08iί<  iίEt tiί@@<@T 08iί<  iίEt tiί@@<@T Uiίt`AiίiίiίAiίiίiίA.iίiίiίAiίiίiίAiίiίiίAiίiίiίAiίiίiίAiίiίiίAiίiίiίAiίiίiίCiίiίiίAiίiίiίAiίiίiί$ iίiίiίmCiίiίiί (08@HPX`hpx h$QiίiίiίG$\iίiίiίH$Oiίiίiί (08@HP@$QiίiίiίX`hpxF!iίiίiί aiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiίaiίiίiίaiίiίiίaiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiίaiίiίiί aiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiί!iίiίiί4!iίiίiί!iίiίiί!iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί B!iίiίiί B!iίiίiί!iίiίiί"!iίiίiί"!iίiίiί"aiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiίaiίiίiίaiίiίiίaiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiίaiίiίiί aiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί!iίiίiί!iίiίiί!iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί!iίiίiί !iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί!iίiίiί!iίiίiί!iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί!iίiίiί !iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί !iίiίiί!iίiίiί !iίiίiί!iίiίiί!iίiίiί!iίiίiί\?!iίiίiί\>!iίiίiί\=!iίiίiί\<!iίiίiί\;!iίiίiί\:!iίiίiί\9!iίiίiί\8!iίiίiί\?!iίiίiί\>!iίiίiί\=!iίiίiί\<!iίiίiί\;!iίiίiί\:!iίiίiί\9!iίiίiί\8!iίiίiί\:!iίiίiί\7!iίiίiί\6!iίiίiί\5!iίiίiί\4!iίiίiί\3!iίiίiί\2!iίiίiί\1!iίiίiί\0!iίiίiί\7!iίiίiί\6!iίiίiί\5!iίiίiί\4!iίiίiί\3!iίiίiί\2!iίiίiί\1!iίiίiί\0!iίiίiί\2!iίiίiί\/!iίiίiί\.!iίiίiί\-!iίiίiί\,!iίiίiί\+!iίiίiί\*!iίiίiί\)!iίiίiί\(!iίiίiί\/!iίiίiί\.!iίiίiί\-!iίiίiί\,!iίiίiί\+!iίiίiί\*!iίiίiί\)!iίiίiί\(!iίiίiί\*!iίiίiί\'!iίiίiί\&!iίiίiί\%!iίiίiί\$!iίiίiί\#!iίiίiί\"!iίiίiί\!!iίiίiί\ !iίiίiί\'!iίiίiί\&!iίiίiί\%!iίiίiί\$!iίiίiί\#!iίiίiί\"!iίiίiί\!!iίiίiί\ !iίiίiί\"!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\ !iίiίiί\ !iίiίiί\ !iίiίiί\ !iίiίiί\ !iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\ !iίiίiί\ !iίiίiί\ !iίiίiί\ !iίiίiί\ !iίiίiί\!iίiίiί\ !iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί\!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί!iίiίiί!iίiίiί!iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί!iίiίiί !iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί !iίiίiί!iίiίiί !iίiίiί!iίiίiί!iίiίiί!$iίiίiί4!iίiίiί!iίiίiί!iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί !iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiί!iίiίiίaiίiίiίaiίiίiί!iίiίiί!iίiίiί!iίiίiίaiίiίiί aiίiίiίaiίiίiί aiίiίiίaiίiίiίaiίiίiίaiίiίiί\?aiίiίiί\>aiίiίiί\=aiίiίiί\<aiίiίiί\;aiίiίiί\:aiίiίiί\9aiίiίiί\8aiίiίiί\?aiίiίiί\>aiίiίiί\=aiίiίiί\<aiίiίiί\;aiίiίiί\:aiίiίiί\9aiίiίiί\8aiίiίiί\:aiίiίiί\7aiίiίiί\6aiίiίiί\5aiίiίiί\4aiίiίiί\3aiίiίiί\2aiίiίiί\1aiίiίiί\0aiίiίiί\7aiίiίiί\6aiίiίiί\5aiίiίiί\4aiίiίiί\3aiίiίiί\2aiίiίiί\1aiίiίiί\0aiίiίiί\2aiίiίiί\/aiίiίiί\.aiίiίiί\-aiίiίiί\,aiίiίiί\+aiίiίiί\*aiίiίiί\)aiίiίiί\(aiίiίiί\/aiίiίiί\.aiίiίiί\-aiίiίiί\,aiίiίiί\+aiίiίiί\*aiίiίiί\)aiίiίiί\(aiίiίiί\*aiίiίiί\'aiίiίiί\&aiίiίiί\%aiίiίiί\$aiίiίiί\#aiίiίiί\"aiίiίiί\!aiίiίiί\ aiίiίiί\'aiίiίiί\&aiίiίiί\%aiίiίiί\$aiίiίiί\#aiίiίiί\"aiίiίiί\!aiίiίiί\ aiίiίiί\"aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\ aiίiίiί\ aiίiίiί\ aiίiίiί\ aiίiίiί\ aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\ aiίiίiί\ aiίiίiί\ aiίiίiί\ aiίiίiί\ aiίiίiί\aiίiίiί\ aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\aiίiίiί\! iίiίiίi!iίiίiί!iίiίiί!iίiίiί aiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiίaiίiίiίaiίiίiίaiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiί aiίiίiίaiίiίiί aiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiί!iίiίiί!iίiίiίaiίiίiίaiίiίiί!iίiίiί!iίiίiί!iίiίiί B!iίiίiί B!iίiίiί!iίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiίaiίiίiί!iίiίiί!iίiίiίaiίiίiί aiίiίiίaiίiίiί aiίiίiίaiίiίiίaiίiίiίiίiίiίbpf!iίiίiί $iίiίiί$iίiίiί$iίiίiί$siίiίiί$iίiίiί$iίiίiίAiίiίiίmiίiίiί$2iίiίiί $iίiίiίAiίiίiίAiίiίiίAiίiίiίAiίiίiίAiίiίiίAiίiίiίAiίiίiίAiίiίiίAiίiίiίAiίiίiί'!\nGZO&kxg;ySHC2H=m\5 NIA6S| 9_2HR{/Fz@rk﹌q xVP077=}v?>&_k_GmvgRғ3h\O! &| XDUh\JS8s(~$!٣h-Cn?k^~Tl0.۲C?E/RYlV G\%b!t'9w\Yk$Q07:B8LL~*O앟"y2co ./s?y/\h6;b7n_4rb78R\GR[|)ef/?h}P'v0u^"/|]LON~(Nzz޲=V\}>ynDmg8hbs,f#O+bQW9D-abST:q|569(t . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.2.102.1 2020/01/28 10:20:24 msaitoh Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=vt100 export TERM HOME=/ export HOME umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? echo '' # mount the ramdisk read write mount -u $ROOTDEV / # mount the kern_fs so that we can examine the dmesg state mount -t kernfs /kern /kern # run the installation or upgrade script. sysinst || stty sane fi  . .. catchmod cp dd df ed ln lsmkdir mv pax pwd rmrmdir shsttysyncchgrpELF(4D4 (ѰѰx L8NetBSD5 NetBSDearmv7hfeb9L H D00-0 LS0(PPP@CP03/T0\,t pp0 -L@0T( R@ppGppP`03/T0@S PQt -L MK \!X1 PR`00: 81 0S  /S 0SP ijB00S5 0 0S*ppp@Cp03/Th 0 0S*ppp@Cp03/W * gL d0 00T0  0 CD~t$Xt0%JIHLNLT 0I  85xG=DO-1F =FT,AF0F4$/)j(18@B۹ Kn:f*oB² *IQ{mQeppGP-O'PNFXO TFkh;k`+(F%&AFл J3h3 ,-ѸTOsh+>гh ,$7QF0FP2FX5h+?%h#@c`.3Сh0FP&0 &I%&H O?$K9p59F0FP0.5h-+#I%Ht!HPF(ѡhHPI%Hb HP0!FHx(%0+.(F  ̄ K-OhFHPI PF IH*$ F5FjPAF KX`h+KhKh{Kh O +@Kh+8МMJI(Fch;c`+ F$Fd(F (0% Y-8FPO UKhFB)F8FL/I:H28FP0,@(FP*pC Oq1KhY "I#H8FPh@a"@b`HPxh@aH"@bPCFY$f#$Br#0## ,ѝ,K$ZFIF(FPhE%IH ̈   x ̠ ̤ ̘ ̌ 8 ̜ ! |P p# Br#0## O2IF8FPf ܶ #"#@4)F0F$0h@oKihB (FP8бI$Hp(FPn I$Hh0+?91F H~($02jB K(FhhC @P( ̀   ̐m p0MF F@2iFjPC!jH, M0# 05 HP I H IhFPBFiFHKh(РmJ G  T _ ̜FIHPf( I H hHP>FIHKh( F@  T k ̜FIHP>( I H h #HPFIHKh( F@  T v ̜ 6IFFHD  KXbpG KXbpG  I"\ I"r I" I" hhP4O3oBF##"HBK]" ̸O3oBF##"H*K ]" O3oBF##"HK ]" O3"F##"HK]" `O3"F##"HKK]  O3"F##"HK`F2]"$O3oBF##"HKQ ]" X KFh[ O3"H##"K] #  KFh[ O3"H##"pK] # CIOs-C"AL#F@I@O8#V_ #h]1FoHOx(xFYhKlIZj 5h+cKgIZjO OQ%bO# B [FRF#WK#1X #FFJ# OJ"#OINDHO# B [FRF##BEKE-#xBCE#Bx8O#`FF#BB3#=#Bx# B [FRF##BEKE;jիh+yj#$H`@;j[zj!Ib# bQ{h F8hY.h;hD{`K#SIEgyF1C"I OP  ̨ $T$x  p$$`-CrLQ"oI O(#C"kI O !O Ozu )FvpcLf&)F Fx6lvpf&d!;Frh W#'&#######JJ4 3t F O #S*CICH+#BJF d! 3X F O#S*5I5H+#5JF d! 3< F O #S*'I'H+#(JF d! 3 F OTOzs2F;F1Ozs"9F0F3"9F0FOzs3JT d! 3 F OR' ̸d p%Bc3i%n%%%F F OX-G+N2j7F5 cC12$ Dkj jG0? rjI |O hNk*F9hj[jG(;j-i< 3h+;3` I 0[ պyjHFTO zj  $% -C8M*j,F XC2 Dkj jG0?jj+I K"k &IijG(ki!h[jjG( 7F #BBbj#0k%IijG0M # FBBi(F!hOF#FFFBB'&  m)FpOO 2KF F!!!FHL+&F!F I 4%9F@35B &pF L%h=U!`h0 "0F2V(`h@ p -KF-O Fh FahQhAi! OOh@ %,F 03Y03Y X01h@c@F2B5TE(F hF26AF DZ"A @&(@iF GK-ABF DK"DM`#FBB?K"h ( 4(hz9IF9H~9H8K%ihFB9@B4N,F4DXh3h!F33`(4hV'IF'HZ*Hp3h;3`+'Kh  3h@;3`+KhԛK*F!xhh~(ۅB 4h! IF H$H#YOBpxhCUv а *F $W *\ J#FBhBS33BHoF а~N,M,I-J.hs+`hB**L$hgh'B ``.`.=#Kh4 $h3'K'`[h`B/``[h<'c h'B/``dh;'L#F``B p$h3' >h $ $   а8FM(hJh#`h\`h`3`+h``3+`8 Ӡ -CF TF4F#xg +ѤoCB7Hi(FL 4h>2IF2HB2HX ້[3Xh IF HHo0F< K "hU"K`&FW   +O l $-OFPMFOO+hMK#+`;`KKhF IJ$IN#F0EU,SкP+M>I>H;h+R*h*OE`4Q"$*`I6K2hh22`3h;3`31Kh o s2h:2`*$JhԒDFhFF(+h+E;hZIH,E*hC ;`h*`$4 F,ѝ   l Ӡ $+f +xFxF!+"I0`F3\h"FIFHHo-]I1F#x(F!+x38h"F IF H H" Kh#:F IHKh(++ P+ ӠOF FB ;h)F |(3hLIFHPHfo6 l+-OFFF FT KhF Kx$tt%h+8F$B4 F# 3iB   "T3F8F( 56hDEE0FWF(o l   -AFxFFF!+%I0F3~h*F IF HHo/~1F:F!F+x0F!+x3Xh*F IF H H" Kh#BF IH <4 F0F"?Fk lBK۵FOFOxD;hAF3;`"P3hP`  $W + -OFFFF'H%'DB 605BI%H2 x ^+\ &x1FH/VX 5\(4 500 x00 x00 x,0p,#%,,#J8Ih# `jFNh( ۽0+;J`0+;JS`] @th$ Kh J K ``hhB*JhBH)o  ( ~N-OMF,h|O O;hB%4$ FF@F0+ #"#FYF0F>P F,̿4 0 ,B Kh30Ka8S @LHaoT 0,>-OwJxOhFwJFh1xL0@d )!СX6`+,a3',BɀgJhZEړ9,0,.,/,)/YBYA d*hxB&2*`#?,^,.;,)0;,*`NJ0#;h`IK2*`-,^,RBD!*hx-, ж%,С ,$,Z ,2*`*h 1Cռ @3L"IF` "(hAF913<h"))Ho XFb1 Q-,^, O2"O2 H3# "IF`(hBF:23 h"*).,*`)Г+`Px ڼO;T Ӡ  (,U~N -A#LOM#`N;hp+`3`( #h3#`+h(`3`0x,* ;* "h*F#*#`+h 3` Z x;+8`Bу o  Ӡ ( K! FhF M`,U$pBE$`2! , 08F Fp3thIFHH F8##+iaW݁B <\+9@  KZh mN8h"!`3hSIH($H/F1(F 0wF9Fc I F,/*/"bU"Zp63h"I F}  K"`h;`+f hRTѽ&RF9F u8h;`+=o0)F B̿j2Fb(PFg0BF18F_F(F[F;h 3`;hB^`00Կ#0ȿpȿ3DK`#h q (F-F8F)F  (  Ӡ  -OF3N0h2K2Jh3hF`BF ܥB -6+L'.E,%hHF3`Fxh;`+6#h . r@߱#0h;`##hԛ6.F%0F 8FFF( o ( Ӡ  -G F)MF FF h.F3`xh;`+;+h 3 M7+hB̿` yF8FuKhFIFh+h4K",`` K`h;`S0hѽo    Ӡ -OFbKFbL&hB̿H 4F@F0FUE+ZMsh,FB{۶7FhOw7D(i3`9F(_2hMIFMHLHh;`+@+h+(F:F({/ihB5ݳwh i9F2`2jh6IF6H5Hh;`+V#h N ahp;`##hԘ iYF*i0D0+i-hDhp;`#+hԚJIF#i@FS(!M3 i+`h3`(*h F(K"`h;`S hѽo  Wd Ӡ -AF)Lci&F+ siiX)FJB;+D",(FxhiAF2`F2hIFH"H8h;`+#h m h;`+#hԛ:x\*zx7+*7 W-O#Mi,F +jH!NF0` ojjB6۫hj3`@BF7D9F2`hIFHHh;`++h  Wh p;`#+hԝԣj%!"p2hx +5{O B@Bh.F6D8h3`1F;(8Уh`;8``##hԚ*Fj8h0;hiJ`"ZU!XBXA!+J%+ǀbjoB2۵FhO{  Dj3`YF2h/OIFOH2NHIh;`+Q#hyh ;`3#h?r?t3hjxSU3hY1`x\)љ1`[xU=FxBE'bjB@Bh/F7Dj3`9F(Уh p;`3#h???A3hoZ2`xjZU0 [x %HpgjBݳwhj9F2`(Уh p;`3#h??0j3D / DB3`++ ,u W  $+! Ӝ,0 HH6F1cjEݸDxhjAF2`0(?-h ;`3#h??j8F+D++GQ*Ѣ, HKh1B @hC`  KFix!+I1 /! F. H>  p,uHM+hx +5FKh+hxP1@ *AH 3+` *!3(` x!+0(`(4L h0 h/H/L,q&F/4wh09F3`2nh%IF%H%Hh;`+#h  dh,q;0`##hԛ0#+hx ,# p](0Y)`QxT T, , W-CKHhFhFKf2`v ,%)`xh.BQ.a(E.!.$=. .ѪK `KhD#(K"hFr`H.ʂP.G.8Hc. W.a.܀V.e.~Ef.g.q.Ll.,$j.N@Ƃ0h*`_x($*hSxn.p. l. +`x +@9Frn.~/p.wKhF(")hKxn(p(l(+` x +@Bu.~Cs.J@dKhF(_NaLv(^Kh+'h/`ZKhB[$*hSxn)Ip)>l)@+`x +MNKh c8F[w.Xx.Ѕz.D>K `>KhDL(H+hx1;+Յ2& "3I;L`(hl `@80@ą2h"+@3Hh&`&$*hSxn)p) l) +`x + *HUD+`DD Kh Kh(rooN1hF($*hSxn)5p),l).+`x +Kh KhKh~(0hT Ӡ (-   $,U,D+`DDN1hF($*hSxn)&p)l)+`x +љKh KhKh8(ەJ3hhB33` FD+`DDI h)I4)𢅉I h)݈HX[x320\ԅHPrF(?c$*hSxn)4p)+l)-+`x +;uK h(LK(E(o3x3!+"1FnH/3xgN,0[jHD+`DD,6!0F}(YK"`O3^J`^J`VI h)[x320XF(?x!+TH$*hSxn(p(l(+`x +Ԯ x"FH/jDHSD+`DD3O<@1D#@1&NhDq3` cFh;`+߫3h X֫ DB ( D#DqH1h;`#3hԙ< O@1:h#!I4(    (  H +5-a,U XC@1@1@1A@1# @1+hxn*6p*&l*-ЦKhFn(j$*hSxn)0p)'l))+`x +B;h X)<`K``K`*hSxn)Ap)8l):+`x +YM, B;x!+"9F,/D;x+,0+?POLKMJOHPIhW.Fh8F(0BIK" (D+`DDh+?41+q1Kh+?+hYxn* p* l*)`x +Z0HX)`")hKxn(p(l(+` x +FKIh&K hhDBFB+`BB$*hSxn)p)l)+`x +" Kh KhHXD+`DDK Ӡ   (  HF(: M0 KhӹK$1F0`Kh@'J000A F0(1Xh IF H H0AF +5 p. d hWlJ-OhFkLY`Yx%)@ĀxQE@!h3`cH h  # : ` 2YJh񗀑2hQ1`!hxYD *,32hx)@:2`NKhB"@BD.F6D h01F30(QBK ``0;0+=Kh^ԛ+x&+_   B  #F FE9hD5eNRrF3h33`0~h]IF]H\H3h;3`+o FSKh  o3h ;3`+HKhԙ\T3\+Ukx 1)O0;BK ^h B 6#FFE9h2UF0MRrF+h3+`:0hg(IF(Hj'H+h;+`+h ;+`+KhԝՔ\T3FB@BM&F6D+h1F3+`(+h`;8`+`; Kh?m?o UF;hU45 Ӹ Ӱ $ W Ӭ Ӵ-O}FF F#co Kh# #"!i#i"XF# \F0O PF }FN`Kh5B@3 ECT0h 2 r F 0^hIFHH : *рKh  QvK0`` : *uKhԙ0+# " F0h!F8D.0BF F0n #D!x! C #"!F XF(?{DUJ h  ETFOy  0D30FKIFh(b0h)AIFAH,@HC0;0+?x4 E59K0hh 2`rF 0h(IF(H(Hh:`G!I0` `h:`:!Kh?B?D0+# "IF F0hJF!F8DGF.N]`0;0;Kh? ?"- #C H  Ӭ ӴW  $. Kh+# ")F F0h*F!F8D.J3h# + d-ODLOFBJFBM&hhF;#`@K hSE &`ca:H} h0 `{:FFC o>!hF(,Jh +hO 3+`0FF+h;+`+#Kh  "hF?B+h;+`+KhԚ&h  XFFF(:F1F0FF( Ӡ $ (,5 Ӭ YJ-OhFWLWKhF!h1ch3SHo PO;hPK"`ON 3h33`S 'F<-; "o   ;wB  U?Kh s#h0#`ch0c`h;`+X5KhM  X) .Qh ` Q` FZXZPBhQh `Q`h h :D`Qhh``q`hHh`P` =?i c Ӡ% .4 Ф $  -C 'M.F+hihZPF J#3`Kh`JhZ`S : ;(њh\h1`DE F FLF Ф Ӡ% -GF"MFFC.F*hBd3 ! F`YCF3h %t`HFkC D4D8F``Cb2`4 F0ZhIFHHhhD ФWIFFH .DK-OFh]F FFYhJK)FGH)FH ]pCO0#`oOb)F .oC0?# FK<(pCOгhS FK(pCO3hkh[+x/+3(FKH)F FKF(@3h+@!F(F/(8"F)F~H F(#FyJOavHovOb!F .X F(OakJ `, `K()FeH/!(F(XG/! F(SAF8F/쨻 o0ڨ o+ڽB W@O8S;*8FKFDE?O8S; x8F zAFK|逹*Z#BB.#ZBB?}3iC%si F+dpCO^K&(x!F /FFZF)F8F. 0RF!F8F. i+]йZX@F,"F$IXX{h;{`+8FF@F (0( YIHXX-`)h`ORKOBXOIO'OC3`Y +O S8%$ Ԙ!)p!\0%0!\43p%833%A!@ ԰33@8m!(!%PKFBFYFPF,yH8C'3`-2hK Or-?s-" N Kh/;FYFPF,CK7``c%P!!( KMi+ Lch+OBiFhH(`` M Ԙ%$#LcbKi #"#h+) FFr . Jh O0h(%$ Ԙ4 Ki* I O0h(K JIhh Ԙ4(!p!4ZFFF$*F1F8FHP(-D-D F,FFFF$*F1F8FH(-D-D F,F FKF\hF,M9Fh+i+HJ#k`hB`+` FH #k`t`D-~j Jh j FI%$ Ԙ!44FMMlh.F, FFhBFHO#kb{` F(h`#k`;i++7,R#sb(+#"#h+)p `rh($t`#{`0-h+$t`-hE+-h+(- h + I $l`-h+-h+-h+sj#,I ,Ѳj FI-jJh ^ KhYi F! I vI%$ Ԙ45459![5\55K𵅰 * 3LbhB2Jh:*1I O0SXh"`i*D**@!8"a`Z`ch+;%I h"IH (#c``!Y`B ݊BOv#%"h+)p7F;F2F,hf+)pOv"Z` Ic  Ԙ%$)p55m6#)O-O FpFFO# $IHhF(9)!+)FvF*kD9"Bp FF$+)Fz - Jh wO0j0+%$6W Ԙ-AFALF`h%F(L?Ki+K+)vm;I )vd#O"h+V)p -0Jh@F0O0``!Fb+rڣj+'I#"!h+2)p4- Jh  O0h`K/`vF9F0F,CII#h0H(-`Jh # k`%$ Ԙ6667!3m7)K-O]LhFF X *F |ILV#[bFFZ F#"F#sKhF*:0+Ҁ쑀!0F##kJ,iKCFV,,pCFeJOq8FbJ3FOQ-@^J^I Fh< ]0ӱWK!0F##MJjSJOQ `패,댩F H0+IK V, GKAF3F,3FCF?JH903PH#y/+ 8PH+PIFH&N F%JKh+ FE(;hKFJ+hKFBF F5BJ Fh3`G 3H6H:K"`;hC6N3h+3Kh#3` F&L+h F[lGF F;hS(Kh:%Jh.+h[kG" I GKh zb )p K)p((![!D!\8!!@!<!\<!\=!d!L!!8!!!!tHOa Lp\H, Jh `O0p+ P=GCFн@ֿ,Jh ? F=$FG0,#FJh ,@=8pFGCF,h+ ++,iFh0FG0pCO ,~` F&p+N+$-K( CM+hlG(+hjG( >L 0YFF8(Q ++hIB FlG(1K#K F(2? F(: FR('! F(!#y/+ 8H+IFH%K2F F;FKd0[,Jh +hjG"I GP I#K(![!\8!!\<!\=P=M!!-O( /O;hlG(;hjG(( Kh[KhG,Jh &Kh˹LV 6};hjG"I G| (ڶM)h +;hIB FlG(U#H F(zKS# F(vKhKuHG UU#0oKh۱lHG찹kK h #BpeK#Br FI(! F( F+XK##y/+ 8OH+RIFH%X0NKhGHG:0+jHKh;#Bp ?K#Brx0S0+?Z0+?S;Kh#0J8HG8(02KhKS#Br*K#Br+S#'Kh+ +;+  F&( F% F"FF8(8,0Jh "f!T==>!D!\8!,!>8!!!!L!\<!8!!0!<!@!!!tH! F iF F+ZF FYF( FiF FI8KLM#`+hKh[h+`*hOIOC MO0OsIK`K`KhF( K "h! +hD28( d T!(![>Y>!%P!\0! KL#`Kh+KhOIOC O0OsIKh( J #h!hD3 K ( d T)p!(>>!\0!!0KJ`OCJ`J`pG T d%P!TK-OFFPI NHOJPhFh0`(O9pGM@2FFq#FF*3FKC02DBrF FFFF#}(V#Y0b) F pDB20B00F](60Z D00 Ig0#Kbg!(K"`HFa(0D02 I c!4?!!( T!0! )p?H%P-C&Lch;&Kh+%I O0&((K! N%OO O!h0h(3hI`Ds`#Bt Ebh*5B I q(%(%P)p?z!0 T? FIh`FFF T-OBCFFXXKh۰RQBR[F# 14% #"*4_Kh+6%HFF(B./ؿOw "!  TKPFhTKhF lPK#Br,ZFaFHFkXE0#Br#4PFF(+AX?Jh(FO5+ 3F:JOwh  vZF aFHF('+A.JXh pO54BA j)p1FHF9(O5(F[#BBAIX3F PFF:( +AXJh 2D#BBA3FXI!%P T3??@"@I@[-ALhsOlN9h h#hI`+Dc`#_Bvg(F0#`3(#"#K"O5`% T%P!0!4![-sO#FF"#Y p7N$FBpKFFD``Q-KhOz#FRF* FjFFDPFYF(O0#j H L @zF)p ^F)pQYE[Fp RF FhF Dj ` T!!0-CFO FF. @ ( -(ܭ-ؿF(FB0FFFAFHF)|6D` T-OX OJ(FF(9(,ؿOtO @N#"#z@((QFEGz(FYF Fh"(-;+Kh0/+F;F(JOth @D!Jhhq!B` jzD!`[  BCXKE:FI , -J)p9F(Fjz#CO0 T!d?@-OFFK,)p($'@N0htBC#D BxKFBF#3hF"Fqh)F#D`0B"#Bp,I #"#('K"O7`%K!JhhB#DS`'8F,`(#-D 3hBx*FF)XF+D`KhYi)(FH)#"#<(02hBDr`܂! T@!4%P![! 8 Lh#hB eh!*+K`h8@P8 T%P-AFN FO- @ (8h7(ۨBhAF(FFFFD)-F#D`O0 T%P-CFdF`/v ((Bv0FO=F4FF*F+NfF+D0O0 T%P-G̰SFQFF 1"hFE)( +AX6Jh 6ܠܐ-t U1A.IX N@( (O0ELFBt8F)F FF("0-dtD0&8FF(+lAXJ6#BBA IX+VAXJh E !3@A@ T%P8F)BCX%E(+.+FJh BE`YFN(+cYJh BE`YpJ#cQ`8A<A_!8pF0FiFFH( KhݹS#BBT# BB 2FI (F&p%%! Ap0 FFiFF( '0Kh۹pCOI F* FF(-+ J#Fh /O0 FF(Kh'L+#FJ! `A!LA_pF4V2#!%M*h$Kh FF`+hK#Ozq#cKhK#Ozq#ViF FFn`+ThN++P#FJh .p+F#F Jh .iF FE0))AApF FFF p2F)F FE>(Kh'+#FJh O0!LB FE(hKh'+#FJ@h y!LB-OFxF/+F0O6(F/'O /!&F(DЀiF(FF`'p@(F&0/##piF(FF舻p@@O0%0#JFAF(F!(FF(iF(FF` (FAq#jFa(F`'p&.'O0!h-GFh#x/+ 2M(h("1I#+`O09 "@AGF0BFQH+^#h$J3h !M+h &&D(`!h'JF0h;F10h(+<0SS8FhBkh@B j(A@B `P0Pkhj(| K!Hh)FXki"Z`8BC"PBC"BC" APO@bD(*khJjhV#  BC"$![t!E'EEEaE}!p8!E-CFhF#g #  F6EO@x FJJ pЃEE:K-AhF S6IBF F F&U 5hS 3 #!i!F(j&K&I/F(F# Fs#idBCX;+j FKѲ3 C "IRCF I FLBCX*  BI# FI<+ B I!F !+EEEES 3F#;B(CX.#HE7F FC&Rp!x 0?"hF")FhF)F FDFB3x\ (*O +0 ,08B#FA,78a,W808B+0, -0H%FU D-C;FO ,D/ѓB[ O0 0 ; -O04W4\pOD tFF\ 0! O04IODKtFF\ ГBBO O O0-KFBMx !FxF\ )>*GFO O B+0:Բ,OOD\t D{KlC?O O9_oHBaFXFEEWO $DdO % A @ B#F F*O O O O +0 , O O Dt D{BA,O O Dt D @{a:Բ,O O Dt D @{OhKmJ;WK5YKh[K5jK/jKpTKhkfK##fJ|&eIeKL"6cK`NKh(@I+@H h(@_ZK+"YJ`ܐ# h(8fK"`#CC6#C31L"0@L=\KL# v[K` #C3  VI1VIVH #UIRH pL#RIOH jNIPHe=KOJ;OK"`#C#ԐmIK)FFgv DI@"@QOr?I#C#}I V{K"sxJ`#Cc.wKh(#Cc"qKh8(#CSlK"`#CSiK"`#CCfK"`#CCcK"`#B`J``KYKh_K+^K^J(^K(o#0I#g"WK@@.?#0B#.#(?##"0HK"1F@8F$\ 0Z "p g&07W+9K9J`9N>+?R# 0N3hB"T#FU(ܭ3h33`'KhB&I =%KT%`(6!T#C(3h33`3hBK"`G 0 !`L9!\ (!!\!!)x!!\44!|.![(,L!T%TKhh`pG![8KhK ILhMh!8 KHh(@$#!F(F X58![![LM !pNF F":`xD**9 )xB1%?*.x)[*+"!!F4x](6Ѭ! L E М+x !I h)O0/+=`+.5 F+Cx*++)F5 x+#:F F(?(Б-ё о]ІBvEؿ"B"!(p hxD/.5FF(@o 3F IsO0p`)FB;1DB (p    N-KF Mh+H+L+N,O(Fw F0F8F@A(8#I'6!H'@oH03H M.+ѝ@$H F.H)h0Fr@BF0F&(`O0!pNNOO2pO;O]O|OO-O]uK0 E LjFFF @@BFh&v2'.'si}# ")F0n(w 'FB@BYF@F&`4[FBF IH D4![OOPP1-CFMx"JI ,F7F;x*FFIo\+77B F(>"1F:p@FFOcjFAF +FjF6I FO60+xx;pF;x3@F F\+77*xBO 0 `8@F F!I:F?SaKhr`\`0F MS+!G+P+@F F+xI*F;p cp+s+ g+ciCcaciCciCZhaP;PPPT![P-AFFFx;I 4O0 kF I`%E`0F' K``hDh(F`TaPQ![ K M N Oh#"i 9F "h)F0F @#di![Q32KpFh*SBADX,N.I h!i%A!a(FpB)Ih0ahBAqX) 3BQi6` F BC"Pp0X ``I ch /"p#c`O5ch/"p#c`%h(F'p`8+\/+#+TO#aBC`P% F)I ![!<!(Q]QzBC"pFPKh#i.hy/+di,Kh@ Kh+KhO0p 1F h&( KBFQh+(FZ(# Q"1F h;![!$!<F\KFh[y.+Cy.+уy/+лVI0F쐹3FxY*,.*,.* - F`#x ax0;09D+DsaxRx !0;#1;3a#x !bx40;0:#`#x !bx40;0:#`#x !bx0F0;0:#s` @0O0 !x %cx"090;3d!YClqqaxx0;08 Dd3"FTF?L'hBO0![TEK-OF_h/YBCX+IB8CX+CS@ E(F'*W!F\F F#BB#BB.  3Fȱ0VE##:G) "@F!I O0@B @%nBCX* "P0;0+ 00@F ![T-CF K\hB8CX+,BCX+';+$S@ HF&T!@U 5#iEEg#BB F)ѽ` h FC![K-A\h&T4'V_]7`(h(FEF-ѦBѽ![8Lh!LGP`8I 1O4 F8JKh S BB M(hdK`CF'+h Jh (hB"$![U!XU2!P)U@ Lh !@ `( IO0![Ud L#h !@=m `( IO0![UP" 03@ @B-OFbM+h+VT06FOO 4 @EIEPCO O "YFPFF(Ph)C @ Z "QFHF(#@ @BBb"(][ X (S## 0a 44J#"O ##JESE? i#  E#EKF#["Fر#EE#C Ph#"### 0a I :I  ##![UV Li !@=wa( IO0![V9-CNiñ%O F@Gi\Yd# hj5B![-OFF4g444"Ki@=8F&T! FRFBB@EIEВj*0 Fر#g##(#D%XFI OV![Vo-CFKFFFiԱ@=HF&RT!@#jBEKE#BB( FO0Ѓ` hd Fa ![ pGF!KMFFh{x/+ iF8*FI  MF( 4Fh*FI , F M@.(F `(s`## ##07Kiab`![VV![-AMNOilcha3h cjh h;h0[#! h Kh!j hL h Fi![!))|)@)ȿ@FĿ@! %FFBC#D !BDF&pF6DOK-OFhMF-BFLGRWk1F8FU PFM(O +hB0Эi- `F(s#"#%)p_2F9F4BLT.`##0S) aC)P 8#%z#BB '!Jh RO0 2FB'J2F9F%\(T#gBr g M' Jh #(F'JI ![VWWW;WZ),K-GFhF>*I0F$ F@"V F6 F(8PFF `x8F``8F)@h-)hPF&bF(nh8F1F&Z(0F8Fh`( I O4IEF(F FI![W|WWF KFFh@" hT @T!h(F&$0:Fah(F%0`h![-A'FWF/@,3FO,,O lTl%TBWO0 $T#<$Tl039OCGs/FFX0#B9O00FFOpB DB0[(DDK@,-A]\FO\ * F4J.&h#B"  x/+0kF.J@    (?O0 ]KY*, ` @1?, ` F7 FkFJ@   l(kFJ@   ^(ڿkF J@   OTWWWX F F I% X FhFF*F9e-1F@(e"B$F hR"(F"`:`Oa ܻKhOa pGOq!\K0$`D_B  hH`Hh 1``h(̿  0O0!\!|8F'x+"I$PJйhc!` F8I"FOqF(F$O4#`O4N)XA-ANOtZFȱ%h1F(F&dh 9F F&x#F*FI | K J I vO00;+#F*FIK"Z`XxJXXX!\)p-KFFOq0F(O0BB! F&A PB8C"P0K;BlK@AkJ iJ@AhK ` @ "dFB(H"FW7 DlrB@BBC IMP$ K - B"``,"hhF2a ]026!\-KFh}c-ݹKhc- d=5D*xk*/* ѫ+kKh+; ! FF.5FOrW!&87BOO# ШF#";1F e$*/#+pEFd")F$"BCXZ * &&|I2F %g5#"0!# #E(?AHX'F(F }U+Ohh 3#4# 0 U#F AwHXih#uM ]5ɲ)C( #"! (lKh !1cKh+B 1B(C%X# (A]HX6#"0!# #(AUHX+2#d" A 0$OK"i# #F(AIHXr + K#1# +"-L#0AKiPBF"F! 00 @Bp2FFS0#B9BA/IX& +@O 7#0#0S `@ ##0 02)B@r0FFQ0"BJ)BK1NB%(F=!`!nFX FFX"FI% VO,!F@F  8hCh;C`+ :hhY` "phZ`# F;o%Oj<+hj2+d-C|K}N}Mh4h}H!F#F+ 7" F$`uKxj\ Z[x\#FnH 3`eK'FhgK`?\=h*F!F#z0 7`+*-!*} * *FSHM *M * F(* %*o&*cx F&+O F 7)*4** ]+x=+/ 0+F+=*0/*S ,*^-*bx-*/ F( :*R<*cx F<+=+S ^*D>*!?*% |*#~*$ # ]5`xh3` F F     cx F=+#>+ cx F|+ F cx F=+ F  bx+* F'  & ) " F F %FF T!XcN!T!HjQ!PjKshM.h+` XK.`~0FH1"xK*F%"` F$L FF%hx%h3IxJR\ HL3)F Fp!P!H*dj4cNj-HFFFg- lycu} @P.6; HH1TWFHOs?@H ,;F2FaFXF$FF$ FF  2D Fb?  @ 2C,*C ?  ,XBCX+C"AErO#FgEvO#FgEvErBOE#FBO E#F 2@ r@G 2Ckk'k8-OFF$|0%+ FF.T G9Fz0&+FFH1K##F ;FG1FF@FUTFMFF F)F FkE!H!"K𵍰#FF#,F F;F2F FF)F F (Р +9F FF/. EF F FFE!J " !Hx8 FLch)+8])F!(-OFFFFx(C(;cH&(bK(##:CF1FF8FFF $(h"(FF0#+FF QH0'+*zMHYFPF IKZ`;'+%'/O0 O1! @ #8J! r"0h 2hFFp*K##CF1FF8Fq `@ ##CF1FF8F`O P O FK##CF1FF8FJo o  N0h'-O4$O5% D k|!HkSka!x-OFFF'Oe#a#F[+FF F@+F F/ػ<E#"F@F FESFJF0FF F+;FF<&FB`FF --]x!H!-AFFKZh.F FF# FFsh+K##FT9F HCFF0FU P$$%F)F F$!!H-AFFK[h+ FFK##FT1FHCFF8FA@CO%%F)F F!!H𵇰NFF(F7`L! 툱CxI+уxN+(F$40 ! (<4` KL`%`v! chFF# H0209F0F!T!X!k(-GY(Lh=,O+JO +N;hh2`!x 2h:Q2`*ۃ*2` "xFp3F"xFCpUFLF=C*Z8hFK FhtF F H*F F U  BL*\*T!!H + Kh@F"F/))`!`!`F̰ Lx/+iFH?0& F?0&#BB*#BB `pFOt F!FF H(FyK`(Fp@(F$h"+dF$zhFH6p!kpF L"hr Kha H`!2F 0FE `p(Fp@!)k-OFA~N 3hk}M(h{L #h3#`3h+`#3`#h;#`#uKh 4h\")hqH "1hpH  !FmH j F(FjO#0hK)F`gJgK Kh3 K60 F! H !l!h!*dKh "` !RK` !FS[$)Fh FF FF$2F)Fh FFO0R FFO0 FSK$!Fh@pG8 FF$*F!F8@hO0R]pG FFO0 JF0 H ! J THBѲBPh2]!lhKhpG!pF?F h( ")F>2BF h>>&``h( "!>$CF`h>0f`(FpO5(7 FK"6 F  KhT Kh#F2F(`hBB $h 0*d!!F$M F+h+' <#XC(`.h8F1F#RJF! Fgk{&kjg{[[#x6+ cx0+"I F"h F#" D=0+<.+(Fp@N!m{J#`J`J`J`pG!!!!F #h;+  "iFh[h#adh i(iF "" FYh0LehU*F!H00v``BU! H0 Jchhy`q`h0`hKc`!))Fh+уhchV@K"hhh3!h-GF!9L8FO6F#h3#`hF{h2N+]@FF0`#h;#`#.Kh 1hhh+hhF( .0F>$"htFHzh@Fih2"#h;#`#0 .!0F +>! !hh.0F>`>-h5`!l!!hm-CFsNFVP8-@р! @ #h+iKh O!h)&Ub[7Cg||-@\K`\Kh +WKh(- AF`hV0PKhh,!`hV0HKh{DK!`hV03BKh>Kh+9F FP$9F F_9F F}!`hrV0+/Kh++Kh*h,`AF F AF FZAF F"i$K!`hFJh[ ``h!;Kh,"` F"9F F H H %VFT f*d!!!!m+P-GF!'K(F!t%hll @EF Q K`ױ *V0k]hD0F%0+ !F!H!+@*d!(-GQ(Mh=)O(JO (N;hh2`)x 2h:Q2`*ۃ*2` *xFp3*xFCpTFMFC*Z8hIF K(Fhd KhpBK"`*\*T!!!-GF%MF&#L+h3+`!xhDV0۹#h#h+ch;c`+##`+ch;c`+##`#h;+Kh+h;+`K`:h4 *0 +h#h`++!!!*d-OFMNFV0+lJKIO@,a DO`DL#h3#`-nЖ0+1@Kh@K0h =H  8hCh;C`+D :hhY`="phh 48hCh;C`+7 :hhY` "p8h q"ih V9Kh:*Zh:Z`*`-hF")F F;hdhhZ`hZ`*Zh:Z`*`#h;#` *d!!+d!!!H*-GFF#Mqh`h"+``h,40 #%hdh3i0F+`YhX#H V`v#h9Fh +#ifh+`04F.J`vvh#F!H!!*d-GFhFUO3h I 0chSOKOMhOK0h /MH ,2JH $.HH (hCh;C`+, *hhY` "p(h ?M.+h+`! FSJF!FFx(R.S#0(QF "(h hZ` )((+h;+`#&Kh !h H`hy+h;+`#Kh .!З0hKhK0h H KGh #.(PF/*d!+d!Hmnn!l!hn!NKpưhh##*HK0۱hñFK &FMhFK0hT eCH bhAH \"L#h3#`(H!0F"1FFK `h >! #!w0F=> +`#h;#`#Kh *d!lnC!hK-C鰛h$ 3'KOhNKhK`+Km``ih2`,@N'`hm`h<#ih3`(@"``*@0`+@`|K60K{Kh3+¿S<rK0+o+'oN,@.$hl0+@7gKB@%CFJVG- ѐ-@x(@ 0+O#iBF)F F'3`dhah1( F:F)Frdhchh1`mh`Xhh`qPEF((< QK` z NK`KKh*O`YF FL  (TC;K`CKh++ 0K0Kh*KBh (` e"K  h\ CV #F L##` +@ d ` K"`Kh+ KhC=! !!!lnCG'!*d!0!p!hnT!t!!hJ`hKh+h !aN F #5F"+h`#`#VL;3`3`#h3#`UKh` #h;#`#NKh (()LKh+#& q  CK! `CK`CK`BK`;L# F +h#` :Kh (`Cn0S2I `2K`3LB #h3#`z.HE# J#h;#`hL3` ! / K F`K`K`+h #`K`Jh;`Kh*""@Kh PKh+!l!h!(!0!t!<!H!p!nf!!J# + сK"Z`h`@"` C O3{Kh yKh( #$F(@sK(`rKh3Bo h +Z\#l0iK`l0+ !FOA h`K`cJ3`bK"`#aJ`aJ``K`G^K` UK` }\K\J`\K]J` w# o YK`MK"`+ GK`?U3B@KBX+ >KhQ`hR`"`+e/iDJBCJB@K!h`# 8 |=Kh2K"`+8Kh.K++K"++ѽl0+,K"`+Kh+ IBB,?N`h)F $h +`= `OBH "++!!p!!!$!(,!!+h+P+d+l!0DG!t!!l!hlzKhpG!KhpG!JFpG!KȃpG!K""pG!( FHh H! KhB +"hxc*J !!  Fn!!K(h`FpG!K/!0hF3  F=H!F`pCO!FHO!FH=(PCO (F"!FF(%F(F)0!d]Gn(LO F&`hh!F K0F` M K/hh3+`&/` h!!!!( Hh! Kh+ Kh[  KhJ;h+K"`"Z`K"!!!! pG pG-CH!. !F F)FF1FF:FIHh n +n+hKh gpG!h FFF=|"h- - 1F8FkT K`K` F"`!@!-OFhFF)_* F%',F.F;+IHF !p)J0 hCEA&JB @FDZF R,/*/" IF@FJ!`)xB`&F+ :*2xHF:*6`" !80hO?:+лB%FF*T*\!hFF F/!Fb꘳ F:F)FS" h,K*,,"+>0:F)F>" h+"h+"h@F2")hSF($,>*~"! F`-h1I*FF !U! -CF F*tM%>K Ghh3H="1F@FF?ah5H MHF  A2H 1H )1F/H ;z.Lk hCh;C`+B "hhY`*"p hCh;C`+8 "hhY` "p5H 1FH -M`h+h3+` FhF+h;+`#Kh H  H1FHhZ`hZ`!nnn +hn!l!hnooF M$`Yg0x3xB%+xh1F!8(4hFM$`Yg@x3xB1F!$xh4hX K"0%h LT"02*0)(۝rh)!-CFN$XX2h22` 0ChBh+`/(h(4|,3h;3`KC+0F!l!)-CF!KO4Bu&h3Fx+B:*5F:)ѲuN3h+b4`3h+c%(F4`F5F%*a9FHFZ(4F<:+6!)o'-A&LX"h2"` 0++hhh;` (F=h-6|.#h;#`CKh+Aտ/F!l!h!FF F/! KS!@<N(F3h33`!0#Or)F8`F`0< ,3h;3`# Kh K F`D)F!('F$h!!l!h!8%L4T 8!T <C`h` L#h3#`Khhh`$#h;#`@!l!-O F/!FF 0F=(# "h+"h+"Os+O3`,`1Kh3BD'՘I<D !0FDFر ** z! ՒFb O  ъI h)ښ *̀ J@h*0FF(yѺ0к * xJ0hO O8"1FFعU lK!HFhl2FiIF F Os+O3D:x/*[ 8F=6(_ pBO@ *x @8F!SK0<h 8FIF0FF *J:F1FIHIH0FF(EL"h2"`+p!0FF *O   pL8H(vEr? "h*?g"h*?a"[!F8F"  0* j` jL"h2"`!0F@F *O   "h:"`*Jh*  O   !o&)+d(*\o4o'!lo/!h!-O%ı,FFF/F.FXFHFx;FC;C$F'F&FF_JhFh+Y0 Y!HF(~а0+ztb S*EmEDDEqDDDDDDDDDDDEuE{DEE&'O O$%0JFR)   0+$.к +)FXF/,?s0"HF3-?f 03!HF<! V.?TKh+J/G!$!)oI!pFL!#h3#`0F+ +@h 3+sh`srhk`#h;#`p@Wp!l0LFF#h3#`#0 K>00 m(F#h;#`#Kh 0!l*d!h!@0+@h -O&F5F4F@FP9h xc+E"CЃHp(v(V($%&{H{JhFh(@ـxHyJc+FxH| F "Y! FIFH.@1F FlF(Ā 0Ch 0+R #xB!FXF!(-x\H '-6ZH !@VH$ 8F 0hsPL hCh;C`+ b"hhY` "p0 h,PFDH,F \FhZ`/! Ft80C F"!F] E1I*K1HF 8F ,Kh! F<$()H !Fչ!hVF$H-#Hx-"Ht-!Hp H [O O~ O O0C" FO @Kh3oxo!$oQ+oooo+hoo_o!ppp-pJot`8-OTNFTMF3hF(hDD3hO,؁,/,:,D ,8 HF ,-؄,@L?#h3#`0hx+78H F(<&.Ȱ O {F, : * p3 *)aCp"pXj 0 ;+۲ + #h;#`++hZ*`#h;#`+ +hZ*`p2C+`+C+`p*\!H!,p*deR-CF,L#h{+KhFB!*O0h8shBο `&``;h3;`-;h;;`+0+X"#`h1HhB #`NO#hh8hBڝ`" F3h33`#h3h;3`+;h+-#`#h!4!8!l!h7Fx F!+$Kh0 0@+*+ Khh(=;S(x* 0; +!d# "` FF!Zh{x =+ \ Kh-x+ KhBDh::`*A#p4.;h+F;hrBF3I`2FO h*3 &sD;++K0 ;+ ۲ +;h4;;`#<;h4;;` `:oDp (<  4K`CF0a+h@;+`#Kh 7!H!l!8!h!eR!*\!4!,*`FK-OFhFc 0`=KF'ZhVh `VD RDB #x+ D`5FxҲ*K p)5F+w'*AO 3pD``b`,FVDB"x*%Ё*HF e%F*xF0HF訹l%FFHFp HFBF(,F%Fl'.F!4!H!8+ M LN(h K`#hh3#`#h/`;#`+3h+!8!l!h!48F $04)FF -KZhD``X`8!L)FNF"3F3#1F`F(FFahhh ((5`.F*h2,`*F-h#FFF4`&F#h+%`F! ǿ1h-O' FFF[غ*Uк?Eк+#x+cx4#x+S@?  غ\#x+4#xSE4'+##x+4Bx#x*КB4#x+4"xCx#x+4#xb+F0FCx+*+Ё+xҲ*?+[+'FF?)쀁*@bxB44"xBBx!*^*Eуx-)])!*^*70##x+?}+/cO xCxҲ*@򦀸?p[F+W:* ZI(Fp%(FK -zFM3F0F#BZx*њx*НB*xJIR\ $BEOҎ q(F})x)5B)x7J5E<и\ѐF*x-*3ixk])IЁ)\)ѫx] #8 (  #(ؿO *xk]*&ZE?ɮF4EO F;x+?7NF4(3x/((3Sx(ف+4"UL+F&hxxҲ* ف(1xp xF1B h) h<6(EJBKhFBHCBx/+D#K-GF^0F ":K'h)F`7K7L`0F5J05Kh#`4K`4K`ih`7#hvK#h3#`p0p;#`+*0Z p0"Lid`F#!Fkch"`+d`)F h7ch"`"h*qh `s`C0p hy ob;`0O02 i+{u;h;;`+?JhY`xTh+3hh,Jh#+"F! F:S"! F:(XF3h"Za2h)hSi D!+`FQa1h Ji (&!(2Ja! : *'+h;;`+##p#&x#pK03(htKh&p+hZ*`)ha9`!*,4,F)o!X*+P+l!T*d+d!\p L#h;#`+ JhY`x'#h;#`+ڽ@!X!T8 L J#hh` Jha JhabhZ`{#h`O3 ``#3a*!X!\!TFN FI3h33`"!8F:0 L#hh( %hi`#O`Ga J#` J`#c`3h;3`3 Kh@!ll5*!X!\!hF.M!F+h3+`9*H1F:ꈻpCO+#" FQ"" F9(F I( F91FH#" F#Q F91FH FVB9 H9Fj+h;+`# Kh +!lpppqq!hpFLF"h2"` " K(F` K` K` K^`#h;#`3 Khp@Vp!l!T!X!\*!hpLN%h2hh22`(8i+j۹+h(F#`#hJh`i J`i[h Jc`3h`;3`K Kh3p@p*!l!X!\!T!hKhpG*pFNL3hB УBѥBH$p*!dq68ML+hB8*!d8FPM+hh(+h`8*KhB`pG*$JhD#L\C#K^hB &*FE ݖF2R|B 6 Z`) )$O30 ZhW!R`.0^Vp/0@2FZh\` !Or5*FRN3hB QKhQL(h hC_!MH9Z `0%(F~P5-GH/GK"F (F9 `0 hAIAM `* h((`9+hB! ! g! 6Mb! ^9)hB 9^0h"F+H )h hd0:rh"F$H-9M)hB 8F9:0\h")h hB0Ph" h! O3#`! !  7`~!!*\IqM*dr!!q{q-AF0+P)L&7FO#h3#`0B  !XC 0B.0F OFH>h+h7 OpO6'3 #h;#` KhAkQh сBV`p2!lq!h8FM*hB*`Ќ@! F{+h;+`3Kh8@48!l!h-OFFF0IhؐQHBݪ IFPhShBE^  ++ +E 90+ ї0+k8FЀ F30#00CE@pKpIhpK:IhZCBN&B "-"!eJFh aJ !0XFXFD0 Y^XIXFO !FD>ch;c`+ F#h6."`!F(yպch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#hFZ"` "p^+" ",J!M#+'J!XFA%J!XF;(OrB "YFT0XF^DH@EtYF F :6?# FF0պ!*Or5qqqbqrrrp0 [ڹ0: BCDSh PU4mh-+FB!#Fp#&F*OqB#3-OFFFKGH\h x%+a PFPFD@H,$?KZhB h"40˱ Fkx+Ъx*++-+%+3K $i ,,H/O)F'K[hZD(J!(Hh#@00+ 0kx?+YF@FhL4F6AFPF(((FK!B:Ԕ0[0+`cSMF(F 03;D+9Hj(p(g(&'$3Khh[h 1H!Fo.KhE.I.HiC1a$ F&y(H,:0;"SC"HXI4F# sC8F6X>Ch;C`+0 hBԿ # #P`p0B0hBԿ # #Q`&F O(rr!$r!Or5rպ0+hKFhH"!N0hdB F!r9JhH#;pG2 pG pG!-GFNMh+F>Z#`@F;@GN3h33`(TOhp(`2$O<4#FF3oc2j`3h;3`#8Kh 5M!*h2*`3J"6"B F F#0.Kh0/H xC+h;+`##Kh p F0 F40$`CAF FKF!E@F 1B03 A! *4r@!!l!h*d!F>JFFh`X*a$)F FN^F 0h8A3C|!!(FF(0V<0З0+!8FwF," FWK60+8F0^C0F0м&Ըђ)F|F!2{ 0N*?f *`!F!FѺB.P|u0;"SCXJ!0+rѸи,?-? ")F F^F&O O s! srs!!$*d*pF8,3M+h3+`F 0/K1Fh0h9@RF(H!F 0+ #K$JhSCJRhB! F! FF& :OrB(L0+ F+h;+`#Kh 70Fp(OrB&6!l*q!Or5!h:K-Ah9HB)Fn0F 5H&3H'10B//N0hCh;C`+2e2hhY` "p'O&0B  8hX600B@hOrFH@F61hZ`5M F+h3+` F+h;+`F# Kh F!rWrg +h*q!l!hrHKhh@k+!$ FH h@^+8Mh0h1"B P@,H? F#`823!s&-OOS_J!0 F^KhFhF.F;k"#>;p7`p+_=+t $+'+"+"+!&\++X ؅+R Cx +х$#?J+RMӊ+(F;J$#>;*;Cx"+Dx * RFZF(FF0+x0; +CCB Ё"#%K&H *FFx2"KOOa "F}#"#J)#J"#I #0 }+ @x( 0bF:#I$=\#"F!!sXs[sQsU{sa*sGs>-ANFO,a3h+^#h+7QOOf?DnLInM"hB:F!W(F#h;+h+bH`haHh`h^H`h\H\H[HdhhYN=chXHhh+h0F-hQH`hOHOH`hyMHhsh+JHhkHHHH`hcFHh]DHDHDHzhwBHt!`h?Hlch>N>Ohf9Hch :Hh60FWh0#h + @F8FMmhhH/Hh!n!hjh")MD")MA"(M>"(M;"'M8"EF5J!gh!Hc!Ha!*si}ssxs}ssnssss{ss**Assdsssslso|srsus^NspF N Fp0F F%ch0Fdh1MJ.`6F0+$2$ OF<`;h+ <."32UZpp"p$+h"p!*d!FKFFFh*KF0[(00h(F8/Kd K0#KCPO3C`#r1F(F)F!*d*-AFFFCFЀF:F1F(FAhPFHF:F(F1F^ Fs-OFSM #+`+h\'OKT$ZhKLKhh 3H3+hB"QFhF!F0,`M-0+jBFF2x),/*4@F6N8(#""#"#BpC/A0+FF  :)ѻ0[E2"KZF@FL# 0 Kh+FI@F@FpCh;C`+] hY` "p"##4{8hZ`!!\!!*\!s!!*T+ds-CFkЀА%FF0 z6@,9/9&K!h #H F#V0 JB'1-ܖV0@60.0sH\5F((g 8F(ЖV@, J%FhKBKA!F`+d+l+@t!*d!px+B!L!#h3#`88!#h;#`#Kh /-+LP-`&#0P%#0 Y 0;#0#0p@.Fp!l!h*d8!LF#h3#`7( !#h;#`S )8@)FH Kh+!lp!h8F FS@-`h 8yHtI=HtIF0!F0L M#hBڶ+h7FOw83+`bhFC+`+hp;+`#Kh z+hh3+``#h+h&`;+`#Kh h8F*T!l!h0 "I 7 LJhh` D`tV*TKZh`hhB``Kh`Kh`apG*T!!pFNM2h22`hh#hBchh`h+` K`3h;3`[ KhCp@hk`p!l*T!!h Li#h3#`K`#h;#`3Kh@!l!!h-G*M+NzF3h33`;OIEk$1#KB.;h!8Fk`khI h` +hh`D `K,`hhB 3h;3`Kh㱽Gh h DBi FJFQF0D@*T!l!!!!h J0 h3` KhD`h`h;`#Kh qpG!l*T!h8L%hy#hJh[;(D`8*T!pMN,h0h$d+hh3` Dp*T!J hh`#D`J[`*T!-A$&FU{+8>`KBHMl, D4C hp$k5UFF-8F ApG, 4S )F0FFDh(F6Fta-OM$N(F^F0Kh;hKHp#4h< F!}H}I}J&}LF%F( FyKhF `"  7(@𐀝 *\* F F7(ѝ *.K"h:"`*H۝  , % *hF(F(@𗀍%xh!h6.!h9!`)$ۋ  -F!h9!`)ۋ  %  p6  p  p籹#h3#`p"W O h"`j" O %h"h2"`Fp!M ;@ E!F"8hLWPF " F((FF.O 9"!F-m%et~! !$tϴ*T!*\!-CgLFO F2F(wcO;h3;`7F7;h;;`#]Kh \Khh,hѸ`^r#DF0(w"#D4 ,ix"#D4 ,DO <^r#0CFw!D3,x!D3hDOXFF,\r# 0w"3D6,x"3D6,D#/H<: O~)F)H/(J#xh320[#x0;ڲ*!HE?+0F7";h F3;`F@CVF0F;h;;`# Kh NZh!FF HC%|!l!h!$ttTtt-OyOf$%&8FN vO;h+;|B)sKh$-oO%ܡ$̱O9oHW<+Q S(a(H(F&%&7 [h]H]I@F (b@FO O O /) 9)TH T09 DDy)h TDiFh7&0@hFDHiFW 7EWKI"F(FH8@B8*d! sSu-AFFMM(m)>LHKNLILOPU4 :+D8Fyy\AF4,DL hCh;C`+t"hhY`?N$?O "paYA+@Fy* 2F:F4,ѽhZ`3H,F+N2O5؀yyB"h\@F4B%L hCh;C`+ 6"hhY` "p"y8FhZ`)I2hF F4y5,ѻ&'U7A F 1F8FA!7/K"F H]*dvvQ(v+hu)v,vbv3v;v"vIF H#$yBF@3+KHY\*dvQvT8FychKh#06 єp/ (@F6p60+є0+60F0+60F0&Ky3)B2h KO` Fj9hY2h+hN2`h*` `O#h3`;hs+h hHV:`Zh)`3"`+`K!*h$Yqh`FFh217 `(`A$*d!$!<!@!v|!((-G!H# HhHFL#hBH%NO hFo [2h#`22`%uh;U+C/*3h`;3`# Kh #y+ ;DS ~v!(v!l!h(F#FF@; L #h3#`8 Khh P#h;#`#Kh !l!$!hx0; + "!L(K"Xq`!(-GF FF9h x+B2h*hk3h$?%F O 4`3QJ !_OrMHMP%*FPC@FBT5`=`@ x-)\xY,22`Zx-*ћx+ xFxB[x :+Y3hIxh)>,Px:-0э "F.H@ Fx:+э *F'HPF?%"#2`FF!I,F!H)FH]x\:- 3#FIH!FHE33`QF"HO F3h O 3kF" IHFO HF*vvv+lv+( F H K( Yyh)!`aYqK;v!(!8pFM*h xL hh p x-*NxJ.0 `Hx-(щx)xTxB [xF:+Sx Jh`hd H Hu^xX:. 3FK`$,`!!$w w ! L M'F#hk++h&;+`+p0:hk;cF0p+@!BhF"h,#FZh:Z`F$hD`8FEhkC`+݈ 1#CCh"bZځ"h`8F 4!"Jhij`$+@xA  pGxҲ*ف+сF3۲ + pGxJ\?  pG\FpGcNx J\ ?=+ pG\FpGcNFKHhk+@wpF FF"a(F (F`p+x-+kxO3`HKhkk aw+@-OeMF+hBF;x_H_J^I_N hx1`+na:xn*2h$:2`* @hPK(hha\,A*2`2ۊ@  (F52h:2`**ۊ  *h2*`CF2h:+*2`_ۊ  ,*h2*`tF0їl pf p2h:] XF ,ЍB,FOF+bB (*h2*` h`FC ( R (u*h2*`Jhh`l"@F ,*Bpd*_*\*T!+@KFFhi *ќi F#F (JJ"!hFvhFhDnJ3F!lhF K Jj-KJj+@xxxC_x5xX𵇰F FKh*F! F,KhBFnM,hGBҷ_, $B!Fhh@kh1F:FFHF0FdNN*T*\!xhxv8KhhL%h-- H K-F8 Kh08 Kh%`KH+@!`+x!p*!K` @!`8LMG\(8B ( #h3#`+hhk2c "!H8@(*+@,*-CSM+h\i,i"Za Fh# +h`+h"KO0c0:hc0;0+0Z x#.0 .ܱrn0F";ICF .$ .).H&.%(.+h$\.A|.(;.&(.;(/+h $ (0S;h$3;`+hh`ae&(+h$@$+hY|(+h$4$+h+h $,$+h+h$C (*h;hh3;`c (y+h"aa+@*gV!X!T-OGFC0iF,! ,2>hjMFFZ $аi!Fh F2FF F]Fix xB` 44a,;h"a FUF+@`\(A,2K:Hh07S (F3h33`0h`[h[",;h;;`+\#5<\(`($(;h;;`+,p5#\#Ep3h33`0h`EpJh;`+k"*p Jh(XRF!P"Cp,FI+@!p*\!l*!h!*Tx@Kh#h_`+;K"hZa:L#hBK9J9Oh;`AF Fp@FD;h;`1O;h3;`# ;h;;`#,Kh %K'IhZ`(K`[h h:[)K*`c""pL&=FK ~"Cp"h:"`*p3pCp* `ۄ"c"pd"Cp+@*T*\!!l!h!p-OFNM#4 0hF,hF3.0cLB0020,0cJKhLh !"`O2#shJhB(FSF#h+%Frhh (̓|%EjoAJB3Dۉ+𿃁Jh;`+ăJhY`yJB3Dۉ+#ho;#`0300h r=F[+@,a(.'( (aG/@bHz"(FLU(ܠ0/0+[00+Q0/\(n(B c(He(#f( ' u(\r(4t( 'v(0x(O O _Fj0 +I0?  ES' +@#h;#`#+p0300h S ' ' ';?F;+`(%H\(-\( H?('O O A+7?a+W?/٧XCo H+@*fT*T*\!dPgV!X!TySy y y8#h +Fo#h;#` ?Gc?+p۲ +k#h"3#`jp]"h:"`p?-#hB;#`; c+p۲ +k#h!3#`ip!h9!`p?GҲ *@Z#hU;#`p/#h1Aj;#` c+p۲ +#h;#`#kp#h;#`pAS (#h ;#`Pp"h:"`poT#hA:A;b#`k*pҲ *#h";#`jp"h:"`p1AZ ("h :"`Xp#h;#`pAS (#h ;#`Pp"h?G:"`pZɲ )?v"h!:"`Ypn//#haAj;#`c+p۲ +#h;#`#kp#h;#`pAAS (#h ;#`Pp'p'n?'l;J\ ;+#h5;#`#<#h;#`/p5\(BћH{ ( 0300h I'(13D[#h5;#`#<#h;#`G#ho;#`\#+p ( 0300k2c shZ:\(`(}(ۉӱqI²#hA\; 9) #`5#<#h5;#`,$$("(ћ+#h";#`+F+"h:"`\"jpFqh)#`+F!!h9!`jpF#1SO3DB2#h5;#`#<0FChFF`"Z*ۉ+?v0FXChFhAKB#h;#`#3Do)*@#h;#`0FNChFF`"Z#h;#`# [0F##h;#`#F+p(FFr((F@Wl((XF@J#h;#`#F;sh[#h;#` #3Doۉ[ 0F#h;#`#+pF8FF#h;#`3D2eRxgV3D[#h;#`sh:)(F.(Frh;FEK0F#h;#`#;pFX#h;#`R#)F0FC3Dۉ+[?rhHhB 0FH[FHB"0F~H3D߉O0Fv0 Hc#h;#`+6l/phshd+7*<+1{+xC +xF+;O5>`E-%>(3##`00F`\b:0 a+Dp(F(W0 Fbb00Fa0 (FjF|(#&(###`,P%u<(>('&('# 'W#`F` N0 (j\`a.0j-("``##F#"h{( 2JI \+F"`" +{+h"h2"`O i#(Fb}(F]8J\6M0-h5P D}(;F ' +H*F!0p/FEp$J\J"hݲ:"`*-ۊP  J\F"hO= :"`*d /@%+:+`#+bO 1tF'' pdPyogVy|ycNT!0 )"hݲ:"`* ۊP  d/FР0 *٭ p "h  :"`0JF0FTH[E8'FDFXF( DshZ  G+G@KhT?l0FChFډځOZ2IZ`TO B  /}+'HF''(shhKB"`#0F0IChFF`"Z"`$#0o#h;#`"#Cp0FtJ!ChF`"ف*?&[#h0F;#`#+pCF=FygVyeRdP`-G!L#hhCi'|F6#hh *h>D`h+ k#h khhZBZAF0FBkh`Fh+#h2F!i"QFL#hij 0+@fTIK0߰h!EK<"! 0BKh@Kh#L(P8K:M$!F`7K`+`T`"F4I*hj; )3,I)Mi!   2$KFS$Kh K`K K`K`+F_0K`K y K` K`Kh+!# C K K!p*d!x+@fT*\!ty+-GM"+ha#F=r (%*hSi3Saj(}n{{"{{{{cc{{{{+h[j3` 'vFF` F`` `.( +hi*   +h RF Fx` `" Zi2Za 6+hi+ # #F` `` ` (+hji]H,  #`F+hi`+hi *j*TIi(6 #`OK`#`C`+hkai``:*Zi2Za+h"a((!! +hk8` (!9`c`+hi;+ oF' h`8Fb' *h #`Fkk` )+hko``/h;i +#Ii!IO0O Y+hi*" "ak #FI;F+hi+?+hi *! k3+hF,(  +@yb+D+hi*! k ;a+h"`a (Р +! r ( #;`+h '*F` #```! +ha (1*hSi3Sa#3`+#h+ #4F` K0F ( +*h0FSi3SaF F+h[j3`*d-CF9MO$FMF+h+h (k0`F+hi(Oi *\j<`'*' B$ O +hh:hZcH/!hFH*h##`;hk#a+h``^c FZi2Za)O0% 5`=`n#`F0`kE``a+@*z-A%'N"'L3ha(<2hSi3SaF( A"#F# 9FD` 2Fz``<`'F(##`DF2hSi3SaU ##4F F0H$5+@*dz8!M+hYaa` +h$`(*h Si3Sa+hh+hiHH8 F+@z)"FzpGChBhpF FFch```epsFhF4*(%H#h+hh0FFF 1Fw4lp%!"FF(4^! ! !F! 1F #h+h*FhH 4hOnCKh0 pG! FF:)O]K5X FF]K5v-CFyOhF;h -;`ܿ#KUh;+5p*v||1FHF4N"!4!  F4-`K0+𢀬B^"iOr@!0F4VKN0+5i!0F4CFOr@!iF4~0h F4`GK"`!h51FFBHzpCO F4#`&iOr@aiOr@ !h() - ( \k#KU;h;;`#.Kh L')F ""=(hh*F!FF!Ha(F4ZFi F"! F4:K$`!FhIFFHB")F F (th F400F)FFH+!l*d!{R!h{\{)BpF FF4!F(F4B Fh(F40F!FFH(F4 Fp{g-AFDhF Nl`3h;3`/h(F4 FDFu!p! N L5h#h(F3#`+h(F3`^#h;#`3Khp@p!!l!h KpFhp.1F F$heh-Шh(4-h!K$h *ܿ2`h@ ,!bF4r( 4! F K ( X`d+L!pFMkh +jh ! F4P۴B F4Z0Fph+ kh +"! F&F46h+!8F FP(KEh``8! KFh0hhB` F@4FF!KhhBFpG!pF FHO3FpJH!F! F4F0-4hF! F4A -$hw!FFHKHC{{{p-OFFFCFG$N*F#I0h"J"K#M/FFU <0h['"FIp0hIOjU,B BFYFbUNhshBrh !h4BCF%rh !hrR48F0Ѩh !B40AF " !h4(BF " !h4 CFH/hBkh!FGh4"`p!{-OFF #!3% 0 #C`FPKh``XX 0KKKJ`0JKHJ`Th0 FB@w+h;+hB"! F4(h h^!FF5H+Q!Fph(KȐ0300 + ! F4?F"h* * *h+!FFH ! F4x "!PF4p(RF!F0F0;0#Kh D Jh3`:F(FHmhf!+h++d{v{y!h!!d!l-O%zKzNFFF"U`2`BF9F FC'3h-ԀnI(F`Wk.g0FLF0FF03x0+x+0F6(Y1F_H's(v(\H -PO x ++-+  PFdFQQFNHFMH  BFPF`2h C2`0#+ѫh+Ъh FIH!F !FHh* ch;c`+ F/#hZ"`-"pI F!F(i F`*|o8F ,KhhJhRKh+K1 K"`hKS$ ʱS$ x,I"! hD ` K603,Kh+l`8K!!!l!h!*dFP0#FJ !HXHH*! } -AFYCh;C`+#hZ"` "pO%L &(F9FF F -?-!F@F5@-ѽch;c`+ F#hZ"`p d'ML*hv2*`#h3#hx h'`4B K"`+h;+`3Kh@!l!!!h KhX Krhh x)3BpG pG pG!!PKFhF˹NKS 0x+%%JKhKF-,= ,,8,%%,,@KF0+%Ф*:ٓ60(K60+%%F+!B-'-'-! F0=U-! F,<#>,33#`"iF 3##I!b #R<CBL!!!*d!<!(-OF F;MhI(FFPHK!h0FI(FxF(OFMW$0+h3+`W$!G$ F+h;+`#Kh 4@,єK"`(=ݒI`hLF(y4>FO I hBF(u>4.qѹ$ЂN,FO --V%0H(F4IF8F ,@F$q5@-yHjoO$Ё%F>FW%0W%0xqHY(F4#F@F~ ,jH$K5@-fHDfM$fOV$0V$0xk(F7V$Y FF8FY4@,&O~4.O LKh 8 h' 'h;x-+{x+'.4%& FH$PFPFtF?,%ع/K"=K`=KhC ;K `b ر7J h3`F82K ` F *K3R(Kh&K(K `)Kh-"N4h,#x+)F F5`$;+ #"##3! F"""b>*#`" 334!F38P "@S  CC !!!!p!l!"K"Y!8F I'!F(F (]0 8@%FBOOrt aT8 M Lh"h2"` #`k`#h;#`3Kh8@ֺ8+P!l!h-AFFFF&- *F9F@F3r(-- FD6 .`h+O0hFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+`hc`` `+h;+`+Kh+e3 Mh+hq`F3+`hc``0D `!!l!h8E F?C K[iB F8@ch;c`+ F#h*xY!`p8+PKiܿ+PKYiֿ+PF~H@!F}R]pGKRi]pG+P 0 FKFR ;+CZ"p0Bd#<0@pG-G F'!F\8sx+[I0F3\ch;c`+ F#h!F0FZ"`""pUch;c`+ F#hZ"`""p3x[HI0F7\0FuF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0FF(ch;c`+ Fx#hZ"`'=F}aT+PKYi4+PL FC@=+PFxr+ HH}~h-Ah h2xh#xB*K=!O0FhKh;`d=!F F`E"ݨF<+#x5</;h;;` =*+O,pDF!F0FA3-#xEpF4F.F#p*\!*TBh Kh L!bihJh F| F !H!(~*x B#`FMD[]##&F{GB]4F#*$`FcN-A#MF/FU#@P3'+рFFW$Pu4',5`@Fah$h)Fjh++iC(FG0`6-hh3`!Fx#H@IXF F@BNO#x'+8Fe,F'! FF( H!F@ܽ"F0F!FH}!~2~M~J0 -AFiFFFhKBh՘GF,լhFAF H1FHNF40=+kh/H F0hCh;C`+2hhY` "p0hCh;C`+ 2hhY`,phZ`hZ`k+hy-OF&LFFFi+ #aa!K&5FS&p6'.Ѡi"K)Fi5" yh ՒiB i2ui2IaaiA%p5?hCFZFQFT T!(!ށB? B=+Ѱ@ pG=+ pG pG-AFFF )F;۹'!zK>`S!@ThB*FAFh `>` F=+@ F`&F$h!EKFy FXAiF(FF(gBhV `(Fu$Z!7H``P(F@c1N3h33`;i;h0(DG{h`ѸhN:i{h2R":a L#c#a{`B{h#{`{hH$$TCKEBJB[h 3h;3`#Kh PF $ T6Eh``*d~T!l!\!!h FF=!F :FHP4ݹF F\FFX:*="p"Zp)F&` F=(FND;<F~gKǰh#\@#K`G]K`!p83Lch`FѠh K H-Fch I"#`c` KBF`H8@!p~~sSupF LF"h2"`U#h;#`sKh[p@hh1F-hp!l!h7MULLH"F~X hD `"D 0 U hU h"``xU <#0Cc`U<#a`5a!|~%Och"h2`Ԡhch F4h,5-ѽ@[ՠhxch#@c``&F!"FF BhiC՘G(h3DhFKFhD"F!F(FFx fh)F0F(=!0F0$hCh"iJ FG(h3Dh!-G' hxkoG{OF&BoB"FI Fн{-GF F I.hhtx-+@Cx-+D+p~0FXF`vJ0F{xh320[dF (F0A<,kIp<&X;x%+p8FF(@]Hu&l+s+уx+KІWI0FDF(0FF(0B0Fx,+HJ+xh320Z(FT(Fȿ,(F%h F&0 FTF "F;I :H 8K!h:4HPhx+K%x "8F\xùO)oBBO3B5BB0?I)IpKF:FHFO1F1?i)F8F1>0PF&--!8F1.<A0FI+T04+hb 0"K#J"z!KhHhh*?3x`1F(F h0 p Fa!FF(FFFAF(Fse"F1F[FRF1Fa[FRF!F# `hh$h `h@lIiR;1F(FaR;!F(FHA!  hh1`h"-CFF #E (F2IFP #"/I(FF(?;h:`_h'*HAF"ehu%I8F85D#5<!I+! "8F(FHBFyBF!HxAFHch3DH b^5D {x?+-+H0#H0QAFI I ChsFhhhHMN 5Uq FF F)FF Hp@1ǺU<0F#D|x -OFF:!BF838AIF(x+=!$(F$pYF@F/xc/4I(F(;`i//I(F3`,I(FH*I@Fsbl/'I(Fй`o/#I(Fs` I(FPI@Fb 4T  xB(F( :* I@F 2Dt0+|$)$'/06$:<%#K0#M0#P0Cl# CCCdk#cc#bpGj#ACBrcc#bpG"r#clBl`3CCdB3cK@CcCCd#c#bpG@$j 㿂kBRBckBcBl"rBbBd"bpG hh1#dBj80]F@k##cfF@k ##cdFjhK#I1^#b#t`"pFFH0V" H\F cc d`d Be f ,"80 F0F0X-#bp@F@kF8#bF@kF8#bf dH1 B80@FH1_jF@!80#l#SC@s#d#b IB 0(I ]tC I0(I  tnL I0(I v toVh"phF F#x-+ ##bbK@ MI #JȱhԪj* H!F3h2`[hkc!FHCh(FG p_FFFF1h9.x-.59hyF(F8h#h##`rhC 6(F@-.#hzh# #`78 FhJh@(F b8J8(F$( JD(FT(J<(F<(\`8FL#h# H##`e`8!L) F-h:*J!HH CJM!JAr-!Qr 2+F^!?!Qp"p+ٲF^ @1 SpH*!T!LpFL%h5FahH~ `p(DH( Ht1F Hp01FHj#hD!LU# )j-OFFFF@F0F)FBFHF,F@򾃹 H<DAFH4D'9FH.D HhR, ԸKF,* ԳKF,k ԭKoFu,/ ԨKFh,ب բKF[,i ՝KFN, ՗KFA, ՒKF4,o ՌK@F',ب ՇK F,ة ՁKF ,-{H-8,j wKF,+ rKF,د lK_F,ب gKF,)aKoF^H5hs,s{jYրӀ+Uk(쀻MiHF@ /Ak/&@Huh5,-+][3/Wi@jF1Hh,cJ+N@sWH+N&K_GFA,HE//Sh\4.6<DJQX`hqzN/8A,@ZHOH UL,@< F7HbJ F,+tЩH,K@F,KF,UМH,KoF,BГH,;АH,H@D,Hx,鮉KFl,஄KF`,׮KFT{H{H{H{H{H{HDE,Ϯ*wH<,ʮuKF0,ϱoH),mH/0 ,jH/0aHfHfHfH+0 cH г@_H_H^H^H^K_F,/?XH,VKOF,QKoF,ήLK?F,ŮGKF,BK?F>HU<8\d#F:Fd!d(F OF̀%W <+b-? #)18?"0G V_emu~^ ,W,\,BO BF !HD58FP=\BF !FHD -%xt 7n(VHhYH-HXIFHf K IK( FIHP !\csFF# "`#x#+4 FbFh#"FI $x+3F"FI (Fp 8Fx;#+LI(F`8(Ѓh`!\c hh0$FFFF "!F(F 0`02hB" h"++x#hx(иB K0h30@ O O TpFL#h chh{B H@F IB FFBFHV"#`#p!pX<h++ H]0}+ +HH]0HH =pG-O$}F&F%OF0+!F4H c#@FOr ;i!F+H(F } F"ESB;i+!F"H {O ؼтFм  #EѺ .FB;i+"F H!@FG(݅BFF6Y!p8F#F8x+ Iz+\,+4#I+T F"\#*y L J N O8F4T < T8F1+F1FBFl|G H KYi  "CF8h"+I !F!p H Ki  "CFh"+I h!F!pFO$Y=!2FI B0F 4 ( K*yh Za(*aiyaJ` ""`н@u!p!`7 FM*h*I c  I+hB B"F I "FI 0!l!d.YFhFx;H1FK #`.O5/!8x/)O0mSCF l#0@2D#`1FH!|!p"-GFdIeHꢈcH*bKcIcI<#j`I[Hj^IYH"k]IVHk[ITHbkZIQHbkJCBVJVILH|UJH0aoSIGHrPJJ0+PIBHjLJL0#MI>HbHJN0#JI:HZDJ#m#GI7HR@JcmEI3HL2OO0E +I ()HG0`U<+Ca9FHFUH5%#DkB9FXF50+O6%j)0Hj),HSB:Xa^ F3F"H`; ) DB  DBF a9F   EۯFFK`o!`F~E-OS}FFF1|uDTkDo#O34FFszBR4@BB3OrZNl9FXKrh3DB򡀍lBSN!RIB,QaBdCClKKlhXE&PE44C444XE(PEэ XBXA(AF#6H:2[3JhB 3i+#/H:2lg(3i+AF#&H1l74JFAF H41HIl_Orl8Fn#1JH%KHh '8F S}!d!l!p}!hk!`!l!dVEWWEVb+K F#ORIK`( KFi!F H +!FHB F@!d!l!pFF FFO 1+. s*KJhqDB"FI V!*h*o`0o0!F(F& I(F!F !p!l!dn!8F I(O2 F!8@ FE"eKi+OrO2( !p[F H8  !-O$NH64 + RF)F;H,:H*#   !# +++r)FDB?(?d)FB ?)FBKq)FB?h(?=)FB ?\)F)Fy!pT;jK-A&FS&P].8FF8H F6+FX# D# 3B K"1F F'D%FU B F Kh@/ĸl#`O0+'J8F1F+M) S)#K)џ${  zg{{5k)c)*g)џ{  s)t)(m)џ{  PlKh{k"#FC%%K@0zg{'{P{  @!X Kn:f*oB (I.񈽚mQeppGP-OF F FFF+I 9F)H /$U I(BFB 4!K$"AF0Fb!FH t)'(F!0DFWE0FO{ FV)PYFD(FE (FFB5 % 7>/|*A-GFmHFF8J!FHNТFQF+(#V# wE𬁐I("1FHk%Y%I"+FXA("(FN9FBF FNOM 1F@Bu9F((F5-(wH砀0sNpOsMj1FCKh9Fp((FbhNcOhM1FjA1h9FV((Fb]NVO]M"k1FBh9F<((F#cRNIORMk1FCh9F"((FzcGNM!d!Xe<h F0:*F`ڍiB0.h FQ`p0pG-A FQIF몈 F*NKOIOIS" "LI F"JI F!FHHLm!FFHDm!FCH>m[!FAH6!F vj>I FjM`iy@-O OFFY a+𝀉k),PFFPFYF ` FYFJ`J@!khkFt,FYFjFYF.RJ@!PFPI:F F*{ F *KKKILIn+{ +fJ+N +L+eDKhh{AI Flk)khh=IF FbhhkBM!F+ khhKDYD3IB FLY0hhDkB>!F+ f!F,H)kh:F)ISF+ ++뉪hh{!Ihh{ FIhI FJIk!F* !F k)!F* !F + q~ 3DWiFFF $ I)F Hv0B(F@-"F;F1F(F4pG@pG8Fh`Ȉ؀R[B@[(R[B@[шjbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXem\\peR BD pR uBD mic[UJh"13B8Q CC Q =C Q 7C     1 +# 2!`Fh KB F# F0Or F:VEWF JhB ѳ JhBF!F@׾Bѳ VEW!` KFhS# F0Or!h(#(Br ۙBp pGO0pGZ I LMNFF Hd I H 4T, T<)F0FT,T(sF F(LhI Fй. Ih(C3LI h-P0+h bhII F#I F# I F(#pL]U!pduU(@њM2 OSF0I(h-0jhI: $ 2D + ]# (4 : #TgT;F2FHD~I FXwL|I h-d0bhyI . FxIF(nM (hF-J0rI pC_nJnIoH V2 D OS4YF-,0 $,OFKD +Oq ;F#"%FFFMUHKI-0. ( (F!(F?Ŗ@dF3gB-h`1@ H7H,?;#3M3HgOF(OG)HX#Br$h#BFKF;F2F0? !H7FyHHdOrYF,H(FDH!pdw(<o dx`u{L-5(-C F"Ihx(8I" "!i.l("2I"`hdxFFh+Ih"+3O0fBoBB#I /v I~"`hJxFFhInh"+Ѹ??IMI*g(h,-0#h jhI H7?g!pdyU( F(# K Ih-0 F)I`h0(#!pdv1(7 FMhI(F쐱 I(F( K IB h-z0 F 0):!pdw(7 FLI h-\0(FahH*0!p@d7(0FMI(h->0jh F I( H0,#H#.#90!p@dzQbp( Fw"IhhF@("I KjFIh-0 F~4!pd{-CFhFM$OY!2FI 0Fl`4@Fh9Ff`G hC-z LMDOch`h2F `0bh I,P!p tIFFH| x-OFFF#333iB5.I(F"F-0 +I R" $O ~@("F I(F-l0 KEK |FF$ B&, IHF"EQFHO@DC#:FAD(F4OD=,Hk1p FF 6&,KB7+KB@}SB F&IF $KBc#3B F FJK(FFp@-6 F0p@F FH- FFFH Fp@ FF H Fp)Fdictaraysnmbrjj  l K!*ۓ!* ۓ!* ۓ1+  pG pG pG pG!x-AFIFFRiC"FF)F@3BF@$?18p? C4p!x?# L"2#2CcN#2o@3!xh hB̿ pGO0pG-CFL"FbRuC+F$F1FFFH9F 2;B 2;BѽUr)FHC-.!x|sFF~"`(F+xFO0px+jh"+C;34` F<I"FH111I +-GF%OF;hhC#I |~h#uCRTDrB ySFJF0?$2hAFG,@ ,{hB 2>OrD@FOpO0-!x-AFFWKFMFD)FHO01ERB J" +;F2F)FH k< !x)('K-pC)}FFF"NFeCFH1F^(F }p\" Fl"I F# 츱\"! FK2chS#1FH#"ih#BEKEh#iBk]g!x8F LiB h~("! FH#18!!xpGu0OmO0.єQ@ueD `Q`A?`0`hhh(<` hh 3h DBO0( Q@ueD `Q`A?`F D8!x I#XL hDD!BFF!-OFF%J$N  KF +]2!r_C{F"K  @ ;FAFO AFIrO#yF;F" @ ;Fx""xA# sHsOd!sJ8F|뀹qI "# #mH #kI8F;\: +$+Rx *cIZ h1 W-+" "YH FF\I8FF FXI8FnBFVI8FhBFTI8Fb(6LI8F;;\ +XCH# AI0D2IHJ=CSFF8KOYh2|2\DK"D FF|2TDU XBB%F$ 2D 2d 2dGD #Bt"#Br"#H# ##+F"FUFLF)F F"E!x-!P}yT!%C-OFHMFFi(h1I~nFCI O(`E @FaBv;OJ*t R (hOr! D*hU!oUЪjsRDtp!FQˁBC"Kh2@ FtFD##q#h#pbhFhbD8i@F3a!g!xsLQ ~Hch;c`+ FFN(F (0I #hZ"`xch;c`+0Fz#hZ"`x% YXBXAp@pGPo}-OF/LFhC-I ehoCrv3FDFkB x#KFBF0?O0 QFO,\ +chB#BFKFh0? =/@OrQFbhAFh+hchBOp-u!x-O#:K;MFB 2C7I,(5H2J! |BF1H#B 2C(I,l('H F2S$NO O $iB$bOv.p@"FDCFHg2h K:D4?F!FHfDF3h4O D[F-!xdm !!𵇰1L2O(v*u29i#.H#,H#2"#&H#2"#K#Hi@,!H Hyh"2HH"2H"|H@,ƺ!x-!AOYyP8FK"rL"F"Or!F!F!U"!oU!"! HN"! HJ"! HD"!H8@,8!x!!6!F!V!fL!hEKr2wR˺BFѢiu)DF:R ^i;a!-OFFF@)FUD HJE{8(r#B,8  2F -OEO { DO Bt "* jF3+цO!!(:*8+)~I#FC2+뀺iOq ~8sI |ES1#E[`bAF#F0E+)к0F_Ki**h1+2+ZH0(XH6PN#F BB#[bA# /պ?pEEвi !:BNܚ1+Wq@R qPF `i;a#E[bAFFEC2hK(1+XFLFG!Bq DD#FBOr2SXF A#$HD!12")F Fh@3h H` H^ H\ HZ HX!!x!N\ $-OFO 7Mb #Bv] #J@##BrK  ԣE*hK(!*XFFDD2DBOv# Bpں+cXFO1HH!–»!x-pCFh}K#1B0EEHO0 }pT"&^jFIF@FfD # I* H+ KF2\"1F(F !k]-O FC }F1FF[K2+ܸH }{O"FxF()@뀔 J "I K#d(܀AhH!l#!FH#J`YFЙKO [hFHrOFFFYFFPF\H@K"*@2B@`- " J 1J0) 6!)}tH hK23=DoH!?@s! D!FcJ!eH?@s! D!FZJ1+K#CNK2+*KK"F*)FLJRH  (BF0@JJKKKH)ؿF@J)FJh~#DHJ@I""e>H*+>D1*+خ"N2+2Kj+?ήR-ɮ J!F-Hj 0?4#CG+FJAFHFN)F #5-є4#C#2!xJGqSb+-Îã )=%-×!'# JEl3DJDKEH)ؿFDJ)FIFBHBK2+dO&"ESB5J5K5H)ؿF4J)F&4HI2+B-K"F*ݸ&J)F)H2+-#3 Dxb+ѝN0)+J)FHj0)+J)FHOK +"#^K)F JH@F}! }tF(I t)=%+M!xoĊĿ{ĩIJN-CFELFbN%$EBF$#"KI#&FF$#"GI#&FFO8k#P*?#B#C2!F F##*? {"F#(~-K#Ybr18F  # @ BpvP #BG B 7v]# B #CNKO " FREq !8!x!`+!J1"F#BFr ;FgBv#"#1#Cl)KB,@*-OOO%#w+FH>FI)KR-+{КK # VJFSFVH* Fb Brc i +zЄK&ihBW# gfW@~H#"#S 1 &jF eEy ;FEyFFO44,cK(rEyfB,a`Ht`K! # ###" #EЕ10F#BFr F #By 6uDNE1˱O #BFr  #By 1)c 4#C EBv=F4F+K"|2 IFgBOKEOI (HKF !!JEOSEO#+F!"F8+𶁍-/--Ѕ-+#4JF@F4SFL2+z+b]@H\F!xH!&XN:!-HK"*B,?IF v%+D-B##@F#SFJFh?@FN#BOEE#QFHF#3h@+ {##)F@F#SFJF(6FI H-+ P    PF6   8*2+R-@Hi(O0O pO}H@rD2;SFH2";S;FqHF:2 ? SF"F!iH)pp0`&?@rD2_H;?C`SF2";SSFSHF2? SF"F!KH`&??C`#2 :Mi<+hD#1+ FEE D U"!XF@F$f ) I" B #SEr # # IEy+wF#4JF)F@F4SFN-?V!x !mǑǤdzipF+3iI(FHI(F I(FKhh-Kh3# 1F(hXKh[ sKfhh Fph1F(hh$Fk5+5!l-,!t-AFhF(FF0F@D(F!F3FJ!FF@DL=`FFu-O]Kh L)F hHdhIK# Kh UF0>H%,FFFHPi*r+/#9FrhhGF( ЄBFBF(+ЁKNO@瀃JF'ShFFCECFvK hB,F `0F0@,kM+h+hqIrJrK( FqIrHqN-hqO؁-?o0)h*i) 1F9FAFgH-h+7JFeIbH%h! b8FshOc0CFc [I*00F F)HF2UKhCFKDE xX21 VHգ  ;Kh.B FHF|2F#` 0B ?#1J3`Shs``V`5JSh3S` 2 F8F^X T03i0"FFhRFIFF  0+6h9F 9FH0F0 0 !!߈ߓ ߱)j!X%|+7Qd@dzTy8F0FBF0?sEF6h7KKh'KHFI{iBs?h(hCH#)i$+OqB SO h:I:Hh*i2Z`jh`4J#+`HShk``U`h#{a0;0*9 : vDF:a(iF|h|(F|B BKh6h.Fh+si+0FTF/!/4ZO.8FF( ?ڭEF!!(IFH6 x7KFh°5Mc+h+P3H FB@pGHGOq4,Kh#+h*N+O5F8F)H Rsh;s`+"(FF ,kh;k`+!(Fz (y, $)hKJH)F,hd 3hZ2`x竉$+hZ*`x +Y,n,N,ѤY\B\A!\!dI!TPW):O𵣰#LFKMh#`+hFH#h"8F+ !F)"hڹF8F)yH,##`.9FvH2%(F#+h+ +h+ 0F00F) +h3+dHdHD0F"rF0F)+':F0FC;FC|-|7B+hLHCl+hGH(Co0FCg+h>H0FkCZD8I (5@0FnCG+ EhC ,H!Ԣ)I $ %Hq#0FGC%h DH]HDW%|0F) ?(HH#%!d!`!\agw%}\-G  FOrF)F)еH&0F  !U*Ѫ)ЭHl"!ZO3n{d+{ f`(&0F(РH1F{)|{`#` H|j|)}"|h~#cbk}}"aca}!+~a#~a~e#h#b+#Cc!b 0#"C#cbclCcdfl3%0$ +"&0B'0b(0e* Dd mHw-0, 3".0B/0bc1 00#2 #c"bc8F F #k"hZCF"BBVH7Ob a8F)o"QI `"NI PFع6ù66U+ѝ6+ ѝ8S8;8U+ѝ8+7>H=I 6F(`;K"!h8F4S 35ES68#kKC #k"hZCF"BB+HOb a8F)"o&#k뱝%5#%C%c%c5#%C%c#dck"!h8FKC Nck"hZCF"BB H c"Lf&>RRaA xOr8FAF)ѕA0O" ! A0ꐱak '?Hb]0B9FHFW7e/XQF4Hw%h ik)F@ :# #D f)F+Hcgh9F*H^cjCbcecmBF%HSj9F cl!eopCdOrl B!opBBOemBRFH@sB@sOsBOsH KOHOX}C"##ef#{0W F k M h%*FFKC p#k"hZCF"BB"H MOb0F)>oFk0F!h 1! 1#l!1 ! 1#k!*FKC 6#k"hZCF"BBH:F0F)o(Fs FFlFh" B$c#`"h"n3f $ o3g*mB KN 3Fl@ H*FR I x8 O3#`pK r%zj-OFmF FF XF{z8YFH3 hHF6# v;F2F BB H{bmHF*hZC)m+hSCB -O%U FFh4m$ F{2F@zH!F {3%7"F)F: sil"xxBcxL+J)HO|`E'є<4 %lOr BopBBp4O3mCEl {@8F{#`(F opEBє -1%y-.ey-+ѥy-(y-#%;OuB)opEB-yy`y yxAIAHiAI (@%%y-ey-ѥy-y-x2I4HK3H.IE %4lOpcxO"xB " op@Bѡx4BbQF@0FG BFCFiG QFBF0F4C QFG 0FBF3m[EE٢x ax0F4QFPZF;D oC`J!rH_P  KJ FFpGHpGHpGz'r%-O FFFO 'mBPF<U1YE! 2K PHF 3F7 2 9F6HZF5I й#J 7  F9FZFF*H{*I +Y3Q#BF&I(3Y+QF F"H9FaBFI (I 3Fs9FJFFHKI q(IBFk(# FH9FJF5 I [(BFI&>YvpF$+mBpkhBыYl`Q`-AF F IFF!F02F)F8F  I 3F:mB4X+O30`T-O"FmFFB @O%;mB@FAjj 3F PBX1 +ٜB؁b20QhBёh*F 4X,٣B a 1 F)FF,HSF*F1F8F~H5@hB)0F"F,УB"F)FHB)FH F#F)FHXSF*F1F8FQYFJFF t9mB$3ZhJE =JF1F8FJ "H 4Y]`,oT-OFhmF FF^C0FzeFH1FjHO PF2F!l#lf.ciOqB+pOkppopABP!OzopNE?O Fh[E(F{7*p!+qpkqqqOsBopIJE O O l!F8F"r0(F{O JF(FQF PF{ OlX 0PEO)pEn0f px2<c C<1n0fF;Fn0f1  Ep2Dn3fI2  h8Fm #"h#BFKF @EIEHO W  _2F)F8F(B\-GF FF%&#mB#kCkJ4&!lK@.Z(F3QhB$X 3+hԒh1FHF 3F:F!F@FpCF+ QF$02F9F FE6nBHI (n&c#mBn+ X+JH I ("m#ByXA#d!F@FCJ3&>']fph OBڼB`\%%p0vx.?%[!-OF5NF#FQ ED,;mBB  QD:nyhPF#:h2### #BBBFPF(@EFHW o ;E#PF# #BB HBFPF(nEB$Y!!-A"MFO/V#c~8F 3FB6F9F F$h,F ?",3F!KOpz.Bh%pG!-A t VBPBOO  #F^,( 5B ,  +B"!-OF@ 1F D+@ mB@$X%F'FO3 D0, J 0X`v  3 # # FF BBЯHbub`;VC"2F  (B.6s e#BD00+C @3 [# # #BBH(1#3p 632xj*iHFFHI "(I(1"AF#(1 5  O(  cC(1 B 5 "BDDD(1DD#D3pbK@!bJbH& +`I((1C(1 D z+h3xY E3 =FOr!PF7F s{ E 3 # ! 3F ( ! ( ! ;KB:HY%'s+?E7HP-)'F0FyF 06H1F 8FyF(@Fz9F.H-N0`H@FzHFz)HiOr! `lСk)#mB!H: X( +ShB khC`3h !縹H+I Qk" P ;F H H k!h-[!p!L5% %H"UF%h˹ U%` Uz5z1 UQpXh!Z`FFh` FYhh]`"F!!hK-AFhFFF M%1%9FP`BF0FC$ F!h!-OFϰF sIFF(:qM5pKhh5ElIlH'QF ch5EO D5rnDB!,@5 1+ 52mBWIYHL pny(THN O"x*/ 4;2hBC@F#" #BBDHrn@F'snBErn@F'PsnB\ nOr!3f dKF3J ! snhO ,(SCLFF F  ! D"YF >KvK vlopCBѽ,1#u,1cuL@F#wL cw01w01wLhC`## N#BB Hh 5XN!!h(}!Lz#5!KpG!KhpG!KhpG!LR F!F  -GFFF P4GKZhhHM+h;K^h&hH.`QFHF,@FzFH? Lch ch h$h!FFHv !!l5 R]pG R]pGHR]pG R} r-O]BNFiFBH$`'B?H8F ]r@28F)F'.O C,Tܹ#pB$ OxEz+ dE ܹKh+Kh+ڤй/I51F5#FHO ?+"pO !T!!!`!!x!HiK-OFhj[k^C2F%kF(F)H #+rB۵B@  F)DF(5#h+%(FQI F 2FF"kF Jp/r # 0 D"c #_bv g=K #+FrF'kB0F F0/K  hhPF X)вEڹx  F (K%k(FAF> ##hbpED+%c ?{I F 2FFCiF=DW@DS# 0_K[! !h!`8FlAly2x!F6Kh `F -Cx q8 !T-GF` 4h_"2$y4$4B2ۢ5FFF0QN3hHF Cxqyl\3hKKh3Khyq  !T!t!-O FFFFX"!F #0lKgE8!hK#$ZK]F[F"F$C$ 8CF#sl"F[F HIF@FLC D  DXlPF @;;F2F@A @g |9F0F`FUF01OP0  ! I I 9# +rڸ3#C?XF pitou"F[F HIF@FLC D  DFF 3T#0+# !p!`!#C8 FFC ?h#3B # # #0 @pOi) @p#P3B#    B %BBpՀ:kECi+@Oi':h 0 k2CiF+@ڀ:h'i 9h>J0F D0 DB# 0KP0  %@8C/F@Ex ںbi<5@D5DL0@CiF+@"oIi AnH mKh+slH$# 0###"#eKhkRF###  Fn    (0 (0(0 @pni f(  bi<5@D5Dl@h"FQF&:hFD>Qhk4H(1Kh,KJB0C {cFJC  2DTA#`   !C C #[BrYB L"hi#a0 09FxUFSF `0F"FLC @ D09F0FoF Jhi Jh" !x!!xT!(!p-OI#]BEBBѪK#BB#HK4BB4)Kh5`Kh FFRFFFF 2\5DJBiCpcFJC " D J oIF@FFP`   !!iFF(F{FrJcnsL  sKI 'I hF)omKhmKhء#kH[Br#CFJFheKh+cKbhh0RF.@VJXh(uZJh*<';F#XBnF4X S `  O0[/ TR#BBҤ0hC B hC B64;Kh;K9F8F80@ O%p [E[E4wBHJFCFh K`KJhh+ #OsD`$N!!!!!T!!!!!!p!!!!x!x!!t-CF4KFEFCF"FS;F2F,H!D5)I@4E'I(M#"'Kg&Kg&K`+h+7$J )b)bSF;8wF(w?K0F9FhF\K"hBB(FKh+UѳB#iR#B#33BC":Di 7zB# 0K)Fhbh~KBxKhRoBO vKO FhRoZEsK)FhoȎءED۫iO #ad'hia R Bh C ''߹cJ Oa F бhiJD! "    R p B pOJ`:hi*GQIєH0+n#Cj#0#@A ,@# ,APFh<,LfOR9hi(Kih&KhiF# 0H!!|!!D!(;Yz!\!h!1!EZ!L!!,!!0!!!H5L#h5K"` &;hjB$uL#0,Kx #h+*H*K"`+hӹ #(F2$hE#(F,$hL@hu#6M*hH#hHl( H`p  # B" IH#(+h H" !!h!!!|p't !hCHsBD+r3c32x 5CD3pZ0SCFFFXK\Jh\5B{ SC67DhUMGr(Fh0iXF LKhLKh*k+kJKh+nx0HMF+h:Khj9FFd XC#F2F?Ip>H|#+`=Kh+;Kx+:M0B3B!F6H"0B 5s\0[D1@0B@r2DQ$lii$ XCSC622DBwy+ YFi+00-R9@0!8!!!hQ!!T!!!!p! !|!( U#Ӳ! ">C g7F6g@O1BiKhQ#C #044C4]#@BF"BB FFYHq(FtF0)FUHg *F!p[IF@F(# HhBB#YB FF#&?&JIF@Fh;h#OrI0#0;hSKh;0 0 p#h7'7+π{I@F(ƀAFxHrK"`#+rFi?eJhF#OriI0#00SbKh;0 0 p#7C'3y3#  BQF"## hLDF C;C!F F0"hFF*8IF(@0y+1J+#(Hq(&K!h)y('z./@퀹x(@߀ J%%`H(/K`࢈FBHH3G'ڭ :F F!p!t!!T`!h!p* \8FM:FO  F#YB h)FFHB&pC_ЕH)FHM($Kx+SO300H)FHK"`J#l!l `J 00O1O0OP 00p OPpyIF`OPpFOPpsI `#nH3!(F(0+bKh+)FeH9F(Ft`4hT!F8F9F]HQ h2hZL*IFFO#F˓FFѐ*FZːwK c##tK$(B LV0CF6OrEu1F(FkH(?]'&=FB$ ᚁB2й%AC[ ˚ KF@FZK`R7F(нBIUKVJVIVKWHWKWKZR! O3F)-SB)F0(D[3AFD)Fu";F>3FI@p[I /K7Hh5H4H)hOR 5#s 5X,KhI*Kh#F$# 0%Kh++h$H"K*hh +$L,CKh+gJKH) FFZ !|T 1!p  u     P  8 `!0!!H !!iT H[*hO LcjXCKFkSo F < g @vFF  w9D H1FK 0Dh@FgNKh+1ݒ0+-0+[H1h"0P%ORc0#X30rKhdKh#F # 0#h+NуKh+J3h0+E0+)H)h|O0F0:,h"!Wp0L%P%0Or#X309F FJOR)h 9hdKh#F# 03h !@s#;]Hl\H(1hOR 5# 5NKhLKh#F# 03h0+"HH?HH(1h#OR0:Kh8Kh#Fa# 03hkc)!7H4Ho(1h #ORc'Kh%Kh#F;# 0M+h+@3hL%2o)0BgH3h" 0H0+NOR1hh KhY! !!!p!!, !0! ( q     Kh#F# 0 0H(H(ԮH(+h+?3hL%2:0B۱C1݂H|3h 0}H0۱OR1hxKhoKh#F# 0 0jH(3hlkB0iHE2hk[Bd0bH\0۱OR1h]KhTKh#FT# 0 0THe(3hl[kB0PH2hSk[Bd0GH&0۱OR1hBKhw9Kh#F# 0 09H/(9Kh,{3h"F\HX$9 HF(*4,*h0'H0+YOR1hD!Kh5Kh#F# 0 0BX 0+ЙBHK*FHF"<:`"0zh*G+  !  N   !0 ? b!d+ H(,h3h$,%*@c#BB3zHL3hc0tH`0۱OR1hoKhmKh#FX# 0 0aHi(3h(+hx)6`H+h+3h <"x"(%0VH$0OR1hQKhuOKh#F# 0 0<)BH+(1hcl#CFBB5?H3halCF#04H0۱OR1h>.Kh0,Kh#F# 0 0!H(1hcl#CFBBEH3halCF#0H0[OR1h Kh Kh#F# 0 0  !0!   H(ДK"`+h+KђKh+G3h,5+B0+H0J1hxh`3`l#,5cCx<#(5F#`lCF#ORyKhwKh#F,# 0 0+h+jjKh+f3hL53a0+hHhJ1hh$U3`#L5#P5OWsT5OcX50.-D\HH-O@nAHDD#DDl@OR0&BKh@Kh#F?J# 0>J 0 0#0+#"!# FO3O2#@F001# 0!B";#:+/+@SHKKhFLH0+m7'i#8F;q{q# 0# F#qcqiFB9O@H:h7H;h+i# F#qcq# 0%K"`$Kh)z2KOb1M`+h#.K0Hh6h.L 5s#"F#p+_Fa*i#pg%H( 3#H(AQH(]vH(ј7q!(!t1!!|!8!LABL!|0 M}!`!H!)5'#H(wi}KOrK7kp0B% "H@S(hHJ%x$!(FoK!`F(FoK`(~ج HZ"i J#p$`J`Jɼ5!`!X!\!@Kh IpCOس_гOг_ Kh H  Oг@OгO !!H$7K-AFh5H5I8FF T|1Kx1Kh+9F/H/K p-KxD'Kx+9F*H )N5F9F@F&Hsh;s`+(F.IJ ,kh;k`+(F$ (y, Y,3hZ2`x竉պ+hZ*`x +Y,n,N,!|7A!!xV!!_PWеF KFFh H;F2F!FHe н!|iA1K-O%`0K`0Kh0HFo(-H,KO7aO` Pwao(&KIF&NaO @fF P>Fwa*F( F( oFHFoF̱(- Fo05]Ea#`@\` va-+P!0!(!}!!8!-OFJKFFhOz 2##:FB+F"F;H&J:F!HF8H䠰FE +F"F9FHFF(0F CFAF##IFBA# B/K@FhF+Dr#2B$+"O{̣F`D K aFXFd##F F HD60DD#H8!|!L-OFFF8"L%hOz 2DBFxEK"`;F2FH%HE OIFJr#"hT!hB(F;FrH#hDD!|!-OF 0 FcMiu8K i8Oh\7I#B9F5Hw#i%0F Pea#i/KB ,F/FF0PBkLc0B>DF#*F1F0F\0ak[nbC @{  !@ @CH F1Fh80#*F1F0F.04kD!|+!!x!!FI hInJ  #hD 3`#CBB K1FhP J Hih3`+F"FhFE7apa!!!x!!-C F!M!I,hBdhBHRd  H#HgFEOE$hiF F# F`"hS`+he`#`+h,`\`iCa!!7еFFF!X"hFhFgfнhF+$ H0+ F KhS Hz##` HSH(##`FH!|N ZbpF N Li3h!h Kh32hi hp@Zp!!8!K"`pG! 8FL FEBB H Kh Kh FT1BʿPhH8!~!<!--OF F gFFBB *+ F>IjIF@F:KFx;+*F5I FT"YF%PEHPEO5$(KgiF(% FR!F+FF/"E,Bg./K9F0FgKuiF.O/0b F?#<5R)FO p!03mp\%bK-CB}F F@𷀐0+)U h#O`oa(`(hVHOb!FSKhSHHRKh+:QNL533hOOx)hFFOHhF:F Wq3hIFHF6#= R- 3E3h)hF'(h:FiFWp3h)hF |q F#~q F#a F#a F#a#k"j\3F#abjF#ajF#a F#zsOQ0 5L53 #P50"0#"# }T!H!!\%!KB?ѐ0+; 5044b303040 40 5 5L5?P%P% 3WqWp OrOrpGT-C0{Kh+@yJ`yL h(xKhC(vIvKx+@uKh+ˈB9FFH# i#aABH`(D@K%"`(F=HR(:Kh+@+FtO m0KF`# B\O3 hD=8F#F F( BEr,#| By i#ac!!)!|6V!F^^F!h!p!<S!h+gK0F k -! 0 mJ##B 1 Z! 3 AT2#F 8F(@ 3 x +8O 3F#kCK2 "## B[Q" \A@8H!0+B6H: + 2F"@p+< i D kPC#BrFF BO  i"a#4`3B#H#(K` 3  8FkZC F 0kB [i+HF檪 !h!|MJ-OFKMKJLNLIF*hFAGI xFIr3 h{"#F+hkB]iE;HAFa 8Ii"pB ؀%ؐB i#aDBF8F (85S%5#1F@F### ,0HF#8F### @HPF]( K` !c!)!\!@c!hU.!|p8 L#h 7JMBH+h 8#$ds#CH #h# fs#CH +h+H H( &  !F^!|vA -pG-OF F FF9F0FRF[FPFF FO``" PDOO` FE`۽ # D#F aFXF-AF FF F F!FK/IOF !`#q"O1 FF߱2 !F FFe[I : ^FF^ :p FFFf2F_2FX2FQ2FJppFF F*F((mep-H EB g\EeE҆BB,  ^EgE҆BB  #Bp  0FCkFk+@R#0#BBh-GFFFF3i@@B>K@/1=J>HiiBEBAqj D OE( $ XDA XCAF#]IFB@FErh((=4D 43i$  XDA XCB#]9FB@FErhE#gD FMEt+F"F#-Ki!@BK@b1JH@gOEv4FFFFF; FBFFK HMEt=F4FEpF%ckBӮ+KO1aJH;ch BhZ`Bh`m#kYk(5k#K@1Jp2jFKh[Hjm# Fb#`k3K@!JH k@m!@I2#jF3K@1JH@mm F@m~b6-OFF#F.S3 +L3%O=pO=@O=+=KhZ"BF9FHKFJx.@O0=l+!:F@FFHKB ЪHOO "PFm3F %5F 0X!UDhBUFm[jaFjw,Ca# ##hb ### #C #C;ЋKOaJH{ ";F@ `IF@FYzKh[ ## #{H##j@#kS)8S!3tK@!sJYF'BӸl# c@&06B #?gc Fg #"#ig# BB`:# FjF(@%,VKB؀3B9;B@ 0gPK# e`m#mReegh#mDl=emF=O)F(Fm<%m fe0D%e ciO F SF#0B F#BB'H ciB"## B5  #@@PIg# #FA F;F2F#BB!KO/aJ!@{WABLHYWABNf3l ##QF F#3B l ##ck"k;@gR#`H`B#kF`3cbi#F@F0Bf 'ci&BE5  #@@PI@ Fk+K@1J{;ch BhZ`Bh`mT7F HNO% FFV F FXFO ~E-GOCiFFj3KORaJH@O0$l'FFkkBHFm F+kS'`7#IF(F#BF?F(#AFHF#RFF(6hc-AFCi%FF@j3K@:QJH)F FHY K@;QJ;F2F@F(d, F c-CFCi$FF@jF 3K@KQJH!F(FK@MQJKFBF0FP#9F0F#kF"FH 'DH-(Fc KsFhF L#h H#d h)F#3 p!@!x KsFhF L#h H#D)F# ho p!@!KMx(hHHH?( f(h^N$O+hmB2hR[m8FS4Rh 4!!A!@L h@j 4 h_##`!7FHh(j,)F)0 F!8 FFKhñmKh Kh`# `s#BB 8@n !p!!lKsh;+kKԿO@bO`b`hM+h Et1Г`)=dHTcH aHX)h`LOR 5i#s 5#d3YKihXKhiFmRK$" *hd3C+򊀒a)Y)Y Fpa)4)2HHAHg(@H)h?LOR 5i#s 5#d3#a37Kih5KhiF(# 0#$F! Zr$t#|3.h e# FF!&H($Ho+HH(?iHL)h#ORa3d3iBKih5KhiF K"$ {FH!H!@!JAe!!0!!"I@ !pG-CFFFFF6̜BF "FFg9F0FL@1C0@ 8@F$"C-O#F" ##F## 3KFF h3ScEF*F\JF1F@FXCFDшN2hBEL8F(#9FF 3hCE@# F#O3 ##F2? # F ###FPmhEF,ZFjI F(F7l-t-b- F0aI F F9F Fm FA) 6 F1FVF ZFOI F1F FHF06PBPBCI F^FF HFhIF FF?F9I FMF#+r$4"### FF*I#"# F###F#ISF:FIF@F F0?[1F FSF:FIF F0?L;FJ!#I F%###rO5 l?1!,'-''''(+*(P't-KF jF FF&m$BJF9F(F)F #C F:F @FK2F9F(F6s ## F -OOF F#F"## 3 :F1F F?F ѪKhB9ЩI amb'ܸA(иLСI Pl lO0c иi (F0(FE (F# @4pCO!,F#"## F # Qh! FF#C0|I FcB&ѱ8yI0 )`\##b"44###$F( FjeH<aI F5_F8F'l;/;x/+8F;FZJ[I(#$lF TI FXF!N  FNI?XFp?l?GI&0.#*Os@I FOr9FXF/B F9IOOr9F0FR8Fl +@""6)!B FF'I>i+6ii+ *cКBPi F$~3F0?(3F$  Fv0?IF FK0&IBBS(,-(@dz((1)g))8)q)):FI FsB F 0j$!m#80PF (ѝ#CАBB#BB|)-O& ( FFF7FFKmWJQF@F*BF # RKhCE F$! F$H7JI FP-A-FI F f- p-YF F.0O5(F 'O &#a! FF(D#" F##"Q.IO#" FIF)IQFOrESp1##"x# F##"F FSCFI F F#0? F0F FO50%%*3,*9-*O*d*v-CFFF'JFAF0FfF0 3KhB 2I Cپf-r-'! F^!F FY!F FTFn$I F!I$$! 4IF FAFI%(F$$!0j1F FBFI/$$! AF FCFI,-****+3@pGpG"I@ !FFFF4[IFH$"F I H:F1F H5*FIH@ I @87#+rF FO0M "(h)px+S/ Sx5h2"#b+B+Sx (h(#(DLO2BC;S@۲T#0"-GF%B6HOFEE# 056QOH Fx@XO ѲDBo"|@\O)F  E!pFFo  E҈ ?`?a papOp  E a!p?a`app-GG OXFFO.KXXCB!#+F(  ,ѓB!@3( ( ?OC  3BҨ @8@X@S @\@ 瀱8?ХOuRESSFO0-GF$F F 8FkcFT# D+F"FBB0F&kW0F:F1FtB-CF$4&hF$TD+F"FvBBO0BF @E40FC4#R>]pG3FS[hl)FF F'0@pGF04[ HN `]pG-O!FFF0UF O0'"IF iF#ahF FTB 4+KFBF|I(F Fk mF`m$ PF^) F JF F(FF.4+6 FFbI(FQFFm4BK FFXI(Fk8Fk\+ݸSKRJ(FFPIVOO (FJ####KFBFd(?c&zk##F(F FJ(?IT B`m,zPF)(A FF 4H h+SF!J!zBFKF#YF(F#BF#KF#F F(F(?sa6 mBӪ$+9+]++1+5+ +-O!FFF!F0I FO0!ESB4+[FRF|I F@Fk #F)#32*[ 2+%[FRFmI FJ#" F####"(@FkP竹4+[FRF^I FP4+[FRFZI FE[FRFWI F#" F##[FRFVF(us +y+:+8h2F(.OO COB BF"OHOIH#FFCC FFC [FRF.I F 5BX4+ *xIF@F F#I+y*+#BFs#KF# F# B (?3ha3h33`#[BACFF F0++, ,R,,+,H,d-CFF OaFkFHy1FyH F#aTet#$4##OF@Oc!0FqC1FOb FaI F.C F$k/aN0WI@4$$pCO'В$BQI@0OI$4#MI F#C6*FII*0GI#C(EIdF4Os$4#Cc"$4IF@FCz#`Fd"$TIF@F+F)FvF F2F(I F}4CgKFBF#I F;F2F F0?j! %FC] F F0?Y"# FB?P3F2 F0C,,,@d,,@d,---7F4BB*  I0 I FD4"FI FR@d-`-8!FM(I(F 8!(F@  I!(F7!(F14I4j--.-AF jFF& mF`mACj&aehF FAF a(FBF I(F F9F(FCFI4F.1.G$$ F(OHp F$+pOqOHqOqqOpr pOpOsˁ ȁjXm j0 F F -O FGFB,T;2FAFHF+h^HNFIF@FBFIO(H FF^F#h+h3FK>JIF8FCF C:JhB$9J(Ff*l*Y(FX1Kh{YF0F.I0FFx2F+I(FI*I jMO0&LO`j9`#I(F2j:DE F@@2#F!z좉RF2FI(FDE F*$ ! @(p(F0ѷ33,}(g.P093}FF(! FFj;X#gE3#3FHCjjj F@jл-OFDSFF ,݀#gBEx , K aEp "BEiKE3^EgE-i)- IgPF\Iw a%F#bcb$iT@gPFOI\(F )-JKS! -IIPFGKHKS%0F)DJ#aIF#@F]F(a gbCb@EIEciC{a#ea##fFFgT{FEE#i4]a%aih(#g B g F # BFb #ciCahaeaCi,aa ayv(F IPF4[IPF%d44D44+445-OFFEF-t1+F"FIF@FC +FD"F0D+F"FC+F"FI`A02#DPFY(@#+#rxYL#ExC#h##gb#C#BvVۯBvR#CK-t+F"F9F0F^C0vD#3##g[BAXF^ -t+F"F8#C+F"FI`A,0#vDfgq+-OFirFFF۹xyIPFUb^vIO5O4)F Fi pI44#E[bAFYF E3i;a3i_a0FKFBF)F F 0# TDBrEPF#WI#iEd B#[bFFYФIF@FC KFDBF 0 TDeEt 2EiOk D_ 0IPFCk8ag.?jpag#[bFF#YBVE{RIAi I=#F Fd ExI/ h# d J#Y3i;a3i_a0FE455%5F45`55iBpGipGipGF-OF FļEoDEz%$Y dFJBv%%)F Fj` FF𵋰F$! FF8(F IzO0 g !J(ȿ  Fܿ# 440zVIFK"F IH$^ I H N MV$(F4, I96d66#6*"* IO0**    7=@pGpG*8F FF#*"/*! *!!+%J@!HFK F*FI ** * * 8   F JR#0O07\!7a-O3OBFMF@cI(F&F0Fh^JBFBZI(F Fi'FFjFy#F"FOFREu4+KFBFHI(FIF@F"$4OTE4+ݗ0!+c8J@!8H7KBFIF(FiAF (FGC781FH#0Fj,$XC"FYb FFFF#6F# B 1K0F7pO HCHE{O O23rZ#0#"7VEW777\!7-O| 0 FFFO # I=BF9F0FBFчKhB F ! FF#C&~I F f- A-zI :F(F p-s-#IF F0O #jO Fh#0?4jbF] IWR4+ ݗ1"THP2BRK D0BFQI Fe!* ***7* c2*FJ@!FHEK * *****Ӣ+;I Fv*<*<Х*+T5Kc"KF FBF7 FD0?Y FD0?S!@"u(F#(F8QF FCF%I F7K 8H#1F6d IF#F@HD"1B0F %,8.087\!483E8O7)F-IFFOEe jhNcFPN FF(`P2FI FO5_(F F'CF2F I FPCF2FI Fn=Fk]8~88-GFFzBF=/ d4:H$O$$1jj0j&.a(Fh (a FCF:FI F(F2FhFFOKF:FI F5Fk8]8-OFFFBF9F0FBFqKhB FFF! FhkI Fr-iI OM! F! F!  F! F4F# $ WIyѸ@RI иq4k 4k#"!#"!g 4;! FFP%u;F2F! F0l#O O " FQ6I#" F#F1IAFOrZES2F1 p;F#"# F#fF FCFI F(I F1狹{Of Fl0+jBB?o IF F(F,9.H9(9[*O*d*v99𵏰F FF!4"hFOK :F1F(FCF KhB # JiF F iF Fr0I E9]/,Y.`KSB@pG!-O FF#F" # ### BF9F0FBFJpKhBV #+r F g`i+Pi)M#BBG # F# #VF??F/ F$ g8 3 FF"QIfZFOI F'b- F2 F0FI F(Fi"$49F0F6 F9F9I F0E#EEW /v#IF@FC *I F%x#QF F#KFBFFs?F@1B0FF F 0- F0g F# I#ZF,!/.|::D:e:;pG-OgF|#FFf#IFRF@FAF KhCEI F s-"3FF F0O5(F# F#"#NB?;@:[ #I F/"$4X3@2[E#r  # FI#[FRF! F?F(# #CМI F ! F,! F&I4j! F!  F 4x# F#F# FIu! F |I! F xI#EEuI F%X48mj"FxmmOcB#FFj FF Bp[FRFaIN"9F0FX J #Br 6#b FF BpQIX#[Er z#Ez#Br 4 AI6 jg4j 4###3a4#1B0 \!0F0a F 4j441J0 YFPF FA0?1+=I 4$$j jj,.:;;@;T;v;;;!<>< "I>HxJ!>>Hnm#$!8HbH` #SHF |]=4=L=c2 *= >>?=/ Kn:f*oB (I콚mQeppGP-OF FF({ JmCHPY@H@H@H@H@H@H#C8HI"b"=HB *>>J>w>+0z>>=/a>-GFFF$#"#BF9F0FhCVKhB!(FmRH@1(F g( a(b(KI F8Fl(u(i((Fl0DD(FDD#+r(F4Xi+ia#BEKE)(F7i(J (H'J %H%H(F F.#@F  #@F iPF #!F#2ji |6iHF,?-.&X=-=?$>c?W-AFFF!4"'KjF Fh3ScEF*F!K!M*FAF8FCF<"I0FKhB3FJ FT*l*H O01F F0$ I  F0!?s?,U#.Q+B@+pG𵉰4OF F#F"###:F1F(FC(#+r F+g`i+Ei)B#BB<ԱKhB# F##")a8 (!$I c F 0, F, FH? i?,/#IpG{ {S{{zzSzzӈhJ$ ]@@pG FhFF @وzrYz  3 B-GFFFP+Fz Zz "\ 2*cxs+x'O "iF@F`02F(FBcxl+H$O"iF8FH2Fyi(FCjF1F(Fi7/4,%4-OFF xk"! F IF Fn'8F 7"F 6!I 5  3 2 1  . z ( ѝ00*+<%O AF0ivF@IF F(5-O7@J%4pFpLv"F@!hFhF4GB p%4FO$M:1F(F4#%4@pFK$F4 F5r)F`ip@p%4-AFF4443309FhF$ CC00#@c0 OHlCFI(F( F&F2FAF FN I(F FO4 IB3F I(FD Fn@@@@@𵏰F FF!4"hFOK :F1F(FCFѬKhB#JiF FFpcFJiF F< I YFFiF Fx09B,uI/$FIFMK8SB@!tFIF7KSB@!@pG-OKFN FOF2F)F F?F ѲKhBбI F@FAo;hF( $F(:I8FP(3XFlF 8F^F('8FI([I`F(@TXFI (Fh( i;+[`F(%jOq(FF(퀀IPF(O #"#1+>F(рF(ƀqI0F(𿀕 F(jI0F(𯀕 F(cI0F(🀕 vF(\I0F( fF(UI0F(Е XF(wOI0F(qЕ JF(iII0F(cЕ <F([CI0Fx(UЕ .F(M=I0Fj(Gе F(<6I0FZ踳 Fh/I0FJ@ F)I0F<ȱ Fx"I0F,њF 1FHFȻ0FzIXF8Fr}B(,/@B(?TFBF"CI(AI(F&(?=(FOF$$1F$4B- 2F(?8FF8F$t*F{0?@I!"AF(FR(? pI F*KtCD?CzBCC7C!C*C5CBCPC_ClE'DLCIF(F(?֮f [ (эI(F(?Ʈ (FI(?  (FI(? "(F{I(.$"$FwI(F(?B FqI F/r$:"0D? $1DBF@EFI$2"80?YIM$:F1DB$)F0FRFQJ3FhQhOrOC##Or#FF (F| v8 ˌOr##eOC9Fse0e @Z\!e0F9S*F$40a0?)I$$1Fl$4B#Or#.5a\!0F $$20a"0?I$$1F8$4BѫFZ&XH <! ?EECEaEӰFF,"!#6#2#C.# #@%# #!K""'K P( K) K* K+ K,*F! F9F0FLS@iXȀiXi!XF"!hF"x!FhFVpF" FhF!ah"hFkZhh3SB"FF B J IjF ICI B $pEXi'X!!HKpFx +FK&&x+h Bx6@C0@BIHĻ[nð2F("!0FP2FI F0(6'Ԛ'o %%"!:8"!$4!"!0I F0𩀝l * ْI %%%H l m-"I F#`0X0нb0+HI F#`0F0нb0+x{HwI F #`050нb@)BksHnI FI#`0"0нb@)B`jH8"!$$gI F 0(+V &aI F0 _H+\H ZI F0WI F0 "TI F(@𽀽OsBOHrCMKx+?{LHvJKx+JHGKx+HH\CKx+EHTDHP#64I,2 F:.2>02$+*0:H:)-,˹.0**+2H xh300[Kx:+* ",H )F+H&(O%$i) 8F .?]5-?Y, ~iHa(i8i\\Gi\N\a\v\8ii\\iiF\"\X\k\~\\rT[-\u   nFHOsBH .\\0 I$jF%DED D D0I(F F08i[^F"!hFjFI F0I f i\ IF@0 KOq J Hr I F0I D `'NF\i].IF0I ( I F0KOqJH<0 F IsCF Hr F$i]@]P'NF\i]ZF!"! #  I FC J I I F_0I `F]ji]|IFjF 0KOqJHI F0 I  I F0 I ]'NF\i]@i]Z#I F0JI lpF IhjF I F00I f `F]]i\FFFHFR(FO< D5-++ 8F<<> @(-  ݗpFFF"!. F IP%`uCFHt Fp,Fi]  IF(K!JH ! F]'NF\  IFf(K!JH ! F\b'NG\0" F!" H  0"!(F( ObiF F( H F0+ѝ0+ѽ0i+]]  IF.0 K@A J H I! FS0I v \'NG\]  IF0 KOq J H| ! F+0I N ho'NG\^-O=$F"F!DI(F0L@OsP0(ڮI P0'+ @ʀ0F#  !(2<( *FBF', ܝK HKFKKKKK (!0!!"F  FԠ3+O @0 P$8K pO23FB󵀛 r`ObpF}JE#|KDpSBOI3JBOc3 BOC3BOP3BOS3JBOB3  BA!p3!pF^Kg[Hj!0D"0 +^ 0 D '+?c =1 # FRL 00v@B7@BؠgnA3B'@O &!FC@@8)##D7K%0XA$3B٠z`!N/K` 0FP!8 ?B F>#x+ +Ā+瀚 *#+vU+kA+zb+ZHX0+Ɂ)*+њ0+𔀡xHi^_>_UL_C_G^\_x!_L^_"2+u+ex-@π0JB@ƀIH0+YyyHC!FHc{&{IF&;F6F@ =Zx(`IF&=F 6F@ 2D .4Yx(0HC!N+0[cx!zIFzH>cx 3D *tJtIex+FiH(qOrI53B> ;@FlJ:FhI0+СxfH0+!y&Fx'x`H`Iex_J=2UBݰyqy(y HF:76F@F-3ؚ0+OH!FtF * 9FIH HI3B*h0KBsB@BJCKpEF>H5 9J>J>JBѣysF H(F EDo&xHF ^  8F7H F2h4KBsB0J1KpEF,H6 9'I,J,J +'+)H!+!"+&H'+"%+#H )+Ӗ+М+HHbx!F2HHHHHHHHHHHH`A __^D^`*SZ3^I^V^^^^^j^|^^^^^^^^^^^s0IFjFBF H~ F%00I (F$@(Fi`F`ZsF FDjFI?F$0F:0K@QJH FFI x1\F J I I(FJ I Fe p`'NK(`a.a@YxaZpIFT@PO5#`(F$pE@-I (FeFIF+F I0F0 I tjF I0FTFI Fe|iaraaia𵉰IF 8#`O0 F0FeOFI PF3FI8Fp0 I 2 I8F$F0I(Fe7 FgaaـiaF("!hF.jF I F{0    (i8*I+L!FFH+a𵅰 #3IF0I  dFI@I0F0I2$OBȿB <(Fe , 21F8F4 ixb b$bJ sFFAF` 1F FE0*FI FabcHp bs-HIFjF0K@:AJHI FC0{kK1 @g I F00O0 'ЈC b'NK7`ii IFjFx0 K@A J HF I F~0H~ &k'NKB`ꀐib IFjFN0 K@A J H I FT0HT &r'NKN`ꀐibI#jF37I %]ia F IlF0 K@1J HI F@BbbKW`Yx7 F FS0J II(F<F0K@$A J H0 F I KF@B0KdYbb`;Yx7 F F0J I^0I DI(FF0 KOaJ HlI FH@B0KsYYYb`0 +Fa+W8A+=8#`O0F"! I F#k0I  iapFIFFXFĕ pjFI(FmFCĕ !hF\IFF0FF(F,@Bf2 iv-H F%IjFF0#KOa#J#H!F(F0O0 {$kKg6K5 !#F(F I FF(F@BLKb'NK`f28FI?F$(F0 KOxq J Hx) FdI HeI 8bbK`a.رL ! ! { J HG "F  I H ?+bbjFIFH@O4#` F F"sCFIHL$bK F$F J Im!HOML!(=FHK"FI(F8F+FHKlŹm!HJKIDD(F"FH0F kh0FG-hKc 1X+bcc%cA`pGA`pGA`pGA`pGJF `l `dpG1XJF `Qm `SepG1XJF `m `epG1XJF `Ql `SdpG1XJF aQn `3SfpG1X8FFH 0#`O080 +$ A;+#M(FC>+ #,T 1XCK \"Kn FpG BЛi1XZI"-OXI" hF,9Mh Ox0QI gOJH4 B0D1@@Ա FxBBL HDh0>IF"FO OF- (FhKXxF Bi"i+>-hhY, @EIE) B(FG(!0+  0 #BB [EԿ##+I LIEp(FG(Bp##"e';e6me5-OdmF FX )F F0I &drFnF@J I F I FKx F^0FZ ^ >"!*"ih*i~h x*.doh+9FF(>+9FF(6:FpI F(/khmKzh'Zzh"ԚzhzbK  xǹ FBFFCF[J[Ix Fy(-h UIhh@9F &1F F{FKJMIX&0"Oa#IJjAFHHv"AFNiNDI8F0!NBH"AFNiN>I8F0R;HV 1F FM0 ,J5IR)4HB#Sk0KX@"AFNiN+I8FS@#RRS'H"! F"AF i !I8F#O 80dF(vIbcKeWm"߈"KXeweeifi~f#f+f1Xifif:!#~JOai:8 z0:##Oa z#qJi$0+?n XFPF(0D XFPF0D01F FGR ^I8F0\Im[H~PFdz1F FWKx0{+@RKn/?Įh"1F FGi z"AFPFiIKRFII(F8Fv0ћDJEK) FF-CO8BH #,# #S;I;H#S8I6H#S4I1H #S0H /H## #S"I"H#SIH#SIH ^ Km/?l{h FG?h"1F FhG,f9ig g$"1XiieKe?{yg2g;lgEgPghgsff""𵋰FF>FI I0F4MF("hFjFI0F0"h+I" I8F J Il+`+h"F I P Ynjo"T(i8jyTjj-GF#I FF0!KOq J!H^ M,h /OyNF0FRFPF:FرF8Fh?FJ1F8F0Fd H @@ p@@ (` O0jjTj"T)sFTI FF8#`O0pF(FF FF( LF hhF``(Fd6J h k%"TsFI FZF(K!JHVF(FF FFLF hhtF`(Fd6 J hLO0p ljTj"T-AFI FF(K!JHO=h-F@FF0FpFF Fh"C J1F F Dt C8` O0jUj"Tk0IHk8FjFI Fr0K@JH@Kh *F KN@ @CsC `k'NU j"T0IFK!hFhhCZh$"`jFI(FB0I I(F~( I(Fx( I(Fr(%0"Ti7klk%js FgFH/gF H M NgF8  Hp!F(F4F k*Sk-GF&FfI x(F? CF_J _Ih("!hFr"!FhFhjFYI(F0(C!cFSI jFPI(Ft0OIgFMH>LI~B IH4FIs) 8BN?H!V/;KFhBіE3hBHF ""D)QFAFZh)F+H jm P F GdT% B30FgrFHF8FAFT% H#5B 6#F &OTT YnUX(i8>jyk1UkUk+*SkkFh F"!@-M&FFFFFB 08 caF0$hj`O0FFļļĜ40 40 0 0 pj(68hkbbd2p FFF@t(`(h6 F̹php1F"FF((hp.` Fl #`O0b 𵥰FF*FF8#`O0%$"!C-*~&(fF #ji!F8FCVh c`-GF FFF l#`,j3FfBO0BFoB#Bv#Br B"#>h"+O09F0F2F. #j)F@FT0hPFIk`-OFF#F>3#`O0i)@ )@ I(@F"!`-ڀ ->F(4I@}@ K.FD/!8F.F4#p% "!4# 5# 1F8FF(@i*@,̀ " FF"x*O .O "#`8Fc(-I>(xOsQB?qY)?l>A\)fAT PV0 P p78FcF(?R(FIF k 29F(F.F(Fc/?9;F QFXFo0?/0+ۀ,؀1FHFF(@KFVJ VI&((? -7-##`,O W Xչ8Fv( AP0, P ? Y*## O6DO6$H"!B>!QP9 F FO;+?4D2ҲxV P0O6J:,;+?4 FD2x#x*?!Fa( W<+ #ɲ CA(7<0< ,}+z#֙4l@W(lHx1VF(Fc$JI "FF F J I  0058Fc8FO6cW(a@aZ-OFFF!"0F%F3pW;F:F!FXFQ5y`hYFhF#G( F5F000+Ѕ- F#`O0(  O` O0 -OF FFF5#`O0:Dj #!ia00s)FPF8 8h($h+x-+YFPF((iIaiybh*,?#'8h( 8h((xpȹ #z(hHF(h I hF1F8FCck s`i3a lg-AFFFF=J#`O0 .ri!FF@FhCge`(F-AFFFF&0F(&#`O00FF #ji!F@F>CWh c`FF$ !FFc8K`T7`W4FF !FFc(KeDa7W<-AFFFhi(FFB hkaac) cFphiO0hkaac4i`a-AFF (!FFcMFp KBF`9F%`FC_a0&w F F,FcWD-AFF ,!FFc(F KF`%:F6 A$_b1FCFE0 F,Fc FWL-OF!8FFFFO t(JNEO B8#`O0pO   BݹO|C@`+h(FZ& "FhF3FeFG(eh6!F+h"F(F3FG(eh!F4-G%FFF/FOE(Fh^h&ifAF hAFFGFPFk74|*h"t[hG pGh00O0 BjF*#cbdiL Fj0O0`h$h0jF+##bdj| F h2#Aht0O0`k$h08F Fb`ciE``a`a# F#t8@O08pư&IFj%IF0FfF``""I"HbZ#`O0Fp(FXF FTxxFBI Or!hF)F/*(" !F/&*("jF I0F0H llWplliJlIH޹l0K!-Amx  Rcqcl]pGFcRFH H FTnxJh+`" RcCc>]pGK[hӱ" ##"!C -""AFH FO4"np(hK%[hӱBF! #*F#!+F0!F[Ht$  % U U FVFHFOHpMH$"F DDGK"GIHH4FHDIEH<  AHB@H/"!O0(" ^" Z6L%`6M"O0C h+0H70H!B* OrB (F'!0F#h+%he" (" " hp+OrB+ + O333"H*F *F"no o:kToo-o8po p1s%&SKh#p@pG;>+`Y T! "D!0 L IFF F!FHx*FI F qqWr 0""!HFI b MF(` ID!Hp([ k`085"> h(-K/6$MOl  10  LKA $FB K`AF8FK_3#CBKKO'`ppq(0PKL!4!CIJ!C $B K` 03̲#CBKK!`ppq(0@# A C%BF#CL`BK` 0K!`ppq(@# C/F۲L`BK` K!`ppq(@CS_FL`BK` K!`ppq(@CCOFL`BK` K!`ppq(@ CCcoF#CL`BK` K!`ppq(0@CS_FL`BK` 0(шhTIòCS! C_FM` %B۲L`BKK!`ppss-qK"#I@h]8-AF!d%FEE&0F9F@&F(9F(57 FhF\"FIg Fb(`0Ffu-A F xn+Kxo+4&fL%FAF88Fb(F&x!Fn+ Cxo+0b(5F b(цIFFH u-OH$ F #JFAFZH&%h0F%|kSI+BSJ+FSM FSIF()FQHj0F0MKEKI(FLH\`b(vhHHR(FGM+hcF@I#(aFBHB0F+h+b9K8I(F:H6#:H##.#5H$+h+3JOc#AF3JF8FhF`+xS !(Fp*F9F&H&H $ V  ShKhcCIKh(FHF%  6aHKI(FHv+v%v: "vHvZvvvv*S*d s-O]F S 4E3Fh S3 S)FFFh HQF#\IF/^9FI8F0 +@𾀣I(F (@𷀡I(@H8/МI_ЙIX?ЗIQKB 8A(F0 F!@ f  +Ѐ"I0Fr(@ȀI FR`+3O@ &48I 4F(@|OC& 6 D DU`"`;h# S3h {hsHOHFS(FE b S3h; 0eH:n?F(bb S3h+@' +@Z" 4@F0@YRH,?O!8O EB "AIPF# Z"(FYF!F0FFFع7Khk$9H F ]TF #4KZFA3H #h  .I3F0,JOa F.)JBOI 8FOfF *?(-*O   yIFH {-OFFt"F8F!F2#"@#A# #>#("h`t IF HxH#`O0C] o U-OFFFFBO0%O `)FDUZFRJ#D ;I8Fh3`D5#D :<D 3SK<3"C(H#`V<(D+V,"IH"-a. q-OF Ft%$! FF)p]-t O7<#`8F2FHFG D zO O AF B4 `\EFp ! ]FTFHjB3FIHHFEGCFFh(#FFgxdFF FFx-AN}MFF!F(FOr0F1F(OpMF4F$N4D#TBF8F I#Ch N}( 0F L!D ĕH "P-O["F FFFH@!0FFر' "'p9F&h=I@FkFF AF I j gz ]-OFF$"!0FX|J$#|M3`F@F`yJD`wJQF@C h/ g8(S 33a3a3a3a3a3333a3a3a43a4(hO#F(hh#F(hD0*hSI ###ZFNI(hd8MI d/h"II8F 78FP3x!CI:F ?I:F >z 3##q"8I8F78F&#x:F1I :F.I.z ڀ' 8F0*h'I(h#F=Z#Ob89hh9@09Iu < @ 4b/((,| ?9>lB8 d(#!FH 0"FI [#H#H #H ^ F H ]F H H 8 h Hh H/M!?7 F"FxB(#F*FI 0UF]( FI@ݿhcF^n( FI@Ϳh"FBx ("FI lg8F F!F HOb)F FH!FH)FH8@Ӹ8|w||pG@pG8F FhHȀ(i ahi`aiaia(j bhj((X`bS BB heZheh"fhn`fnfnf(o gho`g88F F`H`hH`h`h``lwhd   lm(d ~ lcdtlYd mU(e`mQhemMemI``peQ BC p`"54S+BE+8#FBT#!A#38 FF,& 88  FFSBB2s2sXX\\dsdsfsfszszs|q|pccccccccccXv\C\BAXS jBB b\ V $P$(J(,Dc,RccHcc>cH HLLPPTTXX\\8-OFh FF&F``hh`Fh`h` `H`iHaiaia jb`jHbjbjb k4Tc41R BA UJ\BF1L%2-T)FS "G  2*CEOr5q5p8`mxheFmseFmne nj(f`nfhfnbfFn]f oY(g`oUhgoQg"b"KE" 0FDF@F@F8F<F/D#$%B\5SEТ.D#BP%DDED#JCB4%3Q#G#3R# F#3T Ub#0B Dј#@ @CpGp FmFlF*hKB mpOb)F F&&qfq F+h#`h`h`*"B+гftO##t##DXt"2"2LABL-AF M#) F2?xhFt(F~Ob!(OpF F##rL"crA!r#r"papB!p2Fp)F`&r FoF1 BpG3+P@-OFFFFP# "`8F xFFñQx)PI;F2F T+O?K+WB+VG+P3FIIM+@S+#,L#`    + CC  h"*г % XDA DXCPEYE#;F2F/Ik+b+g+s+t+m+# # 3 3 3,""`####FMEt KhE:F1FH#Br Kh#1FEH#:F)F F I;F2F #EI#;F2F2"`SL%hFIHIH#hN+LO %%T)F FD Kh2FFs ])F F5ORkFFJR<+R R\]!B@ 2B# FM!09hkFOR"H"0" " x"8"P" -OFMFNF3h pd  ' O@ @ ;h#1h*hF3hZhKBЭH x3h jYh:bJBO5sAHqm"@X\CZT;h#1h*hF3h pd  ' @  @ )h`#7KB6ghh;`0jZCFEEKFBFH IF@F F`FFsC2tKvD\%B0Cp@sFJC"DFAx aFXFF`   !C C #[BrBd`QO 0 F#K @K F;hXF1F+hEJ@F?h\BoIFFOr86Kh[9F F((XR BA Xd4S BB @f*hXF01FkO"!F8F^'Kh#9F Fp pE 4DE~ @8eOr!F8FZ" " |"\ U" tT" T-OF[N[O dcF   ,;h C @ MKh#9h2hFD:hIIShBHHO Oi*&O OF9hJiFEx=HJh0hREvs nn ) DXH\ FCHX*A5(x`B`A(8*smbKO   Od  0  O@   O   O I H3hk Hx" " |"\ UD"p3h$5+%E9h-"Fr5DnCDsEDD-t5e5#\#T=h4hi~q;a#7KB6gOh{h3{`Ыi|q3a# B ;h3;`Kh+an   C)F0C khJBTkm[Y8QkhPeBqCmAk.@0Fan   L )LF lFF#fOz  QDOzBC * #DOz@ @ D F4I[Z;SR#kxBWNFWKh+1h F hWn   @$C3h(CIF@F H"@\!TI" @\!T8I9H!akHD]khD`kd'#  kjB{ Dkb#Ikk3kcHt02hkBShEBv|n -tD#CBsBD+r3c3 5CD0H" t9l U" |"\=[" 8 FyFF(F2"2Khc h[Kh(`[8"\9lKp Fh!F+ OuOe*F0y1F F3#3pk1D 1(Fp",-O=OɰFFF!OrF9hHK)Mh'+FF$ `#"0;h+@I F+hF  Xk )Ձ.h cl# B rX #F@P"pnrkF#"M+h k #ZҲp2B3+##O &@O; KFh3A@;h"FkKFhcKJFE#@F#`"(FJFXF)@#"#@5##JFOr!H=h0OzpCC\`E(k@ #OA##`KF #Q)=h #a lB  xOY#CS" :$ |;h [n%@#FFOx[FBFF;hr  .@& ZGD 0 $ P%8I+pFF ` OzsSC F+I#"0y+hF Xk FFX$x c# LB cF @ rd[ CSR  # C(#F4 0C9l"<" :"$"\<TD 0 #Or(KOAF #kQ$2=h #a lB  xOY#CSOX"# P ;h Yn  $@% C#F@ &0F =I-O-N|M! Kh+_ Kh/[ K4h$XhDC#0 "8"<"H"P"XO9O O "C@BDA@8F!FlHEFA"O18F\O1F v?!F(F n"A18FDBFP-OQ ^MF(`(O1 ^K`(ТKO`K`;h+@!O2(5,%0KhK)h4ܙHN +h)ܔHD KH*hhFhcPcJ BЏH2 {+hYkK BЊH( p+h2hYkBچH e+hk_ORH X+hk?O2{H K+h BvH @tK,hh0!kBCB\nK\@FXxEiKeh+AFgH+hm**"$%kl\kPQBdaBdF`lFF!e(!Ye!F)XmB!cFf( *F!FIH ,h1h`k&#!FB@o@I  cf(B(cA\B A ;h+Z(OF F/H\ ,h",K'zq`k\5OS##k'd1h gO3s<4bgcb<#cd#Xs0"7L5P5g1" " |" 9l" 9p9t""0^"" "D"PfT-hzs t~Z;F@ Ip8#FO @pP09F`m!F@Diio0 F#`v ` D(aD> DFr OtDlB g e h# vFDrA##BrH JKhhbokFOz"i hx+pp1FDF##IF@FC#"#;F#@2FF#BB ;FIF@FZ@2# 2 D*O[FRFI v0$U--B̿O O [D 2RDBO I@yO1@)p1@O K@{O JH-FF@!n   X@CXC @Bx BOBHrO A 0 j Z O@ YFPF  J YFPF)F0@̧2 # cD F # Br@O1E)(!F"BQE8F 0"SF K aFXFj<;F @p`#yCH3B2#'"SFp~aHH-@K#nG H DEڢ xP FGwAF8F" FFDa HH-@#nAH)DEJFH  " "@@^Fpo%n8F)AQ#iaD#`aF0F 2`Eݹ Fhx ,-AQHH$u/@C H  DUl*D DbD:@ RJh*oSC*30cF "ak#  pI#O3"A?LC `@' p+O,%x#<#(5#06Kh# 0 5л\# BؿF\3;m@1ek0IXemnOl 1fq3 +$I #KO1 \5zs#k bggKemh  2#" AA "QO@F!{IFu#" #$"%O Q9l" t",HT"h" 3h!%ZkR3hJHLR`"hI `YkA`RI `D%lb @!_ȿORfJhcJheJheJh b|rXT~rbb" HUP KhPek0)F @hDchci, Fjp!n`vg  k 3 X@ G XG@F~q;fr##  p+Ϳ "#ĿF_Ba;Fg2F#f KFOrB0|v! f`pv0tdO4d?h/L$b0 "&b 0XKhR 5#Cs 5TK3SOON;h+IYFPFZ@#kzcn  + 'zC CBH#z' {R;4h z0 kz(' Ȋ( 1HjR;f1hĠ-H k-L_hCR "`@\%IB!##`O O]FO3" A!hC90"hB.#`>" " " " 9x" "d" " 9l"$F^"D"<" T" x" H& $"h!KhF*XѣI#F+rڠH +L1+hI0"hZ?XF [OY# 0IFXDZ OI ;O`Kh+𙀆I#"## h!hOP7ObFfOb1h(hxKh)h0h*3h0+(hOr!Wp;h+nHb;h+@0hkIj\E =B2ii%aC[Brh ByAn   *"CC !!WJFUKUIfC `(Jѽz0 ;h"+:2h+jOC>F #$4#~O`QFF)sQFOPObFSJFF(^ObK#P# * j:BAFH1`#seO3eHfJhfn  :n3#Af fH X"H"Ps"8","("\T=P@th" YhJHBI5smxBp hj:bZhB5smxBp hj;b0kS#@ЧI"D&hhk0hcMB hB0OnDKhkMi"DB@]BقKPh$5+K2h`ʄKhBэKh+KjkhFK LhUn1Rk`#h@K h!`0Zk0NyMk0h_ )hOT DvuKh31h !D(h0sM`k.o nJ&^ChTD'F \5.@Ղ` qC vcIBDi!iKCFvhQn YLFxZJ   C)#h(Ch yPNK\%BNKh+)44C40jB@DHP\ /FC4 D4dsA4 d4Bs!FF(IE U@,D+@40HDKED!FOp 0 CSCFvBp"H ( e U" |" " "\" " " TT" x"D0!N 0h6hKpIs`$` hȿ:nsaĿA3g)#"#ot[KEԿgx#H emH3f?sf0rnBaH% [Khj Db*?'FDOJ0hJEJhnBEvq n:F"0$5+ BKh#@n\CTw @G NOF)kk8h o+nAzvB8@ETDFb4 @D h DBp@#F# cC2 CD/J%FF\5B i#iZC#FCs%FF8k k /:iynDtDr#  ND"CFD@!FD +!Kh+@B D?Ƭ. 3" |9l U" T"HKI *F MSC42"D\EBi%ilCBrh@nBv  '*C"C |HDDBpwKh+0j; rKhsrH+ plKh   b#F# º4$0_Kh_I ^L#!h`#[Kh+303040 40hKkSC#oMIMMObLN(h/hb!`3h9F h3'h0+Or! Wp=Kzwh;OFKFBFE3h+#h9hZkF"hQnLH  Rk ,@ C;h@%(K(JhFhB3h##hFZk#K "hhVn1Rk`0@ K(hh #h8hYkI  |M+4,+1T$"D"Hn"<-" 9lE" "\"8" t" " " " -O}FFFFJF^F(2FbI (`I@FO (FO60F }(."FWI@F CF hh+IFQH"kkj`j`#k+ackka#@0+bB0kbclbO&BIBQF0"F(F*F=I0F;I0FD 9I0F>7I0F85I0F2:F3I@F 0"F(I@F 0JF-I b"!8FnHF 20 &N6۲C0Bc(BOТ# (1*24D*#0aP "F#"(##*#N@dAdee}@dz-Am%OcFF)FFcnCF*FF@FF F PM9`2"#(F mF8F FN!F H2Ob)F FH!FHn)FH8@ /8|w|| pG-OF F FF9F0FRF[FPFF FO``" PDOO` FE`۽ # D#F aFXF-AF FF F F!FxK/IOF !`#q"O1 FF߱2 !F FFe[I : ^FF^ :p FFFf2F_2FX2FQ2FJppFF F*F((mep-H EB g\EeE҆BB,  ^EgE҆BB  #Bp  -OFFFFX# "`8FxFFSQx)AI;F2F S+ G+B+M3F;IK+FM+#k+@ b+?g+ # 3 3L""`m+s+##`    + CC  h"*г % XDA DXCPEYE ;F2FI###FMEt I;F2FE $#Br #E I#;F2F)F F 2SLIF F!FH!FH J!`pG@pG8 FyFF(F2B2h h(`8K-GFv FH!N<:FFEFO TE Op1F8Fy1F(F  3C3uD #"(#"!BڐBژB pG АBИBA pGp Ll(V5.cnP 63D.mD0(Fp#CBFJI TD F IFFhFKhBT JIB#"_ FIFF h IhF KXhBT JI##"#~5K-CFhM+4Ѱo10Lh@p/O~i60DXC`,N(FO7h9F)K#BFx#KZi%KhSCBӣhB 9F0khIF@F MObFkF@FiJR<+R RL]!B@ 2B$(FM!@1h=kFObF F#"###"4-OFFFDFXF[F sJ sIn. /S"(0 ! ,6OA ҉J#-AFAM, 0 $!FB F[vF({"F3F ,j2FBؤ 0F\e FxP)F!"0]\1)0F\K\AJ I&@ CT,6h6&3F@F0F\',6&8"z0h;`kiD#--Oǰ F!F KTKh;ЪI"F Kh{;@:FIKGEҤICF:F oOc"FI_O3"FIB;F"FIKhK-JFI FN> F8Fa7a[FF#cB 6 8a F%F@F!IF F)o̿!!$FHqa gF"Bv# ;F2FxIZ ' XFJ XJ x9FD!FiNF@2h * "2`1h BB82``JYFh F!FF 9 5HF } 1 PD "B٪!FFIIF F0AFD@LAF HF23` 6:K;Iw'h(ZC2#bR `"c(2H pO0/J#ݹdUef P H #ceKX0Rc"I #&d#c#cfHKh-=(F*(3I""E"m#>>T###>QSN#P"")FH#0423l +@m=bhci " 6FOYO*JEO3SE7FOѽR:h#h*;+9ѩ '=#`#"#"#M"X##=P@tho0XC#OP +)FO @PF$O C&F3A   FO" FEcb,6XZFK E(0!H F O1 z넹H#FO 3  +BBT,6FDXhSZFzKO  &!uHL(6Eڀ0+ݼL0;d0 F~`/@ހgKh+@D>D?4B`HdL0Cd0 F](= 0XHZ@#+VK OkO hYD/& ,RPDD^ XFi0 16BKh`SF !6HZF6;B0 O[3.sEOO1`DO"KO OC 0J 1  3Pf$&B,6Dhr K&  & #I. 67"##"#># 0IH#"#K.F6D0DHE0+Yv??TдKh+KгH". Kh)@7Ml,F+m@񙀞" zHx0 <& 3"z xO  F2^Cf22D*+in ԑJI9FpF &N#9FD30+bѽx46,5JIȺ%f@F[FyJ|I@F[F(z 6%*FBx&0O &DBn#ME€@F[5;F A8F[z#"%\Ml;+nA^K"q!![HO@"! (( F zbDx0 6 3"z #06x%((@?I@H*?Il7J>I3G% 5ME2J:I>ciO 3+DF"G%B"E7CF 6"DDVdF = EJI 0# H+DD2H+  G%056+$1#n##H>-x!F aIaHm6bE&( 'ZKZNJ\6zF2E? #""!~lK+nA#3'4/5Dx0 !zDHu 3"&#x0#@%F(2I7H&&!HFBIFPF8f& jKF7@V&&0F@"K$O"#zcihB HOcDZ`A&h,R(Dt:iaiDKFhz+FBF!0FG.ݺF">Bp"##pG@pG8 FFFOb F4(h `hh``h`h`(i ahi`aiaia(j bhj`bjbjb(k c( h`(l dhl`dldldPPRRhm`eXXZ~Zmwe(ns fhno`fjf^`^8p FFF FF(R hN`(J hF`hh@``h<`h8`(i4 ahi0`ai,a(j( bhj$`bhn `fnfnfttvvx xzz|.|GеF.8ـ3+5+-+%+++ +p-O}FFFFJFF(2FbI L(`I@FO ,(FO60F }(."FWI@FrCF h+IFQHkkj`j`#k+ackka#@0+bB0kbclbzO&BIQF0"F(F *F=I0FV;I0F 9I0F7I0F5I0F:F3I@F0"F(I@F0JF-I "!8FHF0 &N6۲C0BaBOТ# (1*24D*#0_ "F#"(##*#N@dAdee}@dz-Am%OcFF)FFaCF*FF@FF FM9`2"#(F mF8E-UЊhh Fk:#{`b@8 8 AeJB ړhLH`J DD0#@-'B=#"IFH D-O FFh3SBF*Fh(`cz&zb1 "H牔DD2FH y H[FRFIFH HOFH @FHs+ݥB8F<zݗkF+MzG|h/h@՘xxq\[x"H! @/ h-՘xq\x[x"H!/!h3SBF"Fh `0+h սHFH @x #-CF F>F!F"F "A F&;1F(됱}Kh"!0FhBF!F(FC FHKh"F IF h+JF I ihh{`BFh#(";"I 0I #(UsFLh (hNJ@FH Hp"!,(h(h:J3F@ # #8oCxx"x"y#KFH|]I w I#pD F"F2 D #@@Cp1k3D##8 Kn:f*oB (ImQeppGPpF%L8!*h/<1D<1!K"`. 81;81+f<1 #<1KO2`LH^H\˄`p<1<1KO2` 81381+#E#X0F- fIfHfLfH`ddHhbH`":d2B]H 4d2+th?ph?D[ D%%:k{{rݔk' K7E{Ik GKy)F3AH*+R;  ) nh,7I6I@ @џ @ џ ,Hzj{k{[R;[> 0k H:{'{*k{R;&j ?@@?6C-@Y#x#E##J !  Kd2+Կ $# Ki Ld2 In`2"Bȿ2E#FHh%81C@0"IFE+FHEڱI B#"<:sSF:( 0զH#"!+FO (ڞII #<02@0h@OzqXsh0ehO >-t%5(F# xMKF*FBF  OEaH<~H(~K"!}OaX`2+F"D3`2!#CjI`S[{ ,ձ@ # _Bvgh hdBUMt;F*FqRHC VMK(<gW$0k@#F;CD;KE1SDB;YF;H ԩ;@ k{{*3";F1F@KE*v;cD"$I{{yQ#_B( gDHBe{F#K D#"#E##h##@#"8#"(#"H;e6##-CF%KFFFhF vc|+6#zZB/3#D h3ScEF"Fh ` 2BI#"#х 0  FD81FFHx@F ##-CF!L -FFF @#h+KFBF9FHVHR1FHNh? П{?H!!({R;HMK MK MK MK MK MKMKMKMKMKMKMKMKMKMK4(F((F `CYF0%IDHN\F @F( B=IH^F POb A0L P5I0H P0F(FcF(_(F.@I X FYgO=$#%Y$#$M$#,E< ?d M$#0y7/Of(H0j/|pHz0[;hI; h\BձKh;h+I@F(?|I@F(?u X# 0y oObIBFH\F@Fp9F@F3m6LK"1F F#'FCO! B;  KhGF_FO (HDQ F((FO  ^FIF8(#CCB0-?lB?h=#7BB8FW <8FE8F< +#< +#IF7#PHVKhr:FXIUHD y D C{ 2 KIFCj 2 DCE@I 6 "SE3EF  H 4IF >(0+I/HH .I n,IF (( ] \$IF#Hz#h3#` LIF ( ) :IF (r%Y$#$`p0P 3Q%6?  IF F(=LI#h HHI D$#J^ Kxi+ H3#!pH $#$#8KFIFf"Fp IF IHb IH#IHH$*P$*QFJFKiFhh\4$@ KhK J K I( FF2F+F IH F%YE8$#$֗-CF4KF4IFh h3$OO\B *Kh#F)I)H@F./%Kxi+$Kh+#Kh{gd!!J-;F2F9F0FFxF F:00C0E F;F2F-FkC〶E8%Y$#$#$#$E<I;J hh\4$B PÈ#CÀCy+[ F%YE8-OJ@A0F=M0F:iFF#`F(?4I0&(9SF,8.I鐻FFO F,yoObIXF2F<$FFJFIH,JFIH&F0Fy0F8$#h"f:iIF<$*t`pđ@h-AmFF Fx/*p$O&AFF8x+ 1F,8$ F m3iFx(FPFF(yB2F)F0(&h$*tp8Q FP~*iFFL F8$FFh F@WYK-OFhVIWH0VO;xR+ TKOaTJTH[hTKhSL4#+ QH!QIQHOI`FhXRJIFFHVbHICHP$$$#`+F!X"韛S;xi+Fx+<,Ѵ0Z##*+.Kh+0 F.FH 0FD0F0F0YF0F#*(#H0F[H(Ft$#$Į$#%YQIF%ZEF $#,:\$#$# -AFmFFFFF(;F2F@HUOr@a(F*F;I;H:H0hX7IF5H m"i2M܀F#?hrdiF,(F0F o'F(FOg:F0 KmFH FIPhXBIFHF 0˹:F0F$0KmF H F I.hX IFd{$*t%ZŦʝ$#[(    L4#+`#x#+H@FEFBijB ћibpGiBтiapGF+I FFUFK#BB+F"FHyO)F FzhF :hER#qbB#` Khvj O#BB9F0Fvj%Z$:($#p FFU K#BB NrhF2hR#p#BB@j %Z$:(p FFUK#BB+F"FHN)F FrhF1hQ#03+F"F Hp@^jBB! `p$3F%Z'$:(E-A!mF 'FkF(FFkFk/..pAF h@i,$ F m5.$j8/!FF$ F8#p(F/##pF(Cy+)FH`FL/'6*yB!F H F)h F*! 5B|.w-CFHo@FO> F4XWFHY50%[#DB >DAF4hF$!`D,DƎ$:(Ƙ%Z-GFBMFF 6 WeF;H0!&(;#DB0 &F("!cj F6`)@FcqIF./9F0FAF&H@Fz `@F"F!da q Y$bb!"F(4/!@F"0b `ea q+ja,b9F0F}FHigaa FW9F0FiH"F9F0F$:(Ƴ %ZFnK D4D#`$:(0е+F#I cy+ i I F#jI FgW9F0F#@I FI F B9F0F9i9F0F F h K&FbbнF+iBia-Jfw$:(pFFFwFI FciB F+jeaa,b/!0FbE hx(F `(F q F!hC p# džpK-OhFmInHmKh+blI(FbFhhW'hIFhH*)FgH'&#`F#BBAO '&#BBXYO&yhB0!##RK##QK##"OKh#Ft[ hWIIFBH)FGH F9F0F7F7F  0!2#Fr@KF9F0FF7F$" 03#D0i 0 i 0 i 0 i $0 i #F"(!;hS&0C"#F!6`i$#$Ǘ$#`*p D#Ep F(9 I FHIHb8`hW&JIF(IHP8``hWJIF434!F H@!,F%Z$@8$#%YP}\I$E-CAL#g#8F>=IF=H##Cg8F0F8L8I6H.u85INs5N>x( F"8+F0I1H)r/I.HA2#8F#(IFHF4#5h#C,8FF!I(F8"KL0h)#FI8I0h~1hH$3h[I nJJ%Yh%U $# > %Y 9EbKh(K 4 pGMH$@8-O(L #F9t44c(дHKh+LOFFFO>`zK=Fh3|5U(@Kh+)IHIH#+`Md 2KxR+zРK0+NFOO.H0Bl#9Ci  9+2ѐK(FIJKKK)FH`ON)F8FZ(F2hOa `r3hԝ4 + ``)FH>)FH8I `O0&93A 9F3F b(FzYF `6 .)F \NFO 2FmI(FbfO)FkHjJkI(FX(F:hOa `;h WbI `/p4 + aXHbWH Du $VO"QHFR8`?hy MJ(FPIp%FHHH$:hEcFHI0H #;`FI#BB g@IBB#H;IFH7H@8IFHO#) C9;h3).IH+\K0+@+h+'Hp$@8~$#0%Z$#/P$#%Z˟8w%Y̏a(l̵$EMHg%Y%Yͣͼ# .9. `>O+ri>BOpr;hKJKI.ؿFH2F>>?r `-+H|4t4+?\! H#t4.- `= +%U$D-OFOL#h+g>K"t$ >H``@( =+# `Bt1#!G##@FBt#OaFG0 6@Fg#+r;h+?bKh+KJI9mHZ `!Gx3%5:0B F%UTж$@8MHС$#%Z$MI"KFlj%ZL#h++%U-OFM#(eF +k k# #C###+lPxpC`O.س_𺀳OIг_.љKh#"FIHK3іKh FOq Fh(VhU"FIF O?г@OгO4+F"FIHtO )|Kh#"FI{HgO ~Kh[ FRÈ!FzH0nKh#"FwImHt# FFHF##oIpH0020K^Kh+"FiI]HR]Kh F"!FdH$(F#C F~ FzBF9F F)F FWKhCVCF:FUI FW1F F?Kh#"FOI>H>K;Kh F JJq FF( hU>I"FF1H#C F FBF9F F)F F+Khk.HCF.I:FVOF F7#C F FBF9F F)F FKh+VCF:FI1F F%Z$#$$#%^!E<4NǯA_$@<$# шѡ4 c$@8IKh#"FHIIHfHKh F.FKOr@a F@K(phU@"FK=H(hU$9IFt"b|O+a*iSB3Igh+I1H#H_X/Kh+).IH -H ;h+I)H)L*H> F;(Kh#"hxCp)$#$d$@8MH$E($#0%Z$#҅ҿҚ%U$# $IT$#%Yp%Y%Y`6I\$#/~Ӝ%Y%Zp%^|HR]pGK7Fh F0( *hU}+F"F I H~0 Kh++F"FIH0@˸$#$#$8FKh#"O`A ( hUH*F IF HJ F8Kh#*FIH@$$#$#$)p F NF#BB)F Fp)F F(Cy+È5D%Z8 FF,-)F F8)F Fn(Cy+È5D4KFIF "pI㈛IHI H㈙I HZ IH[ IHH%M=FOX]c%MpFh%F{ I; h\A(F!Fp%,F2FIH%Yl-AFMO.FBFI8F8F(hCh;C`+IJ ,0hCh;C`+ ( y, hZ`x3h hZ`x +n,%YWHRD Kh{ H(F H(` Ft@pG$#(ԃ*FFFKh\('hUI;F2FH F*Kh(hU;F2FIFH$ KhS I3F J- F H I$$#ԛ$#$ԍԖ FF(I(H F&IF$H`i#IF Hi0 IFH j0IFHi0IFH`j0IFHayKJ H)FIhIH~ F@F H))P8HZoՃ?՜լտ0F%B#OaH#KJH05iI Fq%QÈmFI^ FC 9FhFH h, FQ ` q F&FhFt mpFCy+I2 FKhF@(C@hU*F Ip@F H8 Kh3*FI Hp@.p $#$#$0-C/!F@D'O/O ?/+'p0FwF`0F*Fh0FFC뀄FCy+I#jI F F# CKhF( hUg"F I@F Hý Kh3"F I H@>U$#$#$uFCy+I| F# CUKhF( hU&"F I@F H Kh3"FI H@xօ$#$#$֜FCy+I< F# CKhF|( hT"F I@F HB Kh3"FI H@8֬$#$#$-CFxFF.+F .LAx/)!h,Hb ;F2F  h&I!h%HP9!h#HJ"J"I hJkI hJ/I hJI hJI h~JiI hv!h `#h[I fJ$# Q%-4;DMT[b+ I.d-AFOFF" 8hFZ(I 0 +;#0+#H#pt)FHp%Udׄ׭pmFFlF! F#xE*Oa&)FHLF (`#xF+K"Z`O0A+ F` DB< +#HY#=K+FF `0FTK-18K&hpOȿOpCcE= ho7+F&AOq h#"E=!+F h"+F! h hC Z7 *_+-+H)F B5F+FAOq(c%Uy)"T%U5%Z0ðFFFJOq K" FZ`*FC0>%ULbh*IH#c`%UF%6𵉰 FJ!FhF"iF H(F DB*18h(I r$OIT0d%Up FF F J!hFhF LiFF hT*F1F hN!HVpN%UTFJP!"H]SV)FðJOqx"HyC]O0[m8 FEx- -W*F!FF H@h!FFHH8@5!FFH4&(7((HpGHpGHpGTBO\+L#hC#`(K(OC ($K(oH`!S`F# YB1ӛp#Sp(OpC@O`O?Ӱ`0CЃ+ò+ oO3F F&b`pF FLKh*F I hC `C!+2FII \"!(hx*hAT O3@S` XBXAp#F&b&b`ܙsI n; f+X1 m ZeppGP MF# FOaZ|I M]-OFF)l>H=I8FO5"G,F"@ *kex#x;C3D2 *'V'@ܳ/Dє?- - F#F"0"!hFJF!FhFPhFJ.!@F"!hFJF!FhF<.#BF(FAFPF7 /` H FFܧd &b)j&_KFh+%x)ГH@͸xK)H|!Hxx;+ C+++F}H}J}HP|Ih ah@i!iwH@!0+ tIL+F`ih oI硈nH*ኡd++  % hH" gHgHgHgH"!BcH@|aHaH"`H "^H jg;+5201 403OH @¿=201 <0 ;:98765438Hj+#5H##硈#H))*H,H+H#!i)H)Ih;(Hx'Ij4&Hr$I j-hx&bPܴd+xؙ!30=JXl]e5yݜ[=ڏF-OkN$kOFF0h!FE M<` :FIF+F@F%""#D #!"F DTBWI(FSFSIFD! (NI5DMKhFBLH;h JH`84F4O B 0FS FF0 FhC6#c# C-;hy B'0##p!F"h~CF=2h7+,hF%H4%K  h+) F#Dx F0FHjx8@0DFHZHD #BH &bT&bO>e&bPއޫ&b\&eP&bFHKIFH `%-GFKFFFJh!`!`I/ hC `0/ /)ЂH/( /*/h,hh0F{I#pF/// vJ1Fh3`F+F @FlhhliO ,i##pMк"Oр"! F> cFF_0 _ `F)$/#*((a إWA إ7mAp3F!!Bp"3Fp3#pOF!F0F:  O /!0F6F/4K0Fh~CU/!Fa)FG/#0 0FQFN먱/!Kh@F(/Ѫh!F@F9OK0F?F0FQz 0FXPFhbp! hT2FI &bO&b`Pv3&e`ܙFM$`Yf(9F4(phM\Cy ˆry**0D@񦼽@COqJHH1&_R"KF"HKK][E9(F ((IIH׼IHaj/{pz0 J #FRL4" Hpr 0BB Lp300  !FOrHH0!" F(.!hF(I0(p!hI&_R&`Rv30Eh)OLh,LД ԅ!(FQ}XhIOrHnH0I,OcOqJHB,B$OqJH4,! Oq HJ&Oq JH-$&_Rv3JQ#LO. ko2s"x!D1D9D)3B#Hp&_R&aR"KsFhFOqH"`~騹.!HX耱AOrH#xkOrIHHpK"!ex- - F+F JOq H1F`hp@ Fp@qO&`Rv3&_RDx,,p#F JOqHpH@@K&_RR-AFFY)F0F, F HAR*F+F!FHAEF"F!FHA= E)-O$FF FFD"#"F!H% TBLI(FرSFFFD!(BI5DAH.uFFh:VѸДy BEOx[IԔy0B 9Fy !L;x@! +4;C3D1 ) #h P#"! Ih JHF^I n; f+X1 r#DB0FOSI#@!0mZe "p4FO}PO# ]#!"]-OF M'70FFFF,(D+V\O5 `pF#"2K!F IFH HTMIN FIKF7hh4{3`7@0qBN@AAJ3F@I*xp3FK-AFhm+;H d=!O0"AFF F #!FOs0F+`Os+K0 1F(Kh+ mT"AFOc+`Os3`K7 FeT# r`oD# `#*c+F0 rhSIFH,+ IH Kh+ Kh+-I H&o v&m&o$&m|&o(-GF7KFFh+d4Kh4Jh ,\1JhJ,T9F(F/K"G+,K,HZhx+N3h+, 9F(FGX,$Hf{FB, HG0*F9FHJ3h#HFB)3h+PF8 G&+&m|&o&oO *S&mt/jݗ-AFLKFF h+@IKhHJh-EJhR-|DK"!F8FA+?K@HZh?K- ^!F8FA-6H6h+4+!+"F9F@a,H )H4(H-,'HA9F"F   FH"F9F#aHLHH Ar+Ѣ&m|&o&oO *S&mtY!(}/* =-CFOMFF*h! FO,AHI FȹDFO3oBe#T8F0,ѵ@ 1 "` FB "F1F2H+h+ Rx+h+DF%F'Kh+&L)!"hb$KhK#oHO9BEKE #1F-#hcKhKoBO3BB#1F# #J1F##J1F #&o$u#&m|&o&mt-OFbNFF3h!FO',S Jd2SF,`HFwZ0)FQHY#8FF FFXF "F)FGHC3h+ 8FFPF8Fh+DFd,HF0Ѷ@ K&F1Kh+0O O :h,Kh#)F-.;h$Kh#)F#-" F2 Jd! #FH )FF-_@F3 Jd!CF .# )FF-Fa&o$&m|&o&mt7-AF6KFFh+d4O:hz3Khc3Kh2Kh+W1I2HA0Kh*Jh -I'JhJ-A!F0F*K"A3'KF'HZh;h+- !F0FA|-FH,t7F$%B )FHt Ac@Fj+&m|&mt&o&l&l&mA&oO *Skݗ-OFiKMFFh!FOX ,j FF ^J ^I& TBF4!lO FO (WI(F4FOS AC818F h0=Ѵ@  M"XF"CFE @IZF h"+x(ѵ?ZF8Ik  QFT# CD#PF#F/Kh+.MO+h+KhCFOR0F,+h$Kh Q#OR10FF:F1FF @<0h8FR P0F#"F1FF @<0h FRsr&o$j &m|&o&mtFF " C-""$0 T +"FI ,KhKh3#" FbKh!FH. zHZ{je[KZfke[KK{KR;&mt&o&o-CF`"*x FAFp/"#KHB=#X FQFP #O3#"F9FHFC|M$D0 (F#CR2B2F0I 0/#C#C #*F1F &Kh %Kh%Kh#)F0Ft3FBF!## 4nBܸOhKh1FHtOPB 8Fd!F#@F4\&l&mt&oOX&o_-OFF.oKh# mHB =#p ("3 SC8FQFP 'O3 (# 1F '3w (":FD@F0 FOR p("" B*FLI q08&F8/F4O ZCEݸ 3RF!+F  0:Kh+N#("1F8F (639F(" F(O fE(W   # BW# BW# BW# B#W BKh9FHr#H########^&l&o&oOX_&mt0FF" C -"" 0 <0+*FI KhKh3#"(FJL"h*K)FHZh#h+ OR#H&mt&o&oO *S"0FF "C-""0 0+"FI I# h#I h1#" FI hYK]h!F*FF H) H H&mt&o&oO  *-GF=JF09h:Jh*;9Jh*7+-7Kh6Kh;$D"FQF8FF0@FQ`FFQF8FCD00#B (FQUJF I H%#F)FHq(FGQ?;h;+R#isy H1F1F H1F H1F H&l&l&mx&mt&o&m7^FF" C-""0 +"FI KhKh3#" F Kh!F H H&mt&o&oK"-C8KMOxlCEK/!ZpppAF(F~@)FH CR%FFD)F2F D8F#$C90BSP "(0AD*B#3JpY;E#`#B(FB02hQ!!FFH;Op x!F ")F FOr"pOs#uK8 p0!FoE# nKh[mKhCmK!FmH"jK"`s"hI(F((jcz=+ Й8 Bc #DaKhaH #0"!6O #OwOs6+` FKKL0!FX"AF\Zr6KZS,[oC,`#2F+`c+Fh04hP!FF?H6Kh+5Kh+Z/I9H;+0J7J""5I(F(jѣz=+Й8 BcO D=!@F<F0@F,oO 'Khv t0+#H#0 K 0 Or@F0Or # K0W/B!F $Q&m&m|&o\:&l+$&o Mo^&o O`!FHbxB=#<"I(F6F(#z=+?8 B#DKh+H hK!`%#F K`KpKhF!(F5Kh H,-YFPF2ేhO- PIFHuh*F{N~IC00F G#3p<,?'#  `0 @!(FO \/.JF(F0?h"+ hP?)FFVH0YBx"QH)F #h+-++.2#;3" #1F0!׹ &# .C /##.0##ZFFh+ %h-#--# F# I#I F% /+FI F# .+F#Z F#I##(F`>4 plE)F Htep&o &o &m&o$&l( PF(IHbFYQFR0G FsOPth+"F0F# I#*FIKF0F##&me:LIFF FF*FI FB*FI F<*FI F8*FI F2*FI F.*FI F(*FI F$*F I F `W1X8FKhIFpF JCF )F HT` 8"F)F $*FFH&pLfmFFOahFT$ "FI hF  m pmFFFOa&T8H)F mpiF&x(Z)FHD)FH<Lch hC&h c`#h  2F& ( &pmFFOahFT8 H!F mKh  hiF ( &p-HOLMFFRF0 ~+*hOa FT !FrH#4.iYF0F  FjI0F(YFhr F dIhj8 0Fh`I`F(q^Ki ]I(,!(FF#p BF,#3p=SI OK +x3OH(FP秱LK@LJ @E @Fp!FFHhz@CK @CJ>F9KiF8IfP?e;IF\.?\F7QF(FȱSF"F1F2HFBH F^(U%FpFC^B^A#F2F'IF'Hv(F"F1F#HO j4+ @T(!FHO#F2FIOHR  BEO&pACYjx*z-O F- " F dܵH O`hCO I *F J کIUE*FQFH,x,},@OcMK'#C(F^&+ +@ TFO 4sҖKIFJHKKKS퇋#(F:e +OOTOK+]'++8O O "F[F!0r!BR+F0uHv Pr cOqKqMOCoKpM'; lKFy#jKkMs0FfE8FO #0 BLg3D3D&+@ +=z'qj監F6"FOHIF%FP+F"F@PI"+F"F@@PFy {02F?H'{{h?7KF $%E F!X04I/KE!RBR{F0'IE!BBR[60IF!H {0H'{{@YH>cn&D3:(A(3i+20pOxF@P)FBF~KFBF F FYFxH*FZ&+k\FOK*OYOC(4 '+1wM &'JFgCF!0?U!gZSFBR0?FgcR!BR0?7`HQF7FX;F2F@P ;F2FHF FAF2F@@P;FFa OH+FAFt+q\FBOK*zOC(4'+D;M &'CFg! F40?ܮ Hg!@FZSFBR$0?ˮ P g! BPFBR[0? {"JIF"H'{{ { 7F;FP@P2FI'{{2FX;F@PQF;F2FAFzJ HIF@Y1+Hu4IFHB -CFMFF+hFS!(F~h` H P@=-۸1F @;`(@;`=&p0F )9*h(;*(:pCO;гO1jF!*(9* e JOa(FK(Fh/K\bh+)FHK Fh40!FHjF!*m(jF!*fF(* HB 0 %&p/  FO%Y|QK2FIhxKO2`0F5&(hahHx+ H( "!h Hh J` J`O&&,&&& KhSK"IhC!H&&d&p K$` Kh FKhK" `!H&Ҍ&&҈&p&-C)1M MFF-L FF;F"FAF(h(h6ObHF ( #K$#I`3F(h MJ0h320n+?+!a+ p+q+K2FI$(h`K2FI$(h`K")hH`L3F2F I(h&&HP'A&t&PKhKhx pG&&t K-AhF Khs M! L#/h&h+`!`/`&`#0&H&&&t-A F&"@M^p/%=HFx;K*F(F*F0|#z)FF;%F#JF3)F/K0F,M)I(F@ȱ+x|+(F FP&KO2`| FGNsF!H($̱I(FJN(FF#,,,PX,KO2`,#N &0&}9H#3KH,;FR$ `F)hKh{K"`h +h3+`K4&,}?U&H?9&p&҈+#0(tKO2` Lh!F Hy Fh!F FHF(&,$p8J>KO2`p(;J,(XhC5K5HhV1K2Hhz-K0Hh!/H(-I sF [z{)Khd!K(Hh0 F1F ]#L#I F Fi!DD F " FhAOh8GKhSK"` 1F . J`&,&-BU&?u&҈n&Py&pJKK`&4~&,JKK`&D&,FFN(O33`(M#+`KHh+h+h"Ih H3+`3`P, K"ph"H@&,&l&&&(7&L %M#%H+`%Kht+h#`0 FO3(,+M !J##`(h`KhFK? + F !,`F#Ob#pH)h? +Ob!F H JiF(&,&&&Ұ&&&X(8!M!Jh[ `J`(O3+`8LhI FM8K"`K`LKI hJh+F F( FHIhD#h I FMK` I FM(#J&,&&)u&KJh+K#K"`K`& &&,&KJh+K#K"`K`& &X&,& 8F F)F F8@ۿJKK`&h&,JKqK`&Ҁ%&,(-GF FFܢ(;O0&&%OOd'%(nh6I0FM|(4I0FMv(2I0FMp(&,Шh,h%! \!F WF%!K!K` Khs KJ IhhKhJ+ FI\%KK`KhsKJIhhKhJ+ FIBQF IF  "b; Y&&8& &)u4&&p"TK`&,0KO2`H( Kh Kh# K Hh H( K"`# Jp J`&,& &&&&sF(RKO2`pKLh#!hHl(M "ph)pxkrhI h# hSF HI&,&0&&Ҩ 80 KO2`8L#H%h#`%`&,&  J-O(WKO2VM+h+UKVHh (>+RKh#NKQHh$(h "NNYh`+h{KJ`O , cHILF 0EF3%CMch;c`+\(F (^ch;c`+_(F (U:J(ѦZabi2`+0HFCF#K,HhK`0Z x{ /+h `hRE3+`K"`,23+` 3a K#<#hZ"`x +Ѡ0KHh`#hZ"`x +&,&& O& &x&&P ~  N0O33`p((J(!XhFc? FEIZhKhv-t##&, &L0O3#`p((JiF(!Xh0?Kh^h I2FF(F4#+r##&,& 0KO2`(H@IhH@&,  $O2K FG@H2Ih@Q#`8h;`+ڊiB ( hZ `ppG0x#OFx p%,-Cx[=hZ5`%Ղx 5PW$7$nO۲ W$7$0D p10$0$0 pTKsFh FF(< OR)F0F ` #h+I"h* ݫ< ;۲+!C :"`THx *3X p&P J-GFFF FlI "kI@P#`#+x+9 4"eI0F #`#"`I0F|#`獱(h `hh``hh`+5F#`2FIFRH@F FO0/!(F,(P(FxF@!PF"h%+AK"`[e:!F([Z:!PFF5#p0 "(F>+x;x#BOsB3FJF)F#H@G8F:F)FFPh+3` (F`` h++Kh-ѥh-EhK(FX`(Fp K M c    & &$p&<+-OL "I$O3FD D@D(@ـ I(F0 x x{)FH*$ =& F L (؁x+ԁ;!dF(́IL?~I FL:(|I FL3zHyH*F!FO ##p +x+-+x+/!(F0BF@*@hI5+(FcKh.++@,&x6\I FF&-+x+~VI(F:ORJSOhF!F gObF8FD  # *X #"0 00+E:K *F8HpO r(F#@! @K -K` :! (#;O S(?qc""p,FFjF,Fg&FFOFFFF + (й-йl#JI X      $p&D&҈&3KAr&HF ,F.E||+7/! FF# ; F+#xKObYF8F #t 00#x+>KhKh+D=Kh*/JhB9I(@7K+@{B(KF?#ЋBrBE?@IG?腋BrKh+@#LI h"K h#SK hI&&Ҥ&x&Ҩ&&p[gb& &}&}OR`xB*1+/ѡH/KJ3`+x+𰀛Hܠ(Zx+WO: (`F8F8FIF(FVF($+ьH#x+YF F"EFӨ!F8DF(0FK6+?+hzK#CxHV "+ " [x+x+PEд$3z@3%! F6!FgH3#O2>3(F=@=1'aI0?#@3 =SxC?#xcYI F8)FWH= FK'#?=O3?3+h#`6 "!P+3FODKP1F FxQ#R (hKF2F!F:HO5+35H(`O50N1OЀ FO TX #@C!ii谹;hh!`h|MX!Hi,(Щ1F@BJF1F(Fi+HXAFh &p  &Ҩp &%~3& P&>;hi"isi[ (F+((FO5#I 4L h(< I  h(< Khc,/5(FIN3(FI(FI(F#C0ЂLH!h#I(F h#$~I yK|IhpKhT0$rHsJvI3htI(F58(FUqKhcpHZFnK(FnJoImJmK) FFjI(F+8&XMeK,FNKh3QK*F`I4hBF^I8FhvFKh3IK*FZI4h2FXI8FXWIS0SH Zn'5Kh+8KMHh. 3IB'$ (?J((?x|+! 87I 03H12KK1HhEf?-NEBB)HJ)IZ+Mq&P(& &Ҩ& & >-Rg Hɻ       yG+1.KhB33J8G$0'-#K|##Ku##Kn##Kg# $m+G+KS#S  I&&&Ҙ&W&Ҥ    ! -O]FF S$h)F<`F(L !(F8O XF ]0 "xF3J3h20[F% H IF(@€I "K)px+O ((&FIF(RЄI(x*+0x/*XZx**13x+wK#CvHp ")px-+0 ")p#Bp ")p]IBرIF,"YF(?cO3x+\.TNI! !FJJI0HIGHO @1B@3B +xKH6JQH.Jh+`3H.O hT?&xOB&Ҩ^.%+b=&r K@1Bh+K*FIh6 S R32)FPFh S3hhhh S3h`+K*FIh S(F3h HO -?C(FJ>& &𵅰#!1Hp舱/Kh++!F3'I &I &O&M&NB Kh+3!F|:!R#(+h` #+`!R#v4hdI FX8#x|+ FJ#3`+¿33&&҈Uѝ&r&&Ҥ}-AFFGI "F F3h(F#3F8Dd$/ --#03 C..FE<P  /,FJkh20[$ - O$p,d,)-;KBFp3$$hZ`x1.O1K"`AF IF  @BB &Khk%KE иٸи? GKhkKE йٹй? G0/ܘ0+mKh+?hGd,X$c& &&p&&LT&&p&&M& N4hd H KO2` F@pGO I#;`2 F0hL1hH0hKI"`@ ;hF;--k G)F  &t&,&&p-OlMFF"!H$"!H"! # KIF8Fx 4僧 (hJFJF9F}H}KO2` OrYiѱwH4vKuJF`|JF9FqHpmKO2` F9F # %S@C!iiP@BQF*FQF0F0Ki3\H3F[Ihh!`hP2FVHi0i"ici[ (FD((F#"iiPF#i$00YF2F(F3`A JF9F;H3J`(Fh3h00+ #"!F#(F/I(F.L.I/N `(F#h0`x+H h00h,KO2`$Kh3K "Ih ($"Oq(FOrOq(F lM&&&&,&r&L~&>P&\KIHh sFI@Hp(4KAHhAKO 9hA#k0CcCCyc`B"b3JRhB!K1Hh0 Bѝ0Bѝ B(K JS BB c#"x!F(hI(FK(hh/]&&&L&Ҡ&&h&&& t&&0&,yD&x&"&&X&&҈&cx+O XF M#"!#0h+hc"Oq0eHx"xdI(aHaKh #"Oq"!WHUI0TH!#p(PHBcx{+QKKh+PH0+JAK  h3ScE:FF # < 0,@C' H8K9OhO3;`[F'!4H52OF (;h+/K0J0Ih;h+?$#0cx+xyby!yxy$H FKh+? +h3#'+`O  O *"*`+##"!#&&h&&& &҈&&0-&PK-CFOLh h/1F!:FjAFf@! h`0^#h9F#0?Kxh)ؿKh@!@!`Htx|+! 9I] (F #5H)F\wK`3K /I .H.K B ؉(pCOK$IhMK,&&pzV&Ҙ&x&& &&&&F(~ +\+fHAj 5&&&p&Ҙ&x#&&&&D&&p&,&& & }&Ҁ-p`& }JhB!zK@yKhB?ܮ3!tK#SrH(ɮx+!lH(jH !hH(`KO2`dK#+r I+M]I(([KI[K`[K`C؉,0 pCOPJ#`OJ`OKh*1NK@2ANJNHx|+! JI 0+FH1<&&Ҩ%H#%IEB ht!K h^# ZH"LI h!hH` EI Kh+?! q  ~ y+?( G# #&Ҙ&>S&ppGKHh&881KO2`8M"(hF: HKO2 `8@H ,&,&\F0IFF F>u)F"dh;`+ڊiB ( hZ `ppGFN$YF9F4H((FP  L#hK H I 0 `#hOaHhK*FH&O&L4S H I 04OaHhK*FH& ;&+-Ch`#FFFSPձF2FFEиbE43FF$,Կ9FO1FFPh-OFhF8I8F8F0,` ,Y0M1K1J)h1L)F0K1IFhdT 80F!0F+h<+F0Fn4X?FCF I:F<<,ܾ:FYFhn "F0FA=hGCh " FQF (( &]KePx&e ;M;N+h0hx!*$*8JhA)1F3x , ,,T1KhQ)+F#x ,* ,9$1L1`*`&Jh)=)>F #H!`Z*`x!*F!`J`!`!`K`",\, Tx2T"F{/"/ "F2K#K2{#F#F!`!`J`&`&&xV&Ұ KJp` MKJ)hL`"K`"``mFF(h#h3#`p&`&P&H&&&Ҹ&x-GANBLF3hk;!h\xF h#OR8I8HO0(S qq0!h !h+H*O;h+Ġ0hhHCF!h"H!h!HCz+ Kh!hHK ")h@F` "J08hhhGKh++z!h hKBI I &&k&PP&Ҹ-B&҈n&t&dUѝ&HpGFI "FI @h !%-O!-FMͰ8#[bF Fh7t#F6s:9Fk0F{Kx@8򸁵@IF@Ft@{PFFJKFJOq h2Jn{EF YFYFF@FKJ DFKFJFqLDOaa@FOaaF@FrF q DKFJ4DH(7ўt 4 4$_h/8F M4+@PKObhD#4psEC 04qF0h!I+ Fx m-.)?$B1U4])K0kKhxB1U4]) K{B4PdF,FFtFF&L&+&}&&҈ pGFFFF1F8FFꈹ J"`o#` J"`O08FJC\ *F"T,##`>BNsh;s`+ 0F6 (|o#`3hZ2`x +0K#`&&P&-CF LFFO F @sFB8hFH$ EJFIt #cUiH%RC]!DBKI8h^JK0hhhhB3`  &P&''-P'3'=&H&Ҹ-Ol FFF $m #CQF@C8FXP@BIx"FI0FtKh+I 0h;9HUF FB!F F-1K`1KhL1KO20O&܀`.KhBq@FR븹*IOR)H(Khh'Kh:%J#p%J`$4,^)H (&  &&&tw(&,(P'=(&&&҈&x&(&P&H&Ҹ&&78B"+FF P0 + K#`#ob&&&pG!!H4&K!Z0K>13H1hGpG&Z,)2K-A°h#KhCKh,@ BL !F!F H! ! }HzJ1 zHzI !<hGuKFuMhaYf F8F4(iMa.ÀlF#hx@+/jN#hxS+@fHgK*F h#hx#hx,+#hx##hZ"`"p11h[hG(3#h3#`UMUI(hFhKMSN"FOq8FH F)hMHLHlkFF`01Fxe08x + FCHX3008FZ "pD(:O9FxB8x + F,H63x;x,+x +x#Z"pOJ1h[hG F` 3 FK!FFh3K1hGIH&&$&&)-Z,&$W@&nH1&)V)sy&)EK! `t& IK"`&C!KH`&& Kn:f*oB (I𜻚mQeppGP-G L"OF AF hpn!N%O ~"AF h v3hsHFF H="I hK&Z,&)&&Hz! (! $CF3ИBH`! ! F !F K/!LA FT`A" F I H I H!FIHI))Z,))K"sLXhI1N[P+x;(F)FFph"IphK" h60n+Hp&Z,%|&d&()P" HiFM Khs K\A F(!FHHlF)&Z,))F K!h FX!FHH &**  K|Al#x[ F,K!FFh Z,& K7FLA/! FHA#J F+F.0!FZ,2DF pFx# + + `F+FK , ,њB10 p3x pSFB-AFMFF*hFdjhF^hFFV!FH$F84HA𦹣DR !,.O)@Fs##h4FW` )*-GmFbL)FbMF h`K"`I`"`KXh_K"_Ih"  h # 0"  h*h 0*""@ +QJ! PHdOI GLhOF 8FF#h" 0 +O3#@"h 0*(/d"FB6H5K>1C `1H/1J! :/K"&IXhf)F  mF+(ѝ 0+ + +p K>1+HAFTJ[ERF2E H2##`&&(&&&(&&&* Z,*/&&*0ŰOr)Ht0 &HE0"H*Or H]FM\Z ! F2RI Kk)F (݄B!F6 7 H F *F*V*l*yZ,*K-OFO"FFXh}IO|I DzJ!F@FVxK"xIht<(7tKhtKn1" oLOFO kh;k`+&(F;h+eCc(Ѵ1{(_ (1 #wP V+hZ*`x (k+Ѵ.1+  lO  +д1+д>1+DHAF*n1+#0x pF(FFYF $I>1%K"IXh#J! +|h* "" @BэL#fHeHH&&&&(&&Z,*&(&&**/*&ðOr9HF(A7K"7IXhl! ! 2J!(F,0K"0Ih&-H'T&,K>1C `(H'K""IXh<%J! ! ! C (FFFh(݄BK!h* `!F !F H F`*F&&&(&*lZ,*&&&*ðOr;HTF(A9K"9IXh! ! 4J!(F2K"2Ihp&/H'&.K>1C B`*Hl)K"$IXh'J! r! V! RC (F$FF(݄BM!F(h!(h !F 2!F .H F*F&&&(&*lZ,*&&&*0LF hI(FJCchCc`! h J! 0#ch#c&)&0 LF h I(FHC3! h 0#3&)Or6HiFn(a4LhFcy#cq0K"0IXh1 #10#00#01 1 #11KHi1#!1K`1 #12 #223Ht@HH*Z,&[)&u"LI h h"I@& t{ tzF,!@ 8F F 8)F#( 0MGI M0X(AHOa>JTF;KLA:K,F . 1J!F F 4C -H~zx rOb&I0Fh2Bѝ03 +IH,HTIHoIK`!Dx *#Cp H{B8*S+Z,T2D&+ T0++(&P"IHHDOr@!L( ` IH@OriF HHZKhF!hkv&D+H&+Z*yZ,0P"MIHXLHQC+HP M0(55Or@! HH5Oa JhFJ)FhF+&D+p&+x+Z++8=P"IHFй HIF( I H8@[ L*FlVn1+Kh8@a8&<+H+Z,&pP"mIHNXLHQmC+H mp5(F5vIFF 1FHJ5n!Z JOahFjF I(F J&D+&++Z,+++-O(FJ&KO~ LO7 5FOQ``!`2KO J@FxBFњJNh)ȀI` *ѓIHPFe+,F+U 0+9+@E+>0+ѯa+`c+cP+хKIh(F(𖀂I(F((FIF(~I$n+|h+hl+If+WFp+7fs+Wt+lJ#O1`rJ`rJpkKHF(nI {cK"jIh8FD(M"gI8F<(H8F^IF(?daIVKh`\TKh^K`#Uh [INK/!PFDRFTI>H>EKh `8PK"`4睱NI-%-0; "6&`'O9$'"O7O5CIS"PFV4J`3KK"!:"FI@s9K"!:"1I@i4K"!:"=I@_;K"p:":I@V+K" "7Kh 6J`6Kh 6J`6Kh5H5Kh4H4Kh3Hy3Kh2Hs2L2I"F@/1I0##`/L"F@%.I0##`,L"F@0 ##`Y'/"+c&& &&Z,+6Sh+.1eFs]+2H&&Z&8Z&4&&1&@'N&41)&<&0LIFF F*FI F @22&JhI  &t HCh;C`+hC hZ`xKh+##@P&(! $bKH`!FH&#&J! &J! &0F 'I"&K`4! 0!F!H HpLDFch;c`+ FB"p  Kh #hZ"`x (pB3XBXA0 )& &P9K? pGB pGKO\ v^%?'+)"HpL !BaxFYpF)*F@2[Zp F*F[_pp3&2L(K((O^@0"? O"HpG""&&FHLMNO < <KhùoF0F  <T<*" "F8F 42YWZ,2^2b&0!LF h$)Fv)Fv F#SC@rJxCCJC3$#q$dOt$@!JAa!h 0#c&&Z,Kph#N FB 4(h+ Hq#x3D2;Hp@!p&(&2qTK7nM0:KhIJ+xc0BK" h FBkx ԝF H FhG 0* 5Z,Wx&& pF+L1 xc)MB0F2A#I F"K"`p I F%`~F(I FxI FtI Fn"FIH$H*F(FM!N]C@C#@KU1)$ F$"$FZ,&L&(Zk3002&YK1#Khz Z,&"LK!FXhJK!F"@h&&(&p°#M" (h&Fn0 +M##p1빴B"#1y#0K" XhBpB*" (h;FKh($ I0F@K`n#y#0#1&Z,&(&J0[ `pGZ,-H!M VM! UI UNRI L|+hPO #03h# 0O2!hF(ݽ0"DI(h( ݛ0S+W+B+F0Ob0h O@ E6h+HF )Kh+ O1!FE"F b1+O;h+и Z"F!x @+|84E x ^+9h xh;`+ڊiB ( hZ `p`&&&&(&Z,8F L hF F8)F(Рh )F(4Z,CABA@@  F F@y! H@r'y;+&!0h&)F0F젱P0FB(F4`H#y#P#qcyCcqhB`+x !;#B`+x{3L3[ IF0 n F; f+ oBX10jmFYep0pGPpF0L#h;!+.h0F#hD+y `;+65.555? #h"+"`0#0 `! )hHp1FHlh#h3#`.F#h)FD `0h `1FHV#h"+#H#`p@ù1FHHh#h3#`(@p&| j83h#Fp\x B$pB F Fp\*^*]x@=\]x0ֲ.؝x0=., Jn#BSx<#F?+x0=,3p-CF:I(? ! FF6=! FF(:#p FF(Py5[#(FF8F4F. !`y F4#h+L#h+H##`LIF FV(F9F)F?! Fppp F^F!@yph(F#x!+ ` FL!F!F@Fv"b&|#Z,3{ M< %LOa$JhF\1"IhFFX N!O*F@1hF(FPu0#u0 M <D  <4BT<hD<3hiF8F$ !hF#phF-Z<Z,3&3pF FFy[(FF F pI0F(FF)F  s$M N<H Fp"I(h 1F(hR"I(h"I(h(*I(h("0!HXO! H(K! H( &@f44 tx ty&p"I$ 2 K,3CL F0 " pKjBK" h F8@5F@B +! ;B%&Z,&HFH!,0@4&"%L&I h^ 4"#I hV! hu;@ &! hu"I hH{0(3(HH  I h."I h ! hu"I h hR& tx ty4444@f5 0F 0=K>1F,IYeov(@ x)&4,s#[H2A6@FA3"#F##YFPFRHQK"`O;O:2 ";FF i$#h x)О)DH2; $ X x)>H2; $ L ;%$  B-?d =2"P ;$[ 0 ;$ E% &-$"E ) $; 9 ) $% $- $8#Jo cP(?H! c"CF+GD@BF555556&6676R6Y/?̮30FAF i* AFFn B0H4/HOO;O: d8*H*H*HF*H JzD $dO34+/?H h BH;2 /$q+ h BH H/?h66o666667 7-7S-OFO0 AFO0AFiH8$!"F fJ3FhQh  bI"Os`K##o hiFXZHO O O5O4FO ibO ]FTFFO21F ?KHO;dO:@FA0FA )F F;`J ˹O2AFHF9HAF8FAF i" Dt F! g(.HH! g(1F  JFMCЁE  O2J + hH+JO1C0F#;C#T"1F (H J z55\T6R7gTT07{77-CFILFFbhGH#O2c`(F#o0?"(F FC?8H% ()3H$%F$KFBFE.HIHCLOsHvO7 dx8O"Br)U0O`)F zs!J DDI, ,."H,l Hh_hO9 dO5 K#\T7778 8xFp d(HJRhpCO ##:J"F;,p$.F)F"F FA$DZ H+ HJ! 2F+u&888/FF+ * *pG#\ F\.FRa/٥A/ #A- 4B3O3KOMO`,h,`nkh# Kh '  F'8&'7AF(H : _F!D!FtJh3`pG&FH8x+NuhŹ ! F Fh` F!0"FI`shu`+`!Fhhhp-hIhFt|!FhFthFci&3hiF@Kh# F@oO0&8F F@Kh+)F F8@8&pFFF(` +`#`p0F ` H `#h+K +Fp(x08 Kh+ F@R&KhK"J!h{J!i'8<&-C F xFx9KF!Ya F DF N'M J1h/`ZJ F1h/`Z+hKE&'8 "-AFdNiB]bK"`(ic #atDn(s2(iK(k8MK(n.؆(hН IK` HK`HK `#s#xCOs$0#"00!a (?а0K"+_Bذo8ذo)K "o1а_%K "O.ذO K" aO'а?K"K"K"K"K"K"K"K"K " K " K " K" K" ĕ&'8(('88'8$'8d'9H7 jFIL@%Hȱ~ `0P+#`#h+ܿ##`Lm%`#h+ܿP##`0H\( HZ ` HN(@th'8 i'8T4?/`7(%LL/ (&( ("(H($((H ((( #L0#M0H#0HHHHHH(#ML0(F&iiiiiiiii-C H-LI#`BF[(H#` #`7OHKMF`HK`H8`H(`HK`HK)F(`H"`Jh+`J`J`J`J`J`J`¿"K`K+`xKp)FHN)F(0FtHKh(0F+xKh+@{)FHm)F|Hg|4 |d4 d)F}HW ax#c)FyHL0`+x#`ca)FsH>x##caoK4)FnH0mKx*@8"d`hKiIiHe-4fIfH4dK 4bIcH4aK4\I^H4\K)F[H(0FXH(VK4)FUH9N(FFx{".hF[F0Ft".h0Fx00D(`1FGJ@F+N)FDH(FFx+?K!.hh:[F0Ft.hsUc&i'8@)/'8`'8<j'8\j?e<'8H,'8L%'84'8'8,'8D'8P'8X'80'8&D(3m+J'8&j)@1'8&\ٸj '&d &l&t1Gj e'8 0F00D(`1FHF%NBF~)F#H)F(@FH)F(FFH ;h(F1F4xK"`  #|44")FH(?x+?2F@F:+Z%{' G#L4 Kh3 K JxhZ$ Kh3KJhZ#4&'8'8 '9 K!Ji&KJhK\'8 &K!JO&K!JC&8Kh;KJhK|ZKh;KJhKtZKhs 4 +hBK"$8$M'9 '8 &'8'8pGFK![dJ!@&Kx#KJhpG&'8 Kh+ ǹ'8KJhK̼'8 &K!Ji&L4J!ZJ4YJ!Z@4 J!Z64J!Z,#4&BKhCCH@ `pG\8LFJ!Z J!Zj J!Z+J!ZT8& KhK KD4@ F@'8&FK4X@0g F@&FF#XBXAK!J&-CFFFFR PBBD?FH-H!C)FH (FB!H)FHHE?/EOGC!HOB4@E4g-"F"Cjj$j;jR6jl4Khb33BpG&8CFL#h3!H%`8\j-OAq%L #hFc# B y I OZ3llOi6CG%$O Bt۽hB! #BBъi1!YXFO 55D h&j\hKhJhz$ KhFpG cpGO1O0pG! pG&'8h9K-OhFO0)hcBg#BB 04iBD-?O3 i ExlhB#2?ЗKhF4ՔK[h+ $B B  @h(@lh2`h` "giFai`a($,4V_FFiFdG?#Br c#BBp4@FO F 0?TYFdH_^#BB,0$%iB0hB!Q`ah `h#hT`!``h` i`Y`i`a04iBD BhO 4O23 4TO3#kh`ih```i`a\0c5KihH|"DwO2`O 1Khc1Kh(ۻСiZF1!D6`# iBvg[Da#a#Kh+q=,A H (Kh-`Kh(XK #BBK#BBFK"`&'8\j'8\h'8h '8&'8p'8x'80 4"DI\wyR!DgF?k(kIFHaFb%Kh+?X? m9j'9D K-Hh,$(D04OB b*c*!DB ! H0:$!!*$&'jj-AFF`xPO%Y9 F5 (@O%Y9H1F F 5 (0 `F\]k ;I@;HN!88HGxo5H?5J5I5H84J5I@3 @!(0H(F.H#F-HF+K%+J&'@h#4o&|3B!#Hr"I FDx I F>PI F:(I F4(!HX(Фl\+k*k6ktk'kk'kBkIkRT&kmkWk]kckhKSypG&ò+Jh yJ !H+ I Hs H+؃@Py FJ!&)'kk++++(  pG pG pG pG pG pGFx+F((* O1۲BcB cx@*+*FxF8( ':FHxb?CHx|`CxHx|0Cx?Cx|`Hx@r|C y?Cx|2CxHxB|PCHy?Cx|Cx|2Cy3Kʲhh ):po?B c?;phY`p??4C dphN` pq?a9phfO`p&KpFhhh)ݔB x4,`pB <) x&B F4FB =+ F F &IH2Bӈ"q< pG\I6B@a- pG\Jh RypG&(8F4I5Hs3H8(3M+yՀ@ !yY۲-JF!p F(#F! !"H,,ٴoӴ?ӴӴo,##+O,х,A#Ot####"@:@ I,!;ѕ,1C,!? bZTk'&kI3B"jq pGm@DcB ѡ"c+ !@%` XBXApG pG pG*-A FFF F0` `8FQF(F#(#3`,#`(F'F8FO1 J)F0,(F(##3`,#'FFO1JFh$h3F*F F'sLf%F(8B 8#D8piF0F+288e'((HpGHH3' sHFxIj$ FpI F`( Fp@ HF(x+! (FKJ)F3FFp},pp"1pFH FXd #h"BhIh NhBp,([h21F(F\$hp+p8sFhF F!"(F*h#3FF FpFLO%F8x*8B,hF8D:hB88D8hF+88x*''8Tp(L8B>B+8D(BN% 8#D3h[scڢBX ((F888+2 p"D<''8T%LN 8#Dx3h[scb 8H FFp)D!+x*''8T7L8xhF(DKhBF(F88D8&8x[ 0;B8[x+hF+ 8''8T8LXB 88\[- KO2`8B#x+(F'qK8x '8 L#x% X8O2pK`8 'qpFL F FH@sBB"F} pHBCB KO2`j?  YHp;;'qFFM',xt:F!0F<(FIF(> F K"8p( (( (O2K`pG'qK"(( (O2K`pG'q-CFO L/+x:F!FB0838838F 0F(1FHF(0F(8(!! D D('&s L% FFM~Dx(Fp"F!0F5'K$`pG'pF xFDhBhp! (F0F2kh%`c`kh``l`#h`pL$0!F$8"a'K-OFhƲL{(h&x/M#81FHO  *O(h08 8 h# 8+#+(F '8F+08Z#DB0((h("( '# 8d(.$鱙KB !!(F (F1(O( (#48!((48$(() (48 8( (O@$48@,~("t(48-@8 >#88j`(xF@AE1ZJEF?^FV@!D(1F@r8"pLK2x~Bb0F888)-@bD(<8BiD(@g4@(? #48(Ve(?F48 (F?Ѯ488x+? +8x +488Bٮ< + 8BЮ< +?ˮDA#488x+?484848:#'483&'' qq488B< +8B< +8B|< +v48v488x + 8x +e8xX#8UdKh*(` c -FE? ZFPFIF2F(`IFRHrH8x+?#0,(xѷ1xr )?BJO F~R~ZE(ѓEF@F0O D  O B *FO FO 60FF(?M8HF>4H#48!(F]DD(D9(?8B,K[~BHK(F|q'' p=pKF%$ 'F+0:Ѳ )!1`x.+hF0`)F F@t'HpG'K$h[hhpG'-A FiF(pCO'I FF F>}*FOa&h("I&됳(F *F+ *# p1F&8AF&40"+$  F*FOa&6(&<iFBX(pCOѴOqCJ FIJ I F!F H J I F H!F F'0q+x #`(F' `hF{#aAx"kixp@JKh+ip@sx!+(j> Fd0bKh+0j I Hp@` Kh.F$1FHp@' 8&'8p+pxKB ?h"! @ Kh K) MOh/h`,`F`/`&`'7'8'8h'8-GFe "|FF)O1 FLM!JFF`+hS#Bv#0Q0+ЛѸ8 2 1F:F"F ;'8'9D'8hKXh8 pG' 8KHA=v]}$ppLj#bp@U(ch+++ pj(hyb>0Fm bg ' 8!F Kjq`"bb' 88F8,B8 -O#ZLe%XO#`XKFh3s[;`O#"#0CMKhO0j+Do= 5( P*=Kh ;KhcH5Kh(ܰ0 zkO A+H80+e-8F0+e-jch+K+)?+%+2 . .@1u8FoHИ0: l @F' 8'7'8 '8&'8psz'9D'8'8/+7++ch+0F(?2(?-#A=F-c+R#[[\o]Z`mb^m`s\[eZ\E]]\`^M^\b_]]m\``}]C[[]c^ZZaaa` ^G\ bbS]]]^/`ebb\7]`3__]\AbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbTѦ0 +0F (?Bch#;+G(?A..!0Fd(H#c`ihh3@_.#`.!./!.0h+ .\ .Zл&НKhB?KhB?KhB?F+.-.*##`*#@0F(?ح~ZFxa;+##ama(x(Уi#a+ 8y(3PA pH#`h#@+,Цah)hJi!!`KhB? _KhB?]KhB?i+0Fa(0FA VHi(i#FF/ ie(?٭.( . ...ϭch7+?˭Os!..­OS*.@.K`(?##`#+r#"# #B]#hCs#`#+r#"#ai %h%LCC#`#+r#"#ai u%`e%h%LCCCsVQ K Hh`"dF0!Hq'8'8 &'8iVq'J IhKh+m$KhI4FHIKh)FHJ#I hZK!h7!5Y!H(#+r#"#`i(?/8 %#H+rKJFA=*!H#+r#"#`i(?#vH+rqKqJFA=#+r#"#`iFjH#+r#"#`iFbH(#B??|\Khv#+r#"#`iU(?g!RH?_=Kh(FzU(FNN(FJ#`##`#AIF 0+0J 0Ihx/F8I !6KhBF?"4KhB?2KhB? (e% & (?M #*IF $KhBF?"KhB? KhB? ( (?@0Fc9q='8&}qG' qb9 '7qq+pqqqq'8qq'88'8('8$q0+jFFI% 6DKhB?CKhB?AKhB? ( (F.&0FF(9J% $`8Ih.&#6IF(F)p3K`2KheEOp)Fp bi`+K"``h*߿)KhrRF#)pK`Jcih D`h*߿KhrRF#ch+?*(F#"I$0FKh+?ʮ#cr'88'8('8$9 r '9'8'8'8T1'8Kh0pG&FF #O2B@# 3-OFFF@F hD,F WEЬB< +4##pd@F>!2FFӱ(BZB <*+B8F!+ 3BZx( F=tF=_F[K# O 𵘱 F7Bhx&xBm\[x+g+d#F?#4`d+f+ֱ%\xg,3K,F[- ,O,L34#F#hZ`F`XxpG-OFF !F=F(CGDDFB:0 0 *5"pF*xc*"p"B$ҕ0+;+hxUDFp KEF>/#F*+N%F+O0r FYFH(!H@' |r FYFH(!H@' r7K FFh*' |K FFXh"' |7F LFh(0(FJx+)Fh( ' |[K-OFh$$ FR!FFF(F=.0F/)FxF0FO4!HF<F(#"0F0?(F=JF)F0FF0FFOzEE(F=v*x BjxM*Ѫx+*xG* ,<+IF(F?,E*,n*B k(F *PFb(0F*A !KhOK F(M(*HAm# Y(jO0&&}' '7'8'7&'8p'8x&&9'9( s|iV'8s@Kh&Kh*0H!d H@' s}-AFOFF F~>F]  F(ѽ;h,F'9DKF"h&K" `&KFO2h&K" `&8F$ F@F@B F8@C 8pF F,F F4F F2XU ~"!0F(pO2!(F(-CF!F$%FFhF!FhFLF8-0F OFFAF5F8F< +(-kF O(F9h$;hB0FT F(F&<KhF  F@{&L#h#H ` hK#`' ss$%!F8[x0s+4@4 F-G!Fd OdO FF{h;{`+ 8F* (F'#(F#p;hZ:`x .c2BOH!@F)FFo(FUF<}PF kCHK(Ft,*-AF!DK"xxBFI4F#x##0F+p xBcxB4#x4;5FFF#x+7:FAF FxKh+O0;H(FxF3|*-* F(F( !1H/0IHFD((F FHF! D F*FKF!FFPFFPF!0)FFoI For iF(Fz( (FF(F< F'0$hpCO(F!*0)FFoI$'8tytF((#" F#HpG2DF DB F,C/*FKh '88Kh 80?o'Fc? FBB  '8hX  K@*+4 Kh"`PpG'8-OF FF8&dKhB@cKh+ۻB_Kh;B@^KhFZKh;BXBB )F FOoBB )F F`.>&OJF(F]Ժ/ݺ %$)F Fֹ06Kh+Wc?R1Kh+N1Kh+J0Kh+F/K"`-Kh+,H\)F FFb? FѸ!F(!F(K h9(@FA0?йEK"O0`OԿ K&.x'8 '8'8&'*@'*|'8tt'8 KhS Kh( Kh+Kh8pG pGBppG' '8'8'8 -GFFF@E",KhDE̿$$EF 9F0FFs?FѺ EEO0Gh$9F0F, }MFKh+ '8 '8-GFFFpbX 0 FoFb? F7KhG7K h9(#"F+F@Fq FO ] FF doRFc? F%$'8h'8 -AF FF:Fc? F AO0*Qh+F"F8F.K(FhB pGtK(F@hB pGtF F@޿FpI hB F`2 IZ`bh`#hB Jhh;`; F@;i:ah&t' KhpG' FN F4hB!0! 'F8F1O3O2###vca`K-F+h5+h`\`+i,`3#a#h h8FbX$hi2ahBJh3` Ft' hpGipG Ʉ 0 FȄ#vpG~pGCiDAapG@ipGhpG`pG-O FFf? 6O5O4)F FKh+@𩀎KhKBh+#O3Dp F)FF F)F F(/F&F0A (@9F0FF+9F0FFEx~8CF (𓀠  I 0 ,a@N+ FF@`Jh*@_J@3dt@F!9F0F~F(oTKh'#39F@20F* oKKh+?`?\* (w (u0@O7(R;Kh+M`7F6c02KFBF H jH hx;` O o ,O 3@2 F&JJh*0 (0K"` FFOe`t]F50ծ}'8' '8h'8'8'8'8'8'9D-O,FMF/v O4O34 0+zKh@BOxFv! O32F;F(nKh+4F34!FF(gKhLJFec , , ] (d (b07+hP (\L@4(@4<4k44 ?F?z,hu#3B (#+(=0ӻ0:DF414cs4 fj+hH03@2@F00+K"`$#Br! Fgg( Kh+?##(? * '9D' '8'8'8'8'8'8pF? FFkB ( (5D KDEZ5D0(&KEp\x\p-OFF F)FF F%((ۆ.o#3#F F0F $#4FpB FQKh+ OR)F FfF0!JHO3FoF{??FFGMEtCWF0;BSo9Kh+fA7K F)F&`8h#"F8+F]7??ЫEz *KRFh#3#8D[F8)F FF`? F7B1J#`J`Jh"F6#8+F)F F FFa?MEt#"0F2KFBF]>'8t'8'8'8 '8FFFc? FpKh)F FK)F Fh/vFP$KhH!FjHag'8'8tthFV]е (!H@DLFFq"h:C?! @ h8vBBн@¿нu '8 p FFFFc? F! H@ս;F2FwBp1D0Kh@u'uB'85 KhBJhABJhBJhF'8D'8'8X'84 KhBJhABJhBJhF'8P'8,'80'8L-G!LOH8F:!F8F:F(F;BF(FIF6BF0FQF0PF;HF; V'`( ' +K(pFFFh #F (FO4 Fp (,0 FMh($$*ݫh1FD 82D QD0F(hz0FhD$H(!F(Fh1FD (кo&' H\L ax K#aHR`ax Kca!O`!``O`Oc#``u\' oumu~(  pG K"`"" "0 ZcJh "ZcpG' '8F9K:Lh#ch "  5K#??KПBvG0K#Bv@@# 0 `i3a+h+$jFhFFfhkF#I(8 Fh*F0D&l1j DFkXBܣiD`DackDbcR!iO `hFgkDD ! #!3B `a'8'8' \x\p(FKiH0  ' (F @K!FXi40  ' -OOLFgkih=FBFBFhEB ۣi`aiCDaqJh*)*%Ѧh:F 7q]Ti.DBF  7pIF(MFkXKh+wh FE`h(DF(rPFo0](@&h/h ̿O P]ȿE QFFChYFX]=๣hX]hEDڣhX]DYFPF+PPFhEDXFDB8۰D(x( !KhPF йO6#O v hO Q]Ubh7m&oTT3FB!!h;F +&x' '9&Ki' -OhLF FFcb# HIF@F-[KB?IEpE@TKhF*chhDbhB O1XF +(0+*+XbhO1hXFD)FFPF;F0+G.RO ^F #h ;BJbh h!BDCD(Dܹ `i%DaPFIF(?chhDbhO1XFXbhB (ћ`(F'%i(FlKh@DB%0x F(![PFF('%' '8'9'8T-AFF\FK"i DD D( Kh DB =(g" !(' '8T\-AF MF$8+lB ;F2F(l4' (-GFFFFcѩKh,ހIh FOkB ݎiBڊhD0KFBF $A,F $6jhO1D:DF=0FFhjkB ګiBګh D<0#ih0F D[O1`m\FF8FGF i(a#+b FxM,j,@wKhhh3#[B+bhD#\BT_.NѣDDkKhF .(W0+dKh+0Fd(0FzFi"\M)h DD D(h8WKh DB >(?n" ! ($kj CD䲴D_.!DohFD .=Kh+I+*+D;Kh++a&+]:F!0F/_(DljhhhD1FF((b*Ibhk h2D+lݐB#Mh)FZm"!F .D=>D FKh0DBN2F!F (=-H;P#B3lKFBF:F!F'9' &'9\'8Tt1' -CŲSLFF0hs!##F0 -IKhj+ #00EK#DKJbC#d(?O9h KFBF(FXFHF#x+l FkK9H F7Hx+#xNF-(Fm(F9 :@F@F4  , HF#HM R0 KPF"`S Oz FF(XF,F8F(!0DF0FF0[FJ1F(F8F9 HF\I du'8x*-GFFFFF3F@5H!O4 F1I(F}F!F/H.H4(F1,H.O5T F FV! ??{FEx!FFBFPF}J!  4 {K "`QF0 -5uCFQF0uI Dl F8KIh DdiFHD-9F Flf F"X% IF5 DN' ttxxx *((( x2KpKp]Kx3x!H! I+F p Jp K Hx0Kx0#0A=qqxy!((!HݽK"`pGy+'7Kh(޿KhpG'9'8 FxFFMH,FA- F!Dp8`FO!xi;hK\)cxS4;;$)#+p.0F(y<'9 xBh+h F*!JH(H]*!JHyW'*Dy\?LIF F F'*nyX(hS  pG(h ЀipGHpG3KXk0 pG'*DKXkA H;]'*Dy<FhFFx-+0""x0; +FO F0 /.` ##`@B$##`O0.HAm 08yg-OFpNpkȱh+ +Ci G#sc Psk"iF `FOx*\x+(C% ($( (F #T Fa@/''F F*F,p+h_H`9( 0(5-(Xx-( 3n(0+z$n$+(@3%8 #F F(x++0:84z$pFa?/''xF=+hh++0HA` #+`ygKhKh(  pG'8'*H x K"` L$<T<T,`T<!T<FG$4z'*uKxFFpGBЙh :B$3t-O&h/MFFF4FF+xkBкKИF" @Foh//$5#F9h\ A9)-(JEJE 8hFĿ-AvvFF#=0F !>0Fe01 !]F`/@F-#<)Fk,F-AF F$x F%(_34;F[xn+s+d+iFU hFnhFDUk (jF` ( Ђ*I@Խ@F!MF!J,hh3`KhlKh ;6 qKh0F9F+hFKh# @̾H4DKh3Dx KhB޿ K"`@&'9('7'8'8L|'84'8T'88F FY ()F FLHiK"`8|'9,pFLF"h"Kh 71F(F-#hF Kh# f(FpKh+޿K"`9&'7'8T'8$K-CFhFF+48!JF ##F9FFVV*! K)FhR FtnFHFO481F H%B(F8 FF$'8&Fh~##`@ pG-CFFF*FcHDB HBѸ2` B52xEШB4"FMF@"!F3#p(  #D0D4`B Kh8p@Kh8KhpGKh8'8 '/ K"FhFKhFBCgE2E'8 '/ KF IFh hZ*gSE:cE'8 '/K"0O5hO4Kh;B0E2'8 '/ KhEBp Kh#BO0gBpX3'/'8 K-0HhB 0K,-0 '/K h9޿'8 K0hKh#:BO3O2# E3??Ѓ`E0'8 '/#M"L##*hchB&hޱhF0F8-!(h+hc` `f#Q?@#pO3O2#'8 '/K(h( Bؿ08pG'8 F#QxP:) ؉.) F?)\)ѐ3+pG;pGFpGFb M.h1B9F&F0F"Fk 3+`#3U'/H3jFhF]iFhF]8F MC?,+h;Bܽ8@4 F8'8 8 Fxd+P+b+ CxEj+ B+b+##`F l+p+m+t+##`(F8oO3oKhT `'88HMKL(`h;( FFh``p M(`ph`p`8g'98'*gP|-OFNxF55`+V O#x0hBM@GUDBC :+J %+̀.+Ѝ0# 0 ?+ \+cxLF0# 04#HFA=IdF(ظP ظD[иLXиB 9?b:@ظa. FFmP ظf84Ӹl pO ظn(хKhsиx(8h_0hB  (@0 vKh0-8hrI(0+0?|^0[(Կ  z0?)p`Q)pQMw?F#HFBA=F6?7S(+9e w1EYa1h"B Fǀ3`"pC?9'/&'8'8}'8aKh)FxF\Kh*:1H0F1@F??FuY n1H0)FxFBKhBKhK8hG8hA698hQмK@*+k)Fx1H0(3`FF~?? FF+rIF@FnFFYdK@*+1 FFV? 9 (3", H H8h(iHH'8'8 '8 ncy'/+K!h|KhKhd U K KS$Xh Kh Kh Kh9i K"`'8'*'98|'8T'8L'84'8KhKhKhK9hG'8T'8L'84|FE>hB% #Bt7F`9`pGB #Br+F"F#^E#Bt+F"F#E#BtF7.sFF FQ)`hh7$#k`T FA v!Fh`kB` FEMDB"KI`F hұ) X`pF1F F=(O0"F!(F7("A` '7'8hhx@ @h0 -OF*:*7̰EF!  S$#[Br#FNEB?دB5H*Fi#{1("FTRhKBNE#XF[Br3BQF# NE ! !h#[BrF#  F'7|K""""pG'7K-GFh L&j>##bKh+&b(F #F??F PFIF@F(FUF;h;Bh%O'8'7'8'8 1K-Ogq?V-JO1O0)Kh#O1%Kh ,OF9IEܸ/O&HF  Fb? FPF#BtC?ЏBv )F FBHFROeF\x\p'8'8'8  LF H@1#j [ #b@9'78FhPKO1 `O0  8h7r(F'7H|H}FFC KiEBBh  |-O FF## 3`dKh@#Q?НBt+ E@Fȿ )F FĿ3 <#C#3B#'F.F#2?nKhk[+[Bo#8F1F~(@cKh˱+O #C#3B2#v+#C J +O NK 8 [ h+J QFAFF F(F@[F FF FG !>H0"F#  h! #Fv#/H/H"F#  h "F8F1F S z F7I(F7FE 8Kh+ "F8F1F S [ F7*(F7';vOO8l'9D'8'9'9'7}'7'8'7-CFF $` L$h LEc?KIEps?(нBt$L#h EBp t?EBAh !` Jh*Kj+ '8\x\p|'8'7 KhFJhZ`h7#H`@2'7'8'78F F+ #xk Li7H#aK"`8*F!FHO'7'7'8YH@ '7-OFqNFFFj x j t+EO E3 #P?a?НBt YEp -`?YTKWFFhCDtx1(#F  O3O2#a?^Bpo L  DtEzN`?#Q?ЫBrE#Br*'FWFF #2"F3iSC+Fq(  #D?ЙBp # xb bEzKh@FEzۻ j xEFzF'7' 0Ec?o\O3F F F)F 0"KbKh+ѽ@'7'8-GFFN x+W~HDD]F|KhSoF"FvH(vKh+3j 0i`@P !pHpH!O5jO:h*;h+3j#3b#3b FXyrFs?FSgFFOrF(QO:h2 #3bm;h+XLKh+6ѹFHFoFFF#FFF=p? 0EO7O6rg?+qO0H|+ @ѹFo*KFh@FuFF'&@FiFFq?#0FO29FO3SO3NF80h(-  cKhu0h((F'7'79'8'9#'8'8  IJhC`Kh@ Q'9D'9$ IJhC`Kh@ˁ'9D'9$ IJhC`Kh@׹˱'9D'9$FI I I |! @AF r!F n! j!F˱ˁQ,K-Ah,QСO`'! RD(F)F B)F >!I 6 K"`bNM/hj3hCE+hB +hJ3s[`IK"` Kh '9Dˁ'8'8T'8 '7'9-pC!F FFF0F!D1F`jn#wa Fp(F!D)FajZL hBK""`2Z`Bh`6}'7-OFRMMhPI6F6/KLPF#` F:FOa0FFp8Fh+w+hHF#`#c` M3x!+BF1FPF(0 + +XFFx+F )!px+FFFHFKkh`C``hh`3`ZYxx^)3xBЀ,$*O3  p#"\(33  }'7)-OFð F CL,-O`юKJM`XOHcF(x+=-@<>M8F(FF@FF(FFHFVD6!0D~+FBFxIFEHF6uI0FzF0F6 -jJhBˀ#` #c`lMlMiM0F~ȱ83\ + 3FFB(Fz(#3`|(Fl (012I!pFFF)12@I FF  2@ЛFH2 Aԛ0320X[FF)12I!pFFF)12IF)12IO2x*Л *К *XF2(~XF,FPF{h`C``hx`3`*FOq0F(?bK?J KB(Fzd   '7}5P:+I)'9DTKhI F I FI F쨱I F쐱I Fx! F0(\     }TZag}FF Fi( ( (H!@me!H!Hmz;J-Oh+iEU)F F FF)F Fİ'F.F,KhL8F1Fl#C FF#3B#c?!H'F.F0++F"Fi0FQFFFF(ј0# 0 +8F1FdKeJiIhh81h x+?'310X!2 O  3  @; 1h x+310[2 )Q x+ F2JKh [Or@ a F0? <1i{a,E1h;+?˫Z1 W;+?hOxaOp F#xaF110 \+"K#J)Ihh i"PFIF0KJ#Ihh X"8AFб1hF:F;#310X# FF05>?F$! ~\KJIhhyF0'T 'T'T9# FF45 CЁEkKlJlIhhLkKh+)#T3 x2hIh{iha;I ~:K`#;ah!7J8H6L(6Ih0K`kihc#+akiihkax,a kBx#*Zxn* J!`JF$:Fc#p030LF#3` ( ( $cli#+a hhBha?ap030.##1pSpc4F\'KP'T'T 'T j'Kl^-O MF+hKlhFhI ~IHK`I+`X3 `KI`#SdO(hCh;C`+ڷrFЊL)h`*hHLkEF@8KhnhZ`x(hKB  yL(DзP0wNPP0hn퐱P0hP`tH P4`n #P0P4ñ8hPkKBз iHhH#;`]KfHh(`HP\K"`clù#l[h#d#l+hRN#hT0`F+ŀR82hUI ~\#cd1hQK F PIPK~<#hxObMHOb!hJH o2hHI ~&Ob1h*Ob1h `*~F^ `~Z:JOa[Fİ/HZo XF8h &KBз.I%H08` B ;h ChJ`I0h (`(H8#`'T$'KPd'T 5P'T'T %/'O 'K]8F F4(+F"FI ~.8F LF h5&1F#(FnF;F1FF `(Fn h'S])M)O$+hB&Kh@?$Khh+6h5"FIF } #JcChX+4h!;h@hfI@hF(OR3F!hFF0F;h!hFL 3 ]'S'T'T U'T(-sCFM(h#I }`KO O$h``hL$h4B"Fmh( phSIF }f 'S'T,'T4j-OFBLBM 0Dx "ii2B Aia#iDa`"p&./\.ё 2 Rպ0  ՙ \*&*  F"ii2B Aia#iDa`p3"i2"aIFO *hO RD0?g6?~!ii11DB ai1Da#iDa`*hFRDQh2FYDH"iF3DD&a'S'T,TFAhFFFDiKBAah` `/*F1F#c`D2D"e`ZUK"-OLF`!H1#bKh-9`#cc (jh*;h+0ChB `0+@ (j-h+bj"!j@h0 hh+Bh0B+ Bh0B#` `c 3h+aj!jph(Ыhh*Zh0B0`+rh0B*[h+3h+bjF!jphx+ph0pBpA+~=;>+R#9u]UQgIU!J!h!NhB[ !0hYC`50`'h #2h!{C(i7Pp``'`#! 1hCK(ihKhcjS M!bj j+h)h JJ'T'S'S'T'T0'T('T'Tck+(j+ej5&jj !0F#bA0Fbb~#HA#"IH:##H#"IH-#K(ih#jOxcjKhKB<#;`;h3 љHh(=x+:И8`;h #;`"!&+7;h6BӈKHhK$ Fh1h 3h[BKhdh+^h4"F}IF } {I &0 ;`<#4RF(#3 "!x# ;h6BaH,$ j &dDPF4FPF4;h2FB&NH0!ND!PF4BFHH"F:hBNF>H@K6@I @K .O ;h B&0HKD(K+2IhKEVD P-KhcjSN!bj j3h1h !H 6#bjIH#"! H(\j+W N!bj j3h\1h J'Sd'S'T~/0p'T U@th"O&'Tj+&x !28FFcb܂!bj8F0 |.?cbKhcjSM!bj j+h)h ffJ!hNhB[ !0hYC`0`'h #2h!{Cki&jZizhjiRhB i K Ih}6cj1F#F(߀##acjO OFkiи@;h!jZhp#DH=ki0Fj;hh#1D=O;h#BB # FqH1Fki0Fj;h#BBOк Di Oy#"1F/F(Z RF1FZHYNζF^$Ϯ @;hF$9ƣi`ki[hSDN!bj j3h61h nih(F"chCc`QEp #"1D+@+hC h2FI }zC`hYChC:!(FZ(#p+x B+5(F8 a>'T8W^KpFhKP`h1Fh+  #iZSBSAh0Fp#iB̿###iB###iB#iB$h'T8("0FMFX*FI }iF 0 I }ObiF F6 Fl M0 { K : * B² *I QppGP I0 F;0+Bڰ1 0 YppGP 2L!FNh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@'UpK0hci1s]xe(x+h@,FK|lh~Y}0+F t ɲv!ҲZu"( ('UpKp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p'Up(-A3L#hZi5kC#h/J![ikM-N%-O3hB.#)Jh*B"hRi( "J!M#"hRi, J!M#"hRi40~H A#h[im)FOZh J!M#h! J5[iM9F@F2+ѽ('U'Ul`8FH`3I Z "FI0bHJOqH&M, F8 !(F,#p+x3,IHLP'T@sX%H( vF"Hx?+Cx۱0MFN! FPZ0 Fp/! D Fz(ЀhFS+ !F0F F!F(Fh#`! |UcIFH  K D|KD |BєB4KFIHKh[i1cxB [x;IH@"K,IH,؄@I HF@, IH"FIH@'Up'U@9(@2LUhr`IFHn !7F F"` F#xx<#`O00h"+@0O0 FF1 hiF F0"FI |hJ<#F#%FpBݜi*5XBB<#? p 5~#p! h#l@dpG#p! h#ldpG#p! h#ldpG#p! h#ldpG#p! h#ldpG#p! h#ldpG#p! h#l dpG#p! h#ldpG h+#`pG H`pG# K`pG`pG8F K Jhh@!B#8-#,O@B ##'$'X#pG `pG# `pG# `pG# `pG# `pG# `pGK J`pG'K J`pG''tK `pGTK `pGK `pG K `pGK `pGK `pG!J 535pG'# K`pGJ 535pG'K J`pG'TK J`pG'K J`pG'  `pG# `pG# `pGK `pG$K `pG,K `pG4K `pG=K `pGJK `pGTK `pG^K `pGpK `pG}K `pGK `pGK `pGK `pGLK `pGK `pG6`K `pG9K `pG'tK `pG"KO1h#|1 '$8" M F h(h|!(h)1 8F!h'$K hhf '$p$MFh+h|A"F1h(h Fp'$F! F! lF! 8 F(F!CF(FE"!F# 88 F(F!CF(F3!F 8F*!Fo(E "O1 F@Fa OpOpe `  }K` '# "O1]"LOp!F w'"I@C 'I" 5#D '" hH "LOp!F w'"I@' '"IF 'I" 5#D '<"I@ '<"IOpw '<"I l '"IFb '"Io X '"Ic N '`"Ic D '."Ic : '"IF0 '"I & '"IOp '"LOp!F w'}"I@ '"IOp '"IF '~ h" K!D 'K$`~ F'\<K$`tp F'\<K!hjFyn 0]K!hjFym 0]K!hjFyd 0]hJ!@Fa K!hjFyf 0]$ F `d F $ `\ F $ `T F$ F `L F FN `  F `  F `  F `  F9 `  F1 `  F `  Kh,!F  '$ Kh,!@QC  '$OK h,!  '$OAK h,!  '$!  !  !  !  Hf\ HfT THfL  "K` '\-    h -AF0 FFFB̿iOiȿ@ȿ 0ȿB.%KCfiD#S+Ѵ0iB$-aҲw*bҲI9tk:F)F FG0BiA\KC8(x"+ Ii9V0Fi$F8FChN11-OFiFC:n`h@ h( FFF !t FIFZF`FC И03FO2# iD0 Bȿ80ѓB3ゴ0DBEڴ0BF1FO_B@# AEPڣj FF FSF AF0BѴ0# K*FiC"Fi:*FiDqLiO.FB Fク#sクAEڢi  [h R 0 FSF9F F  YFFL hK("O1 hR '$pFM(h)1; OqO0p$ h"F|A8#"1h(hN(h"F1h F'$pFFF F0F*FIF Fp@F)F,04< J!5#Di@J@CJOqIH:PJ3C F@J2JOqJOqK!h+""K@F'''''''F)A04@7J!5#Di@yJ!J@'JOqIHPJ3C uF@J2JOqh IKh@F''''''F)D37;h!K"Di@"J!JOqJ@JOqIH~PJ3C F@J2JOqJOq K!h+""''~'''}''''))YJ!iJOqJ@pG''')  J@iJOqJ!JOqJ@pG'`'''')) aJ@iJOqJ@pG'.'')  J@iv K!hJOqK!h+""pG'''') J!iSJ!JOqJ@pG''''HfbH@E  " LOp I24 A"H~"AH~''  " LOp I4 A"H~"AH~''  " LOp I4 A"H~n"AH~h''   I H00" Ib #JI@''+ I H0" Ib #JI@''+ I H0" Ib #JI@'}'+# `pG `pG# `pG# K`pG H`pG H`pG `pG# `pG `pG# `pG# `pG `pG `pG# `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG `pG# `pG# `pG# `pGK$` F'\<K$` F'\< h+#`pG"IOp ' XK` '"I@ '"IOp '"IOp '"I@ '"IOp '"I@ '"IOp ' K` 'F M(h)q? OqO0$ h"F|A(h;F"1h F'$ FN0h)q? OqO0$ h"F|Ah;F")h0h~(F F'$-AFh Fpchc:ihF?(!0Fh``&0Bܽi7Y#ih(pi BY!I6ǿFi9l j8iE jA2##biFiA*#aJ'F`#B7<2%/i3aд)FB<#>~5~Oq >Oq @7@Q 1@Q @*Oq $Oq @IH ~p#L&h.;9l(9??JpJ,"! J0O0;O0BM(hD``(hD!`(h9@ !`2S a I#<%@# 3%+##`0Fp&&&'U(~-OF,򙃞KhB@iS$@,#! +@Os?nFj#i FG#k FGi*@D0 P#1O O O `hX   h8Fx+@&WF&`1i*0B@3FO FB3FF !0F @  (0F BFF -o  mBBF 0 QI Kh  bE*ݴ D %uZ PDB @"*?0 yIhQ8I9H#F#7[BF.&KF-J  hE(?*Ih2F'H[F "iHhX1 XBF30B? ѣ Oh -Uh-umCF*FQF8DEha?V ;FIYDB 'UK!9xJ0HO1i:O1iB#մ QFCF*F8DE, bFB!jKhE F!@0"ozwC+ FX0D3B!ۭI 2i@N(F><(,(a (c (S(@@0 BТiRԴ DBDイ0+;iRԴ Bfj&I M(hCjF(hCj#FF8FEF(F9F(hE%F@0F0VFFKFF+ EE0h@S9"FlK0hBKF"!0hB"!0hK0hH0h>aK0h3x(od(b<(o>(@`0+[VK[h;DgE`jOF *?(FN0+?/  [R#s"r₣iO0EjB `p3D7D"rB:FBؿ3ؿ[x(c?z(`(x(8a80Bi[?殠 (8?߮((J C20I1F (FH(. (O{pB2а?(?,>(@Bаͮ@SB(ڼ#P'UT((F>(v(? @0q@0n@0kzh#P i9 jiEiF0B# i9t jiEiF`h1#c`&Mis?׬?@h;pos[ʬ FGB?ì(si9> j0iE jA%biFiA#a0KiS'@8F|i*DPh 1Yi+D^`30Bck FGi%A jaA%b q(u( I "ܰ-K[h;q(8F@ 8FFB8FA8?yXE@Bp'UKiS 0YpG'U(KhBiS pG pG'U-OFFFF%$ PB1F $ F!Dm P00S$((" "PKQh3@@ (FF113In *  C !> " !>#"2""5F * :Cl !>t !>p!"! "B, * * ," 'UTUUUV@ -OFF+𲀺PFM1x!Fh8j:F!F #3p Й0C@RFIF0FI'hA0FtFhChCh%FCC# <+ؿ'B/Bؿ'#B+FBĿ FBԿA8C7}KArJH=N (F(RC ((4(n 3B@iJh20Y@3c* 8 5FO N#O IYIhApIFhAlVIhAh[$%F#sLFMF'F(@BC@BFK1FFh=320[)=320[Ը*- +,+8*1=DF? FF8,%h}hFIF(F. h| h2##`L%h}hFIF(F hh h ##` KhI H0',p''U-O7IF F`5N*F!hFȹ(FA G !F @A @*AD !F @A1F!H6A4 H@i 7^G hB)jC  hCF0IH$ !6Hh h9F(F9 h@F(F@"(FFIX(FGD(Fp( @_-OFF 3FF"3 1nBѦK`3(O ĕMLI"FH+h*FI BF*h*їIPF*FI4+h+*FI (KhFHKhDCFr(@L H*F!H3!(F=: ̬+Cs+()F {z 3 HqIPjL h@kI h##`hI0hZ@gIhVph 6 bH y x۱ { v2hFZH |IK"`GTK`(F:1F0h1hPHOK! "!``Fj!$$FP C h C`#4 \ \FĖ 4YFOp 4#F >(k03/IF`&r ![" B >"0F!F:$Hn6J, K h3SBF"Fh K `h y' tptb@f''''T0bh+.$#"(FB*OrB GKhEK%`>pn `V>H@L(h0z9IF F~$&U!T!F\+#x+?_/\1 F 0+IF F # ""I22!F@F*3"xzS/ ̬! p0,*?OrB? w`''7hF#L~%hhF IF(F hH h##` 0IHF `XhF~IF(F h.Kh[zh0JIFY inh0 IF H '+'v*S?0#"2$K!" C#1 #IO3 I H8 Kh H2 !F(F 0@3d' -CpF F(S+!(0@O0##`iCpGI(xF(.OVI(sF(OVp/.F `9$(FfC4 B#;U(Fѱ* FO4s>H-OF&R[ )F,@I*F x'/49F ! FF Ft' (FO IF/F"FI ID#F:HFI F2pB x%+@+*!:0;x'+7<*+1/!HFF#pHF  /#0ñXF&C (@hEHF/`nI8F6<'x/E&p> hI8F(0#(0*0P#*0]L h7"! hB h>BF#h  )FCFFQHeC<@ v(QAFNFA3hBFր !F @Z,΀3hB;H?A~ ?'AAJF`@ @3hBAj!8H O?tFD$HCh;C`+򆀱p>N3hB?l  0h60h>!0hBF .F/V (j(F/ F,yvЦ2Fj1@th(PdB{.*? YFPF((FhE6F/KF(?KFI(DD5F (0;(0/?pH?kh3`wF ^q/V,63hB?=@ ?@2 OpGd0ð@0Fp0[.!0 H"C0F"[Hv"!FH'U'V-GFhVO`FB# F#p_-и/-у k20#)F@F%p4#1) F+FJF4TF!FFF"CFА"!(F/a"I(F*F1F FF F,F F'WpL F0F*@!FF 0˱) !D<.+/i`@IHbI@p\Hp'U`'X'V-A"-I @0n"F)H"(I @0n"F#H!"F CF'("!R"II FfF F0NOD 3"PFH F3hF01F"8FFF")F8Fi!'Yi%'Z'W(i8k'Z-O"]fLXV-@ dJ~ ( aKhaH`IaH ( /~FF3x+HFZHDB "ROs2#"S,:AF0FZ1FDF8F{jAF0FNGKh0DYY #Op"9F05F " FF8F ( 23 R-8F/~/]p!(FvO5(F "]!(F/F &Kh F$H"Ow! &Y`3f2BCl&@ss cO3AFf7FfVFr O3HFU]HF%@F/1'U'T'v  Oq"%HXVl"IHN("I}HF(4|K"@!>{J8#>0 uHpJtIOpkh{ F(%#*F)F>0>gH1s+@𹀔1l+@bJ2h32`~^H(@р\IdF(@ɀ1'h\8XTJ#v F\8PJ#u F/@LJ#w F.oIJ#x FGJ#{ F\8CJ#z F?K.rx=J)F(>AOAHO \2F(?@F(?K JI((@Ԁ\8}J  C\8PE" wH / !tH#prJ  (" nHl / !kH#phKx+\8C\8dJ  (" aHL /0s]J  s(" XH: / !TH#p0+\8C\8!NH8#x+\8C\8%HI(FB9GM#88>CI| #*FQF(F\YF(FX#:4:4+?&+FJ0I c(?K>,J (>?>/f%iG'\@']?3`'W'[;f'F'Vp'U'ZLUn-L1\wv3H43( ؖI"HdJ#y F?+"I8("IxI:*F FHKF< WFFQFq:C!  xIGwKxF*>vIvHFpuKh, !FR pIoI(F*0kJlIF@F0#iJ@FiI0#]J@FfIeI  @F3+<.o^Mos^I ;2'5QZI(F&b# "SO1F# (G>PI\Fbt)Fb FF IF0F(`hAF~#x3DHFBHr/HєW5C?I >J>I F^H]Kx]H\6[HZK!ZJYIFVIF TTI0FP:4#RJ0FRIHQI D\yƱGIF(F6:4+dDJ0FFI<:)BI %BIBHF(5?IF >I(F=I(F:I(F 0#8J(F8I8J(F8I035IF(F3I(FJ(Fj#I .H-I.H\63,HI+H0FP Bp&K0F&I$HI#H'U`n'F03'W МI-@Ma Ob)h1I `a)hOb `1fh0FbEv]`.[2a0BVahOb)DahOb)D `F('chFx)r}Kph-@wM+h$(nh0+iQFG?Fc+h$Q-+h&'f"AFr(Fx bOcG+h"frAFoOc(FG+@^IaIF"L"aiHXIHFVO\&\F-@h aF( bhLI(F(\)Yx3x3! ` fO [E8F ]3K0Fh1!s0F,!#Fxh0[QFG?Fm+h(F0G  vQ-$(h0+QFG?F$QJaObahI `aObah ?Z"IFF(Pp4'$',+ 5k59F(Fb AF(F^IF(FXбI(FTI(FN퀱I(FJX" I&f")F` IF IBQ0#Q#O$$q F`@k"F9hF h sT###"0GF(F8Fh,+h(F0G;h8F0G$Q -O]LOrFF0F!O94.!hX)̿!!KFh0h""08"!FH2q7h$! Q ,|4! (1,081SC"H!01#$1h1(1)@Łs $#,qS 4(| ,q08#MJ $1H+oh#ShBra@]2O !>I" !HFq3h8I $1h#8FRBR![q0Kh`1hs## *I $1hhs3h$1h Xhk !O F 9  O3G9W<+@݀@]7hp$h0G$B͹׹)F O5l'\(P'$''`+'5/^Os#sK"` |Oq  O3EDHOps2pP!YwI`#!3 1!11FO3F0BFlI !0F 0F OpeL"%F"aK`(F ]:FA<2!sA; "h *ڝB#o#`"B"`lB?=gMK\Fh/?LYF@FFq}1#}1$1s! s@F,!# $ {F3 +5K0hh(i(?( s$+?"3hq$1h##3h48!JCI&m@* cEI F-.Y#mAF##eW#m-4 F"FB(FF(#F/cn#0J!mC!-J`@#nC!(J`4m$I+$M ""0lI@KFm;"n*SC!JIMI'$'tp8AUo")BH#'\IMILIMIEIMI>?J!"B7BFA&&[my-OFM+h*A\~HE}I}H}NF|IF FL7hG+hxI3F8F я 1hrHT!F XFnI,(h)q/x0)F(LF|`ꜩ8F`bIXF8FGF(7O@ ZKNF EF6$2(l(F`TFHF,^Opu!FF0F,L$*FDIXFCL#x! FAIXF@IXF?IXF#x#9JXFI*FBBFI+8г% +)K3O(F&IPF&#.O5kOb `b)KXF(I+F#+r[B#IbBXFy I H&O3Fl&O3Fh3Ff M# OqBJBK(F^p~ !#'t y+sS-OF|$M,@𽁴M&ԂFU$ AF@64,ѫJI46JI*6v!60F,F0O60F $MLH| Hh`HK(lcc H,eTDO  [)IBFZ(BFIK#`rK BF`I``xJa`4 884D  ıO sKgIS)BF(BFYF衝#`6eK BF`cI``[Ja$4 884D  dYK\CB XK@9qWJXHO 2FTK"pSH(_RK RIh2:!F2MKh)!LJ3OaBFIIPF8F;FJFH((;hCExh 0(;hCE !Op`FOp {hp"O 8#4h3#Ocx8G(?JF(HS(%J HK Ioh2!F&^y!y`!%!7!I!O!ac!um!!''$ 8A't+߈`"3F9F*F'OF,B(F,zS7Xh,&q#Np"2hBAhj-3Hk"%$hBU JoOckG("FI(F(ІB'_D'aDK"F"(!) F@'_DL2C"q #2'_D-O"FF ROj ,_F(L"FF ?8F< TJO 4FTE(F,LHF"I@Fb2F9F F\p]21 բRx#  dAF v0O9O9O O9TF#F#`iFP) hK"O0R-A]&F`F`F`"1FgK hF,y!F F&i!p,$( OsF'yh F!s F,!# Z B#(#YB#tB #kr(F@F(h $@C";KrFD ЉռBLAD !LDAHAi`F#F IF(FA))2BI[F"FV?Fs7O#FE #HF#Ob^v0O:HFf[F2F*Ihh(Iht3`h3`+ "!I ! F(#cB# "* "8F_"\2 9 T-a#2FIhnh_"8A@dAde.o"'8 FF! F? !F(F8@ 8iK-OFP!F2eJ!h+PT!2`Jh+qTP!TAL):X!T"+iX!*RHtFPH!ZD FBT!! PA`P!GI ``"X!oDNs>S8FvBBB{.* F(F0F03KXhE0aP+8FP"X "(K"P!D T+(ТT!DKd`pBOP!I`XAXDT0P!!H$4PPXAOP!(F I`I'eDv'fBvvp-CF@Lq@K\1#?M" Q]2"*!D \!D!DB @  #51D H < L HQF@(FDFHFB8MF<8FHFB8MFL8FHFB8F@F8MF!KJB8EFF88FC𛿃I K K\1#\\1 #'eD+" FiF8p@XBXA& OAJxI K"!H`KJK6K J!H K.H]ڿ ]'."-'''1$L''OA0# K#!3 F#I ]B) A1 0<8H !F MyF(F(FI { F F8@+@p"R?FR[)F"*FI tj#FI T+e0@pG"f"O3 A=m( K J L`: J!F H1J!FH| ''1'' HiF{v퐹 I%x I%@ ] O0 py HiF{N0 ] p0O3 A=+$ F0K JIF(K"M!H`KJK K J! HS K'`'"''''"$L''O3 A=( K! J H K KJ! HK ]'"''''J#3+ pG\ pG'fPJ#3 + \FpG'fP I#3 +KD 1C 1pGZ\"ZT'fP'eD0Q#0Xh K) !ؑ D !'eDKD 1C 1pG'eD R} O r!2 2#H#"2J226" J8!2"FF F F^ R}y'eD J KDYh()#FpGBh) )3'eDL#h+I ##`'"0HL"MFhF "qhF( K+`A0 D# I`1p{/!p0(`"'eD'l"" FKh!Fz'R]pG7IS[HSFI IF )F F FVI 0@pG## 7IS[H&F IF )F F F*I 0@pG#)#:IH#Z# H H(H0 ###Fn( 8"I D@  'FIH FKJ(FFH\'''FIrH FKJ(FFH\''')F'(ML( BFC<:1 CO1(h4O1 h4O1(h;O1 h;(h9b h9`(hBZ h@('7FpEh+T+F"FIHVH0##0 ŰF"F F ! F#pKhK`2EjA IE0I'l'eD3 }8H%57L"F Fh FJ1KhT#F0J!`p6"q+Hv)I < t#H"%K !U(F#K #2 #"1#)F&O)F4b0FO3422! \`2J!JH"F x J2 }#'eD'l*S5#|$"FH0iL`rX8F1F6ȱ0FF@8F+t`bJ!Fp1"qHvDOs K4( Xi, F9< FA6 'eD!F< @iF O3I]iF O3<]hFhs#hXhn"## !8FLch(+ !h)(F z84JK(FF''-OF-Ì^+O,NĐO =F(F"FIF wXF(6SF2hI %O (K%`F FK"FI@(F%(ѝ0Py+30a#0030 $1+'$4''$RN*S'sl-OFF$!oG&O OF F4F%h*GF(~$! F&GFF.=#x+o!F8F^j FDBe5K@q4J5HL # A= "g_Z V* B Z! ;D $!F  "A=HF oC##"# "_, F V+E6!F8F2F>D\Z+@0F!F^ F`7$!HFF>p@F $}D$-CFFF!FF* Fб$B@F!F*FBFG F*(FC*Y$0E$04-GF$!pO oE$'& "A@FEg_ V+щE $!@FLFHS+]pG%eFHS+]pG%Kd#H"d#1K`H,K`H'K`H"K`HK`H K`'eD$'H$'t$'L'p9'h'x F!F K@h'$}!F" #" ! # D ]HFȹpCO"WHh"TIUH$"TIUH F }Or! PL"!!"F@*@"iC(ۅBAK@ !AJAH@I*)g Y;K"p O3,9,kd ) *I/H^_(7$@*M"t& 2BX`C|#!j 1@33O3OCF$yk (FM(F AKh+^!l '''''h$R$|u'.v''h-OFNNðFFF3q3hJH$,h F3F FCFEJ!@(!Fx3hF+7 (;KF3I F@F@F*,5*Jh3`*I D!F(hGF( FCJh3` *F!$!F F*@F*$I k3h;Kh#I F`jhKD !B !/Ji3a'''P$% %E'%i'eD7FCh F ++ HqJ#)F F#60JI++ F%op%y-O@װFHFFKhH"!H"MJ FR<(+@K`N#\L uh(-@8FKhF)@ihB@  ~M/AЈI ( @ I I I $17{H xH0鰹 0#BBrHAqH8pI mIoHLkIT ~HF! RLT+D 1+1 2i3h+A 1+;chh +dWK!dh=9LAFP1h#_ DYF"hJJ #`a ** ED 1C 1ci3ca60*"ai5FFFO5kh*+c`` iIShSihh!FzDIF(D(F<@F*+QFl 8F9FFFXF`0=+#IF0F*FOQF((F0F l퀹F$h@#@F(O4 ~F!@%$***\FOp(FF# &'( N'"F1F(FXB yC ha`) ` h* d| FI@dz M$OcF!FF0vCFF;F"F0F F(FXBڼ` F M FIAde0hD#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕp"Pl" pO3 0pGo 0pGKk+ыk+ ##pG++ ++#3##jF F+&h0+#+OOac ##c#hhhkGb0#h hh[kGbjlhbbkZeke  ;+JR#"#hcachhkhEK-OFOk F & @/o#Bܵ0+ۙBݪiRRiOBDh)Q/AQ*IB )IB)IBв *56%JBjip!D#h#kYԸ 0# 0h+JB+Тlm#e 0SE[EJB3 JBKE"hhhaihnG(ѹB3'=a# 00pGhp!-OFh)F(G%Khh)FlG(ch $BСhEE"ыlBѼKmEcp"Fc5 hhBؠh)X#h`hc`jF0E0%p''-OFhNFF(3h 0`p&h7D;k1ջk3.єK"Oh:ni\hnB8$FOpFq[FRFI@0F0*hKBiD 0 C# 01chEҹkH hhlG(*hvKBѫi 0Ѣh2Dk@C 0# #"fK [F"[FIF@F FFC | "[F @9@8o1 hF3DPqnh+jHK F2Opx00 q p0@  x #c 2 y3  p ixL-#F  4'4#I0K'o'X''o( +(8-KFLFF0+@@}O@O d0BOp0V0B@"H0BOp:0BOp,0BE 0BF 0BG 0BH 0B@0BOp0B@0B+hhhZjBE*030iS0/kk+mhfIBDeIB@dIBK"h=Kh06K"h5Kh K0h.IBѫjpi @   "I#F:F0F0{#IB ѫlpim@IB ѫlpim@IB ѫlm0 IiIB'ѫln0'oa=+(Z(`''X(i'3(w UIBZѫl[ns@i`@OI2F#F(FLJ!ET dOpy*F!DIF0 i0(F) ?JBѫl30hP!+FS+hhdBFiiG+hhhj #RBF/⮲ *0 &Ii0\ll#Ii0Tll Ii0Lll_Ii0DllIi0 B8p@р (%ch@XFDBO6DOf` 0bO0CI`kh 32Ex"Bp hXCp DD h h!h#" #O'$-vS5pIh;h8FlG h:h&hG(e hO3O2h# ##(# b FF"x0G(F#& h&#"h0GCF8 h9F&O8hlG 86F(#& uSF@JFxA| 0 2 #  5Q  PNFάάά@T0+ + ¼ƼƜpWEO# 0IZj#B@PFWE@i 06O;HF0lGO<F h FO1h##"0 G(F #!###"#hFhkG"eOp "JF$ X @ƼƜ& #c\KAF"D YK7#2## IFO@F(2XF0P hWE"h00pc G"ckK 3`T hhlG"# F###hbKeeW!F(F8` G(Bg#b@#?)WEh ghp3D  i RDDk;kch;c`JF$(xWE?vr h h0G e'h5آh #_kBC6(? #i@#p#_Bp"ch[gh1D0DZC i RDDk;k##hh #ch FO8;c`!F(F P& B680HFlG(Ʈ@F(&-C FIhp'Fhq( +h`hkhp zC`D^hp"!@D i1 (F(p  8D AF@J#G 03 F ba2bbjh2j`$)F F F)FO0-OFӰFFF*H +B#O;pO;@O;*;;" 0! &O TE"$#2FD(#D% EHF!AF0F FS #F* J! 7#F6d8FKE|E<#%<(F7-A# a FkklO@Zkgh)FFBOv")FOOzrBCFBOv#XCFBOv@COS F@AUOCOC#F aORO3OqEKk-C+ FV*#+R! (JF(NF&Y&!_6.8`˄@7 `Op2 aOp-K"!Ff# fK 2J3"2#"#)F0F$ F(k+)F }h-OðFO 0;E 0YF@F  lG(#SEFXD E IF@FlG(yQtpg{FB#v #Bv ۽Bt[#BtU")F F[FL[F" B FFQF E 4P!J4X"9F0FCF&CF" FFFFp JP!gE.4 .!~ C  u)n'X'-OFh F hmG#hhPF%P5% !WD/D8F'b(oЅJ#EFS !6F-m,b@C2F+FzI^0F '(F' F'8F'mK$hB*qRF"F#"hgJ!PF,D#x+@"F`I&#O1* "F#yB'E!FPF(ocx+@-!x`)@B04a9@FlG(C46#]BE! @FGE,-F < " FD2FFKF@p 2NC `#D #Bp #`Br 444#C4BA7 JIZ a4J!_[F4 IZ#F 'X))')=))0 mI  F0Z" FFgI :Z#ZEFI0FO`A*4 FF\I(F$0Z"| FFUI F 5RK!hObF@(Ob!F@"F F'Aoo6iFk #Br #[b44'' ]O4O34=')))-H F h#h`#Sg B aEp  ڼk# ؈#"h-OgFEFoF F GD4hdCA4Kh.44C34DF"3FEI`Ah"3F FDF`FmdF'F4BB"3FJF4BqFF F44! x(DErJA4 444P 0`+Ҳ@FgJ!B(dKM hQ! @F!rF,f#F2FSI0F p ' F'(F'HK$hCF#CO2[F#FO3# #!XF#HX=I\Fp2F!BFBOr6Oa2HAFh& 1I"FFY 1F0F }QFBHB F!FFFHF<F(0=+BrBJ!D\G%"0FN酹H:F!Fo0h(;F"FI0h0h0I0h IH<sN#*S+'+++ y-A°F F"! FOO8iF H+ Ѷ0@/U#0 aB:FIHJI b(JIHI W#x#"FI P!OpW0OrU#0'''{+, ,,>,[@=8F F)0J T#0ha8'l"K`*% '\K@FhF&BF;I0F 0FF0F&@+OsdF3F/J  &Vh(?zOs3ar@-$K$Mh<"F(h?(h-(h<#Or2JF&!JF"!o"F1FF F+p'`'l'''{'\,,-'-e-0(ڼ(q)-AF0HF/I,O.MF(9,h<8F*IF F~%HF&H(5K"J H6(h82FI`(h"I FF F&S@ F HH2FI F@ FH* JF -!!npG pG-OFE"qFFFJgE @@,D*B@%OF@&F,FV DEx gOEv ]Et $gBvEgDEMEO5O4Eh,4`EfA=F4FE23Kh!0pG'|-OFF #MFEDFx gFF#+r#"#/v ;F2F)F FC3F2FIF;F`A2FT0BDt=F4F#H3OF2##Bt E@F 0 FOI` sE2#Bp E FF  K##3BTA/v;F2FI`A$T0BDt=F4FcМ0+_ĐZ F @##BBJ#BrDۍBt5#Bt:4BAU FD/v;F2FI`AT0BDt#4F=FBtf#"#K`Br #  ]0%###U"#"( (F)F 0ppGFBh IW F@%f.fp FF/!(FX8FH(F2F5Dix`)ٴ aB0b#FBp03O0"H0Yl * F("HF~ $ N MV$0 F!,]#!,E ;`'hKh H'h'#`FFFB,@!K#`ppB1+$Op1 ` &qDE`7F&BBO5O4EEoODg1h;` 532 F.v8OrPF!0# 0P#`08-BFFFFE+@9#*FFE 3`a3ڲ +-%pp/E  E32 Fih$kh4 J FJkh JJ$..""!F0K@QJH{P@h%/ F@%*..FM+h*(`OS"BrsOa OaBOvۢh@!!'FmFFF+Kg!JH{ mKh!JnKi!JCnKj!JnKk! J~Ch`h"uCaȿO& /./(/A/Y/t-OF#e Ofq %F(sO1O0O1OY' 2B"p";FF F2O1 B "p";FFPFcf"fSCfK#`#ee#`` F+" IHbX#0 F9h3`#00/-O,MFOfq #PTX%tF(v'O3O29F#@FOc +CF F% 0dI.( F%(F^ ,MO1QEOp SFZF F\F@F# !`'F4#XO F####`` F0SE'(F$BFCIP (|д *)#BݙXPBB+b3  0 *Mh2`+H++4#+r0"#""0(F "Fбxñs" 3F B F F#B#r#"#  7z#[b FAAde/0FM+h)(`s#Br 0h+hBO3O2#"## F"g(д +hB #B+ 3 '8FLh # "ABز83!+ K"h KhB (4Bx2F'h'|'8 FF((`O ###`8VK-OFh FF O "FKFIE (B@vO  #p#00##"FYb# B [FRF# 0s(q$,0 X3A" @pBж0##0ӱ,D BKOYqJHzP"BBO3O2 0 3 h3BmBj  2c'h/.-CF:KFFhF)0'P"8I+h7IZj#BO4D3P4ļĜhE+hIF(FlG Os"&K1F%K6#2#:F#AF0F# .e3 FK0F#p0s hB h@ G 2qh@F a O0h+##0Hh-OF0FFG#h FlGYKhszO;O:@O1O0#hFF@AWE"g 0 FG(y"!l ## ## ##hi !"[k G#h"0 FGCFW#h FlGF(O#hi*L" F#GC ##(#hkG#h" F0G0-5#hME0F0# 8 O3O2##  F###"G(%(F%'$K-OFh#(1+@܁ +h3K@AJHyi.΁Jhd(FN$OsO~OFCqKKF#>O38#FFCF@=#h+h` @O FXh 0h ph&K"! 8FgO@C"!@Fȑg 1FOp  2x [FqH:0$1hh0$1hXh@"!FO #B+h0+H"^HOq`!Y`@aZHYaYHh(Y22WI b@b#@s3133o O3GF HKb0F0Fd+++\$&F,(FG(##z0:K" O4 F-+h1F(FlGp#C !#h;+46hB؄@ F8#Kh)"HR(F|F(F@+h0+!(FG\B\A+?Ʈ!(F\'$11F'\'180@''1+h"hhO/Kh@!Cb@! &fI@]IF8F]+&B#O$!(F (zaR hR4 Ch(FQ$X4 YhB68F#d 34B#$F#$!'$-OװLF!O2%hF+Or(F#1F(m!(F#)F8@F>F#0FW!(F# (@8F#@F# K hS"+ 0B`+Uі(1+kO Qj,1L!\ 2 # H1# 4BpUO #<KBBR FK!gFOpJFIO F&G W @+5H@|K` C 0+0G( 3  hB-؅$[BO:0G O MF,~6FOpw(H!2FD" ! PI F!gz@md\!FXF~FPFz 0Fv #D 3D F"YFFVXFO f! QFFVPFX 1F  V0F# FF B+K@Q+J+Hx F#"3AF2*F33#?FFB6 &R#`Eѹ F#8F#@F# #??PFLF[ #qF''+111F-G%mF FvH)FO#`*@2(F9F(;x/+ JFOaF FOb9F F*O(F(Ob)F*oOa Fp(#x/+0 ex%m # F*F*&3;DDo?}MObI FlorOb* Fboh0F( ڵh0F`-0F F m`1p*SF0(  @ F!  "iFp ( F +Ђ@ B.-OFFF{@F(?иO'0F|\00Fx(FC+ "I FTF(#FRFI0Hb5";FYFHFO521C1-GJmH"F@(Hn(Hi(@߀HObF((F(%(I 9@((xF(чI(ObF `I( bIF vI(ObF `{I(y bvIF `qI(ntIF WF(@qI(anIF FJF(@kH}ObF `bI(J b^IF F1F(@THdObF `SI(1!F `VIF(&PIF FF(oPHCObTTF `nGI( FX$0JFOa ` cB `0;F bQF 4 ,%!Op0F Jm((%0I(ObF `0 `FX(I( bI%F F#HObF((I `H%(IF F cJI(?1222-12V2!22b2u2222 272@*22Jx1 `pG# `pG# `pG# `pGpE-t)F FiBdDK"hbJ!0FK-ht6 5 !P"FFH F"* p'X='' -OF@h#C#C#k:գk3!%kd##e+ra#%[BbB#K !J(m$% AP]ckh0G8= %O3c0Bpp#wk3 & 0BO6c501FPFlG(#EE6cm|H #C M\KBFhZK[JEFFUJ!O3 6" OKp"O1/ ##t0F "VCKhFFxj6 W%-(e)%%6KL%7Kh3)pۥ%#EB;0EAhlGFF&#*+#  9F8   FD2FF;F@0D#kD##c;0+Qπ#BrȀQEp FF/3W'X+*ST'[K ;0FhYKh,1I ("i F7~6m @/J;F(!0F  гnOp%JSFpkh[o#kOИG3h+Dh+Dm^ @yJ(!;F0FX@&k!+#@#'X%3^3h(o3Wo3t3e3m( Fqh$p %F#FBѝD* :F+ 6P!3F)J e'H) '!k#h"kԒk2$3%+ P"F T* P"F ,Hg, KJF!hF- K J! H)UYd@'o3'\Bh!-O2Fjvj0":Op&)FO B=7JOP#C4#a@2Ka@b1Kb0#c0Kc#hg#fFF hhCE&ah#Op B3 Fj(ۡji  j( 120 !A|hjFAFlGH# J h "k j 3 y  -OF7FFFO p' E1Ѻfqhp'hq!(]shQF`:F3s` Fi1 x#"kih b####ice+je7hii D hjB6* Ѩi@x1LHk1&#k #`m!cH*Ъi*x"mB"eA!c##c  hK-Oh F F8F$_ eh! PF!F(\J#SE-FOsOsQO;tpżż@s"1F@IKA#2RF##"(}0F"CEnahj1 !F(eahOp b 0 h!(Uch` D1F4bh)F  *"AF0FRFAF(F #8 +c!Ff8Fl#hkc F[ 0ch3c`1O03`Rf8F8F;'$v -GF FOp 0@K"O1+O . #30 /+"9F /#0eh&B@ij !F(ahp&ha! (ch!`( "B2F!O6(F<#h"9Fckc##"bUbch F03c`0Fh9F 0 OpE}d*F!Fo(F!y6'\-O FF#!4"0g4PBv#b#"4dCA4#4BBA #`[BA# p!!0YKhO(rUI$(#p&BBj(Pm3oO0EK$!Op COhO3F3`Bثj+m$'F  O32DjUccXQmI+hmkG 0h3Db0j3DBZm**kB cj+@rHh]Pt0@QPQQ`0Dj+@` 0B"F 4o4jhBh !FlG(h+++# c!FCFj$''$%yl !F(FGh+ #Bp# B #[Er gCF !F(F4h+hB؛l(FG`p$Bp'Dk3I##)p#B B #I#Z\:*@3 +p;#+#r8;#[Er /NE@7#3B2 #j # J YFPF;Op  |KC02D## b FFB;#"#NE@p! q[BA Oj p"B@z2 B/ p#s1@0 ` g#*KC029FDBr 0FFF 2FJ {b#B9(#3B2##FQVpAKCv0DF[Er _Ev  #B j FF#P,Dg/vD###PABv #k3 @ Bv+0KEyB@p#U`)p #+r#"##kg##c+kC+c##`p# wk3î#1B#1B;Bp!qBMEsk1 Q kѻ j 5FFS'P#;J:bF F#@ p# UgKC02D#gNEpBQ'Dk3L#;B QYEp <80Dj+ IXF~(?9FXFvH#+rF#Fsm #sesm+#ep-OLh% F(Fp& #B"-lp!(D!F(eFO0E"DPԫK$\CBLЪK@OQJHw03nJk՛k35Sh0Ep"IF Fn##k!գk3&.p4p"IF Fn.fhS66IhhlG0##h0[hBp4 p !,p0!!u 0Kh;$p'hlG #4O3$F3FB2#0BEJEg5#D4yF Op KC0 T#D[bFF#`+r PAxEoDEx򌀹BFb# %0B 4,sO3O4 4 j-@ o'[B Op 3 !D44C340B/&p'03DkYF?!FF6ԙkKP*FJ jhlG0D3kY# hx# @V KC02DPA405(wm33'p#pGD;kZJ jk3 ЫE3h0Fo#G0CDIEp#EE 3h"F0Fk#G504<+h(F&lGLFH4 3FH2#0B;pp#wk3~;k{#+ru)hO8 2#+r 8#BB 08@H04w6#CЋk36Cp,C` kCKkB k  +hBp" P,  }k3h.AFlG0 82d0##3hb.##5ce6ep4_Bj#CЋk3Pp"74SF$M(h(4(h7Vj+`h!0 bO6 Fb%KOOrUKjF#2 #c#FPXBbڠj B(Fb #!F00Rjj 2 V0( ' -OFL h)1$Q+-@uO-@o(!+F)FF8O@F3'$ h#s0###"GF(#h$Y#h"(Fs#G(F&FhB4!h@1<1@1p#Cs##K@/,aBhO X2"N !!d #"c!K8Fd K! "0F"Kd+h"hh O$ O% 2 )h Hh! vXF +h"hh *h PhZF!v& H9+hh+hXh@"AFO #"J#"#0vKO %&uH"`!tJhY`"a(qJYa ٨j0"bmJYb #@s3"6@33o O3GF _Kb0F0Fd.?ꮳ+c!hjsq####0h0G.igW)hM#EEG0(FG;F2F)F";F2F"(F #'+FB9K&Op B@O1O0z.h+h"1F(FlGP&'#h+  6"Y&.+h(FO80Gx1;F2F(FGh+KOaJHv.4#)Fg"#;F2Fc"F("L'\+4p80@ '   p43)F"yFp3l##*F/FEC#EJ"" h9F(@ 7]j *F F6p5R"lkC dhlG(?I"$C hkPKFG$CDlv)p7WDl.$3j..Vm.g) gp gBA g FBA3p2p&"^Ch5DlkGh"C$hkP#G$3DmBer#PF0$0%0& 0J(?a"#$33_>Ob!z" !`bOr!n"Oa`rF Or$!"(!",!P"0!-I_XFF&#"#+l$jFinhlGP#g B F85E&` h #+r|+#"# pG pG-OFhFFF籚h8!3hhhahBCYc!`a"5hk3`-FJHp`'h+hB*izhihhhkhR 0 P "0F8# J`bhZchJD`3`#i+`2FYFPF7 YK hBڂpG+#pG'\ K`pG'\8F$1Cx1$h0G F8@ x1S%5 x$1hB%-GMȐ$DF%FO3 VFFXF  E?>"!F)F@YOsQ" B "(#2O3:F!FF0FL(F z F: OG(@O0 "!KpF)7 !(/i@*  FIi@+ ckiO pkIF(Fp@ i@- ki@. ji@/ #kp44"pF°OpFF"F . !,4Gq[eyOpiFLIQ@= i#HI#F(F&Bp@> i#kF+z @? ickFOpi80F82FOpFm+0J!\i@A p)IF F&@B idm&IF(F#n+#J!>i@C OpiNcnFn+J!*i@E n+J!i@F #o+ J!i@G Opi"coF 4,46{u4B4L*FOpFF"FhF.3&4@LD)O`T# 40V.;@0i,@!4BQCH!F(h K4#"C$#FO1@7 (Ov] $+h!J8F#"sO1#F0F8FNB8FH(` F,@9&0@:& `O0*𵕰>NO3 F FsjX @s! "!"0(\pb0 +X"DHLPT+K$\`)FpjS &K"Z` H +kbOq 5@& $+h!J8FZ#"sO1#F0F98FB8F(`5@&5Ov5@& 5@& (`O0'\*-OF#K#O$FhF"F ( ;hJ!PF #"O1#FXF;h0FC##KFBF)Fv 2D#''X3W0Ű +')17Etjoz$1#"#FO1@I @K1"h,1<@J !O0 k[ c EKk[ Kc$81#"#FO1@K XOw,%#h!%J0F|#"cO1+F8F[0FB0F `(F\@M'`@N'Kn[ Kfh@O'lOw o[ȿ# gKo[ Kg#"#'$*0 FŰ +L08NVb #"SO1#@# #{/+ ")F*PJ!(F(FH8D#{/+  sE1[ 1!*BKtO ph,1<!O01[ 1( 1[ 1 1+1+$1v@%'$(J!(F#"SO1#F8F(F(B(F"0` 1+1+v(1@&' 1+1+v,1@'' 1+?z1+uv01O w `n'$*ChFsl##` hJ0Ih+ 'ChF{;s#+r##` hJ0Iqh+ 'Ƞe-O$ݰO6%FF{Kh D(xK@s-𰀸x!*$hBR&XF80gJ! 0 DD8F[F0bJ  aK) FFR1+_ "Dh)} WI qh9FlG(84X/Л bYF R D,/*EIFR& "D 2FnBrЭ @FB>FUFF7$hBi>FUFF'F|8Fh,IF  *I "D1!CRS2:F(to5 ] )?}0 ,($!Ir (0"#DZ`8a4Q1D1'ȼ'1+5p2u5S5-CFDh,AiF'&PhjFTlG`#Br FFX04,Eєkj+ g J Ih+#+`(h <2" # 'A-O}$MF D(0!J#DhIFx, IHZKhIT I O ~I0F"DSi#{I0F,#)h !DP0+6ИX1F03DRPPTJhOFoF#G*h'"DDmFh:DxIm#GFZI0F  0WI0F{O ,#)h !DP0+7ИX0+3F0 YDRP TK hO"FoF#G*h'"DO DZDmFh|o#ImGF3I0F5  0*h0F/I"DSjj#$+I0F *I 0F +h%I#D hnSd+h!I#DhF c+h I#Dh[X+h I#DhS+h"#DZ`dO }51J!F(Fh@ idB 1K13$1!'J(F h@ idB 1K13(1!J(FhOpidB 1K13,1!J(Fh@! idB 1K1301! J(Fh@" idB'\}(S'X= *$1pF FF phBx1x1S%c0FxAD%0 !x(0F F("! T$1 J I4# K#3KK0 a% 8A' ` Kuh J+ IO2 K JK]' 8A ` a% Ku0@?Kb`ck;+إhݱ1{%4>@ (^#10K`0Kh*/Ibk#:*  ,0=!F !F %J %I2h2#K#J#K}"J "I2h2 K!J!Kn0 F{J I2h2KJKK JI#ih#KKo'\'$'7' ;5 2 F N'Ƞ V 2 I K'Ȅ :Q E E 3'' H 8 E 3-A%F)FL"&FNF["OI0FFMKyh0:qXhhBkP!D"; 3jDJd" FH3B(F,"I0HF-=-M-&0F M@2~"0C0D0۱*K8C4\%hF0p&JAF8FbF1`v\(p2p2#0Z"K@QJHq$BFF8F^&0[K@QJJ J--. JAF8F"H9dyT9,94848Ah\jB$ٜj #ZCX@Bггk#B 3h#h8  0+ #+rKO}qJHqOQBOp OaBOp! Oa@!9M8hkBF#BpO3O2# F#"#"Q0  pF0KOaJHq\k F!FS F@KOsqJHq I,ohB?8}N*+]  FNxFF5- "!O4 )ѝX0#"gI@"9FEF& 9fE&6@B*F12 h*Fh*-#p @B l  '*FFhXjB jBCXG"hF69FhFiFD1*F F -OŰFFIFFNNN%\|:FI ~@ Es[h#B$0#"YFZ"qYV5:-HFhF$|@( # gBvF #g B ggEv %@(` P0  #g B ggEv ,Fh #kFB ОB $*K` F3@,0ȹ+c0!F4(h;`#_B g0 F:/Fh  " FF(-KFkFF"F,TЊB (i "@2B Q0)0C0#[)Fb FF FBFb #KeB " 0+ @EIE! F0Kh;` "!F0:FAF#40(@EIEC0'-H FFFF ĕ#3`O3O2##8F#"###"'HO0G@w0`hkB.@y #Bp! RF .K3`  F02F!F0C0y(hEC`#[bFF:v-O]$FOcD!@h !6$ F ] I0(FO81k#FFF),іD@k*MХI Xsh I (#D0tkM,=tc4k,H4kMO,@؀RFIF0FCFF ?" hHh( o  F3?(CFF F0qh #)F6p FEJ(!F8F FO2d JQFhUQh1A,d'0(}/'KF[h EHD#Bh F@''0-C!FF0"F Fh"Hgh#(y`a+y+#iC#a*+#iC-OFFF'FOq%( 1[5-B', F7]*+Щ+2D"o 2xa2a(23b#EE +%8 Lhh#@z` 0+hx+p5#+p8'pdh%h) p0yEPh(FbhM##xh#(8khCEhAFlG(#BB#BB8kAF h&*Fo3FGF FFкٺѹJJ1F(FLF2FF(FJ1F(F = <48ApFpuvU CB Fp@F2FO B\F ss 1"@F  ,b" B\ٹ#FLFFOq  F(QKFFO F5F  *5)3Щ) h2"D`" )ER@)"2 DZD ZD"  ""FO FCFv;K@1;J;HnvO2q F(?`(FO3B1FOrFO``8FF"#"?#2#2CcB F`O321!1s4h(Fq0 F$ F h+"FBOp#hjF! FlG(((#h F0G9<-A`y,h((Ѕ(8(9Ьi&0F@ `Oh8D'phqN3qqq@h +hDw`+h8P+h8(h&$OB? F3F/((&3+OGF82BOт111111111+h9F8q4FB!2FF+22.h4B8(2+ѐA,8B,ѫi+?[J`X=-O4mFF!O !Oc~ O5(F 4m I(0X64F{C#4sB #@"!pOr)F Z BT13rK@!qJrHn$ s#D 0Ѹ- #DŁÁā4@,ѶESOX.2OI)b2F PFK(R-PFXF`@F`\6+X6+XFFFF9F@@+-N02FP!JP# FZ{CF+#K"hsO3[Er FF#FYFPF+F8FjCFEE@;1EF!`YF @1;hd!*F`#FGP@*'$-GF%KFF FO9OhsSSS,ExIF@Fo ڼF@+Or Cc"@>?#O EF;`#h;F2F)F FFG`GO0'$K0hFIOp41810! F(@ I# F#hP%# FG FJ0'$%!  dP !@MFK"FIFH H+? L#h3 `KhBK#hXBXA( x0%FlF*F!F(FX 0#iF33b(O0 ]-O?-FMOϰ !(F\## ! FLK# @#h`i+3@2##Br ڔN44$#4L"hR?@I  v#h+ЁV(ˁIKxKh+J! 9DKxIb\푋@@FIF'bRJ@q D{4{j&vd.d&3FVKh+#-Khd!JqJF DJ0D#O I Bp'@O vN# vJFq #D[bF Fh9t#H8s:IFSk@F{bRKx@8耵 IF@Fb@{PbFFQK!"KEr)@Ѐ OB0u@3 )p 3AI@2O0 CC3B#Od ) FpF@1 OK O#CSx@3 OHO#O CS%J)F0FhK#+rD Iv x;/@YA.( 0( h( `( @( t }#( p ( X!( |+>!!" Br.SJ3w ! n$ O.FV  rF3FO O O%O O%@P1FF)p 9J1F(F 4q4J43K"FhCnO b FFb@IF@Fb$K@k{7H{{zBOaa FJ1F(FD8FOaaw F"h `ih%a%c`%`%J`3Fah&(Fh+$hhBҝB"Frbid*Ѫ7#`O02!a F(`B )Fh0hK FH*F9Fh KF "O30 #p&VFD03BO60&K"dO3H00O6P 0Fp2Z`jhh`"hF(F(F &&R0LFOr!#h#nI0 H##hBД H%0(ASFhFFnhB #jC."9F0dh  H@ȺS+8F K F) F!r F F!eKI F-F8@ SVS^ZF-0HFQ [$Hb F12#B{F2!0!32#`Q FII"F#F20""b32 { F2bd #@1Q!0HG0SeS|S-xKFF #BXFn [h[hhx3j 0O32A @  Y2,QXF22@X0FF2th-HFFWF4hEF HH32A @ 2@4!2# Q(h 0 H2#" F2@A"s#Fhnh"h n( ѫh"h$N*hnhp#j[Z *Qil 3 F3! FZ0 F?30Kh13 F^3dh#jC!F(F00FldhA4ClpFKo@E0++(#dlKo@E0+(##emKo@E0+%##fQDQ-@LQ-PQ-`p+DP#cl;cd+DP#l;d+DP#m;e(F,5R 1; 1 a.a(F,5>H1;H1Ha.DDa(F,5*P1;P1Pa.LLa(F,51;1a.a-HFZ# FFF~F#l!F FkP " 3C32A7F2g G&W2AG)FF2g2# F #H-HO hF #<\ #I H0+cl+ Fg0 32#Q clKI FJ+FH龽S5FS-GFPJ 42gQ$'S2F2# 2gSeI'2FO0\2#2gqQG2F2#hZ@0 0+"2! Q"NK gQ !Q@F)SF2#]2#!0Q Ѹ>poGG`2#B0F26wn/e2#! Q И 0; 0f.H102#BpF2=0+CD%0` HF(FFIFF.9F0Df0#sf#h"9F`0n0V2n B2n Dq3rnBج# '@AIjFC0 32#Qcl3 F L032# A (O F F@ -OFj+I0O 32 XY s"C9 B#C4(F Yx $ HO Y s"C B#C(F Y($ s"C F'WL% $$($ F-A xsBC% nhs"C0R#C-D%U sRC0F (x'WsBC0F (x'GsBCvh  # VF0 AQ/mI C'nh} F%((eK)FmcH(F/%( ( \K"m[H%mh #!PQUH!9#F!PJ V AQC"CHH0EIFH|BF#(>" 0:IJEDH7FXXBB CEԿ##k<"#`O0IBv##i0`j(( }pihKEiSECh S`#bCh`;F2F#ibk"j`B`` bF#*ѣbEEiBEԿ""Zh2Zh`X` _Ev ""h^B^_<_I;## G]FFFOzqFFF FOzqJ (F;FQC1F%B@0K@Y!JHki%Fܱ&h'jBiBiB gh^w`gh5>`jg`<`b4Fb(F^B^0K@m!JHj#dd^C ^-GF0>KO(q>J>Hj@lB OLCFDO4 F8@HF'F/@F(F:FOO F! JE O O! D#F)F0FF(Fo{i0?h04pW"p2CCC~CS E agig 3 E a$hJF^C^80KO7qJHjF5 8@f^C$^-AFF0KOCqJHj,'O$DDkB 2FiF 0O0 kkS$0;>+٨4X P,C@<^C8^Fi#O2a#`ba 3`h0hxi`j2+Z`Bh``2+Z`Bh`"a2+Z`Bh`"b2+Z`Bh`bF@l F F@0 iF 0$ F0P! F(F%C_`O3CaFC _aFC_bFC$_b#dO`d0 F,F-AF0JK@1IJJHjbIM#dl*@jb kG#h+vCF"F# `ljCSѧh+Чh@B #gBBBԿ!!2ñZ` `0G#0j0(Bv!!"b0f+7+D@6g( *1 G* G|*z l^CJ^;FHFIF {Bc4 F-AFJFFhF((@-;F2F I HF0:F1F(F F$R]pG-AmLFFF#h4CF:FOahh0F;IF(F$#hBВ$ m(UR]pG R]pG Rr]pG R]pG RV]pG R]pG R:]pG Ri]pG R]pGK@`  ¹@K"h1 CV#hjF I`0н0cb '(ih F { F! |dhh F  F ~dh#DFB +* ,F+$p FFL#/x+F" F( "1F(F(:!(FlF(]"!oC0##"# "c;`O0p3p")F!Kh.F;#Z1 R5oC"##"#0F "#!c3px.+i+oC"!#0#"# "ac(O3 ccO3c:+|TpMFF*h1$hd#`iF0Fb0$f H F+hBВi+dhp(-OhFFFO40hwJ4`hcah8F8hkx++$hbi5!ich12HF:F! p+z i+kz+ 0 5:F[F!HF h(B#` iB@hnhpGCj@hpLF F"!hF#h%" hF3h HjF I-F%C#hBВV&p(ii~-A5MFFF+h Ki +V i!|l0h,Pѧ#` F+hBLВ.#㹣h+ * *("#h 3#D DED)+ѣh.+/+*/#i;`$* h3SsEFbFh !iBdh (CF"OqC-"OBp0IH FCV_ZFC "I 0O0 -O߰F F!KFOrh] OCFXHK8F]hB𴁒(Fw60іH8F'$I"FG BF## 0[x+U(M=h-MѻX S%(K5E%$lB3m" S$\ (TlBȿ%$smBݳm" S$\(Esm+D$slBݳl" S$\(;sl+: 0F$(8 \I  (mhE%%? h( #!PQ %%44B%4B% +tl 0FDй0 0Fh#(%! F`.H#FF"I k HF0 cbm"IF Os x"^OC0I0[ Fh0a *)؇* **IFH# (C^_hi_5*Ѓ*+IF8H:%*B*А*#(0  #= D)=)g=(0+ +sl3IF0F(% # I@@F FC ] FD0IFH: # FEi3#d F0#H0#ld3#d%b] F`d#c`{h``4|`ed__@_13-H@ 2& W2L\FҲ@ D"0@ 2E2g$Uu$U'a0F22g%UO'a&022g UO'A& 22gEULO52-CFF FF0H(FXF IF0Fk0F H F 9h"(F1HHHx FB@F?;hFZ:`@#Cl-OFnNFFFF3hF+x"+!<"+@?5@(x(#4< #0B'ӹ0ԱE ##p)F F3@E٧7#`O0)F F0F0B E,)F+\*qjxn*0*Fb* *aFat*x*r*Y,Y ",U""p,PO #p4K,IO .K" xh 1 Ѝ xV1J . !"hF p1F" F[0  P2*Fѝ "!hFz( ,PF5FX,"p4F?E H(TXFxF2 + +pG+FpGXxCx + +pG?FpG-OFFF~F8DH$T F=!F@JF=I=HT0F%p0FSFM0FHFVF("PFHF(S@%`"Z`P%@8F@0F@8F `FPF\ F 8FFP #CUh0ZFQFD:0KDZp5FS{/1F8F(+HFF(HCs_-OFFF8I"XFF G(5D! H!+o 0 ko`;`S03`CD0403``"!IXFL! P!o 0 o`C3;` C3`@C`D34`! !n 0 n`;`0`Pp4`` `FFF x{%#+pkppp  0ppppp /!F!pDp" F ###"# ":F3H!F*O0&1F (х/#<.-(h 0`-F)F8Fu(9FH``10 F"O3##"#"FF(FH!` 0#*F! Fo+ܿ"p+ +Op`pO0Fh%i,'#j`Bi,'|fj%Uj`B `jp# 355-OFF"CFJF $ h1z+ 0<l{#0=CJCCCC-WCCh~CWCcC{,ivC B ]  & & U q a ~ #  (5',C F{F6p"F!(@;im"m1Hb(kmeZje@# 0FjFO HFhB𾅑5O 2#CF2,54K B!#"FFMF O G#)H 1O9` (#"F1F/0 x+I(@̂ O O# 15O 2#C F2,0"!FpO 62#O C!F2}(`PC"F!#pAFџIFH@eH1.+ќHO9CZ # 912E9%#"FO 2#FE#"FO 2#>5t"F#! BFхHF,,sO (,5)@@k+@<1 FO 85O 2#CF2,"O3##"#" FF5H+ !FcHO9,"oC##"#" FF`+!FTHO9,҇!FS#ȹO5E`E(!F4HnO9,!FS}#C(O5E(E5O 2#CQF2C5"F!O972#O CwF2g+C`j`w```!B5#xs/! FF8/!0F#p"FO/#;p(Fz(2#O #FASF2##435O 2#BF2,"oC##"#" FF5.+܀!FHO97#"F?xACFHF}(𽀗?a_5D5@?A4D?O ,,! F FCx3!FHfO9{B6#b!AGѪHO9Ch5@O 2#CF2Z7 2 Q )BF2#3"@ "2p! ! F F(T,#3pFЋHO9(64@ 0F@u((Ѹܦ^7#`@0 +D3C @0O +D3Ap@`5D5B@03D@@2FSFAF0HD\F?v(O 52gGq0F2,!x)4)ax4)GsFR2##x6+cx6+2#O B@F2,Å"O3##"#" FF50+!FBHrO9,)сl"FD0O H58IO0O 2#2gv5O 2##AF2j,w ',! FF F 8FF8!HO9*O7p#FJ9FO 002FAFp@F:5I O 2#CB2g+5O 2#CF2``aCaaRCan451#O rI F^85#O rI FR85 #O r껲I FD(аI F>05O rػ!FHO9л5O 2##F2û5O 2#CQF27#p1l"F#0!F0ѓHF{5O 2#C!F2 A5O 2#CQF25O 2##F2w5O 2##aF2j5O 2#C1F2],i!FSO5TE(E(#C,3!FS%Eg(yR,=! F~0>HO9 ":I F5RF0+!eO9غ2#O #qFAF2#ʺ(I " FFH0RF0E(?׭!I" FF 0RF0"I F"I F`"I F0"I F(iPFF HsO9La|aaaaaaaab baab'0|RFF0 #3pJF9F0 #@F3pF(5_ Z 8UBFIF[(:F!FpO *"I F層RF!0?@@FqF(?9O 5F1F%1F 8BF9F!(?JF!FpO d"I F5("I F"Oc#Os"#"PFFG+?QFHO9 "I FF/!PF8F4pQF 2Fr(F@G"###"#" FFGx+29FpHtO9#0"!FpO z"F(/! FO35"l(m1G(? lO (e@# dC`P"F(l/! FO35"ill1G(?߬klO d@# jdC`&,2)=m"FL0O MP5O 2#BPF25O 2#" @2#5O 2#"@ 2#5O 2#BF2߸5O 2#"F2Ҹ5O 2#B F2Ÿ5O 2#" F2b/b8bBbGbVbc,!FS5#C(?h+!FHfO9{,5m Fle(HO9Ne,q1HO9CZ!F;?F!FH4K5O 2#B0F2>5O 2#CAF215O 2##AF2$5O 2#"F25O 2#BF2 5O 2#"F25O 2#BF2HO9OWLHO9޿O1 F2#BvF2g' #;//! FFF7#p!F?F!FlH'F5Z[kn"(nO X0 Y0 B3F"1G(?;jn(fSkf#SC,CНX TY0kpZ0p[0p#qy+/"!0FO #+ve ,?x2гEц] B^x BўxvExKE_q/!8FF4#p2F9F (9F*H"!0F,?A+="x###"#" FFG)v+?)!FHO #+v5O 2#C!B`2,YF HO9bCbbbbcbbcd5O 2#"@F2Ǿ8lh 8tp6x|6 #` ` hV 666 ñh,иK 6? F!FHmO9HO9d{$(6"pO1E ! F FGF ;!FHEO9Z(FF@HO97N# FF7#p:! FFر#;!oB"!FFG F#HO9 "=! FFȱ FpI FFP8FuFdPzHO9FFG%ptI F{F08FEUXFGعmHO9kI FeF`8FDF3(GpO5%Gp`I FNF8FE+F0ZHO9GpVI F6F8FEuF0PHO9GpLI FE C!FFH Y F OBKBAH%uJ*չ=HB/@!F9HTO9i7I FEE4I FEu1I FE.I FEe+I F()I FE&I FE#I FE I F(I FVE%6I FNEkI FF EEe$I F<EYI F4EEI F,E% I F$E%I FEeI FEUI F E!FHiO9~8FF#pI Fر FjF(?1h,"1G0HO928FTEUFF#2hB, F\"h Bbh*3,44hc3`,##3 3 5%HFJIFFF0F6!p >'O WK  > ` `,? FCF7#p"O3##"#" FFFF.o8F4FF3F1F0F:?F>k?2HO9OF(>Y3F"FIF5"1F`"HO9s8F=F0O Z  @3W`,?HO9`wll9l2l+l>kcMlFlOd"r%Cdd5O 0#0F5H!O 2#CB2g65O 2#"0F2)5xH!O 2#CB2g5O 2#" F2 ,? F~8!FgHO9hO 15O 2#CF25O 2#" F2ܺ,?SI F452gHOI F* NI F&@GiF2O 'iF2O 5O 2#BpF25O 2#"`F25O 2#CBp25O 2#BPF2,?5#"F!p?F!HEjAO dO `<O<>tQFH:"!0FO9J,?V h.ǫ HO9$;" ddbcS-OFLF F%'FOX81F2j2(5c-1FHDDbj* ѹ H1FO0GDYFPFjO'CleF%I F #H(F42#CB`#".##"0#K22I 1O3`0C0F g"SC2#CQF2a Q2#CaF2I`PJ-OF FFF+O)K"`I32#q@ #!`Q0FJFSFBFFlBFO ""J)F8Fh"F(Fm12##v"E#3C*C2# FXF O ,(VVC-AF F)41+Z1+dn+a8F"1F OKBj4mlmnn+^Ѡn&oco+_ ooo+`Ѡo`0+_~`0+_t nq(FAlj1Y6(Fa&\1Y6(FS&"F0F(Cm T"F;0F,6n;f0F,6co;cg0F,6o;gph60;00F,60;0`P-OFF}F(T5̡2#C B25Oq V# 3?F(s0/n #!`Qf,! !5f8H,! (gH,!  gعHP F H1F FFF0F5#f#kg#gx#dF 3Y(1ѫn1n 1+oD1koH1oL1oP10101#Ij(]j|I~Hy _  [EYF ,hqH I1F F}F ZF 4QF@=iF  c   2F! F[FTF8D Bx + +<\+j##%F UOZF$GI iF  +DѸY@IHF(@ (k/^9F%O GC܀ F cF  * ** *#*;*8 \ *" TF x)\)@22F&8D Bx + +<\+O9-0B4O0 pG pGB pG pGO0pG8F"(FF^F8(F!F F-CF xFJxEpBp0F(F`6MDBӼB: F!CB:AF FCX;+@;8Lm,K!JHgSmK! J`l]l@@B8 ll0B4O0  gZIgngpLF F"!#hH"!D1F)FW#hBЏp(FFп8FMp0$8@IFhc8F)F(Fh # FJ(D($jmcmB88(&$ FoXoYjmcmB!F(F(koZco[ 88(ѪooBF(&$hJZgnhhhhhFбh"Fp5(F&F"!F(F cmBF(F!Fp FK!>J?HfGx// У/#Bh*aВ #@;@BУ#O4` F3hBNЎ> 0bFBF $)"hFF!FhF#p0=iF(F](K@'JxZ)$"B4,""A B$,3BFx3*F(hK i ia( -AFCx F+ +HУ/#`O0 %#p,&FcB8FX!8DFB+&v3"-FH5 BN5xŹ8F#3p'B KOq J Hf#%p 5p ( iyKi 0 KOq J Hf!K@JA hC`hK'i i0 K@ J Hf! KOqJAC ;Q+B@+hK2i i8LMT8(F@K<i3FR2CFO4 F0@pG)F w0FFrOT?  2F9F(FCFi-OKFFh@%,@GFF(I8F̐(@kp0+@!(F (&H@JI(F F0с I F0ȁ:FI Fy0+h #AQ@6IF Fe0kl+o~JI+ F~I FU0*l FzIM0𔁕H FwID0jj FtI<0!(FpIF F00wmI Fd0p+hnh+@3!FFvD0;dI8F(@BaI F0U 3 2#\JQ[K[I FF0AXKk*@k(F-%(F@l(h%(@n 7 2# QJI F0p0CpEI F0H0nOr!I0:I F0.@Nx0 F1I*F0! F,I0ۀ0+\ F&I*F0ˀ 3!I F!0@F F|(ikiiijj jj!j-j;jFjOSj`jjjlK@jjj2^}I8F((@8F8D<6+:ФI8F(?􏮢I8FF(?􈮟I8F F(?􀮜I8FF(?xI8FF(?pI8FF(?hI8F&_&]&[&YJ*hnhB  I F0 O0B!F v0[hI8FpuI8FHsI8F sI8FHvI F0+tH .Ѻ 0CoI. (F](iI F0iI.ѹp0.!(F aI F`I F0]I Fy0􍮾+hnh_%(?FVI Fi0􃮮8F%(h.@܀ x0K| FII*F 00h1(F t0*F@I Fp0 .Ѻ ;1 F F\CF*Hg.@*F.I F1F F50?W1ZY*%Np&=;FB<+FK!J +*ѝBx*K!JHe@6iiS5FSiS|S ij`Kjjjwjjj2^}k1Kjk0B "qD(?2z= `B `"`%hBЍ)`3.?<.T)F F .`'pF hFFCF F#p@pKlp FFZ+Q)J)J!F0F0O50%[ZiJl:!F0F0O5 F@J!F0F0O5! F i` F N@J!F0F0O50h1{ F gX0!F0Fh!0O5(FpJiSii5F #-C2FFh 1P9F0FAF`HO F 2 !*D ;FXH$ `S0.0! SBOKPOO Dh DB. SL SP"` F Slt`8I;H@&4O#,NѝW$0;>+٢Z#`4Y  Q@,CA@<b," Fb0 Ѣ:h+IH# #+IH(OrB I"FFH#i #0 F09F@F$hKkEBBU1k[krk}(Cx+@$K"qF&F=F; + ѸBq"2FqhH0HfI(FS "F9F(F$%0B𵀌"F9F(F=;FOaHSI(F|6$ P4)F u0 0(;x#A)Fu0я F65D*!F",%00O0 B'ЌCu%9F0+smip(F:F/?G7=D''& m(hMTuhsh-G:N$FBFD3h!"F-"##!40O4- F3hBPЌ&(I(F(DF!CF(F! ,FLE##DE ء#`(F O4"F 8FF H." pQF@FEPF#DF.(M]pM FF@"!+hai" 1,h.A0h40"i$0 ci H Ih.F+hBЌp(i@i-C$O FhF"!;hAF%U ;")F  H `˅hmFi!(F&X`#j I"cj# KF%;hBЌH'( iik˰LFFOr!hF#hIP" hF#0 i;hjF I0hRIC#hBЌK( iI˰1MFOr!hF+hIh"hF 1d#0 HˆhihjF"Ih0hC*( \#S#ЙBp[#cb#SЙBp[##b #_b g I+hBЋO3O3#bK( ij-O]L<FOb#hF5Ao$m(н BС2O4#``0+ѝ0+E+++w*B,<(F0gѡhV<O4=+E;+*?C ѽnF(н D? :CKx+`+Kha*ٽ13+ O1 !(FF% F0B*ٽns(?|A!) !O1 >(Fma0+50+ (F+ 7Z ԝ(?S@M+7"F+p+#F3` #Zx* [h# $ 0#Zx* [h# ( 7@"!0"9FAp03h6I07ѡJh+СFh1+.I/H0+mA"(F;Fj6]0+Y x#Je f0 D(F G0+B1 ` Ɇ 3ˊ"F1F8F ?Fѡh1+I H0+ O (@iMgv.v?0+? 3x+sx+#sPF "`(F ]ǰLFFOr#hEK#!2(FX J9F0F:E#hBЋO0G(Mp_p MFH"!+hh"Q ;`0I0h0O0+hBЋoI|000co0h #oCѡRh+I0h#p(HilHimH? vQHK0 (FvlQHK0 (Fv : K0%#!C FU2C p 0MxpG-Hܰ@MFH"!FhF+h[T ;0hP"!FhFjF7I0Fd0!F4Hf0O 32L\  "("*CCB jF'I0F @0!F$HB0 32#AQ(Or! "!FVI0F0ѠhV+HI0F0ѠhV+H[+hBЋ\(HilvHiWv iPv iOvܐ(0+  pG(0+#`$`LV#` F(0+F#`$`0 c``3#*F ;F0FO3`:#*F;F0F##a;#*F;F0F#ca6#*F;F0F#aa`!F K@QJhc`i`#*F!;F0Fo0 h~``#*F;F0F`02cwNKwwpF`n3,ICFfѠh+KHhE032 F2V Fp  I H$(h+FJ!F$ [wNUU m8#FxTh F(*F1F@#cU FpF,F-OͰcMFWFFaIHFFF+hXKb(kZF1F hF(qП$1F FhQH8F K0BlMOr;F8F {6#2F [F h4#2F '[F 4FT 0#'0,0+E/Dѝ'0N @#3JOq8F,h L-IKF"FPF0iX LF(!Ha%L[KF"FIPFK0B ЊNh uLKF"FI`PF^FNLKF"FI`(FMO (wNb@wxx&ex3-OF%M F%NFUQFO, ,5 1, B%p%B&F,ѽ0F U,XB 3BU,XFU ,FHF;6,5#T ,@FT,5F0F*NhxCxK*-OFFؠ$#`( FB9F sb0 DEєf  #3DBҠ"#9F sF0O0#<#1F"F &DL[FIFF8F>04FT LQFF8F00h9)j-A*+NmF3h 4ؠ#` / xU,ѫ5 LL!FF8F09F s0=9F(Fs+FBF@A~0O0 $3hBЊ I8F0x#` m(  31]aS R#h +F0-O F+gx@`{_0LՖo0 ZF9F#(h|F(@KT0@ր$P0eZF9F#(hfF(ZVD"BQ(FVF(ۀV;  8AF(4ZF9Fy#(h3F(ЂK+-$CDCE 6 2#aQ0x0  tH2#CaF2 F 0 +ٟ#`OSDBҟ"#(FF(?j#<#BFQFDO2 FX;B :iBhBO3 0HF3#t0+ & 8!IF<($w ZF9F!#(hF(?E0  Y< +(FyFO4l B;iBhB # O3PF3#t0  8QF(4*@CO `C@O #BCoCOs[#F$K+xWxS-OFK}FFF hh 'O'0*F4#0'^ Yѕl0+@𹀕,0+@΀#hOO, #h  1CE؀0OO, 3h0 3nCEɀ#hOO, #h !BEO 3 hh 1[E 4 OO nCE @F(K8:F~IF0Fb0 O0xKhB(~#*F h0$ :FoIF0FC0#*F h0 (i@ K:FdIF0F+0a@F K:F]IF0F0ѷ h K:FWIF0F 0Ѩ'0?B#Or@!lQ:FKI0F0.'0?-@#EJ@!,8:F@I0F0uRM'H30 "P @?O, nB> 4 )FFx 0:F1F h"K0}+0+!F0:F1F;0K h  , ZsE2(x{xxxxx@x ]M0 PB)F hyh0:F1FK h  , } ]M8F@4nJh"n(FO3fnCf!oK +h" oO3#g#"#8-O&@Fh$ hdci &ciai#bhca#ifa8#IF(F^2   Q(`jKFRF1FFHO3#cKd # 1Q𠀬I(Fd!O s"C `jKp1FFHO3#cK@0 Kd#kZ 3`jKX1FFH+"1FH##ck z[G{k'{{zck zkg{'{{ zco+;`jhB7єx03K #k1FFHq*BӸG{1FmkyH'{{*zkB z1FqHekg{'{{* z~`jK#k1FFdHXVli+bДx ^aii iBWk+T#h+Q[Kd#kYT 3##`@02# qQ01FQHyBFOr@a@FFBFUIHA(F#o3i+^aii iBY(F$13R`o0mCF gA9H!(FO̸5K#h+ 4K4K4J!ck"0Jk!",J#k!" #1F'HRFIFF0F?ѝ+FJOD??xyiy$yAyHyPykz yyzjNz(z/z6 } ~= qz< -KF@F !hI(h+F"!KY0O32  Y$ s"C )K F #@y;kl+cik`jK FH8(F9"!(F3(h!+F"&h&` if ci(Fdaif#bi 0f3fb2!e 2EzK-OհhFF`S0*@Cl+ 6 2#&uV@𪀙KS,"3 HEHn0! F-EF@ H!72#pQO Oq F(t0˱*ٹh( B  "wJBјx ԛh`#+p(0+kp+є= )p2# QQۀh+@׀ڀրOCk  s #`F0F A)3J2 #OK D #*?(Os+IJ\Q#"K@A+rU##1B0;H#!F F3FBeE8 pcl+6! 2#pQ'"KSl&3,JEVZ[2F{k@9FH7kkn@#uD!NOq F"0 HOvAe(NzzcSc;zw5zz;e6й-`0!k`2#pQ@jKCR D0 8!ʱx 2REM=" 8 PF x28!x2D$ *DB@𤃹й@'t0;xԛhBm +@2#"0 $00 <)w+@6# 0<0 J<@h<0 @6#0#0<0  J0#`  <6??13 B? M" ?!F2?  D3{ 3 B?x <" 2{F2  D8AA13 B?[ " A!F2A  D0 +@3#0#00  J<!z F*?o(?h!0B?Q" ?Xz B "  ?i1F@Fm 6@@03 B? +" @ F2j@  D70+?g +ϭ|#0#00 O0`60E"+&hF7#O;F1,3 E5&>h0,3lBAFYF?􊮫 ?8#0#0 K S BB   U{ J!~ |0-wHFP&`r h#F"1F]35mSK1F h0#2   qQ J1FF HB FpH r#CKJ1FHF [{z{8 FP H F#h! #Q F8@8{J! }J! }8FP +h;+h#FJ!hjJt F H# F+`#" F#8@8 }|J!͹ ~/p PF1FH1Fk*kH h#J+`!#F#"c##032 !f F2Vp@|*|N }J! ~-H #PF`6+`h p #3ҹF F(I 1Hh#h #1QT,I FdH69F F2Fh#hO #<\   HHxF9F F!2F9F ~2F9F(a F0K@JHa8hg  g(ah F F#$O FHz|g||wNw-GF`FhhiBsjB_0%FU {32#FJn)FF*Hy "Cі@ ! F"QF FF!%#F"! yOYI FdO&j OC#h!(F h" K!#R%|S^ |pFh% #6V?#F"!ePhih " FA(=iZ'#+`# F F pi FEJ FH6 F|8F0P3 FvF HI Fd8@к X(aH F8@ 28|g|I-OѰ`O hF6FO2#X h #1Q$13$13ўhh0+иIHPuOq (߀O3`fgP#"!y+`K8Fd###F" 82#qQ8FZ8 #81 3  q/S78F o8(:FQF2x aQ#"C}8*#K FHBP 'q#"h# F2"w Cv Fj BF$?d+FrJ\2# !#Q#"cC#hn 8ȳ7p81"Zp81  #h80=p7x 8p)( 81Zp8= 0r=)*#) FGH~GH FHO0Bu s"C F>0!Q  FZh(a+i:F Fh0IE2#O xY(H#2#!pQ@(+k3$yN(@|F??F #&0hEv" HIh Y#3kb(N|S} }N}/cSc}=+ckkkckc0SE@րP-?Z+h+?V`#"+`6# #2xQal) ^H: QŮs"C hjJ FTH10#Ch+0SEhjJx FIH F h"#F!c2x QЕ@q h$+i F9F#@0ki 9F( FFȱ@F sha(?hBF+iog!ax0Cx0 hJhK FB?Ԯ ^#3h+% FQT}Z}v }} qcSc-OF xFF+F PKh*nBCF:F1F FU= *)B(#j+ 1l+#D9 #c`#90o"!F0CHJ !S3h+hB#Ј$!F"8FhFH " 1 Hn3 !] (OO,hFh!-OFFV ;Oh P FnFh 0ӱh±nBє= *)XFX 1FPFKFBF)F Fedh-CO 0F 32gxYHCH h#F"P!I FyF0 32#Qcl+ FCS^ - Fh 0O 32E|\ Rojh0B w&W\ I Ŀ pGS^pOqF sF(yO3"f!+F0F (Fcia[+{   J1F H6O0pI(Fdp@H)O9U8F@|i `i h 8 F ,hnñh$K z$(O3$1( #(180h+Rh-HFP!52#QE00= 0*324L!XF2( * * 2&;O@ A 22' vWLXF22V Qb#C Fl* '&W%O&KL!H4!O#!FF3FBB%`vTVZ[{k@ H7{R; h2F K!1eD!Ae ;; e68FP#Fh!JEx0+ h!8@ƹ8 -OFLiP)h(koB  nH# FkglIY F0F(ѳiXJ)5hhiB/IF F_H0 32#qQ Fc#h! #QO32#yY. F 32 qQ!+h + F Fu(&  cD>pDFF "C90+i Eki akia+?tcj&'O F !/  Bji0i2Fњ2@*`7/K! hdl F2# qQ?7 # F+`#ngc}S^>yF"в2 pG[B F*pFٝx#`O0p$F pLp>pp!2F "uU F( @CO `@@O opGO@pGHpGXhH hhBhhBhJIpGh@Bh8 Fnh F8")F F(dhnh F h[hh hb@h"BhHx0+@o0 pG pG@03O0 biXiұ(Дxx0+±(0 HB јO0( +XBXAFcScK-OhFnhO5#jPfj ѕI2F1F8FF(@dh+h+ѕx0+ko3KOqJH_Ikohk FFPO@FhB𔁇jo `oCg2@HT=AF&koAFh#1F906"F00B("F006F(Vcj(00" FyF( `#HT=AFAFio81ioX11F FF"FF(?W1FNoioxXCXgX1F8FB+0FI8( hF(?["1F!F@F #AF|0"1F!Fj0?kx+(Fih8 PFcF0FF8FF")FMEQFHF(<   $B +ЙB"IF(JlOCCљx0cFK2#<"PF FBH FF(?ݮCo `<CCgO3 HT=AFAF 8 FtxA1 X"!8F$FHAF8FvAFEEQF8F"!F(?oAF`AFY?`#aj0 2 Cљx0cFK2#<"PF$ FHW:Ai p 1F%H )F ;CFќh1+Мh+Мh+ Мh+iiJ 1H1ki hܱhhB#hhhBaiPah{Y`bh F` 5koB#x0kg0FpQ`F:OSU0-0Zoʱ0 32 qC $U0+!F0 0pG8F@L F H F8#03`CaO`-GFFFFF8DH$ F0!32#Q 0hP0hhB!? F"AF(FF(P4 PF(Ea#a#`a ` a HFT J F!8FxkjKMFH+F:FAFH!F ?0ќh+ IHGi F i#i##`shc``t`{FyOnh9Y-UUtF@,_ci3032#VW__Дx0+!(hl(F@!h@$"1FhjBijB  %H1F"(FF  H@ݽk(1F(F#k,00h+0"Xgx co3hcjB(F#fgx0!(hR#h+ѡl(F1(h@0 hpGiBa-OFuHBn2#`FFF(F#"9FHF.F.(*hhB!*VQ`ch`=X4 F('HO="8ha"`` (hb```@(h`8hHF(h J F !,+hhBѸ aai#a;h;3!FRF0FF. FO ƼO{h90-GFh O Աi'h.hl! RF4CF0FCCFf:9F0FpF'>CFv:9F0F@F'>CцFv:9F0F)p: Bڛ"#"Uј +k@+Pݼ?H % C$0FC$  %CAF@FFFgF G  FF+CagF"Ca# F "!@'  C%&FC=F4F#"#E%$8FF9mHHXBXA8j("H0=mB  FFF:F1FF(F8DhhllB(F FF8FhhPCж"(F"#FF(F+ ' F8@ "h`p 1FH")F s0ћh1+Лh+ Лh+Лh+H/hH5`4hp")FH#hXbh;Z`bh Fp@`r`F%O8Fhnh F8B0Cdh S(h(АH0+ѐI0+Ѓm[h"FFF8F F0  pF@F$ht~H0+єI0+mB Fp"1FH(x+-pKFFFFٛ#`O00O 32 l\ !C!F3FCp@*"!0F#"F+FRKBCKm`Cm `-OFmFi H"HFE@e#` g C#l+@zs<и #0`"lFF+AJ1@0DcjYB8#cb#jZ #bBRF)F4H#3m2J1I   O.KF*FZbj#jQZ)F)H!F ?F$Hg@F!HF)FX)FHHmcj#j(FxO bjISJ2!KmOg#Ce;H+b=zO m8sF Fj-h"Fh#FFmY #e Rԃl+lm @m#Cѫh)F )F Fm@8O0F-AhF%#"f#1F F`02;Z`bh F`DFz`(F-OhF F#"#g#,b-&hJmYՠh032#XY__H-2+?Z`bh`"HhdFhhB Fh!032#PQѺ#C9F >9FPFcchNs`ch`- FK4F0 -𵇰NF3hnh=,F F3hB)І^0 mhh,!0:hlS@BzhlS@B Ѻh#mS@BhcmS@B$h(-GFNOF"F F;h( .`n`#(OOOF"I(0 F] F!@O80!F F H F8F" C/`0+ ((FP-OF7F0 nFFZFpPF8@F,h$/"IFH(y$hj`#FIF@FF?8 C#(ˌ##`khc``l`mX#CCeH0+0єI *+MCH0+HєI0+Bѣm>92+Z` `0GHF #!Q FG #!QУmmC@e&` #.//2+?Z`bh` ##FZF !F8FZF!F8F/ F 0+?T0+32# !Q?E # Q<@F0 3#B?/!0FOyFPFFhL h HO0hBhB$hhg`C``` PKAj-OhFF@"(@0 32gQil1c"C*ѕ(0+ѕ=@,,КV#)"FI0FR("F}I0FLp#`O60F0B  p/(F]F(oKO @"(FKFO6F(0O  3fH 2#l\ %"QFHF+F]AF F0>h.YIF.#` v{h&`1F Fc``|`w0d00(0+ ѕ=0+$ѕ)0P0*0Q0+0S`R0#T0,0U0-0V0.0W0P0 Fe+*FR)?eShCe&V#`[P0"HHF`m[0 32#aQ3v F^1#2h`H 1x FP#`0&"6hm ((Fn (P)P1E-OFF 0 hPHˆ@F!#V# X# @F# 3+hO O ("YF@F"FRP?+bShkbh"YF@F h#`&0F hBj j" C #C0n@H1F"PFy#eF0K8 0/KЗ(!hh 0kicjBpbsbh 0#jB3b0bsj+"jB'ٚ*#`0F0 hH"1F(ѹ O g #8˱#3`khs``n`v Y(O`hF H 14iF iF F iFHidP9m0F 030+сhH 1_0iF iF FFh HB F-8(F00{PLh-O Đ8 FO0[hh$DF Fm:fjv" PF8KkkD.ch[hh;\Gem#ekjS)jcbh# 0_Bg g.;FrgFBv8k+j#bkj+ѸF!h#ijh_ Bg g;FrgbgBFvk Fkj0p FhHpm3@O)F F%$h0 hpGm BBe0-OFh O ım'h[.hH4,lhCF!RF0F 7. :_OvE𦀚:#` ! D+BF FlBr #)j){Hє0+F#@_rKBgE DL{ F X\##BB* gE-ܔpW#[ b nW3B2 g Q.;АBB3B4O+#Brmթh`LH 1>)F s0 љh1+Йh+CH9#3mO #He-hLBr #h  D \BU**Q.Oyh)LД0+iKd# !n#KB B DAKXQFF#ZEcE7BԿ  (F# k cF ZF n\3 K2 l QBBaEwD;P#E{ Br #8OFF #CS ! Kw Ht!,IHF aih<1sh" hBѓ hpGoK!-O=ɰh 2r@&`H;O3c`72F%F"$" *F8FYH) 3shTKhBރ`` +.#AFuHHoFDHj+032# Chzx=x*@X-@U6H+F3H#z+cz+.H A Q"!0F("AF0F0 #Hk<1hzk{@6{@{@ByKOaxJyH[ˇvK0!32#`Q#b#9D!b Bj+@р #b Qk  {7F{Ok@πHFWISOzwJpO@' {PO Ozs"FHK #@[b/F'bF3B2#0K;D#b[ ?2#Ez+Ozw##b O@' {POOzs"Fj"Kpջ Fh/#bK;H:#bAe@Y@@(Q#e6;;QB@#jO OCH B"b$JID!bH/ IgDBB'bfH#{K[yK J'bBtK H ;Dj'b!jK8F3hBŀkl+ ."F8.0+6И>#`"$Fع"))'(#.#*s$#) @qy]0ZV EH̀ 8  IF,0C!9#`FF )3I2#.K D$x*Id!2" OsBxKEOr IFFOqF"8F0 IH:kj2b B !'>l;F  H35;e6(6;QQaI I I %I -I 5I =I E8FmC@@eՁh`H 1hP+h#+0s  Hh FW h8@6mH*h8|-O@FF0;&g;F I0F#(h  h1"+F!]IF #h;+mh&Kh1Kh1  "B0+БK0hT0O3"0%##h+ɀ/ƀ o#ogcogn#gncg#F3)hO #:Z vI(F,h g1Q"12sC 3"C! Osh1aKh1h1_Kh1h1]Kh1h1[Kh10ñ WKO 3Ѻ RH$0{0X :=kg{'{{$z0+h0Y?c:4kg{'{{%zU\Ѳ? J@sF )qBF`YF,Kh12 #F )9IF<HE@#00Z2؋B[#00Z2؋B[#0O??陙Qi,#h+ ###`0Z2"h~I(*bF F!%"0Z2 vJ!(h"0Z pJ!(h"/OO ıF0\ SS 9 `XF 1$\H SFh"F ) `MH 1 bP``JPFSPF/"h 0*?IJF0FXH"AF F 2F :H#x + 2F7Hnh-0;n+CF"F1F(Fmh0cn`xQxBѠxxBxxB1nh+nbxxxxIxHx  jnZ`xQxBѠxxBxxBh  H=FCF"F1F(F__ =/(R@8XRKx!hFh-KFhP #1Q@13!FGF@ыHK3FJC B`32ṓBрJ!H<3zK3 2#!QH\cT1hH\) C FTKƻ?|B 2<C ;T2O#'TO37`00 5dgE4#OFFcE[#hO <\ ٱ20#C! F EMіlh+ Жhh+?I@H FK-nU+*~:h*h*i jiڱ+Oc F *~"Yx+h00#`0C``7/nw3/! (0 "! `" !c ! )FHn Fl0*FIHK F h K"! #RY RjRUR - M-OFLQ FxF,5&O, P1, B!`%B&F,ѽ XU,,B 3BU,XFU ,zFHF6,5#T ,@FT,5zF0F700  pGmH*h pG0p FF$ Fp@,2F)F FN($hFnFh,F F0 mh@,:F1F F3($h pGF F(U) z ! zh1(F? )0'32#vW(F(0'32#&Wh +@@C`&"la!+F0U"1F(F H?*FI(F)0)O3$2# QOq Oac"##F"C/0$(FO0? 0K"l!h+7 pG F!-OF0FFhӱ32 +F"!@,|!h ) ##`(FIIOٿ 9 "C4 )2kl++ )))')p #!#` #  3! c(Fd0 2I2HO(F0+M "`pAF(Fobo#og"g"Ѓ V W__I(FEIFFo{ nxnu Fr#0,hnh@K @O3@10+RhhRUb"FA8Fh#FJ!=PM h#FJ!2 h#FJ!* h#FJ!" h J#F!*h*#@#+`8 %  -(-AF FFh1ыm-+j+*+h #1Q!0!32# Q03Hi;CFУh Jh#Fh9;F"F0F1A -OFFF+R.ؖN#`O0 hO0O, LP1 CE90OO, 3x0 3oCE+OO, 1 CE$JFMI e>C4>3| ..ؖ#` ] F3ZCEOC!LA\@2o B2+61)F`h#m BF-La"PB ѹШK4  (hI 0hB1,6O 1hB2,6.K c (h&O q OqF F(HO0F'"C!0#F0F9F F0 #{  2FIHI Fh@gRUzpF M8(h ph`0|(`0$ #`O0#`KhF xFp43p"x:*aF+*V5`v\* x25 R:*F( TpF h:(NxF_3B,:* p-@,:*,:,BBxC@*F (FK`pGpFFNF;0|+:+#FpBFЬB cK,:,|,FO0-O4MF\4!++[ѱL%h-WX(F(Odh`F | #`4)F  FSD<:+ F:# 0  B1HF   D hAFbHFXF o0 #`( DDDF 9F@F7RF0F DiOFXFK`B8F8FTwF`o:*?N&\*?E * *CO .Gl.pFKO;.p=F.O;#9## FO3$]Lh"#` a``a( -GmaL#FF#i!ahkx&p h(5Уh+2#`o& e&8?+khU|(@h+@ F`.p[#iFIhy`(O0 mhUVйh(Ѓ@ф#i`"a]h(FQF(Fy`(Dl+faxD M2 @:)#)bi2<\+#ca<\+#ca:+ +p#kpo AF/"pO3:F@FcF+<`\+?n;fDl`|*:*+(  T8F F)F F8@'-GF="F(d (@ #`o F^+ cx:+o+mЦpK\+cx:+a+_У0 4#˦B0 Ж0 T+%E+3B+C+рN+R+%F+ #f+c+e+b+#r+t+n+ #:L(Fd@(F #Fd"F4F#xA:++*O4p(F_(8`wFd"O O: O O4kF="6Fd w?Fd#/A:*в+O4p(F/0` #`o F;p L(Fd(FSFd#FO4pF#"Xx0+CxX+00!!8$/0޲ .٢a+آWB 4 !A+آ7 ,`pO0#L`h#`n2 IHy2``0 ( -GFELFFJxFbhOaAHf8-y##`(F !PF`hCh;C`+ڄ` (0hZ`x +0IF0FYl(-'9Ft((I0FY^&I,0FYX( "h(x+0E+K"FGu47x,("p3C,"BIs  ( " 3pC,"%`* FF( ((  Lbh"h2 F(FFY(H( (F2K 8G( 8%L`h%`>e`8( 8Fh L!ha*F (F87  8%H( (8+FO*` Ȅ ,`8 8Fh L"hb)F F87  8%H( (-OFhFFF.ȿO̿%O5g8(F@hKEh [(QFl(ѴB!F1FB ܴBG$0O5W B0 pG pGpGpG pG pG#L`h#`n IHy``0 (-OFdFUNFFF e2H/@#08F ! 4Ch;C`+ڄ (0hZ`x + 0"!(FD=F1F FY(`?AF(1F FY1Fh` FY( "hL(x+Ѩ`'тE1F FY( "h6(x+` FIYa(I FY(I FY(?|1F FYa(?t1F FY(b(?l1F FY|hb(?d:!(]'gFe(Lbh""h: #(LOcFF0/(Ф0((-AFLFFFbh"$hD#+`($ x3F"F!F F (.` F(FK 8D( 8%L`h%`je`8(-CFFFF L!h*F;F F84 %5` % 7`(JOc0] (-CFFFF L"h)F;F F84 %5` % 7`(JOc0] (8@P@@@ @@0pG-A0F O# u F !<.F090F0F5F+h-e.F3h+YT `,S#hB %`e`hB4Fh+FhB `^`;h`{h`#Fh+Ѿ~&qFh+v0Bq#hBychh(h``b``h`bhhB `S```ch h h`%FhFFP`FN`,#hB %`e`P0h !`!`Qh``h`)&ЙhhB `J`S``chh`"[h``chhb``h`hhB `S``P` #`8F 0h*``Zh"``h`*BТhhB `S`\``#hh h0Xh(h( hZh !`!`hY``h`hhB `J```#hh`"h``#hZh"``h`jhhB `S`\`0 0Fh"F%``;%O 2 `Y`hh*њhhBJVhֱh/```F iiBhO2F(FEh"!`#h"`^hBh^``h`h>hB 9`y`F ``F3F`h ^h``h`^h>hB ;`{`Z`` F!`#`h/hBNh``h`h>hB 9`y`FK``F3F`Sh hV``h`Nh7hB 3`s``!`#`-AF5F+j-g.Fsh+[T`,UchB e``hB4F;ˈh+FZhB ^``{h`h`#Fh+Ѿ~ vF+i+v0BqchBzѣhi)Zha!a``h`bhQhB S``\``h! i ia%FhFFP`FN`,chB e``P0 i !a!ahY``h`)'hHhB J````h"ia"h"aahZh``h`hQhB S``\`P` #+a8F 0i*a"ahb``h`*BhQhB S````chZh i1h) i) ih !a!aQh``h`hHhB J``S``ch"ia"[h"aachhb``h`jhQhB S```0 0h$"F2K`# aZ4OO Q``hi*hUhBLѕh/i/,aaaFiiBlؙBӋBhF]hO4F+F`h!ahBMh``h`hohB i`` FK``F+FaShahU``h`]hohB k```` F``/i/]hBэh]``h`hohB i`` F``F+Faha]h``h`MhohB k``Z```h$F5F+h-e.F3h+YT `,S#hB %`e`hB4Fh+FhB `^`;h`{h`#Fh+Ѿ~&qFh+v0Bq#hBychh(h``b``h`bhhB `S```ch h h`%FhFFP`FN`,#hB %`e`P0h !`!`Qh``h`)&ЙhhB `J`S``chh`"[h``chhb``h`hhB `S``P` #`8F 0h*``Zh"``h`*BТhhB `S`\``#hh h0Xh(h( hZh !`!`hY``h`hhB `J```#hh`"h``#hZh"``h`jhhB `S`\`0 0h$"F2 `#`:4OO `Q`hh*њhhBIUhձh/```FBhO4F+FB]h$`h!`F]hB h]``h`h/hB )`i` F ``F+F`h`]h``h`]h/hB +`k`Z`` F``h/hBMh``h`屝h/hB )`i` FK``F+F`Sh`hU``h`Mh/hB +`k````-OFhF 9F,F>:%V9O{ K h[h9F B:!R KE ӹO ػ_O= ? @FTFF FFFpF(𵇰HM+z+GLGKHH&hFFG&hDKEJFIFHGzFJFKz)FEIEJoz( FDHDI&h/FCHG{BJCK{)FAIBJo{( F@HAI /F?H?O&h8FGiF(i&h)&K(JF9HGiFhi&h!K#JF5HGiF &hKJF1HGiFi&h KJF-HGiFi&hKJF)HGiF(j&h KFF%HGiF`h%hK"JF"HGK$h!HFFG( +dRv%Y#z&3BQb otFFFF9FF T0F1FF L(F)FF D F!F@F lCiihiCD"@b@aFZMi3B#SOihDB!S@a@aBa2ChchkhB ЃhCZhBFFh*FpG0Lcjj @@@R3@#dBdDO1D D,bibAQi DSa03(𵕰O3'&AgCc"F FBF#F,ЄB)F0єV@"h\^Kh~KIGK[z+Џ d(Kj FpGiiBh[h(-AFL#k3 رcj( fj&jFB8FD0FB c>Dgcc F0 k"D%F)F{(D`cc(8?0 M ?jkk"DBhkDlc8 F( (-OF=L&FDlD#XC$0F([1h$D$0FO @TE! #P$0wl WDB!#O S$3l :DB#lC)P(FG GF>?+@  ѓ`#zpHwmJ%&h1@gB`h&da@`djaA9dYg.@+D0Rh#k@#b Y#f2ab*B"f1fnc`#{C "OH#3H%b(Fe c(F9"ie*baco3cgco+@рB8cabi#jқca`i%%eYd(@ȀO@F $M2H F \(?c#;p^-Kh.[A9* %*5?U^mx}"',;RWfuz#cr5##r0##r+#jkh2B$;k` kh+?3co;cgco3(  #)>(Č##r#h+;`jh:B3h+;`jh:B3##s##cs##s##s#0#0~KQFGP?9Bcaci+0#,bi)F(Flh+?+#p0(O%Kp0D pG(YK-CF]j FBjC@}j%DBq]@ D.ih:FZ! F{iB.р/"AJ\@C jiB8ka"iCai2i3aB*2hB #3`h)F@F]&O.K'L4(K|o`C@ 9F+)F0+1hB5`Bًi+0)F0=j@*FZ!,*F!FhFFF,\biZ! ime#`((-CF=M+jB+j;DB 9F F(@+k3($ Fkn&.0F4i1FF@Fme3`mB+nB F"9FFȹNFFh Fhj0@8B44FB(c+f,nn#F 02iB3F6hB4'D.3iBӻB0Fu1FF@Fme3`NFvh((=K-O (FFF! @% p/K P9F sh@(0@ : FF-hh@FF `#FbiO1aB#i  O2@a"#C5k9D!9FF{*:F( Ntj D0%(FF( F:Fme;`9F,z)"F!(F0{+"F(KF[hB!F@@(FFN@s{+%(FFx{LKh}KIFG #`3{C " H#5Z Fp( +->-O FN (@Ӏc#B, ش{,Kh}KIFGaB]%D @B7hBټB shB)FF,rѦkbC D@B𘀪EshJBlj9F%FF( 1sj@ jѠ@O E 'JDAFXFza*F!- 1@D  TD@"E*AFXF гj'2{+*F F4%`3{K# "3H4(F 1jE(FosjE'JFH(FFpmX0{|Kh}KIF2 9 j \DYFc  AFGH.z :Fm{+?(:F% %( +Z>(H-HFF0N(V-OF Fh 0(v'F 0; "HT8F $-$o  MEP(` @ Hj JDB>@KDih0B\ B;ҖB F (0FO3Z (O33BCK!FF(𪀴B"F)FB(F j#Fi0BؖBӞB|0RJCh3D@@@@B< #BB  S@;Bј 0CB2(Z!/F[0+дB٢!ME(\0B`0B   IFF/H0 "9@(FKFCFQF&H FF@$0B?z2F{ QFH 0[B ҩ8Z!B/ 0+дB٢!e`pw Kh} K IFGD FF #`> (H+(FK{C "H#3l F8(>pGpGHpGHpGK0h3pGTK0h3pGTK0h3ppGTK0h3pGTK0h3pGTK0h3pGTK0h3pGTK0h3`pGTK0h3 pGTK0h3@pGTK0h3pGTK0h3ppGT9 x` x pGFpGp pGp pGpGpGpGpG#BFpG\*3 pG-AFhFF$CF"14B F# hT#!3B"pFKhpGhF;+`ڌiB (]K h\ `p]KpGkpFN$V4(F Fp4 , K +KKhG pG8#P# FpG3F爱hxK0h@ pGR0O0pGTXK0h30o O0 pGT@FFR;BpGFpG#BQ#@@#@3K0h3pGPK0h3pGL7 I L(F F+x+ FhJ#F*FIHvL0+(H(9 xH+ pG pGHpGTJK3( FFpGk+;+A,A 3۲, 2ҲB+FO0 KhBKhS HpGfKhBKhS HpG|<{pGpG pG F H{ I FO:Hzh IFHvI fH@o5R]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpGpG pGpG pGpG8#F`HxF %`8OqYL( (Ì7FL"xE 0(,`(ÌFhx[@(/! F0  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!Hv*HH( (  pG pG -L,M P#KXb > @dp`cKK@p``cKp`KPQXQcK0 d:#KRS,*0#K 0<0 0 K Q:KX d0 I:0 KE:p`& @   0`0(K0 /:#K  @  (Kdp`@ \(\b@a -LQM@ \00 `WY ``m KЫ 000y La-00 KЫpw`Y 0`00y Q `LJ -LM 0xhF K"SPK.XPKs  3Z1Y;Wc  2 2V;TE(KPK 0 20S  2x 2X ` 2L 2< 2Y' $ 2 2WV  2 2T  2 2^(KWVTZPKYPKWPKVPKTPK(KoB`x`@`P_______X_`_ _8^_ -PQLM00R,`K000@$p0& 48 0<0 40@0 40D0 ZP 0S nSl a0CS񏐃ES~}|{zyxwv&srqo8 EPY T000U000 EP[Y T070U070p DPGY T000U0000 DP0Yn T080U080 DP%YT000U0000oS DPU000T000u0}` DP (K@ DP , DP  DP]YI T080U080K< DPp @ DP D DPJY8 T000U0001U080T080(U000T000U070T070U000T000 (KU080T080U000T000 PP@`MPdP  K 5-LşM pP 0@ @:+C;PJ- C/o"0R , ` 0 `  `0 0 0 0S00z Z 1 `(K0 - CP/o" ` 0s `(K @S (S0 P (P )P 0P R0 @`K-K 00  .S R P* @0[S  00000SP@P0 <@P* (@P( @P" ?P P r2p0m;P 0S X @P  j00f00b=0[.S0=0KPrPp!~Q z@P  Ip@P B cQ b@Pȁȑ Y R@P  !>@ 0sS llsQ ;@P< 3@P Qs0 0? [@0[R AK0 R .R 0Q  @Py QA@0 @@N@P Q   84P]]]4]8\\8\H\[[Z -LP@U 7UP7UP!H`FFqP `A P E0q1 pP 02P -Lp0KM@ KK0  l@ @ @ p@ h@ d@ `@ \@ @ @ pa l0`` @ h0 \ @>.00 > 00 p> 00 d>00 Q \@0! A0^U0e¸ 0Ӄ1 00(K1QHm/.?<;hpx@f$1076X(0SwW` dQ0 (010 $0 %0h0h0AD QChP  \@ ?`30h s(K\ 0S @`0j!0S`!0=S 0jS0S40S <0 $Q` KtT?0 1Q jQZ 0Tod0U[*h (K`\ $ QG|; 0rA T \[`ljq\Ph0吐PA 0`** C!RL TA H" Rd Vh0 \ Rᐐ ^0h\@0 0h0 g(K`\ $ 0\@0 )`' (KHPgp: hP\@,*Q 0 H2Sehd0Q* p\P(Kh Wg@`\@ $  Q0G0 00 A`1HQO K0P0 2lXpl( ,0 (0 ,0$0S 0# x r0W!n 0 '$0SD"x$0SŠ "x$00$00` LQ%H`LDh 00 0 0000 eDdW0fʡ$DD%"DD$ % XK|K'KXP D HLv.P 0/& 0/%0/#0/T$X 0/%0 000\@#w0 DL$^%P Q\fw #b D#] !W D!Q D L!D%G"D`DdS%ʱ&ʡ0 ʡcʡʱ&ʱ9!DD&00q 0s #, DR SG R SQ> $0 h$%`!DDh$c0 _; 0 #Ό ` p\d0`p` p`N;pW`0 #D"D`De$c0 hp`8; 0 #Ό ` p\d0`p` ';Y 0 # ##DD$!Dh% h$0 $% 0S !0` CRD H`LX\ ʁh0P Q   R S0 D`D0s &e$0S"xy$0Sv"xo D%j$'0s 'c00 `$0S]"0x0^00 T(00(0P" 0( ,0J,00,0F000B D%=!D`D#Se#ʱʱʡ&ʡ2!DD% &+Q00 fp hl0 &g R $ Rd0 p``:#d0 Z:d0 W:%7 Q:P QQ \$7 &0 %#0 $$%`l|ly 0 $d0 p`':d0 !:$GGgGgEEdDDDC`C, -LM >02 >Y00 Xv <0`gK}K PO0 [@P`poo 0K v> 0cp/@p&0/Hp% 0/Xp# 4 DpLp\pq q |q xq tq pq 0P42 t1Sp!RʄQ|!R00 1S`&P#@"PU@FU03dU0lP@0F1 i>D4 T\ ULЃ008 C4 0C8 ,2 K'`p``@ Qx0S ='_Kp`0 000?K E:x@ Q4|!R qW =20?K(KD2 = rK 0K R SD2 " ) Q/K  ЀS?KK >S }rKKPP?   0v !po8 0 vnJ `Fa 8 S1 ,20!1 R1 Ŏ= 0  0`VQp 0 E 0PQ ?K 0K q=0S m=0S$?KK 0S x]V 8KDda`fV 0}K 60@2 @PgK)~`K0 _}^@rK01 C?K8ΠqajZ,=@?KoKЁrK@?K p Ps 0 PYOQ8@ᓜ 0K✂( ?K@U0UPU= 0@@╓(?K 0K M 0PQH ?K 0K KT<#00<0SK0 x <K0 00?K(KrK01 ?Kx?K`Q`<0##pWo?K`D2 <D2 R {/K= 0@ᑓ ᓂ(<0S`  0-L@a BZp0ὧầᷧT00T00 R PQ R  /  .D4D$ p@- DQ 0` SH PP0@#  T\  Qp .@CCH  Q j.0 0#  Q/-x00@-0PP Lo>O@ 0" P0 0-X -@L`pP @P@0% P PP0 0i,d0 0@,D -L M`P! @000 @0nN@@p040 4刾0`P  p PpZj(KZP P(KPX 7  ++ -P`LpQ @Q /P@D 0DB(000S  #$J -LMp@@`P( r; K ᣴ 00SP g;0"S" 0@000S0 4/KS;0"S1Es\0@T000S PK1Es$ XpJH I 0-L@ K0h$ -L M`P4 X 2S=pPC P@S P P h1`000 0庽@P- 0nS: =)PP00PQ! Q P I40R A 0P 0Q00000匽@P(K000S rpp(K0oS@pc`^p L( G -BML M`pP:T E\P:.)@P $ 9\Pr084 85P B>Kc 0C8`@4 @`D@K$@ 0@ #p 00P<4 s @ 0@<$x#p h<`P, T#z4P0D L D4 H  20 @P@*@$Dp p AK AH?7P `PLH@8@0 pi {/Q @[)@/T/  @1(K( 1@C>K@ G0 #pR  @$9   c"P K -LM 0KK #  K?  L"P K <-LM K00"KMP KBt(0 P$00 00 /(<( 0-LP0U@ 9,,0 ? P5/0(xA 0-LP #U@ 8,,0 ? P5/0(A 0-L@P0003/0'A 0-L|@P0003/0'A` 0-LP00P@0S 0 003/0' A -L@PpTP`Q $ 0 @4/&@ 0-LP00P@0S 0 003/0&P@ -LP`L@Pb8,,0  @Kh/&@T 0-LP@P 0 003/0%@ --LM  tp@ 0003/K%H? 0-Ltp@0003/0$? -L MԀP@(0K 0`@pZ+(0S 8@(0 ` ,`@ P "}yuqmiea]YUQMIEA=951-)%! ///x/p/h/`/X/P/H/@/8/0/(/ ////////////////////t>8??>>>>>>>|>h>P><>,>>=======t=`=P=<=,==<<<< -LLM@pTPP00 S S S 700 (Kd?0<0 0S J < AP Y0J" p0p T0SXWT` 0 @ 0C< D0 0 4 8 V= p `F f00 0 00Q 3 "R> \004PAP@D0@ S>03052 T *0`< 0L 0J`L@ @ T2<03 07X`( Vp80<S  Y>0305p2 0S000 (K8 @<R00S00000 400 T40 805052` VEpP 0S' D0S$\004PA@D0@ S>03052 T *0p< J80 80X@  <0` 80 j@ T`52`P V,080 ]` VPY`P VU@ T!`512;0<0 ";0<0  0 @ T K` < X \ 4 8 0 QP s * A<RdD l2, L!0,   S3"Q_ 4 R4p X P\P0C@D0T0 0 S@4 5>03050240 5 T *40 ` < J4` 04@0@p Tp2< 3 7T R4 \PA 4 t 0 H H` lD D` BH D LH`8D`H b` 1D  "@ S3"`P8 L ܄KKK_ 4 R4p X P\P0C@D0T0 0 S@4 5>03050240 5 T *40 ` < J4` 04@0@p Tp2< 3 7T RQ P FRp ` 4 h \ 0P\ 0 ` `RP0P0 J&K  WP@ TP0p00 #P!P1 3` %0` 5\ ` @8<Q  RX  0X \  \ 4   T4 8 5 5p2P FR 4PB0 p PX` U. W,QX 0\`0C@D0T0 0 S@>03052 T *0 < 00 J00T0@ S 0p`0 < 40 P0 08 @0 T5 2=Q+ 4 B0P  pT`PV W+ P R(QX \P0C@D0@ S>03052 T *0 < 00 J00X@ h T 00 p` <KO@0 T`52 8@<Q  R\ PX  0X 4   T5p24 400 B P8  `V U. 8 R+PX  A @DT  @ R> 3 52 T *p00 00< Jd00T @ pR, P0 0\P P03050240 5 T *40 P < J4P T00 S40@p 0`0 P40 0< 8 j4 P0 0\P P, T` 8 ^ R0  BR-4 R4p X \0C@D0T0 0 S@4 5>03050240 5 T *40 P < J4P T0 40Q@pz@0 T{*= 4 p@0 T #T %*= p G T `7,0P80 L<9H9@  BR.4 R4p X 0\PP0C@D0T0 0 S@4 5>03050240 5 T *40 ` < JL4` T00 S40@p# 0`0 40 0< 8 @0 T 6*` T # P , p8 00@ TPT040 * `4 @00 T0:T ,8 ` 4 <00K(T 4 %T# p G, ` 8 4 `4 0 00-LM@0@K0 p-L M@`P 0  4/Kp -pRLMP@b  [`PH/!a`P l0P  p02 (K0S)( $0   Pp0V20S0`  Pp0C20Sꐠ ;20S 0(Kh 0` P  0'2 0 "2 0 e'&p*) -L M@ |Kw -LG~KQBNK pG @D`GFMPM+4 ) VP@(T  V@PT 4 p(A  W0(K10 (K1 0 (P -`@LMp P)P /UV0SP 0rS)0rS00P 0P0 0@@0K0 Kh}0rS @ 0@ 0Kv1 0 ''T #-PL@ᥛp` 0/S /VP @0p S 0 S  ) p-LIM@AK M` @PP KKAʜp 4: S \0 0ip Kp1@O00Kp@1@00" p-LIM@AK M` @PP KKA⚜p 4: S \0 09p Kp0@O00Kp@0@00 -LM 0KK #   K  P K80Q 0 080/ -@|LP`P | dPP u |!P  Kh5&@P|P -000-0LM  0 Ky --L M  K -- LMJ4 P(0  0 Kyh 0--LM@JP  K -L@+8000,!Pr0 H<0 8 00-L00 @?P80@0800q| 0-L@?P80@0800 0-ML  D K 0-ML   K -LPpQ?mM0`p1  P?[Kp!K͌V P`?QKp!K͌U uP?Kp!F͌(T cP>GKp!F͌(Y QP>Kp!C͌  0S >P@>Kp!B͌80S +P=|Kp!̌X P%=TKp!B͌l03@@ 0S@780H0@QD \@@@PlA \ D @@Q \ @@P \  @@Q \ @@P| \  @@QT \'(  @| Q78A Q0! 0C T 1 d1t1 0|1 |1t1x1 c,0Pg|!10! -! P t P@ pW,0x!00 U? aPX P0wsxaD,00x=p(K,00P P0?3300ws<11 x,0 00PA   "-! R@ B! !pQ* P㐁  A ! A `  P 6Y,0x!00 W?a !PRA币1S SQ,0xq嬑0`DIu,00xQ=p , YH0 ?33` H0|1!0|1 SA01 t01 @P@A 01 P ! L01 PPPQ `qPGQ 0P01 P 0G1 S0T|1  0 -!  axA ! t1 Y ,0@tQ0p0`P pW,00p0T? a@ PYt!x1 t! |! 0x1 SxaV,0 @0PD,00x<p , VH0 ?33P @0!10C!1 R0!1 R_ʌ 0a|! t   x1 Y# ,0@t!xQ0p0`P pLW,0t!0p0T? a@ PYx!|1 x! ! 0|1 S|qXʌ! P,0A1`D,00x_<p , XH0 ?33` P0L4p 00R 1S& ,0!0-p!  01@01P01 @T,00@0X?3 - b001S!pQ*,0 At! 0 p  `P 0101P01 `V,00`0W?3a00 t1X!R) ,0-t! p 1 01@01P01 @T,0p!0@0X?3 - b001S!@Q. A,0x! P!1 p t  p 0101P01 ^X,0p!00T?3a00F x1PS #! |!10T@K P  @0\[K 0@t1 tA p 0\@@GK P@  0TeQK p`  0V1px< PK @P  0UeK `P  0UK @  0Y2|@K P  @0\GhqW!YK`A @Q P`1 PP) U1AQ RKa Ё `A Q @PPP  U aЁAQ!R! 0E/KБ A `Q @PPP 1 U  `AБQ1!PS2M@QOOK q `Pp`P V0 Pqꈁ43p 00R80000S`p!V009pKP0U 0 PP1|1 Ppt!W00L0K|A `@`uP 0V |APp!U00:0Kxq @p`P@\Ph 0V `xq&xpt!W00MtPK`0V D `?PJ -LC[Mp@p Ph3[Kx ?K͌lal  3QKt ?spK͌DpDq 2GK| ?SPF͌(qPQ 02PK ?c`F͌(p`` u82`K?spC͌ ̀pp  0h1pK ?B͌8褠ᤀ Z1|K?̌| | 0MH1TK ?B͌T@ T |1 t!px`pP(K[?Kx1 d Q?Kt1 o G?K|1 0{ PK `K  0 pK  |K 0 TK [ p-LPMLP@ 00  `P@ KpX p-LPMLP@ 00  `P@ KpWX0T 0 H D R #@ R$ 00?H/W<0L0 D D 0 R #@ R 00?H/V00  -0DLD   R #@ R! P?HU` p@V,010 0RD   (  \@T 00Vh00 00U|X X0 H-?30\ 4@  \<0@0GU\0 -L M0PXaS`(KPx@P"T> @00 R p@p0R0 T0 ZP X@0 @x0D0T p@Wd0 ?3 R #@ R<   0?33H0/P @xT00 00Sh0 0-SL@P KP 000 00R 0 H-?00S 03@ 0 S\x0D S   R 0S 00R00 00RP 0-LP T@T00T@0T0 0 0 /Q$ 2-LB$MP@0`00 Vw d:`"`\\< TrT LŸLH D"匢 吒嘂0 00$00D0 0T0 040 0X00\00`010h01080 0i010p@0 jp00z"P 00<0 H0" 2T 02h0$0i0D0j X 40 \00`0080@0 1 0 %  0 0 X(K脠儐 |< pppH t d0D T 4 P0H0080 @00@0 Qxl8<$0 -PlrLM`p @P @2Z 0#`` b"" bbdbhb``c ````cc#`PV c pQ -p|L 0p RS `b0` ``&P: `0` `&P/ 'p+ !p' ``0 &P  %O0f{000S :3S $K|$@$Kh0SPjNM -jL$@|3,P, P00 R  Kh K \1-LT M` + PA?@ T:>< |^0:v p0!# 0'S !!!- _!!!!| o!* !!f ㄁! ^ (!0^  R KQ 40 0O?h0 U  KK(0h$ 00A  S/J$ <5-L4 M p[ ` @+(@(p0$0 T!P. 3P4!&*+,0@@-@.@0@`@a@f@g@h@i@j@k@l@m@ p <8H08n@q@o@s@t@u@v@w@x@~@p@r@y@z@{@|@}@%3`15$(245P,x25231d2e2=`@30h3:|P0S R \3 (\. 0p (  RQ 1 0K>1hI PP \  0(`V(p00(K>Z<^v8#:0'# #H#p--`_|}ozpwrtyqzn{k@|hh}ey$I  = cP P@` 0-L@P @P "PP0QP wP P000 mR R0@0R0 1BQ;R" S0S0mS0 C ;S R0 R S0S0;S0C  Q0R0R0R0 S0 8  -LM0tPSp J|P HM0m0K<`  0rr jD|2S  #R $ |PK?T0 hTTP _X Q($$$4 | 4`T0$X4 S0300S< p0S9 4S 4S0 0t/2 @Wl"Q匑T 5P\ 00@l2Z+ L1S80 ' `P# 800P <0 =8 <08 R 0p2L%R4S 4S0?o2s8p2Y=3@t2 P[ 00@t2U>3@x2 P1 00@x2h(K0 D $pl h $ <%$[U P>0@l2Y Pl2<l2Z Pl2?;~0l2Y P<3@x2Z xPx2?;~0x2W nPx278x2U  cP<3@t2Z  ZPt2?;~0t2W  PPt278t2|200S0X00| 0rr QC|2S1S0! 4SVH5SL4 ޴ H (<$ $0 00/0*00@- $@ TP@h@ XPxl@lB`pT@tBHx’|@00@K/<$88 80 0Q $0X0 /. -L M\`@PpT 0S"!0S S0SXT00(K 0  -LP , 0 S0 2 L  -PLMP\qAp$K p`@`@ AR`` 000$K00$K`@`,0 a( X( ,0P ,0 ( g( ,0P `F `ᰐ帐 少帑 Q`8(0 $00 -<  ڸ -L@Pp~P` P`@` EPE0 "0X00@0 u 2@  -\`LP@U 0S1 RU0S@@{0SvKhˆ -lL`@pS0 SpV0S"Q0S 0SV0 0-MLM0@jPB~K@ PJpG 1@@@0|" AT #0 S*S \X K)L Ӭ)8\ - PLM  R  *0K  K) Q\0 00-L@D00S :T &0t00(0 0-L`P0S' :#CRQ# # p(0:@P #Cs## Bd0:#!BQ##(<\0 -LP0 M 00S ʃ0 K$ K'T8 80 0Q $0T0 /&$ -L`ިPPp@ 0@ 0SP0`0:3S 8 L40 00 :#&< #-L⌣M3 0 pE< @  `3`S040 0PP8 B `P%Wu /p p P@q Vp  0s 0 @0lR00@0ϐ1PB PR RZ RW00d S 8 `20<03`pt r @@Xpk t20R 4` 0 S[   r 1 `R R 0   (K ! \D 0 ^(K7p P@ 0` (K0s0 @0nR0 S  S @@ ` 0 @ 0s 0 @Bo0lR00k s008 X0T00 ㎩<  0%L%T%8%,%$##T ј! -L4S@P03P`? 80$ R, ; ʌ3SW"3Sp #0CW3 W " Rp 8K !0 00@ 000@ QP 800K@ {p0gP @0S  0zP PE(KD!P <0$C008@00*(K ``m` -ZL`CpTB D@P03Q4 Q&T,Õp A|g^00  T#, \ BppqL A| T@3@TKh 0-@PLP T0:|"C02TP0:CT 000P 00 1 / `808 000S :3S /<0<0 00S :3S  `/808 000S :3S /D<0<0 00S :3S  @/808 000S :3S o/H- @\ ʌÜ\ 0  h0 00-L0@T J 3$S |B0pQ P3K0h)P K0he0 <0< 000S :3S  /pX PT 00 R0S *P@00$// 000 000S :P /P0 L 0-L00S :P p Khx0 00-L0P J 3$S 3S p K0h|B0tQ 2K0h(0(0-   p000 000S :P /< 0-LM8 0p0`V# [,@KP $0p P 0 0p p@ ((K 08 @@P  P %/ -jLP Q3S @P4P0@3SKhHy 0-L@ J 0s3# SPP!0 P |2 $R 02S L03B |20"1#30000y|0P :3S// -@P4QLP( 80S $ 0S  0S0,0|00 R   R   R  P 4T `TT *2S Q P Q0 iT0 -:LP|b@0T!RN   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @ '  (!R 1S X  08!R 1S 03@0S T@ '|(@ Q0@0@!R@  @ T0 -:PaL|2P`@0T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  03@0S H00001S@078@0   d40P0 00 @0?30Q@080/(0Q$ 000/l(0Q$ 000z/4` 0\3@  0 T@0ʌ7|œ8@0\Q0@0/0 000 00Jh@0 < 0@0-L0P@;0@Q@0?30R@080/R/R"/ -PSL` G@H ?@(0-   PT 03@ʂ@0|œ  78@0\ R0@0/@/\ 0-LP@@P00 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/d0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/d 0-L@ 0 00 K0h 0-LP@ K0hR -L M@ 0P P S CKh  Kh 0 0 0 -LP@`#p Kh 0-L0 M,  @ @K8 -ML K -L,M( 00  K -Ll |0^P0,0!0s0 S\ H00P00S0x0  -H00QZ P00|0 |0SP0, ͟0@t0 h J  C@T0 @ @0 T@QP0,Q\P 0@P01L X0 `00,01L00 x R0L 0Q `0Dh0 xp h@ 0RH ?330 `0\0,0000,0\0`V0V 0Z 0 ZCd ^ p@`P,@\PL@^p p # 8` l p@0P 0H V80Q?o2QT{  0 \ p000|PE p0SB 4S 8P\  >l @ m 0 Pp 00p` 0P 00P f P p` P0 0 0 B B 080\00S\P00@@0 op000P   U P! f^1l   0  8 Sp000P fJt1l   0 8O RPlp U 1P 0 1Sl@pP6 V 0` 0 L5S( 0\ 00RPlpU 0P 0L pP0V0p L ` 4S 80S00Q0So L5S3r` 0-LPM@P`0 R   8p t  p0pPPU80  D 0! B 0C/? 00  Kv0 00v -LMP@p `PdPX\ `0hlYX P $K80 4000!BPCp`op`$Ku 0-@PL0@T0 !-L1P000S0Hpp?spS,, ` @F&T:pDUx4p0?330 @V DE0Z?# R0 SM t0 00sP 0-L0@弣T0 p-@PL MP U 0T 0 0S P@T P @@KpU  Kp`00P`@T P @KpP/ -RL`0p,S@ PP @P 0S pRQ A0@ ", "Q//  00C0/x,00 -0L0S x 9-0|iLx)$M`@ @ P8 4P pP <)0<0 \ X0 0x1 nRU;40 CR x8p0JPS0c 0U ^PUYP AA  R 4P\0 x 0 aRX01<(p RV,( RQ E P 0\U70 䧟7䇟 0W00 P0 P R' R  RN  lP R LP@70 R4  8  (K40Sy 40H{  R E PĖv pX PE3P0P0xP ~P0S PL60P<& h06< 0P  Y R# %4P0<0 OUuPp0 0JP 0 CS<0P0S 0HSx5x%x < p% 0 D `%H` ` 0 &D000Pp Y 4 prpgR p@pWLP<0  R $ 00Q 40 40 4PUɑS C  ^UPPU ,$  P 00C 0<0 R70\300S W0HH`SY%00P # 303Pᄓ0 pxspU  0PEP0xP P U,3,0(<0 3 s000 p0`@@ 0S @2PP0P0U\T00P 0 jP" 0  @ , @!  ? ^% 00P <0P0S lP. " @10  E : 8R"-RR RD0 @0 D0, #P\1aT100S yw<00S YmPUPP0S F aBU( wqpdw<lvvuuuuTuttPt$ss`8sLs8lrhrXqq@qPq<q8pppppx|onnn| h3-L`S M\CP@000 P Ė0 sp `Z_ # 3@p T10 Th)P b` @P 00 00CS & -P ʔ2 y0Sx20` d20  (KP<BQn(   @DR  T  lPT ` R ! E10@ ` k @` `Ql1 Q&T `` '@T  Q P%   lP ~@T  `   p@ ReB F @D`@^ ` a  p ` R  h R  'P ~gmXm <dl`ldlLlllkjjjj -L 0 i -L 0 ix|1|!0G-@ C@M *⤂X6 L!HO0  P0S& Z0( S!,p`pG\0  R    \0 \00 \0`SXЍSP ,qU0 0 0\  QWXc0 00 0Q 2S0l%R h%R //!R!RtP//ald 0 000 0/`d -L MUPPJ 5p 1s?  S࠱젣`q= q|şAQt! @SǠ- T0P\` 45  0P 5 5 l‘0@ @lQ hQ 0ʀh20 d"2s% |202,d"d",d"d"+d"d"+d"d"*d" d"*d"@d")d"d")d" d28d2 Rd\0Snfg~rfRg Szo|v`~fRZ Svf㊆pRM SfvfR@ Sfj~fR3 Svf㮆ppR& S`v`fR S:fR [=!0 Y. 0 C C S: Qlp" l200 C Q1@!n0 @8@1 :@p"bV/ 1O!LO 0 p0S! T100S 00XH0 0H0 0 Y ,01 0 0 00Q^*`V(K0 0 (K0 0 Q 0ʀh2Q 0ʀh2Q t5S 0ʀh2`d0f`bbPd1 00-LDP P?P08 Q8\6 00ʃhœ\ 1:p“ @TnB pƒ 0PUOnpƒ 0A\ B\  0    Z0P01@-0G$ 00` PAʀ: nOh0^000 @P)#0000CS 00000000000000000Y -PP@L M@&\U ,npvrf 0 P |P 00  (0  KWd`P\0@- P\P nV,pFrPP 00V 010-L(0 :h2S 1@0@ 00S 0n008!*?pB00 R 00@S0AS Vt0\\h0 000:d/U, x00-Lp@P@00:h2S S0H0000P000 $ @0 0@00Td` 1- Q@#@LP`@0# R!p hQ# Q!*?Q<n23 8|20" 41  1Q=@07 #@8 0@0!*?Q#n23 |20l 0  1Q*|20h t0 z 1Qq 1Q*|20tTT`/|0 x 00-L00@00C0SpP0 0 SpP UbxPR0 0-0CSL@0pP0 0 SpP UDxP80 4 00-L00@᫛P0Q 0-LP៛@0D ?@?  Q P/0Q?? \\ /0@-Q 0 @  0 B 0CJ S R!@- P0 p` 00p@SL,0L .W 0*S /SR000 00C0*SP( S-Lq$Mp`80 P( 8K  80@T<  !F q @ D $T  5/8 080 @TX < 0FRs0  S00S: (K <R! .\  ""!H >L0 <L0P H, K080 " gX00S P@ 00 R0SD0?@P  5/@TD0`0<0o@P  5/@TO  p-LMP@` 0S 1S 02S0$0R  `@WKp00 -L$M0 0 KLl0 00-L@M<<@ P@ P 1K0L$ Pp-LHMDD `@P0` KpK0 p@-000\Sc ^S. %@@5 'CqPr!@1{p SL LL T}A4c0000p0000%@@@cS{EAETB0@@ L `\\Ad0@@@T 00DS.0P@00 0100C@P00@\S{ '00p0dKT p-LM(0Kh p&(P$@!N+AKDgmM 2Pa!%Bb 6 "`Kp  0-LM 0KP& P@k @CL0 0#.CSc@`0L0L2!"@K0 X  -LM00KC-&0,-( ?,D*Er0@N0 4<$cb0 9 <"#` KЫ 0@-@%@p 0  -L$M8  @`P 80,'0 p8p  00R0pDp   @P< n m @ ,R3T 00@\ 0 8 @000 8 080  RS  Qs%R 8 +0IGS񏐕D*  ~|zyxwvutsrqponmlkjihgfedcba`_^]\ZYXWVUTSRQPON\T0 S\R 0S0\S 0 S000 W D0PC0@ T 00$ <0  000 0d0 />0000 00 0 00 (K080  R!.Q R*Q080 D0 R@400% iY0 @00 0 8 K 8 @PeuPF0 S 00@00 0000008 0 -0 S@0@0k   00 0 000000008 0  0 S00 8K00KL0 @0    0 0  0L0 H 00000 x< 00H @00@8 000 0 SS\e 00dY% Pe0 @00@uP 0 d 000 8 0 S8\E 00%Pec 0 @00@uP0 8  0 S!\00K& 8K.00% +0 @00Pe @c0 uP000 00 0 8 @`㽖  00(KH0 H00K0K@F | p 0p-L@ M`@P0S PS#  0 K00"P t 0 Q0 QT00H@0x 0 Kp0d?0EElE8P -LM0 S 0K0K0K@0S pKL$P0 `V$@PU @ 0PfSPKKD`Q`0P 7K>4d -LM0 S 0K0K0KP0S pK& P0 `V$@PU @ 0PnSLPPKL`A`=0P 480PK=d H!-L M0`4S(0K0&K'0Kp0S= (PK1P4䀟A P*0< qW# X $@ 0H(0sSPp @TWV 0S !c@pJ@@ Kp Kd; 0  -LTMX 3lpP P0KX K\ @$ h0 g:0R0K* @P 4 P#0 x0 p >,0t0 d 0l0 0SL  R T0KS K`Vx #V =V =&`P 000`0 `ddPq  ZV 0 0W*S |prP Y0 0,    bVP b`0 PSJ :\ @PP@xr`,\ ph` V AT1@  tb Q0= ` P Pgb  VP\00 (KT@K$Pl0倁0P`0 H `` ,0K 0$0 ᭔T`Kl P <倡 P 4M`0@`0 `TKQ1Pt0aP" P 0`0 @`C`0S (Kp0``  @5L Pl_x0< I | t  # 0-0SL@,08QP P2ᤓP,0P0Q 0-PLP@P040, 4P0 -Ly00 -Lp`@P0\ %\0pS sS lS@ 0\TT 1D !01 CR0@CUPW A> -pQLqM@ G PH 00S040Q y?K$ mK H X z?K Q R KQ %Qp rP Q, 40,(K@P%T >,`Kf0 1 0DXSXaVU^SRQPONMLKHGFEDCBA@?>O<;:9876543210/.-,+*)('&%$#"! ( 00 00D p2"7R@0A@?S00@^p P!1! D]R񏐳)~}|]zyxwvwtsrqQmkihheF&ba7w^]\=ZYYV^.00A \ -00A{0l@ p0!K p\P(Kj`Z P 00040P, 0000@TK @D,0K0@ A@ X 3!P ,04  np 40P4 0`V 0F, K00 S1ऀ `F,0K&@D0` 1VT/t-,+nG(B&9$#"! 'B<R     &00@T? @D,0K0@ AT POQ9 ?Q  ;Q Q. %Q0 pa0As RA0AS00OS3A ,K,K!000 0 01S101 1Sx10x1 0@T @D,0K`0@ 1P h0OTyt10As R0 pOR,K1 PT10 T000S , K!0C00 X0S 1 AX@1@!@ &P , 41mp 4004000@OS ,K,K!000 000'SS 0S'S'Spp00S 0C, K00 10SQ  ?Rp ;Rb PeRd pQ 0%Q 0p!0     0C0"00OSl,K000 ,0K1 0}SS 0S}S}SOpC0@TN @D,0K0@ A@a0As R!, K1 A20`VE `F,0K!T0` 10 ~T00`OV ,K,K!`000` 0R Bp0 OR,K,K1 ,0K10 000000i00xP !T00 ~T0 0jP< 00&@D00`0VTlhjihde|csa`_^]\[ZYXWVa|vRQMONMLKJIHGFEDC`A@?>=<;:987654j210/.-,+*)('&%T#"! O00}`0 , Ka!@00@ eOVE0, K,K!1`⤀ 0` VXX S@0XHoᨂ4P5X  (PPo 7P@A0AS3AAՕ?o2P'00 - -LM 0 K - -L M  0 K - -LM 0 K00/( -`QL MPp@. 0ST00 00 KW& 㚎P fX x009 X*T OTj K `P {Ppp0 0 R0S TH +T0%T Th, KD3Fp 2[S "[R1 000ST00P S00hP |S00<0޲ ˜ h \ 0 0R -L MKF@P K -pL@P% T% `PV @P|PP0EmV ᴠo ᭠P -LP`pU@ ᫍP T R -L@P 0`BpS%  p 0! p  0!p 0S `᲍P `  0?s0 /rQ0r00?s Rs  0/r Rp qQ A q```0 p WU?s0 ^ṖW qQ0p! Ͽ|\p  Lo`q ?s0 /0r p⢏ `W0ᶀ Ͽ|0S /rP  0?s`/0Vr U``a @r P/r`V1 0` /rpS $嶍0 p$0 0$pZ 0S! $ p /r ` nR 4 sR# fR 0 $ `P $`0 `pR00U0S  0|\ :pp /r0 SU000`pU0`?s0 /R0ppD0 -@QL!MPp 0hh P 000S> P(K`P 4PK0pK0p -p 0 RP(K40S 0 1P40  0 PP 2PPX X0 00HP+P P0 *{`P T l -LMB~K M pG04 `0:S(0@:SS 0:PSPSPUD3 R00X0S  t,0K 04 TL_P P0`:S (K`(K<2 -L0Ÿ0MPM  @`ppIP= 0/SM P   ၌Z  PK HE+P 0  (Kh0P B~KT! pG gP"80 r (K0P 0S/S ppP ?Y0 0 P BK  @Tp 0,, YW @0 00(K,0000 \ 8 < -LMP\P tpp@ `OpP @T EP0  0  $$(Koe  --LM@"00  K 0-L@忋彋<廋 幋巋,嵋K0hC 0-LP@S:0S P0 -L ^fQ ^ 0?s0S nQ sQ^0 p00 -L p`@WfR@pW P_u 0P  nR@ sR@pW@0Ot@@00@ -L@PpP6`V)*0<P( D0< ?0D0<0D0D <0nW` D p: sW% fWD0< DH00H00 .<P0`Z 0 D<0 s0?0D0<0D0D0 0D0D0x< 帏泀D00D0 T @ -L M@0 pWP `V 0$4 40 D0 *00Pv 0  u]Wy /   QVx0?0  G0S 4`Ps0 ? 0|Ͽ6(0S080S0H0S+000J(K0(0S $P`s0?|0Ͽ 80S 4P`s0,?|0Ͽ H0S DP`s0<?|0Ͽ "CTd1.P Kp  -L-@ h0h 000s@ I CPJH K KIKI  Kh 0@-L-TH{V@(M   SH1#9"VR<ol4G iQ)pH1 ~}|{zyxwvutsrqponmlkjihgfedcb]8!tt-iS/ .D \4 76543mM0/.-,+*)('&%$#"!      lcP0D0 ʘ$ 4@ P0S2/'L"KDK) P0S !00 $KKcP0D0  $ \4@ P0S2/'L"KDK P0S4 00⼾!00 cP0D0 ʘ# 3@ bK00sSL cP0D0 \# 3@ P0S2/'D"KDKP0SL3 00∾!00 cP0D0 " 2@ 00S2/'D"KDKP cP0D0 ʀ" 2@ KP0Su DKPX0S h2@@@b$0 KW"00 fcP0D0 ! 2@ KP0SI DKvP/0S 1@@@;0 $0"00 ?cP0D0 VX! l1@ KP0SP DKOP0S 01@@@0  "00 cP0D0 ,  0@ KP0S  DK(P0S 0@@@h0 ֽ"00 ?D 0  P   x x @ @  4cP0D0 4  00@ KP0S DKP0S l0@@@0 "00 cP0D0   0@ KP0S DKP0S 1@@@0 o{"00 cP0D0 T! {V(4@ kF{ { 00S DKP scP0D0 ʐ# {F3@ {k{F{ { 00S DKP ZcP0D0 0# {l3@ k k P0S DKjP0S 3 00(!00 7cP0D0 ʬ" {2@ k k P0SW DKGP0S2 `00!00 cP0D0 (" X2@ P0Sl2/'L"KDK#P0S2 00ռ!00 cP0D0 lʠ! 1@ P0SY2/'D"KDKP0St1 P00ⱼ!00 cP0D0 >! 81@ 00S+2/'D"KDKP8 cP0D0   0@ P0S2/'L"KDKPZ0S0 t00w!00   d 0 L 4 \ 8  @ t cP0D0 8  $0@ P0S0 "KDKP0St0 007C!00 RcP0D0 ʼ  0@ P0S0 "KDKbP0S1 00 !00 /cP0D0 n"00 M  SGK0"00 ?   SOKr!00 .|  ` H 0  ی ڼ ڼ @ ٘ ٜ ٰ T ِ  \ @ @ ׌ \SOK!00 <  SOK!00 p  {Sk k !00 # M# SOK!00 # SGK"00 L# {Sk k V!00 # ESOK!00 " " W" 3" I" SOK"00 " ~" XSGKp!00 X" DKP8 v820@0 ,20@0 A s PH V @ e{F0 /G "KP d!H H  0/O"K0S :!00 I G E C A ? = ; 9 7 5 3 1 / - + ) ' % # !           "00 "00 "00 "00 @ !TD-? ׀ ֐ ֬ @ h ִ ֘ ֨ 8 ՠ פ h @ \  h"00 !00 "00 !00 k k !00 "00 "00 k k !00 !00  "00 "00 !00 "00 "00 "00 z"00 u"00 p"00 k"00 zf"00 ua"00 p\"00 kW"00 f20@0 20@0 H #H 2/'L"KP82 D00-H\2 `00$0!00 ?+!00 : /0@- M R?AϠ0CSS/@Q  S(R#0@P0[Dk{6F{7{ Ѝ03S S{ {7{ AA0A31 00P10 RXH` H!k ;B{6F{7{ / x/0S P /? @4@P/ 0-L@p`8P (P (8/P86 , R( 040!"R40GPBV: `V# G 8,04`00G,0400 40, 040S04000R`0``P 0-L& 0S# $0S P04_Iʃ R 0 S PpTP  $ < @ @00P -L 0S $0S g0P ,00040 Kh -PPL@% 0S" $Y NPQ`@aD/T@0DTSpp8Q (0T (9/8p (@$Kk R-`L@3 8S1R  -P/ 0 S $ (R +3/PP P4?@`08`pP $0(3/`H  (0 0$ R(  $ ppp@0  0-@PLP 0S $0S PQ0 Q @  \ @/000 0S L ??00P00CSTP L0@7sN?0 QO?0(0 S@p0(0,K? 0a5?0U0 0PEt@Tw0pS LQ/<`00 ld`hr0l0  ^6X P"010T :u0PEt@010PkUL`,0< S80 0P0\l* @D7~˒ LD?q@D0L`@D< B $0Sp0  0p7?@0h'8w`<#0#V LQ/3`00 K?07s@D;DM?<0P0D`SB?0| @p  LQ/X4`00 0S \ 0$0C 8 P 0l0S> 0X p0/P0X p0 tP LQ/4`00 R?`0LQ/$5q@D`00 80@pD0 x@ LQ/d5`00 7p` s@ Ql0r r0 Pl R0PEt@RULQ/6`00  P0SG?0`L~ R0PEt@RUo 0a`l` `VU` d U\  PEt@ 0! `Vl d 7s@Dl0Pk7~@DD0e.El0 4K'44pK30K'8'|20K1pK@pP?`0.0<SAa  00$0SW$   0  4K'44pK30Kp6?@0;I?L0)7p` q@ LF?l0 4K'44pKp30Kx@0[\7p@D| 0@D''q00Q/S ?0S%L`900 L`<0 080P00tp0 P0 0X彯Xl WP L`900Q?0iLQ/900 `@L`pp d0\lT \ h 2P L`d:00Q?0s`Lq@Dn??@0LQ/:00 -@PL 0S $PU `P(80S 5/$P(5/00` -@PL`P 0S $0S pP@0 QR 408 B4 08@U000p -@PLp`' 0S$ $0S! PP 0R>/ S  P00S  z w0S R?0 0-@PL 0S $0S P0  $000h2 d"0-LM`PP0(0 0S $0S lPp^6 0SSt #0\#@< .L+K,0K  Q"$< 0-K @ Q00cS R#2Q SQ0S@0S50l0^P  I Q00cS R#2Q S@@Q0Sl0S0C@@??0( 0R $Kl0SSh(P -L 0S $0S P0A/Q@o -@QLX `VU $0SR XPJ+(P6/pPK 8`V ( 0(3/`P: 0 0@ 0P@ +µP45Q *p0V0C0p0 (0 8#᯵8`po=QT0AP0C0T0($03/P -L 0S $0S TP0 :+ 0-@PL 0S $0S >P Q 000 000P -L 0S $0S 'P0C R L RD0+0BD0OP -L 0S $0S P S>p0@@G-M@`0@0\R P0U0SCQ 0|S 0P0\W ^ UP! U0! 0100`V P0uZЍ 0  0ЍS 0Q0P0S0P`0e0Vs00R @ 0PS0 RS`bC0P@R@ P02 0 PSЍ0,4000000@?o2800@  B( 0<0 00$0Ppp 0S0305 :UPE 40%P3P!`03`!00%P!v0&0(`490C `1` R`pP00L3 0S C@ 0$Q Br $AR\Y   \?( P$ U:  Y` \( L * $R AR @@ BR Q: 8 Q  Rr, %Q  Rl<@ $P B@B! @@ L0@ ?o2,0%R00ST 0 4 @000XS @p <01 00 ,0!80 , 04 00> G-HM @:,0B8P#4 0H0 @0 Q ,0 LA?C0CRp`&PfP80 009096&0Ct0Cl ?oN t2l S \ 0l R8 Ll0\000Sl(K Nt1Q40S Q5 Ql0DPL 4< @`8 H A8H@ <@< `@ D0 l0 L0\'! H PP`@0 D0H@<Lln l`l0*4S1#\ &R \ R8 C0l0\00(K\ R8 C0l0\0w00S(KXDP -L` M 0, 0CS0!4 00 G0X0T0X0S0D SpHor 0t $0#4 L  B B  0B0U \0 8@D  \0 0  A  \0TW+6@*01TB:@DlP\0/PE 0 S0S@100TP1T:XpD pGpor 5W!  B @ @ 40 @SP , 80Rt06A཭,0l0&\0AQ@@UF (K40 @Szl0  \\@SF(K8 l0\@0l0l< AQLl C&80R ll& A5l0,0l0uPfRP#0 \00\08R3#QP R8P1P!X -L`PM@P4` 0S $0S 6TPp0S80 z Se t Ru,0 SH:D0 40 P< @@ ct0S$lT8 `@X`0 D@@4H0 R:,0 0H0PP0l t0>t0Sl  l \ D 60@ x0`040th <  800(K8 R"L 8`!BD0D `س,0l`\`f EP@0*St`V 4 0 ,0U0`:*D (K -@PLpP 0S $0S `P l0t,@0S@1WTU@80C M` -@PL1 0S. $0S+ z`P(P``0 S`, `S S*0q0 0 00(0s0c0*0 900` -L@PP#@L D!B,0 0<0PG 0X ʄ lP\PtP` 0` |0VhPHPx`hH 0-@PLP 0S $0S P0 RP00 -@PL`P 0S $0S P V000U0:60 -PPL M@`0 0S- $0S* 0P00 &z0&0R":kƗ PA5T0C0<0Ve@T0@  d@l`F0(K000 000 -@PLp`P \ $\ P0p`P|0 ? -p`PL1P"3@ 0S $0S P 0S S S000Q  l0S0 0P R%v%\\0 0S00Q 0P$Q 0P,Q0 >-LPPM0`00 b 0S_ $0S\ 5pPYVW 0@So  RiV0S\c\ (\(`R`V ^ BPQ"ST Rt0S 0S R4 R d-  ##03/0@S200 P V0SpӐ S00X #  #800#"0 p0oS0c§r0k0Sp<p0 000aS *SD00SAl0S0 B8@呓0A0#22c0#$  0l0S  00# #8 00#"0 q000P0S09S ES IS! [Sg gSg  R\XV/ 80S0(0(K.0S0>0QK 0I X:3 0 Z  X 0%* HI 0 ,0 S R B0 0V  2R'0ScS@`S\ ȩ0, R Y I   R.   0 0S0  0 P,0SQ: R00, R  R0 B0200 [  $ R,0  $ 0 0S0  0 P,0SQ: RL0 0 t00 0  RC 0,00Q0Q0$ s0Q0s0R 0s000 0 0#400 0 0 S0 S 00R01 00 0 R  00 0#400, R E  )0,0S)  R0 B0y0,00g  S 0 Q0S0  00#40X0q000S 0 B0J00 B0C0/pVy 0 V V 0Sqtl 86` 岠!ƈ9096&0CtRl0It0l0Q Yt0SVF :V㴖m 6S9 \ R 8l0 L l0\0i00 00#400 00 0  0#400 0 \ R8 C0] l0\0)00S~0J0 0 0 0 0 0 S0 S 00R01 0q 0 0S0  0o001p0 000060,0 I0 [00L D0 !B t0S*l0\068P 0P4p tq&l8`P 0@ 0S1 *6夆ƒᾐ9096&0Ct0Cl ?oA t2l SoQtQVw Q Q`l8cTDP0S0S0 0XXXXXX{XvHSo᪢Z0C0G`0S`0S*0Cƒs0椦ᾀ0 010016&0C`0Ctl ?oA` 2tl \0S B80H l0\000ST4p8P\ R 8l0 L2 l0\000S20/:V4p8P 6S \ Rvw\ R       -PPL`pO 0SL $0SI PFv@@ V00W0S<0S  0 " R p* 0S1 0V SZ&R R L D!B 0ŭ06 0x  ` 0 |0p0`L D!B RRD -@PL/ 0S, $PU) `P&0(pQ 5/0$P(DQ 5/0$P(@Q 5/0$P(8Q 5/$P(05/qW00`` -LM`2 080 0\Pp00 08Q1S00P 0Q{ $0S yV`f0V`F00GQxFQRt0  YRpFSo40 媢ZhV @&( `4/@Po  J40&@p0`AT` 0q`h0 d` ``` `X` T`Td\岀RQ㲀rl `Q= 0\0 T X!p0100PT00T0 0X`0Z pN<`p p`pdըfq 0Yc#60p'v\0STlX8 p0H0`H ✕F 0@\  p0 T 0<l   SdP p` P0| AS 0CV 000000C0. 0`FS T \T@NhLK@0 0T00P r  0Q , K R@BB Q  0^(KT\P`dP l0=bXppT@ x^ T001`FW1 @T@@6:*^Y I P A-@\PA0RP+}n@p `0\( \ 1|Z000R R$ P0T0 S R S |RP00 P0 S+Ұ0000Ұ00P0G-MⲠZRRj+=k!P@  0000p0 Wᶐ@ YP4 W; >0 &02Pa@ARs0 sPPѼ& PPP0 0P#406 c@\ FpW Yp Y @P0  00RЍZƖ0b Z |*~J ᴀ<h Qs0sH@p 00@#40Ɩ0l R30Ɔs0*ᲀ< h Rs0s j@H   0 0@#40Ɩ l Q"r ἆXpGr Kwp0Y@x氀@ 0#406 c0CWrp6 @ P W6+-㱀 h Rs00 00#4 0Ɩ0l LQƆq \q0Bs0 q  "$  n NS2s00ßk MΌ➒s0sѼvp00pp#406c 0CR. 6Z48 + 0 QW4&&&&(K(Ko  0r <0~<s0000#400a A^3s008 @p1s000J&s0FP 0 P P 0 PQ 0-LPD@ r2m>FP 0f P e P 0 Q0 -`rPL @PP  GPr -PL`r @PP  3P^ 0-LP@C r2m>FP 0 P PR 0[ ?PQ 0-LP@! r2m>FP 0 P  P> 0+ Q0 -`rPL @PP  P -PL`r @PP  P 0-LP@r2m>FP 0 P P 0 1PQ 0-LPp@r2m>FP 0 P  P 0 Q0 -PL`L @PP  sP -PL`D @PP  _P 0-LP(@or2m>FP 00I PH @P} 0 Q0 0-LP@Nr2m>FP 00( P ' @Pj 0W Q0 -PL` @PP  P4 -PL` @PP  P  0-L@Pg>t3GP 0@0 -PL`@PP  P 0-L@Pg>t3GP 090 -PL`@PP  P 0-PRL@ @0 0-LR@P  00 000| 0-L@0P }S{S0P -L 0R P Q Ûo 0 -SL@P T``"P8KhhP Kh:   -LP@P p`QP   `@L 0-LP@P Pי000 0 0-@PL 0 0R iPP 0 00  000P0lQ0P Q  0PT 0-PPL x0 0R9@P 0 0HQ0P Q \ 0@0@ @P/0 0R /P/0 0R/ 0-@PL X0 0R  Q0P Q # 0000 \P/,0 0RP///0 -@PLM ?o  2P0S K0S0 P 0  P`PpP 0 S  R H  - PPp Kh 0-L@<PzP0/sP Q lP Q>dP  K0h] 0 -SLP` @ 0S M@P<EP QQ :P/4P >/P  Kh( -`L@Q 2>Q# &Q P Q' <QP&PQ  PhPPQ PR>3 0Ls0S>3 /Sh `(`  0Bs\00@03<0/R>R  R `@R  0Bs0S>3 00/R>RppU0F0 S aP0/S0$0F 0>SM Ss  0R Br R,0 ApP @2=QP= Q @  LqQ>=\Q- \`FV0S0(0@1" @r RP{(0Sx0$00`>Sr0``000 0 0B00"Sb0 S 0\ "P P0T C  >RO00`v 0 0 ௥ W Z YT@-\ <\ AQ R\ <\6 &\@aT lTt\% @mT pTo\s\;\'gTt\;\>@pT@;T;\<S0SqTu\o\t\;\"Q 0-L  `o x1-LMKQKMM`0H1 O?KL1 N?KP1 @A0 Pp@H Q. 0W `PD  0 3/P D1,@K PLqP1$D<18SSS @83@ PN0!S0-S0-S0@@SS -S 0-S>Q@@ V V; -PRMLM`pcP 0S @0W : sW[ /R 4BK.<H0ፔ 0 S*100 0 ;gp@0  )U< P_0P K0?  K0CW /RW  C/QW0 B@CBK@3TH@! @$0K@04DΘ0  K0p P_p 4p0P T -LM`wPKE@P3 ,pB KWpD dKe0W= p`00 `sp&  0  ` rp0PP! $K p``rp  $K@M$KL@L@  0-L@K0h5 -LuP 0 0 d N Q P( -LMKIM@ NK00 LPW @ATz 0 R 2/0pPue PA0mK 03/U@ 5/T vuT T@AT8A 2 p0S6 03/P Z :/p]u8AT 0 R 2/0Pcu$ P Z :/W8 003/U 5/mK(K 0 0C/ 0 0C/ 0 0C/ڢ F0 0 Ѣp <l0l 0 ȢX !T0T 0C/࿢ L OL NH L O8 N$ L O N L N M L` N M L< N M 0-LP@P-  PPL0$0SP  Rl^P P IPP 4 0PPP M D M,P0/ -LMKMMH @L T! HTL 0D! 00@! S,mKQ_KNKOKS/KP! RK T%`0P! CP4 HL0 @04/@PSoKR_K@HL003/@0 (P(KT@D1L!HP < 8D! 0H SL @! (KT!R00 0 0K/ I@ K J 0/0/ 0-L@K0h, (-L Kh,pP&h (0-@L?K0P 0-L @@ઌ0 0-R0 S SQ00/S@ TU:0/P 00#/!SQPQ// -PAL@p\]`P (MIP ID`P JᔌX`(0?$ $0 8 I H I p-L,M@! yDP = @ ? 0-P@L@0S 0  Q<0  0K0h0 -SL( $0$ 0d 1 Kh =( @P ? (0-@L0 -L4PpU ,@ᄑQ ` 0E0`£P #A焑Q ͏PX @@X@  z0 0| < ?t >0 S-L P< P 4Q ,00D c@0@ 0 , (0( 0 ๝ ;l >D =d ;H > =@ 0-PLP X0 0R @$P0 {0 0  : = < -@PLP` 0 0R U aP @T @p PP@ @T  0 0 [d 9 =t ; -L0@`S dPPP P Kh 0 0,4 94 < ;, 0-LPE@P H D0 0 40 0PR<0  00 -PL M@`40SP EP@|(K P 1 0R0P00 00 0SP hh p JP P P ;P 0 03/P 0pP 0 S 00R 0@2(Ko?0 00C 0S 0pS PH@4 000 0. 7 r8 6 6H 6 :h 840 -SL , 0C40P Kh@ <0< 0-i( $0$ 0-` 6 9 8 5 8 7 -L`4P 4 R @,0Q p ,04 P@Tp:80# -PLM@`80 K KP 4 0Rp` S"*,P' B!'u4 <0 B4 0<0Kd F`0` 0.L GH0H 0.4 H000 0. 40 8$ 6( 4 8 6 3 8 5P -L@Pp1 `0VHV. 404 S S6 H0001,   , 0 00,0P , 0000/o"\ R `" `P*    ` RP`D }@0@ 0^/y, (0( 0^/p 2H 6 4@ 2$ 6 40P 00R/0P -L (00RP80080ۜ 0-PL@80080K0h 0-@PL 80 0R@ 0P4@0 0-@PLM d0 0R@ K0P 00S@#:K0&@ڸ 0-P@L{T ,0 0R@@n0$ -PPL 0 0R4 `[40S @40S,0@ pPJ`d`@ -@PL` @0 0R@ P. @'0P /o40"0\ R00\/ -@PLMP l# Q (K40 Q8 `0 K RpP @P䂟H IpP 40 Q_ 4X3, <0p0P<04  pp,WQ<W\WmBXh  0 080 +p m pP8 e,00QT  80 ڋ80PZJ0 / "H B@!s0 ,0 4<q1 P4< P,A-X* p'<A!r,4 <0 pP04 <0_]| x0x 0.༙d `0` 0.೙L UH0H 0i/ઙ`P +T -4 -L +0 . -( + / - -L`SPp@ T  P B#!000 $KkB 0 0o/j * . ,P- ?o82 ^0S 00 S0P/ 00R/Ӏ P/?o, 2 \0S/00 S/TP- ?o02 ^0S 0 S%P/0 000R/-P <0/o0"00^ R  RҐ 0-LP5@P P 0 03/P P P:0PVB30P -`L@PP +pP $P p@0P p Kh] & -LP@PP  2PP Bh`Bd` 0-L@P $P0P &H 0-Lt@@P q00 000а 0-L@0P AA0P -L 0R RP0SSo804 40 K$0 0 C +4 *( + * * * -L M 0@`S7 vP/ 0X00 2qPp@P  P  P X0U UHU#2000P A"<@ 0*CP? P(K(KoX& 00Xp@pP P$1%R< P 20000P X p=P =P (Ko8 $ ) # ( # -LpϟP` M<0 00 40 080 @Q ArP|0Ph  0P<Q =Q 4z0P WA W7 W/ V 0  R}0C1 0Qt Q Q& Q Q <Ql =Qj z0Pg @0 Qa0C#2 0QU Q Q Q Q7 <QM =Q@ @z0PD V 0  R> 0C#!3 0Q2 Q Q9 Q Q' <Q* =Qp z0P V 0  R 0C0 0@Q Q QG Q Q <Q! =Q < lz0P|(K @2 YPOpQ 0As0S <Q =QE Oz0P@03Q 0As0S0{ <Q =Qz d  3z0P pQ 0As0S <Q =Q 8!z0P V @0Q Q QL Q Q <Q =Q  zP @B@030@Q A|\H0 N <Q =Q y0PQ~ 0As0S <Qx =Q  y0Pp @)@03pQe 0As0S0 <Q\ =Q y0PT @ V p)QF 0As0S <0AS?< y0P9 @@03pQ, 0As0S0H <Q# =Q! y0P @Q 0As0S1<Q =Q t ry0PpQ 0As0S9<Q =QT , ^y0PQ 0As0S<<Q =Q Ky0P)@03pQ 0As0S0 <Q =QW x0y0Pn@03Q 0As0Sq0 <Q =Q[ @030@Q A|\X0  <Q, =Q x0PQ 0AsP <0AStx0P @00@30pQr 0As0SJ@03 <Qg =Qe x0PC^QZ 0As0S<0ASSxPM  @@pp @ p@03pQ5 0As0S 0L <Q, =Q* xP/#@pQ 0As0S <0AS|xP@03pQ 0As0S0t <Q =Q \axP @W P0S<00P(KP W[ Wp=@Q 0As R00@32dp0pS CpP@1_@ p@Q 0As0S0 <Q =Q (x0P > P <P ) P @<<Q Q AQ @P <Pp @ 0@S=Pz13u<PPp<PPB~ 0# ,3, 0X p@Q` 0As R500@32p]pQQ 0AsP 00@30 <QF =Q  w0P<pQ8 0As R00@320g@p4P@ pPpPp Pp@ pR 0BsP00@300 <R$ =R mw0P @{0@S CrP @2  <S =S @Sw0PPP0@S CrP @2  <S =S 6wP n<Q =Q ,w0P ' ' ' 'x ' & &D & % % %0 $ $P # " " " ! !H @  x 0  h  p      ( 4  X \   <Q =QD (v0PE@Q 0As R^00@32 <Qz =Qx vPq@Pm P{<Qh =Qf v0P_<S] =S  v0P2R0  pPL PH  PC -LP`PU@,;pP  ip P@ 0-LP@P0P0 @00 -@PL 0 0RPP 0 00   `V :pP  7pP00PP/0 0R /xP -L 0 0R P`U V :@P  V@ P BL0L 0x ̒@, F(0( 0x D 4 l   d P -L\0 0R 0S P4 W000 0 ࠒPd   XP- ?o02 ^0S 0 SP -L400\ 0SMo -LM$P@`U P x!0 P 0S3K $0K P $PP3:pP   0KzP2 $0R. P' @P$ PUp;P$0 0@ KPp$  ! P0"S D B@0@ 0 x;dž0"S t ( 8 / 0-L4P4@P@ 000 0Stq d PP/?o8  2\0S /0SP/ H0-@@LT(@@ @B0@@^< 0-@PL (0 0R.000XP/0 0R/P- ?o02 ^0S 0 S0 0-SL@P 0$0S 0 "P 0 P ttp@H@ @@0LLL@;@804 40 F x]p\]<ڐ P 4  -`PL@ 9@P@9PPp @9@P:p \P@K YP 1 0RpP 00 0S/0 03/@P P  Q 00C 0S @ 0@S ,P`Kh5@@, (0( 0  h  D  000-P4L@Q8 Q 4 ,<040Q<00P0 &0 0  4  -LMP`p@U#  -P 0 P (0S p @@0 Pb00KK$ B 0  0 ೎  \  -pLP(4iP 40S @,0a&, 40a@T:8 408  S-L MpP`'V@ T 00Q @00 K( S@T (  Kir 0 0F/T   0P 00R/0P -L (00RP80080 0-@PL 80 0R@ 0P0@0| 0-@PL 80 0R@ 0P4@0$ 0-@PLM d0 0R@ K0P q00S@#:jK0@ 0-P@L[T ,0 0R@-@N04 0-PL@D80080K0h< 0-PL@58@2@@0 -@PLP |0 0R` 40S,0AT @@ R0 0O/p   L -@PL`p 00P P8040S !,0Y P, <0 q0<0P;PD @0@ 0S/G, (0( 0S/>  P  , 0-@PLM P0 0R@ K0P  @K0 p-@PL M 1 0R KpP  4 P"80,0!aV# P ,0P < 0@400<0kKphKphcD @0@ 0W/ٌ, (0( 0W/Ќ$ 4   D tP- ?o02 ^0S 0 S 0-LP@P P 0 03/P P P0P 60P -L M@P K  HP  $0SKh $ -LP@PP | PP 5"`5` 0-Lj@P $P0P 011/ -@Lp`PP P1S!0„ P 040P !p` P 180A4 40 $0B 0 P ( h |  H -L\ ^ \-QRS  0S0 0X5 QL R S "  0S €  00 Z0 0 ‹ ( -PRL,M00Q@ P 0 ` p Pp `0 0R0S00(Kp`0 $- 0>    S-0>   S- 0    S-0   S p-@PL,M`P 0S R00Z{$P KpKph.0-S 0 0 0 0 0 0 0 0  0 d P0U00 R 0S U00 Q0000 00/ 0-@L p00T000Z0[ 0-L@T 0 0-L@T000 , 0-L00S Fpd00 , 0-L00S 6pHd00 , 0-L00S &pd00 , 0-L00S pd1@-00 ?^@@ N"0S0(\ 0 @S^ 0S 0 \ 0 ^#  r? ? lR PC,@ 0 0r? ? lR Td  00 0/L 0 00/ 0 000# / 0 0-SL@1/000d0 -@X0L M00SP ~K  o d/v -Lro- -Lo 00 , 0-L00S _odAo// -L KM"vHC K w-LM KD9Pp KQ -LM Q Q a~0  K  KH0 K^ B0($/(/$/ 0Y.<+ < 0/(/$/R/-~x` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@{} P//-~x` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@Px8U5U5E030@3C #@0@#2 0 /R/  BP B0PrA0A/  l: S0@- N S  Ss00  Sw00K P@r0-00 w0-00!=@SV F SW ! Ss00D r0-00w0-000S> ) SS S0s'r-w -  "P> 9: P3 Pt 0 C   0 SC  Sd00  S@ ?00S0- 0 S-00  @x0x00AS00AT 0 C- 0 Cx 0 CS0 SA00za0-00uc00rp00ol00lb00i -LpPPP/ qP*  pp` 0@0pp` QU GtP0=S Q@q@PVʎq0pp0]| 0 $H2 D"P-0L M |Kt N lpK`"@2 H 00S 0:S 42W H0 0:S  XҚ}T00 0R' :R$ 0 Rʨ! t1H 00S 0:S x⮚H 810@0+ Ca]L !T0 010!0 xScL0< T!@0R0 0Y H R :R 0 0CHRl  0'|4% %$$  $## P#D#(#""| h! ׀   @ d Մ 2-Lb M`0 p 0S20P@T "PP@:T60S" 000p200S 0:SG?(KH0000Q1j Ÿ-Z c!P@P-T@" TQ  PPdPi -@ dP 0:S" 100S000(K0Sd100} HH!0 ,10Q 00P10:P Wڰ00 0 000 0 :P z 0Sv < lD 0o4(x  p Ө `@0   x , -L) -LQ* Q Q  0S 0!0 S 00 0 SpPWa@U0 00 h0d d0 P@Ut 00t T00 Ѽ p ш -P @ 0 Y00 SL`p:0CT@! l 0 @S @@1@(pP   H t 0p P-OoLMB@T`p+(P y'PP 0@ @0@` 00 @0@P HK7t@00@0t@p(P*tp'tp((@ tpLD0 0 X (0-   X Q0  Y0 YQ;   Y0 Q -LP```f00@ AT fVa@R !/ -pRLP` @@T T0 !3/pWG / 0-L@P`(T 0K0h/0 -`QLp@P RjP  0㼀pD  $`,@(P 0Rs00 -L MP`p&@P 0U0dV X  WPppL0PP  KP(dd p-L M0@P` 1S ,0S k$0S k pKp0 0-SL@ e0 P @0P '0 0001 1 00e00 s 0 -`0@LP 1S ,0S dk$0S  ]kX0s 0-@Le00C0S0 Pe0F/P --L M  W K -- LM0 0 \| \ #&\ \! R @ T _ T  \ R  R *U   _\ R(K\ \ }\ \ \ @0 >380 ‚ 0PQ  0Q<0  IU   8P80Q0 @00 R0< P\Y t@PR  Ra R  RR  R U R >C Y‚ @  Pl @RA TU \D R*U_ X  \ R Tw 0>#0!> \J\Z \/ \q>C 0 E @CK PO@@P0CK@\ +  ' S  ? K7-0C>C@0 @ 0!P4 > Q, @>C @!>#"R@D 01S200C00># @0 @E ď@@P0 0 0 `00P>300 000Q>30N@Q `P00C00Y   -L%$M `pP4 Vb4%  \ l\t \4Y- P0VNA>\| \ #&\ \! R @ T _ T  \ R  R *U   _\ R(K\ \ }\ \ \ @0 >380 ‚ 0PQ  0Q<0  IU   :7P80Q0 @00 R0< P\Y t@PR  Ra R  RR  R U R >C Y‚ @  Pl @RA TU \D R*U_ X  \ R Tw 0>#0!> \J\Z \/ \q>C 0 E @CK PO@@P0CK@\ +  ' S  ? K7-0C>C@0 @ 0!P4 > Q, @>C @!>#"R@D 01S200C00># @0 @E ď@@P0 0 0 `00P>300 000Q>30N@Q `P00C00Y  {G-RMP 4@ lD`F!8pa>SU6 U 9U mUS UZT 0 SЍUf  U K&U6 UE T 0 U<  SU 0U U. >c U U U  >ccP  > Q Uv` V0 P PPP  >S UP >P>c V   Q0 rT >cRbP c8Ѝ -LDMP P`p00AL )D0 Q0@WL <0 040 0 lSàH  X30 P @ 0080 : T 80000  _T  R@00_T@@T 1V  X 80_ X0 00S RyAoF`FVH0L 00000 D0WPz 0 0p@4@0S7 TS  Tc P` XE  X U1V XA 800000_X0S7  Tan 80000Ua$ T@ Xp 4@p0 ` PUT@Xp T6  TA P0P`0<0!V00P Ua Tu<00 T<0``h <0a,P! 04jP000(K<0``P00<00PP00P`,PaP00P00!q -LM`0pV0 5*0Q>3So S0 Sj S@l S S04  0@ 0P EY4` 0Pp0`T:(K@0>3@1># R@004P  P0@0 00 JU4P0F`>SP1`>SP1>3"SPE P0 Z0P  p`:>S@04  0@t 0Pm EY4`p 0^WP P0  pM` S S Sp`0TK:(KS0>S `R G0/ >S` GR0/ 0 p `SYhG-RM,@0 lD`Fq>SU; U DU UZ UeT !(PS P  ЍUu  U T&UG UM T UE  P S U U U4>p P P PPU "U U >pA P P PPUQ B V  T U  "UP> p P PPQ>S U PUx X}PPY  pP>s Wp >SpPQ> Xp Q \\ }T y>rRP No -L4M40 40(@<0 00 Q@ PY\D0 30 080 0 k40A/ 00@@ @Y Z 8 @30!00000_Z0S` U 8 30 000_PES_o0R0S 1V  Z 0_ Z0 S RAoF`FV!0P<`00 S 0 V2@0YP~ Dp  Pc0 c0@p4 @0 S! UQ  UI p` Z@  Z W'1V  U 8 10 000_UQ UC  Up`% 0V!1``00p HP 4P@0 ``pW@HP00,pa``!@ @04 B@p0(K``0pa,pag0 -LMP0`pU5*01>#Rn R/ Ri R@k R R0 0@ 0 HZ0P 0Pp0PT:(K@>3@1># R@ 0@0 00 IZ 0EP > P >1>3"SH0 0Y0  pP<>R@0 0@r 0k HZ0P0@ @@p 0[WP P00@0 0pKP R R RpP0TI:(KR>3 P G0/ >3 PG20 pPRWe -LMe` ^ 0 @x P E2  R(000 0 S$ l0 0 0S000 0 0 0 h 0|0 h0| S<X# S*pBp @t ` `ZpGP P@ R@ W:0Ppt`|0U 0Plp吀`0 h0d X` T0 |0\P HP P0 P@@  p 8  0 D0 \<@ 4 0 Mi0t  l Fit0A/ 0 0d@@  d0 @paK U" x d=0 000_UQY00_UPPU 1WX  Y 0_ Y0 S RMAGpGWq|0 h 0C?oR20SJd0 `h P ad0p ad@ 0`t ]@P0h d`Sp /h l0P0 Ul0 T  Uj p Y3  Yt X:1W Yc x ;0   _Y RV  Uq 00000 (KS0@@ `d00 0X< R$ X *pC@h l p t` `ZpGP P@ R@  R/Pt`Kh@0S |*0|0 ` ɠ\0 H0  @0 <0 80 40 0x d X` T P  p 00 p0 A? 0 t x 00|0 0 0 0 0h0 l K W @P V{  V U1T V' |00000_V0S!  W A |0 0000_WppW 1T  V |0_ V0 00S RAOD@DTk00S l0 `p0 0xt0X&K`lR0 Wh0 p0@@y V  V  |000_WQ  V00 h` c0|0 - 000 "00  00 p00 p0!T00P UA WUA p ` xpt` 0 @rPUiKd0 00!WXq t@d` 0 pX@pp YJ  YH`00Xq U?e0S-p0A,P+`0,q UR (6x 00S `0! 0 xt0E h0xL0  0S0H0S h@d`Kp@L0 0 0P 0PS2 0Sp0Dpf W 0"R0H0S0 h 0L0S H R9   0 PpL@ E 0T* 0PP pP \pXp  X0XL E B0/ d` 0P@D " Q2A1(A1( X00S 0\0 HPd 0@@t +@l0L0 0S h0s  0S0H0S dPK|`ltpLL 0 P 0@S \d0PD` V 2p`aaS0H0S`0  0L0S H R L  t0Ptp`L D0\ K*0@P C L`P \X X0XL D B0/ dp0P@D"`Q`2A1(A1(X0\ (0\0 HP "@ uT0X|p\00 d0p0 P00 `00 LT0 <@R80h \p0 400 Pd0 W   W h0L0 00 20Sp00PB0H0SX D E0 0/ 0H0SQXL D@0 \0/ _0EPH \00 00 0:PH L 0\0 0P \  00 &P\ ! 00 ~ 0 7L t0/0\0 f!C00 hP0\0 YP00 P-Lh8Md P@<` ( , S 8! S Q  9#apT  ]( 0R1$K    \pK2 w] appp X  bP` 0 \pK2`p4  ,pN(22|28 T -`pLW 1: S\ 0 0S:00S000000]\R*p@BlPP ]P`P PUT 0S00W1 P0 0-SL@ :0S00000 0 Q[Q.Q000 S*R .R 0S00(00000 ]R000VVLp@-\#* 0 @0 0 P  Q00S `C S0 B!!Q00V0S p0S 000000pKUX @-P 0U`r 0s@    B0U 0G0Q  00C 01>3 !/0 0-SL@P*1 2!2#S 0S 004000000 xPP0TP 0-LM0@PS0S* P  QK0 P 0  :-LPM040 0@S00 0 0): q210S3 xP. pxP%0W 0\  1#2\F c00 q0'Bx< r0` 0V 0 [ P&  [ P Z :Qt9  000(K0^S D  ]S -S-00-0-00H)  8 ) @ S* ]P4 R3#-PQ\ -P] [PR:0 S!` 0!*-Q 0    0 S H :R? =R00S:0(S 000 0-S]S0S007000= 0000HSF* V =R 0S00 ` 00]S 0S 00X~:0(S000]S-S0S006000vfp`| [P 0S `V0S000S0000S    000S`0S* @0 SG B 0Cj^0S pc^ 0S0 0 S HS* V :R ]R00  ]R-R 4, 0(  0V0F|CzR  ]R -\ V0S 008000\0<00  -00-00-000 S 2* 0]SQ0'  SJ4p0rc  cc Pp`  B0Cr0D R! 0SJs  ` `   B0S* <00 " 00 00 0C00SQ < p0b r pRWB00  0Rs(KoYD2000(K 000(K0S 001000(K]0]0]00H V0D  ]Ry ` V0` :3`Y0T A/o" R S p   Q P SrY0@000 00 DB"(Ko-]0 0D RN[KH 0 QQQQPPTOO\) 8JJL ! 1 -L MP`@08p(0  00 0S 4040( 0R  K t 0U ,0Kp0*0K0] 0,PK+ K*0Kp  0 =T(8 -pRL@P`P ! Y0pp -PL`@  H0Da R % T P0!@B @@!IE 0` -LMP0@p` S 00$K0SV 1 V00U U0SzvNMLutsrq#mlkjih`Fp0`FPEp  B0  B$Kk-`0 F   B!0SP "0SC  PE O`p 0 B `_0 }  B0S "0S A $Kkp$K`0  000$K  B  A   BC :-LEX0 : 8 0< P0 H p匚0 PSz*|Q Qu $LXP1!/.-+('%$#"!      x^, 00L00 0R-(K0S008000( 0S:U0S00x8000<0S0S 80  EQ*,(H00000 Z8  000  0 (, R*A?QP{Q P?Q:0S00x700000 0 0D @ E 40K010K0X040 @D 0 0S 006000Q:0S006000 D0D Z 0 Q0 S*0)S T ) Z0 ! Q*00)QJ 0PS005000F k 0(0(0 tZ 0 Z00 0S 00d5+Q000 9?Q {Q <%P 0+Q ?Q {Q=0S *,Q 00 S *0}Q0#0}Q R00S 00  0-*Q0 S  B0 S  B0 RPX*A?QP {QQRNHE 0PS 000;P*hß@ H @ Z 0St H3000 0 U < 00Rp 0S8p P 80 E0S0H80 1 "< 0 S]  B 0SO "0SB  0 0 S/  B0 ~ x0  H E*Qo0 S] 0 B U g0 8p P0S 00< 0 B   A   B 0 B  0 B +@0000 E P 0H0000< @ @ R0Q T(8(BB@@@@ ?>>==X=,;888<  S-L⨗4Mǟ < @ 8 0 h Re  `ZD` W:0TwH0 PL7L  Y0p@0 C0 S* R 0P\U )1U L.U [U JU D0D Z 0 a0 S: 0!  Z*0Y30`S00pp$PE_oR YUAD0S 0S005000 00800 0Rn(K{1U~ _UN>E0CSM0J x R 0S00x50000H Y 0*Q= Y\Q `0P\U0@ S000  P)1\Uw0S  < Rh*UP0S4  000P}1U 0Su 0R  B0 S 0 BX  BP`g0S 00V0  & 40K010K0] E4  0 S+*R \R0)S H0) \ Z c0{Sj/0S *,P~ 0PP" Z*0Y\Q~ Y  S\R_ 00Y0S 0042P`000^Q @0 x `@0,( 1P0000\S0)S 0 B G Ox  F `F`=0(0 ( 0 }R Y0S 00Q 0L0000#R ,RLP "R>310>#R R@0P@`RP (pp(p 0>3S S0Q>31S B R R R SRDE LpE" e2(p @081 00 0 @(KR(0DE" L0e2 @0000 0   V(p@` @X J P<@ 0>#R0P00LE" e2 @0P(K -++4 -ML/ K 4-L@!MP4$0K D 0#@ < 8 4 L( .KHh Ph P"THT B~KP pG,TK4 `PPXVP @TTH0S d T( 0R $KT( 00(( V l'D'8 -LGMğM  4 0 `$ 0V@4 000 U F^K; PEC.K EFKApPx4S 0E PT 0 Pl40h;PPtHpP~ Pyp<Tp hPpl3h1K;P p)T h% Xt40 0R(Kxb`x4PSPXUPUPx4$`0S b`/H}"4 P0 C/3}PppT  <PZ0 Z"4$P00 0l!l1 00PLLx444  4!0 4P04$P00 0 0 0t0 |pibxx}( j k _| _p i j j\ j\ j0 j$ i@ i i i i ip ih h h ht h hX h h8 h1 -L0MPK@ `p 0(0 WT+ TW00KpK @Kl@P@0:KY|P:[0 WP/@WPW@/00( 0R KW00K _l( -LIMDM@Ɵ4 ]K0 PE| @T ` 4 x $ 0$  00 dEK A9Xd Td Pd \4 pPK 5G~KCKpG04 F>KI 0C4 504 504 3t4 tPP#  PngW00S+ cW0=S0`S(X  V``V `ሀ\xDNW0#S@ @T Pm40 0R(Kt40Ct4 3W4 P4K}P#$W P@ 4$K4 }P 3 |:{$ N$ N4St40Ct4 f  0p4 pPCnKZ `FH#t4 3SR @LRTD0lT dt 00V 0Pھ0 4CKI@C  Z34[$SX SV dR dR dR  Pfp$[R&M GNK4t4 x4P@V* |1 0 0p4[ S  P t4SP 0p ` }P^ PZ Pz4=V0S 4p`zTt 8( f f f e d d  ( b b b a a a -LdM PKp0@t! P@x0 0 0 D t0Kp Kl ` d \ X T h p xP3t0Q 젟,  MP 0S t 0 `@t允x00 0R(KhI@ 0  @Pc@ ((zI( wD ` ` ` S -LM@@K -L,TM( P@KpP` !0  0 t0Kp Kl @` d \ X T h@ p PtQ @,@L@8Mt@ 0 @t0 0R (KP@ y ( uT R4 -LM@@K ( -L+KM ğ  ̢ p 2 0nK"  2 0" 00 o-0ّP CPX 1[ S S S S t@p#  Sq S  0s000 S S S S a R R1[@+S1 -SnQ[U: @U2S - Q+ 2 $02 0+S_o`R%0S* @Se2"PP ~ PpQ[U @UO2SvQêPȂ 0+S -S1 QPPUwpxA XPq= 0@ S S0 S S C0SR 0 C0SQ  m_oR0S @S2"PP`  R_o`R20 0R(K@QPP2 02 _oR@A   (8 R-LŸMM  " 0P 0 0 9 J K; AC.KAPU9SR NK +K+>볿pS9` ݾ9 9ӾP@ #=K 0C9 rP-8: S1 )@x100᷾Ḿ90 0RJ(K88`P 0 ~@P 100S@ )@000{RP 8S ) S )@000 )@|0008 )@\0000 C@(h Yp ^0 X ] Xx X< X4 X X -LD@K4MP`p S H0K< PH@T@T 0 PPH~ KH@P~ KP = 0-Lh@ Md@ @00"  P& $ (KP P KRK 0RK0( 0-Ld@ M`@ @00"  P& $ (KP P KRK 0RK0( -@`LPp F`R 0  00Ap ^aAPWAAAP7AQ0 S A@P 0 R:0BS0ąp B 0S  0R:0B00 00 -0qL@`pP@?0PX ?XD8  p0\ 0 0 0SETC*410?0T!:*0a `q? ?`p? .R*S$*"" P * U Q0*@0 G! 0R ? S *0:  T!:X00?0Q*00@ S* U  S S  L0-LD@`p@P,00 @p 0-LM0P $@ P@P  -K0H R 0-(ML 0K$ K0 0K, K 00K0(0K6P@0,P0(@$  P@ K0 Q 0-@0ML0K 0$ K0K 0, K 0K0(0K6PK0,P($ P K0Q 0 P! -`L\M DK0 @   h  |!0  p` hPPO Xq@T1p0d0 0 Q@P7 XNP%TKPPP0KT0 X0Kd0`0cP LKXP XP0Sb 0h00 0R(KLK  nP  PI Q 0 0( Pd Tl P` PP PP1 !0-LKM0pL1 000 jLh`7PPN Pa@L1`0H1 0 @P6 MP%OKPN?K<0 =KH0 0PM/K@8 @t81So 0L10 0R(KMK P MP P 0 0D( R N N N0/ 40 0-L MP`Q0 0  0@K pᏋ|0 0" C CW0 0 0R K8 !8`P ( M0 0-FML MmK@p0(0 !!㕺PPBNK@D#+ჺ Pʈ$ =P@ᚺ9P$R@( 0R K(p0 -Ld0dM@K Pp`0(0  {( 0R K(33 H0-L@@PKM @%G 0㙾K0 KPM1SppЍ/0 0p-L$M@PQ0 0  4K!`Kx5 K0R!C0(0 0R Kp8 )8PP\( Jl -LM M( 0 0}K` pG0@00 `P60B Y03;S 0" U ?CK ɹP  U0PUO0yO@ֹuO@(0 0R"(K+hO@ŹdOX@ 0 )GQ0ᴹQNK @DDpF0( 0-ML Kp0 -Ld0dM@K Pp`0(0  +A( 0R K`(80 4 -0LM@P p@K00 000 (  @0\)p*Ed;@`>F pdP&@ @&͌P @Pl! P eQh@$p @p.Mpa%p' p}d,`` `!@ `gqP(`&\` M``,X'`.dTm LP.fappP,]ap&@ . (eq H@!P@ `nD@$'@ ]@@,`@@. eMp,< P P`P%hPP p*dp'8d@<)]p'l @ .4a ,(@L`e͌ @h.`P `!P)8@ .H@\ P%d ` )4lp P%D`&Xp)`` @* @p(_ጀm` @$| )@\P,T@M!|唀 p'fP韠` x < P% ! p'Xx`P P 篠|p 8!&P)TdAL `( x Hp )4`&͌ "Pnp*`P$韠` P% "l p'` P.DL/p' *@@ )H P% )"</Dp@Pm` p'P% (韠| 倐MP% (fa xP P%菠 P 'P |PdA8)@p  ကP& p'P%͈P|np' $p'<4] ()l` ) .8p  p) @ p.@p'4p' 午韠eQᄐ .`,`&)`)p pM h%p'韠ጐ   p'  p'xdAP |`(͌`&)n$)P`p pภ p' 匐 p'] p'xl) `.)@)午`&eQ, @韠op p' ᔐ p'Mh p'ࠐ  !`% !`&!dA (篠 p  Pp'P p' p'͌nᜠ `$|  `& "`p] "l . "ภ!@@  p p'午p'eQ` `,| `&0 "`p)Mh)p %韠x 尐 " dAp* p' ᄐ < ༠?Hx͌n` p'ഠ`P P` )]篠`)pl `p 鏠| 圀 ਠ p'x @p'@| eQ (  ਀) )`pM` p.`  `p'| p'dA -`Ϡ. ༀ` ` )aP )pP `,ͅऐPP .b. P `p "  `xp` )@썈) l@韠ᬐ ᨐp @  `'p @`&-ଐhp%@|P` @p'@ p' P *篠ဠ Pb!@ .` . `p@@`,,`@ P _P MP,i䭊!Ϡ `` P  PdA (` (x 菠 p'p'ᄀ `p' P "pmj(p (  fax |P菠p"   ଐ @ᤀ p'@ p'n"/ p  aQ)M) | ጠ p p p`/ **͌" dA` pꯠx 崐( (mpl *x 0) p ) P1 b:L㌀ . x .fap,_.ଐ|P p'P@@ P%P%|-P%`*ਠ& ! .寠|P M.b!p  p P)ഐd`p(Oᄀ@ P%@p "P%@`.唠 `&@a)},`& *x@P P%@睉P%  gq" (  . .o_P @|P @,P魊iPᨀ ', ".j Ϡ @) p@$( (@-pa *p,M.p'b!p'! 蟠ᨀ ࠐ , 篠P (P(ठ p (x倐dA p'ठ p'p'P") |P͌x n*P$ `& 菠 !`&lP . "@ P%`@P% ,ఐM*oa( ( (p' | _dA  " !͌)*଀n!ࠠ. `&$ . (.ऀ P*l "P% op'P*@0``0 @,0M) Va` (PdAp@@͌ (K#; E'F?N , v4(I20A 0!0#L!/ -p 1`L00>!ґ%0"P0 0% 0?S@@i MB 0iS*0W@@`pG ,Ko8B1 -L 0M0pK` @P 0(0 R0 0R1130 0~? S  0~? S V `F "0 0R1130( 0R K*ޜ( 1 1԰0 0p-L$M@PQ0 0  4K!`Kx5 K0R!C0(0 0R Kp8 )8PPt( 0 -LQMM0 0 0I~K`pG0@00 ~`P60B Y03;S 0" U ?CK eP  U0PUO0I@rI@00 0R"(K+I@aIX@ 0 @Q0PRNK @D᬴pGܠ( 0-ML Kp0 -Ld0lM@K Pp`0(0  <A( 0R Ka(0-3P@E7FA+ 0/N<  8Iv$02 A1 3L00/G-hM( @ 03? Q0 ;<0E`  pP ( (`@%g+ @$hp@pp,p'e J%pD.{P$`P `0P,n$hP(!˂ ``4P`dK `&P ` .L "g{ 8njb*P! P P%lˠ P 0aY  )<")@fk@T與b+dLp)@p )e[8x`  )D $)h\͆dK` )Hg{ `.n`&, `@ P)LjlˠP!$ P% PdaME P(Y &)@@Hb+hTppfkp'dI p%` p' p,e[x )h X\$!dK lPa``  n " ',g{`4b)l P iˠ!a)` PX 0*d[0&0#@b+h@@fk0dL (E %De[PP.苌` pTp p*p p' $pp jdK,pP p8y4 P0 (\ Pl͆. " `! h`D(n``'a, `,`&P )P0g Pp0lˠ附 `!P(0p@ `P `&pp@0P"`@PP%j@P\0@aeZp)b+  p p'*d0@iK p&p<0 j p'` p %p.40pfḱ$pP0p (e[Pp *X0pdK !p舉`0P,  pP*P%pj(0 Pp.lˠ p\ ( p'`n !L0 ha`%pd0@``&pp<0`@"e[ @@$hH0 @p!b+L p p' p*a00 {&j .X0 ` $fk (`0 ʅ'dK 80P.@茂P  *g{T0 \@, . @@$H0 b-L@00i lˠj( % !@ .04@Fc:e[@.p,@ph @z@"@fk@$b+ @P I c;.0 00 0 0 `0#`  P>,d p=FPꚈP8l͆  g{ "` *P< `[ dKl Ln*i , lˠ( ,he[ dppfk p' p4{@@b+@$ @HJh. D ` ) ,i g{, `ȆP PdKP% P0e]` `n`& `@fi  i " Db- lˠ( Lhe[ (` ppfk p' pTy@@b+@$ @@dJh. Hn ` ) \际 g{, X͆P PdKP% PT]`n0 ``& `  fj " S 00 00//L -L4@KMp `PPPW0F>S 0!31 00 0  K>SL 0!31 00 0 @00 @00d/ -p-L M&P@U@0 ` ` DP t0t 08 R;0Kp a 0 ( $ 'x x̸ p\XQ- -Q =QR-@+R +QqoQ uQ gQR   +S -S =S0P00@"     0000000@-I@0P@XS oS9 uS5 gS 0+S -S00PXST 0!0P \PSPQP\     0 Q#  -LLM@P4T <@KLK0 L0 H0 D0 @0 \p T@O`P 600000, %K00`` 0d0 8a0JS ' +Z@ 0 -SiX0=Z0X0 `pP@0X0C S񏐃~}|{zyxwvut%rqponmlji dI`IppX 0 |X 0 {IW R:d0`P0h d0 僑 P h I `  B \0  00 =Zo +0JV?o20S R{*\0XX 0B00` R:d0`P0h d0 僑 yP h I `  B \0T p0 0 tW9X00#=Z00S 0X0 R:d0`@0h d0 僑 QPd h I `  B \0  00a V R*\XX0 0B``Zb ,Z0` PX0=Z0X0 0X0 d0`@0h d0 僑 P- h I `  B d0`P0h d0 僑 P h I `  B q= PK0  P00S@m=0"S1Ds `` =@`0`0 =@`(K>0SV`` -0/+0` @ 0(K`k+\-L p +0B XR R p0+R XR  -Rp    X@0PPQ`}=00y=0`@ 0`` r=`` 00l 0-ML K   v&p` KP -L 0 =o`/00/00/00/ 00// ///00/ // / -L@Ppe++`+V Pe 0  ֧P!@P P`raP T000p@000<P97<P Q B -P@L`rP A00p 80p0 ` @ 200p0 -0LP@`T @T0rS P§KhP0+SKh豧㯧Ǭ l!-L0K $M #, K@( [0P$0 J 0100Sq1럧p@$ P 1 0K$0( 00S.$00Kؼ K  @,0/><@c1h0( 00S dོ$另卦,<0@K,஼$0hd6 $  6(5 -LK$M, 0,K0 4 ! ( 0P$0 A 100S49p P 0$K&0( 00S($00K K:4 0,@㝧;|0( 00S@ dc$53;0@K,T P$0d444t`1 \!0-LMp`0S581PU 0V90S P@T0S7;P00000S `K;0S   :pP 4 PK.Kd\0PUL@40 0 $ld3@3 ¨2 0-L,PKl`KLM D0%0p@ p?p@ (KpA;0S @Wp pP 0   npp pp@ (K[0Pp R@ -LLM#K08 S: 00 S D? %K@00<0 SC; %K@ 0<0 X_X0[ 8 RX Z00#KS0? CKS00  p``P0  L K0 K$K 0b3P0H0 16P0 S(0@ZX X cKPԅK 0 5@U00T0Sp` PXcKcK$K! w3`S0 02<0 @Hd0 @5L0"o @ S`&8@@@ T(KA; %K@0<0 t? %K10<0 m10H0 J0QX0 5QA cKd0  0L 0 |2YcKcK W0@4P \ EK0 o5 Q`0pZX0 @4PS\cK X0S_$KRSKd0 T5KLcK0/800@ <4#W H@ @ @ R@GzG  \ <  > cKW0"P0 pW`#KL 0P p`0 $K0 #Kd0 P$K0L0 100#KP0s #Kd0 $K0L0 @(KxP+5 P#`EL0_ᖘȂeigfF<0 x |@ @ 0 Fae0H0\Ϡ00Dllf`8@@2J QS < G-MP@0*?[Q:^b ` V. V0 V ^( 0U USQЍ^` V V V00@ T@@P U P000p!` 0W``p```]W -0X W`p]00W` 0^ W0Q0#0p`KR 0S0/0 R pP// -LM M BNKp@D`P+0(0 P0@ 03/( 0R K}zX( -L M@`P p``a V00"5SP+ PR 0SQ  0S B0@0000 00P$ T3   P- 0  0  (KP& T 0 0S"I    `V *o`(K0 k8 0 @ -KMXLTb M@`0p0P/00 T* /T0   0@@T/T  U00 0Ri(KQ8/T4U U@/T p=K@ 0C 4 $0P0 0   R  ; 0W/S 4: S+ S 0 00(0 0   (0CNK+ P 0@ (03/P4: SW/03010301:7/ 0@@ oa( -`<L8NM M  4 0P@4 0尠$ p00 7T#*0*U@%@0 R R0$0C?o24 004 RU0 pS400E0"0Sy004 04 4 4  $ 0S`CK+ L/ 0@ 0 3/ 4S 0@ $04 =K 0C4 :/P   0S00* g 0.S Vo 0S0 @YF4Sf 4S 4$6P4: S $P 0I HS/ 3 I1$ 01p 0 PP00K$0 AP4: SP 040 0R(K X:0S0Y0S  0@4 x  2/4S[  0  0.S0S 0. S} V HP 4Ip 00dPi 0 40.Sb q,1W0S? CK+ P? 0S + P@6 4/P 0 4 p 04P04 64 R|  K }60/000 A4x( ; -LƟP@QK AM7<;:585{$0 0K080Sp` 00S 0Si$0"S 0 㚆( VW0(KW 0PQ0E$0 (K>$" 0 J8 ㌎ 0-@PL0 0S @T0*0qT' /S T%*0Q/S"  A0RB" R /P@C@3T@!d@\P; P0008@/S @@@C xo@ D ͐ 00-L@M4 KTK@ L0 PD0 @<0 EKЎp "KQK00 -L`PGp@ Pp! V U uh p` ގێ؎V@Ҏ@ H PP0C- M 00?o?o 0@c\L\= \`@'P@p@`'1?T1 >`l<S0 Ѝp7 h7Ѐ0C7`L pf96 P@P@7:L@011&PP0 0 /0 -L  G-! QMP0 00OoOo @@d\L\< \@!1?@P@0 #T 0ᡑ  l0!YЍ Pj9@DL93X09 h Y:L00 2S2H00P@0 0 /0 -L    k0#D0-0{P @ [D0 0/ AC0  [0#D0k{{@{7P/AC0 -LJ Khn@ lq@ -LJ Kh(@ &q PP -L ` KhΌ"00?0/R//R/?0S/R/P/R/ 0Q-L4M  (002 K0. K@ -L  -LPMPP @T p00K0p0``: @$ Aԍl8l 00 R ⫍k8 -LD" 00 0S Kh?.kD0@-EAEdT2 Cr0b 0lR0cR0L1RCa`P 0DIBIT@D``C00C- M`0F \͌ ̌L@ pXl,`0F0L@ AU YࠃࠓT^ S\!: Ѝ Ѝ R-L Mp0  `B@P ICP @XY  00 @(K(K$1 -L0M@` Pp0S( 2 K@+)K00S  \#3@!!00(2[R@0( 0R$KӭP @ 剭($ ܭK=( -L_DMPP0 @t0\ < EL IrIH @X T0 ` %S& `<` RP 0@S d/8  D ಀ@ 0`00@ `<` 000@X`%0IUS[TYXWVUTSRQPONMLKJIHGFEDCBA@?%5431/.%#P_$#"! O-R> 2*?`<` 0X%S| `(K< 000@X<`m`H0 Rp RH0 ,L0EΠ8 P?3cc0 KdP?BcdT3c0c?o2L\ 4# \H00H0 L0 H0 $L0EAE?3cc K?dP/bC 0C0`< {H00H0 P0L  0080h XX`< iP0 L0  KX`< ]H00H0 L;0 `< OXML f`< P0X0 @X>L 0< ,K n1 !L 80X0C0`< *H00H0 X$H0 0H0 XH0 0H0 ,K c0 ! 80d XQv>C 0C80 `< LKDab080 L 0H00H0 0X0 nc0 8KX0S`< ) L0d8 0?2c##80 L 0P0H 0 H L0 `< n 0 8K80/`< @!b!b0CL 0\ 000C S`<` 0B0/#K000C S 2< 0H$Kȏ ? K< \S00Hȏ0p `0  Qp`Q0 $K#K0$K 0 #K$K0A QpL4K⪪P H0<`0H0 =0 LXd X ]c0PL0 `< RH00H0 < TR <` ^ D  @R D0^0 R# R z IL/o<K"<P7zY!' d D  8  R:Q  `0PL d0S0` 0$(0 d <  MR R  D  @ L X1`0 "h< `L0EΠP?3cc  KdP?BcdT#cb/o"L H0H 2#  A100@80DSd080 ABLB|q QPIJRq` `L <0 (00c$0! L ($0V D  <0P 8 <0 `B.1L0 "v|"D< P L`8 2 0!< 0( 0c$0_ 0 0 0;)d1 -@0L4Mp`P0(0 TK PLL Q Q Q Q0 ( 0R K ,H0 ,H0 ,H0)<(0@P/ P @/ -L`pPV! @0J@S  R DJd0U R  RS0@0D@R B/0S00  Br/\R/ 00R/ -L MpLa`WP@F PA  'pPA 100 4!0 aV0 Y0(K4 00 #KP0 P 0 a0P 0 00 =00 0 0 0&$ -LafM M`?P 0p6 000 R pK 00CSN K Ap? 6: S8@GK @Y>KD 0CD 5 Ǜ_^KOPE5TAXA\A>E CKp   0 U  E E @P P 60 0R(KO00@@00@00%`(T 0-  # --L M   K -- LM0 0 f K R-LMp@` R00?r  00P @ P z00 P ! !  4W\3?OP2 0 K4K VP Y406 V[WP0P`0 ``f`00 0 00k  (K4`P" 0P8C0 PP 00P  (K80 80P V 80P`"$t -@LM# (0S0  0 e0( PP1/ 0`VQp0$  00 0pWoS <0pWo K 0S  0Cpop `00  -@LM (0S< 7 0 e0( PP1/ 0`VQp0/  00 0pWoS <0pWo  P0Q0 K 0S  0CpoT 0   0  0 e2 R0-L0 @T0 E2 R0 00R0 ]P YP U<P QK0h蝅 -L4@`0P@P 0:WKhp 0-L,@,P@P 03WK0hp 0-L4@4P@P$01XP0x@p1!0A-M0 @P00S0p  p XQ0p `S 7( W80C0HS 0 `S0" \0^0#S ЍW   "\ ^ #R.S  0A a 0C ƒ00@ NN!RR 00Rq4  R  *4 8/ 0X\S 040:8 R РS /Bx -Lp`L L0 H@P X  g fᄧ n P-L`@0 A- PLHu@ \ 4$210/)(,+%q`\ h\!# ^ =^w ^  0?Q000 0 00NS00N%\@ 7010pS;^ cTƟ q@dT 1U QQ0^^60A00-Q ^Q00\@A#OoPPB,00%Ao 00&Ao  00=Ao#4 0000NS>0<00C0| ^ ^ 00v 50000 D B 00N70Ns00 00d<000 0  3 <% 0W0Cs0 20M00  00A00  00Ns00W0Cs00 00*T40000   0070Ns0 00Ns0#^PP00 0p0@0;^ 30000 00 C10 0AnS񏐻tZp~}|{zyxbvutsrqponmlkjiNgedD>a`_5]\[ZYXW(UTSO MH00000| 00w 00r 00m 00h 00c 00^00Y00T\00O00I00D0N00>00:0000 00/cT`TdTi00&$0@<00p?dTV q q q q<8 -L,KBPpM<0 0@ 0(10K10K80 `V, @<0 8PJp0S T, 10[0UPE& 10[p08 S8 00(KL 00(K 8;P U @0 G00UPE10[0p10 00  00  B r\ -`rL@pPg /.#C=2"#bbqQWJ 0S$ RQ 100S 1003/P.P!0$`  ?T00Nh100SOX100SD 3/@!W 000( 100pp3/P, WP P$`  00  0S000S00STP0S =|P0P0WPD  000000;;L q:d:$:89$ -`rL@p Pg / "H2#bbqQWJ 0S$ RQ 100S 1003/P.P!0$`  㧥T00Nh100SOX10 0SD 3/@!W 000(f 100pp3/P, WP P$`  00  0S00 0S00STP0S P 0P0WPD  0000009@8l oX88P7X7H -pPL`x X@Pu QPPc  00 Rc</NCC=!T$C4cQAU% X PXT $00X! 0S7  81003/P00  $000  0S 000S0 3/ U 000(PP0003/P 00|000S000S =LP000066@5\5 -pPL`x @Pu QP Pc  00 Rc<O BH TC4cQAU% X FPXT $00X! 0S7  81003/P00  $000  0S 00 0S0 3/ U 000(0PP0003/P 00|00 0S00$0S P 0$00044|3,3xSR -Lp`P5 000S 3/0Y @IOP j T0 0 0 0 Y @IOP W TT0 0 H D0 0p`P2T2 211LSR -Lp`P6 000S 3/00 Y @IP T0 0 0 0  Y @IP TT0 0 H D0 0$ p`P100000$ -PPL@ Q ~PPp`L@?P t~pP`V $0"S P00P -@PML M` Q08  QL /QH P.00F kPP:#=Kp0Cx 8 /Q0 Qo  0/SS.Q3 0E000C ShH/0 I0@ 00s~p 8* R( 9R0/Q0Si/QP @@P00``(K IR .QRV  u/R @Wp88傮K J#@|0P0 8 8 Q,0  8/Q0#8 PVP/0000(KrV?00/00P00 `P h Zb>00^00Z?00V00R`00 -@P,QLP6 a`00jP9 0  0\0 @:\0 S \S 0@ S @ 0:S@ 0L0P < 0  0 ,++@-:S 0S0\\ :R0S0@S@0\\:R\@S :RS:S 00/ A0@-@\  \:^|^00^^ R B|\ :\\0  -LMǟ M` d P$ H4 0X 0 \4 !R000 { R `G@PU 0PT4 3  PP P40S 'C~K h$ T$ HPd0 003 @0S` @ R V1 :RF \R` R R`` ` \+*S P+H{PP@0 @ RV+Y, P` #RR X L4 gL4PQ P:RY P\ : H L4 PL$L4P `E`Ph$O0 00 PP4:{0PH4 0T4 T4@S HF{TY@ P0H4 P$0SP$ m0L4 i400SL4 W 4h 0X4 0L4 = X`PJ 0:RB 0R0CK`K @ H4P$P pP p:00j0L4 L 80:R@ @ R@tD`FpGJ00S:S:00p0IGX$ E @ 8P* hT4SDd$ U E0A01:`4\40 L0R(Kh$0IPE0`FJ iP? 0P` h N@ J@0L4 @ mP` PP;f IP 0L4 0 00Hz T4S $ 00T4`ShLd HwzhT4S Hoz8Hkz0L4 @X4C^K}KPE@4 o < `0 6/p P0L4 03/0L4 8`V 44@ 0C<4 0L4 00oJ p PP 03/0L4  00^n 03/Pd4p0F?o2L4 `4PJ0L4 @^@A()x _@ 0-ML  0K0 K 0-L8@@ P 0 00 0   0!! 3-LcM M`D x#0lC 8 @8 @000 Q 0S  A.KC(t!D!8!! LX  I 0-L@PK0h -LP= @P dPd :p`\S0 @  R 0:SSd ^S0S:S^  R0@0AdjPa d 0S:SK 0C|^6BC2\ ojfla\ihgfedcPa`_H]B[ZYXWVUTSRQPOJFLA<IHGFEDC0A@?(="000Cs^:00Ns^@1RA0@A0 P@ 0 @0{ 0 @0w 0 @0s 0 @0o` @lp @i0 @0e0 @b @@ @ 00 -LP= `P. dP, `Fpd 0:SS  R0@Add P pRA@ApPp@D@ @ 00 0-L@# P 0R  0XS <, 00BaPBs QU70BABW0BQ^00H3 -L<ß0BMM 0@ `84 R000 Z /< PPi rP@T p  w> 00CS!8G & /0:Sp0@4 B   00840 0R~(K  D4 -wD4 (w #w0:Sp# @4S 0S 00UP R0P  R!, 0PDpP6 CK@T 0S:S04$10<$ D$   R ;CKH H4, K <$/04J%D$,0K0 $Co010@0M@ P vl0CKP@t 0p R:RW G07,00( e NX N< M / Lp 0 00 $ -0-L M0  P@^00 0 00^100 M^  @ 0S0,00 v 0RK0P($8 0-L$@M@x0 K`| KT -LŸ`4M pP 0000 Ix20YD $ H0K0<@KxL0KϿ KKDK MPH YL0 P0 @PP0 IT 0H L0 IP0 P0 PG  X100s W$RF 100S @0 0RR(K X0sH P 010P0 *P9 5SX"VW00#  @ P0PT0  0ST0@T Q"@3: , @wp0'&  ` 00 ޛ0S"@@@ *4(lv, Ҥ Ip H H ;- M(@L0@@09PKL 0- P{k{ {G[ F  :0/0/=A 0-z zPk[k'kFK E{{:0/0/ =A 0- {Pk{ {G[ F  :0/0/ =A@0-{ kP[k'kFK E{{:0/0/=A0Q -L4M@ ,K 0( 0#, 0 $  T D KP@D 000# 0K wK 0-L M K,K, (0 $0 0 tP K 0-L M K,K, (0 $0 0 tP K 0-L KM0 "0 0 t K u v0u -L`PV p P@PV \P/ -LsM @`p|K@ g?K@ 1 0 OQa a }oKTA0XA\A0L 0   @0 0R(Kx(P 0-   -LtϟpM 3 P 000 p3 r000  1S01,? @̓ 03 ? Г 03 p`W P0#%Wȃ   % 0S0 R 30 0R(K P0 P @0C 0 S303 `P0zS~E5~}|{zx(omh dcaPH 0@0P0B0@ PN 303 3` 03 0SE3  `FV񏐧|G Pv0 *P 0@0C0S0003!HK0C S 0!,+`0 # #C C }+@MQ)')3#Sp0`3  WK303 9`03 ?K3 0 3SoPWWp303 303 3#S 0`3 A3S s `pGP W`0C @3#S 0p3 3S3`ps  ,K003SS 00C 0X00 0S P W pQG 3c 03 003@03 &  #S|@ 00C0S,000`V3 C CS XR    0#c#0#         3# # #0C#@ # T}# HT }H@ @pxT|@  } 0,K03SSZ p0 Q0C R S [P W3S303 `n3`<3 03 g3`03 b303 1#00C3 `W 0`3 S303903 0`3 G3;3 303;03 3# # j# 0# @d#@`#Z#+Y X3`93 03 3 `# <03 3:3 y03 X3:3 r3`93 03 3;3 g0,^Spp0PP3 ?K3 3SPG= #%c # ` $  C @  # , K BCPD T-Rh ]R R 00 0 P @0C 0 S P ` P : P C 3Cc 0F S*?K3 pᮻ # R003 c0 FS S  3 3 C  B@R + D  `@F B RV 1*@NT R0T ITR @ B RQ *@s`W30S 30S0WWp0CS@0 s V:SC 3`FSs5*V V003Xw 33p3 K 30 \000S 3#0CS3s 03 @X( C C ? ? =Xph4 + * PbW`*`@ XR sWN OP3p3 P3T 0ES3S 8P 0p@0C`S00 3 3 pes0S񏐦{'P<p+0D P  @ B R X*@p P 0`@0C0S] N0ASO0@0C0S0 3 A dPW *`@(T90@0C0ST # , OP,V**@0NS%0p@0C0S0 `3 PS3S& <PA 0p@0C`S0303  0 @0C0S0RZ*@03 3Sp`D3S 0`@F0C0SV0*@biT nTN sW^ sPY 0 @0C0S0R'*`@s p ]P`0p3  @AQ;R_*@` @ B RX *@60p@0C0SW 2*@` `@F B R?V z*@sS`pCS3` 03 40K3 崹?K3 003 0p3 W+3p`c 0 PX0#0C 03 00 0S _P 3 s 3 `CA QP=0 P73` S0 B 00- R0`@0C0S'0V *@03 K3S00Ck S@0G0X *p@`W PV*0p@  P30A0U@ PV*p@)Tn0@0C0S6Q0*@`pAQ0cK30 C S 03 88@03 3`F#S 0# @ R*V ]P7 ,0KP 0A2L 0K&p P p 3`FS303  P XCS 3S[W P 3SM 0@00*Q0S K3KC S03 903 03 `p"0S7U9 P 0, KOK` A0L1 0̸p P ʸp Ÿ,0K3PS 3PES303 3`03 1P VCSsW 3S0303 I 0C3 3ic 0#Y0P #@3  # W2s # #PGRE*0 @ P V*@Z PW*0@`0p3 % 0#7 {PU 0, K`/KA# 0L 3c Ap< P p0S-cuS@00X K*@` ᫿PV* @R ᢿPX* @ ᙿP(X&* p@ # 县#P!R*`@ I_0T0P0S[0p@0C0Ss  LV]S30 l K30 d _P<V:*s@  TPQ*@j#p]W  sP pPHP@@ T Pt:P p2P3# 303 0eCS ƷP{3W@0Cs 3  N PV*0 p# @!Cl # #P:R8*3`3 @ CSs PW*0 # @C`Ss ׾PuXs*0p`@ ̾PeXc*0`@ ¾PV*@CSc ` CSc 尾`@  30C3 #S  C # SxV_ 3`v p3SVVS0C C[ `v `3SSꓬC` SSc `V0CS`s PCSc `KC` SFC`Ss ACSc `CSc `/-0`fpv -L@P`pr0 ePs 0-  p 2 0-LP@8 "00S7 J0`v 1S010h C00uP P! pW@0PA s`PT 0 0 @0 C PC000#0$0P 00 P*0QS) 0< @8  BPWP00`0s0 KP ;0?B0A@ #A  P 0-L@P sP00-00P1 0/ `-L@pPt0t 0pఀ T  ဤ@0 t$ ᓏ  ' Y0j -L41P0\*PL1S L10S@ P1@@@0@|1 X1 ;a`% 0  R  0  R d1~s#dA L 20`1 +T\LA1!XSRP!001PlTPo@Th\1@v/0PP1 0|1 g @M@ 00@0 0 }t0p p0 uܧ\0X X0 l(    l P P  <        Q-L@Pp` P V V }P0 $Kk?= D!0D/o"]S00S (0T"@=0 !1 p @ -L@RMpP`0 J0  K 0-Lt Mp @ KP  KK0K0@  0P @RK0R( 0-L| Mx $ @P K$K00 K K@ Kx 0P @RK0,( -LM K00,  K -LM K K,  K -LM@K0,0  @?K 0-LMPK@ K, P@.K0 0-LMPK@  K, P@K0 0-Lx Mt @ KP  KX K0K0@  0P @RK0跦8( 0-L M| $ @P Kd$K00  K K@ K 0P @RK0菦(  0-LM K  .  K t -LM K .  K K 4 0-L M  K  -LMK0@0 .0 @K  0-LMPK,@.  PK@wK0 \ 0-LMPK@(.  PK@cK0  -L➮@P P`P`m pf0S@ -L MP`0@E S a K$pK 'H A0S(   0-PPL0P Q 0S @@կ0SЯK0hg -LpW P@PET `@P`` -L M`p0 V @PIV @ P00ST*A0Q0`F0`1(K (K 0 偯`0  0-L MK( ,K,0 $0 e K 9-L,KZK SP$p B - `P"!L"""$"(@)P@ -LM@50SXP 0KU. 0* KSPK"00 eP0: S& S 0  S00KeP 0$0  0K0K`pepP$` 0p\0`.S0dH0 L0SL0S #PQ$VW00]0S \040.S0 -L`pP ⻬@P \0 00X0`ⱬ@P \0X0 0 0P `$050%@ -PRLM`p K&ep@ Kcp Kep@ *KRS+KRS H@00UBPc>P Kd@ -L`P1 ,  0.S P 0H0P Z8 PD,P L R@QU < R$  %  W  0 p400 0 `P4X0S,0 08 XST00CT0 0T 0`0S# P0XSL ,0R0 S 3@80%P ,0 p%<,0`0 <0 \ `0 @0 tXpP0S0p5PP<Q,9 \  R4Q\ 0 T H0 H0 ,H0 M<H0Q @PR A< H0 L0  %H0PB R ,8 T  X 8 J[Q\   %k0S> 0. SE:P0Si p(K&`W PϬU4p5 `,0%<,0(K(0SX (Ko00 00`ᰬ H00CP<0 P00\0 k 4 @8 0P@0 0`0  55050@0 0S  \R   B  0S0  R   B   R 0L \R054p0$0S3c0$0 =0 -L MPp0y@Pm P(X,P ` P UP1RP Up+ ``Pdt0, PY P0L0U 0` ``PU# 0P;  ,PP8 ,0\L0 IP05YV0P 00`0P PPUX00Y0S3p!, P , 0` 59 X (K.00V P֫U ҫЫ@ͫ(KP`UP1X   0, `iP@00X@ap,00,0 0,QP `   $ 980 -SLP %#L R@@T@L 0RyP @tTP nl,@ @f(a0bp`  aW@aOT @@ -L@T ,,5S| S%* Rt ` 1L0Su 5S@TP`U`!L0s ,0 PL0S,@@ $0@S005` 0BSR@' d!VW" 5P PU05 ,P,0 }`p( 505PU\  R 00 /0\@,  @ ^0  oPS,@@caP[00\@ ,0V/P TT `cp G0p@$ !PS ,P[ 05 ,`ဪPVPPP,0 d @5 ,0(@aP\(`MK,0@H 1@807P? ,0<,0B(`P]0S0 @8%PPk P5U0 5$ b 0   0SZ`P ,0 _p(" 505@kPP|0x x0 _ 0%$0YP(_UP,0<,0O 0%$0p 6, 2 30 x h R %-0L:0  -LL`P@p,@,0<!% R@ RP @̩T V,0``<,0L0S00/S ,0@ @@h E_pp@ R`PO_@@ G_ 1L0 | 0-LP@0S0`0( 0S (Zu(Xu({yKh&_(Nud P-LBM R   hh ANKX  P P^c  h( \ t 0- L -LŸPM Mp` @ q( O TH " KⰒ H"  @` ટ0 ( 0R$K}BNK@DH" 0ᓟp m^0 B>K.0C!0 ( $  100A@  08 08P Q AA+Q-<+*)>'&%$#"4    p Q\ e     \D Qo(, l D l X0 * -L-PpiMt i`@90S00  P P   P000 0xP K -R񏐿chgfedQA00 x  R/ 0R00  00B Sp 0  #.Q00Nژ,"Q0Bpxp  0B ^X  @@ @ @ pEW pRy0 00S xP Zx&K&K@K;B(K00 x0 p xPx +^. -^pp  x 0pN WxP p0^xp@pxp 0^ @ 1pNWx0pN@x@ 娀 0N@ X@  !x 0pN W0pA夀 @ @夀H@WTӠ@pTpg0R00 00 q0XSI xSG x 0R R00 c0 :Qg{RG ࠱ࠣ R{ Qʈ\&KZxQ!"z00  R  XX@p RR pXQx )  @@ @ 0pN W2x@W㈀p @  ^@@   @ R^ T  TR Ӟ|,Мpx XDRfk[kk ڀ@BTڄ^w T \a@ {k{'{ 2 EP⸀ 5 Ƞ R0bOۋ 00 <?O0 0?G0 ?0 0 @ ἠG0 0 gB^@  .B  ՜ Ŕ 0`W`QQ0C`FpGQcSrʈ0SVW@Pl tmPg 0 ` 0O0S P -{% )K )KJ{%kk+Z l00jS k&0B0 lK{'{V  l ??GR { 7 tHFD BPP*    !XK`K ĬPt  Ԫ@P ` QX00C00 AR AppQ6`n  vXK0p0t0Kp KXKxKL 60@ SZ&KP< 0 p0^ @ x @0^ @ 1 NR pp @?A, D( d X XIN%^ ~ h^H\ʄ0{S0pG{0qk{'{ M\, \2P{@`@kP{'\U{ lAG5Nl {Gk{&[T{ ` \G\5fl` Gl h ^ x@K=P x00(SK 0 ?Gh l0 x@K$,P 8x00Cx0 #Px00x0 0 ?Gh l0 0 Nx    @@ @ C#30 5@P tөP t0St t孪Pt Ƞ0S??Gl0 0h0 0S t `"00&KPP ViᅪPPdP  ᤧ VVl /C0pW jWZQ {Ǜɛ:S䛟 IVI{;R;R k AlK;B{{ { l00SZi{V{G9h0SQQ{ǛZZtȠ墨ᠨឨ在 ᚨX{@ 7 J0 /C)K-㸐 @ Px꭛Vl I{;R;R 0sȠ0?Gl0 0h0 n l@ X[k{{ L° \( \ @{k@{'T{ \ l^kl\ \x4\@ Lh@ @7Ơl {@{r0 &Kl {@ 7@   40hS 0?G0jS#:k0c3QX??GRq" 0?G0h 6l0 0 -lP`poK 0 0 4o@1P1 -@D0L,MP0`S/ P P@ P qp 8K p, @K` <0K\ P 00CS  0?G1: Klpp@0< @0 S0;0"0 0 K0?Go  h 0 0 mԜ0Q/0S/S/0@-PP0@ S 0\\0 00@on -p BLW"R$M H L Hz P@<P-T`Q +TP@00T~ Ws /0K  0K0 "`#Kp #K8<@8  3P OCK0@q ^a@QW@A@Q7@V\$KCKTUQP 0 #K0P@L0 L\P#KQ 0s Z EH H(KZ \ Z00 H0 00(K0  p$K 0 #K00XS00 C R A BRWt0 (KWk0"$Kp0 #Kq"@P0$Kp0 #Kf  0 0 0*i' -p BLW"R$M4 4 P@gP-T`e +TP@00T W X0/$K$K$KK0 0P #KUHTU QP?$K`CK 3PS OCK00@00 0Dq PaDQWDADQ57DW2v X$KCKS!TU QP$K`CK 3P OCKP@`"0!#K`"0!#KZ0P#K VE4 4(KZ00( 40 00(K p 0 $KXt $K$K Kir00XS00 C R @ 0P$Kp0 (K A BRWH0 p$K0//0K 0 0 0e -L`@PUT0p  R *ᕟP@ pP xT@p@!@ppl@ -LHML@K`pP$  0P KRP 0PP  gK 1-#MaLM`p0P000 g@PN L1 `0 S [ P(/ k뎮K J VP%  P P$PvPP0 0R%(K P 8 P PP0SP 妟@㣟P(yk(土Pꎕ(dd P -L``@P#Up@  PP `-U`P -LMK@Vp 0: S   Up  `0K0 K0K -L$M$@P`< 0 4@ G?o8 2@ P R$140t e0D0 P@ Tp* @PHᆞPPy p0 <00 Up@D P  TP*[0S4080SQ4000 p. 0A 8` `pPVO* RL0   R Ѐ@J  P 1W0P 7MPp8`P00PEP00@4 `$ @(K0@ 5P V 0 40040 0!^T<CTp`00 p(KP@ @0 8`00 1PU 40 p080 0S P U  P0   0S80S0   Pq00 pl0 D00SD0 1a 0-PL U P @PT0 00  \  /G 010/  C. *   /G R-L(M@Pp` t8K ,@  @PKD0KP P@ 0D $K L 0?G0 5CS@/0c#:S 0CS0c 03@/'R@/ Q-L M`P0 04 p U4051@c2*  6/P   ^ U :000S00 40(K R-LDM@h 00 iQ/ h`00L0 lP P` j T0pP\p TP h0`@D 0P@P 0`@ T 00 6/P00X40 *D 0I 8@ X0 D0@P`U@<` H P` `4p0@` U  8/PQ @Y @  z / KlP @cb 唀&c\A:>SnePm1:odrfWgWn1#f>RbnQm1R0:~nnPma:_dbefVPna#em1nn!^PP`` N8*K?  B!c!b N BPBuPP\@ P܋KVP gP 0  0 l0 0 | P{ _0q0 0 0 | ?j|0l 0  ^|00 SR  X1hU0S0P 0 R J XF|00SB  X1=0S08 0 R 2 X.UP$UP 0 0 0 |  X$?00 X @?00 X\?00 Xx?000L@s?P ܋KB!c T0 00   HKoH0[S0GK0 R X@e b`LH`K1 0  uo XH0[S0 0 R Xo#kP |ꡉ  HKXo -LXKTPM p@ @.`p0 \W@@K38 p-LMKP`@@,0` CV@@Kp -p`@M\L@P`r_k8 0 `@f_$K2h< -p@M|L@P`Q_jT,K 0`,PU``@>_(K1< 0P-LP DQ4E  ॉ1L, @ 0-L@@0`R`00@-0 T@P0P0Q 0@0@ T D0008 xH0-00S x0 \0\ @0 00m.!D900 H( 0 0-LYL_{c NsH`@O ⧁W?@D8c`0 P@R  D0 0< 0 Y@@ THX 0-LL@P@ P^0S 0000P$ K0hC^\0 -L`q Pp @0^ @DR000C C1100XcX1 0`   t ^?XX!0T p000 0 0h1000CC1100XX0 0p  0 0 0 p000@0 00| ?0 p< 0H@ ] X,Tx8 -gFfFFLP4  ``F@g] AR@H000C C1100T$ T0P ࠠ0 P |0 Qx0 Pq]g&f&F 2pgqpŇ,` ^]4 h 0-L$@@ @M]PI]0T -P L܏P# `pU`X P0`e%0Jh@X  0PAA]0pGOZ_>]00wX`TAXA\A <-00/00 @0 0.00D000' 0-L0@@৻0@P00S@0 -L@`P@_}P(p0@aaZO\0XPO\(0TTaXa\a,(0(  0_Y0($0 00-L00S P\P0SZ 0CX@s R`\0@T P LP@\(8@1 !0-LMP@Qp`000 O VE V8 0)  `00S K0K   MG`P$0K AG`P 8G0S`V/0KT  K8GP`.000 0R$(K ` 0 , KⴀK‐ᐐ"Gp`  0 @`[~0 0 0KFP%'X( --LM  K -Lp`ᐆL0L 0H@P lW    Kh|)%$ y4 @-/ 0SAS/0-O$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/Pp@- P^ 0S^ `@S 0TT0`0`pPPpp Q-LM@04 0! 0pPᄠ0 4`  0 U X00 0 &kP`@D:4 00(K(K 8 -LtMp #NKp`P <0 YIP   Z  P0 0R:(K0@0S+ S 3NK 0 jp0S  p0%  03NKh 0 j 00S3NKP 00S "|( H -LtğPPpIM 4Mp@ 0``000 0S SJK  `0 0R(KJK RJK#  QVJK A C 0J-K BK0,J0&J-K<0J B08 0dJ=KJ K 0C@I-K08 B%P w0Pe  J=K 0CJ=KJ0C" 0 ?j _0PQ  0S= S0SG0S  0S0/S S0S 00 0WX` 0`J=K0C0; 0`TJ-K2 0P( ZK 0PE< VHPW P `0"R   #<J=K 0CM`QS, S\y 0 00`@JK*KA, B 1ʠ BJK0  I=KI-K8 B(0C DP P`" 00SJ=K0C0L2S` S S ` 0Y0 0 P`0  GP ` ( q ( t Q-LPß ML P@`p 00(0 00CS6G B 1( 0R$KQ0XS00 RZ0SW`"0 =iU00Q0XS00RU iU 1i # 0 00  m0XS 0K!0 i 10S8:  p!0 hU%0S20S E0! hU0S* SQ@ 0S)0  hVUy00u0 }o E hUQb0 j\ 0  hn8(  t   -LPIM p ` 0@000  p P 0SV  8PW0 0R9(KV 0@SWMK0 3KKp4K 0  N?K0O?KP81Z< RY  R @1 实@1P 0ꌂ( -` @PLp0  0P9 0-LM@KPP#P 00S R Q R @PPK0@PP@@ 0-PL`pp@@c00. SAA0Cq .S .R Q P-S /S /Q P_S 0p@-S J RM @\@E ^> S R 00eS:@PT8 0SL D`D V> U 1R* @@@0T&\\!^\ʔ 0 0 R0L?o20S 0Rp0SR pR ^ pU R$ D0DPS 0SU R D0DPS U RT 0S DPD@US0S@-$MdaP P` 0S  R 00 0S PU0000$Ѝ lqhA  R 00 0-SLP0@ T  0@[0 @K0hB p-L M0PS @K``$ 0`Z$@0S 0S 0SKp `3-LhKTST`FMKPDMPXKHL8PE0@ ß @D@HK<@DhK@ (KKL BPL0`F000 (Kp1@ BP0$1KDA00K08A@ 0PU8K 80C0s K1@A#l 01n8K<0C 0Ƞ` PPP  P8K80C H008K80C 8K0P0C00Q`(K 8 P0 8KD0C008    P0! R 8KH0C00(KH B0Z}8KH0C0S8KL0C0S S S H0 00(K0L B08KT0CdH0C oH0 0jH0 0eH8KL0C 00NL y( -L `AM p 0P0(0 V@ @P'0B^K PE ` e 0( 0R$K 4RP @@ .RBK @ P"$0K@dDH 0  ( b,P 80 0P  R00/00 -L0S S R 00 0S 0S0S0S R 0'0/ 0S S S S S00 00S0 S000S00 p-PQLM@`  R R Kp RRR Kp00 B00PPV0S S  0` Kp  Q Q @, K P 00 Y rX \ 0-@LP0|1 x!0-L$M`@0Q00 @ Q2LK 0 P% D[P,0 #KKK ~ (P/00T/ q x 0-L@PP @ވU0 0-@L P 0 @t@0@0 -L@`pPP  00 0 00  k -L,Ÿ`("LM pP@ 0h l @D@ 0 P@Th00 0Rj(Kz@P P @K P& @@0K p0  Ap0P RQ@ PD : 0 @P/0' 00S q0Sp0 0 SR sPD  0p @P 0 00Sl@P =@@l@P~X( n -LϟM    烯K2 OK" 08 _K00   2XS` Y 0S0S ` pP "0020 0R(KK0 hb0?K2 V0h2  0 `P0nB `@Ȓ Ģ B Xx @HXR`Bp2 PĢS `-p2"0?P 0"S@! %0P2  9}P ) 2C"0P TP"PU B/K؂ 0В ܢ ?K``PU 0S RL  R RR 10 0) R;,"R8 R5"h0 =Pu<2  PPchP` P] l/  @P  2P  `Ģ2S l2`{Љ@9ഢWr r02 9崂 02 T ?K 0d 1 0D2 0 08 h2S5d"0R . RS+`Q $ QP@,B R  Rd2 Q2 Q` `P`w 2 R 0S" @TprȒWĢ Y 0  0@P0" @PTU 20w0S]`402 B0P2 w, K?K@p@ hB,2 qP,Ppr0S 2S ` 2 "00@X `ĢВ؂ܢĢ` R P 2KP 02c/ &2 M@P- * ('&`,Pi g``,BT0S 2 2 Pm@T 0S00S,2"0C*  R`V` @P  `Pv @@ 2ܹP@,rHpX H HH#2W @B :P؃@PIIV2" AL0B `4R @0Rp帢 2 " 弢^ @T9 pD (D^|puKp 0r $2 0 2 %0"借 2 _$ "(;P":P:B Rx3̂0ย"'.K0堀0 0Q   pr00D, K2 l";2PpD2 2 |z0T S S \0S0#pp0S}\p(2pSUK.>"QK ;PD1x00x02@D`Ģ啄 0dX 0 `P 0^ 0S  0H?oR20P00S0Sl2  Kp`x ,K0 P  0B R R   B br/Kn@1lP@@0SBRj7z Dr0#^0p^{`u.)pt( $ gM$ d d Y -LlPKqTM@1p0|0  |Px 0x0  ៹PL 0  RS R R R0 T@P0LK`L` p0K L KP0p0  xYP(Kp`V`V 000 ]`Vp0S 0PP0ST Cl Cd -LdM`pK@ P0 lPK @0pp0P tKxK V 0P P0S004 (Kx^P0xztK9xK 0P P xhppLKpHp LKx:0P0 P0 0 00SVA 0 [ [< -LŸpK (AMM K $A0 S 0 P K*K A, BlK KA\"0J KH"A * = `P@ 0#S2 =K0C宸P, =KP0CP᥸P# @P 0S   @]P* T 0S S S@ ሸUP0P\P 0DDr_P0@=K0 $0C00R:(K=K@(0C=K 0C0$CK N(0N$ N$@P=K 0C0(@T =K(0C`@T 000 <P =K 0C0(=K 0C0(@x ( ? Z< ? G Y 0-LDK,M p`@H0 t$PKp _$% (P @0S @HP (0S0 K E W| -LK&M,LM$\ &KL(@NKN̟ KKP@PPf=K0C00 s ` PZPPV $ y&=K`Pc0C00 =K (0C03/PV =K 0C0`PU@@Y@Tj X@1*&00&K d1 *V800\1S/  P X0 P@P4A Q@0SV X0  P ~~4`10 0R(K0l1 80h1 0< @Tp h1 .T0@T R@R.@DOoBSb d!"S:0  sP<T0t1 0  DD@Q0p1 h1 &dATQ 0 N DD@Q0t1 0\1 ] 0p1 h1 0 KP0=SA <0S S" S \1SI t1s]h1S^p1S- ~~l100Sp10p1 0  Qh10h1 <.K PLd!% 0 0 PD^<00Z< 00\ M~S<00V0p t1 h 0 P)ʭ0 P"=<00t1 rt1s 4<t100<00t ( -LMPp`U@ 80 SZ yPP K00 K00 00000 0 |0 x0 t0 p0 l0 0S4 S S5 u;00;0S% S S ` K0 0d K`0 d0 \0 X0 T0 P0 L0 PH  d1iLH0S 0(K0` 0 0 0 ` ` 0 |0 x0  bpP Kd1dK8 0 0 ̐ 01 K 0 Ki?0 0  S* +KP# 0 `pP K 0  ! 3P0Sl}X 0d1 h0SE  D 8 -LŸPM ` p 0@000 ' ,p! RP PW  PQ P Qp0 0R{(K0@SW 0@S0@2 Sp@ #.K1D"  /K0KYD2 /K @"?KD P@"40SD 82Z@2 0 SH2  @2H2P@"0DZ: 0S ppZ: H"  0 @ Z R  QpTH"ᵎP@D2@" 5 ~r ( -` @PLp0 1 0P<A0 R0@0#40@00@00@/0G-PM@`0P 000pQ@Q Q84V0<0 x4 j7Mp.P0 p@,0p'pV7 8Nب |0@0@$P@,0 4BdJ00 (P`'> 1L臄0` 0`& P`$?|5Ofe0p!$P0(*& 'D 0@0# &0(@V0XJc:P  "@! ,u F}O'p@`P$FP0`@#eU @p$4@pg"DkH|`0@!8`@0%)F<`dJOA0 #'7 \9H"!꧄0 P) 0$@P+Fci 0pP#!P 0*-OyfJDP0Lp 0# H@0P)`c: P!h %iD P!`p' P<`%bU `VOP(feP"@s @pL!ppQ^B 0&00#W 0YNP] ;p!$P /&M) 8PSdDb@i` P# P`P%PLp塨MeV ){0wN 0#  0-p0%p 0 0#B`40k "W!7SL PPaդO0&00#0pc6  !`t`&ZuD 0`靃p #D`  "JPpc [  )lO  " b)`0%` ٢)oFp*H gv0"PP%@P 0'BY0_O0#0$`;P`! `0P`&v `qwHp fipP#0#" 0<Fc6P%P`& Oe^ `&`0#pD*j$J0# 0 P% c8{DP%p Pp`&`TO`&`0#8fnp 0#࿞K0 P%:DpP%.P(B eX `&w`&zN `pp0#d0#0M(c>P%P%@P `&Z4p`&9 `)M @fh 0#y 0#vN 0ppP%4LP%PAe^`&e`&ତL` 0#jp0#D0)O /c8*#DP%P%  9 $O`!s P${Je] `p@ "p @`Ùb+[F@ @$0@` H H!8` }T_OP0`0#p 0P-%Hc= `P`&0@`OL娯Ffk PFP%,NOP @X(@0`& @ D@J ࡁD% @0~SwOpP%<@ 5b:mKR `@jZBP  @!0 p pa4p0C *KN @0pꨁ` P "  %0@ 0#p0g} "0` fk p' PX0`&P@PE@PЍ#; E'F?N , v4(I20A 000/ -1`p L0a@@f "W.P0 : `ft  DW?0W@@pG ,Ko_0 -L0M(PK@ p` 0 0  h!7R8 bx b   0RX Kh|lo 8( 6" - LM08 0 ` 4K1K pB 0S P 0 XR0PP  U( 5,00Ls@TS T00@ P 0G0S S( S! QU, *  0aA B ‚8 CR800 0R(K\*30[4 [8<\*40[̌\20[3[4 [48<n.S\ W*0`  ʀ( -LMKnP K\1 X!0-L,M`P@0T00  pXo TP8 ?o2T0S E0 0R0(K PK @1, K0@X$S  $ CY ,0K 1$ S0 P, K!0$ R0 0S zn (( 2 2x -L rM @`PptK|@ 0e/Kx@ ! (0 4DOaD1/"D! TAXA\AvP    0 {K Ypp 1@wP ( 0R $KP :x00p 00)n ƨ( 0-   x -- LM0 0 K -,-L$ M0 0  K  p-L$M`ž@| P@t4  ,` $ P ( 0,K00 8 0@X@8KV` V Kp ļ hL r -LQϠ\ Kh4mD1 -L80M` p!0(0 .pP @K   L.p Z-@( 0R' KQ-KP@X @@T PU 0SP@5T0@00qm ( 0 0-PL@ P0 000jw(0Pgw(P,Pcw 0h0PP 0P 00 00,,SP 0P0 0 - T - 0 0-L@  ~ 0 00 00 0  0 0 0-LM 0@P 0w 00P 0 c3?o02cK0& 00 0 0-@PL U 0 0-@LPv0PPv0P(v(P,P0 -p0L`P] vPW 0 @ S S0 S S e0PF  @% @Yp> HSP# @PPC 0S@ 00T# 0S S S@ 0AS A2 PP@  00uP ` uP `@w@  +  -LM p@,0(Sd: ( TN0T0J 00SF 0Q@@D@T`; 00S700@D0P@D P& T5 00T&:`010 I0@`P" 00S0AS00quP  0(0tPS@N@$KA00$K( RuP ( (,@ ᥹( 0-LM 0@P   p P K00 0 $$ 0K KP K0Bp 0$0 $HK0 -L\UTMP`K@P0` @@ PDPtP@ @0@ P5PPPY * 0` QR Q, 0S*QQ   @Q A`@0S:0S bs0P\0  V\h `0 @ d0 0X0  R  R RX0S R 00I @T: h .u\  0JR5`0 (K  X  0 LKX0 띀d H D θp   0@` d0 øW G4 `ම @T:\`0@@t(KH D    S QAR{  R p l@ @0p P AWO WE Wc p WS T' QW> W4 Wp`` 㮿 p`^ \LQ  QA@p \ ^ Q\,  ` `3 `  , ` R4  l@ 0 P @T:)`p Vt-@f &+8+'Q -L Mp``H NPZ<rP 0$ :Z2/9p@p7( $p.Z3#W, ,0-0(PP ` P 0 v0 QBPP"!V00PPU03S PU:UYIW(KW ,W1!030#-05-0%:00s@(K1@00(K0WK #((R 8` `4`F2`F1`FS0@`F@PV4E 0F : s0;0(K0Y' #((R 8P P4PE2PE1PES 0 PE @`ὯU0 0E 8 s090 :04  800 @য4 @00:`08P !p -LM(p@$ Ks*p1 dK1 S0$0 @.P(u 0 0@P  K@ K$* K@(끾00@( / 0-L \',\@ \  Q:^: A 0Ͽ|q<Ͽ1M00H00 -@LM$P\R 80K( `4 480r:0垒dKNrD $pL :3D;1`@3:16"-`c2*aVb80 4 0 # V 00`809 v @L4c06na0(K0?s0Ͽq|03?1<Ͽ 0 0 0-SL@ 3/K0h)A-y7~I^ Q@P+ @P @D T<Ͽ8 p `6o`FLPV% L B, B PE&"PEL"V%L B, B PE""PELQ%L Bu, B'"T {Ÿ @D 1<Ͽ0$ pPPEGPEV%L B, B E BL &"A@!@ B BA!" A@%! @'  Q@P(` @D T >8 p>NLPV%L B, B PE&"PEL"V%L B, B PE""PELQ%L Bu, B'"T  T T , ($ 10PpTT. T* T, 1pPTT @D 1PT T T T Pxd@D 10 Ppm|xt\XT   P  6 -`LP㫯00s !R !PE U5  ᰭG0 P02PU pWU@@JyPp X 00僯  N pGp 0 0u 螼0 @0 0je$1 !0-L@P 0  0 0 0@ d .S 0  0P0 : SC`ٸ@ P pd0q`00 @  00C 000 B@@  4G-0`$M00 |^ @0 I.. @  @|p\ @ pV P|@T @ `p0I$P @ ` ` P@ |\ p. ppP p `0 IP''  .Y` ಐ@ P@`V` P `@` EI2Y 񏐏{#~}{zyxwvutsrqpodmlkjihgf[dcba_^]<lN.O~'`2Y PENMLKJIHG(EDCB#@?>3<;:9876543210%.-,+*)('%$#" @@ @ Ѝ<N.O~' ⊐ಐ 0 @d P`G  0J ,ಐ  P `9 P`30 @P `, x -LM@P, ,L$  lr2EAEX0a0Vf!ld Q Tm`B@d@K   -LPAM M@PBnK `Fp 0( ,P,4[S ( 0R K.zMe (0, -LM`@ `P,pPP 0S 40000K00S.SKG| -Ll`hAM B^K PE@0 pP h 0RKe T( -PL@`Q @Q IPV 00V00 -LM@`p/PU 0V0 R PU_L0P`0 HW00KW 00K  p-L M@P`0S 0U0S @0SOL0@P0 V00Kp@V00Kp ` -@`LM KQT:8K, (0@0@K  Q 0 0{0 0v  x0 -0LM@ KiQT:<K0 @$0@0K  -LIMşMT  l 0 P4 @@Q0@TX$ 00 qT5l0PL4 e 0 0p (EmK`F@`D CNK @DHD 4$0?h4 0 `/d$ \ 0 PhP400W0S T40  \4 dSh4` ^JX2D4[S @@D@H4?@H4?Pl0  GJp0SLmP 4l0PL4  0 X40 0R(KXH4C40)S( lC0L$ @  P L  ݸ0S ٸn JX40 0RL(Ko$H4 < ?0@rR( IT" x$ "|  t pp p刄 d t 匔 p IpGpGW>40@ $PRT$ U x I`  I V 0 |t1l$ 000 .V 0 tba 0 `ZU` 0 Rtd刄匔@P4SWT40 ~  z 0 ;0`D 0  nIV 0 D)0l$ 000 .QV'ml OILb (28 d pA T 0(   8    9|   X 0  -L\@KlMp `{x PLK0 0 LPK 6  ,[`!5[` R[Ẅ[d [h   ğ l0 A l0 00H`!R   ;`!Rp0 㡦  P  P  P  P  P  P  P  P`!RWYYR ĒP_ `0 kH d0  bH h0  YH D0 OH`!R   ~0 ` 0 `|@0 `v0 `p&K0h 00 (K ?  Y tQ lP_ X`0 l8  H(K (K 0 (0 ๥t0 ಥb0 ૥O0 थ<0 )| 0d0  h X   <     lL 0-LM@z Ta TR !T^ 2Ta QTPK0TI T= /TU lQTP 3^\1P@0(  T0  TE (Q TP @T T) Q TP T+ PTP P TP PTP P TP PPPPPPPPPPPP|PPtPPlPPdPP\PPTPPxHtT8T 0-LMP O@PK0 0( P0K00 0A |x M-L@MPPpK `@0P 0 .0 a$T @D 7000 0R K$0. 0H` (t -LM`@8 4 8PK0 4KLtp@ L0KH0 4Q}Py RP00v80-P 8 0+P 8 0# D  p080  S0 B,,d .PV 8 00@0v p@@Ty'00@^  8 R0#03@\PP  8 R0#300#3T ?*8 'Ġ*,( * ( (0','8p  0R (K 0 8   8  p0N 8 000CQ80D  @  T  R 080 @  S # 2RP T=S; 080 @T2#80D @TQ 080 @S#2Q\ TS 080 @T@ @ ^ [Y Q -LtM0 S 0& @S @  D gO" < ^mnb`As Dv,!%IS0N0&S`0 HHH2 t4P ?\`lTZPP 4P<`@((HQacH sB ED00 cmb`A TȟvL0 W0E0$\0 51E&s<R!5I80 2@80b rS<0"8 b pFT /c8 X 40 <0c80 d0㓇g ^@^`D^XX@K V M T0O < ` \04HT8400 , L0P (p$b-X hV ~hT zh (K耆 㘀@H00<0 cꈠS (J x  0  0(K@V 0 T 0 00 |PԘ@, 0-L@P00D .R S0*SQA@0T.S 00 -LM@p@ 00 OK@ 0v.  00 $ ,K0 -0L MP@( K(0`S`p Tw(00 K P| 0000 0 ,Kp)0S, W0#03 R0S0(0  rt T -P@L M( K(0`S`p Tw(00 K P| 0000 ,Kp0S, W0#03 R0S0(0  qX \ -P BLU"RM` 0 8 4 0p] p@ᰭP-T 6 +T@00T] UU < $`㻯< p"9, @00Ds Qa0DSW0DA0DS70DUR V:  S  R 0@80 80RQ40 Sl 0J00 400  (KS R f4 0R000  (K i PiApXQ 0A P A@P UUp Pb@ Ppb 0 0 0[ XX -@L`00C0S vP0 ` SvP UCP00C0Sp 0/ Sp RC 0-LM@( f00 (0K 0 $  崤00s !R ! KPᰤK0 -@L`ᛤ00C0S vP0 `㘤 SvP UwCP 0-L00 R( @ R S 0S00020H04S0P}0S R0 @ R0 ~H -LLPH` p@ p0 Kh[ }P 0 0 X | -L`M Pp 00p@ 0 00   3@$K # | -L|PxM p` 00_p@ 0 p 00ż@$K # |0 00/ {0 00/ {`0 0灵 {< -LX MT P`@ p0!p 0 X K { 0 0 z -L|PxM p` 00p@ 0 p 00᭽@$K a# z| -LPM `p 00p@ 0 `00  @$K 9# y -L,M( 00   K yHT0 P 00-L@0pP K0hh#0 y (- 4  0 x0 -L `P@R U 0P R.R  R@ \R0Q 0 R@ R@DDT@ -L M@`Pp 07"PH0S0 R=.000  0 0C 0(KP0 S#@000 0 W R .R  ^ ^  \.R 곯00 -P0L@`S 00C0 蔯00 -LM@@`8 P4 P+Y4*00T/:Z- 0@< 000 00 T- p0@0 P  P0 PQ00800400(K <0 P H(K<ްh`ݤR -LP0AS0@A@Dx`p`A0 p@DP t8 0cP0p -LMMK M @DK `-KMK@D,JMK@D4 BD MK0@D-K B H p0K0P0 00   P= 0S@P =KK$0C<A-KP, B 00K B8A th P-K0 B0 H@P=KK0CA +K,HH; BH0 H; P=Pd 0=K-K<0C8 B0 PPp=K<0C =K 0C =K80C0EPaW h-W 3WM2W*/W :0W 1W=KD V%U%E0C2?B0 S=K-K<0C8 B 0 P8H =K 0C0@3P-Y 0S .S 0S 0S00S.S =K-K<0C8 B8 0 {PP=K <0C00=K80C0-K B0P0a=K0 0C00R (KW *W Wt W- WZ0DS =Kh+0 0C-K 0< B0-K$ B=K,0C0-K8 B=K40C0%W _!WC #Wh0DS =K*0 0CQ 0: d 0=K-K<0C8 B0 P=KDK0Sgl:KAd*0`z 0-K BKAp0P8*#4 -K B0=K0`C=K 0CV0PPV0=K0C "80"<0=K0C0C @D;  @ 'Uʭ=K-K@I<0C8 B0 P\V9ʭ=K-K<0C K8 B@ 0PL=K80C 00&PB9V00#$ #(#< 0!ڮK8L-K BD  @0B 0.0 .0 0Uʭ=K-K<0C8 BA0 ~P=KDk0PD[ U:W ;7WD+0D; 0`D; @: :J!pD 3D 0-K BS0l=K-K<0C8 B0 LPW KW=K-K<0C8 BKD 0 WPKD;8' 0A WgW*W W W.=K K$0C@K0A@C=K<0CP=K80C P` 0`pP0 PKPA` 0 PT0 P=KD 00CS & =KK$0C<A-K, B 00K B8A Pl)W! &W40DS[=K%0 0C W* ! W0DSP=Kl%0 0CWMKD @D ͧ=K-K<0C8 B0 P8 W W=KK$0C KA@0@C=K<0CP=K80C P` 0`p%P0 ~PP 0` P Wy0DS =K0$0 0C>Wm=K-K<0C8 BK K0A@0 0 -K$ B  BP-KD; PBQUڭ-Ks8 B@p`@T D;1 V2 0d =K<0C 0(P0D S=K #0 0CD @D D D+2D 0@(  K$@@=K-K<0C8 B0 P=KD V%U%E0C2?B0 SR=K-K<0C8 B<0 P@x0D S=K"0 0CW0D S=K!0 0C+W:0W+WD 0SM =K!0 0CcW=KAP=K<0C@`=K80CpD D; D P:U0 P5WK=K-K<0C@8 B0 D P& D; 0D a=K0C00#$ #(#< 0=K0C0CS s@(dې, t< Xx X߬ݨhHܜܘXH Tؘ (<| h Ѐ|4 DpWe=K-K<0C8 B@K KA@ 0@P-K$ BP  BP0 PD D D;D D HKD |0 ;$HKD;0D; YW> WX KD;x! 0A0D S1=K!0 0CMKD  @D=K-K<0C8 B0 P1i0SD;P R}QGN RE4Bd 0@00=K-K<0C8 B`P0 PDD 0d D {0 P3D 0d D j0 P"D;D 0SS'Q]>  R-K 0BT# O R =K-K<0C8 BK K0A@0 0 -K$ B  BPD =K0SCV%U%E2?B0 SU=K-K<0C8 B 0 EP 0H+HKZ 0D+@0CHK  0D =K-K<0C8 B0 'P 0H+sHK< 0D+@0CHK  0D =K-K<0C8 BK K0A@0 0 -K$ B  BP=KD0QV*P  0 KD; 0@D+ 00KAS0, P0S" K @@pPa0W4  0d  =K-K<0C8 B0 P\D+@T=KP0C0S=K0C0=KD 0Q:=Kd 0C0060 =K-K<0C8 B0 P2'W=K-K<0C8 B00 0 -KK$ B KA@  B$P=K-K<0C8 B`K KA@ 0`p-K$ Bp  B Px0 fPD D;G0D; @d 0. 0 QPD D;0D; z0d  0 >PD PD D @D D Dd8d P@0D  0 Dd 80 =K-K<0C8 B`0  PD;d HD @0 0 PD D iD0d D  0 P{D+0D; @T" YPD;@T0D; & d 0 0 P^$W0D S =K*0 0C=K-K<0C8 B0 0 PF3W =K-K<0C8 Bd 0 P8D;@DK PUB zjp` 0E!S|+J= :! 0 # +J  +J "  " +J   # +J R! +J J! 0;J=K-K<0C8 B0 ]PDK@DK =K0S-K; B00 0D; K0AD+ `0V+ P0S$ K @@【Pq0Y4 =K0Cd 0 =K-K<0C8 B0 !PD+@TPV=K@DK 0T:o+J=0,10 30;J000;J020 20;J0JJ0J00;J+J=0=C<-10 30;J000;J0 200;Jt+J>J = !  +JCCCf0W SIMd 0@00 =K-K<0C8 BP`0 PHD 0d D  0 P7-KD;p0D; S*N@D;0D; S*d 0b 0 P+J=K-K<0C8 B0 ,J J   .Œ J Ì J\ J Œ J JPPDKPU@DK D?d D 0 =K-K<0C8 BP`0 2P=KK K$0CA@0P`@C 0p P 0 PꫝK I @PTTh m`=KP<0Cp=K80CD00Q 0P0PT0 P=d @0 =K-K<0C8 B0 PnV \@D;P@D;V0D;  d 0 =K-K<0C8 B0 PN+DTP4-K⫝KD  I :B .P@VPD  g`=KP<0Cp=K80CD00Q 0{P0PT,ᔠ0 oP 0H+HKᅠD; d @HK @7N 0DK - -K8 B=KP<0C0 KP-KĖ Bv-K B D;`-K< Bp0@D; -K RK AD+P V  K 0@ !P `0d @ 0 P`F@P=K0C0D;{D5 D 0D+ d =K-K<0C8 B0 P-K⫝KD  I :B |@PD TCT. e`=KP80CpD=K0Q<0C 00P_0PT =K <0C0PP-PD D (@D D #D@MK @D\4P2 D 0x=K-K<0C8 BP`0 P*-KK$ B KPA`@ 0 B$PD=K-K<0C8 B0 D uP WD =K0S =K-K<0C8 BK0 PKD;4# 0A1 @D D D@MK @D22 D 0=K-K<0C8 B`P0 :PK0 D OPD =K-K<0C8 BlB`P@D 0 PK0 D 4PD =K-K<0C8 BP@D 0 PK0 D PD =K-K<0C8 B@P0D  P-KK$ B K@AP@ 0 B{P8p=K-K<0C8 BP`0 PbMK=K @D0CD 0 \P{KD;  0A0 PH-K 0B  0H+HKĞ˘@ɴh ŤČ8(@X< 0`$| x4d(pXD(P`( \HX=K-K<0C8 B`pD0 D @SP0d @0"0 @DP`0 P80 4PD \QD0P D @%P HPH0  `AH P0  PD D0 D @P HPH0  `AH cPt0 PwD WRD0P D @Ph HPbH0  `AH 9PU0 PMD -D0 D @P@ H@P: 0H @ H P,`0 P$0 PKD;# 0AU=K $0 0CO 0H+D44d D 0@=K-K<0C8 B0 _PD Tڭ=K-K<0C8 B0 OP-K 0B$ !0 @PD;DpD{ @0 3P-KK$ B KPA`@ 0 BPD{=K0S=K-K<0C8 B0 PnTkڭ=K-K<0C8 B0 P_KD;% 0AꫝK I @PD;tTTL vp=K`80CP=K0V<0C 00Pq0P0`FT\=K <0C0Pa=K-K<0C8 B0 PUf`+T ڭ=K-K<0C8 B0 PC7d 0}=K-K<0C8 B0  P0=K-K<0C8 Bp0 P$g`=K-K<0C8 B0 Pg`qTڭ=K-K<0C8 B0 mP=K-K<0C8 B0 `P4xpnK=K-K0C8 B=K<0C` 0LPTڭ=K-K<0C8 B0 =P=K-K<0C8 B0 0Ph` -L$M^P`A D  D4pD0@Ĝ`P pP KlM0- 4 103Ѝ/ x -PSL`p@ W@0 V :@@PU P@(00V@D : 0-`VLPA3: @0T40, p0  40@T"TT0T400S0 XT 0$,(  P@@A0( 0Q -L MP@`p$0S 1$ ( 0,0v(`Vs0So(0S$P!,  0(, S=400EPe, 0,0\Y U$  ,  $ ,, QG: , 0 400, Q::($ "0R*P$PU0 " K0F +P(,  (`, (0 $0TQTPP(0$PQ 0(  ,  K0 K讟 0 ꩟( 0 0Q -L MP@p`y$0S 1$ ( 0,0w(pWl0Sh(0S$P!,  0(, W7<0<00P\,0, RP0U,001, * 0QD: , Q!,0::( 10,(0 S)P$PU0 " K0G P',  (p, (0 0 QRQQP(0$PQ 0(  ,  K0 K 0 ( 0 0QC-W`S@Ap &a0 <$Œ'?pF$@`PP SA @pP0 <&a%Œ'?p0:PQ `P`Q Q@P 0,Q :Z@DP R6㗟KR1ᛓ QZP@Dh2h 呖Y h @DW P `|0W~ QyP U@D ``Od2 0 00(K`(K0 S S0 S S l.P 00  0C?o2P@ x2 ޗx2P p"`" WF*@pSnXn 0Sk @x |R p`pBtRpPp 00W P P Pp P( X:( N H @P( 0 0 ` p60l ` 5O(K`( Np2 0p2 Py pG` px2ppB ` x|R``Ox` hsxs81 -L,0P$LM `0Qp(0 , X@K.0 P' W Ԁ0`0 嶕0\K 0`0K00 ]PP `N 0 ( 0R K\8PP `@`NTD !(ww@ -L`M`Pp@T) W ``0,0 n(0K 0,0K00PP ,N 0 KX`` ,K@,NT KOP @v<H 0-P@ 0L`0 S0 E0cP00 00cER P00 Q-LOM 0SwH0CS0H1 p 00 pB0Y P1 H! fP1P@00նH pG H1 H 媔`WQ:  ᝑ0H! `Ha C 0S@ 0S= RKO8  :P1 嶇P1P S  :S.S 00,""40S0Q.S:S+ H1  @A <1 8! 4 h0 0( 0 `0 K_P@[00X00@00Q<.K ƥPP\wC ( T p -LUM<˟ M,5 @ (;`H% ^4E 0<5 0 P00 D  ^ ^ 0 <50 0R(K:0(5 (K0P85  0` @U VS#p0  00 PP0 (53/P P@V:,%0B?o2h5 R0@5 SH5X5 =K8 0Cp5 4 0P0L5  B4 0`5 9\% 0l5 =K0Cx5 9 0t5 9T% 0d5 0 P pWL:P%TP#P2UF 5  Lr PP0 (53/P @ V: $  P @0 TuU@%R $5S% ,%$5R PC'SUPPPX,$0 $!05X%d00%MpW*L% RL 85dT5 h5R00Sj450S, 0  450S 85PU u@C @0G@S?:4e 8yLT5\ C  0GS ,:)D 0 XU' 5 C@R00T0S  P585 8ULD 0 60(5 5PX5 P4% P# P@P>HA&5P   L PP0  PTL5S `58%P50Ra*85U0P85 ՒPPU L50L5 P,5$% SR;C>K 0C $5 400 0PR  I T$屒5 % BRPPXPU$5 H5 ,5 S S S 45%PP450% 0S$5S L5S5i 0% 0 Q}p5T0Q*0Pk5TU 05 $05 05P@C>K 0C $5 400 0P  05 $(53/05P T-`58%P50R855*U 8% P<0S;$05 05 4 %05 BRPPXPU+$咎54% 0cX%%lPxL]4%$5 0$50 z54%@E 0U45P,0P5 P=K 0D 4%%5Pt NL3|K\ pG `GP@\i l1h!0S  q0tp1 S  Rr0U000^0S V^PT^e L5Sb\% @GPa0 sQSpp"P^J45 0SQQK % A4ZKPU(7J`5 0`5 0P 8%P5  B0K 0x D4S@4S<$?R 0 PU(J`5 0`5 Pn 85P 0C085 0 @ (D -LM0@S`04 S/0 0pIPP2 P; ( 0P ӢP,  0 `mJV 00S S  K0 0pHPP 0  KNJɕHJ2 -0CMLMp` 0 S8 00 + SCNK|@D4 PK0C<4 !0 %pH@PE XPP@ (< 0@ P> <$ 0 0PaIX6 @0 @C\0Ⴭ  R     @T&h 0 1 0  I 0  I! 0   00S S? ( -LM`p@P0P0 0  ` 0p P(K` 0 p PP -LMPp`ὔ@P 0 `00  PŔ K 0P0 RQp-L$M``@ P00S: 0S 0S0/S7 S 0S2 1,K0 ( 00 0 ,@ $ P P@00KpR R O@/ 0 0Kp0S0@0  0S 8@ 0 0Kp0 8 q -LLM@ğ`PX 4p \0 0T 0P0 000 (?GPP 0 H0 P M~@P @0K L0  00P0ë RR RRd0 @0` S Sh 0 S S 4'~P 0  R `H@ @ @ P~P @T R R R@  U:(G PT PE`PH@\0hd S  H E\ X0CBH  !S<:C Q7 LP 0P0JL0 L0 S%:  @CY 0\ ` T0 HH @Dԋ0H PR  ЎX`pHHU 0 T 0P00 0R4(KL  P3V P& 0 0` H0 bH0`>`XH 0H  pGT 0000p00``P ` `=  (VUXU p-LM@P`00, 0 0PiKpZ Z0 -L M@$9   KYY 0-LM@P, 90$0  0 K0YxY0 00-LM@PU x 0 @00 000oT 9 PK0ᩨPU^00 YYt!t A-M 0  ` p @P 0S!  . 0 C R+0 0 C.S#U 0 Ѝ R0 XR  9S  S @ PE U R8Q< 4 2 -LŸ04MP` @000 2 P%P@pK0@0 :U00 0H h2 Lp 0P0 0\p  pP`H 0 KT X YM ᯀP0 pW /000  0Rr(KZ@H0 0H  H P勀PP0:YFW T0SH0L P0T P:U`H00S L X R:L*$pL HP Y\p0PK L0U:*$ L0 T0S$ L R 0BSL0T sS e 0.Y`\pL00PKYPL ʅL0S3< l(z -L,M`p @8PK0l  ( !P * G( 0R Ka@00< (x P-Lß|M| )K 000 000 PK  0@B,0K1T0, K\ N"T p  q R 0S q w00\0S  pR qp w00 X0S X00pp $2`K✀ 2K0 0 @T\ ` VN*WT:00V PI1 2!UA@T W00S 00SW@:00Tw㜀0 pW S$*: 0 S* 0C \:@ ᐈ0ꯐ0/ 00 0R1(K 0Ꝑ 0 w0  `0S S 0Sl ?R0 Iᜀ P 0d0S ; (v -L⤕M,K @P00SN )(XV U| U U U00`#(K0 p`0S 0( >$ X( ;0a`P),KP8/ 0PQ  00P @ P D00  0 0 0(K貳p pKP0 0* RD ;0L UX,K-KZm  0 8/ 0PQ 00pQo\ <pWoX0 0 P8/ 0PpQ`0 1 0 0 pWoR <pWo,KQ0 ,K0P]0Sli,KS0S0 p`\Kpp`Pd%K K K 0S  0Cp`0\K 0<p8o0@0 0W -K K mKW0j*6DL0mK0cpo0 8/ 0PQ' 00  P @ P D00 0`S0 00 KP0S : 0C0```张0A0 0W -Kp`_mK K p`Q00\C0I00 @0\ C 000  `ہ`0 $xS -L,M < \0P L #` p<`D0 L0 D 00K8p H0 WPPU8B0P 8 p@0 @@0 8 T^ X H0<00PT 0P@@V@TU 0ED   R% DQ DRO 80Y5* 0 LR0.  PZ CYR Z PCOoU0P B@S00 Q%  ED Q" P@ @@ T @pZ  R0@<@0P0S8  (KSy P0L\  @ R:P\9 S00 8 P@kL0SW |P 0S  DPL@S%S$ 0 0S00噉8 <80 B80p(K @P rL ^ 0 0S S S S P 0@000SV S 0-@0LP0FGzp 00A00@@@ э0TS @0ʍ -L M@P0.S00K -L0K M@#p@K R .S.S Q0B Q-R/S  .R0 .Q AAQ0B Q//0*S0.S S /0S ! C]R.S  .SQ \S  0 "!C]Q//]R0S! C//0 0 / 0 00/ |( // / , 8  0/0 R @R /AS0S01!// 5-L1EM40 \4P0, 8 ,LDP 0 @0 Q `V 80P P*@.00P0U@V P ē\`  p0"C!C:QD9B7@?>32;:98-6543210/.-,+ )('&$#"!  U3`0@^4]Z0 Ud0aਁp `8h0q@0D00xD00DU 0@80PjD0P.03052d:d0( (KAQc R< 0 0cRC1  R  00Ud1`< 0R'D 0S pP@TP P H90 @U:X @9pPp0PSP @TP@ 0U:X )9@0@00s@Q|0K0p@@& KP K<0 0n `PF ʌa!`l`_ ^ ^  0-PL M@0 P XK0H  VP K0K0_P -L M PRP H10D0SD 0q@,,p( $1 000 #).0@S+0a0000S 000000 |000 00`0 } (Ko7(00CsCD$D CCHC<? -L`p`0S @P0S0P @aP0S  g0@ 0@ #P] \ -LlM`|0 ?oQt 20R#x 0S @c300 0SSP0S00 "t ,K|ß 00  }P W @00@0 P83 pp 00 $300 VA2 Q/ p Q* P0S@ x l 3/0 10p0PUp@RP00Sap" 00C0T@(K,K 0@ +P 0S 0 PKtP |L P 0 S<A@@@` n10\T `0QD 0 R? 0Sl!,0Kh <#0@0d RP] <@@Jh0(Sd @ d 0@@=h0Sd @ d 03@Tp p1S MP3 0@0C0 ,0K <#0@0d ", K<" d0  \d[ Z[[\ YZ XYYp Xl X@ X( WX| WxG-oEAE?dTc l\a 0Sn t:Sf : :B ` X@ҞS?_0cgFfFFceaEv0IIƢce0CJT d? `DAcP0@0pCq`F^PHN`nZBPB^ ` A\&@0AT ڎnNS^0U@0 @㔌(00@<,0CL0 X  Cc>dT 0S :S 00@0@;S0C  0@0C<<4%!E0-PR 2A#a@0/Q-`00S! S0P0 / 0Q W0 0R 0/0 0S 0 0S0 0S0 0S00C0 -LM0 0K   @0  PU0@0 HR?0౓2c2<#bQ (! BS  Rs0SH/ ౓"b"<2cQ0 10CR00S[* *BS*JCAQ2P2@BnP"A bP 10C^00SD@T B/pb 0\Ad@ 1 0CQZ-J10Ck'S&^v @edaEn~A\00V/ LKRb@n5e#bU2bRm ^ QmQ0 T(K @ dVeaEPIp `? ccd0hh>``@N TR0X?o20C#1SZ @ VvA A ;Yx0刀KPApaĠK 0 ̀ TU} U0:P,K`p 0@PϠ0  c0aY0lK  U0LK 0 ,K0  ,KSೱTU5 PU@LKzd@Q̀1 T10@T+1Q00S% ,K,`KA)f8P\PK 0 ?OTd1DQ0077hP 0-L 0L \ࠓ @0L \.^,0T 0^0"0 0 p-L M0@-S` +S` PK0 P& >00:S V00c0Kp;0 P <0 " :R P 0 00 0-L0@JS MS 00C S  m1 P 0/S& <000 m1  ~  0 wP 0.S0 mP 0.S0 cK0h S-L$Mp`H cK X RJAAWcKTU0L0 K RK2;0h0  CS000L0 1 0@KyUGQEp`cK ??G0C S00SK ZJu?ƂC#c@TJu2A#a@cK[?H @y0W/#K#KS03?d"cBbR3c.CcS'Kn1 Q0'n1 K`cyp1 RSQ#KS0T1dY00S ~0T (KKm1 Q0p1K0@ P9yKH\p`W010@ pPE`WU1dEd 4n14b#bAaBbQRnm10PZT@Dm1/K\xmL0 0$KK0 L0 0$KE,ß@mEd cK ?bcFfV3cCcS U?o21`0TPER@ BX [Um1 Un1[UTcKs0{DA$I"IPT2vD L#K?4  B1c1cAfJ%!E2#K2A4 @#a0w?CII0C0/@!b!b S0 B > x> x`p <0x<0 xxL X0 0=%!Ed2a@`P7#a>BdT6  000S PE0  0S0PH  P$ 8!d?OR0@/\0 SPpP`S <40(0Q*(''' 0-Mp@L@0P0;P U0S VP.1 Q0!Y$K0pYs? `W~wX51@p`p`KdK! p.`"'.p` 0Y #K:[bhv0  ~0P 8 F^PRl&"V, h @(@ Q A  b (K 0(K 08 4K.0Pn AY pQ`Q@TUp]{T 0 Xp` `Y =>h>L -L M@P`@p50S@0 * K -LŸ@PM H2  0D 0P2 000 0S0 0ş{#KLH2 DL T  1[0Pd QhXu \#>K 0C  P0Sbڗ^00P` S,KP\b@,K!@U^N >Kh0CX2  @2 <" <2@"SB @2lpr@2 0S pXb  o0 B0C 0<2S 0PR R /o" @ L H2D_01[ Q K '{T20?K P200\ (K{T0 {0 % 8( -LP 0SSBh6p`P0VlV@T0^g4 h6"woR -LM@P `0d0 t P00pW <W 00G S+pGW 0S0 C+C RQ 0@h0 h R 00l0  S ,0R0R0;R00Sd0>C`0 X?o20S;R,R R0d Sp0 x J:l.0p=W0t  p0t 02\ ^tp0| 0p t0 `0တ x`l2 Fn`p 0b @`V` p``h&^00cp0 t0S `တ|9` xf b`x&h l&|p&t&u&&&+l VS 0S>S>S@V9d hʅp b@@h& lvpvtvuvxv|vvvv{ `Ar p(KdKP ` V0 >SS 0S>S>S0@h0 T0K|0 P 0,S@0K0 P 0Sd {O bt h&, Kx ʅx`E| ~Ol6'p6`t6u666p  f|& x;0#a0 x P@ pVp` p0@`C  d t0l`.@aaPQ0@xP t@ P@p0%p!E> p0 =` 1@㐠 0 <㔐 1@@ 0 ?` 'X0 lt0%K  l0P  V 剑0 t0%K U0P .V p @@@t xCPAp0pt S<d| ` `0@032ad scS0#(KQ0V JD Q@ `KP:0hhb@K`0GS000Ŝ@KX` g>f΂06@Pt p0 Yl -LTM@H@4 +PM T000M 0:S0@/SW  t320@P`?@5$ʟP p 420@G.g0P T  S/R .R0S/SPPP& +P@ P@-(KUx@(K(YPMx@PH2 0@h p0 00 L0 ,0d0  0$4 4\0 1\0 0$4 4`0 1`0 0$4! 4 D0 1D0 "0$#4% 4$P0 1P0 &0$'4) 4(H0 1H0 *0$+d44T0 1T0 D01SHPT7PQ1\\0PS` PRppL@,0D0P  5#XP 0x` 1#@@0 0Sw00Q =l `0t` <0 X j pP$!,4 Y@ W00R 00G1!S@pQ0Y0000`<0V 0HplW4P^t0` W*@\ S00x0T@ 00Fh ^0T\ -  ^0^P ^44 ^$0^! S0@p 0$4Cw@PlH0ST0S d00T V<g0 P T0h&0D0S00K phL0 Pp `T 0#KL0S pP$!,4 X@ 0 0 $4ČQ0X0#K:^@0Q U0P 0B S 0\D0p/SX0K`P 0 ITH@0PD0T0" \0t"P R p 0T00H F<`u0P R ^ 0Q0S @ 0NL Bp0@ L Vh0S 40@ 0R00S 0 S H0S; YF:}00 ]N1JpP ` PQ V PQ W4Y:00 00>S   Q R0*@;0 "l R 0Hl" R 0S0Cs"  RT$`Y@0B RlH Rl ֜@㸐@  P0H0 ] :@0 `6S00 hvG[ J_< 2D 40 pV<0pOVK rP@40PSD00T `H ./PU0^0NP@0`|Pap⼖^2 S0-P UPhf2TG; r>pPH 040L00  0-@L@0S tK0h x(PP L@ @h@P  ^0 0 ## " $#< -@QLPT 0S\)0ʀ0` 000h6l6p6t6u6h; _`P 0:S  (P `V VLpg@_p`cPT`Vڄphv "@@@Xp PqP00`Z` #`P   -PbLR M`P p 4pP@@W qP(KW@02`PUe wP[TR Qa P`!U1  0l0a`00F<h0hvR0 P ` !nUVL^%p1 l00 lvgdhV0 40  0"20\0 1h600 00 0c40 ^Z)Y,00 @(K, p'PP 0 0h000h00\00 0!L04 0 !l < 0 x < , D   0-PPL@ @0 K0hR$ $0  K0hG$`l -LX@`pPP@P@Ug40 "P ` H< 0-L^F< p0hFS0\   SR 0s0 0 -RL F h"0SP| s00 0-L @@]K0hW  -Lf Kh 0-L(@@EfK0h= P 0-LP &@P >PP0@(jsPf0 Eec 0-LP@ 0K0hk 0-L@0 0E?K0h]p 0-L@P 0 0E?K0hL4 -L@P`0 Kh=( -LE!P Kh -L4M@@K0P LK -L4M@0K@ =0P <K -LX@`TP@PDQf80 0p` P 8<Q 0 0P0 0 0-@PLP0 0d 0  K0hXd-P0@XaAU 0SZ/=02 PU@/ -@LP`Q0`0 0S 00\ 0"+X BU0SZP8=02 PU@ e  < C-` M€@ˌX PESe@TZ pAHQRpWZЀY$u AIQXZЀYR S00Q Ѝ@ЀY Su QAIQXZЀ SR S00 Ѝ@ЀY}Ѐpr@YM@BP@@ -P|L@t`l0`0 0S X00P  0lP@4 /e  ~< \1 !0-LxMp@PP0(0 G 0S9l 0 S8X`KH!0  ے mP,$! `p`K 0H  l00UP@@' i@( 0R!$K0唐 S   hqt0@0 0 01WqT00 ~l(tPD`lH0@D 0-0 P000^ N |8T0 P@P0-@0LS (000S 3/> | $ p?0-LLP@T0P  0 3/P q%@T0t0 -0L`pP$@P UP q( p?p `@= -L@Rp`p @T @Dz%@8/PP0 -`0LpP@;W #P 0`0P p0"0 +\000#Q P R(00 z`xL01 0-LMP1`㔁0@ 00 1q0p 40B4< <#>40 P1080 T U0 R7 S0# @T A@@420C4242SV @$T(KS 0R0P3/02 S04"R4 0T 3 # T 3R`0`0@S8 0  3/02 S @ ypT G -LM PQp `0(0 -@tKe?K|@ 1 x@ gO1U/{KTA"@XAPE\A>K!  1 1 0Q Q q Q Q q .!0( 0R$KoT 0 g w|( -L$M 00 K vd -0 - L(M 0 K v 0--LM0 K0 0-L@`XPb`00C`0S vPX0 X `XMbp SvP UX,P u X0X 0`00C`0Sp X0X/p Sp RX u  -000-0LM  X K t --L, M( 00  X K tX -LP@Wa0S000 `PP`+P.0`VPC0 p00 a eg0P00+JPH V : pSg 0 B  a GQka G Ikp --L M  v K -- LM0 0  K 0-LM` KP*PpP) z@P& !  P(?R!ʤ0 p@ 0$ , ( 0 0K0 cK@K}n0000@ r@Tx 0-PL6a@TC;a0 -LP`@i RT0U :T:0T:KhfR -L KhR00 -sL@P !R ! 00 0S uP0B`Q0AP R 0 UPPU^P0c^P `]^P 0 n` 00 R-Lp" R R \  0 H H0R00S000LH 0 00l PH000H 0Pࠣ LL0b00  H L `LL41 L U 0`0H  Q S Q  R  HpH^   -PL`0P@!@1U !pP  D!:mp@ pP  0 0" -LL0KDM@` Pd `\0 m0T` P0 0S|0Sy %S`P0KpT KX @ BZQPNMKJIGFC@543210/-v)'&%$ "!*$" vWR~ p  uP0U9*T0X 1!P0S X|Xd`0X T0 " T0d` ^     p  uJP0ST0X 1!P? !! 0B P0A$REP`@`> u,P0ST0X 1!P!z`,@@p@p`z`%uP0Uj*T0X 1!P  uP0UT*T0X 1!P  uP0SP KTKp T0X 1!Ppp` p`{` `*R0 0B@ Q 0B Q uP0ST0X 1!P 0B Q?` )) 0B Q0I$R uP R&T X1`P{` p`p`R 7 uP0U*T0X 1!PNuP0ST0X 1!PyuwP0U*T0X 1!Pl 3 uhP0ST0X 1!P]  uYP0U}*T0X 1!PNP KTKp(K ? uAP0UP*T0X 1!P6 V  u0P0S"T0X 1!P%u#P0S\T0X 1!P # uP0SP KTKp T0X 1!P uT\0P  P KTKpq x uP0SP KTKp T0X 1!PuP0SP KTKp{P KTKpP KTKp^zP KTKypsP KTKrpnlP KTKkp:eP KTKdp^P KTK]pWP KTKVppPP KTKOpIyP  RT  X` 1  Xh0 :h0p3$R` J usP0SP KTK&p! T0X 1!PbP0U*T0X 1!PW@A0S\0P R(Kpa@@@A``u5P0ST0X 1!P*O u&P0SP KTKp T0X 1!P`0P00TP KTKpuP0U*T0X 1!P X h0 h0p`P KTKpP KTKpP KTKpy@ H uP0SP KTKp T0X 1!PuP0SP KTKrpm T0X 1!PP KTKdpu^ 0B QI@ $$ 0B Q0@D$R uP R'T X1PuP0U:P KTK<p7 T0X 1!PxtvP RT X`1y Xh0 h0p Xh0 h0p$R@ 0-@LX0000 -LMϟM   0& 007 ~000  1S0106KC&0  R 0 S /K0 p ' , ,L' & 6 &  7 & 6 6 嘆 & 6 6 6 吖 F0S %SF PU %U60T &`" J& 0R& p06 S p6 Uf P0 `&  @ 6 6K5K` 0BZS*J<(6B28JEG"\`\ozFYP 00 SIv0sE `GK @Y>Kd 0Cd 5 /^^KO PEZ5.@ETaXa\a[he `,p0 DCK&L u `Pf XP`f 0@&0@00!iKP  p:60T$6S9 06 6S 60@0S 06 =K0CPP 70 0R (KʟPf <` S   P6 06  kK @ VN k>K 0C 0^UK0 &R &K S06  k>K 0C006@@S@T R  RSnK@`F06 6 T6 6  6[ F & S& & %[R& & & P & R& 4 P@U1U# 8p0` ' @PEU R & QPEU '@`pD8^P0 0K6[pS 6jK @0S6  00pQ> p 5[S 60 0KS6 KkK 0C A 0s -06K6S6 6 06 f <0 D    QX &   6[ S 06K V006K6[ SR&  0S  00B QPP%0@ Q$P Q06    6S0c6 +0 6K6Pf S0Bs06 06   6Pf r S& o06 ]( |` H d dԔ@ӘHЬL  ܬ D ٴ D ؐ  D 6f @f7 V,PK 6& 10 F s0& p5e `0&K@& & & &   J f 6  S& 606 6/ 6S, f 6 A& x @06 k>K 0C%K> :! 06 6f f@CKJ Y^K PE]V 6606 6@p ?F 6 f aRf PH P06 X05K6&S06 6@ⴆS1600 & i.K BB 0Bj.K`P &6B X  s& 05K6S f u 0*RH 0B` Q0 #0B Q6 ꀠ @ @@ 6f P #6S6&`0a6 VV   FTO UPU HX? 6 %f 06 6f P6S M6S6&06 X 6S FT!lCKJ _nK  \`Fv @V VvP @0  0@svV`Pf  C>K0C  \&iKA  0p &0V 0`dPf Rf P YnK0ἆ @UK `F &K& & & & 70㩆K6 Y^Kk.K PE Bd@@aΌ 0  D`D0R00SdAHFHF000F`  dXڼiKYP& p6S6S6&6@J T@T ڌ6`0@S 6 pQ p 6T0CS@+S&8WPPp @DT0S 6 Q;@DT pʜ7P@0 0 0pQ p &6R`t 6SPm7jKئ P006 0 p L WpG0C@P   P Q  @LT@T ڌ` P@  T@@@T,T6 0` @DTP  Q@DT 6 `^@  `\Wӡئp6 V `!6S6 ',PK6 0S6  0p%e0PpQu p 7@C6T@T ڌ6`0@S 6 pQ p 6T0CS@S&ڔZ`PPp @DT0S `6 Q?@DT p:P@0 0 0Q X6  piK!P]iKPS& p}6&PCU+Uڰ0 pPEU R 0& QPEU p<\P0 0 0pQ( piK 7 P p 7S&606 P`-06K6S06 6 6 6060RQO [SKH FV`HCiKP3 6&S0VPY^K PE`K  KPQ6 @f C 0< 0@LTMT]`PP0 @DT\ ` QC@DT 0X.P@    0%Q_>K 0C @6 0<  & #66 P `  Q iK/Pk& 0'P   _.K B pyiKPV& 0iKPL UQ >Q jiKP6& piKP,& 0 R`@&  bQo 0^iKP& piKP  p%iK6 P 6Q4 p6[iK ' P p 'iK ' P p '&00 ?R 0& 00pQc p 6S6 '6  0 S6 pQ{ p FTg6&06 60 7 S    60NS `U6[o`@ 㼆 & F F F iK6 VP6 iKLP pW P_ 6V  kNK @D0  @h  Q 6 &  pv@k r Q 6 & puE@S A S&606 p?iK6 PB6 l0S&6E%K- C0cB+ S S%KMBNK @DW D kK NB P0n00BBD00\sA*0_K @ C 0R@D0D0&0C7 R6[~@f/F F & F f[@/F & F F fZQ& 6 6 &  06 6S0 6KkKP A@@Q& 6 6 06 &  iK ' P6[ p 's06 /& &f@& & & iKlP& 0<Y^K PE`6[d 6 k>K 0C6` 00d`H u ~ Q  & A  S j Q  &  AkK Ls     S& 01 jS01 & _  S &uS &AkK0 A/ q  ! P66@0AkK @6 /0 _@  P6606 pY^K PEd`k>K 0C BF #0 k>K 0C f0dFH ghV ``Uڀh`06KXhh`SiKP p괆6 6 &_K @00 ER  0K0006 GkK @0@ TU< `6[6 k>K 0C S0Y^K@ PEd6弦 v pЖ V P@ 0 UZYp`H000H 0S U  S00Sg 0 >ZP@0V6dvЖHF6 6V06 kK @ P6V & kK0 N 4x05Kp06 Q !& ` &RS 60C6 t&@dU㰦PPp @DT0S 6 Q pP 66@0AkK @6 0 ZQn  &  AkK L!P6606 pQE  & AQe 6 &  pS&606 pQK 6 & p 7_.K B @& <6 6 0 d` 0 P@ OY^K PE @c0095K 0O6&0CS?6 ʒiKP 60@6 y, KKLp"6 p 6QL& &  H43P@0 0 0pFiK YP& pLbV `>iKJP p & }f @& & iK8Pt piK.Pj p96kK A00 & kK& L  &  VkK& L  & IiKP< p}iKP4 p6`H0HpWpiKP$ p606 Q pF]P 6 kK @ AQ 66 <Q YC>K0C  U iKA0p@&0@00pT]06 00 t`t Ȥ 6 6 Y^KF PE d2&  & @k.K B )]06 00&  & @k.K B 6 & 0S6 6 &  0S6 <@G S& 01 _K @0{iKDPF p6 & 0S6 6 &  0S6  &  & @k.K B g\06 00l &  & @k.K B T  S& 01 P&0@00:&R'  `V u P0B Q`&0@ Q$P Q4 `  ^8+Q 16 ` T`, KKLp"6 p 6 V `B, K=K0Cp6"p Q60 6 & `6 06  & -L`D@pPO4@0  @O ( -L@P`pN0 PN -L{VMP0 @Pz 00 @ (Ko{0 {F{&{ <8@Y:0 SA.@0c8 8  0c@1"33ѐ:0X0 g{{ L$K&A ??҇coCa?Ɗ(`ȳ?DPy $4XV(|0 ,PP 0T0 |0ppp Dp l 0@Y / RT R X RCN4@@6@d0|0 L0@0PX0 |0 LQ S  R Q  @D0CAL dQ T R9 Xd0 0PX0  x P `d0d0 dP `d0QDT Q h `R`L @0 L TS\0S-ZT0S@ L0S`0SX0L0 B E80 L@d 0l 0|P h0 XP` W pj00T0 P8 D0 PSPR\  EL iLQP @0hS\ QJWPUR.d0PST00@5  `P  X0Z X 0PX0  P @P0 t bP(K@0S0@0 0@0 l3Z  0/1[@{;{'kkKE{{:N{7N@{0CB:N:0q0D Sp0S @0S S {7{E{{:x  P T  l Z |0 PP D0S@0  S00p0 S|0p  T Z@@T {Y{ H )!k, ,"[ {KQ "  {k&[\ R m{[ J Zkh{{{ < K Bq {@T@ T@kKF{50q~ R[kCk6kG+G[2[JRp  =KG[2[JTg ['k&{;C{5{0qZ T W>lp zL  BL id ` 0@0 Xp@P    !Q0PL0 P(K @$?@?( k{{{ < K B{@G{5{Fk{Z@00  R P 0 0@(KKKT L@X S D i{B"[['I E{k{' \G[9d0P DT Q h `  d0 !`d0 `d0 ad0`P#ZP80QdQQTplL |P p0S @0S SS RTplL |P@p@L0S% XPS d|0 |0`PPKZm[{[%{[gL @100{L0S LvtT0]XFP I`P& T0S!l0SD00C0\ l@`P  0pp0DS0S \@0S S `PX0 TX L0 @@(S  S@9R0D  |l p:D00C0xZ X0SX0@L0 @{K$@k[4[TEJDK6K@0T D0S  T Sg S@9Q0D k[6Xs0PX0 B8 RK R R  !**R@0 `` Q R ;@k'{[E{6@{0q DDPT0 T0PPg D pl R  p  T  ; T Ze l RڊKI [%k{kk <K L0  0T P9 X 0 0 @N 0xp t K -Q, y0 S0p `K(K00 PxP Q 0Q 00A S0 `@ "T0`Bڜ!T00Ax @0 A R \   EPC  xp x  +R -R    x  0B Pxp -0Rxx 0R 1BP!x0B x  0B X x 0B0@ XLP\Ӵ\`x0 R00 Zc  R@   R /o" jTg{ @Z pp Z{ *:0 fk01[kk 05SZӨ0S 0Sڨ %0jS0*0jdK{A 1 [ K0k {' {'{ P<pK0|0Q0P0 ?0XS$ xS" PxP 0Q Q' 10#0S5 t 0xp 0 Qx000S000 R  t 0  xK000t0KP 9 t Q \\QTx  0B \\ x R    P RQQMZ Ӓ# x  pKpJpW_  8{01k{'{ pu |K Pt g | p0BXppp  pp p| pp 00A S0Q0 pGW'0 Sp  00St 000P00 0S 00P00 uQ"0t 0JXP ` PԐV!00 ʜ0 @0S@T pP  Pt 0@ 0  p00C| p0 Pt n 9 `@['Q05 pHC0kl0/@ BLS:l {0\{'{ l QRzG%pG&pl _   X5@{00k {'R{ G O0Rx  0R 1BPp㨠  I B%RL1,0  lK 00K00@Pu00 0 쫟@00 ˟R0bԐ 滟00 ?0 ۟ `PPW    !It0PL t0   !H|`pp0F0 pP< W00``C0 ppG0 BS B0ppW  V RpGH`FSGQʑ0SX!V  P  pP 0S0S   0P@@S@T 0S@#X X, J i!00 0 0 0| 0#pR00S00 KKH I `P Q  I `0tS  !8 t Pt 0S  B\]0 S0| 0  B| T| p00 Q C/o" R (K{9Hk{gZțkʜ0S rp nl*0xp St 0p?@?A<V (m0r\x@K0P x  0000(S 0t 00{x@KlPp x00Cx0  t Px00x0 000axP0 B   &00Q000 M @00 qOt "00F  P  P  PP5  X@`0S``Vy0` 0 J0ۛ0 PPj PPPt  B\>ʜ0SJ | 0 | 0R00 'tN Pt p 0 Bp 0C0 t00 8@/0 S00 t P0S0P 0CSSM 0 00CPP Pt Ԑ0 @B|0 p@ MPt 0S p0  0ljhfd p0R" 00S S S tV0 t  00 "!Q053*R00 0c1300t Su X0 00 000 Λ@ UI^aZ0S{狸/zKH9W S*0S ڼ0 00 0 b :狸@H{H:ɋڀ0 P P0Ԑ0 ?(Ȫ pg  0[01k{{ p ' \ T0 pHC  0kl ?C0C@R*l { P0{'{  l0\SzG5pG6pl0 s   0@{00k {'R{ G c`@tGPt p |  Bp a00 t0   N "00000X  b p  l00 00 2  10 00   R0t00 0p 0  p a i 0@ J@ 0 t|0p|p t ,spK0#dK[0  A K k  {{ %PZ !   Qʛh 3Rp 0  \l0dK6 0(M ` 25R{dK   0 kK {'{ P" ]0t S|0 ;s0|0 00˛ 0QF00A00! p (K|0 0B0 Sj tgڜot p00C p0 _P PԐW0S pK5 `gXP ` PԐe 0S |t 0S*0|P| 00 0 0#R00St 0" X^V.  0 RPQ00 00S%0S !SP PԐ!000 0c?(vtP Pt 0Ԑ0 00 P00 p  0t 00 V!00  0` St Y0! S0S000 P PԐ B Pt M 0|@@d@P|00|0 !00 -L00r  -L0RPPpp@PI `p`  ^r0"(p0 ( 00#80#0 C X*N   r0"(0A#80A\#Z 0V 1 `` PP    !D@`@ 3-LM8 0@00S 0 @ 2 140 040 8040A  AR 0AP0Q p`0 P@ R PU0 V.\ # 3Q R3 \0@PVK(K`Q  0 \LpL  0`  P b0 P0P a <  aX<PW< XR P0) @V/o" RH 8 00\0#03Q0S a 0 @a0! W \' 0 X *  X*40 R 08SY00(K XR^ P0[Y=0(K4@0 S 0c1# )P Qh  Qc )Q0 8 0\0 T -LM`< 00 4 8(0P00Sp 0000P 00P R^ P@\ @\P  0X@0X P0z^ R  B!8 P^ p^ Z@v 0D0CSڣ0S#`Pg 0 @ S  00QY{*@ pD` 0 `TD R @N S00T @ TD`@0 BB! B40PDPp$408 0S48 0S@CU 0S Sy Si }JP@"00(K0 @\PR ~@(K PP pP 8 @@ 8 +QB -Q > AP rS 0I0ZP] 40X 01S  S  SW 40@PB``0 0s00T` 0  TV<  Pe 0@SU40P00 S S0S L0`000 b@400`< 0I"00qG PeP408 0 8 SuI@"00(K8 A LP @0  0>!L^A@08Xa8 r@W 40 0Sl Sm S @008 `<0 (K@@HpP D@p 212 Qp80080 }P  \ PZ P@Q Q@E`PLWDpX p@2 PE1@8pC40080 80p0C80 0@0  @00c00S pT`0:  RLPD!@0S+0SM 0SI 8 9p @00pjUUEP @ 0000S0S Pi ph4   BR"@I P15!@"@A T P / -L`9 C@PϠpl\ \ P U0p00 0V@`F`V 0 BPp PU  0 B0EP V@ 0-LM@KPK  0 B0CK2S$  K { BK, JBBK k K0-0AC^ 0S RA0@- S *@@Q@0A0C00\00\0  S  13S / 01R *0CPR/!3QR:// 00 x 00s0QX0a00s0Q40A00s0Q/ DT&D'a 2A-R`P !! 1R a31 p@800R31 B B  `S000 CB!S 0000 R 0R    0B! 0-L M !S*0S @0SR @K@K0 @K@ 1-Lq`p0S3 V00AT  R+00 0PV@T `PR x0 lPV0!@ 0D1S  $00d $pl k 0-@PL0 R xPQh00AKhJH `<0 0PAKh do|loD0  0#10/sP#8#4#2#10 0// / 0-LMPO/"K(0,`3pp&"`X@P0 ` 0S1 `P$K3`P    !G? u q (0(R8421S/ / 0-@LP0@00 -LM0PS``P0@@S0P80 C @ ^*0  Q0!<0 P #*D X\  <p`K @0P@Z0@`TpԃKpXDX @00C R  3RX808(K -0L@<$A QPyW@ @ PU p  0P. @ p1`0SsPP? 0S 41 1PU 0S 0C P 0`0SMpP 0q 0 y0S x0vd0qyW0S 80e (0R0y иkTdlXj i 0-顂`PL`@Tڃ0T pP X 0 0X0 i  @ ^ @D@9 )  S2!:R @@D@'-0P!0^$3 1\ : -L M@P p@DTL 0 \K*32P A:P8 0 @00 p` @PPU@PU@XP`0p Z0 P@T Zp` J 0 B  SN00 >0CR 00 000 (K@0@PpbP 0! -`@LApDP. P 0`0 V `5C5.#110;BV @*P  D0V?C `P1. 51Ό1 0;BP%0&;BC -LM`PXpP 0SJTS06Y(0 , (K(0T0 1CN@@D@`$K,KsP `(0,"K"30 (0  S0T CND50`@D@@0$K0S0/0 R / ?-PDO000K7D 0 2D 0 lTx㸯 0-@L600C0S0 P60P00C0S0/x -L0rS. wS( aS C00/0S +S eS%0S fS$ lS, xS0+S  , 0 -SL@3 6P00 P! !& 0S 3/PP೼000P @ P X00 `R00aaq6?`` 0D3PCP 0000 0-sL@ !R !P 0C000 0 S /3 10-LQ@P00S= 0  Q#O >000SC 0,$0 3/0:s00P    0@000000P @ P 00< Q 8000f0PxGB3P00s0o4 C0  @00 / -LA \S :S6@@ 0 Kha6@@ 0 KhQB006@@ 0 KhM000 0 0000/0 -L M\S`p@ C$_o᥂P/$    (!P) SS(!Qz0 ᲀX (QQ  0 0P  K R5$ !0$1$(X$X$ $!(1s(Q0 0(QSV 00Q (1 (  RQ:0  P(Qu0Q ^  uP㲀R"0R CP `H`(Q0 pp9nP(q$(Q $!rBPP,Q 0S00 r -L,M @TL D /H0  1@`3/,0(P  Q0PN P@ @pP\0K < p@B ^A p WP`VV 0 ) P) 0p PR/ WDJPD@p(K 0 ylpPw < 0 lP9 00  P@P00(K0 8 T8PD@T T< T- ` P\Hp Y A@P$K ^h@PP(KD0JPH0  lP   @eP$K ;hP   3eP(A`DV !RT(q $A (!@$Aջ@t 0-L@  S0 K0h%A,0A00,1 0-LS@0 K0h A00,10R 0-L@1  0K0h@,0@ ,!P 0-L 0At 0@@ -LM41PSp q  aa@p6/`A/`@ $p_ APMOĀmp]@Q 0pePN`Q 0pePCQ 0peP9 Q 0peP/Q 0peP%Q 0pzePQ 0ppeP@Q 0peeP T $K $KZ@OV@,D -L4!@`PP/1S 0L1P@WPP!R MPPP !Rp ~V @`_oR@`@`` 0-@PL P0P -@L`PPJ VapP> VaFL 0. \ \ \ \ \ \"           V       0V  ?PP?PQ 0-LP @41S0 P0P0100? 0 -uQLMMP`pF wF@P? U01  WK d?Q 0  pX?`PS?`(K Pz  0p '0 Va X^ A/xp% APZa@ QUp0GSQ  :/@ PI( P p0 D N⎁pH7!V QUU0$QP4QP$Q PP c#p3ß@C ओ 0p !(Kxß O`4{>00m>Pd>DĀQ 3  4 8Pʠ pp qc>@ _>V Pi R04 Q \S Ҥ S S0^L4p;P30 D H $  dPI!I72C,< 0(jq QfP1Yꐑ̠8 ( 4   p D > @ =Kݩ PDP C@P 3>0>@`P*>P#>0̠ P  8P4p\ >`4 >p>p P>`4  -@L M(`10p1fPS(p Rء P. (01`a ,Y !DD X051,5(Koeꂑ P  0 " Ik=0cء(K 0-@ 1L3/"R000 0-L@Q +00 210= 0 -LfSM `, p@ z=@00(KX 7`ᛡ@97`|1 x!0-CMLMp@P0(0 形P8 D10BnK*CKKHA0 H4 D4 @4 <4 <<p@ អp  Yp U ἢp  "( 0R KhT*0P6 P@@6P6@?00| P(pl -LşPTM @ 00p`0 0Q00  %00 20ZX :X 600`0 0 0RP(Kwo0 0S0d0 X 1S b$P䡄 {0!0 00@0Ps:1Sh `V``Vh0h0  P`ʼ`h0oXT `iP1! C ^:B|Z *0 N0 C!1 C !y沑 ഑ 0d 0(0 0S 1S R10C00C S  $ X 20 2g0S0B00CQ !l$T K30Ph0 Xh0T` P 2  0 p N$;(  R3wo Pd0 ?Q0XKd0  pt 0 D 0d SX0@K d  HpKH @0 < $ p] 0 L 0d SX08K d  PPKP 80 4 d0  P h#`P9 0㸡h0  0Rb1 S0"1!]h 0 h RZ^{/0W #0h0  P\z {?尠!<Z500 ( -LMp(`P 0@SO pഁ0gl!  H v1AQy0x10 pp R N1W0!BqqQ Aq  R~ 6 S! B!(0 0S (K0 R1S0C1 0RX 2( 04@ cK 0  4K P (00(0 p0  p WP V'10C0S4K 04@ 3KP(00(040#[0!0dVQF10C00CV Y4@ 尃K4K0H 4@ 3KP*(00(0Q W"P 4 Kp4 sKP5(00(0  "p000 4K4@ 尃K:P 1 C  BV* ,"P 14 K0C4 00C3KP(00(0  " " 0-@LPQQ0 "0P  "0 !0P  "0 -L MP,0 10C0S-0S PmPja V0FS S1P !@P] `V0ഠ p0 p0  E"00(Kp刀1 pp J/1FVw0~1 p0S001 W 0`L0s0S 0Cs000 \~6SL "00 R 0]P0000(K0(K000 !00(K1  1 -LM@`Q !00 2(Y4 Y+(P( P 0) 0!`P 10C0S 1 ! B R0P 80 !80S  "0 "(K>30 (K0K b PP 0 pR  ”1 0C0A\*kP 0 P  080 t!80(K10C0Loᩒ L P 0p% \\ L10C0SPSP 0 ;!Y8 3!80/o"| *!~00K p80 !  P `0 RT ,< Zq  !뼁Y9  H!R5 p1X0C00C^ S 뼁p X0H S1 W `PpW0 :1P`1``  < `P  0 `P 0R " `PrYo0)80 80E2 0 1~P P!< 8 _ P,`N 0R Z  q WB 0G1S> 0WS ,u q W0G S1  `P#QX1PE PpPEuPP! P 1`pP `P!0CXsP0P1 ;  `P 0-ML K0P K -L<ß`8KM Mp `P$ P @ O 0 1@0040 0R(K G@T R B @ W/, P 100QB Q1?0040SXS  ܔ(2GT P0p@ UXRP>  HZ4@ pT CB>KCK 0C 4 ;l0 W *0/S0HK 0C/RG WhQ0P܄ l=K 0C`4 d dV" -~p#210S X 4 `C0 S00R0J Xx P100o4S ᰜp @eᯜP 1@@DOoBZK0 A0ᕜ/00PPP4: S 0@00G ~l(R -L Q0P:Q:0Q: KhD)^  0-L @@U ! K0hU d 0-LP@ /-@! @ K0hGG-`MkpetG `y@3P-CdF0 ,4 0a@xF8  DH`L@PP \$(``40@<0TX 8 @   PP$@( `` p , lȠ!p pp``appp "pppb(pp p0#pP%pc:@$peZ ,. pdJ l̠ pppn!` `p pap "pb,  p@$pLp.0# pP%<` \ ! " ,app pb( lȠppp` p pppP% 0#@$c:eZ.`!dJ "anppp ,b,pp p l̠ ppp` p pp0#pP%p<@$ p\. pLpW pfp,$@a@xF<P(030dF `y2-2C 0@0P 0k0eGD0$( 0H ,L0 0`P `0`P$P@4P`(@08@X T@084 \,00  <0 `Ѝ -LXM x0KhPK@p `t` x` ( p` l`  00 HK  '@  ( 0R$K ux( T1-LLHM @0`KpKPK 0 0 Ȁ   +  0K?p*  R' Y   h   0 0 00  0R(K( tP p-LAM@A0S tQP@P RF KphA0S4!44 PBP<0A0Q`  5+` 0 0  = p@  Lp ᭯Th @) RHKp/㘯S ( P  -L M K@( 0T KK D2 @" Q0-LM0p0 000 j @ 0T] 00 0Rs(KY`K @ 0TI @HPK@00I0 W0 0): pGZ?00 '3 p C #S 0A@ s@ @x000 S000 X@p0SZ2  0 0 p0K 0 Y  i&0ꄮꂮp0K 0 E   R    R&@ rp0K0 q0(  P -LM@`* pK`P D P:000 U *KD  @ 0-L @^ 0T0K0h1  -L`P @K 0TKh  -L,M0AL !0P BH sD Q < 尠 00CT @0 P0p` 0 Z 000CS}0 4 !0@@@Zs@ V `@ 80 v`p80@D PuPR4 0QR 0  0 < pVwp:0T0s0L!0P 1(0  0RP 1 S0"s0&1!V0CL0 P0P 1 0 WXCWC p  WV,(W(( 币&! Bx X 40 4KⰃKpl4 4KⰃKh4 尃K4KcW> p  W  E0PE  40 ( 4Kp尃KJHx,40 尃K WRYq YG  X  0P 0P H⨀Hx,p40 尃K관X! Bx X#弁 XH  Y 0P00ⴀ p1| 0P p 40 4KⰃK  Br n각 H㨀Hxf !0崀 pO 0P -@L`PP 0 00(0`0Q0(0 ,0-Lp@$M@ D H0 1 PD A@D@T8 8 < ` p@r` @T!  P @DuPP @ Pp8 0$001P @p8 0V PFuP 0!0P< <(KD 0<0(K 2  V 10C0SQ\D 0<0`(K 2 < `Q` P4 ` 14@K@0C 00C3K PP aH 0RD 0% 0F1S  aH P0FR S1  P @VT 1@DUt@ @!n j P4 4 K@8 PSKA @PH V80QH 0RD 0E 0E1SA  P, 0UNNS W6QH @0ERM S1P@T0 :1 `P` 0P `J 4 E 4`6 " @ 1` \P APU1@D @`@Dt@@!s0!0s00000/ ( 0-@PL L  0( @ 0 %0 "0G- M P(`$20 @\0 0?2D 00p `P 0p   "@g!!  e!&  T e!@    01)A$N0@ 0 0 0``p P 0p0 @10䥠0 N1   d*c ! * 1@^ 98# !#0 00# %0 0  0* l 0l   0@  P  `0 @p P `0@p Ѝ`\ -@PL`P $(pQ8 E$0(00 0` d06  0F BRh .$ 08R(@R )@ b$8 $)8 b$ -P$L@`P @p`(W1 `F"(@* ?V@pF(?p@pp@ 0@ 0T "T?`V( "a?V@pF?p@pp"@@TR -L  Y 0-@PL P Ό 0( @ 0#0 "0R -L z 2 -`PL \0@0]@P\  0 Po#0 $$|G-M PH@2ܠ0<0@!*00"p0`  "b p`)!( @!'79 'I 0&7G9&+@07N 04(00,@؀0 ؀#(),0 @%B! P%@$Ѐ   B)P@0 #"A(P%@$ 0  , H؉0  ! Њ)( Ё L P%@$Ћ 0 ؊0P@S) +u80 $0A=hܠ( 0iJT1   A )(0 @@(@PA# `3o4``H09&6D0)7p9T0)9`7\0 0 p`0 $3 0>L06@0( 0( K= 0 9P0 7X04`0.30$0# "4d0%E0# "P@ 0# "!P @(b 0  p`@P'@&pp`A``a0%.?%1p00#.l?h.1t03x0! `0 p3`|0 0 0G&0# "IP@a@@P@gP%@$p'`&0 ip`0 hp`0 (PPP@"` `P@@A!P@`@p``b@AB0 p`b  P@!C!ЍD 0-QL@PP  0pRPQp b!p |!0P0 0H @ 0 0K0hR Q bd!p ]! -@DLPP `PY8 d!0 0 0# #0 $P H P1XHs`【 $PPQ$ UXP 눁d0  0# #0$XHPs【`  P $PQ$ UR -L  p-@PL M` 8P;F$K 0 \K  Kp -`PL \0@0[@P\  0 P 0 $$TR -L ;, p-@PL M` (PF$K 0 \K { Kp ,P0-L`M0d0 ` ^ P 3 P\ fP +P aPC PW 0D @0 2CP >8P 2P! 5P U3Pp 4PA  0 ` KDK Pt K0!P BP P PG P# 0D @0 d0K DK \ K p \Q K0[P2ZPvHPwWP IP VPi@ O 00P P P P 0D @0 &P )P| 'P (P 0D @0 3P Q7P9 7P 7P0  0 ` KDK P` d0K DK \ K p \K0>P=P:P1 u;P <P  0 ` KDKPc`wAP_@]GPZEPW 0P^P KXP YPF yC 0$K<0  R0` $KM 0$KI B0$KE 0$KA  0 ` KDKP .P 0PK P P P0D0 @0  ?P P P8 0D @0 sP wPd P* 0D @0 e#P~ w$P %P ,0D @0 XP P 0D @0 P  P  &0D @0 D*P +P D0D @0 P2 P 0D @0 06P 7P  0 ` KDK*P yPd0K\ KDKd D @ 3p EK0/3P 0D @0 PD 0@0  DK㬊Pv@u )0D @0  *0$K +0D @0 zx  0 ` KDKP V 0$K 0D @0  0D @0  0$KDKsP < 0D @0 L 0D @0 F 0$KB F0D @0 < G0$K8 0D @0 2\  0 ` KDKP  <0$K  0D @0 z  0 ` KDKxP  (0$K  0 ` KDKfP  0$KV 0D @0  C0D @0  E0$K@0 0D0 B(1Q0K\ KDKP#@ PDKZ00p\ %0D @0  0 ` KDK#P  0$Kx  0 ` KDKP 0@ D0 njܸdøœ8p -PL`pUO A@0S @PA VPF l 0S2  P0 W`= @ 0S: P8 pU ! 0S@010@V 0 0 W 0 0 > TT Z2 V@W T T F@00XX ? \Ӕd4 ż Š | L  0-L0@T 03/@TtpPP |00@T 03/@TX0H00@T 03/@T$Ν0 x Ą P  -L\@M@P K0K #K  LpK -L MR Pp a@  = 0 S 2 M SV: m 0 0S6 0 0 S 2 / 0Q70 T 0 0(K 0  00 P 0 0(K  P00 (K @0 @ @(K 0 0P  00P   0-LM0P @ RP Q    R0 0 Q   R 0 0 1K3/K0s/r?  K@P10  0@-P@0U 1!^  QN \SD0L00@-P@0U 1!^ P\0PU000 -L@`pP@0S:ؑI Y P1P! p  @T  `P$pP p@ -LM؁p00K< H@0 PD 0<0p] PU @< @P U00 `1`!  080 >W 80D PUp0<0 7 (K(K0 -LP@ 0P a`F  0P pV @D: P/0@ 0A0S *Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-40P$<D%LT,\ Ġ.̌8 R0 Ġ.̌ RA R B0-80P$8H%HX,X Ƞ.Ȍ8 R0 Ƞ.Ȍ RA R B0-<0P$4L%D\,T ̠.Č8 R0 ̠.Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-#81 ,Ġ̌%T\$DL0P  R0@ #Ġ01̌  R R B0@-#81 ,ȠȌ%XX$HH0P  R0@ #Ƞ01Ȍ  R R B0@-#81 ,̠Č%\T$LD0P  R0@ #̠01Č  R0@/ -P<LP@4 ``#P *T 00S<4 #`@T: 0<02 -@R"0LMpP`000 Y 00S<0S 00 0R(K40S`  ^P< 01\ 40K`K< 0K `Ġ0 2 R? P<&YF j jJ1 v0` &c4`0`` 4`V <0  T@R<<P`0\ 00S 02,"SRn,BT wK!02,"SRh,BT 42S00STb/<`x" < <` Q`0R2 04@P0@RD x0@@0 <0 80 40 00 T0 013"000 , KDKP,K\00 T @ >R0-L4M@D @0 <0 0 80 40 2K 1,", , KDKP,K500 0-L@zK0hzH-M  0ЍR q 0\/S/0 00-L0@0S- 0 ,   0 P @P 0 0$0 s0 00R 0   00  0c00y280  -LM@P`ppP pKzP04 :CRo  S L   H0(0P   ; 0K; 0K x "-LRtM0P@` 0 0C 00 !0 0R(Kx K|K0pZ | P0 D倀@"x0 \  ppAP぀0000SpK!@ ᤞ Pf F0B/SKDIHGFE9CBA@?>=<:9876543210/.-,+$)('&%#"!  00 000000p0{0 0 x 倐 00 t0K0Et0SQ| p,OPꈸ( $tt p-L M@0P\00Ta!V( K+0T1S O‎0T1S 0` 0U0TX1\1\1S 8Kp 00Kp0U\1X!0 \1X! 0-@0LPU0 \A\Q X10CX1S K0h T1O<0K0h`َ00 000S/ Pd0 0-L0P@T000TA媎0`T TAT@ ٍX1@0X1Ꙏ0T0`X1 d0 000S/ xd0 000S/Q Ld0 000S/ $dL0 H 0-L4M@DK00  0RK買 ( ,Dx -L M@PQ4PKT0@K 00<p`  QQW W0&`"(K W0 S0 Q `(K`(KQQV(K S0`"(K <0-L4M @0`0@`K  0-L@PP P _@0@0 -Lp@P`P P HP  JP@3*e @"00` @00@Y @00Q:// BQ://41 -0(L000 A!@00QP `PP[0P  Q  p!@P   0R` ?@V`@0@S 000 !B B!$Kk  |$X 0-@PLP 8P0U0 =S00=S0( 0-L0@@@PP0K0hw$ 0-LP@P (0 P0B0080 0-0L@P0 P3#01 -L0 M4 0p00 @T_ `P ]P0=SG @PT40SJ @A@P P)Y - R@`@@@R*Ya2   匾`P, 00  D ! 00 0``@(K00 YpQ1S (KR@`@F`PP $h  0-L@,  p 0@0000 $ -Lp`HPP@P  bP$0@00 $0 0-L⯋@P0 0@0 z0 0-L⠋@P0 0@0 z0 0-L⑋@P0 0@0 zx -@LppuP%poe0:0 p-L M0`@P  pp0 t 0PQ 0p:p0 Kpht 0S0P"1#Q 5Q /  T% @ @1S 1  S( P  P    K0P s100K0hi0000 0/ -L pU` QU @ @E6/P@ -LT`ppAT P PD6/PW PPGP -LT`ppAT P PD6/PW PPGP -L `U@p)1S @P@E 7/P/@P@@@@UE !0Q00000 @@P @@@@@PPpT!R 00 0U000 0@00 P1 S Do@ 000@@1@ 010Q- "!RP 0 \0 R 0P 1SB0S  0!B0C -LP`@T0PTP  Th U00Kh{\ = Rc   T  0 0H ^ P_QQ0QQ00000#00#0000p0P1T\R /oT"!0#00#00!0 0aT 00Q T  P0 !RPPPPPPPs RC/A 0\R#R! R/R00 B-~x` PP5y  R i  ` RPJPN P?e0 ?o60⃑ i`PI 0 08P?e0 ?oP 0C!P05H RJ@+ IP?e0 ?o5H0 SP RZ 0P@ 4 0S00Y+R03<PR#4@@PPrR PP @0!32P#4@@@ P5`P_eP _oA/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-40P$<D%LT,\ Ġ.̌8 R0 Ġ.̌ RA R B0-80P$8H%HX,X Ƞ.Ȍ8 R0 Ƞ.Ȍ RA R B0-<0P$4L%D\,T ̠.Č8 R0 ̠.Č RA\1 X!0-L,M`P@0U00  pXY U< 0SUD0 0R7(K0 0R1(KoL PK P1, K0PX$S  $ CY ,0K 1$ S0 P, K!0$ R00S P Ӏ(i|i -p BLW"R$M4 4 P@P-T`e +TP@00T W X0/$K$K$KK0 0P #KUHTU QP?$K`CK 3PS OCK00@00 0Dq PaDQWDADQ57DW2v X$KCKS!TU QP$K`CK 3P OCKP@"`"0!#K`"0!#KZ0P#K VE4 4(KZ00( 40 00(K p 0 $KXt $K*$K%Kir00XS00 C R @ 0P$Kp0 (K A BRWH0 p$K0//0K 0 0 0 ` 0 000/ @0</0 000/ 0</0 000 / ͸0< /0 000/ t0</0 000/ 00</0 000/ 0</0 000/ ̨0</0 000 / d0< /0 000 / 0< /0 000@/ 0<@/0 000/ ˘0</0 000 / T0< /0 000/ 0</0 000/ 80</ @/ /H-M 0Ѝ -L@Pp`딑 pWE$`` - P!# @ "M0 U 0SL P)@)0! 0S $K  0S RP/O0?c0 ?oP/ P-LPM@CKR0AS w0 0 (KYR7 CKUQ0S ^0 4R$0I PQ 00 0Y K9??o 2#< c13280 ܃KS CK@ @(K40oo?o`FV ` V CK f56 03.0ST (K0BP R K 0 0408o3@CK?o /o0C!` VR VFCK 0f5 03p0/P@ᬯ0 0   0 PUp@`V0 8 < CK\X  (KKN40oo?o`FVCK` 0f 5 03CK@f5!>4 2ԃK/#K)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO08 0-L@ P00000;8 \L/ 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGO` 00///Q R R  // U /Q0 R 0 000/ 00/00/Q0@-P@ S Q \@ 0SQ @0\  @0Q@-p% `^P# PC0 \` NT^0 Q@E\@E`0Q ` `S`0Q- S Q P 0SP 00Q / U /Qp@-`@( S(  P0C S P QP @P P 0@U0pP@U @p0Qp@-@P`# S\   ST P Q@DPPPQ Pp0U0pS @Q@-@! S P0C S QP  0U00Q   U //q 0/00/   // R0  S 0Q 0000/ 00/ 00/R  -/R0  S 0Q 0000/ 00/R S Q 0   /0 /U/R 00/-P 00 0S0s R S  0  0/ 00/U/ 00/ R Q 0 / 00/ 0U0//0 0-Lt0M|  @PK00 00 -l -l00 'lK)l 0RK0 @(0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$0$ 0 R / td -LL0 H 0-L@0P p`r@` ////// P// -LQ4M`Pp@T 1 (0TK @0T@ KL P0 B F > : 6 2 K6/(K 0S' ؀PX S@ S0S S4 S P0SQ6Z8U00 0^0X R 12S 0A@   Q C 08@ART !l0 0 0X0 @00 400 (00ZZYYYY<YYX/Z/[/ Q-L4̟M0 0 P 000 000 ,< 0 0 0 0%SS  SW 0 @   CZR~xe_u_O},yxv*0 00 .  00`0 p`00K0 0 t00 0'".&`p c  BD0 0 0`00 0 `t00K0   000T0Sl@0 T@P@ \  N P1 U5P2 \; 0 UA5P2Q R: U5025P2 R*" 0@C 0 U@D05P2T0   00`0 p`t00K0 00 & 0  o 00`po0 0 S0pw-0`0 0 C00 0 C R 0 0 F  ~ @z@x 0 0lS 000`0 00K0 0p`0 x00 t; 0 0 Y @0 ,0K   c@ \0 0 `0SO tD  0 0 PT  B` Tdb O¡ 0ꀀ0@0+0 0 0P ` Q0 0R  00 d500 0`0 `0 0,< 0 0`0 p`0 , 0`0 `-0 5 0`0 p`60*S 0 C R@40 $$0 C R-08S 0 v ,0K@ c g  U05 P2  U#3 0ZPŅP \0@ U@5P2Pʸ @ U@5P2PʥR Rf 1> `0 p0 A0A0R  R_ A0C B0DwV0 W P@ 0  000d 0`V Qp0@ P 0C0 B@DR0 U0E000 0R(K0   S 0[@ X p0 o0  h 7 0E@ B p`0 a    01@ . p`0 0 00 `p`0 S0 ` 0@ `10  0 ` 0 p`d`  ``0 p``0 p``,@  ` 0 p 0 `p`00@0 T0@.#00 T00næ $(RRLH1Dh0 d 0-Lp`P@PU J0PEX@S 8/`upW  -L 0S S S 0R o 0R0@o -L@`p0@@@P s(0( 0P  E -`AML@MPp000 0`0 0R`/(KCK JEK  0 0I4Z"P 7tt 0 ⱌP0+ 0X4 I}X4 040KB}054K L( D -L0S/ S+qW( Y%`@P U 0@SÇP04S0 S 0S0S0S P PU0 R 0^^Î ^@T\ \ -LBM M@ P 08 @<$ U0PE`D4 000 ) C~KpGPU$:4 00*mP@V: mm84<$YP@^PD40 0R(Kw ( -L@p<BM M<4 @ `T 0P0@$ 00 ; 0Q8:0x0(S 0S @40 0R-(K0x0(SUPE C>K0C84 @V: [mXm<4 00 8tP PU:4 084lP ( -LϟnM M  xϟ6 & 06 000  @T 1S 0 S`1   p? @X@0>0& >B @06  >6 0S1 SKvoPH0pS 2P  p CNK @D0D6 eP0S1SsP @P Tʔ60ST~vp `㲀0SQS`V6@  ^ 0S  @ x& &  <  & D T0¼6 06 ڼ&0& &S#& R1S0N t6 0SO S006 &10 KA2 K1 AT gnKg^K`FPE*p P6 &4/P~6 S006 ]0Q6S66 66 60S AT  6@PP PPP61s6 j 0;F uPO6pS6s  ipeNK=K @D 0C`DC6 ᘆ 堖 dWPP  f~K pG0/cK L L   :06 :06 "@cNK0@D 00G@00p ncPP Uڰ6 60Rx [`1 X06 #66 6@CU0W&ϠL6l& &哒?@ H)c%"FcPH 0S   6 @0&T6  & 0& & S 6S6S < 0 x660 0Rw(KpW AH9  @X@0 0R  @0 00\6@C  >P `1  8 6Q2  &0 P0`1 d @8 F6t6 0S06 f0P@ bP m0 Pp  7" X@X@0K 0R  I@1 01 06 VCNK0@D 0 04tP0& X`/. Q 0O$| G ) &0 @0 !c&P 0 v  @6 X0616 za @VpD CK @\0cKN PW 1 6 ڄ3v@ 6 V DC 0┆@T 00V CK A/6vp Š6160 0 & 06  ğ6  0@X0|  (06 Z06  aP0&!&  44@X⭈6 A0 QRS] 5`1SU 0 &  S0 @6 #F [@0+0CS 3 QD tX xV & SG`1!,! RC   $3&@x&X0 \ -?6SK I ATS g^KvPE*`&0tP4/PC$@06 ! l2DX@0 0R  >`V A2 @X0`1S06 1S&06 60S S006 1cKVIp06 p106 06 P1 6 TbPZ0&0aPD101eNK6 @DcK`D Hs H& yimK `FOH&H `60P06 0`0D & H(@?=L=;9P9|778876L6H5444X2211 .. .-|,,,t T`0D Br DR `Pa0@6 ]x  6T_6S\ 06 x6 iWC0 0 0X0.6w D6 ` T`0D Br DR l`P'06 $X&R!6 0RT 0`1   10X`0W0  =n6 X㰀?  Hr R  T Br DR  R ,#*`P  6S<06  &0  0 0a06 = 0 X x 0 u0  2@X (06 tcNKe.K@D B0T6 ~aPP b1011S1 0 3 X0x  R{06 xt06 q6 06 sg@0+0CS1 3- ]T d/ /M@-, ) B0+Cp`S13pe8`6<` @0Ѝ/M@-B !,0S Qp`ACNpS`` @Ѝ/0-M  0S P@0 U0Ѝ0/0 0CSЍ0/ 0-L$PK M@p`PK04Ko`P, ?K00K0 0-@L0M-  Ѝ/M0-Mb@AT Da 0Ѝ/ 1-LqAM Mp@$ 0<4 000 P$ dPP CNK`1`K+0g1P 04[S ! 8$ 00@ 00@ 0SᲰ<40 0R+(K`rXP840 @S 0 S0S 00@ @4@ @C v @Ⴐ ( @+HX -@CM L MßQ$DH 000 P^080L <,G SbS000; 0 0 ```p P0T8$ f8$L400Qj(K0 D匄0 0;~ P0 @00;     PS 8$ a08$8$ tf8$ 0P" P* P# bf E0v0S 8$ <08$=0 h:Cf >f 9f  t()l'T'('8 -L\XAM M`p 0P000 V ; 0 0 0V@ @ P,CK0@`$0PiW 0 000 0R(K PP @@0.SCK@4 P,0K@dD,  e껝 ((&$% - L@P`^P KhF -LßPCM M84 00p@@4 000 0@e R/ 0.R@ RW<$ % S5.0B2?o121<4 5T! d1<$#T`0#01S<4 b 0 80 0KP`V @40 0R(K<$ C.K4 BPy<$d1@#2  R<$ 0u @D D0H4 Ro `Ld Dd 0SA .S< 080 0P/ʀ0=S 1S/ S= S2 T0 xQD4SSL4S $e`lLd Dd <4 080 0P0S`00SL40L4 0  H4 RH4 D40D4 <4S0<4 Ld Dd 0 084k<4`Ld  Dd d_d[깜0 80 0P@TK0<4 b T( -LdMpp2`0@c XPPTPUPPP| W0"Q1 0GKp 0V W W (KX P|`K,0K 00 HdP0yP sd d0W㴠o ppW  B R,0K B00cP` Ped bdcd\d뺠E(K 0Q7 70 + 0 H 0S0  P`s=dy:d;d 0s3d 0S  `P0E0 P\ -LpP@`"0D@ S')dV`pd0  c c0 0@0$-- $$ -L@`Pp庐ᾀ E0S@P0WU! Pcc@ eDGpcD- -L,M@g\`%px\|xL 0<  <K  cK$ p`0 bK[xKШ8 -LM0P4 8 d @t億`p0t$  0 S-0 S S  vP%  pP/ jPZ  dP10c 0-0  SR 0  SRS(K3d1P20d10 dt!|3P000 @ 0,P  %P  P)  P&090060 K3P000 ݀|ـlp 4 Ӏ0000:0@ P ( P090090{ P010q  P020g  0P<0 8 R\ @|8 ?P01?0# @0 q8 @00< "H4 0P<0 8 R= @8 ?P01?0# @0 q8 @00< (#) P" @ yP010  oP010  Lxp` -LMAT $KZ 0000 007[K@@ 0 p-LtM`A0T 0  KZxPK 8[0#0* )*T* 0RKp@@ u ( -@LPY1 !01n0SuOPpPp Yp0S -LQ@U x3s|p ợ01P 01000_YcZVxXYP //P // -L`P@.V00#\…^#  p僣 p0p p V@SP 0H+ D;- LaMM& P0@ 6 000 `a0T2 0H 000UnK⽡p&,=d1.q25d10 0`111100O5KLP@ 0DDzτpO06 ", d1 0d1s Pa `@ `p`0D@H S_a] S\  S S00 Q@ `0S S R:0 0CS00S00 090a0P5 ) 8CK(BK00 $6 ^>K @ 0C  & 5  +5 *Pf 04[#S;S  P *4[ S S'6S60 S S @CSOoB@T`0 o_A$P`@` P*4[ S S  P &4[& S S00R00S P(D[ T T ` xP)4[ S S60' 6uS& 0d10d1 AW|Ἡ1|EYAp Z>KƟ 0C `0Sn V `0`H`HpSD .S`0SVP@ .`FT00V0S 0 eP % ~ 60 0Q00](K6S160 S S pCSorpW$`@ n_q H Pp`0D@S \R?* S S00 Q@ 0S0`00CNK-P.P `;oR` 1 x#|#sp)DQ \dD@`}Q@)0 SQ_F l6 S&0?O$p06 (f V , T T@ 0DT?o20;T@@TR@T 3P&0` ;TL  00@@T\ 8P   'Pz@p, 5 6ah $PQ @@t0;TS&p20 00@ 00@@t0;TS00'P% 5l1 Y@(f V,R'Pp %-0p!&!R$!R0& 1 &-01S41S060l1z@-0p6p@ T T@@ t@0S S 50EK0D1@ @0@@@@  4P0I Pu RP 6du 6R@ [F `PMpx2  ꅖ r<(T xL$L( ϸ !-L(M1 P@7΃`LVW T 000 K pQx#r cgWV p  \0x00<0KUPT (000 K   A-@ RP0`P pp P0\^Î ^ P  ^ P(0 $00-@L|0 , -L,0KUM@T A#P HQU `Y0P`1 Q/Kd! `!0lA hA pA X!  PQ PVpP TyP 0Z\1 ( \!RPXQ0s ,0K 1`FP0X1 #ZHl 0PP TP yP0S 0Z\1 P0P1 SY"XA  `F  @B PUh  d &9 @QU #T 4P U`F HP 0H1 0 `P ^00(K h0` 0CQ*\!l! \! X!X1 p! P!h! PǦ 0 PP ᾦ0H1 Zg  0PhlS X  :0C P S:`C0KTA p @ Q  p W`F0P!pp0TApZp `FT 0! P QK pW    V `F *PuHQU, 0  y X1` 00Ξq 0 ` P Ǟj00 , 00-L@P0@000 _00/ 0S ?N 0 0 _h 0-@LP0!0000  0-@LP 0  0 0-LM0@KP   { R 僰 P 0UPP 0 K0RK0 0  ֥p1 l0h!-LM`TQ Pp0 RpGS, `;ep5 K A@9xP! 03xP 0S@0S0@$xP0  `+K|0x t  KX0T H ` ]lH p 4 ؠм0 -0LPU# 7U#P7UP!q@@0``F,0P $000$ P E0`1$ (`P 02~P P7-LH$MD' @G0@<0  70  `R Ɵ0@ 4 $ (& 8 & @ SF &Q  FTڨ d(p! 0CS/+*&%<6 0( ,6A(@d0 P(@( P(-P` @40A0P80@0S0S 0SkH6S 0S 0SK S 0SS 000SP005 0P0 p( 0 W B03*PCQL TA QU $ R|4|$0x @C(@( 1  P@<0  U40(@(K#pKq4001RC@!R*ßP 0CP(P@0(0 0 0S  1 `30( \58(09( . 3 0 ( (  (0 *( "2 0( 2 00 ( "2嬂 0 D cpS ( x2 0( d2 0( P2 0( <2 0( (20( 07S 0S'10GQP 0\ *P10P1@(8p4 ( 81R3P1SCD0LL! Y0CD  p  \@(K1hp  3p@0( @\ [dX`@ $p,@x`4 hXhPи! 1G-0 MX/*@ 0@o_^0<000 00 R  \:P 000^ R/YЍ$0 0 S\(00 , 0$-Lwpu R$ X -L@@`V 0 CQ𨝈PaᛚP `F 7PTP 0`0L -L@00 R ^^ ` P`1PP0 0D@ $  T  Q$ 0-@PL0T  0S  T0SK0h(R֚K0h"R0P@-0p @0 00^,0@01P(0 0$00 O -L@`PH 0(0 `0S  1T  0"00P -L`0P@P PP 00ļ - @L0`@S  P 00   $  DPP$p0S L Nl : -0LDM( R@@ s *`0<0 :@* 4 0^pH0 <80 D` :ωP0/0 pLp 40 800SpP@:T 000P0 @:TU69Y0P PLl)p0  X < D000JH 00 S  !$RPxx)  L l) T SeU T( 90$ RE 80, R: ( 0S  !R 80`  @`@ $`< gHD@$`P 0!H Q < A<ȟ  B QP (@ X , '@ $ H0 G0p@<0P,0P9<0偏@PB @pPD`d0S*'0 00  `' 000S:<7B@ 0@<00(KA(K(K(K(K60  260p0PP(K0< ` 001JAh \ ,Q$ L,@ < ^9* T&(Dd \Xp&<0 00C?00(K(K(Kd\ 0@ Q`01,Q& d RAW `P l` @\`XP\p p  P @  AQ9\BB$ X 4\ 0 0A!, Xh  0T\0 Q0 0<0 QJL40<00D0 `Pl`0\p Q0 1*#S\0 ` U #d0 \P 0Cd0 0P@@ Pd00~ ` Rv$op `@ $\P\ uPv\ `0@AT# 0 S\ 0h00`T0P`}<00D0 @0d `0 }d `0P 0C 0-[\0BdP @0 $tP P R6LP$` $0 tPP 0 dPA!T 0dPAA0\0 @$d 0A!B0\P @0\P @heb1Lp 0 pL@h0 h1h0< /0S00 0@T ^ό000@P!< /@:TD  T00 )0`00P`\t M `L<hT@ 8 8,(d hXLLD -@PPLP00 R  ^ `p p`1<0 00@ $  AL -L|@|p@pPU`P!V01`F`1S ( 0$ 00 A(Q -L`pA@TPQU0c@P 0 p``PPpP(P,P0@uh -`L@PDP UD0N  P  0000P   RO( 0-L@hK0h0/ 00$/00,/0 00/ ?0 00/ >00/ H00$/00,/l000/X000/D -L``PU 0AP pkp80APQ@0@ 0    ( $ , $ tMgMM/ L-LDM@0 < 0 0 D K = |( 0-L@20`00K0h4 0-L@Q 00 2 20M 0 -PdsLM@p 0p T 0KP- P       噣`P 0P 2h "Z &= " 2*  0 00 0PQ Yv YRKLPP%K0p 0pPF 2 @0 2{ 2011 10 01 100P# 0 R00  0 (T 0 2 13/p (K < 2R"00@0Z K`@(KT`0-00`P P 02 2p 2: 2 2< 20SzY 2: 2x00u@r@400` < \ -LM@`pPQ 000ESdZbD`_E\K 2 13/p_ R0 R0S 2  13/P"?o2R03S $K EcP> (0$P ( p 2 00  i"P?o2(0"?oP2(0 $PPU0PU "U0000$K$PPU00 -LM@`pPQ .00U-0PU) 2S* 2 !13/`PE PP 0p  2 00`K K``00` -LMBP1ȑS.:b, V(@ &*,pK@T RppT  & 0 P $K0 ` PXBȑ$K ePȑBA`V* 2< 2$K -LM`8 Xr=*40K<0 Q̡P@ p@ W ZJ!PE 3P ̑1PE0P U40  04 K P (K0<  PE4 0P P80S(K80X* 2< 2(K -LM"`1S3:r, W( B R"*T$*,KRU  R00U00SR 0 [ PpX U"B$K 2< 2$KP"!$K -L MrBW Rb,*T *4KU4@ #0S 00Q U@ E0 0  Pp@Y U 2< 2(KDB(K(K -p@Lⴑ`P 09 v`! I!V`Fx0 v`!  R A1^`0 A  B R Bq  R~ 6 S2A0C2Rp -L@_0P P `P  n` -`PL@Q ^00T T(0 2S $A@P$00C$0@000Q 2S@3:A@P 2@:0 2 -L4M@`PQ !00 V] 2+ R (K 13/p3 0 t0+ 2 L`K@  DpKP0K$D0 #?40  0 08/P50"F=I'IF"PFF(X8I RP : *'@22=="QFHFX /8X8FhFFG "HPa)F%FHPa)FFH%HFxF(h+I!F%(F@+ F,V(H U-OFhFhI aHI#JMFOFԲF` `+``1FJ FAџKh,ݞJ0h*`+SЛI a(O:N(/H(L(#оSP()R(0l(1f(JI(i( `#r((v((p(;`0#0+`+`#00J`0#+`0;`0`# `0rJvJ0++h0+6qI+;0+##+h+#CnfK<` dK`~@BS$aK YFHFo\IZF #0+##HFHD`/   hB,/* IIhS`#B$00cCH < =H0@Tzh+.7JG,V'<.pCOй/ #O T_*F(%y0#h+#JI}#(F (3"h\/)F+ x ̘ ̤ ̠ ̜, ̔ | ̌ ̄ t ̀ ̐ ]1 o ̈P0;+P`F)FFH!jH%+]^h#k3DDo\YFHl j+2/!HF X CI 3 0/+7O:hS;`6OoG"4KOq3J4H`AqXF(f .Kh+ ZF!j,H0F(ʮh+w&I TpCO#`@.KKhkJh;`J+R#7K@?J!F(wUp  ̔?hl_r t ̜(УmXFh !j%Hj=0+?3FA00+?(F%(F,L#h[0+?ɭ+h#Kh+?­,V'b0V' I pCO?,? ̔ ̤ -OFh FI `&J!F(Fj0ТI FKMh@8L.`jFKc 0H`Kh* 0_ԗI"cF h(bbjI * F,Lx`j#bKccbH7 K@+mVi^00! 0@aOrcO@#F *(b @`k@!OOr[hF`jG#jC#bbj+hH `00#hc` #Cо #Cо0CO `k#kAC2j DkiGUM0@TIJTM#BB,FFD(ikhD| `(у)FGHJhB@f(0#BB`h!d###C/MYi! hFFP#!hDf#a`g#C j-@2k(FiG0@+h+%I+$,"0 5$$  %/% ` Ͱ H! h ̨%) |K {KQ yM#g B EEX? !80 [j(GFFF #9(rIo$ ?tF^HT 080"(j#GQ$QH0#^IIBV#^BV0YE# ##"#}#gZE9McE#F#pA#YB0#F#pA#YBcFZF#K#"C M #_B1 g FF 0 D0KhGJBѽJBkjhG0 I 2 X p  hUo%6-OFɰhFfI `LBF9F0FB icj*#j+I.i(:a(,G(O0P(@IFH g(h(#ca#m($k(l(#`n(t(#hzI r#`#caOCaa##b#caOc#caO##acbP +x hIn+kxo+5#(FO c`,!  0FXO_D `@\I D# FJ[,!(FjF#j PIPK!xFKIW(0 &5FD Bg:M .O & 2B I@pC_(D6I$pCOѾ(h @^C1D6ȹhѱYBF)h(H5(h(" ((hھ()h8F(0F0CF2F)hHF` 3 #O \\ F5.BF+ &&&N&s&','F'u' &(yl' @^Ci+7УhBHchj#H\o# HRoYHJ#H@ 3 /j3b+8ѫibгOгojj{K|H*F(chckj+KjoгtItK+c #kcrKkiqK+c#pI(c)kmHBFb# #`#[BA #kjB+Ѐ[KOqZJ[Hjk :YH+kFWK+jVHUHj/SK@KJh.S B1FBL8F9RFIFF@FFF"BBE1F8F'"FFF"BB?1F8F"FFF #C:# #@!##`4g[FRF(H`9F0F .9F0F.9F0F vfH''(8(p(&8&D(((2 ))& ))R)G)x)))&#gHFhRЪaJh\Jh WJ #C# #@!##`FNH+jӱ # FfSzFHWF;F2FAH@Hmj.? B1FB88F0QFJFF@FFF"BB11F8F"FFF"BB+1F8F "F FF#[FRFHl9F0F .9F0F.9F0F 2" Is#!;F2F@!`^)1d*&* xF)-Ah(-hDhx-+9#41B-+`#p( E(S(IFH &s( x(фIHKhK`#41#L1##b3; s (SvI V! RsI NrHDF(FiIpHNoHbMnN,81#lJmIaHcO9h)kѾ(vȁ0+4q/@TL`H!F$_H8F(T81;ZJ FUKZIhhXI EAK"Z` hxh!Fh( F dhx!+"EHh+0I;Hhx+ (;H>0F @Fn4<p#`$  \(B  T(F  N(J  %D(  >(O(AfKh ("F ,(_Jh l +"  ( +"  ( +"  ( +"  (GL#h'F!EH B(``BJ#h+ѣh0>HpFx'I b;h;+ (#0KhI s;h3#;`"=!LQ!HP!!4R)p`R%**!PRK!X!\(}!\4RvFhFI O_%$:F1F(FhCKhB L(P($$D!Ff8F B(. +,-OFLFh&I %_ea`JFAF8F&C ќK /0i[ )f( R(#P(W(d(Ѧar(i(#f`av( x(fa#ac``&bfb%I O F`.3X)0+Z0F.`-^ܡW[-I(F cj(_+ANpCO@^i*@Z)FHFL30F&80D`Bx/) /!0FF1x.)qx.)ѱx RH(""aZFQhB)ѲFO9  VF'ch3(F!!cj Aci A@"8FF'&HFFph+ǀ2IF!1I 6P0; +~b}}}v}}ihj (-j_)FFPF##a@_ I"FF i3kj+?++иѵP0i++U+V (Xi#h+)jXFR)jhj^F!+, 9]]7U]  ]Gi+m)(w")FHFgn#*+gii+Ѫm(j(\ .h{i p눹#j#h+?N(j##`G!(Ai+,h+?9&h?+?3 h+HFR ii3)F@F##a h+?h?+?h+ѓ+? ^L)FFPFipC`O"(F F8i{)F@F##a#j+?o.l(Fg`O)F(F(\O(F h(F (F(Hh+h?+h+-AFh F%I %N^'2F!F(FC KhBO ;%DFT@(Fp(O r(!h%H./&h/!0F0Cx+3x#C0F V(1FH;F+, p! <"O# A8=" F F B2   K !p KI(`Oܿ"`^/HK0 H# (̀Kh++%+цK"# K"`K`"K`#}Kh+BxJ6 "{Jh +vKhPxKhsK`pKh+ UsK"`rKh U+.#`KxdmH2lI#FlJ(F F F FfL hCh;C`+ "hhY` "`HphZ`+C#KK6 0kDKxSTH(l#PK"`>K@BKhS$KM&U$1F40, :Kh3K(R0K0S4Kh;?Khعg*hh#x320[ F*FFn!Fp#3"1F F a!FHKI h(H z,+0C@ tBI( T@th^@tiTtz_tg=h H-OFhFI ^L%FFFUx `oSBSAc`K'J1FHFJCьKh (й%+rлO O 8к1ЀI P(H( L("({Khf(R( Mh( v(#FF##O FO OF) I O33-JbhV'*A:!XFX([^V'P+x3#++YI(F*`"IF@FF(@RI X O O .!XFJ(JIXF0FEI(F0XF"(F 0*F=I *ch ``P0; +CBBBB2BB2B=#")F8F*8F|F(h+9)I`^1F&F%HCF!iG)jHFR`^1FFH&[FCF+(j&DDD0F+!\+(,0(!hU <-OMFFbLMFab1`1`ab1`1abT2DE#hZ"`xch;c`+ F<#hZ"`x.8F0OS00OS09F=H.18F11+1[2H1H(?d-J,I-H-K)I+Hh.)I eP(7O#.22I8Fw(|I #(?T(FF*FIOr HK"!F6"!FfHn(8FFN!!l!d揀dm!(-AJh(KZ`+N$OhV$P8F)F A]#`0;`0+ I 4, X0ZX "p18!p/|P-O'FF=F;F>Fww JFAF FCѻJ , 2l-!"H ?F0ѱJI l( a(ܠQ*d(Fp(n(&r(t(#FJh-d-r- !!!d-=R-S-)Q-@p# "X*IXF v0ѐI Bp-gr-/l-@V"DX*XF2F "X*IXF P0I"X* z |IXF B0zIF("! "X* d'"9F^,f]F2FkIb  W BHe cIXF 0aI$F F^H]IF(FF"X*RWIF8FF:FSI(F8F PJYF(FF(F'LJ9F zJIBFQ(F >JDI4BI t,@𜀌F&X*TKXax(J2hVI 2A#2=QM$QN+aY0F4Zho e232&#2AK/!h0FF#p3xC>0F0> ? /!@FF6#p0C>@F0l> .?/!0F#p3x+?>0F0U> t#2J[FI,( 3h\I h2oOc2*2!x,-!;E(Ȯ !TN/!@F"p@F HpCO2hKax6h]//!0FhJ3FIHiHI 0Fp! F Hn.0F j H> &0Z"OSKEr~HzHzKOR0FF HEqH:!ESBoH0F , #s#2#2]Kh0dI3YKh2[+?F2ñ2+ 2+2+2+2+2"#LH*2?N*"GH#si3EH-?ڭ@W(03a2k0i 8@pCO#22K232)C2%+!!20i+r,O@C:Fc(`U9Fh+)%H$R-"#U!>#>*F0\ F(FU!>07a FHf(-1!\N by!ȐȢ#@!hgɄ7a(YЦJFhH6h 4O3`" `01i`HOr_H: 7O 4\Os`$7,('?+"2"2OK(vh`uh@(F\ (@*FDI ~2h+D> 0>HZ@ #XOq6H1i Zxw@OGAOX# CS47F2,72(7Os 72$7wJI ^0qHJIh R0fHLHFAF-@!@)F HCF`}Hnh j`\_!p!! uɗAdrAde J!  J! VJ1E0b.̀222222M|2+"2"SC|2)F D PObB|"ZB2I#!(*@lh'IFxhFG#KF"##6a1I\.(?G`F& 2F@ 0FЖ1*@+>Жґ *й2і!z!b#B B #[Er ۻi3ay#FBOrKHHK"b"a2o22?+#?"2Ca"@54Svo((F \'8F78(>0F0>HF'(9>->2[b #C$H2[bFFQ #C Fh@P/K2+Ǯ H0  !x!!h!6!K)F4PFAFCCFE \ 0F(@2B ## B6.ѩKoOb"Rm(sOQ #BpOc|23P+"2j{KZiKiB󞁓I +2+L2+HH(A`OkO '&OgBFHF2Os"}H#BFg2?#"vH##"#BF2mH(dO"b* "QF0F 2+W2+SUK? F2+@)UHk(@!SHxO O'&#[FgPFPFHFN(Д111111119JO  0c 0B 23222+@׀+H2O0w88$H #H8"H"H  |( xiS?pIXFJd!H舻In!x-!@fʴZˆ!6)̗!!hP!}ʚ˲)@FO BCI(D@F`>>E.2>O >VF&>3IFF>\˹FF! "QF0Fzi2?pAF!Htu2+ͮ2+ȮKXi?YFHZHG(HH?(8H3I¹PF/F?Fŭ Hy5-!̼!h-OL-#MFJFN0#F0452JAF8F CVѣIKhXD#K`HhD#0Kh '>FPOal*F`:/!(F,F FPOaK `J d(F4Fp(FFHB FF( Oal` F(@À~Il n(Bd(2P(GT(JwKwIFwH f($l(0hTt(_p($q(эbHOx(~y(v(^JShC\JShCS`c0C0UJShC S`RJShCPJShC0+?F:!XF(OI 0#pBJHYF/YF( F!#h ?I3h x =In*HO=Khu! (8I 1KhF4I &РOp(f(n( P(x(y(q(#;`#+`"J`!K"`#+`;`#+`#;`KT "AFT { TPF T FFXF B>F=0F!\!`!T,( /KJ-OFF ` p8# # DJO#I$`FJ;pKF ```J1F(FVBF?ѹTKxKx#H$FKhMЌKhK"`! (ЈI KhI I \O-󹀁Kh+ @F d+o3U+F+nP+B+wKwIhF(=A0a+2X+b+OjJ4c+9p #hhIhK(6`p+^m+>n+Qf+#;ptx+^q+^Jh3y+Yz+[J#`aYIFj(@C9p #TIhjSKF`SHK!QH`BE030?#@J#JIhNIK` c#FFI hFEH+Jx3p*K"p030)K"`nO FH0&їI 4#h 3hdD4 #ĕi3+H0уIH0сIlL-hрKN""p~Kp~KpwK (FJFPF?FQvKvNȁh3xP5{+Xm (SjKx+OfKx+K3xP5#L (@2x -<јP5 +7  #"F3` c[F(F(@TJUI ih F-hdd6ܸNgܸAUиC߀@FKC@aBиbGиWAO $oC"##"#! "8h0q`+?l:hu=O ܸl&иs+иh7sXw[.۸zKp'KB FFG##LC"H?#3r<#sr9KpL5K"p1rKB?-0p;#r% Kp"1X2`g}2g1g2x"""","Kc (1g20sL $PuoC"!##"# " h01`c"hgI fKlOT ܸLиa`KCFsܸmnwиzWLUL%ULF2hXFE0RI\3hk;"SC[8)FFKJLI,F F F?F&0F0AJCI F>J@I0FW:J>Ih3=KOJq6J\d(f(D$u(* r(t(ѸI v(w($&#0)h x+ D(hFD4030O NFgIPFvPeIPFp(dIPFl(AFh(_Ih(:hYFFXXxh zhVI ~BOaq^F PIq #3h #F (5FY! FBI d AF(D0Z (D6B%B@I QW*F=HW*' @W* ,I ( F0FHh%I8F#`(>F %7Oa2Fq^pF(#3SBF 8F#F`FPW*lFpW*8F@(w,w[k5+5w wwu"BF(@FF(.ieI0FhcI0F@bI0F|W* _I'.h_I0FrhW* (?n Fh@F (W* Oaq^F(?  JIW*萱HIHH24#31F3XF #FRhkAF0FBF1h+2F:I1FOb P/! PXE(F0(DBr#!+p PCF U<9%J(F%Id((F I(FX0(F0F0DVQ4rKhFh @##+r$kIkKhFB#@'+r'9F@(F`GF*F`I%VJ0*F]I0+4F*FOa^jF(*FUI FOa ``$OcOJ9F(0F`nKJKIV0XpCODJEI>Kh:F!@H=J@I!(F9J la F:0)FFH@OZQF Y((RFAI̮;Kh0OxKC2:Kh+DKFBF)F5HSF#xY.JiFh$ٱ+'nEx FJFzC!I hx+F *ܼ6+Ob OS0oCObH=1"p'ts="8"D" "PJ OpOr JhB+ 00$0K_ORH0SO0( {Jh0`xKhF* 0+#tJuIuH#0sJhC0)Կ` (F"F1F uGЦBB F: h+?ܬ ,aXhbAF5(8F\Jd![M n la ,`(W ,bUIX pObl_pObORb'n0F`жDHZ, ?Jd!F F  :Hv9Kzh ,a4HhT*KhSC B@Ux#80ihe P0xZ" ,a tp8)F Tp(?N" FfBI BxC  (?8Z$ ,bIFI +?t3"P"8a"h9l"dwPp"X1 KO2-O- , NF`" FFF BF)F8FCFѠKhh3#`/Z,i5N,iF,I,D," 0hJ x"+гЌI S,OSV,gO,"#H##"1hKY`m,f,O]i,lb,"OSxH#Oc"1huKs,tv,n,#"oCnH##"1hkK0O yiK"`h3r#`m"O3bH#Os"1h_K`K B?[2h\I"#[H##"1hq`I"OSTH#Oc"1haHK8"oCMH##"1hQJK#c$"#GH4#1hC5K`O3oB@H##OB1h1=K3h-J4x+8I O #"!"!>U&`!KhOr`0$K@!#+r!@0FCI2F !052FI#(,>" ###f#MM#$,#Ob'0+F0OM;";ht#+FrF4Q";h^H##+r򕀜IRMOcQF0F*F_ڕJIzH00RF9F(FL*FIh! bF*FI_")FH L5 > >" ~H0'{JIE "}HHAF2(hOr4AF8F(8F0mJqI  dJh#` kI!>*#C_JgI CfIjndKZJdIXNG>* Hc!>r*#BB VI|`Q9h2" F0@ # KI#2Fr8a6r F01FCHO[YF YF(ZF>IԱ;h!h+KFBF1F5HF[F#xdPFY:K?h$F*}ѺjSF Z#I h-+FIF@F2"F0F rcB Fj J##" x=##EQFx FJFB-I hx~9FOLFEOx Oc4449FOP4FEOxOS *FO F9FFEOxPi9FOP FEOxm3-O&- FF2F! 'L[pBڣI N2F!  (9F0ћHr0јIO틋|FO6GFJQF(F.CюJh턋{@{џ{+H{{+o<(jIC84(_N25:RY?]aJhCC`"x ( ZI hCc8;C8;yhCPKh?qTHK x#  FI XR; AIh"x ( :I< ?hCshCSh3I FC@`0@;(hZChChC8;C"JxF ( IzOsBIhC_hC[hCCWA@bMR`??zG{#G\u#"H|,,("xF( I("xC+ yI[hwJCcvH`#hrJC rH`#lmK x+ ?x gIO p{{`I/<;+\I&PP| FF###C@8G( {( JIhHCHH"b<;D2=GBKhB>oCB=FOs,#x+#"xg#"8hY@K@ hFF[-@ҀBր +Ҁ5& 4I 3 2 1 0/.-,+*)('(O!+FFBh ўHvB 8;#"Oq0яH8;#"Oq0цH8;#"Oq0|H8;#"Oq0sHhՃ"x+"y+"z+d+{+"+"+;!'xy;#z;(#;+%YN(\I0D0b"!t(4TI5F1 ?!PH"@+OI63Bؿ#2U@\DP>"h{HF5DD@A"hB¿7KD 9"&hx1eapVrCӀ[0+#r/KhF`D haQ1C 6! "@ (#I[0k% [ "!(I h;# "!;F(0I+ "(#IT#"#"#"`"Cdݗd %chIFHK3FAOq(AKOq%I K[*F[&#a [#[UaL+'U&)U!F zLv<;B󏀧M )Fl@z틛{ @7 :˕LI H@ВKVz{ @7 :I`"2BWڵR݄I`.r{ @vKi[hyI`@՟`HHI2"nI 'lpN0@jI_JSiSSa+?0eI1F 5cPI{]Ip7{( H{ȿG8@HHI < 9F({*.F-- Ih+D8F?I6""Ct-#p+t ~h+&8F1H61H (I lt;x2ESh 8F~#NIFF#Hd2"B+?h@$?6C-A~8@@#xEE,###h#"# U#0+@2B`2;NBKasˆV#Chd2?d2u*FRQh#OzsSC H{K7{{{@{{{ Ճ {Nj݄!D@Oh23h2d2;d22[EX#zꈰH z;FF@Fk2Z +1(+<; h5rHC;&21h3SB2FFх"^#@C3;hC ZH;IFXH&RKCID +h 32NHxh8FEKh?v#&ꈰH z;FF@F EAh>6I HDIDbE  KD D0B  n#ꈰH z;FF@F !hJDz HD N|chE& 3+].u H)0F HF  z#E:e##@#};+ U`  #BF1F(F(?ix)6!#%')+-/13HAF(F&'HHH鈥HHHHHHHHHHHHH#BF1F(F(?H#BF1F(F(?ix) HZ(FHHHHHJ#BF1F(F(?ꈩH<#BF1F(Fr(?H.#BF1F(Fe(?rH#BF1F(FZ(?gix)}H}Hk}Hi#BF1F(FG(?T)yxHp#BF1F(F;(?HsH#BF1F(F0(?=oH#BF1F(F%(?2jH#BF1F(F(?'fH#BF1F(F(?aH#BF1F(F(?]H#BF1F(F(?)xXHhAF(F +&0++𛀃+@   0+.г H * D  ;8Fr;H  vF;#DXF  EoO   ;  3  <Yz1HXi^%Gs3=Mas  0  BF p.9;E RF0IHF(.HMRFIFP &'H D  4o;: # XH X.$Hv#&6ꈰH z;FF@F& H #1O0Ի#"-OFF`IxF-+4 F"(?ѨK$"`OOFF:F1F(F`C9ѡKhBv'>3FS}\(FW:FV)W/DDdn(X X'IF $I F(хK"@Z`d8( '*!$DtDO 0 DdDD4D$D$O OXFlG(FYF(F%)F F|bI .џF(UphUKhb "!QHXWI2F XUN[h "!+OHX2FQIMHX-7+F2FMI XLJMIMHX=#IJ#IIIHX6f!F&! "! ! ! ! ! 07I2F7I!O00h+1H*L!hF,J?F(FX@)I"FF , D &: !O0p0h+H .H)F FH0F6,$"., %7^DV+txi*S1(-OFM FHRK(FHJK`nh3x-+6`WF80FL0WF0! J`U+>FO O- ?ùK4;p=U?D;+ѤEFIDH, 4 i8I?H #"8H4H!OA1HV ;L .N4TU  FFSU FFY?G)#sb{hbKFBFo3,%^%ZEDE8%Yy"=O`h(-OF F.ݞNOL)F2FPFAќKhK `Kh*D"!HK`Kh+>ڔI f(S(&L( T(#d(ьK"s(n(q(шKt(v(цK"#;`K"`K"K##`K"uK!" HU&p/lKh+Z8F8F(J((dKh#"!F J! 'W!  W!  W! F W! W!F W!F Wj[3иАRI )(Ѓ/(ރ ("!FPF0U&0GK`xg*:K9FhCKOeO  7/>KhF@F62FAFyH4DxKh3wKhwI@Fi;h0`.>F6 F2FAF4DiKh3hKhiI@FK;h^4`.ـ>F6 F2FAF4DZKh3YKh@F-;h8`.>F6 F2FAF4DKKh3JKhMI@F;h@`.>F6 F2FAF4DzF6 F2FAF4D\-Kh3,Kh1I@F(Kd,hK&Kh3;h (FT(Kh+}'K"F)FhCF@|h7+xhFHvF[F#F @p&&b&b&_&b`&bp&c&bL&cP&bP&e\2?M[ly&eP&bTRL& &(&D&`&|O6@$h+@Cx+?+<iQh)8 2a  h0^&,.X FgF:H^S9KPF9J!FhhC8JhC7JhCy Z""B1F2H^Fh3+h+xg+,+KhK)I*Jh( F'H$x+$H.h+ XhFH V V VVVVV0 &cP&ed&b&eX&bP&b\x*5-GFh FZ8OL)F:F0FA$ѥKh.)$&B4&*<&"<&,&*Y8&*UКHH WIF k(7d((D()b(f('h(#46r(O(n("p(06x(!z("v(@60 6#$6#(6#,6#686<6D6H64&r<&Z0mJmKnH) FFU#PgI(FW (ZeK! a##xh`I_M(.]NOhO W(@E #3p#spVHSM#CO`XFOHH$T(?h1!oFZ(f.@;vCF@-?HVt +x++!.F0F77H4F(FBO 8`E~ub+Jhkxh320Zh<"MPC#FOxeHk 20 Ѹ:(3xFyCFOb1(F (?̮+x BӵB #5#5PFBFs+F9hF 5eHdK dH0F "!`HV#Oq BpVOgHC"Briڧ @TM85Ow&U U#BvOU 5nU#C<6+C46+A0?J?K)F>K >I1V P;H66[9H0 UO5#Bv۷ #"D"IEp9F0F{HF$ M&JJ,6{Or@a!HB"I(FhH dH H<646+z! *&fx^,%&f%ISkP+K,M@6+I*KD&(J3C,H&%J3C,$&#J3C,8& J3C,0&J3C,J `$H`X"F(F&*FIh V)F`H2KMY`qR,&-GpFlFH&ODRF9F(FDCGKh-*m(h(l(H(D4s(t(n(&D4DD$D00W#P".H)FH8 !+K+J,H<*M!(F(*F'I D0d %L%Os!h<0 !8FBI *FI8F(lh+Ibh8FI(I6!FI#33,*S&k Oz ty0 tC9D&(-CFh#FgLhNhO"FAF(FC2eKeK hcKh+0bNcK2h haJh:h+@_Jh*@]Jh*@\K$O(p`ZK`UDF(;XI De('a("A(M('b(d(KJq(f(n(JJw(x(r(=J>Jh3`;Jw`BKhBK`BJ9J7J2J6hn"F!F# F5L h@5I&F "h 3I2L&`#"FF@FF@@F,Kh0 +x+9FU(FV--9FX =D=Jh "2`+?eKJ``-^O y,&mt&o&o&l&m|&mx&o &l&l-&o(&o$&o  &l&o-GFFlIF4FML9F*FHF|A0ѣKNh7-H4iLI F I F  NLM2F9FHFXB:eiKh.( @3B)a( t(#i Kh#aO 獱3i{(Q `K$JO1 Oe`~KO`K`K`K`K`#`~J;p`}J`}J`!}J`}J`}J!|J|H`|J`|J`|J`|J`|J`|J`|J`|J`|J`|JpFF*F8FB ? VtuI2FF `sK#`rK`rHqK`qJ`qHFHoIV;(ZQK"`PK`BjIF (nJK"`JK`fHeK`xcK7J`FL#h;`Khx_H%`^H(X\Id ZKAWKXJ`XK`Bt@)K%`$,K`#TFFLLLKI FU!K`HI FU!K"`EI FU(J#`J`!F@H?I F(K"`$&+&Ҍ&<&$&& &&&&&&&&t&&Ҥ&&Ҙ&&&8&&&&X&& && &H*&Ґ* uIN&XUcP&&(gGH# c&4D+kEiiiieiiiiWiiiiiiiiiiiiiiiiiHiiiiiiiiiiiiHiiiii9CiJK"pBFCFѐH#F"$OhKhRK`K`KK`.X"!F}K!F0FPx8K(D (@phUF2FxILxHlwJ#`wJ`vK"`uJhC`tJh3sKsK"rKrKOb!hqHo? $hUmI"FF hjKkI`F(}RKhJ[K"`XK"heK " hbK(`x+?d_K_Ih V " ht[K(`x+?PUKWIhWK&hGVK "UI 8 (F  hPrOK%FPF`x*BKIHh K%5-"(Fc06H  )U#*K" h`BF#8J`8JN# h("h3I3K`2Kh?)1H tM.H+K.Hh*F-Iz&&,&p&&D&Ҡ&l &&&&h&&&&&&U&Ҥ}&<&P(&&&n& & &(  4 JL#JH#`` x `T(@SFpM+h3 j x(` hK`L#xùKhOb Fo𜀓K? hUJ!FFHK"pKh#HrK` NE "ILF "I(FH*FFH 0F"FF0FN 0F"FF0FN 0F"FF0FN 0F"FF0F zHzzJFzH yHryJFyH xHj"FwLFwH (FU !F !FqL  !F !F lI +@+:F MFeKh0FSF(G?Ob_I FoZe!  :!hȱh !NHNI nMI j 7!GHF(EI \DI X@!h(FPF F,FkFVOb9OF0F e6N[h # #03` 0;h+ *V)K"`+,"!F(Fr&&,p& p  +w      H9 O  e&Ҍ &Uѝ&҈&&&;h;h+ТI `KIh&& -CFh FZnK`BmK`lK`kK`jIniK)F F"` gKx+eL"! hbI , (;\I x0(09('v(,XJh3`)F:F FATKh.U#@,:PJ#xh3201 F(JI" a08 #`ih@F&COL!FOr?H<+F/ Fh#c`;h`M#s;`{h#{`Os;YNOsO3aSHtSHpRHnRI QJQK1hQH)FFZNKB`({LL1# NHO%,,Zo0B-e(Н mF0Ųc0230B0300" 8h1+Н3hk(Д BѴ0[ 0 ( (" 8h1KJK ( FF%+(Д0BI2&&&&&&&(22 &Z,&#+)TL-O]FFIFVйK"`OLĂ:FYF0FCџKhBDћKh(;?Kh4I(F6(I(F2(ёK"`V( ܠ1+ِJIHh*FId(O l(c(`08c``JIHN x!_xM `3x-+sxkh0[?+ѫx!E4FO  FFXh#!h+ F FHD0TFeH!F:F  xTF]H1F pCOYH!FO@ah+ FQH!Fx8F8PFT,88F*FH!F.xOb!FpCO0FI0F6 0B IF\HF"8F(0!F@,Hh+kh+)H!F#"8F#hkhOr@!0F(FlF ?1FHO khk"8FlO9A&8,<;58O>88888\T4FIF8FR8FPHHF~LHh0?0F!FEH*0!0F4AF1F?H yIF1F'7iG'7iV&'8im'*@} }i'7'8'*0-OF\LF&ZMhXI T&`JF9F@FC)SJTKhh2CW# 5(h(=U(GK!h FH(yDI f([)I(K E(E>IFF>H a(O Be(2K(h40J)h3IjFXFn(<i(1l(#"F&H`((Hr( u(#"FHP(!H#c`}+hJ+F#`#`tKp)h j&j+h J+F#`##0^lxiyh'KP(+'T,'T%/d'TM'T-OFF I(ڰI "LMŔ PK@/! F DJ F#xIh320T K"` 4IHMSO,@𒀛O&F%FFFDJAFHFC@𥀕Kh X# F@a| Ox0Ii 0:`0 0*( ;`(F"F1F Q  ,"mIkH iJ! P#BFrIrHs"!pH "!nH "!mH ӱkHF(hI8 D(fJgKgI(FfJFBFeHd "x-*eZhx-*_bxe*i.Wx,Si*k*e*L`I`G`Ee(BQ(^ E(?JI(.-( O Ba(*d(-S(?< Dn(?7k(3m(?i(;hx^.+[x+?'?+@!r(3s(4p(9h6HO 9h4H 9h2H;hx^- [x+??+;hx^,[x+??+9h ###%&$'Up'U@(T 'Ul~(,'U@th w('U+ٮ0+Ԯ i *̮0;h I0KI\tg-O$UOFF%FJFAF0F^C#PKh.,-=(FRX,7 F F.KX' 80FX' AI ,g( u(G(;hx=h+x+ -OͰFO$hFRKJF&F!F `O1AFJAFѠK +.E"0FF?ژI2F f-/b-e-&;wp-(z-*l-O3oB##"9hH  oC"##"9hH[F3F>h;h047FZ< 8FxFP$vN#"vI#"uK`uKXFrJ`0Z (F`nK0* P"`S!F(thIpC_(##,к/v2F_I ^I F\I "FOq F( " $ "1F F(MI S (IItGI 9F  2 0{! !F8F $  :I#F:JF(?e8I(5IB3I)F !FX).X) )I(I *O0;QF8Fh+ ;Ij(( p( X?, ?( `@th( t( x( |@l?@@!@E@O@g2G@]@@@ q@ #D B{cFZF#BF  (h+ ;aBF I} FFtOyU8+FJE #{нB%h+B ;4! PFS.0F@F$$O @K(-Oh FFeO*`Lh|I FxFXzHXFehB̅uI FfF(sIsHsHOr! FnK FD bO30430$1Br#FeKF #!`aJQ`ICFPF F9FA9\M>k>+h Fbee#FFAPF(@ #!`QKJ 3hBʁHK+!HJ F3 #C1F V(eN(V 6(;?(4(O T(MRP( #B`F ##c7k(+ g(,j(f(-Khbp("n()K&Fxq(x(%K&FnO kkSKh>cbK&^#[CVK&R#c###(WEWLVB^[[![I VV,+[(U}UcUuUC #!`QHO O)*@AFA=>Sx@SuB 'So5K"<=5%><*J<>g@U!QѝH>Q>SC$#C?XFLFSF! FA( #O k\ خHO +JцH*h 3BAF FAG)h# FFW!AF(?kFSF! FAB)-O [qH3 FF5kH FLhH FO1 #2C B +3+ZFcF? ##  QC@>O  C?VNH0DILH>> 8 (P>IGH)L3ZF ###AFASF#LC# 1Q-$hm(F( $ )F`2H>@$/K/JFS+!,K F,J#!`Q2O&K"$K%I>0I#H8>0 IH # ]FA#QXF>N01IHWLB]][Z[m[~[p[[+}[l B[[Vb@N2hREXF>$lnhIHo Rl(#03hW#>F! SFH>3hSE+"W#(FnZF@hBa`0 +x#(F"(D<6+O O XF<)XFO4HZ0$ Z`O OXFP0I3+T)B 1Q@#"3CbKhW#;803 ;/03[H>C:FQF(F;IF(F;,UH>7PISHh+LIPH>R FTCF+@%FJH>1FHFJF(T. . h+AH>>+h+=H6(F..ʭ # 1Q@~@3H0 |h+.J%I.H>@-H0 jh+(JI&H> FTF(UB$I!HN.?.?IFH>Jd%!  ! FT,0?=IFH>p"FH>k,B\\\;\C\T\e\\\\\\\\mO S&>;j+mHFS >6jmnBh۹*- #!PQI   = # QѫH>wj)[hnh.Yn F>1 # QUn&h/W " C' 3"Cd3.#.o &Wi w&Wc P!QI   = F<( FAFAnNh,Y8= ~IO ~H>F=3j#:FQF0FH=< # !FB@ #3"C 4K5NhW#`#C3JbFQ1K1FcF0H # A (OD F>K0?cm+ QLsZF ##FJ=# F>@f(?&\..(Fg]n]] B] !]#]5,W.W7W> +]K 0 0-0LQ0@| p00\@tpK0h0 ,0 010# 0 #/x 0-LM@TPK@L D0 % ,, @0K0=Ѹiѐi 00@-S* R  @ @ R R @P ST 0T800 @,0 0 000 @<\;;; 0-L@KM,PP0K0 t - LMQ K 0K #4p 0 S 0*0 K8t /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/}*/_z*/\w*/;t*/bq*/n*/k*/h*/ce*/2b*/_*/\*/9Y*/V*/S*/8P*/M*/J*/G*/D*/ A*/>*/;*/08*/Q5*/2*/)/*/{,*/|)*/#&*/#*/) */=*/*/*/"*/*/*/ */////^*/*/*/<*/*/*/T*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/4=*/*/d*/(*/$  0|*/ eu*/r*/ o*/fl*/i*/f*/Kc*/+/j^*/O[*/hX*/iU*/vR*/O*/L*/ I*/F*/!C*/@*/=*/1/ 8*/5*/I2*//*/,*/)*/&*/#*/ */*Q/*//7*/>*/ */6 */*///*/@-@+@*/ 7AxGFxGF JxGF.pxGFCxGFxGFbxGFcxGFxGFU%xGFTKxGF'DxGFxGF!xGF9xGF'xGFxGFJ 9xGFʮxGF;XxGF:xGFԋxGFZxGFxGFxGF%xGFxGFƲxGF]qxGFxGFDxGFNxGFk xGFAxGF xGFxGFHxGF6 xGFB$xGF 3xGFxGFxGFJWxGFxGF8xGF;QxGFxGFxGFxGFexGFŐxGFxGFxGF\xGFxGF:xGFAxGFFxGFY$xGFAxGF1wxGF:xGF xGF$xGF|xGFxGFUxGFIxGFxGFxGFwxGFExGFxGFxGFxGFxGFps_strings missing =(A})1+2y7k?aC=DDFmGNG 3J1`KMOPqPqo(SuUUUXe_`5c'dsywu'ox9|~1')/pC[uuy,'ޤԝ0֭y,8@ge;eAe~HMQR%qY!\$ ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory ]#1$"$@@$#=߈A$'y@@$-$3i#~M $:Y$@@@YV@@$Funblock and -DNO_CONV?|X LVTF<oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat%s %6sCan't get mount information1024-blocks1K-blocksonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-agln] [-Ghkm|-ihkm|-Pk] [-t type] [file | file_system ...] aGghiklmnPt:only one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %s Used Avail %%Cap iUsed iAvail %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %10lld %10lld %10lld %3s%% %8jd %8jd %4s%%Usage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s ????????????????????????%'*llu %*llu %s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)ifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... lq l}llllll]KlllEmZmm*mDmZ#md md_mv^mvFmv<mv>m?mmPATH= M^yty3ifBuduusx3icuumuuluu r\3puq*nuu vuB b   EOF reading here (<<) document8Czvz~zzzzzzzzzxzzzzzzzzzzzzzz{߈z[z`zeszjzpop.AsVsfs }-+?=M@|||||||}@Nsi|suslsosr||abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'!H0!1 !\1!48!0'?!0V!0]!0d-!0m!i< 2%| 2Wc*iTmR ;$  ? (~|>>>&<&<> && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchp:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Illegal number: %sCannot set mode `%s' (%s)HSabtfdscmlrpnvtoo many argumentsunlimited%-13s (-%c %-11s) unlimited error getting limit (%s)error setting limit (%s)internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeIllegal number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultIllegal option %co %s+-Illegal option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Illegal option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Illegal eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sBad file descriptorCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# PS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... illegal signal number: %sunknown signal number: %doption requires an argument -- sillegal job id: %sillegal process%s id: %sevalreturnshifttrapbgchdirletfcinputrcgetoptshashprintffdflagssetvarumaskunaliasulimitwordexpPPID20181212 BUILD:20260402180431Z SMALLNETBSD_SHELLUsage: %s format [arg ...] incomplete escape sequenceunknown escape sequence `\%c'format %s too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed 3 &X 1P&  M^~oz:"bt{w[==e/}eei2^e<1&l9=)-0%\Ne #3#3"2!3(3'#nHOW _@,l@fv  @4| C$CC$CEKRY{=ai@@r  7/@ #*19 @@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gTIOCGLINEDtcgetattrTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.^o'Eat@@@@ @@@"@'@.@= @3@9@B@J@QV\ckqw~ @Ā@Ɂ΁؁ށƁ '-ہ3:BIP X/38@EKQW^ei0A|ou/_is|BA| '/7=AH\R[bkt}/38@EKQW^ei0A|ou/_is|BA|/38@EKQW^ei0A|ou/_is|BA|changing %s byteorder to %sline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environment%s: unknown machine typeattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes failed to read bootarea from sector %uread sector %u len %d looking for labelno space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] 7Usage: %s device %s device command [arg [...]] Available commands: rwnot %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. forcesuccessfully scanned %s. %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s Wedge dk name too long; max %zd charactersunknown command: %sstrategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s'unknown command `%c'J.J]s͔ͧ O n Ι ε Δ2EϤϸ 3!r%#r%$C&r%1r%2K3r%4r%5g6r%8r9x9:И;в<=@A BGCsDњEѰFGHJLM NO P0QBRWSqTzU҂VҚWҴ\Ҿacde@fTgghgigpnqr%sr%tr%uӄvr%wӊxӞӺ!6EWxԘԴ !;YkՂ՞ն888Xxրq֍ְr%r%r%r%$=0Tgt׆נװ%<D\q؎ئ5Iiلٟr%r%49La{r%ڎھr%(4Wۇ/%lu/%luusage: %s [-aBFfIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1Can't read %s partition table%s partition table invalid, no magic in sector %lldsecondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld decimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. realloc [n] write_disk(); wfd == -1Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Sector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsExtended partition busyExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionOverlaps another extended partitiongiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d Partition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Nested extended partitions are not allowedThe data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafiIluvA:b:c:E:r:s:w:z:bad disktypeBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s size (%lld) is not divisible by sector size (%d)DIOCGDEFLABELCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]'t#'t/_is|BA|returning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo blockUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFbadCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directory%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 Invalid long filename entry for volume label RemoveInvalid long filename entry for %s %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersInvalid long filename entry at end of directory %s No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check          @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s CLEAR (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %lu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %s** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** starting CAN'T CHECK FILE SYSTEM.Alternate super block location: %d conversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'MISSING '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%ldcg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONG (TRUNCATED)TRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****cache missed %ld of %ld (%d%%) cannot allocate quota entryffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %dw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-)111112+242]2ga2/6`556 6!636G6U-/@----..0.H.`.|./X...//$/_is|BA|J.J]s͔ͧ O n Ι ε Δ2EϤϸ 3!r%#r%$C&r%1r%2K3r%4r%5g6r%8r9x9:И;в<=@A BGCsDњEѰFGHJLM NO P0QBRWSqTzU҂VҚWҴ\Ҿacde@fTgghgigpnqr%sr%tr%uӄvr%wӊxӞӺ!6EWxԘԴ !;YkՂ՞ն888Xxրq֍ְr%r%r%r%$=0Tgt׆נװ%<D\q؎ئ5Iiلٟr%r%49La{r%ڎھr%(4WۇHFS0eC@UFS0eC@!haHdInotNeedEFIAA*s(ҺK>;*AQn|n֏- q+AA)Qn|n֏- q+A8ABQn|n֏- q+AOAXQn|n֏- q+AiAtQn|n֏- q+AA=Gry=iG}AAM;t?AAWmCĄ 3KOOAAyD¢<#*=(AAРD3h&AA \M}-BB-ıܹчHB*-ܹчHB?IZܹчH'tBYI􍂱ܹчH#BlI􍪱ܹчHABwI2ܹчHB'S@ۿ )ѸBB1*@ە )ѸB1ۏx )ѸBBa:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuidCan't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:partition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size]New size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverError reading backup GPT information at %#jxNo secondary GPT header; Run recoverNo secondary GPT table; Run recoverDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?] %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:sector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidGPT_HDRgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsZZZsetifnwkeysetifchansetifpowersavesetifssidsetifpowersavesleepsetifbssidsethidessidsetapbridgesetiffragsetifrts`````0`2x`0``2x\0\\ؑ *2x1(`0x`0,`ԁ2xho0\ho *2x`0x]0H`i]]ש\b\b]P]PIsetifprefixlensetifflagssetifmetricsetifmtusetifnetmasksetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandusageprintallstatusmaindo_setifpreferencedo_setifcapsepiz2+$iyVVV2xY5 ?VV2xk6r6`Yx5hLb6`60iy2xg4i2xi5i5i2xi2xiiiii iij@jjj'j/ j80jA@jJjSjXe7j]jc ji@init_current_mediasetmediamodesetmediaoptsetmediasetmediainstlgG l$gG`l/l7@l/l7lgGD*$media_statusmedia_constructorklk7@klk7@ll6lllk7llk%7$)l)7ppaddr_matchccuyMccUsettunnelm92xm?7print_link_addressessetvlanifsetvlannQ8PnWn84nVnW q+SIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockSIOCGIFAFLAG_IN inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeNONEWEP40WEP104TKIPAES-CCMPAES-OCB%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211BSSID/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211CHANNELSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: BSSID too longmalformed BSSID: %sSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS CFPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM ???unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAaf_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6link0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtype [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] mediainstSIOCSIFMEDIA mode %s instance %d media: %s status: supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno networkno carrierno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctlSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagАfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@xxxxUx@xxx xx vxxxyy$y9yLN[ y[@ygyxyy@yffs't#yyy'tyyyy%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousautomountedextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdup|"|,k5+x2s|7v xx vx,Tv@|>|E|J|S|]|a|f|m bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.|"|,k5+x2s|7v xx vx@,T~1v@@xxmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %sreload|"|,k5+x2s|7v xx vx@,T~x@1Uv@xsoftdep|"|,k5+x2s|7v xx vxv@usage: mount_kernfs [-o options] /kern mount_point "%s" is a relative path.kernfs on %s|"|,k5+x2s|7v xx vx@,Tv@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %s|"|,k5+x2s|7v xx vx1,Tv@3 @"{e&  @@|BH,Q[e p@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s,T|"|,k5+x2s|7v xx vxv@xxusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o Ft[r3i|1c)%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%uCannot resolve "%s" (%s)%s only supported with IPblocksignals: sigprocmask%s (%s)0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()ӻǫǧǣӿǟǛǗǓǏNjusage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Checksum error %o, inode %llu file %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%llunot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY-W =eUPBROADCASTDEBUGLOOPBACKPOINTOPOINTRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecFPFP*0 XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printbitmask_scanf6 )/>)L1dw|ee Y'3@RZry *2*Z*u*)))   +6=BUL:AFM%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x0x%0*x0x%0*llx%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)%s: this type is unknown to this program ...(%zu more bytes)Invalid port: %sPort out of range: %s%s: !returned size wrong!%.2f %.2f %.2f hw.ncpu%d = %lluuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu 0x%llx %lld.%9.9ld %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d regcomp: %s: %sregexec: %s: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpfetch_url/Qsendrequestrecvrequest+"F"J"N"R"V"Z***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbervbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20170803malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gzqqq-S SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i#'('+'+''''~0;'Zi'v'}+'+'+'''.'+'`'t''''' ')'7?'Ze'y'+'+'''+'''+'+'5a/_is|BA|NAME=#yymount_disks       !"#$%&' str_arg_substget_available_cds /_is|BA|edit_fs_type_exta='35 0JAcysmedit_and_check_label /_is|BA|disklabel_freedisklabel_change_geomghxca=)CݽYIޟܙܗUEuّsMUٍىeWAdisklabel_set_part_infodisklabel_write_to_disk0 9Xouter_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var normalize_clonesreplace_by_default''Ƞ'' !"pm_from_pepm_whole_diskgpt_create_newx r] r9 z z {a z y v sM s v v)  ps q pO t p pMU  ! }  { qE p m q w+ w p'tAA*A# A@ABBB ;/[F;;;'t#;;By;yy;1A|yyyy; B;gpt_get_part_devicegpt_get_part_alignmentgpt_free)12+12]a Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - HFS0eC@UFS0eC@!haHdInotNeedEFIAA*s(ҺK>;*AQn|n֏- q+AA)Qn|n֏- q+A8ABQn|n֏- q+AOAXQn|n֏- q+AiAtQn|n֏- q+AA=Gry=iG}AAM;t?AAWmCĄ 3KOOAAyD¢<#*=(AAРD3h&AA \M}-BB-ıܹчHB*-ܹчHB?IZܹчH'tBYI􍂱ܹчH#BlI􍪱ܹчHABwI2ܹчHB'S@ۿ )ѸBB1*@ە )ѸB1ۏx )ѸBBq ==>xA>A>& ؜>0>@>P >c>qinside_ext_partadjust_ext_partmbr_init_default_alignmentsmbr_create_new0  O U U  o U a 5  A i Y C mbr_get_generic_part_typembr_get_part_devicembr_freembr_read_from_diskwrite_mbrmbr_write_to_diskmbr_add_part/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6) [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 9.4_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksmount point (or 'none')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-9.4_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-9.4_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-9.4_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-9.4_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsSwitch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Bootable flagSafe eraseUndo changesUnconfigureEditForce umountAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionCannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (ADI_BRH)Kernel (INTERGRATOR)Kernel (IQ80310)Kernel (IQ80321)Kernel (MINI2440)Kernel (TEAMASA_NPWR)Kernel (TS7200)Kernel (RPI)Kernel (KUROBOX_PRO)There is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] [-p] where: -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -r release override release name -C bg:fg use different color scheme -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog9.4_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-9/latestftp prefix/evbarm-earmv7hfeb/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hfeb/9.4/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filesysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)%s (%s, %s)%s (%s, %s %s)-t -o disk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2 %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %d %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.craidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi/boot/dtb*.dt*./netbsd.ub./netbsd.img./bcm*.dtb%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10schpass -s %s rootsource for 3rd-party packagespasswd -l rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousdisklabel -r %sinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %spartmanlvol%.2dvg%.2ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%lliPartman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.c/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c%s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEparts->disk_size > 0parts != NULLgpt destroy %sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt %s %s -b %llu %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1138: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1100: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2100: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1743: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1773: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2067: internal errorparts->geo_sec != 0t != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2198: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI Boot***************************************************************************************************************************************************************************************************************************************+"F"J"N"R"V"Zusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_handle1control_handle_datacontrol_writeonedhcpcd_reportssiddhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1Rdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_geteloop_event_add_rweloop_event_delete_writeeloop_q_timeout_add_tveloop_q_timeout_deleteeloop_exiteloop_requeueeloop_signal_set_cbeloop_signal_maskeloop_startxsocketif_discoversplitvadd_environparse_optionSb4c7deEe_feIg`nh`ijjkeUlkme_noefpqreqsex4Wt`uCvew\xezyeAeBeC^ DeEpFeGeHaIYJeKeL$MeNeOePeQۙS+TfUf VfWf!Xf+ZS1f:4fC6e>|-U~fL}fWfUf^fnffffffsscsffciffkcMfffffggtgggsgg"g(g0g5gEdgNdefault_configread_configrt_compare_proto ! ! + +rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt rt_buildrt_delete  sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initsa_in6_initg_k[kkkY`t=kgetkmake_envscript_buftoenvscript_runreason0123456789abcdefdhcp_envoptionm*mQm|mmnn0nJnlnnno o1oRo}oooppKptppppqqq4qZq{qqqqrrr.rLrarwrrarrrrarrs s(sCsis}sssssssstrqst5tStzttttuu<ubuxquuif_copysaif_opensockets_os\dvvvif_routeif_initrtif_ifa )( PT@P HEPT$ @CDread_leaseget_leasedhcp_openbpflog_dhcpWbn,}dhcp_bind~v*~"yA dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_readbpfdhcp_readudpdhcp_recvmsgdhcp_dumpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1ipv6nd_rtprefipv6nd_applyraipv6nd_expireraipv6nd_handledataipv6nd_recvmsgipv6nd_handlera  h dhcp6_checkstatusokdhcp6_openudpdhcp6_validateleasedhcp6_sendmessagedhcp6_writeleasedhcp6_startrenewdhcp6_startrequestdhcp6_startrebinddhcp6_startdiscoverdhcp6_startinformdhcp6_recvifdhcp6_recvdhcp6_recvmsgdhcp6_start1 '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_dump/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: connected to Access Point `%s'%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version8.1.9--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 8.1.9 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-8.1.9 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware addresseloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.cread_cb != NULL || write_cb != NULLwhen != NULLcallback != NULL%s: SO_RERROR%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption `%s' does not take an IPv4 addressinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argumentunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleteddeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinTESTSTATIC6ROUTERADVERTUNKNOWNPATH=%sinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=%sif_down=falseif_up=trueif_down=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid=%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'%s: executing `%s' %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%snd6_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtsrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_USELOOPBACK%s: SIOCGIFALIAS%s: if_addrflags6net.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6fwetapxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: %s: truncated leasebootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s not foundNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: timed out contacting a DHCP server, using last lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: dhcp_open%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: %s: short frame header%s: checksum failure from %s%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired, extending lease%s: DHCP lease expiredDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired address %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %snd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_addr%zu=%s%s: delaying IPv6 router solicitation for %0.1f secondsreachable againunreachable%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.cdelayingunicastingbroadcasting%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f secondstimespec_to_double(&state->RT) != 0%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: DHCPv6 DAD completed%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: ignoring unicast option as not master%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to request information%s: DHCPv6 lease expired%s: failed to request address%s: failed to confirm prior address%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%05d %s%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6DUMP6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6UVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\B# 9 :) :-/ :E :]5 :uW :)% :; :9 :` :A ;BBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~P\T ]#)/5W)%; 9@`Atpl/etc/group/etc/master.passwdJPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pid !#$*0- ).+(/, '!% #34 :./, .   :       , /.       .  .  .=                               9%'A)*& , ./(&-0;51234<=>?C"DEFHGB$21678 !"#6$@8&&&&&&&&&&&"""""""""""$$$$$$$$$2222221222111\+GU9U   +: januarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresv0%llo%lld0x%llx%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar  O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME/usr/share/misc/terminfo%s/.terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X `%Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error C00`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz taf1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist