PT8 0SL D`D V> U 1R* @@@0T&\\!^\ʔ 0 0 R0L?o20S 0Rp0SR pR ^ pU R$ D0DPS 0SU R D0DPS U RT 0S DPD@US0SA-@dQ M%R @ 0S  R 0  0S @T0000 Ѝ`lq ᶀha( R 0 0-PLP0@0T 00@ @0T0@K0h p-L M0PS `@K`$?` $@80S 0S 0SKp -0MLDMK@(KDLH B00K 38L#0 KLA K P@hK0`F0 (Kp1< BP0 1K0@A00> 0PS x2y K<A1#r 01t(0000 ` PPP  (K8 B F P8K80C I008K80C 8KL0C000Qf(K 8 P0 K@@0 08  P '4!48C8S (KD B 8#80(KD B0Z{8KD0C0S8KH0C0S S S I0 0 0(KH B08KP0CD0C pI0 0kI0 0fI8KH0C0 0ꬁAP; @ -LAM` p0P (0 V@ @P' BK0 @` Pf ( 0R$Kh0 RP @@ .RB^K PE $0K@dDI00`X>P$ P 80 0P  R00/00()( -0LS S0S4  R  R R R0 S 0/ 0 0S S S S S00 00S0 S000S00 00 p-LMPQ@`  R R Kp R!RR Kp00 AP00P8#<48#8V R R  `0 Kp  Q Q8, K P 0  ꈋ4  0-@L߀P0 -L$MT1T!0@P P`0 = P, LKP% `D[,0}` R P m"2 "c? ,%0P2 K"QKͭ lPD1x00x02`{`X E{0#^0^@`{@h5P0( ~% %  @Ii -@LTMplK P1儡0|0  P0x | x0 3PL 0  R0S R R R0 T @P`LKp0K L KL` P0p0  xYP(Kp`V`V 000 j`Vp0S 0PP0ST  -LdM`pK@}P0 plPK @Q0p0P tKxK 60 }P P0S004 (Kx]P0x1{tKxK0  }P P x{pLKLKxH 90P0 P0 0 00S[B 0 $  -MLMŸ K0$NpK(AS 0 P K*K, B A h"K A X"KTK A0J * s `P@ 0#S2 =K0CBP, P=K0CP9P# @P 0S   @3^P* T 0S S S@ UP0P^P 0DD`P0@=K$0C00 0R:(K@K=K L(0C$L=K 0C(0L$ L$@ P=K 0C0(@T =K(0C`@T 000 IP =K 0C0(=K 0C0(@y<"P   x -0L,MD@K p`H0 2tt=`$PK$% )P @0S @HP &(0S0 Kh  -&MLM&LK\K,N@D̟P MK8@D(@NKN K&K@00 0K0L` 00S 0!S <-K0, B0=K0C P4"48C8S pR=K0C*0K=K,I0C`I0  @-K: BP0<=K0C00 =K,0C03/P/ 0 SS00R0-K< BS0p% P&,K`&,K B` K4A@@ &xV@ `S``5-K0, B0M R  C'SR%-K BRJ0.@  $ $ ( ]P)=K 0C0@#&,KP@&Px>0@0=K<0C&,K0 B0S &,K B& KQ =K00C0&K0A m Pi&00{=K$0CpRJ.@E &P?-K B0=K$0C K @(%=K 0CR0:$%R7 %r4~&,K B-K B R  P\ P @0fv|Pp T h -LUMP`ğ` X ` p\1 0 `RtP NtP >K d1 8V00\1S0  P X0  @P4A R@0SV X0  }P vv4`10 0R(K0@l1 @=000Sr  .S 0S Q@Q@.@DOoBRc d10R:0  YPʲ=0Tt1 0  DD@Q0p1 h1 &dATQ 0 N DD@Q0t1 0\1 ] 0p1 h1 0 1P}0=SA =0S S" S \1SI t1s]h1S^p1S- vvl100Sp10p1 0  Qh10h1 <.K PJd% 0 0 PBD=00@=0 0[ u9=00U0p t1 h 0 P'ʭ0 P #=0 t! rt1s =t10=00_uP -LMPpU`@ 3 0 S[ PP 0 K0 0 00 00000 |0 x0 t0 p0 l0 0KS5 S S6 <00<0S& S S!0`  0 0 0Pd KH d0 `0 \0 X0 T0 P0 L0  d1iH0S 0(K0` 0 0 0`  ` 0 |0 x0 JpP d0K0 0K8 0 =  9 0100i?0 0K0 0K 0 0R( KP! 0 `P 0!K 0      1P0SuX  d1 ih0SD 0< -LMPŸ @ `p0 ' ,(p! fP 'PW  PQ P Qp0 0R{(K0@SW 0@S0S@2 @ #>KD2  1/K0KID2 i@"?KD0 ?K P@"40SD 82Z@2 0 SH2 @2 ᱝPH2@"D0Z: 0S ppZ: H"  0 @ Z R  QpTH"ᆝP@D2@" M ~s P -@P`p 0L0 0 0POA000 R#4000@00@/G-0HMp 0@P@0 84 0<U0 8`'0 `0`& `8lP.P00P%P8eZ@.@00@$@t8G & 00 " Xȟ0b%% `0!08`<$ P, haP"`P@%$`Wǁ@#P @ $(PGi !@ 0`"`ว,0l P, P00 P%PeZ)+C0)0O B @# @t4G0&0  #8 P7b%%0`0!04<`<$  P,@ǟaP" P@%D`Vǁ@#P @@$  b PF ,@  "00m @&0) 0 0#[4@&0& 00# lIp&0% 00# b&L6$0!`0=0`," ,PD` ƟP# PP%@lɁ`U @!P@@$  b,PE ,@  "00m%0) 0 0#[@%0& 00# lIt%(0% 00# b&`@,@$T4@ᚃP" !D a #@@ , pğ @$ @)0$ 0TDc>@`! `&$@8ğ `j P"0@P%ğPeX @# @$<@D&0,#0l΄ %` )3`隌0 $P !3 Pa0 ,@ ",0S $P0) 0# 0tc8c>`!, D@ `TSj"PP,PeX,C@# @,@ß D )0$0l̈́ `! b0`Ԣa 0 P " (0P0#@@E08b` )` xŸi P P%0PXbe[`0 0#  ( `020*@@(0bE`0 ,D` l̈́  `!PPe[ Б0  0#<0ม8 ` @`&`@e @! l͆ 4p P " \Pb+@  0$ 0,@pRL`0p: p3PeEY@0Y@@I $Kk -LM@p0 0P(`K0 0  p!? 7R8 bx b   0RX KhpP -LMH"H2 0@480 0@ 0p 4K1KO 0SP @ 0 XRP@P@0 ``+ T6 >.0 N0P,B,RS R+00@' U% 0H0S* S5 S. P 01n(."4n#..(.< 0T. , a A  00C208 CRP800 0R(K^*30[4 [8<^*40[^20[3[44 [8<p.S^ X*0p `P -LMK]P K -L,ML1L!0`@ TP0  Xpo TP8 ?o2T0S E0 0R0(K PK0 @:, K#<@$S X $ CY ,0K1 $ S0 P, K!0$ R0 0S oPp  -LrM@ P` p( tKe?K1 |@ x@ AOA0TAXA\A1 hmP    0 {K cZpp 1@nP ( 0R $KP o00 0p0XoLPB- 0    -- LM 0  K --L M 0 0  K p-L$MP@mtt0l $ ,K00 4 ( 8 ,@ P @X@8K`V Kp- DH r-LQϠ\ KhXn -LM010!0p`0 !(0 _p@ PK 5 o _p U^@( 0R' KL^KP@X @@T PU 0SjP@KTFJ0@0nPi 00-PL@ P0 000n(0Pn(P,Pn 0h0PP 0P 00 00,,TP 00 0P,  00-L@  Ë 0 00 00 0 0 0 0-LM 0@P 0n 00P 0   54?o20cK0=' 00 0 0-@PL U 0 0-@PLrn0PPnn0P(kn(P,P0 -p0LP`a ԻP[ 0 S S @0 S S û0PJ  @I8#< Z @> H୻PP# @C 0S@ P@T! 0S S S@ 0AS AዻPPQ0000 mP Q` lP:@t6 `@P$  P -LMp P@,0(Sn: (PTX &K"[T4"4("4"<8#80I 00SE 0 R?@D@T0: 00S6000@DPP@D`% T4 00S%P 010P I@0`" 00S0AS00lP  0(0kP@@$KA00$KklP (,@ C(P 0-LM 0@P   p P K0 0 0$ $0K KP K05p 0$00$00 ?K0 -@ULTMPP`K ` @@0PPLPjPH @@0 CP=PPPY * 0p` QR Q3 0S*QQ   pQAp 0S`:0S bRj0P\0   \0  @h `0X d0  R  R RX0S R 00I @T: h l\  0JR5`0 (K  X  0 LKX0 띀d  D H j p 0 @` d0 _W G`4 R @T:@`0\@bl(K  HDS QAR  R p l@ @0p P AWU WK Wi p WY T' QWD W: Wp` ` @`^ \LQ  QAp@ \ ^ Q\2 @`0 @k(K` ` `   ` R4   0Pl@  @T:#`p k'pɽP k'\ -'QLMpPo| Pi</i`@0p000K 0 ~0  y0p $p$t00Z(04Z`30!,`501,`%W1 -  (``P `80 Q 80`C ` U  P0!03S `V: PVXIW(K`W,`0W 3 #- 5- % 1!!00@Bk(K@00(K0WK #((R` `84`F2`F1`FS 0?`FAP5V4C  0F0: ;0(K0X' #((RP P84PE2PE1PES 0PEA` U0  0E08 90 :04  800 A4A00:`08P -LMYp@% KU[p dK!0R0%0 @BPYu 00p0 0@P  KY@ K[ KY0@0 / 0-L @\,\@ \ Q :^ : A 00000 -LM$@\PH 80K( V8 0044n:KB8@L;0zC$07i8 1y-`BCL^8` 4 0 ` ^   00c8 0A932 3 A00(K Q 0 00-SL@ 3/K0hi -LM8 @<S Q `'`8  0P  @`f&PEE AA!`F`F!f&@@ AA!`F`Fa&P@PEU% BAA RG! 080R@\RRc  B10`[8R Y`00K  0p0 P0  I@ pG`f&PEPET%@D D&"`F`F"f&PEPEX% B B""`F`Fa&PEPEU%@B@D Y0 G$80Y@A Y Y 0L 0H 00K DN0 PI00` 1 B01 0DP`0F0C6# E B$"@D@DF$0C0C$6# B B("DA!0C0C1# B B%"AA! 0(KYY& Y" Y$ 0 0KP 00`Y Y Y Y 0`p0 B01 0P`8`0\0X0T0l0h0dy7 | ` 6 -`LP 00s !R ! PEU6@  P G0 0  PU pWU@.Pp X 00  @@pG  00Ҿ  0 @00Ǿ -$1$!0@L P0 010 00C11.R 0  0P0 : S`J P @p0l0Fl0 @  00C10 B0@@ ʚ; G-5p%0  M0\ 00I10@ @\` P @R P@\@ p`0IAP@@pP@\ P- PPPp0IQP`.Yp ಐ@`@pWp `p@pEI2Y 񏐓}#~}|{zyxwvutsfqponmlkj]hgfecba2cABdQelQL2Y REPONMLKJI(GFED#BA@3>=<;:98765432%0/.-,+*)'&%$"! 00000@000@ 000@Ѝ002cABdQeQ00⊐ಐ 0@  p`B 0J ಐ ` p4 p `p,`!0@`p# -@L Me| ⒁$2al B!!0C H M!!1L ,0@0 } KЫ Q -LAM@ PpBnK `Fp 0( -pP,4[ S ( 0R$K.TfP0, -@LM`` Pw-pPP 0S 8 xK00S.SKh -LAMd0d0 @\B^KPEp0 `P  0RK f\P 0-SL@P` @0S IPV 00V00 -@LM`pPU 0V0 R PU_L0P0` W00KW 00K p-@L MP`t0S 0U0S @0SOL0@0P V00Kp@V00KpT -@`LM KQT:8K,@@ 0 0jK茻  Q 0 0{0 0v -@lLM KiQT:<K000@@0 7Kк T -IMLMT ş0@@P@ P4 5l 0TX4 0p00 t|5c0PL4 h 0 0@5mK0?h4 C>K 0C`FH4 0 ` %  /\ ` d$ 0 \PiP400Z0S T40  \4d$Sh4 ` -KW4D4[S@dD@H4?@H4P?l<0  Kf0SLeP;0b0PL4  0 BX40 0R(KWH4/0)S( 0L$C @ ZP L  %-0S )sf$  JX40 0RL(Kod<H4@!( ?0  JT"t  |$ "判  $ "d  $ "p p$ "唄  x$ p JpGpGWC4@ 0$PRT`) U | @J뀤tD   JX 0 tD1l$`F`0 00 .V 0 x嬶ꌁ 0 㤶Ul 0 ꈤdt唄:P4SZ}T40 y  8u@ 0 ㄶ0tD   6JX 0 tDr0l$`F`0 00 .iVoel  JDcPap  @ l_ $ ` (  -LlM\@Kp `딅P0 0LKLPKw  h  l%[`1l $[S` $[ᰥ[d 应[ + 40hA  l0 I`1S   ;`1S0   0P  $P  P   P  P  P  P P`1SXh0SZ RP_ 02I 먂 `0'I d0 I \ 0 I`1S   ~0 `x 0 `r@0 `l0 `f`0d 000& (K >  h0S QP_p 0`H "ld8 H(K (K 0 !0 m0 [0 H0 50 ݴ"| 0ִd0 ϴ@<<l T  D \ 0 | \ <  0-@LM Ta TR !T^ 2Ta QTPK0TI T= /TU lQTP 3^\1P@0(  T0  TE (Q TP @T T) Q TP T+ PTP P TP PTP P TP PPPPPPPPPPPP|PPtPPlPPdPP\PPTPP( h $ t  h d x |  ` 0-LMPKO@ xPK0 0P0( oK0茷 00A < M-L@M0 0` PPpKP @ .0$T @D 4000 0R K$00. 6=adP, -LM@8 4 0 x8PK4Kp90K`50 4 4Q0P RP (KR `8-\ 8 +\ 8 #0@0 0ಠ 08  Q匠ಠ10 B011.\M 80 @T@ ppßW' 0S#380 @ \R  R 0S#380 "#Tp 7))8 *,& )Ġ `& &d0*8*p  ` 0080   080   0L080   0 B   :80@ p @  T  R 080 @  S # 2RP T=S; 080 @T2 80@ @TQ 080 @S#2Q\ TS 080 @T@ @ f caT -LtMQ00  S 0Č @4 8 Ȍ@<̌c(#@"$l,.,aH!c$"0l.$DŸL80 0a$ ^!<0 2Ÿ040 QS0N0a@%`0 N2%cC2`b2`bfa@1AR@0 :D0 W0E0PRReQN0 bd0 $2!C+J !; 0!# =+J   +J "  " +J   # +J "!  +J J! 0;J=K-K<0C8 B0 EPDK@DK =K0C0S  0D; 0KAD+ 00KS0+ P0S"  K@@P`q0V4  0d E =K-K<0C8 B0  PD+@T=K0PS=K0@=K0C0DK T:U=+J01-0 30;J0000;J020 20;J0J000J;JJ+J01-0 !30;J0000;J0 200;Jp+J0-1 0->JJ C C Cb=W ꫝK I @PQTT ,n`=K80Cp=K<0CPD0Q00 P'0PTe 0 PD>0d D  =K-K<0C8 B@P0 lP@PꫝK I Q@PTT d 0@* =K-K<0C8 B0 PV9 ]@D;PD;@0VD; . 0 d =K-K<0C8 B0 PfS~LM0@0d 0 =K-K<0C8 B`P0 PND+0D d  0 P=-KD; Bp0SD; *L@D;0SD; * 0 d 0 PD4<0d D  =K-K<0C8 BP`0 pP=KK K$0C0AP`@p@C 0P 0 UP)O=K0CD; D+  PD+ @G-K BD;p0D; ;0d P@ pc =K-K<0C8 B0 )P=PD :#D;J0D; P@0d F =K-K<0C8 BP`0  PD D;0D; 60d - 0 PD D90d D  0 P@y-K@`$ B K KA@ 0 BsPi=K0C0D 嫝K IC \9P@PD ' 8i`=K80Cp=K<0CPD0Q00 PD0PT^*0 P7 0H+uHKD 008B0d H D  -K8 BP=K<0C0 ~P`D;-K-K< B0D; -K  B@wp-K B R9K D+P V  K@ 0 UP `0d @} 0 GP`F@P=K0D;9D+47D D  0d ^ =K-K<0C8 B0 $P=K0C0D 嫝K IC 6@PD ?TyTd f`=K<0CPpD-K0Q8 B00 P0PT@|-K8 B0 PD;P0D; D;@0D; D5@MK @DP02 D  =K-K<0C8 BP`0 P_-KP`$ B K KA@ 0 BYPN ,5 0d =K-K<0C8 B0 P;D@TD % -K B 0R0-K, B4`BP`4000 0  0H+^Hk D 00CTH D 0 =K0C0S=K-K<0C8 B@P0 eP ^D;@0D; XD3@MK @D02 D ~=K-K<0C8 B`P0 BPKA0 D VPD =K-K<0C8 B(C`P@0 D &PKA0 D :PD =K-K<0C8 BP@0 D PKA0 D  PD =K-K<0C8 B@PH0 D P-K@P$ B K KA@ 0 BP>vD=K-K<0C8 B0 D PgWD =K0C0S& =K-KK<0C8 BA0 PSKAD;L! 0A=K-K<0C8 B`P$0 PP=K-K$<0C8 B0 1PHh`m=K-K=Kd<0C8 B0 P|ULTxڭ=K-K<0C8 B0 Pl=K-K<0C8 B0 Pxp -L M`^pA@0 <  00@P@pĜ` PPK,MM$000 1 2Ѝ/ -PSL`p@@W V:0@4#DDH$H@PU 0P@(00V@D : 0-`VLPA3: 0@4T0, p 0 40@T"T0TT400S0 XT0(00$, P@@D( 0 0 -QL MP@`p$0S 0! $, (0v(`V{0Sw(0S0! , ($P, SG100Pm, 0 ^,0a  ,  U$ ,7 \P: `$(,b"  b$ $, 04 \0,::(00, (0 S)PU$P0 ( ,0 K0F P&, (` , (0 0RTPTP(0$P0Q (0,  K0 K詮 0 ꤮( 0 0 -QL MP@`$0S 0! $, (0x(Xp0S(0S0! , ($P, XT̠ 000gPx, 0 Q,0l U $$("(!,  $$("(!,; \T: $(,b"  b$  !, 0$"448#8 \1,::(00, (0 S)PU$P0 ( ,0 K0H nP&, ( , (0 0R QQQP(0$P0Q (0,  K0 K 0 ( 0 0QC-W`@p 0 <S'A&a$Œ?pF$@`P pP0 < S'A@&a%Œ?p0:P `QP`Q Q@ AP <@0U,``Q`  ==Y*0 08l tk -L$M` @ğ4 0p00 3P0@0 3 040 30D0 3080 30H0 30<0 30L0 Q 00@{=Q 00Pr Y6 Y Yy V XhTP0C10Q_ 00@t=QX ٛ0PU < 0C#" 2@T007:SHQD 00@]=Q H彛0P9 V@ X48 0C#! 3@T007:S'PQ# 00@:=Q} D圛0P V X4 0C00@Q 00@=Q @僛0P(K PQzY(KV@ P T* P P Pdb` P]PQ 00@=Q LSP @Y  YR 0@0@ 0S VX0S  R 0 R0 0@=R  X_j j j j j j j |j j p@-0A0S@ p00XSA 0SpRp.PC+SU.PPP` 0000`  0C ^7ࠃ0ࠓ`0CV0 TPP  0PN U7P0P>NC[@ -@LP`BT @0 x0U ࠱ࠣU0 .PF0 #2 S7`0`000p 0 S7`0`W00 ^P ^00 0 0/YD0 0o/㈤XD///ᰭ -LDM @0\`K0p2 ( 0 RP; 0 PC P( 0R KHXPXd - LHR0ŸL %ȠiNMhCK4 A8 葟姢d@L I"!'b rjb%)@ LCqc`Q@p0 < aN2<0S9VAZIU<0`00 4`K0@K0 SP#X0S    00000000S0 @(K40K0 KWjP40K0 KD<`PV 40K0 KHVPZ 4`K0@K 0 MJPU ꉈE.ų%I$MndWl -L`PpḦ0S@2` ᪣T#  0R.S@0D0bS.P@TD \PT S\P  @0. 000B @  @ݪ(0 0 -LM0 0@^KPE0pp  0 PBnK`FH P *o 0RK GTP 0--LM0@R0  b,PP*K fKF 0-L@c 0`00K0ha -LM?  _ K p-L Mt0t 0`$PK0@  0  0 T0 00 0RKpF SP -LM0`Q`" @P0 Q0 0(DP 0 p p2 H4hB 0d2 <40l2 440t2 d^@P /K "h= P R 0S Sv 0S So p@T `"@1 GTh Aqd2 K:P@DQTD:Y@DP R<?Klr p`R4ቢ QYP@Dd2`lrd |Y dpW @DP dr  e0d"R@D} q_PU oF `2` 0 屩00(K`(KpR xb|R#Yq0 S S0 S S lx" œPP0 0C?ox"20P  x2 |" 噦Px2 p"W|"A* pSUa R^ @xb |R pRtb@p╓P @T P P P@ P W:( EP P 0G0 0xb.0 h  E(K( Dp2P 0p2 w pGp|"x2 E`{p2 ^ X2 -LLM(1((0P ^`( p+ X@K .0 P' W Ԁ0`0 奤0 0 \K`KHP `E  0 ( 0R K` GP `@`ET.EMPtY X -LM`p`@PT) X ``0,0 ](K,K0 GP ,eE  0 KX`` ,J@,UET KGP @8F xF 0-L@`PQ 000c BP00 00cRE\00 -LOM`HsHpH VL P@0  V 00K/0@0L10 0R(K0Y` .ΖP "0 p S S  "! ".\  RF\ Q.R@ 0SyH0C SH! r0 p@ Y0P1 H! hP P1 @ѴH  H1 pG 0H1 P1 喣`WR:P1 በH!0` Ha C 0S@ 0S= RKK8  :P1 jPP1 S  :S.S00<##40S0R.S:S+ H1  @A 8! <1 4 S0 0(0 `0  KvP@W00T00嚧0@0M<.K PPX CJP:tB tGT -UMLM@,5 0P<˟< 0U `8  T0D% 0  P@  T T   850 0R(K:0(5 (A0P45  `4"48C8 @VS#U p0 00 0P0 5 0 (53/P @V:,%0B?o2d5 R0S<5 D5T5 04P04 H5 0\5 9$0l5 9't0-Kt5 9 B0p% xM.K0X% 'x P% L `5 pWK:P%TP#P2UE 5  A  PP0 (53/P @ V: $  P @T0sU<Q $%R# ,$%Q PB'RUPPP,$0T%`%;EpWP*H%RL @45d@P5@ d5R00Sj050S, 0  050S 45LU@C u@@0GS ?:0e &>CP5X C  0GS ,:0@%0TU@T00 % BR0S  L545 4C0@%060(5 5PT5 P0% P( P@P@D{&P5  A  PP0  PTH5S \54%L50Rh*45U0P45 ¡PPU H50H5 P,%$ RQ=%C>K0C  $5 0PT  K T$堡5 % BRPPXPU$5D5  ,% R R R h5 05&PPh50% R$%R H%R%i   Q p%P Q*P $5 [%$50P 5 $h5 Ph5@/C>K0C  $5 4 0P  h5 $(53/Ph5 0T/\54%L50R455*U P4% +P=P$U $ 5 CR00X0S/$h5 fh5%P05 fT%l%CP`h5 05 $% $% h5K50%@E 0U05P,0L5 LBI 0 @%00%5 t%CP5QnK`FPpX.^p !l1   h!0S  rt1p0\.  ^U00T0S @WT@@PXT` H5S]ڃX5A 0SSQPVP"\@FA05 0SJQK % A0QDLU(@\5P 0\5 45L 0C0B K @$5 iD$$5R@$R<$r LU(x@\5P 0\5 g 45L 0C045  A GPxQ hQ @@ H -LM0S`@03 S.0 0>PPp1 P: 80P0 P+   0`+AᝤV 00S S  K0 0>PPp  0 K A~A -BML M2p0`  8 R 0 * RC>K0C3K@ d<4 P0u# I0@%T *V$$"<2P  0 840 0Ru(K 0  CK  @ ! < %=>@PE PP@ 8<0@ 0 P> 0P00<$ 0 0^@X6  0@C\0m  R     @T'G 0 0 0 m@ 0 f@أ 0 ѣ 00S Sƣ?H:PPF F E -LM`pᜣ@P0P0 0  `0 Pᡣ(K`0 PP -LMP`pt@P 00000 P| K0 P0 RQp-L$M``@ P/0S9 0S 0S0s7 S 042 1 00 00( 0 ,K,@ $ P P0@0KpR R @/ 0 0Kp0S0@0  0S @ 0 0Kp0x5(@0 B -LLMPğP `P \0 0P X 0 T0 (=@P 0p }?0p P PP 0@ K0 L P0ð RR RRd0 0` S Sh P0 S S HƌP 0   R+ `sH pPp``ᯌ0P@ `V R R R`  T:((>P pU 0D@ PH\0h dS HDAA`C\ 1XVH@ <:`FR7pL  0p`Fߝ0V(: L0 ҚL0T`FP0 \` T0 ` >>  Ἒ0H QpR`FP  ᶝ@T`>>  0` T 0P00 0R4(KL  P/ P& 0 0` H0 H0`9XH g0H >0T  `00T 0ӡ00`@ ` #>4P   p-LM@P`0000  0fKp -L M@$$ 9 K褈 0-LM@P9( 0$0  0K0LP 0-LM0 0@PU 0t  00 000@zT 9 PK0PUi00,/LЇ -LM1!0@  ,pKP `K0\! 00 0 L RL0100 L.\U 0 00K R0 XS 00 9\0 \ @ PE U,( $ P(, $Q0 8 c# $Kc4"0, ፙ0x. -L4M2Ÿ0 @P0`00 2 P%0P@pK:U@0 00 0H d2 0P0 0Lp \p  pP`H 0 KT X YM QP0 pW걠/000 0Rr(KN@H0 0H00H0 P-PP0:YFW T0SH0L PT 0P:U`H00S L X R:L*$ pL HPY\p0PK L 0U:*L0 T0S$ L R 0BS L0Ts Sb .Y`\pL00PKYPL ʅL0S<,P8 -L(M P0pt 8`K@ ( !P * ( 0R$K 0@0b<)P\6 -L|M|ß|  P 0 0 PpK 㣟0 @B1T0 ,PK2\T0N` 0 r 0S Q r v PQ  0S` rq v00Y0S Y00`` `0K0 2圐 0@0 2KT\ P UN*:0VT0V J1 _!XA@T V00 S 00SV:0@0Tv㜐0 `V S$*: 0 S* 0C\ :@ R0\/ 0 0 Q1(K 0J 0 v0   P0S S 0Sl0X S0 J ᜐP ˚0d0S z;8)P4 -LMⰕ ,K0@SPN ޑ(XZ Ur U U 00ّ`(K 0`p0S 0% 5% X ;0`P-,KP8/0 QP$ 00P @ P ;00 0 00 㟑(K蓲 0* RD ;0L UW,K-KZx 0 008/0 QP 00`P\ <`Vd᷎0  0P8/0 QP`p0 2 0 0 `VR <`V,K0 P,K0Pg0SvΏs,KR0] 0`pfKp +Pm%K K K 0S  0C`ppV  K+Py 0N0\L 0<`80@ V0 0-KmK KV ᩖ) YFmKL00c` 08/0 QP$ 00  P  @ P :00 0  0`R0 XP 0S : 0C`0`Ð`弐00 @ V0-K`pR2 K mKV0\`F0J00 @0\ u: 000 㑐`㌐`꬝0% -L,MS\0p < L  P <`D0 L0 D #`8p c00KH0 WPPU8C90P 8   p@0 8  @0 T^ X0 00H<PT 0P@@V@TU 0ED  R% DQ DRO 80Y5* 0 LR0.  PZ CYR Z Oo PCUB0P @SQ00 %  ED Q" P@@@ @@ T @pZ  R0@<0P0S8  (KSy P0L\  @ R:P\8 S00 8 P@kL0SW ჋P Q  0DPL@Q %Q# 0Q 00r8 <80 妏980p(K @P rL ^ 0 R R R R Q  @ 0 QV R -@00LG`F0~p 00QP0P@ z0TS Ps -L M@P0.S00K -L M0K#@p@K R .S.S Q0B Q-RS  .R0 .Q AAQ0B Q//0*S0.S S /0S ! C]R.S  .SQ \S  0 "!C]Q//]R0S! C//'"0 0 /0 0 /\ /0 4832;:98-6543210/.-,+ )('&$#"!  Y30@R]PY&lbjC⧁j0C000@Y 0@00 pPk P.03052f: ( 0 (KAQd R4 1 0cRC1  R  00Yp ዓ40PS`(HQ4pPpG W`WPW&4 8@@T)0@4I0Y b<P`40 4pW 4p 0pg'P`0 pgl7""P`P*00000@ꜚ 0 % $ Q" " <! -L,MH0 0P<0 4d0@0 4 L @08 `P0 Qp- UH [Q` P @Q P @Q【p P @ Y80SPQ@p<0 D B08< P<R  8 RÄL 0CSH R00(K\Qz .Q<0 0D0CPv8<Qr<0Q S.Qj <@ @]ᤈP 0pJW00 R0xSO2@ 000 F 80p SZv0D /R_ ]RGQ)SD0p2080 SZgQ 00S%0HD 0c3 X A0< 00@SV .SM< PDPT0  0KF0  T0]R @㰙0@P/ꨙ( 0 (KQ  P D X"D 0S 08 pZ R+  P0R 80 SZ(@s 0 (K004S 80S„L0 BRH0S0 0,80 SZL  0 -PaQ`L@16*0pS. R/ 0wP0*X'*P@  @ 琠岐 T  C d 0 TC0@Sp0D(00dl R-P3P#RP3LM U `4 p@ A0 <0  Q5 @P P P (00 (KV@Y?00B@S00PS@8 P8 40S @T* P pTP<0p0G0YB -LMP K -L,M`S@@ %  Z< ` 0S `0SPp PpWXP 0Sw(0p0(K<` mp00(K00 00 @0L` p0P 80 H` PU 80P`V* Xp@ P00U0S <0H S%*40 40`40 V 1 HY0S - P4?0S``VH04 S00(000S L 0CR* 0GSP0S 0P0 00pL0 D 3D 0 PP P 0AC\ 0AL^ \ 0S0SY8 0RH` ?0)40@0 pBY<`AZH`P 00M@0pFN? -LMp@xx Pp`~K 00@ p@  p 0RK@3$P -LMpp @J_K`p0 ( p 0 ( 0R$K3PQ/!0S/P0R/\/\:00/ 0-PLP*0@S @R R R O( 0 0P00QzP Q0@S Q- AL 0S R: BR B 0S  00A(00 -L@pTPP2 !0W$0X WXTP` 3P @TP0P  ؖP00ҖP(00P_oR Q-L`@S 0RP@`V  0PR@P0  -@LTA`pQTPAPW1Q@ʆ?00ꁖ(00|00 Q-AL% 0S" S0S  Q :AQ0A U0 0O(0 0 --LM00  K -LM@$K@#p KTKR-0S0 \ S \00 -PLM BU"R0 4 `0ph p@! P-TD `+T@00Tn U PV^8 2'\p8 " ^-  T  R& @@0D \@aDQW@DADQ 7@DTr V^  T  R  N.@`걕 ꬕ 40S R0J00 0 40 (K蛕04 0R00  (K8 )2[hp8 XQ 0A P@P A@PUP 0 0 0X U -LrM@ `P eKp( tK |@ x@ O\ 0 TAXA\A{KQ Q 1( @0R$K1 P- 0    -- LM 0  K --L M 0 0  K QP-LMP4 0 d 000S000s !R !p 54 @ąP @H@` #/1R8` = 00Q*R  "!"""$"( < 0P< / 00   ` 0 BX@p @ RNP  0@8p 8Q 0080S  (K袔T 0 @00(K0ꗔ 0 -@P`pLZ0 yP[ 0-P@Lv K0h -Lp`PE1t0t0l@  W  (@0 E2 $Kk Hd/ {x 0-@L0P00S  3/000S0K0hVL -PQL`0 @@P 00U000 -L@pP` V  Ex0000/PP 0-L@PP0K0h  -BMLM@q1pCnK`FPF0 0S pP@TP P /0 @U:X /Ppp0PSP @TP 0@U:X /0@@00ƪLQKx00p@@ KP K<00 u} tlH 0-L MP @0P X00 H0K0 00xP K0K0ꬍH -L M PRP H10D0SD 010a00q00@`p 00 #).0@S+00儑 000S 0 000 00 |0 00 00 0  (KoZ(00, @ 5  X @  t X -pLp0S P`0 PS0@P`0S  v 0@@  0"P 蠋 -LlMx oSR|0 3P0`t @c#00 0SSP0S00 3ß0 t0,K 00 0P W @0P<3<00 43 00 00 pp VA2 Q/ p Q* P0S@ x l 3/0 10p0PU@RP00Sap" 00C0T@(K0,K @ 00NP 0S t0P | 0PK0L >P 0 SA` @@@110PT `0QD 0 R? 0S,0K<#0`!` 0@d P] <@@ h0(Sd  d @0@h0Sd  d @0@Tp p1S MP3 0@0C0,0K<#0  0@d ", K<" d0 x`H@hPԄG-MrX2ϠC2l11Pe 0Ss z:SjP @2 c?0c01NT1@Ґcǂj1 @P 0 N➌ϠIlǣj@ L`?@1c1c0\0B0P0BPDڅTa ` a V ڀ`@\ P 002c2c^3P ALRAPE l lT3 l P 0S :S 0Ѝ002c2c3P0@02c2c;P3:=00C02c2c3Q*gfff$Ip0S$0-@/BA#b0/QQ-` 1 R 0PR0P 0 / P 0V0 0R 0/0 0S 0 0S0 0S0 0S00C0 -LM@K  `0 0S0@ Rౌ8ȟ౒ ?c0a!BS ! BQ  R\0A4(E4ȟU@!"A P/QA!bP1CQ0 10CR00SF \ @矵G0圄ɠ`LS  qpGPppW,0Jxǟ@ P%v>R 0T\\\0CQHLKB`PA`A\ \  R SST 0(K @Ɵ夦 N _eSeQQCRC@ T BpQXo PW @ S v>C 0C;R 0 z00 pK@QĠK` p K0  D0C/A!b!b0CvD AT`PbJ2/2BL1#b0w?C"0C0ԃK/A!b!b S0 B .0 S.0 L< 0 E< 0 >T0Z 0 ?" ! 0 0 0K#K#KX0P 00 0(K0S#^N !V0J\ / 1V0 iVd 0?0 R ͌.1P0!V#K0u? VP5 0 0Ό 2 >"x! 0  V0K#K:∛ Fh P0o P F>02lVK  P0SP@=00 S,KP\,K B@!L^Y; >KT2  Y4 `bFll0SP TrD0@BFLl R ?ohh A @"2 0 <2  r01[ Q h0oh  C0 0C0YP YT 0H0 ^(KK ᡉL20?K ꛉ 0% P -LP 0SS2FFC`0 X?o20S;R,R R0d Sp0 x K:> F,lp-W t  ! t p  "F lP ^tp |  t  p pတ `x`r0FS 0S>S>S@d V9hʅ bph&lvpvtvuvxv|vvvv { ` p(KdKP ` V0 >SS 0S>S>S0@h0 T0K|0 P 0,S@0K0 P 0S, Kp dgn`h`aʅfxp l6p6t6u666x|& p (s;$@ `!#!U!@2U@@xPUpP p0PC B`K/P] F,hh0`Pt@ @p0p>p0 ` 删 匐 @ O@!2a11W`a$"Q20VN` 0 2Xct0剡  %K MP0 V  0 t0剑 %K 6P0 V@@ -@ p t x%Pp0pSt d| f`` `@ 0 JD Q@ 0@KX`  g>f΂0`@K0GS000ř0`P40@t p0 h,{Q3 -LLM@ 4 n!PL 0T00L 0:S0@/SW ‚L:`P?@58ʟP p0 0:U0P/S .uP T0.S0S/S PPP)+P< P@#(Kކ@(KHYPֆ@P0h0 0H0 ,0d0 0 0 $044\0 1\0 0 $044`0 1`0 0 $044@0 1@0 !0 $"0#44T0 $1T0 %0 $&0'44D0 (1D0 )0 $*0+44L0 1L0 @0d1SDPLPT 7R1U\0PS`PQppH,0@`0@X 1!0 @04$ 0t < 0Sx0 Q` P - l ` 0p 80 X j P@4 <$ \ 0W0R 001!RGpP0X0080`S00 D`lV04Tp0P V+@T S00t0L@00Fh^0 TP, ^0^ $0^^4Č0^S 0@p 0$4˅@PlD0SL0S d 00LVS -  Q R0*;@0 "F,l R 0D"F,l  R 0S0C"F,sl  R$Y`H232420B RlD Rl ,`@   P0D0 \ :<0 6 PS40 GKV,JOV|h 28 00 hpD `80U`PUL gP00@SD40YD P/ 0RA 0Q-=<0`@0paQ3 @ R0.\ 2Š@G;F̌@>hYD 080D00Dd1\ P|0h0 -AL@0 ^`a0 tRE SQ0- 0-@L@0S tK0hd PP P@ @h@P  V 00 NQN[8Q -`QLPV @ TpjX9f @@ @@@hFlFpFtFuF 0|KTpP 0:S  P `V _VLpg@p` rPT`V pp 2F"F,l02YhVl0l`0 0`S X00P  0kP@4* s$AC p@ -LxM1!0`@P0P(0 H 0S:d 0 S9PD!pK0 {P-! pppK 0  H{00UP@@$ x@( Q$K0刐 S |t  ( 0XR $KkxxT / P$CB-D0D 00@ P000^ NH l P0P@00-SLP@ (000S 3/ lا X 0-L PP@T0  0 3/P E9 @T0 -h0L0`pP@P UP )u $0p `@ k -L@Rp` @Ѥ@pT z% 8/P@DP -p0 0@L`PW nP 0`00"P p 0\00#Q0 P R(00 <@T@ @0 -LM1!00P@0 1向0 ` 40B4l1lq0< p00 #>40 T1<080 T U0 R7 S0# @T A@@420C42p42SV @wT(KS 0R0P3/02S04"R4 0T 3 # T 3R0`0`@S 8 0  3/02S @$ <??x?p?X? ? F -LM `PQ p( ,@eKtK |@ x@ O30U1 >KPETAXA\A1 1  0{KQ Q Q Q q q  1 ( 0R$KG~T008 P -LM 00 K -- LM$ 0   0 Kء 0--LM0 K -0 0@L`Xp`00CS`0 PX0 X `Xpp SP UX/Pp HX0X 0`00CS`0 X0X/p S RXܠ H --LM$0 0 XM K\ H --L M( 0$ 0  XS K H -LpP@ pp0S000 `PP`7P.0`VP C0 00]p  v0007PJPB V: v 0 B  =pIyp4p Iy --L M0 0  K -- LM 0   K 0-LM` K6PpPP) /@P&   P(0R!ʬ0 p@ 0$  0,  0( 0 0K 0rK@K|0000@ , 0-PLo@$C@o0 -LP`@}x RT0U :T:0T:Khfu( R-L Kha 00-sL@P !R ! 00 0S 0BPQ`0AP R 0 UPPU~mP0lP `lP0  }| 0`0 R-L@ ` R R 1k0A A0\00S000B A 00 0b P A0pA0P  B!  u]P0U* , uTP0SW #uMP0U*  ! uDP0Sq   u;P0UY* P KTKRp(K ' u)P0U*  >  uP0S uP0SL   uP0SP KTK'p  uTX0P P KTKp s uP0SP KTKp  uP0SP KTKpP KTKp  P KTKp P KTKp  P KTKpP KTKpgP KTKpyP KTKprP KTKpkP KTKp;dsP RuT Y1` TKp P$R`0 7 uxP0SP KTKp> AP0Uf* <@A0 SOX0P- O(K`@@`@@uGP0Sk C u>P0SP KTKWp  \0P00T,P KTKDpuP0U*  TKd0 5pd0P KTK-pP KTK&pP KTKp@ B uP0SP KTKp  uP0SP KTKp  T0Y1!P6P KTKp 00B SA0@A@ 0@D0B Q$R uP0S!0T Y11PuP0U:P KTKpy  |tP RT Y1` TKpc TKd0 pd0Z$R0@ 0-L@g0000 -oML Mpl? h00 | ' 0 v  1S0106Kq&0   R 0 S '0&  & K & . 6 7 6 6 6 6 6 0 v 吖 7 f0S %Snf0 6 P6K5Kg>K 0C@ `6 ` 0DZS,/.?a6EXIN]X^8)rvn@T %T6 V 6PJ60S6  Qs  TV t6S 06 6S 60@0S 06 =K0CPP 70 0R> (KFhP 00 S+F0s' `GKY>K 0C @5 d d FOsTaXa\a.Vwˠ0p^^K D PEe `, @ECKL'e `Pf gP`f 0@&0@00iKP pʟf h:0 P   Q knK `FR` k.K B    `REK  &KQ S06  k>K 0C006@@S@T R  R@pSnK`F0T  6 6 6 6 6[& F S& & %[R& & & P R& & 2 P@U/U' ب0 `@PEU R 0& QPEU  @`T80^ P 0.6[S 60S6 j>K 0C0 Q)  5[S 060S6 K 0CRC Cj>K0  6 4&pR16 P 60CP6 0P6 6f S-06K6s6  @K 0CQ [P@0 L R R R 2df p"6& p   S kK! A R0-0k.K Bp6K6S66 06 f 10 Y  & Qp kK L& [@6[@S 06KP@F006K6[ SR&  0S \@@00 D Rppqp0 A R$Q&  R06 6! 0& 6 & 6 6S0c6 +0@6K6f S0D06 06  P@{6 Sf & 06 P!!| Pd'x̓ \  @ 6f @f pV6&10,K & v F V p5j `0&K@& & & & }P@ PP4 f 6  S  1& 6&S606  0kK A x H>f %K: `"[@ 06 6f f@C^KPE lV66YK J06  6pv ?pF 6 f PaTf V P X0& "5K  6S06 6`S= i>K 0C⴦C Cj>KP 0pP &6B Z s05K6 S& ! f Py@0*T= 0 D R`0@100 D R6 P@@@P@Z@PZ@ P@6f pV *6S6&`a06 Vv V  FTY dpPa pGWp 0&K@& & & & /& f P06 6f p6S x6S6&06 Z$ 6SbFT!\C^KPE  _nKEl@㼆 v 0`FvP @6 0 0@sv PPV L C>K0C  㔦 l&iK0 A p 0&v 0`Tf @PTf pYnKEKv 0V &K@& & & & `F70㩦K@6 k>KYK J 0Cd!.Q000 0L`L0S00SdpFpG dWiKmPM& 6S6S6&6@JT@T ڌ60S`@ 6 Q#  6T0CS@+S&pWPP @DT0S 6 Q.@DT p70P0@0  QM  &6R`k 6PSdئ  7j^K0 PE0w6 V X60C6 600HJP0   Q  6@CT@T ڌP `@  T@@@T#TP @DT0S pP6 Q@DT 6^   6`XSө ئ V `!6S6  7,K60pjS  6 Q  6@C6T@T ڌ60S`@ 6 QJ  6T0CS@'S&`HZPP @DT0S `6 Q;@DT ʨ:00P @ 066Q6 iK?P iK6 8P 6iK-P & 6&PCU3U0〫 PEU R 0& QPEU ;0\0P0  Q6 iK6 P 6S6&`a06 V-06K6`fS 06 66 6060RQY [S~KpG F`pGD6&S0YKK P J`K   Q6 C 0@f < 0@LT@T`]PP 0@DT\ ` Q>@DT 0 .P  @  0Q 06 _>K 0C@6 0 <  66 iKXP8 0& 'P _.K B  Q iKCP# iK;P& 0iK1P ^Q KQ niKP& iKP 0& R@`&  gQ 0ciKP& iKP QU 6[ iKP iK& P &iK& P &&? 0R00 & Q  6S6  60S  6 Q  FT6&06 606 P   `6Q _>K 0C@6 <  0S    60NS `T6[Hn`@p v & F F F iKcPC 6 V"6iKVP6 % Q aR k~K pG @L Q 6a& h&h I@ E S&6a`l0Fl6 Bg@= Q 6a& h&h g600 & iK P U&0S%K- C+ S6E%K0cB SEBNK @D D `̟ C0 P0BB00BD0\0@*N_.K B00^0DC000C& 7 Rp6[@p/& F F F fd(kp@/& F F F fXQ6& a&  6`06 06KQV kK LQ66& `0a& 6  iK& Pn 6[&o06 d/& &f@& & & iKvPV& 0<6 6[ 6 k>K 0C0YK Jdp d`pG   Q& @ & & k.K B_@ v    Ss gS01 & t@  Q`a   S &tS6&0 kK6  A? m 3 q Q& @ & & k.K B_@ *  W Q` kK A`HYKk>K J 0Cd` 2>!B 0 0fdpXgv ``T.ʴg`06KTg`QiKP v&00 ER0_.K_.K B BK000 kK AQP,& &[0& -k>K 0C R0pYK Jd@6V VЖ ئ @ 0 iU0 p D`D 0S X  S00S| 0 i 0ئV6dpЖpGF6 V 06 6V 6 zQR `& k.K BknK `FR `R !& `@x05Kp0<%6  RppS 60C6 t&@dpT尦PP @DT0S 6 Q Qp` kK A`W N Q66`0& & a6  3 % Q66`0& & a6  $Q@P&  & & k.K B@ Q@P&  & & k.K B@ S&6a`h0Fh6 Qa`h&h Nc` 0p`%^YK0 9%K J 0^c@p00L0F pGF ` 6&0CS?6 oqiKsPQ RiKmPM& 06 6, KCp"/p &6R&&  & "100P @ 0FiK AP!& ,av V `600 iK+P  iK#P  & L f@& & iKP S& k.K B &  3& k.K B &  &6`D0DpWpziKP =@̸}}}pz x `wtiKP =iKP 0 6  kK A ` bknK `F Qj F Q  6P6 QS Q C>K0C  㔦 d 0iKA p@&0@00aK2l 0 0& M&& YK JF dp6& `06 l 0 0& 96& `06  @K S01 & _.K B0aiK4P F6kK A  k 0 0& &RF @v `w&0@00@p0 D R1`a`0 A R$Q& R !`&  Z  S01 & 8R& 16 `@F^h`6 0& 6 ;`V 16 6, KCp"pX 6@v `%6, K0Cp6"pI &R6 0& 6 -LP@`?^44 0 P<^V -@P`pL%^0 P&^ -L MP`@0  pP| $ (Ko3  oP0:ʳcK8 0 CK 0PzD R0S R00D0 40K0 K"P *z4` 46U0GpGVx0  D>N@.@>Y<.<>:@P:(.(>O 0.@P @ 0P @ $0 BP 00C@0 @@T0d0 =#KP0D@0 0d d0 `F0VP0 0fBX0 E0S0CX0 UP0 E@0SnP h0  0P l0 D0L 0C?o R2p0 @50R0BL0 L0@0CS"/X1< <R 0ZE  ! (K0ppC PA>< 0<023@` ` @x pGVApPU 0 T0 |0 L0 0` t \0 0@@ 0R?0S\0So x0S4@CNP0@6@d0P0 X0@' P2 X PRQR00 B@D0AX P0 lQ \0S z P  PP a PP hQnL \0R0p P 2 0`SyX0`0X0 0@P0 TgP0Sjd0S`0S\0S X0SAh0Sp<0T   h ` 0J0d0 l  @` ` !00PP0  L  0@R@S\0   X XQPc D0hSQ\0!V.@T'ST0d `RP @  =P Wh  5P  /pP T`  0  1 (KD0S0D0 ~0D0 _`8Q  T/ @010 $KcK @<  SM  d8`p$K$K 0 0`p|P $K`pH0PPP0 P 0D < 0\0 @0T 0t0 0S`0 P L0D S00R  R0| \0 |0 `0S@@T@ #K@(KQ=&0 !b1@ K6`0"0K<0 V 6p甀 < _@P`p< 唀 K0m`pd0S 46P<- 0B 6#`  5ARK80 `00 @00 y5 00P1 C)K0 \0PS`p@ )K4#K P 0KPU 08#KP R 0 圠 堀 ܃K  0 0P T   4 4p`*P 00PPP 0`pP 0匐圠@0 0\0 T0S]t0 `0 +0000PT00 0PP0@0  T( @00  Q 0 @(K0X h0 @0 B0cX l0 0D0 t0`0 `0S. hT0X0p@0 @9 _0 0 @ @P   ! _pP (K<Z 0o2 P 5AK80  2VcK 0@PP 1P & $ꌐ圠堀(K#KX@\X0@0X0 P00P0  K@0!Pc0 10 3ER`p !0@iKp匀  #0P@iKS< `pPP L \0R0p 0h0 01l ` qPkPP< QQQP`l | R D R R SP`lT0`@W XW  lPAUR $?aCoc?`(?yPD?('jd?@$@@?(K(K0<0 H aPF @0P0C@0 - \0Smt0S`0 @`` P  00 DS0SR0`<0 D0S3 S *PMp T< S- @ S9R0D  t ` T L00C0 Pp10@ 0 @ @)W %#K KN K0QPE < <0P K1# 0P PT0\0 i Sn @PS9U0D o`PUK \2&#KP0hK<0 P<0SK46S01::SP0@0P0 0h h0 R 0PS <@ 3p`:P 0 0`p0PPP@  0DSPD<@ P^ 0t0 `0 0L T0 R  0| \0 A00\0 #`0SM t@Tq 4`p<0 0 04@  5A BK 80 @ q pP( )K| 0VPG@0T D0S a0d|0<S D0S S  0b$K`p8P$K}P  @00 ;ꌐ圠8p P Pp P P9V5 `01`l T T@0R0D p<e10@ 0 @ _0.0<0 VT  ZP t0S `0  T p<D0P`Sl< 9V`99 T0 @L00C0u t0o< P`lL00C0j t00P`l9V S<`<0S v`0!(QP/RQ//// P0-L@00 R@SP@0 0-L@PP00S0 0 R U0 0@!} -L$M0@pS4 q@DP``180 P00 <0 4 D`  `@P H@ @ P0 C R0 R0 Z*D`80@P0H@ S< 0BV *0 S0B 0CRV@D:@4P' 000 PPZ 0*!1R CV * R0C 0CRV@D:@0(K -LM 0 0NK0P.0 c 0 KL!,! T! P! L!  0 0 lX 0 ER?K H D @ < 8 4 0rT8 P -L$R -L,R -L Q-LP @T0 `P  \00@Q  R @ -L`_@PP  \-M Ѝp@-@ P` !LNu` !@Ap -LM K 0-PLM0 P0P @P2`1$K0 BK0K0(c 0 ?B0 00/5 ` -L @M0K #K@  Lp`K -- LM 0  c K  0-0L@Q r P 00 S P1 0PP   ! i[@0 -LMP0 K40Kn4`0 A Q@4 0 05V% 0S| Sl 4P8 pp Z80z0 Q# RL 0 0 b" p0 ?0SQP(K0S Qt0p0 Q A V0 !PPJUSQt  P 80 U ~  0U80jSPp0pP  0p    0P0p 0p Q=0S 媠 pW4Q 0P80 49J 80p80 &80p@ pg80 P80 S 080 1 0 p0 800a80 80@p_ 2 J0 px 0 p80J`p@0 0Q/ R  B / 00-PRSL@0B!R@ RP   `2 0@!R@P -LMPX l0 t?`0h0 ;]0 p #K0@P \0 H < 0 -RB,@?>=<;:93210/.-,+*)('&%$#"  yX0H S X0PH(K ` @  R 0R0|0  00B S00  p@1T00pCTЈ 0B@ @00B S0P, d@ EQEd0|00 @P0@0 0+S -S0t t0 0@0 00C Q@P -0S@@ 00S 1CQ!@0C0 @ 00`C V@ 00A0`C V`@lQPtPa ` @ MdP  0 A0St H  S ?o20 dPT@U``! UK h D<01$CK 0KK\0d 5SRt0 S t0Sd0t %0cSGt08 K d PBPU0 Kh+1 0 KP#K'KK D0K8P< D \80`BPV8P   8PD P8P 0\A0S 50Q0 PEUw0 S8 ? 00S;< 0P00H l00S| P0H0 I`"0< 000R`0 0|0 0XS xS @ 0R R4 0|0 | .^ 0< @P H0 XQ@00`0SH00H0 R \ <6l@@K P @0P0C@0  P@0H 0@0 0l 00<  R P`P R@ T0 d@ 0C ^ࠃ^0t @`  S d Q0pSЈR0d0 R d0SЈ0@0 0U h尠!0TH0 |0 @0S@Tb`P dP60< |@ H0 80\ 0CD 80 P< q =0l 0`0 0@K<0KNPH X0@P SX0< P_0p@ L%bVP h 60"|p ` p`0PL465600 6L%ZK 0 PHXKʄ`|p`06$&!:%&?C0C0 VP#K'K 0h & 0`SKK0S @ 0 0S 1CQHd I0C%S$0 0H0K 0l 0 4K&P80K0 0I0|0 p0d 00 't pR0b0p0 ? 0 尠 @0Ph0 ;   ! fW<0P0 <   !ZWD@8P0P@DPd0 Up00\ `CP0Ep`PQ0CPEP`PU00X0pSPE`FHQEQʒt0SV XdB0Pd0 h `P 0S0S/ Pd p0PppSpW 0Sp#p U !0 H0 2P(K)K 00 |0D \0#R008S 00 KL0KP K@P PQ @U<  !<NP< |0S  B\eʤ0 SD |P  BD E CW80D 堐0 CoX㩒Y Kx!x1_  K1K 1@PP 0R K P\|0S hd@@KP  0lH 0@ 00(S 0< 0000C@t0 0 `d0 t 1p H00Q00H0  @0{d0Pd0 / P+  $/ N7!V瞯<)A?2?( cPPi d+ 1P Up|TX 0P(K)K00 *h0Ph0 h80Ph0  P<  B\W|0Sa D \0 0R0D |0 ;<P< 8  B8 x0 0C0 s<0p|0 P0 H0 R \< XT0S0Q HXPXz HP h尠< 0@C\08@ D0 PP< |0S 80l 08 6d420 80R" 00S  S S <" 0< lH 00 "!Q*0R00 0c130|0< S  43,U h#h3PPK P  Ka 0 K(K0 KS| S=U  0P  0K00c0 pSP 0 )KP H0  0h尠H0 y Pe0 Khd$1 0 KP %XP h 4`0"| 儐 00L$&%&0 $L#ZK 0 P`FVK|儐045$&!:%&?C0C0 XP#K'K 0hx%` 0㨀`SKK@A<P< 8 D  B8 a[0|0 <0H  -\"000l 00<`00c0 W`000 S00 0|0 30t0  QP  R<|*8 0 00 8 a h)K(Kp 6(K)K 0P0 <D0< PDP sAK0'h0c 10 @ ,0KcH0K 0l 0 P ! t   oQʒ4 7R8 t 0o00, K6 0" P`h8t 0!0 K 05S00, Kb000H0K0l 0 P 0SD0 < Ls-0D0 00 8P 0QU!\0 00CD 80 H D0\ 0BS|0 F <u|< | 800C 80 | ;d X9Pbh K1 t00C1 o h尠$U 80K0 5P`e^U hᰠa |0S < D0S*0|P| 0H0 |0\ 0#R00S< 0 U`^*  0 RRQ0H0 `0S`0S S!00 h尠H0 \|0c0 h尠< |0 P0H0 080   0l 00H < T0!0H0  0H@ S< '!0H S0S000 h尠d0 0d0  B P<  0D@U@d@PD00D0 !0H0 z -L00. -L M@ P@Y`PT 0@000 040 q00@P "(,8 80W#8 4AqU*@L @!8 8 R0DD#8S 00 R  001 (K@P   ! RR0`00 ` -LM3ß08 @00S 0"0@0 1 40 040 8040 @ AR 0AP0Q p`0 P@ R PT0 V-\ # 3Q R2 \0P@VJ(KQ`  0 \ L pL 0`  P b0 P0P  a a< X<PW< XR P0) @/oV" RH 8 00\0#03Q0S 0a @a0! W \' 0 X *  X*40 R 08SY00(K XR_ P0\ZZ>0(K@04S  0c1# )P  Ri  Rc )R08 0]0 \ -LMp< 00 4 8(0P`00S 00 00P 00P RX P@ \ \ P 0Y@0Y P0u X| R  B!8 PX pX ^@q 0D0CSڣ0SpPc 0X@0  0 0QZx*@` T0DS@I0 Q 0 T @   T@ 0CC10BY40DPP`%408 0S48 0S@CU  0S Sz Sj XP@"00(K0 @\PR @(K PP pP 8 @@ 8 +QB -Q > AP rS0J 0^\a 40X 01S  S  SW 40@PB``0 000T` 0T V 0PCSU40< 0P@0 S S0S~ 0p000 40b@0p< 0W"00 aF PeP408 0 S8 W@"00(K8 A IP @ >IQ@@8Xa8 r@V 40 0Sl Sm S @008 p<0 (K@@`P `D@ 21 2 Q`80080 P  \ PZ P@Q Q@E2pPLVD`X G` @218`40PE0@80 80`0C80 0@0 @000c00S `LTp0:  RLPD!@0S+0SM 0SI 8 =p @00`jUUEP 0@ 000S0S ~Pi `h4   BR"@I 1P5!@"@A \ _ -L@P`pW P  0 P  0  -L@P`pp P  0 P  0 0 00/, -` LBϠl\@pP \t P 0 WP0 0 V @`F`V 0 B Pp PU0E  0 B P V@98 -LM`$KpP@ K0  $ALŒ\ pP l z0 K-0AC^ 0S R0A  S@- *@@\@0L0C00Q00Q0  S  13S / 01R *0CPR/!3QR:// 00 00Q00aP00Q00A,00Q0/8 \( 2A-R`P !! 1R31 a p@800^31: B B  `S000 CB!S 0000 R 0R    0B! -L M 0!S*0S @0SR @K@K0 @K@ 0-LM 0 P 0@0  0R"K0| KU00 0 0 00  00 00 00 K P t1-0`LVP@p Vp P0 Vpp8#8S@Q,) Q Tq% q/ @Q @DoV  000VppZ{W@r J@@03a2! (HR!030#Ƞ1\-( Ġ1,̠ 02 00C#A -@0 QLP$;pe x S W$%R 2W@TXe45S ;ˠ0 A-` @CsTP` S \C^@0" Q 0A:RAS Sa  "bTd6d```p\ SL "0dt@2#  00@ 0V   0 ;-Lˠ0 CCSX`p S \CQ! B$Kk?R "S S 0RC,*`& GL$Kk+qX0h0378pppp@" $Kk,\ S !hx032! q0 L00@oW@X  ? -p`HIL0M@ PcK)pCKPaAQP@PcKDKw K0 QP) K 0QP(K 0@ P 00 #KxSRCK 0SR@@ T`w(K K(0 00  -LMŸ P"KU U PĒB UȠ,Ƞ,0\@$Ÿ Q? ?#K4 QIcK"K`pT@P&%+'5`p0@@PZ 0`p$KbK `T@P LDOoUB@@!_ 000Up"K`pV0@ o1_ᩒ `Pp$Kq"KcK, Ϡ0\R0"K0b `p@ 0 ?q"K00@ cK`pQ [0b `p 0@cK`p(0?Π"K0 @NČ @n2Č>,0a(@ a31 A>42` 41 @ܓG-@P M@RĠ0@!#K@ @L@D@ @LTCЀ @ PARtB{d@P@@$\ ZL-Q-!@2@P @0PT 0  ЍGAE@P ЍA\1 \_  1 0 2 0?S`c? @@ @`6@`4& f.@ N7.74 00000 0@Pr@Hap`@P ЍGLZ2 \J' !2!0c0?s1A? IɠΌ i4Όɜ `4 , @5,50 !~ A@P$+4 @P00 o  0@ <?@Py!00000 0W -QLMŠ8 8@Š0 K8@ 0@p"K0@ E<@ E4@ XCcK`p@PcKDKQ!# L(CX`p7\, YLEQD$K1$KDK@TP0 UT  R030#(1R$1",! 020 0 C !0CÌ 0bA43"(Ko DKG@P(KC\0 $K\ SRL\*$K@VP*I1p?Xh? @Ό `6Ό6( h, H7,78 `p0000`0pCKcK`p@PqDap`@P< (Ko]Y+ \ $K1$Kh?x4DK? H h4  a4!, A5,51 $K1p0 @Ao_@P *T?@P|s@Pw$K000D0 0@0  HP/P / /B/ P/ A-PM O`P!3#1Q`1!2 L< a0<010Ca  0ZЍ@P0@- P!3# Ƞ1\P Ġ1,̠ 2 Cl AQ lL0Q:00 -KpT0WLUoJP( V @GOoUB@T ~W03@g0 L  000V`@ (  000複x ;0$S-%L` S n@=qP R R#*Q03!:0!0C!0cR t0 V4 SRJ RJ*Q03H:0<!00C#0cV^7 ^;:@ @aA`a#!N@@  A ABAR$Kka^0 ϠR0F?o^20S $Kk0 0P3:@ -;A0L M[ᡏS P⠏(@L UE UTO TZ*QP3X:P|!PPEEPeSR0 RK:0<!00C#0c#D!AT `pPC 0}P~P@?0S 0"K$(<,\R   KiT KRUT KiI0 눏 KPQ03:0 ;0S-L ;0S P 045S p0p ;S \0\ !;S 45S PNP  ;0S-L ;0S ?/R S 0P 3# 45S !45S ;0S-L ;0S ?/R S 0P 3#P45S 45S  -@@L<<1! ^`PpO No RQ1 ^ 0^P  000 Cn6 `a2ƌ A3ΌT 3q \lQ^<0 8 nCK$CK5P P:%ACKP0CKa K p$Kq! pK܄K0`4T0&&CK(ԅK0`p04H P0<,< 4 #K L@0P 00L0@##00 0PRK#K 0 `p ##K 0000P@ 0RLLL 0  (KoeCKcK@0`0* @_ 0(KCK@ NoX \ (KoCK@_0 L 0(K 0#K# 0` -@V壟Lo)DMp!@` `cK\`pcK# X XECK0"cK `0p @0 _ 0CK @?(KCK X=CKU (Ko0K QP< Q 3 #1Q1!1K 200 C(+0C# 0h0#8<0 8 h\#K 000 K0 QP4 Q 3 #1Q1!1 20 0 CK+0C,# 0l0#<40 0 lCK5$;%CK5:p5`@ Q0UVKEKL` K0 K4P #KK<0@P8 <0  0㒄K0p 0## X0`0#K .$DK0@TPW T0 R0@vPP0KK܃K%KT@`p#CK3 @P 0R@PK%K@ `&K\pQP##*#Kl<cK0p"`QP#KKK (<G.@Q!080K P܃K 0"HCK K8 $DK1!0##KK0 4 K@TPT#K @ PK$K# R0t0EK R0@RPT 0EK @`Vp#3 0 @ 000``@0 0(K$KKSR`#p#: 0 @(Ko 0@ ? P040 $KS0RK00 : 0@P#K -L) #* YX @P0@P  pPp` @`UT PpI`YX @TP D`p0 $@ P   -PL%@ # P P 00UT 030# D`p `p  -PL%@ # P P 00UT 030#SD`p `p  - q 1pL0`S3 V00AT  R+00 0PVI@T `PR x0秸PhV!@0 0D1S  $0璸0玸 n|g 0-@PL0 R xPQh00AKhH `l<0 0PAKh_ m|Hm0  0#100/ P#8#4#2#10 0// / -LM@_ p ?"K`,!(1! V@P0 0S1`@`$K1P   ! Aspo (0(R8421S/ / 0-@LP0@00 -LM0SPP0@p@S0P80 D ` V*0  Z0\<0 &*@  X`^ 0< @P0 4 0 pp0 @QP40 X@` p@W 0JS 0:SpW80p8(K -0L@<$A QPyW@ @ PU p  PP. @ t1`0SrPP@ 0S 81=$18PU 0S 0C  P 0`0SJpP! 0 00 0'. y0S x0 d0yW0S 80 (0R0y \ Li|thg -`塂0`@TPLڃ0TpP X 0 0X0 i  @ ^ @D@5 )  S2!:R@@D @#-0P10^$3 1\ : -LM@ P@DTpI 0 \H*32P >:0P80 4 ` @a@P 0  R0 R0@PVCK@P@4  Y  Z0 Y @P0I0C00RN0>HS 808(K@0@Ppa0P80  088 0(K -p`qL* 0` P00G ʔ V 0`8S # 52#10CV 0@ *S  LG cV2\# 053,1S UV@ S? -LM@`PpP 4$66X(0 , (K0( Y@ 0 C@@1`$K,KnP(0,  `, (0!30 (0  S@@Y0@ CIA5`$K0S0/0 R / -H1HALMP`@AKsPP8 pP20S  Q4 K#p$ 0: SZ0P   `0 $ ,| ( K FO000KF 0 F 0 , 0-@Lg900CS00 Pe90P00CS00/y -0LrS. wS( aS lF00/0S +S eS%0S fS$ lS, xS0+S ,  0-SL@3 9 P00P! !& 0S 3/PP೼000P @ P 00 `00aa8@0`` 0+6PF 0P0 000-sL@ !R !P 0C 000 0 S /6 0-Q1P0L0@S2 0 SI ;000S? 0)$0 3/0P:0000P @ P c00< R 8000uY  0@000 0x0PqlIl5P 006E 0 @000 / 0-L QS :S0lB @K0hd0LB @K0hTE0000B @K0h6@000 0 0000/8 -L M\S`p@ CoR$塏 P $ (P ) SS (\{0᱀X  0(Q\ 0  P  KQ5$ 0$1$( X$ X $$!(1s(Q00(QSV 00\(1 ( Q\:0 g P(P0\ P 0 SX%XU!0SPC BP(0 qP($!(Q$ qD, 0S00r -L,M P`ßUL D  ` ! PH0 2/,(0Q00 0 P@ @@pp@P0K p< PB ^B  @pW`VV 0 P_ 0R@X"pWDPJUY@p(K 0 opPwA< 0 >pPO 00  P5 Rp@!8  P8D`V VD V 0 @P1ಀYHpHp@ @  hPH0L  kP @ @(KL H0 k@ P@(KD0PJUH0  pP   ^hP(Q`EV 1SU0$Q(qP $Q(1ճ@k 0-L@  S0 K0h C,0C00,1 0-LS@0 K0h{C00,10 R0-L@1  0K0heC,0_C ,! P0-L 0At 0@MC -LGM41@S5  e Q 5/p0 ` P 0qK/K p.K-K ,K@+K*K)1K(aK'QK&qK%K$K#!K"K8 P.K QKKP p`0!KqKpaK1K`0KKKKqKaKK1KK`=K0KKKpK`KK< Ƞ 4K KK0KK尠KGpEDDpFGFKpĀJ0I`EŀǐHpI0JF0GpƀEHD`KƐǀM0LpNO`pp 0SR`QPpʐ RDE`FGpːP 0< 8A/p^ APpM_Ām[PQ 0phPMQ 0phPBQ 0phP8 Q 0pgP.Q 0pgP$Q 0pgPQ 0pgPPQ 0pgP U(K(KBO00B ,!a` -4!L@ `PP/1S 0L1@PPP!R PMPP !Rp ~V A`_oRA`A`` 0-@PL Pd0P -`LPP@H UQ0pP< UQPEE,!00D ^ ^ ^ ^ ^ ^ S `@  `@ SRA@RNA0@ Q0-LP @41S0 P0P0100/A 0 -pDLOMQP`, wz@P% 0Uq1  WK APr 0 pA`AP`(K P_  0p '0 VF pWC qA/` ***!# p!!" "#, "$ ,( 0,$#4 ((Ƞ''0  0p't0..p!|.!"#" p!#|' "$!"# $%,,& +0 $#4(p/,x3 ̠4)*0,-p.012 D!74; !x!""#"$5p689: ?00@ABDEF G崜HL0)t..Ƞ.ŐpCCCC嶌 (Ɛǀp0!G!!GG尐 ) L A AAR!Hp''' C pC C C,BB))x)CCpCCR,BBZ!!!tCCCpCR.ĠBB`z `AP\0SXIXTx q 7/@ PL( &9P 1Dp N2ḡ !0 NV Q`dUQ0PP4Q$a$PP 圣 #@3Cp` p`(KTß pO`|??P?ĠQD  < x8P Ÿ 004p  *? @ &?V Pj pR4 W qQ^ PŸH ^^^@4;P3 0uD H $ 0ePI*> 0BH,0<0(t |pQP2V< zX!P00 p 84 p qD> @ >K. PDP MJ0S 0>PP>@`P>P> P< x8P [>`>>>꼭 a4H -L M@(` 12f0pSP( p R!ءP. `0( a1  Y DD ,Z105,5(Ko0gꂑ P  0 " I8>09ء(K 0-@ 1L3/,( R00 0-@LQ ,00 210Y> 0 -fLMS`- p@ G>0@0(KX 00(K 0S0 00 @0T0  0S  SS  @ p 50 0 5 0 lPP 0A101$]P@ 0TPS 20 2@5Y85000(5  5 550 00 S S 0Kp %K0ZXDX# X3 2W 00 2!" ؁R0H     P 08:pH4:@ P w?w?Á Ñ 0 *P0j "  S+P 1S0S1S +0 29 20 29 20S 28 2)  K-P?P: ,ß  R0  " KK""$K K  R  K  KK ,KK,,KK" " K"$0KKK.|K.Ƞ# K.#(#4KpKKKK K0Kq *=O00P p @(KS1S 1@ 20 271 @=00SK p 20 2(Pd1d! 0Z*0X*<00<0S<`K L*P  F*`P pW0p!! 0 w< + +:0SԀ*0C~KpGK AH4 D4 @4 <4 w[p@ p  p X p  ]( 0R Kh+0P7P J{7@P7?0@0 P( -LTMş @ ` ` \0   %00 RP_Y :Y h7 0 ` 0 QU(K w0QPY 1S %P䡄 0    {?p @Pp|:!h0 Ro  ppRpWq0 d0 BPih0张pod0YT pqP0h0 0! 00B^:A.Z*L N l0 A0h0 !l0 B("811"ȇh  0P *0 $(0 0S 1S  R!<3 B00C S  *% Y "0 "` R"AAW !%T K0Pd0 d0YTp P 2  0 pd  $d02(00S* w0Q:RPXpK Tpr  00D SX0 @0 @0KP< H0 HK ?p]  X0L 80  80K4KP0 /0 0SP`KPP0  0P $pP; 0㸡d0  0Re1 S0"1!`d 0  l RZb {0![ $00 d0 :Pah0 * 0!{/Ⱐ1>0 6 0 bP P -L$M(p  QP@`U ഑ 0m rp! ppp I)!8#8  pC!xS'x  ⇀ ^01Xp0!8#8B08#8S 0C8#80 0 S0081#810Q! B!(0 0S (K0 R1S0C1 0RX 2 0(4@ cK 0 4K +P (00(0 p0 0p WT V)1"0C0S4K 0 4@ 3K{P(00(040#[0!0]VQJ1!0C00CV Y4@ 尃K4K0H 4@ 3KWP,(00(0Q "P 04 K3K80 4 AP806(00(0  {#p000 4K4@ 尃KP 1 C  BV* "P 14 K0C00C4 3KP(00(0  L# G# 0-@LQPQ0 "P 00 -#0 "P 00 #0 -L MP0 ,10C08#8S/0S PtxPoa V0FY S1V `"@Pb `V0ഠ p0 p0  "00(Kp1 pp J1!F∀0V.1 0p\ 01W 0`L08#8S 0C8#800\ 0 Ƞ1,Ƞ1SL "00 R 0VP00 00(K0(K"0(K 1 1 -LM@`Q r"00 26Y8 Y/(P, P 0- !`PR 10C08#8S 1 !0 B ("(RP 80 C"80S 0 " "(K3 0 (K0K  PP 0 pR1 "0C08 #8C R* P0 P  "0(K1 0C08#8Boᩒ P 0 p# RR B 10C08#8SPSP  !Y8 !80/o"y !{p 0K8p ! 6 P `0 RZ < Zs !뼁,Yj  HR!f p !뼁p X0HK S1H  `Pz 1"0CX00CQ 1X%X P!!1 P P崐! f! PU PpW0*` W!  `PF 0R I!  `P7Y20)80 8!802 0 < +! 8 P`, 0R Z !q W@ 0GS1<  !q W0G S1 k `P WR 1 BX%X XP!P1`p  M `P Q1PEPPEX%X XPp!  6 `P 0-LMK0 P K -KML M``PPß @ Op $ 0 F20@040 0R(K G@T R B@ W / P (200QB Q2?0040SXS02G0T Pp@ UXRP>  HZ@ p4T CC>K4  ;o0 W *0/S0HJ 0C/RF W0pQ l=K` 0C܄4 Pd dV! -៽p"10S X `0 S00R0FX} U P100t4S ܾp @j۾P 1@@DOoB_0K0 A/0PP0U4: S 10@0L ܔr P R-L Q0P:Q:0Q: Kh* 0-$@L@!  K0h  -LP]@Z -@T!  Kho -@LdM00KP  )0p \p )0 ` )0  d )0 h )0` l` )00 X0 )0@ p@ )0 p Tp L x s @` `0XPH t 8@ < @DP 弃Pḓ帣HL  | @p ,lȠp@p Dp`pDp !8pa`pHp  " 0 `(  pW'0Q 4 R   P3 `10C08#80C0 3 P00 RpW 0p gW``0 R  U`p 0R ` P ` = -L$M@P`Qp .00W. 'W W W (00(KWFW! Wl WF0S 0S 4K 80KHX40尃[7 W :0GS(0tW,0p1! B ("(R  1p  CP(KW W% W# ,K0:尃[P 0 00p(0r00㸁(0= `p 2 ]400(K,0`t1! B 0("(BR0O ( O 0崀1  P 4K 80Kp 80Sm 43[  1 m P W #W# WB(0币@XEWF p TW[0 4L(KG%4 尃K4KvW (0币10C08(#8X 4 尃K4KaW> p %W  PE 0(04 尃K4KJH(4 尃K,꼁 X  mP) 0WSLqYG  \P H⨀H(4 尃K,p꼑 Y  FP 1ᴀX0C08(#8X弁XH!1 ⴀ   $P p0p l 0C( y각 0H⨀H(p0!1 p 崀!  P -@LP`P 0 00(0`00Q(0 -p@L,0$M@ D H0 1 PJ a`F`h&hV< < 8 Pp@ `Xh%XV" @H$H @  `FP h p8 0%0!01@0  @/ p8 0U @EH$H 0#0@< <(K0D <0(K 2  U 10C08#8SQ[0D <0P(K 2 < PQP WP4 14PK0C00C @3K @P 0QH RD 0% 0ES1   QH @R0E[ S1X &P `UV 1`Fh&h T`!D   P4 `40K@ 80 cKT @PP 80Q0H RD 0G 0ES1C a Pd !0U B  BS9 rQH @R0EU S14`1 P _ P= a1`F``Fh&h @T`P! 4GP7 4A=  <!08#80P !1 ` `P! % P0 @T0* P0000/< 0-@PL , B@ (U% 0"0` -L,M0@(pP  "< ` $08 @0 \0H0 00KTp L0 p 08p8` P`@ LD0 02` !@0`!@0 D0%8f#" ,"  % d! d!,H <P  2l0 ? 10 !>2h0 ?!1 `܌K`&0 %K " 0# K E?K&K "0#CK KA?K ܌K ЀE?K``&p'eK̠Ì ̠30 C?KmK  "0#nK` p`pnK 0p0S` K-KK.Ko0l0 (0 /K(0LK0= 0 KdKJiYW`܅KKK܃KoKeK K KeKdKKKlKCK$Kl0 1t Ġ̌| p !Ġ ̌x gKGK@$P%MKIvp q~#H,p 3l ܄K(w yp (yQI^ wP p VmK`&p' @P PNKK܀ ܄K@ P)790 )970 .܉K(K  !,à)K " 0#.K,KD @ @P 0DK@$P%K`pKdK p` );40 ;40 (jK.K`&p'dK`pdKeKP@ 0܃KKP% (@$ ( ))  K ԋK 0 K !KKԍK@PKK@P ܃K<30 <30 ܋K.KnK`&p'@PoK`p(`) p,Kl 0@PPXK܃K#K dK @ PK!DKEK܅K@PK܃K"EK@PlK`pCKC%KfK`p@PdK!%K`dK!#K`"C(K -@LQ PUP`  0pRPQp b!p !0P0H @ KhR Q b!p ! -@@LP `YP7 rd0! 0 #0#0 $P H P0Xp【H【 a $ QPP$ UX P㈁9$  0 #0#0$Xp〠H〠\` P   v$ QPP$ U R-L  -L M@P 8PH8p,`KI KU@   K 0-@PL 4@  P 0$$0N R-L F# -L M@P PH(p,`K KU@   K0-@(0`( "$`T"a! 4a# 0/ 00-,PL`Md0 ` a P 2 P` dP *P `PF PU 0D @0 1CP =8P 2P$ 5P T3Pu 4P?0$  00` KDK Pr K0!P AP P PF P" 0D @0 0\ K00DKd0K p \ R K0[P1ZPsHPsWP  IP} VP) 0 0P P P P 0D @0 &P )P| 'P (P 0D @0 8P Nx8P; l8P 0P0$P 00` KDK' P`0\ K00DKd0K; p \ K0>P=P:P/  w;P <P0$ 00` KDK Pf`zAPb'aGP ^EP,[ hL T^P OXP YP!J | G 0D @0 R <0 D @ ` O 0D @0 J B0D @0 E 0D @0 @0$ 00` KDKP .P 0P+J P P P0D0 @0  >P P P7 0D @0 qP wPd  P) 0D @0 c#P~ w$P %P ,0D @0 VP P 0D @0 P& P &0D @0 B*P +P D0D @0  P7 P 0D @0 .6P 7P0$ 00` KDKEP  yP0 @00\ Kd0KDKd@ D @ Mp EK ? <4P 0D @0 P0D @0  DKrPvD u )0D @0  *0D @0  +0D @0 y0$ 00` KDKP V 0D @0  0D @0  0D @0  0D @0 DK7P : 0D @0 J 0D @0 D 0D @0 ? F0D @0 9 G0D @0 4 0D @0 .0$p 00` KDKP  <0D @0  0D @0 t0$ 00` KDKP  (0D @0 0$ 00` KDK}P{  0D @0 P 0D @0  C0D @0  E0D @0  @0 D ;@1 R 0KP#DK \ KD @ m p0\ 0  %0D @0 0$ 00` KDK8P  0D @0 0$ 00` KDK&P 0D0 @ `Qi,PO \aMTL4KIIH\H|Gm -PL`pьUO A@0S _@PA VPF l 0S2 SP0 W`= @ 0S: GP8 pU ! 0S01@0@V 0 0 W 0 0  TT ᓺ V@W T T @00XX x( h8 d @   0-LW0@T 03/@TpPP |00@T 03/@TX=0H00@T 03/@T$0< H  ж ض -LMX@@P K 0K # K  ZpK -L MPRa@p  = 0 S 2 M SV:  0 0S6 0 0 S 2 / 0Q70 k 0 0(K  00 0 P 0 0(K  P00 (K0 @@ 0@ (K 0 0곸P  00᪸P   0-LM0 R@P Q \   \0 0 \  R0 0 1K3/K0s?0 Kr?>P10  0@-(@ U1!^  QN \SD0L00@-(@ U1!^ P\0PU000 -@`LM ,KP (K(@p@0T!؁,H(@T`1`! @D  T(@ p,  PP$K$KpP p@ -LMq00K< D PpG@0 0<0 x PU @<@P U`1`! 00 0 80 EX80D PU0<0 T (K(K -@`LM $K K$ P 0 q @pG P@D @ P$P TKK  KP/0@ 0A0SU*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0@/ 0-P8LP@04 02P*T 00S84 0`@2T:+0800 -LM2Ÿ0 P@R0p`00 Y 00S80S 00 Q(K4P  匴P8 01\ 40KK`0Ġ`☠K8  0 0 ' R= P8%YD 1 c1'à40 0` 4`V 08  R88P@PX`002,"SR,BT 4"R 00d"00820 0 R)(K I P02,"SR,BT 42SC?00 c/K8 02,"SR,BT 42S)00 !Kp 80Sl XFдSP`  " ô"P 0 S c/KoK0 `w42S04"000@ 0~((P X` `0((\= 20S P02,"SRl,BT wKn02,"SRf,BT a42S00QX-028 808 `0 R`SQ P408pV R48 0\R408 \P0` @ yUY@B`@ T T 00S`㯱<2P`R ` 8@P@@ wKQ@ J{@ ?02,"SR ,BT 42S@ 'ꋳ P L5 T<  8 -P`pT@L@M`@ 0 00YPᶅ(K( -LM@ß@ P@T0 @`ISQ? r4 rD 000V``V20`V`0 R2`0b ` n0X@ Z ! 1i@T X Z:0 0R(KV 0 4S`RU @@@V 04S:0`S0qKp~. A Q @PPK /00 PT   V@7`p W4 P +V  RX( QP 0P0 @ R R0 p0``~S _W` `pG`0``Y~``Y``Y`LKVQ@q -@8 00pꍲH P 0@- "A @ " @{ 10-S@LP  P 10 2 0! 20K0hp@-@P` VP p0-P@  P 0S RP0/P*0    PP0/0/ p-LM 1 0 @ R 0 ^0  0Q0KphK KPUP*`KPP `K`1E"F0^ R KQQ*KQQ  R 0RKp ` P -`0L,M0 "!D  L  H cL0040  P 0 pP0@"Pp (P@8 a86/PD6/P8p6/Pp40S  00 H0 X@ <0 :pH@ 6/PPXT 8@ 4P00 p Xr: 6/PU UQ 00  S T8P40SJ 00P00HX@*@0C00pG0A<S B@1!<0 0CS RoQT00L*S*SY:@00@Cs 0L H0 j 40SA<0 00 < 00 PD0 0S 40S 00 0U0@08P C00pG0B< S D1!@D 0 R000 Sp*S:0)$40S <00 0R000/RX @pHP40 S0E PQ @0 CV40S H0R0000S0P40 00H@ ᐒ"R8 *p4P4p Y *00pc0 0 Z p 6/PU U 04  W  Z p00@80S(K@0< C00pG0AS D1!@&40S@0 Cp0U!6/P8p6/Pp<D 0 R0<00 (00@ <0 6/<0P 08 @0 86/P8@ 6/P0 080 <0@G6/<0P0P0 b6/PP06/P0Ppp@0@H<00<0 6/P<B6/Pd6/P@U"! RQ @0 C!10S D 0 R0P D00SC@0 P@0 @6/P!6/P@6/PP06/P0Ppp6/P8@ 6/P0 080 v8@ t<@@0C00pG0A R-L Q0P:Q:0Q: Kh'ꜯ -LM 4PS@  $3/pd0 0Q P p圁4P4S $ 3/ 000$K0 0 4-dLVP:@T@T 00 S   00 S   09@P`0d0p@A -PLMK`pP$0: S@P +@ 0 0S t K0dT K@00 K@ K( $$4/ 4-s0L@P`0 }P4 $ V0000C0  0R   10 00  0% 0JH H - 0RL0L0  0 0 S  A 0 -LM4PS@Aa0S-0S*  TPd  P0 00 P!    0    0(KpPK $ 04  0 W 0QP3400 e$R P4100@000S0p pp0d 10V0 p0 $ 6/0(K  0  0 0O 0 A0 000/ 0-@LP  0R 0 00 CP>0 0-@LTP @T 0 7p0@TA`0  0S S/P/$(0#   @// / //// 0-LM @K $ 0 0 0 ڜh h0 0QP00S 3/ œT눔 X -LM`PpK00 $0 00K,@ @ (0 (K P@ D| @K -L M0SP5  0S p@; `00 dT BB Q  x V`! [ 0 0C `@0 p`@V` T `0p@0(K T 1+#3/P0p0CS@D0 ,0Tp@R- 0 T!1 P`#3YQm R~,03/Pq00 0S00  Y 0 p 0CS @D0 `0T @Tp  00 1P @ 000 =Pm s R*V * 000P7@D RD,03/P,`Ve*`C Y:P   I0`0 `NdP 0  000WP 0 @ (K  0 B 0 0|  0 B0` @0- 0 8 0 3 0-LP `V 0@0@DT`0@T` ,0 3/Pʼ0@00D0SKh/ 00-@PL0 w0 Px0 0P0, @n~ Ph~0 0-L4M @D x>R@0 <0 80 40 00 @T00 13"000 , KDKP,Ka00  -@0 DL4M>RD 0 @0 <0 80 40 2K1, ", , KDKP,K:00 0-@LxK0hwH-M  0ЍR- S 0^   0-0 00L0@S! 0  R 0   0%  0R0U0  00c00"0 P @P 0 0 $0 0l  -LM@Pp`pP  KP04 :CoR  S  L H0(0P   ; 0K; 0K@  -LtMR"P`0 @0 C 00  0 0R(Kx K|K0pZ |ᮨP0 H"H2x 0Q0P p APP0000S!pK @  Pf F0B/SKDIHGFE9CBA@?>=<:9876543210/.-,+$)('&%#"! 0 0 000000p 0x0 0 x  倐 00  t0K0Dt0SP| p,NP3| PXL  p-L M@0Pr|00Ta4}V( K>}0T1S O|0T1S 0}0`}00UTX1\1S O|Kp\1}0F|Kp0UX!\1 0X!\1 0-P@0L3|U0 \AQ\ X10CSX1 K0h"|T1OR|0K0h|`|00 000S/  -0 00L@PT0{00TA|T0` TAT@ {X1@0X1|0T0`X1 0 000S/ 0 000S/Q 0 000S/  -L4M<0< 0@DK00  0RK] P Mt,@ -L M@PQ4PKT0@K 0 00ep`  QQW V0&`"(K V0 R0 Q `(K`(KQQV(K R0`"(K 0-LM@,0,0 @@@K0 0-L@PP P _@0@0 -Lp@P`P P HP  WP@3*] "0@0X 0@0@Q 0@0Q:// BQ:// -,1,0L000 A!@00QP P`bP 0 PQ 㼐 p'@P  ! 0`R Gᾨ@V`@0@S 000 !B B!$Kk ̀ LL 0-@PLP 8P0U0 =S00=S0 0-8@@@LPP0K0hx 0-LP@P 0$ P0H00~ 400-0L@P0 P3#0~ -L M10 000 @pT4 _ `P jP0=SG @PT40SJ @A@P P)Y - R@`@@@R*Ya2   嚥`P, 00  D!  00 0``@(K00 YpQ1S (KR@`@`PP L}\}}| 0-L@, p  0@0000 L -Lp`HP@PP  bP$00@0D L ,0-Ly@P0 0@0l ,0-Ly@P0 0@0l ,0-Ly@P0 0@0\l -@Lp {P%`e0:0 p-L M0` @P 0p 0 00 QP 0 p: 0Kph. 0S0< Kp -L M@p X0 Q0P:0:0Kp C0!-!0!Q00 000000 0#0, 0#0 00!R0Q0 0R000 0-LM@1S 0?P"1$Q 6Q 0  T& @  @1S 1  S( P  P    K0P q1K0hg0000 0/ - ULp` QU @ @E 6/P@ -TL`ppAT P PD 6/PW PPGP -TL`ppAT P PD 6/PW PPGP - @UL`p)1S P@@E  7/P/@P@@@@UE !0Q000000 @P @@@@@@0PpT1S   0 0U0 @0@0 01 S Do @000@@1 01@0Q- "!RP 0  \0   R 0P 1SB0S  !0B0C  -PL@T`0pTp  PTl 0W0$Kkw\ ? Rg   T  L 1S Pc1 Q Q0000 Q0 Q0000 0#0 0#0000pP 0TP000^0R" /o"!T0#00#00!0 00`0T 1S T  p !PRPPPPPPj RC/A 0\R#R! R/R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA -L,ML1L!0`P U@0  XpY U< 0SUD0 0R7(K0 0R1(KoK PKY P:, K#<P$S X $ CY ,0K1 $ S0 P, K!0$ R00S Ңh P` -pL$M BW"RH H P@P-T`k +T@P00T W  ?X#K#K#KKKPOKQP00 T00SEK4 `00 42"< R0K@00D  R@a0DSW@DA0DS97@DW6v $KKXR%KQP00 T00SK4 400 `2"< 0KP@"0 01`#K"0 01`#KZK V0EH0 H00(K0Z0& H00(K 0 p#KXs #K(#K#Kiq00XS00 C R @ 0P#Kp(K A BRWI 0p#K ?? K 0 0 0X 0 000/8 0</0 000/ 0</0 000 /᰾ 0< /0 000/l 0</0 000/( 0</0 000/ 0</0 000/ᠽ 0</0 000 /\ 0< /0 000 / 0< /0 000@/Լ 0<@/0 000/ᐼ 0</0 000 /L 0< /0 000/ @0</0 000/̻ l0</ @/ /H-M 0Ѝ -Lp`@P7. @T0P@ -o@ "P! #L0TM R0"@(P( 0! R0$K  0S RP/0    P/ -LMQ@P Y8Z J (KXY/ TBZ 6@ Y 0H @Z00 X 0h0?o0c5#8 c432<0 ܃KZ P @(Koo?o`FV` Vr 0f"ZN (K0I KZ00@i o`5/o?o B!` VK VC 0f2&5p ?@P 0?40 00 #K @T 04P`V 0p8 < CKZn   (K 0 coo?o`FV` 0f4&1 @0f4à1 KQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 040-L@ P00000踾(N / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/00///Q R R  // U /Q R 0 000/0 0/0/00/@-Q @ S Q P 0S Q P 0p@-Q@`& T^% 0C P PC@DUT QP PCUTQ pS@-Q S Q P 0SP 00Q / U /p@-Q@P( S(  P0C S @ `QP @` 0@0Up@Q @p0p@-QP@`# S\   STP P Q@DPPQ Pp0U0pS @@-Q S P0C S @QP @ 0U00Q   U //q 0/00/   // R S 0Q000 0/0 0/0 /0 0/R  -/R S 0Q000 0/0 0/0 /R S Q 00 0/0 /U/R 0 0/-P0 0 0S0s R S  0 /0 0/U/0 0/ R  Q 0/0 0/0 U0// 0-LMp0p 0@| 0PK0 00 帍 帍0 0 岍Kⴍ 0RK0譜 P0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$ $0 00S0/0  -L -D0D 0@L0P p`c@`Ԩ ////// B // -L4MQ`P@pT y FKg1 0 0T TK(L KP0 6/(Kk0 S)  QXP 8QS: S0S S. S 0SQ/Y1^00 0\0X R 00Q 0S@B QT " l00 0X0 D00 800 ,00NNMMMtMHM8M(M// -LM<͟< PQ 0 0 =-= 0 0  0 0%SS``?S @0` ` `   CZR'%$"! %    0c\P60.q0 00 0w0 T p0 ` 00K  0t0 00 0&".'p`  cH D0 0`] 0`0 `0 0 t0K s 000T0S @0 T@Q@ P   Q U5P2 P 0 U5 BP2RX: U 502 5P2X*0 0@C U 03@D05P2T0 00  p0 ` t00K0 w 0 00  0  ` 0R0-0`vpt0 0K W V0 P@ 00  d0 Q P`p0@P0C0 H A Du0 C00 C R 0;0 0 0 0 G   >@ 0 0lS0  0 0  0 p0`00 x0  0K0 t 0 0 @0 ,0K c  `@ ` "0<0 0 0 0`SP tE  0 MP0[ HT` dOȡ h0 00 0000 00@00 0+0 C0 P 0 { ` a000 0s0S 00 0m0<0 0h0 T500 0 0`0 `0 000 0`0< , 0 00 `p0 000 0 0`0 `0 000 0 0  `p0*S 0 C R@0A@0 C R0  S 0 R @,0K c L  U 05 P2 U#3x 0ZŅPP Pp0A U5AP2QeA U 3A5P2QRR R 1> p`0 0 A0A0RP 0AHC D0#0 U0E000 0R(K0 [0 b0 s0 0 @ s 0 `0X0 80 P0 0W @ S 0 `p-0 0 0 0> @ : 0 `p ` 0 `p0 0 ` @ `0100 `0 0 @`   0 `p`  d0 `0`00 p0 `a p0 ` p` 0 `} 0@ T@ T0 0 ^@ P -`X0X 0pLP@PU J0PES 8/`uX@pW蠘 8 - 0LS S S 0R o 0R0 8@o -@L`p0@@P@ ؙ( 0$ 1~P| Hh -MLMA@P `X p0 m0PhX40 0PR.(K 0CKEKJI 0 0RP ᚙt 0d }L0+0 \4 &k\4  4K k5Kꌗ PHt@} -0LS/ S+qW( Y%`P@ U@  0S#0P0S0S 0S0S0S  P PU 0R0 ^^Î ^@T @Ȍ ^ -BMLM00T .TX%XD U@ 8 <$ PE0 @`* C~KpGPU%:0 00=^P@ V:^^84<$ @ZP@OPD40 0R(Kh P -BMLMp`TT T@ ,T @XT 84 EX0 A 0R>:0x0(S 4"48C8U @40 0R/(K0x0(SX%XUPE CKI< @V:c^`^84 0 <4 fP PU:00 0 0]Pꅖ< P -nML Mϟ&    0  @T 1S 0 S`1  ?@ X@00& 2 @06  >6 0S6 S==K0C☖ @voP pR P* p CKI  D 0P R!Rs P YPʔ6 @0ᘖST `P6v PP0S`V6@  ^  0S <& & X- @  & T06 06 &0& S63 6 d1S0` t6 0Sa S006 1&021=K0C6 =K 6 AT *pgnKg^K`FPE0P0& 04/P񏐚6 S006 W0d6S66 66 60SAT 6@PP PPP6qw 0;F ֕Pl6`S6c  W`e^K PE@E~V  `=K 0CC6 c>K 0C6 ?` 圆 L  f :fnK06 : `F06 F 16cK FH0  0 p 嗄PP U0ڰ& Q `1  : X0 0R  k106 $666 6iK CAR 0H@L9/Ci>K0C2`E)b!lv YPL 0S P  6 @06 T606 0& S& 6S6S l< 0 x6&0 Q](KpW A6 00liK6A C   6 P6 `1  x8 X0tQ7  %00 P0`1 g 8 X0VF6t6 0S06 f00 ẃP @ 0P w  &P7@X@" 0 0R  01 01i 06 [0 CNK@D 00t 6P&0&h Xuz0@+S .0CS(  ; 0K %ꘖ / 0& @0 !㹄6Pp0 t  5 X06q_Q @U`D CK @cKL01V6 6 p06 ڤf `#& v@U D 6@ S ` fU CK A6 Š6v`160006 06  d40@ X0 %06 /{ (06 06  P0&q3 @Xy0 AQR RP `1SH 0   R0 6 6 x OexV  R[`!!! QW   2&@x&X0Q /0&RC A RAT` *`g^KpPE&tPp 04/PQ2N06 /@2 X@ 0 0R  S/`V AS06 1S&06 60S1 S006 06 1c~K06 x1`06 pGP1: 6 厃Poq00&IPX1016eNK @DPD cKZ H]K PE H&  i&b 60P+06 0 P0D ) PlXCT x8,ȻܺLp,Htزh TP B("(R D0D ҁP 0@6  g 6Tx6Su 06 t 6 ZVE0 0 0X0(6"( D6 P TP B("(R D0D 喁P06 h&R!6 0Rj 0`1 z 1 0XP0V0   \.i6 X㰀U  H("(R  T B("(R D  R,#RP l2|@ X0r0`! 6S<06  s&0 n 0 i 0P 06 [= 0 X 0x  i0 X3 @hXw (06 0cNK@De.K BT6 圂PrP 1011S1% 0  4 X0 06 8_06 6T0 6|\0@+S .0CS Wm O2/ /M-B  (0<!`p Q1`ep6`Ѝ/ɚ;M@- ",A@TP Q`p A `T Np`@Ѝ/ʚ;0-M  R0@P0 R0Ѝ0/0 0CSЍ0/ 0-L M$PK@㌁PK04K⋁P K,0"c110K000K0 0-@L0M-  2a  Ѝ/M0@-(@ N Ea0@ Ѝ/Mb -AML Mq1p0<4 0@$ 00 P$ dvPP `CNK1`K+0}!P 04[S ! 8$ 00@ 00@ 0Sέ<40 0R+(K`'IP840 @S 0S0S 00@ @@4@C c @ឭ 48z P0@c -CMLMp03,#8 0 D$ @P@ 0 CK0`010<4 0>000 P^00L 8,G Sb S00; 0 ```p 0 P0X8$ W8$D400Qz(K0 @u00 ; P0 <0 0;  PS h8$ 8$8$ bW8$ 0P2 P: P3 PW d v4!48C8S 8$ W 8$ . 0Ġ"Č$#$4!4 Ƞ,Ƞ(8"(#8Au!W W W ~Y`x Ph$@ @\p  -AMLMLL pP`0  R; 00 0uzV@ u@ P,0CK`@0 PH 00 00 0R(K PP @@0.SC^KPEL0 Y,0K@dD0  Vt PTZl - L@P`P Kh< -CMLMß P p8$ 0 @@ m@~V R/ 0.R@ RW S5<$ %.0B2?o121<4 5T! <$d1`0T010#S<4 ` 0084 LP`V @40 0R(K<$ C.K2 BPw<$d1@  R<$ 0s @D D0RH4 m `Ld Dd 0S? .S: 0084P.0=S 1S. S< S1 T0 xPD4SRL4S V`lLd Dd <4 0084P0S`00SL40L4 0  H4 RH4 D40D4 <4S0<4 Ld Dd 008$ 0m`<4Ld  Dd UaU]0 084P@TN0<4 e$s P -LdMP20`@po W00TY"   x !DŸ\!   / ̌V|@ x  Y V V (KW,0K P|K0  0 GTP0P (bU_U0V?o2``VPⴠ  B R,0K0 B 0TPP CU@UAU:U P⺠E(K 0 '' 0 &s~ 0 pG R0   U U U 0  U 0PS  u 0P<E00o < -LMpP@`/@D T@/)TV T0T T 4"40(",4@0$K  0(  (t -L@`Pp帐ἀ E0S@P0WU! TPT@ D GTDܢ,0`( "4`43MSZ1S Ѝ/ -L(M@H}x} 0%`p8 D xS| 0  0 <K< $0 4 bK{xKT -LM0P8 4  @$dt各吤 0`p 0 S-0 S S  P%  P2 P]  P40f 0  SR 0  SRS(K#d1P00d10d dtq#P000 @q 0P  P  P)  P&090060 P#P000 q|qip4  q0000:0@ XP ( QP090|090x BP010n  8P020d  .0P<0 8 RY @j?P01?0# @0 80_8 @00< "E4 0P<0 8 R: @K?P01?0# @0 80^8 @00< (#& P @ P010  P010 ꀢ $h̡Ġ hg̠ffF Fx p-LMAT ,K{,0PK0% f $`0` `,00 00 Y|Ka SKp@@  -L|M0 0pQ U( ! K{ 9[$`K0#7f @K2   %( 0 [R KPP֊c P  -@LPRz 1!01n0SPpuOPp Azp0S -QL@U x3s|p 01P 01000zc{VxzP //\nP //4 -L`p@>WP0PS 1S   W00P0S@ -ML MP+; & 0@ 6 000 R0T :!,UNK,`05d! 0  d!.`1111a0OK P (0? 0ό6 d10d1  Pe ``@ ]`0D@S_aH S S\  S S00 Q`@ 0S S R:0 0CS00S00 080.p0P5 - 06 8(00(6 B>K 0C 6 ^>K 0C & CK5 f +5 Pf 04[#S;S p  *P *4[ S S'6S60 S S @COoSB@T`0 ]_AUP @F   P*4[ S S   P &4[& S S00R00Szh  P(D[ T T @  P)4[ S S6' 6d!S 0 u0 2d1f Ax|ᓦ1|zpA ƟZ>K 0Cv`0So V `0`SH`DHp .S`0SVP@ .@T00`FV0S 0 fP % k &00 0Q0R(K6S/60 S S pCoSrpW"`@ ]\_q Pp`0D@SH  \R@* S S00 Q@ 0S00 0CNK-P.P `\R` 1x#|#rD^DQ 0dD@`WnQP0 SQ ,Ph Y6, ( `$V T T@ D/oT" ;T@@TU@T t#6P ;TN  00@@TW  Pp 60P@`/ $6 ㊁Zt jPE @@ 0 0\N L 0-@LP00000 0-@LP  0 0 0-LM@ 0K    vP0 P 'FPP Ƣ  0 K0PK0 0 굢 -LM`1`0\!XQ Pp QpGR`, `Up5 K A@ iP! 0iP 0S@0S0hP@  `0 0K| | t 0 $KX X P `0 L Zl,YYȍY 0-0PLU# 0U#0PUP!q@@0``F,0P  $ 0$ P 0E`1(`$ P 02~P<'' -L$M(('  78 G@7 `R 0P$ (& 4 & 0 < SF &Q  FTڠ&(dp0CS,('#"  06 0(0$&$ A@dP(P@(@ 0P(0*P^ P00Q@40P0S0S 0SiH6S 0S 0SI S 0SQ 000SP00 5 0( 0^A02* p! PRL C TA X\ $ R$4 0@(SPX( 1  S<80  \40p(PP(K p Nq0001RC@ 0R*(0S000P(03 0R00 1d# (0\8<(0=(01 30 (0+ (0 .(0""2 0  (0 2 0(0"2 0 娂 0D @0 TpS (0 x2 0(0 d2 0(0 P2 0(0 <2 0(0,20(007S 0S'20W 0T *!1 0P1(<p5 @(41R3P1SSX!D@0 Q0C @@!  p  ^P(K1j p  3pP  0(P\J 8\Ѓ4,$|dp`0xL~ll~dQDG-10 ! M X0*00@ < 0 o_^0 R  \:Pŀ 000^ R/YЍ$0 0 hB Ą -(0(0 LhBf0A HTv -@L@`V 0 CQ𨝈PqᝁP pG P0P 0`0H -L@00 R ^^ ` P`1PP0 0D@  $  T X,@  0-@PL0T  0S  T0SK0h53K0h/P@-0@ 00d  0^,0@01P(0 0$00?  -L@`IPH ` 0(S  1T  0 $0003Pl -L`0Pi@P PdP 00뼄 - 0@SL`@  P 00    $  DPP$p0S p= l( -LDM: 0( R@ @w * `< *: @4 0^_H0 <80 0PD` `:P0 p?L ω00 80 04SpP@:Tń 000P0 @:TU-9y0P9p00 \0 LL D0< IHS  !$RQT) P L) T D) X SdT T ( 80$ RD 80, R9 ( 0S  !R 8d0`  @` $`< @c\H?@$`P 0!Q < ȟ A  B QP'@ X , '@ $ GH<@,0 0PLP8<0兀@P: @pPD`d0S*\'0 0 0  <' 000S:7@ B0@<00(KA(K(K(K(K60  260P0LP(KP<0 0 a0I, 0CR Pl0 $0` 0T0  0,  < ^ 0* S(@C\h@ Tn%<0 00C?00(K(K(Kh@\ AR` a, R$ hQ BSdP  P`p \@  P `  B R9\pA@ 4 0 T  4` 0 0a, @Td  0`0X0 0Q`<0 @` QFH40<00D0 @`pdP R*#0d S`0 R 0ch ` B` `P@0@ ! P`  1 x d\o$Pp$`@ eP@Pr`0`# 0S `` 0l00`X0L`~@<00D0 0d0 ~ d0P 0C 08뼢`0 0 $eP R6`$ $0d dP`  0a\ 00b`0 `$l 0aK0@P0@Pmjg1Lp 0 pl0T@``10 <0S0ρ00 `@T ^ 000@P!< /@:TD  T00 .0`00L`_< 8P0~8, d x Htl`lL|}\@pd{$x\zzz\uLut<y -P@PLP00 R P `` ``H0 0<@  $  1  -@p@PpUL`P0V1`F1`S (  0$ 00X,0 Q-L`pA@TPQU0{@P 0 p``PPpP(P,P0@s\w -`L@P{P UD0N  P 0 000P   PMvw 0-L@K0h0/ 00$/X00,/D0 00/. 80 00/- 00/ 00$/00,/000/000/ -`L`PU 0AP pip80AP}404 0 ($,  {|}/ -LM< < 4000$ $ K K, L d:(u 0-@L0`00K0h 0-@LQ 00 2 20 0 -hsLMP@p 0ㅨp T 00  0 0 0 0 0  0K- !`P 0P 2h "Z &= " 2* f00 0C0 QP Yv YRKmPP%K0p 0OPF 2 @0 2{ 201!1! 1  1  1  1 0 0P# 0 R00 0  uT 0 2 13/p (K <R 2"00@ȥZ k`@(KT`0-00ᐡ`P 0P2 2p 2: 2 2< 20SzY 2: 200@@400`+ b  d -LM@`pQP 000ESbX`B^]CZI 2 13/pb R0 R0S 2  13/P"?o2R03S $K EpPA ($P(0 p 2 (00$K"P?o2(0"?oP2(0 $PPU0PU "U00<00$K $PPU00 -LM@`pQP x00U-0PU) 2S* 2 !13/`PE PP 0p  2` 00K KK`0`0` -LMB1PSȑ.:b, V(@ &*,pK@T /pT  w 0U P $K0 J P`XBȑ$K dzP BȑA`V* 2< 2$K -LM`X8 r=*40K<0 A̡P@pP W ZJ1! @D3zP ̑@1@DT0@ 40  04 K P (K0 @D< 0@ 4 P80S(K80X* 2< 2(K -LM"1`S3:r, W( B R"*T$*,KRU  R00U00SR 0  PpX U"B$K 2< 2$KyP"!$K -L MrWB Rb+*T*4KU4@ "0S 0 0R U@E0 0 k PpY@ U 2< 2(KDB(K(K -p഑@ 0LP@ `!`` I(1"( B0R1.0` R 0 1V!0B0000C08#8S 0C8#80 0 S0081#810Q!2 B0C!2yp -L@bP P `P  ` -P`LQ@ 00T T(0 2S $A@P$00C$0-0@00Q 2S@3:A@P@ 2:0 2 -L4M@`PQ d00 V_ 2+ R (K 13/p3 0 0+0 "@0  P0KD0 $% ?L`KDpK0 40  08/P7 0RIpc P$0S@ 1 R "! !0###R0DDD0$K@Q9:: 0P<0S0S  Q #$0 0@0#$ Q0D0 0 P 0S0C  8#8 C("(00 $K⽠@0( 巠@0( 0{eO 0 v p-L M1@SP taP8 0S,000>P8KpvKp -MLM@<<Ÿ P K8LqŸU`(K P< Bw00 _ 1 R18K<0C0S<0&%@RXjj`? L<0 l60l 0` HpC UM8K80C00 0RJ(KV:`K,HH8   [0S ! 0 " "Ƞ"S CCC X 0ႀ " 0X tˡpp@0@0O00v PY -L M @ psPP 0H2`a 00 = J9 000 0Npⴜ0Q(K -LM40@S00S040000 `1D00 0$pA1< 7p0C 0R40 0NP`p P| W 4NV0 ^ | |  0SPW00 `D s `  R 0S  ps"nR 05 $0P8V:D0PD 0P3U0V1D0E2PX%X.U* 0 ሟP 00000P@L0 (K0@V$08 gP8 {1 ad00 (K00PV$DP @00E S,`V ڈ1  U 0410CQ 4 0 B Qs" 00lRX3%Xu1PX%X`10 `DPD0P0CD0P0S%ʆu P1PD  U XD %X`V `DH  A PuD 0$10C0S081 ,1 cH00q$UThSXS -LM@ p`WLWJP0P PASP[*0῞ P6 @0^ S^ ^SP0)P@P 0S 0  00Sb 0 ~P 00080080(Ko(KP00 00S Q0008(8 40P(K4` `D0 0P 0 @ @ <0 8080 80C 8440 0< 0@`p D0 0C 00@400  - @`501@0JJ@0D$ 3R @N !A$0@DRLP@ T00t2@@`RDAKhG -LlM0 ƟX@ p` 0Pp0 (p 0  P| h p0 000` 00@PE0SE0T Kl \ Kx` hp d0 t `p 관Up PX%X Ga 00E0d0Ppd00d0 `P ڴ R5h G\ X 儘`0PHXP%X 00CT l tx P0 )hpx @  0x0A00@p 000| 000(Kp0hp@|0`x 儐 0@0p|)l@ t 0 Y*  BRp≐PU R(h#"(PPUD0Kd0 L0K h0 % RH @  RD!Pi `d h    0)Y* \ P B@@ H L D `0Sl0 RH @  R P3 0d hl0    d hd h`0t0<0K0 0 0 0bP8Z <0Xl0 40`St0 P t0@0 sK0 @ B("(xN Y 0t 0ᴜ0Pt0 @R 8 #8Rx0  00 t00 oG0S t0P 0 |0x0  Ax 0x 0 !(t0P x 0 20S M0x0 -L MP @hT@p 0\`@D00 'P vr qP* Z00 8#8R50 (K 0(!S $1 !0$1 0 R 4P 0 P0S 0$P  00S$! 10$1y00 -LM@80 0PPEXY0 %X0pY 4p p U P!` `Fh&h0  ("( F` `00LPI} YgP4pPP Rp R010!)f P` `Fh&h 40 ` `E E 40 pG Aಐ0@`0@000PPEX%XW^ ` U1! )80PI )P PEX%X. pW ("(! P E @ P 0  000(K @  p PPEX%Xc8  W0P0E(K`0<P  @  PPEX%X -Lp` @P 0S00 0-U@ T X  R P0BQR R-0P0Ӄ0S 0Ų00@8#80 0\0 L0 X800C80TU@ ` -L M @0T @`p@DH$H^P%0S70   ᶚpPJ( @00T@`0@DH$HTʴ0S P 0P` P(KP T0 P(KP(K 0-P@ L0P Q P P\0h P0Q 0 0 -@L PR`  R 0 Q0E@P0R%  0S㲀Pp> 0pGS \B P 0(P   0(!0S$! 1 $!0Q 0P @p0弐ᲀ0p 0 S 垷0! P ἐpGxP'x 0$! 1 $!(B 0 -LMP @ T@p0 0CS 0@D` 00 "P onP( 0 0 0YP00 8#8R0  J(K 0 R យP 0 0 0P00 0-LM@ Pp10K0 -LM`80 p 40KP @pI J8KP50Y0   $``↠ ⺠ < K .\  `ഠ 80Lp0`000S0Y(K 08 "P 0C8#8 p000 P p -L4MpD"DŸ Pw ^@HP 0 _" R 3:* LPv XP`b XA1 C\[: @ Ƞ,Ƞ V%: 0C8#Ƞ ` !#h" 2 0" 2 yH00 0 RD(K HR  00C L G12 S ?p PD K᾵p D 8 8 K4 < @ @pK`h&h`0 ^P202)n P -LM@pPQ` 00 2   Q v:1Q0" B]!24 00 00 40 V^ X[ZFWVHT0PUO Q * 2 13/pW 0S* ",, ( A,K0  PF0S: 2 K04 KE0PVP V$P 0  0 K0PUP`0PU Q:0(0$P= 0  KtkP,   ( 00 KlP 21 l,m -L$Mq`@TP  llSdAPDZ00CS0=@4a Pp: @Y@DOoB0S@ K0: S ]P 0S 4KA pW + [0 R@@6 ͪA03 KlTsS0 @00CS0Ị0 0(B''B\ GB -LAK 0C0C(T:BK @fP ZkB.K B,@` p|d:edAw \-Gs 0-LM@K0$`0 pP  hpP0 PP Khk4M?(@P +E?K\ -L N' -LM K+ @ K+d @ K K+ A @ K+< @ K @@qP K K A @p KN -LzWQN $ $0$ -0L< OԮ $ $0$ -0L( Z?Pl -pL`5W@P  <0":k0cS@:UV 0@P8 80 $0Q/ $0S/ z @ L)<<0 0R/$ 0S/y dh) -LM@Tp 0SP\/mPPX`@Q0@ @@+PPP 0(Ko/L|' -LM`P|~kqA Ep1A0Q,4SQ 0"K#K04 K  0 !YpE0lP3 bP) BP jh dOKeP0 fP 0tP! nP0 sP0uP vP00 07(0000 00,40000KG0S 0S 0S0S0S0S \<嬆P]& '& '40P' -@LM`pP&|lj@ @ X3T#Bp* fPD LP8 P8 HPA E]RP6 XP PP ` puP#rPhP/ oP0!C!-\\ R0C020PU UT R7 Y hiw0@S` pD2@00 00  `pWPPVPaPTqp |P   Pb 0P0#0 T!YaPP`KnYp@ l.% B RܗPtt0S  X  X { 6/P00S 5$ P\j P$ PSj tPY }pP0S @AL\t&&40t -LyM@`3{i)0Y刉则y0000x)*EGK 0`pM?K 08 00M?K E?K @AKpe`@@K?K O?K G@,V!OK 8!(1##81 V!KK (!1##(1 1c1s#p 0 DG0`S,1 p<  #!J]0!!"#B]0!!"":]M?K 0 00M?K E?K@ AKemG 0S #؃`R pf\ 0 0TZGLWGV,5 0SV/*,1  K?K0SV+*EK 0tO?K0SV)*GK 0e 0 O?K K?K lGz)KK (!V'#(1 oV!OK 8!1##81 b!1!  0@AKd= h!(J  ' 40  w &  t^  ' V      @,6 !(me ] $?Z \c] G -L M, ( (0U,P(000%0PDr0C?o20, (<p( !( ,00C,0 ,0S9 (000-S40$41, R(0pP EP SP 4aT PGDsP xP00(4 $4  34! 3L! 3 (00(0 ,00C,0 dP@㤴㡴㞴q@P7 xqSTL381S p#p@FDcQ^ cPdHs0S 4aVB( q߶PM81S% "2 Fc^ 2 ,0S (000S (02kP (0aPᶶPR(000!S (0 L崻,0S (000S 㚶PWqE:T``0:D100P S Dq!0`00} 1 e@P k@P| 1 d@Pjt t t(081S^`@0`DqSPQ081SqKP 0 p F \FP`&7P3$081S| \ D0 TU !(&t'40@'(Te@&(t#({%(L'(1K!(P'%(_'%(H'( -LM@P`/P@P,@P3 DrDB ;p?(2Q-= 0Pq EQ R[ R] R1 0!BSQY KPPT0: SP00 ͊!O;pd10 ER!NpE㹊hP LP" 0FP QvPP fP000sP0 iP000 nP00vP wP 000000|6vB KO@P0: SpGP  v@6d'(&tE z -LMP`q@`N0B@p$ :p 20Q1S `00 ?0PE0 @TBmP pP qirP /rp ^XD l \ _ H 0 S0 LOP00 0K0 KP 0Y/S / ,0K0$C`@T p@p @/R0W/KP 0 S :XPp ᔥCKyPF ((&J -LDMP@p<4<$ 偞dKmNP%KdK&KMdKcNP%KdK&KMdKYNP%KdK&KMdKONP%KdK&KwM~@3#3PK@@ @ @@ `3< KTKT0 JP,< KTKDP4< KTK>P8< KTK8P<< KTK2P@P< KTK TP *P< KTK$PP92 K<P <KPp"㣵<0S <KP<0S <KP<0S <KP<0S <KPA0`S VLP!0S0S p p@PhA \1R@PP@ 0p/S Z(1PpPU   000/00*ǰ00CSdP0000S $Ќ0s00`zЊ('U7(P(e(]7}&E }7(7(Я(lܯ(7 -LP`go)^@p y8pt00S !LP PP@@T9PڇP 7@l& -LMP`,Gp 0o]P P B8p 6 pGW/0S (KfP RP" PP WP dP`rP iP0`0vP xP`0`0 ` `$`P q  `V 1S rUI䅟䕟PU KLP$0 S50 0S*)00  @`P/Q / BP` .QQ .QQR`   Q 00@`X0SP$0 S0S@ᓶP `pP ᠷPP0S <850C S_0$S P PJ] 00$ @@] 0ц0S $ ?RR00R0SX5S S4 S4XKP8 0S Ҿ0S  ( $ ] 0SX  P  Ꮈa!SR0SX PJ 0SKP 0S0St 0 0oP j0S 0Sc 0?S_ 0S ᳶ>y0S u0?S q0SS \ x0: S R  :S0R0S0: S?JP` 0S&'00oo 0bS`V f KP SJ 0SGKKvP 0S 0?S 0S0(eB&tBoBB -LP@Vm\p` h6p 0 R1 P0C@P5>pPp SaJP'PW` /P 0S 0S0PFJPx'0^&t p-LTMh d ,7 K80!P L H WIIPI@JUJT0`0 ` 4  nIP 3 ժ[30X0 P 30S S" S 3 J 33 3 0X0 `30S X R <#6 R @# SR$3(3 3 (20S DK 2 20S X0S'0X0 2@T$ P0"v@mB00CS00  0 X X0S?0X0 16 R0S 10S0KZ 0P_0K0 X0 1 1@T 10S @`Q@FTDKNh1H1PG810S @10S `1 P1 zX0S 060S , 1 J 00 HDKdhs`0S d00S 0-S0X0 g@00S 0S 0X0 eob( (vY}&((L((((|((((Y~&&Y(C}&(Y -LMs@P kZ2@ @0`S Z"4p 01 K0 IPt`KJP\3a@P444@ bGP @@4 KvIP%t KnIP%T) *00S@0Kt 4K`KM0Qah0 l0 0Ql0S ` KPPh0S 4 K<DIP,%><`KoKK3PKKPKKP0@0 00 @`K+`K+0l0 000  ᩳP`KfPq&&qqBt @qq40tht@qt@q 'qqgtqn -LjKNK 0C$ @4S P$pPVZ꠸0#S MK AFDM"BK @ENK@3f0E?o2? MK A0DtWBKX @@;PPBK A,"f/%^p,rW "PPBK @E`s:宨00CS0 WrP Pp PNUu0 P00CS0Br0 V _"0 S:00S:0&!V1 1M"1S1S 8Pdp|!(D1 f)V:P HQP-p0V,4 wB.K BH "P40`FVhP@ P  f/}0 ᏷T  'P E"p((cv40<p )̃)P&&)C t!8('} s1P'md[ P( -PLM) 0P @P` @ q9Kp!-h`00CS`0X :@TKX0 X @s- )(' -P`p@0L\MhP dP `P \P XP pP  t0 /pt0$`FVlTT!Yt rTdT x0 Cpx0!|$|lP aPP Q @R`-dP@pP nP p rP tP0p0 dT0 RT ST QT0X0  hKh K QDp (KpTM rT! lTV p ;- hKޮh KX 6DpH~ TKѮ0T K )Dp ( TK⇶ TKU  DK⻮V@FQpP  t0GPavU4@ 0p T K CpK@IPl ` %  @   ,  " l0KP U! l@$ 0  !O~l0P|0 P~VP'up0@S8|8SlZt0,pK1('R x Z0|@Y S p,xRPU F 0P 0P |@P z6 |! ~ 0 tݙ40&2V~DD{D|D(,9HWc}DtUϚtyaratcid 0-4OLeM22222222220P1 1 1 嶯. R.p2>`PpE }P 2S 2S02S-2S*2S'2S$2"S RX R2(_ "R S4 0s|$d bP 6EPo "2Pf 0P>] 1P^ -3P` AP-_?Km 0 BP |10S"|2RSP_ FP0Y IP2TP6 aP02sPd iP" cP fP02lPD rP= <02tvPH tP  uP02jwP zP<d= P  ʌ  Y 4= (= `H| Kb=10SPA }2;028@[k0 D7;@T(K202%02;/`ᚣpP000pS K,p~ 01 W /ᇣ`P000`S K,pk 01 V /tP000S K,pY 01 02_?K0:j0* 06P |10S |2 S;2R28j/pCP WKAPT1: S :  `P QQ/-P *0  Pt|QK@P 4XZ@4KAp eK*0R0d " VT P9*1 "@P1  !14)S o`o`+@b02a8]|p\p802V0 SQ 0SW10 bV00 0`0 `>K Kp `ZNpP ``>K Kpp2S WK-APT1: S022S 2S2SQ` 2`S2S|w0 t7jP p0SP L` ?p ,WP/ {P4 f/e 7,0$7('4v?S㠒"2"2 X+6PT 00P U_MP Z p{2 S2 K@pHK s?0 0%K(   ;%KcK 1/Ÿ0 cKЀ4 4+2,72(7< 72$7|u @p | @ppVdH%?p` *? `p$+P )/%+`Vp%+rW 222222T|2S"2Q|"t !14!8!K0>K]/K^K)P`F`1p!0C`1 0K0Z/KY?K[K )P5d1`Lt1h1 , R0cK xl1 *Pe?K1!01!0Q e?KcK 0P u !ʮp`_ YV02S )&<I{)40F,b))kvC )tѭp)U)ܮA)))1͕rdA#edA?v>qL )p8) "&ް :)8Z'{8)))3T|04 a_Zᨠ>K0]/K>K^K(P x1 St!#!p!!#`!SpW X+1"Rb~*> R0;|2 PR"2R SP1 p10Sxo2SN2SK(-1,5FS 2S/2S,-,P' `p`" 0 i*,0!`" 00_*? 0! 0 " 0\S*,X+ P 2|bSBpl 0! ! !12S5 2S22@t(@2S+P% [3`p0 0?`(*@0+P 1T011P#011011012׃<ѣ<2BT ,2S202S 2Sr$2S 48S8S +P .. ,e$$P 2w4x5)>)>)40)8)&d ' >)  Ā&>) >)P@a8)zd@P9): tedAr -LM`@qQ \'p$X 10S 10S 1PAPV MP lHL1 R L@`@CpP fP nP PP 98xP yP qP 0 00  0 0 00000 00EX 00K G0P C8p080 880pb:V`PUZ(KeH)H)G)n&*40 -4L,M$P`<K ;P#K<K#K:90@ltl$00dd4dd@@@H@ L0 P$&p0:H0S00S 40S 40S @H@ 30PUaF 30S 3 P 㜞30S 㕞㒞p㜓圣Uʔ30S(KdS\ 4US FSZ PSz BSL3L0P0 PP043 0P 30aS0 XSq )^bS"+ cS 0 *^2PՊpSF mS) nS9 fS00yxSD qSx"6ySA zSd"000i 0L ^D2</^000Z0L 0V!0 ]2 >0S xuh!000\1 <`!00 D1 4!P10H0 .!0001@&@K0!0 0 c 厞P3S KuS0 `lS sS" hS `|wS* &zSp3`3X᠀qxpnpȿk00h0 0e43`Ha 3 ] `,3XY p CX0C(0 0R2`O5>KPe!00 0 Ȃ AP3S r"lS LS aSt. d"CS*sS mS%wS zSHL#Kp0 L3S  0C,K!P @P!J@9ʶp``p!< 4Px!6 "P`! 0S1@!|3/ K6/KXP HP<1>tMMBFMH ,H1iMKM*1gui M m-LuP q= KhV;,:Y) 0-L@LH)P.@,&(%7K0h<Y)$&SS 0-L@LHP@, ( K0h!,Y)&\_] -LdM16PjPy6P0 p) Pb6\c6@P L6H2@P0<"@ 4244嬌 6 DKp DQ N6P E @ p1a 0y0 @ po0 @i xe0T0 P0 L0 H0 0 0000P0 0 00TK$@P  TK4 DK@@ <@ 8@ 4@ 0@ DP v DKv!555 0 X0 ,0K4 #@@d K\K\P &p-PPUPh0PP 0/(KU UTUU؛UUVVPb&ha4al``Y) -P`|6LMtvtF P 0  i!pL6Y q ^-K B00^-K B0]-K4 B^n0 zp@G>]-K0 B 10>n0S0ST> rL. R   t [ K❤ZK 0!00  0 2;0(00  0&`:@0S  0P]-K0< Bi: 000  ]=K<0C0!0 X 0 90!00 , 0 90!00 0 :`0c 00 0 X9 0!00 0 9G9@0S 0t)tQPd|kQTᠠP00z <ᙠPt (9()(^k@፠P00 ᆠP000^ #  ^-K0P B0R ]=K$0C0 1 1 ~9A@;1P]-K08 B8 000 @ ]=K80C@: @ʑP/őP  k0S 0$0]-K04 B0 $&(D%b# pG6W` VWY K  @⻢V K 4@ⶢ]=K00C0]=K40C0SVY w堗0S<0V4 0YK A 0pP !i@:K,0C878S \7 ?? Rp0`Y=K 0C0 7 ?/ 0 6 R0@u0S R0 f`&u.pP  YK A/p  0S@S K $@QPPS=K$0C {jC K $@iZP`;%YPPp%pYK A/p Y=K0C0: S<%@, 40S 2.@P %] K(@bP$  @tP0GpYZc0S]=K00C0V}K0,pG0V=K40C0]=K0C p)d$|]=K(0C`^-KK> B0 DP^=K 0C0r04:P 5P0#]=Kn`(0C`0#00@00S:K,0C('R 4SS *0h# ` P  l2Z$ `P Z82$0S0P 33"ZPV=K,0C `p`:K,0C4SS V=K,0C 2 QP*ipp]=K40C0 2b ?,!0[p X  i^=K0C04 KApؘL  <]-K0P4 B0  1$" 0b#p|00S 0# ^K?A V0t]=K40C">@` 0R$| S\ [)w[)ww40[)&&Uyyw\)'w\)[)|}'x 3=~`~w~~ 'Mx~^xY|{x[)[)&^a2xx sC~xxzxx)yypzyy\)yyzz:\)u)z\)=zTz 1uzzz{!{j{x{[){\)&{|B| \)[)\M|U\)[)w_T|b|^=K0CV 0]=K40C ,pW `VuS  !R {\ +S :0 Q+劵  P ,} P +P +*  QXS 010$0S  Q*pf0SfP!q0S010 0S 0S 0!K00!0S0Q#1ѣ10]=K<0C0 0]=K80C00^=K0C0?Uu T,t P,X20SU ]=K00C0KA뮂p@ P 0 K"d(@("=KKA@„P6.K BX\ nF> .-0 K #d(@ ",,,,4,83Y-K0 B0H#0 PY=K0Cx0 K0[=K0C@ A,p>K0CKK(A&P KZ AKPKP ]K A\p h T:K,0C4  ;>.K0 BDkH -<:*ML M p`Z* * *  Cp@ 9P0pGs00W ZT[ 2NT[ FT IT DT*K AA )8#80* Rl0CQ (X"(gST0B VTQ OT0 0 0 9mTd fT0H iTR bT0*0 0+8sT[ vTf nT0!00 0 x8<0:  d8 0s000(0 <0,,80@w 0 0  0i0*0 0+7]0!0 0 7Q0c 00 0 07D*=K0 1 T1 }D770'40S1$f,0: )) K  @⯞K @⪞Ya稆X 6 R, 0S6 R0&*p  M )K A#,p lF 0*S@:K0C 0 R0$9[S >K 0C QP*`zf0U; U0P: %Xvf)K A+p 0S G*@P * K@_0P:    Z SPPZ z:0S: Z>K0C0>K 0C Dp 4$Z K`t6Pr0`4]P XP#80f^PZ #0St:S0( $9[S K @*0p# :S4P3D#8cH>K 0C _pp  $3!0#kWp d  e:4 KAlp8(:: M90P: *\ 20呃KA !0 Sڤ:0>K0C  *?>K0C R0: :Ѐ!4PQS4   : FX0::+$$S$QQ 10S8  0    z):SppW r)>K0CP 0 **)plle>K0C K R?A : X0:*!՘  X0:1 : X0:#100xd*40&t&.|`~P`){xtd*|d*}pd*'x 3Yd*|zd*]yypzzyzz:*)z=zTz Dzz{!{j{ -P`LM  P `K0*OP d %*P)pK)c)p 0PLP.epYn 0B8 pPp W l>l.l> W ()PX <>EP )P4<;S)P`Wi $  h 0N =OMN0 ( 000PP =0 _Xm"R1<;020YCl=0S C@4PZW5Pf@XPI h2DM 0 L 0 KL K`"2R K 0BP ' "2@PBP30S 0 ' @P 0BP@ KP 0BP Ha 20 帉KH%pP0  Zd@+A,K@PYDP0x00D P v v Y10D p  P0 d&P\P0:CS0@I\&@@ 1,K 0-K]j*͒u*?{Gz? %TeAp&40Ԓ`RMb@A,Jhv*0m*ē v*Ǔm* 'BNm0v*v*v*z l*Ę&((l*m*-C6?Dה!8~A@m*$@xm*@@_d'mXm*0m* &v*v*B P'xҗ(@Ysژ+9JX}˙K-g˚|v* j*!&A JN`p <1K@P 0A\PZA@P 0J 0@P KAPLK 0AP LK1 J#J KQ$@T6 0S2 g k ,0Kt #|PK0P0p+t0$pP p0S Rp t幈f%t;0 00!  W 0 0t#td5x!'x!8C8S.̄ 0 0G 8(#8"( 0 5q  KrK2o 0+K;    0;4< 5 0Ux5ԋK0$#$0(00"(0 P5 Z4 1pЖ HE]P( X0 0RpUx5ԋK0$#$0(00"(0 VT'0 G0D lLpw0X P00SU 7030CSln4ndpdpnnoPm|mmmmmmmmmmmmmmn  0P+K`0#!   0 *PL $ 0 "PD Qlnnnn` p t x |  0 P& 0$!$#("(! 0 P  0 P  0 P Q Q 8 < v@ t0 P\  0 Px  0 P  0 P  0 P  0 P  0 P  0 P ( 4 ; `` . 0P+K0S~ :S4 S~0p0CW0 "U WB 0C0   0pG 0 q00 S 0'0C1  00C0 00 0 00p WpG BY U3 t<;Y [PU WB0< ḛ> 4Uy P0H00 0 CI#Y  0pG'q0C7!  <  CUX Ux30P$#+K 0(00"(0 $ 00 v -LM`P)2@0P-S@[P/ @04 p$0p  p*40SP a`F PZOf/PģQM 0CKs"PM d3 \&P@ `3tC d@Ptuuuuuuu(uutut4uuuuuuuuu uL@ RK@HGG000 p 4 x4  W  `\00S'U`P!"P`0b 2 R 3 /30 S 3 3U+ 0 3!n30!00h3X)  E p4 ,; pi0S㹈X㴈` ) pW0SU MP pp@@2 0 \ Vpፈ`v+&\ t}wNDgYЛݛ0f  -AML MP@P1傇P㰇8 |P7'` 0-S& ?.P ត9.P[ p @ `FPX@ 0PE0S0 P @DDA@D얟f{b@Q 61 Q储< i.P -<1P@X-   p pD0B5S񟗕`{LxLxLxLxLxLxLxLx|{LxLxLx{LxLxLxLxLxLxLxLxLxLxLxLxLxLxLxz${{Lx{Lx{{LxLxLx{LxLxLxLx{(|{l|x|Lx{|p\ CKpH5040S 0E[P @[00  p d0SMt4P 0[000 04084 4 0S |[ `4 00,tLP 4t CK 4040S P3 000 0t0C?o#2p R0S 3 nPifPal* q`3@DXU8[TH3Q00PE@rS# RSm iS tSr xSk r袟@T*Q 0S =Y XR 2B R00/S v|J0S T\k 0P@x4 0S 0S  U2 00S Fl0S <@ 0|Slr RXa@T:BK ABK @ 0 BK` @BK ABK @  0r QP0$00S BK @< BK 0 @wa0,8v+K40,mP,И&Ğ+d,&G',nܘ&\I,MP'zE t[ןH -PLLMPp@O& fP SP@ LP ? TP; dP> sP2 nP* qP>tP. vP> 00.7 p>>PE>A R t}p>h>0S\YT> L>H>D> >"aV=0SP tP P=0S 0X0 ,H h ,`D ,@ d ,< ,` 8 ,oo4 ,h bRd0S`0ZSYP Q0 +1`0 <`00gS <4kC 0C00A0@! 00 0P 0C #10C0 0 0C0 B #P 0 0 0C0 B #P0 0 0C0 B #0 0 pğQP~ 'KPP͌0/@dTd0 JZ4W00 pp'os`F0+ᾹP# U0#03R0SU 5%P倹P t|. \* KP0`0,#,R004# F@∀ PKopPEX!EV0Pw"E0<6S"46S" 02Q" T201*_|56S l0vP0 BV V 0 _0 P0 @,6S m/PP 9)<6S46S@d1Q|0 @6D&S1x0Kx0 t0KRp!  H&0R\!\ $&0RL! 8&0RK0CPC l}\T dPG>K0C0CH| 4 P 0S6娚 E>K 0CPUEK A1pyS%|"+0 4 5 cp"0|%0%a0g`x6P l՝h6`6?QXRS$K86< 0꿡60 & F 00y0P 0S ciFP@P U0S P 0S cc5hD0S5Q +p}pUP{\5?@# P* 4 050S0rc5 LcP T} Yoxe Rx\Cd Rxd Rxd Rx Rx$Rx$|Rxx lRhD!q_VHDVVV(V4Syڐ4S  XB@420S Q@Pfa+nP}Vu4:sP 4/aPA@PX12TVL VT,&2@P uV rV4@`8\sPP0@P`!BNK@D+|4lD 0Ad4 0hd `4 U0FK Ap00c2U p0B?o20S q R  1 4S b20S 20S 00+x-4&.?.G.BU-h---l-.--t&.-p&.L&.h&.@&.7.]7.?.7.7.-&.7.7.d-7.c?.8&.s7.: '7.7.P'40L  {&-7.?.H&.@.x&.&.--ob'!.#-6p-SJ7.bl&.40x--U S]#/ &md08t T2 1 |6.$% % 0&.-; -LM@PQ3Dx5p5<h5G`5 XP H5 3n850S ,E  PKTڱqvPM `t脟 0PN9PFvPJ$000 ,p40`DVAT 4 000PJP dS,X{0@D R&@48$  444$00Ka0@K$tt tsGoP_K 00@&3`,0p vP3# ur3 @R xS^rP  `5Ke P P0Sf0CLrP `  PdS7vp@|b 0<0 00>00r00010Dq|xtsh2h"Q\6QeT2pf Pc B18C8S NwBgPq堁p1Kl U0B?o20S! MrP1K 1 [\kq=PS  0 010010K 1Kr18C8S 1[ 00R0S P=?o20 P P 1Kq18C8S 1[ 0 PԯPS 0Pp1KsK.L.pK.L.dK.EM.L.K.eh '6P'k@M.&i1L.ĭ&rL.TL.K.K.TK.L.W thK. '{& -^ML M`>PtP 6 vF px60S`V=X6P4 yD6/DVP 4QP 6 VP 10@S% dP0 lP cP 050@00%bB.K BZx`0-S0S P y0SB.K BFx@_KAP% ?o 2R0S 0S}4p PRv vz4 qz@3v5: Sx  Sl0S  pP Hvw  X hUK AP   vT5BnK: S4 `F +6 y9}3 P @ 6 ~P6 ^>K 0C CC P pX T 0S0S8u0 00My 0S0S-& P 7 y0S `&0[x  uK 0C xy 0SBK- @ p`BK A1u:`-K B w 0S p`uHN.&{'&% 6# DYo  ' 0-鸃c00L@@P0LP 0S00^}P t3 ashszlr@`|0V* s/Rz}P0c0#3PP mx䂟T 0+0C0SˬPȬP ˬ R}P@D 0S P X2 TPbP 0S 8P 0S20ݑ2P R! 1`V 尛`PET 0SPP偖P᚛Y`@DDP9T10S H10S0Q,뗨x㭺1 @R1|PhP˰wɽP)P@0QP  {UhMPǔP ꌋ..NXN..(~.&`N= X.N.N.N.NN..N}.&obN.D. -`LLBpD.@R@` p"2 0 QQ PPPEabfPL IP> EP8 00 aP8 ePx1zh nP5 iP+ lP0 ,SP$ rP uP0 SP 000 S00000`0t S000 0 P&d0e@8P HF .r40.&r'P'qq.ħ..  -L$MqPFğ L@l4/᠓\4P@ 0L00H0 P ,4 N$0HA@Tn`PtD@ @@ <@ 8@ # pz30IYZs0崓0 1 4 K0 #[3[R S 0 iH080S, nDP "eQD0S   <0S    @0S q@P y@X{"P20" h -R R -R i^eR^|iRy kRv eRseP8 QPN EPv IP) -P paP& dP$ SPh @nPe kP) mP2 iP0`^VZ0SW ?S``SrP) sP* pPp080 G\C0P^U?0S< ?SPP80@^T40S1 ?S@@-0<0 '0D0 $0@0 !SC0S@  R;ڴ3K04 K3K 3h0lnتY.u.00 '.-&407u&00H.D.ht@Nu'dujuouffttt u+&u-uugt -@`PLTMrp@ p1p`FVU ` PlKpl EEgP uP GP0p0 0P0S@0Tx@   x p`V  p!)El K  `pKN P R Y E[ p V lK p T x p U v p|DPU  ` TvpPL@@H 0pD u40&utuE vv͒f$v 0-@㠄L0 0 RV LcOKV/y> K`1 00 0 0 0 h0 01 1 H>H^1 0p<1 #0>K0  >p,(T-뼮1!P1 0cOK B141 08!  La 儡PP#0u `.1 0CS> L>|-00+q#OVPX NPJ 6P3 ?PR 4PpTPD HPP#16;3kP( gP) jP fP<0`1 pP ʴW00S h ۥt&p? ե|&xZj#A1Q  0#cK# 0 1@08)0 0 ( 2p ƍUP > 91 S 0(!#cK# *#c?K#041Y tP@W8 )W|800p8 (+cK# 00 p@?x @$儍Y@8 ypl K凋pP oK# 00cKh p  1 R 1 AiK  P hDP0  00矎P%UPp 1Q +  o  !@PW ![Rp |s,0Ka!P6RppOoL!P ᙂ<&B R` p``W@Tf 4p1!RS 8Q1 o?K0o?K 0(0460| 0s| 0s 希 |`q}Vx啌lGw0S Tƌ1SD pW1SS mw0S. 彌W ew0S( 婌~ 倌'P1SS td`gK$! p `Vh呌ZW XZT#0(44Wp*w0S $4lJpw0S #_P  q  `)4!11 婍P1 R4! PpC Q0D 1Z@i/K #0@p 1`V@Ѓ0%00(0 180M 0W CPpfL pdH 0勋_P 1BPUBK⺊P|h\s 0S   ᡁBPl 0S ~080 C0p D0sp` R080SW 0R  @ 0S 0 0ۈP R `V a 2 yvW t0< < ; ' \@ m@ @ ,< +< ( @ 40: : : : (C 9C @ @ @ @ @UA A qQ obm,' A 7A ; MA ]A A A A A 4oA A A B B )B 8B IB B |C ' oB B &z< < < +B B B 1S#0  {pppCt#@0#0(0 0000   00 06%#  QP᥍p 81S #mK 00m?K $#04!$418!iKᛍP  p` 8! R0SR#0k#0(K 0-P0L  xp00^ r!C Kh 0 0$0108 @M 0-LMh@T0PK@HD0% 0y,, @0|yK0輪tAphPAdh00@-S* R  @ @ R R@ P ST 0T800 @ (00 000 @  p-LPM0K8A #$ ,!,,,@  PP , K$K ]`p` ,0SKp 0 AP000 0 AP000 0 APp000 d d0 APL00 0 X| p<`$Xl -L M@KcP0 0*K{ < -LMd  Q K 0K#@p 0 S 0 0 K4 j!w /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;~*/b{*/x*/u*/r*/co*/2l*/i*/f*/9c*/`*/]*/8Z*/W*/T*/Q*/N*/ K*/H*/E*/0B*/Q?*/<*/)9*/{6*/|3*/#0*/-*/)**/='*/$*/!*/"*/*/*/*/////^ */ */*/<*/*/*/T*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/4=*/*/d*/(*/$  0*/ e*/|*/ y*/fv*/s*/p*/Wm*/Kj*/+/je*/Ob*/h_*/i\*/vY*/V*/S*/ P*/M*/pP/< /!C*/@*/=*/1/ 8*/5*/I2*//*/,*/)*/&*/#*/ */*Q/*//7*/>*/ */6 */*///*/@-@r@*/ps_strings missing 0X AC_'Q P"83@T ,,     2 8؛X!!l$B\+'242 2A3N$3L3Z|3f3l3 Iw^TwLsLsw(xv(xL942% LdDD.,t 41B <|DramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oC v P 0@@{ 8  x@@ L \% c 0 @ @@V<@@ Lunblock and -DNO_CONV?$,44oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat%s %6sCan't get mount information1024-blocks1K-blocksonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-agln] [-Ghkm|-ihkm|-Pk] [-t type] [file | file_system ...] aGghiklmnPt:only one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %s Used Avail %%Cap iUsed iAvail %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %10lld %10lld %10lld %3s%% %8jd %8jd %4s%%Usage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s ????????????????????????%'*llu %*llu %s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)ifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... Q QQQQ RAQ RAB R4RHREYRZmRRRR#R R_R^RFR<R>R?R SPATH= 2^ tѰf['ZdZZs ^cZZmZZl[ [ rA p[Vn[Z v#[' b   EOF reading here (<<) document___________^&`````!`)`1`7`<`C`G`K`R`Y`___X__T!X#YjY}-+?=3 @ (b1b7b=bCbIbPbZb@X&bXXXX%b%babcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'(0Yd(1ad(1gd(8qd(0d(0d@(0d(0d@,(0dd;N   vNœ ! > ^ &f  !{>,eu{/e !ni&b_                  PPE TfA |d uX Yflj`f^ffd} \$@kf\X*nfofdtfdO xf0A{fHA lmf$f.XYWd3xf0Ľ|9 ff P fpf<hefԣf,PP4oTf?Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directoryerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcfrsuv [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dCannot continue job (%s)[%ld] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%ld] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%zu more than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchp:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Illegal number: %sCannot set mode `%s' (%s)HSabtfdscmlrpnvtoo many argumentsunlimited%-13s (-%c %-11s) unlimited error getting limit (%s)error setting limit (%s)internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeIllegal number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultIllegal option %co %s+-Illegal option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Illegal option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Illegal eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sBad file descriptorCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# PS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... illegal signal number: %sunknown signal number: %doption requires an argument -- sillegal job id: %sillegal process%s id: %sevalreturnshifttrapbgchdirletfcinputrcgetoptshashprintffdflagssetvarumaskunaliasulimitwordexpPPID20181212 BUILD:20260507173141Z SMALLNETBSD_SHELLUsage: %s format [arg ...] incomplete escape sequenceunknown escape sequence `\%c'format %s too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedmm jmmj4ommm m A m 2oPpǕm: >nT>n>\>n>w=n> p0?n|?n,@5c Ao= An\@n`A~AQ @n?n>X@n@AAZo^obofoko#jo3so#ro3zo2yo3o3o#pppp p@@ppppKoJoMpUpdplp]pp "p@)pp0p6pSo=pDp oC$ oCoC$oCkooo"o+ooo1ooooo@9o@o Ao oooo@oo onnootp{pppp p@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gTIOCGLINEDtcgetattrTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.DŽׄ-=Prׅ̅m?GO@%@U@]@d@l@u@z@@@ @@@@@17Çɇχև܇ @@!&06AHNTZbgnu3ej9t6)S-&lj͉0wˈԈۈ9t N$)-1&;?GKQ\kw%j+07>ELU\ejovÆ̆Նކ #+179t6)S-&lj͉0wˈԈۈ9t N$)-1&;?GKQ\kw9t6)S-&lj͉0wˈԈۈ9t N$)-1&;?GKQ\kwchanging %s byteorder to %sline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environment%s: unknown machine typeattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes failed to read bootarea from sector %uread sector %u len %d looking for labelno space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] *Usage: %s device %s device command [arg [...]] Available commands: rwnot %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. forcesuccessfully scanned %s. %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s Wedge dk name too long; max %zd charactersunknown command: %sstrategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s'unknown command `%c'ͨ˲&M  Ƴ   /?Vk״%;So !qW #qW $&qW 1qW 23qW 4qW 56qW 8ʵ9е9׵:; <(=@@OAcBC˶DEFGHJ3LPMaNhOxPQRSɷTҷUڷVW \a1c;dvefghipƸqqW sqW tqW uܸvqW wx#Mlyй ,Dayúں+;Wqwлػ1ɻ*=HqW qW qW qW Rj|̼޼#EEE^}ɽ7S[ܾ-XqW qW 8ӿqW qW 7Zm/%lu/%luusage: %s [-aBFfIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1Can't read %s partition table%s partition table invalid, no magic in sector %lldsecondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld decimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. realloc [n] write_disk(); wfd == -1Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Sector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsExtended partition busyExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitiongiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafiIluvA:b:c:E:r:s:w:z:bad disktypeBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s size (%lld) is not divisible by sector size (%d)DIOCGDEFLABELCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]   0wˈԈۈ9t N$)-1&;?GKQ\kwreturning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo blockUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFbadCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directory%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 Invalid long filename entry for volume label RemoveInvalid long filename entry for %s %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersInvalid long filename entry at end of directory %s No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check          @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s CLEAR (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %lu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %s** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** starting CAN'T CHECK FILE SYSTEM.Alternate super block location: %d conversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'MISSING '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%ldcg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONG (TRUNCATED)TRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****cache missed %ld of %ld (%d%%) cannot allocate quota entryffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-K07JUG 0CQdy0&؂&L&d&|&&&ȁ&&&&,&&D&d&|&&&H0wˈԈۈ9t N$)-1&;?GKQ\kwͨ˲&M  Ƴ   /?Vk״%;So !qW #qW $&qW 1qW 23qW 4qW 56qW 8ʵ9е9׵:; <(=@@OAcBC˶DEFGHJ3LPMaNhOxPQRSɷTҷUڷVW \a1c;dvefghipƸqqW sqW tqW uܸvqW wx#Mlyй ,Dayúں+;Wqwлػ1ɻ*=HqW qW qW qW Rj|̼޼#EEE^}ɽ7S[ܾ-XqW qW 8ӿqW qW 7ZmSFH0eCK&HSFU0eCQ&1Hah!IdontNeedEFI[&`&(s*K>;E j&|nQn- q+u&&|nQn- q+&&|nQn- q+&&|nQn- q+&&|nQn- q+&&=rGy=iG}&&;Mt?''mWC 3KOO'&'yD<#*=(1';'3Dh&E'M'\ M}-`'q'-чH)'-чH'ZIчH 'IчH 'IчH ''2IчHw'S'@ )Ѹ''*1@ )Ѹ(k1x )Ѹ(&(a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuidCan't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:partition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size]New size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverError reading backup GPT information at %#jxNo secondary GPT header; Run recoverNo secondary GPT table; Run recoverDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:sector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidGPT_HDRgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps)@7@F@setifnwkeysetifchansetifpowersavesetifssidsetifpowersavesleepsetifbssidsethidessidsetapbridgesetiffragsetifrtsEEEE F& F&F&FF&A0&AA * & &F&Fă&F@&M `&AM P * &E &B&3F$C$CL AA BBsetifprefixlensetifflagssetifmetricsetifmtusetifnetmasksetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandusageprintallstatusmaindo_setifpreferencedo_setifcapsJzi`&|yifff&>L&ff&P (&W &>p&MH &8Fȉ&N&tL|&Nd$&N0&N0&N!&N!& OOO+O7O COOO[O@gOsOOO O0O@OOOJ OO O@NMinit_current_mediasetmediamodesetmediaoptsetmediasetmediainstqQL |QL `QQ@QQqQL )*p media_statusmedia_constructorUQ^Q P؊&P^Q P؊& ^Q ^Q&hQ^QhQUQ&gQ^Q}P &h^Qh&paddr_matchBPKPLHQIQAP@PKsettunnelRU&RP&print_link_addressessetvlanifsetvlanS&SqS̋&SSt^SIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockSIOCGIFAFLAG_IN inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeNONEWEP40WEP104TKIPAES-CCMPAES-OCB%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211BSSID/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211CHANNELSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: BSSID too longmalformed BSSID: %sSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS CFPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM ???unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAaf_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6link0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtype [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] mediainstSIOCSIFMEDIA mode %s instance %d media: %s status: supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno networkno carrierno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctlSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@]]m]^:  ^ @     >^^^ -^] \5^H^U^k^|^^^3 ^@^^^^@_ffs  -/_4_ =_ B_ F_J_%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousautomountedextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdupzaaP ^" a\ ^-^ O\] [@aaaaaaaa bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.zaaP ^" a\ ^-^ O\] @  d[@ @^^mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %sreloadzaaP ^" a\ ^-^ O\] @  d^ @e: [@]msoftdepzaaP ^" a\ ^-^ O\][@usage: mount_kernfs [-o options] /kern mount_point "%s" is a relative path.kernfs on %szaaP ^" a\ ^-^ O\] @  [@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %szaaP ^" a\ ^-^ O\] [@kfBpGpjQp Wp@`pgpopupzp` ~p "@% nnpnnn n@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s zaaP ^" a\ ^-^ O\][@^^usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o w|||}<}v}}}}~0~W~k~~~~~Di7\%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask%s (%s)0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()P}L}H}D}@}<}8}4}0}usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%llumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYD\7c/]UPBROADCASTDEBUGLOOPBACKPOINTOPOINTRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printbitmask_scan  ,2KG,Tbt4pp"*">"N"`ll.5Nd'9>LSd((: %07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x0x%0*x0x%0*llx%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)%s: this type is unknown to this program ...(%zu more bytes)Invalid port: %sPort out of range: %s%s: !returned size wrong!%.2f %.2f %.2f hw.ncpu%d = %lluuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu 0x%llx %lld.%9.9ld %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d regcomp: %s: %sregexec: %s: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpfetch_url\sendrequestrecvrequest***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbervbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20170803malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gz\&p&D&S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: filename expected%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: extra characters after \ at the end of %c commandw commandread commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-ig/ b. `/(.4=(.N'._g&..a.%.C.B//d.. ..$ /-c.7H8.Td/a`.r?.{P......?/P// .)/5/A/  0wˈԈۈ9t N$)-1&;?GKQ\kwNAME=    B_mount_disks       !"#$%&' str_arg_substget_available_cds0wˈԈۈ9t N$)-1&;?GKQ\kw edit_fs_type_extd- XC J    |  D- , 0J c  s edit_and_check_label 0wˈԈۈ9t N$)-1&;?GKQ\kwdisklabel_freedisklabel_change_geomghxi   x  ;E j&|nQn- q+u&&|nQn- q+&&|nQn- q+&&|nQn- q+&&|nQn- q+&&=rGy=iG}&&;Mt?''mWC 3KOO'&'yD<#*=(1';'3Dh&E'M'\ M}-`'q'-чH)'-чH'ZIчH 'IчH 'IчH ''2IчHw'S'@ )Ѹ''*1@ )Ѹ(k1x )Ѹ(&(ɻ (# ;# S# лl&'b# $Ar# d|# # # # # inside_ext_partadjust_ext_partmbr_init_default_alignmentsmbr_create_new|H<Ԗ|, tH4hX8|ЍԎ( Pd܉TLȍ`Ԓ̒ܭmbr_get_generic_part_typembr_get_part_devicembr_freembr_read_from_diskwrite_mbrmbr_write_to_diskmbr_add_part/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6) [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 9.4_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksmount point (or 'none')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-9.4_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-9.4_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-9.4_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-9.4_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsSwitch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Bootable flagSafe eraseUndo changesUnconfigureEditForce umountAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionCannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (ADI_BRH)Kernel (INTERGRATOR)Kernel (IQ80310)Kernel (IQ80321)Kernel (MINI2440)Kernel (TEAMASA_NPWR)Kernel (TS7200)Kernel (RPI)Kernel (KUROBOX_PRO)There is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] [-p] where: -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -r release override release name -C bg:fg use different color scheme -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog9.4_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-9/latestftp prefix/evbarm-earm/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earm/9.4/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filesysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)%s (%s, %s)%s (%s, %s %s)-t -o disk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2 %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %d %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.craidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi/boot/dtb*.dt*./netbsd.ub./netbsd.img./bcm*.dtb%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10schpass -s %s rootsource for 3rd-party packagespasswd -l rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousdisklabel -r %sinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %spartmanlvol%.2dvg%.2ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%lliPartman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.c/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c%s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEparts->disk_size > 0parts != NULLgpt destroy %sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt %s %s -b %llu %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1138: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1100: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2100: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1743: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1773: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2067: internal errorparts->geo_sec != 0t != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2198: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI Boot***************************************************************************************************************************************************************************************************************************************usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_handle1control_handle_datacontrol_writeonedhcpcd_reportssiddhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1ďYkdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_geteloop_event_add_rweloop_event_delete_writeeloop_q_timeout_add_tveloop_q_timeout_deleteeloop_exiteloop_requeueeloop_signal_set_cbeloop_signal_maskeloop_startxsocketif_discoversplitvadd_environparse_option+9 blcdJ e E fJ gE hE i-PjkJ lP mJ n/noJ p?jqrJ sJ tFF uvJ wA xJ zwyJ AJ BJ CVC DJ EV FK GK HF I>JK K"K L*p M+K N1K O:K PGK QSTOK UYK VcK WmK XwK Z9 1K 4K 6J |~K }K K K K K K K K K K ;Y X (Y K K  H L  L $Q H L L &L 3L =L NL LL v SL [L hL ˱M nL tL |L L L BJ L default_configread_configrt_compare_proto0q0qnnrt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtpprt_buildrt_deletennsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initsa_in6_initוLP @ P P P >E YQ 6NL $K lv P make_envscript_buftoenvscript_runreason0123456789abcdefdhcp_envoptionvR R R R &S OS |S S S S T 0T YT }T T T T U ?U jU U U U V #V AV SV eV V V V V W $W \ B\ if_routeif_initrtif_ifa )( PT@P HEPT$ @DCget_leaseread_leasedhcp_openbpflog_dhcpe e e e dhcp_binde c e e v[ nc e ^ e dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_readbpfdhcp_readudpdhcp_recvmsgdhcp_dumpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1ipv6nd_rtprefipv6nd_applyraipv6nd_expireraipv6nd_handledataipv6nd_recvmsgipv6nd_handlera8w Aw Lw Uw q q \w q v ew v v v v w w $w dhcp6_checkstatusokdhcp6_validateleasedhcp6_openudpdhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrequestdhcp6_startrebinddhcp6_writeleasedhcp6_recvifdhcp6_recvdhcp6_recvmsgdhcp6_start1 '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_dump/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: connected to Access Point `%s'%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version8.1.9--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 8.1.9 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-8.1.9 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware addresseloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.cread_cb != NULL || write_cb != NULLwhen != NULLcallback != NULL%s: SO_RERROR%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption `%s' does not take an IPv4 addressinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argumentunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleteddeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinTESTSTATIC6ROUTERADVERTUNKNOWNPATH=%sinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=%sif_down=falseif_up=trueif_down=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid=%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'%s: executing `%s' %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%snd6_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtsrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_USELOOPBACK%s: SIOCGIFALIAS%s: if_addrflags6net.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6fwetapxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %sbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s: open `%s'reading standard input%s: reading lease `%s'%s: %s: truncated lease%s not foundNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: timed out contacting a DHCP server, using last lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: dhcp_open%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: %s: short frame header%s: checksum failure from %s%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired, extending lease%s: DHCP lease expiredDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired address %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %snd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_addr%zu=%s%s: delaying IPv6 router solicitation for %0.1f secondsreachable againunreachable%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.c%s: ignoring unicast option as not masterdelayingunicastingbroadcasting%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f secondstimespec_to_double(&state->RT) != 0%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: DHCPv6 DAD completed%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to request information%s: DHCPv6 lease expired%s: failed to request address%s: failed to confirm prior address%05d %s%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6DUMP6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\Bo <%$<u D<{ d<,< < <}< =$= D= d=BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  ' P} X P ` o %u { ,  } @ ģ!!!/etc/group/etc/master.passwdJPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pid !#$*0- ).+(/, '!% #34 :./, .   :       , /.       .  .  .=                               9%'A)*& , ./(&-0;51234<=>?C"DEFHGB$21678 !"#6$@8&&&&&&&&&&&"""""""""""$$$$$$$$$2222221222111\+GU9U   +: januarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresv0%llo%lld0x%llx%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME/usr/share/misc/terminfo%s/.terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist