'Vei0NetBSD/earmhf ramdisk 08i<  i='t ti@@<@T 08i<  i='t ti@@<@TU it`AiiiAiiiA.iii(08AiiiWAiiiMAiiiOAiiikAiiilAiiimAiiioCiiixAiiiyAiii$ iiimC!iii (08@HPX`hpx$Qiii (08@HPG$\iiiX`hpxH$Oiii@$Qiii F!iii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii4!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii B!iii B!iii!iii"!iii"!iii"aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii!iii !iii!iii!iii!iii?\!iii>\!iii=\!iii<\!iii;\!iii:\!iii9\!iii8\!iii?\!iii>\!iii=\!iii<\!iii;\!iii:\!iii9\!iii8\!iii:\!iii7\!iii6\!iii5\!iii4\!iii3\!iii2\!iii1\!iii0\!iii7\!iii6\!iii5\!iii4\!iii3\!iii2\!iii1\!iii0\!iii2\!iii/\!iii.\!iii-\!iii,\!iii+\!iii*\!iii)\!iii(\!iii/\!iii.\!iii-\!iii,\!iii+\!iii*\!iii)\!iii(\!iii*\!iii'\!iii&\!iii%\!iii$\!iii#\!iii"\!iii!\!iii \!iii'\!iii&\!iii%\!iii$\!iii#\!iii"\!iii!\!iii \!iii"\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii \!iii \!iii \!iii \!iii \!iii\!iii\!iii\!iii \!iii \!iii \!iii \!iii \!iii\!iii \!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii!iii !iii!iii!iii$!iii4!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iiiaiiiaiii!iii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiaiii?\aiii>\aiii=\aiii<\aiii;\aiii:\aiii9\aiii8\aiii?\aiii>\aiii=\aiii<\aiii;\aiii:\aiii9\aiii8\aiii:\aiii7\aiii6\aiii5\aiii4\aiii3\aiii2\aiii1\aiii0\aiii7\aiii6\aiii5\aiii4\aiii3\aiii2\aiii1\aiii0\aiii2\aiii/\aiii.\aiii-\aiii,\aiii+\aiii*\aiii)\aiii(\aiii/\aiii.\aiii-\aiii,\aiii+\aiii*\aiii)\aiii(\aiii*\aiii'\aiii&\aiii%\aiii$\aiii#\aiii"\aiii!\aiii \aiii'\aiii&\aiii%\aiii$\aiii#\aiii"\aiii!\aiii \aiii"\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii \aiii \aiii \aiii \aiii \aiii\aiii\aiii\aiii \aiii \aiii \aiii \aiii \aiii\aiii \aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\ !iiii!iii!iii!iii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiiiaiii!iii!iii!iii B!iii B!iii!iiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiiiibpf!iii $iii?$iii@$iii&$siiiC$iiiH$iiiJAiiiNmiiiPX$2iii`h $iiipAiiizAiii{Aiii|Aiii}Aiii~AiiiAiiiAiiiAiiiAiii' 'JY6%MjPdS*+cЗk5G,gN=Y6oe-S:iTO瑀H(vRxg?|7[ ef27Y;tADs-k47}jKw.Og6n(kMysShr>Mx4 q@Z ND0BS)be7#, )*~!!*ٚ<eBnP_ex&[6=]Pqct . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.2.102.1 2020/01/28 10:20:24 msaitoh Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=vt100 export TERM HOME=/ export HOME umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? echo '' # mount the ramdisk read write mount -u $ROOTDEV / # mount the kern_fs so that we can examine the dmesg state mount -t kernfs /kern /kern # run the installation or upgrade script. sysinst || stty sane fi  . .. catchmod cp dd df ed ln lsmkdir mv pax pwd rmrmdir shsttysyncchgrpELF(4!4 ((w (w !&& H4!&&NetBSD5NetBSDearmhf9 0-D D0 @@0@TL0(P0PEPP03/T0p)%,% -l ll0 @0LT( R@ppGppP`03/T0@S P )% -pL M`QK \1 T1`p0\0: 81 0S  /S 0SP 00S5 0@0@T*P0PEPP03/T@0@0T*P0PEPP03/U /L d0 00 P0 0 ~(%H`$,$% | -xLtPl@d`hPP 'F]pPOU P @X&| P-L@ KhޓH0`  BR` pR RDX X/ᨾ&& -pP  b L00CS0w`p@ ZE0S TX 0S7  0T0R0S p ||yx16@' 0@ LA\w000`00816@0?6 0S ![16@ 0S $p @ T T 0S ^p Ip0S TMwp -sp @000 ^ip T@?0 @&&&& -@Pp`0L M00S 00 ]P 00P@P p0 P00S(K @0 P0:T0`00 c꨾&&E" -LM1Vu/ @X$0%XS(0SKbP<0 S(0(` VD P$幁$0S;(00$0( $`P  \00 KHu5p$ P`Vp꨾&&& -LMPXqXa@T1tHLL$H00SE 0 L]P0@tH$H) m R |@PKp0: S T0 P00S(K_@P0 P0c0s 8#8T gT 5먾&&E" -Lz0 ZX& 000/' --LM` l0@  O9 A'I9  A{{`z$$(K KЫY@'>X& -L$M@4K00@K xP Ke  d1-000`QzL@ 5 7PP _0SP P0V;0' 'P P W+ 0X'pa_V pX_0-S tP`PPL@p ,PP0SV  4-&r|' -LM5  R  @P (K rpp |U@p5X`0S `50ST50S D50S,50S+ U%@E+00CS0P줟 Pp  PYU Q@0 P00CS0 0 YKL ps8\100 pp 4pPe 0 K \@P0@@ K K 00 30 -KP0 00 0 \00Sk 00 0 p  8p ]  p@T T1#0 C0 P< @!P @肟0S 2P T\10: S200 HH/ l+  T+ pP.K ?.K0@DS .KKQTT&@ 0 Rp  0S00S ttS-K ?-K0S -KK.( U0P  0T-K8@T \@@0 00R0S 0  0 0RKP @EP ll@0S LP@ 0Rt0l00oP '4-&'''''X&&'''&'' 0-LMPAK@A p  0K0U4@ h:P XXK0AK<@PAKA,(0P X4-&' Q0-L@ XP HH00P$($0P0K0h4-&' Q0-L@ \P LL~0"0OP$($0P0K0h4-&' -L0 VX&0$/ '0$/`' -L2 -L2 -L 2  -L2Z 1-LM  0 0 K4' 1-LM  0z 0 KD`' 1-LM  0h 0 KP ' 0-LM  0V 0 K\' 0-LM  0D00 K>`' ' 0-LM $ 0/ P2 Ks81& 1-LM (0 00 K~' -LM800 0 0 0 K'`' -LM800 0 0 0 K' ' ,0-`LM!A!qPU0 x! R0B=00 B  P_}0H!@!7 Q8A 40100 KPP 1=JP 000PS  $K 0p P4  04 00003/Q ! 7000@080L0D0`' ''#=7'Qdo 0-LP@|P00!QP800 ` p0 A R0SR ' '`'0  / '`'  - L0 -L  - L0 -L -L M@=PKh) KZPK -(PLU@𨝈80 03/`P]08003/(` -LM80@0K(3/P $ F008 : S( 0p K3/P   00 0K00 0 1/0 QP[0S 00ꜯm8@ p-@P`LM, KL=80 (0(3/@Z P,K0ZPKp' -L$MhCP` XSD @0 $KZ#K@30F 0 # p8p (1/0 QP$ /! 0P܃KR K0 <0`Mr<  ?P#K0#K0$ T/Z0S$ < 0#K0 r# 0#1!WK#! 0 ԃK40`# 0ԃK#$K SRtq!ԄK SR !$KDq P0!YX(:$Kq!! 0!#KKSR 0 0S0$0z{ 0$ #KKR 0K 0  Af> 000L0! PAaJ0 4(KoC(K`'''' .  -LM2 @  l* 0  P#_K0e0}s'" b%1#H}*K *K@_@XP0!!!! d K !@PKbUK " StRp d!dK KNUK " S$R  !dKK:UK # SR  dKK&UK ?8p<` !0HJ/0T0 /TX dp`KKUK $K'' 1N @-LI  -LMa P00@4p! %@8@0 (1/0 QP$ , $K`尀T 80 $0(3/P 0 PUP@Dd 0S0C0P.0  Y$D$ . ''81&k -LMxQ 004@  "80 @(04/0 QP$ -=  (0 80"K0, K(3/P$K80 $0(3/P`p#SR $ 0P2K80(P 0, Kl(3/pTP #SR !QP` p `p`'m P-0L 0@M00 0K0 K 4K -LMp K!&`P @PD|-KwUPKPNV@ -\@LP`UPE  .PPoQ' -ML M<1` Q Q  Q 0S)(Ko%0P@╦&` 0S00S 0  P p0啧'S D P0`N@T(KK@P oI>K0CKKZ P K A' 1-PL@ 1 QP p 1 ιP Wt pld1P `R3P000@1U@@@@PWx 00CS000   9 0@0CS000l00 \0U0 wWI< 8L ş' '('$' <X&P'|']t'\ 0-LR RS 0S Rt0'# 0-<<@L000(!S& PPP P100 PU0P0SU0T@'00 q 0LPPP 0Pp0P P0CPU0P  0|'P'@1&t''t' 0-DP@L00 00@0@000000't' -`LPP@ V< 84@0p S@Dt0S  嬸PVu 80000 E0T0?x` 0 VX< 8L  @  <X&] '$'(' 0 -0 L?0FPIP@@QP  0P/S0 @Pt)#p` `A\0PH t@H'l'0$\'P'=W$'Z -`LP P|@ @V 0``D\8P PP  ? P@P 00@$'P'{X&p '(' D0P-PL ,@ P  0 0$'P'  -DL@:fP(0( 00000 Sp'&'0'@-44@@00  AR   P'0'//// -P`0LSp.@l000PUb 00CS000  #0`0CS0P000 <'0'@'|' <X&]t'A- px0x `t0PF@0P\0U00VXUp000'4'@'H0-D @00^P0 0Q00'8'@' -PL Mp 4KMUt2t"RP4@K 0K)@P(K@8b P PUT  PtP00 :  R R1S7QP 0KP 00SYA嘑S@ @@  P?T\ XT00CS0<10) 0`00SQPT 0@0@00S P P  QP 000CS0\00@0  Mqd''T'&d'|' <X&]t' -@xPx`0L00h0@`0@\0@X0@0@0CS0800 |'@'4'8'0'<'t' -L M@p0P U U[(K `P 0崀 尐RP00@P0S1P 0S 0 J0 0 {oP P@TPd''l'X'`@-`0 @CT`@ pT00 P0S@XX0X 訾& -L M@r崂0SX pP_0`^ `Vx000l2Tpp`2pp00 P00] 0p0CS0 20d Ub10P 10 10Sd 10S` V`F]Z 40`0CS010?PU0 Pd1@ 00CS0 n 0 P U !Q00 000T````P0 PS" w00CS000 0@ 9S l hlh``(KT (0`0   0 'L'|'D't'l'H' <X&] -LM$R< r000 040 200010S O@1a0<@0 0P80 @0(<0I?oT20SU 400 SRP @0S RY@T  Y 0 0  4 00$10S@@ @0 1 P@000CS000 (K VS  v0P  BR p 8 @0S Y04 0(H'l't'''|'X&D't' -0L!S@`yPPmR? 0|EpP0!S P QR# 0HHH <00S ,w$0@{X& !'9' -P@lpL`V0S vP R$ PD蓝' <X&> -L MpP0` 00 R O@ȐȠU00U0S 000S D@@P(K 0R R L R  0 40 P40P@`'t'l'H' -p0L!SP`@P`Q 0@' P0!S cP Qi 0LLLM @00S 0T@G@{X&Ph'9 -PL M@b00CS05j p \ @T࡟A܁00 001UppppP0 #OQ! v00CS0Jt10 P0@P@0 6 0p0CS0100S00 R 000 0 0 (K0@ Q h8|, 0`00\0 @`0T00T  ꨾&x'T'|' <X&]t'l''d' -L M$p0 P0 SPEUP(KE P 0"00@S0 Ub  PP  00C0S.h20 & D00CS0$200 &I 0 C00S P䡟PEP  R R  `V' V ,x4 P4  `P2D @< 00C0  BR  !  HY PFP 00 C00SPF V0000VPPPPiP 0P0CS0<00tv00`Ad'l'|' <X&]t'T' -@LP`p @`U / 0@SE@ @^R00\P0S \Z lk>P h0 @@P*0@00H1&& -LMT @0D KP 1[S( 0C01[S 0C0 Kt'ht@D1& `0` 0-SP0 R0LRP$ S \'X''t'# -LMPpP@ `X 0S@ @0S @T@@DT 0 rP 00S 0 0 0 P(K'l't' -PPLpb t0t0S`@T>P 0 PP@ P# t'' T0-0L0084 ,0aA!R   &'' @0-0L00 $0a@ Kh &' -L M䂟Pr0 ` R  36㤂嬢 @-T @%T[ . T $T T-00  R ,#U\ 4 N4  @q J4 N4 "QD  (K``+T ('Tc V YB! R=9T0T7*.TI /TQ3 Y /DoP Q  ?T ^T ;TQ 0;T000 0!0,^T-T b @^T-T  QAN0 0T!@r6N "RQ  .T  <0Q 00-Pd'&'\'t''# 0-@p0P0`娀L00*P 000000 ,R;R 0S  S   0;SRp\'''X'd'p@- 0 P@@ SR@@\ paVQ B0'' 0-LP@P M, ($ 0 00 <X&] Q-L 0Q\SAo 0- LR,  @0`S! P@pP &IPP F@P 0 S@/R/    r0 yt't' ,0-LQ  @t' 80- LR\ @t'' -`q匁L10SPW h1P00S S L!`0`00P0S00 S@P0.S0 S 䐟@ 0007PP 00CS0$0 \ V  T d0 00CS00 `P'd'h'T'&t'P' -L M 0`R`FppVRQ0 0@00wtp00 1 10S M l1 00CS0M=?(K iP00CS0+  R  YP A R#;`8p p  R000`00C0@\0@0  p`'t'X't''h'P' -@DQL81 0R``S`qVPBP@PD`B@PU.000]P 00CS0)0 {" .Y P  h0 00CS00PU*P`X'''t'P' -Q 0L0@0P` 00CS010 5* {PpH0SӉ00S c 0@D@@C\0pT0 0@0CS0t't'h''P' -L M2`0pSROPB U$t0 @Sl000P2XPPPPPRvKH  00CS00& t0P  R/ R 00 P00OK! |v00CS00    BR   C0P0 P0CS00 C P0P0`F`05P  P  X0 00CS0(Kt't' <X&]'P' -ALpXP `0C AR1 0 C000`PJ 00CS00  Y00CS`00 \R pR pt' <X&] -L M0D00 0@S 0S $0KePp(K00$S/T SPPP ( PgJ9 00CS00  0$P0CS(00! P(0( 0 S- R0003U````rP0 0`0CS00 (B#0P  !@o!S? %S $ Z)0(0043UAPI *00CS00 k0$0CS(000( 000\Q0 0 PR$ $ R0(002UP 0$0CS(00WY0 (0 0S 0S꜁p0$pS Sp|  ( P 0$p0CS(00*,0(0P E S:p00  ,0S p E$0 P (00PE0 BR0    P00(0PQ 0$0CS(00 t'd' <X&]`''|' ' ,0-LQ  @t' \00-0LS@ 0!S 8(FP /7P 900t' -LMA00 S1"Q,q`WX0|0003PCH 00CS00. 7000 @P R8 R  KPK0!S #P @ j 0 Sڼ P0,q0CS00000 0 0  \00mP 0  00d'&t' <X&]!`'2 -P?L0@ @T@ "C`hV  1QVB EVO !Va =VE V??P? HV PV GV cV WV aV VVeV :fVx gVqV 9lVb jV1 (o Pp  @ 0n\O p\H l\I 00 SnV f:pV|>qP 0nP pP lP 00 S ? quV1 2sV8  >UPvn NPo>0SH pW=0W@ 0nQ  pQ lQ 00 SCh=0Si vJwV /:xVs zVs<=$=P<0010CSx 0nP pP lP 00 S<<00S@0 0nQ pQ lQ 00 S   @@<<0S \<2PP@NlP 0nQ pQ lQ 00 S;0S ;;dP@0@@pkP@ 0nQ! pQ lQ 00 S;0S <;;;P$+0 S00@0@@* R *4!R@ * R4 000@ `P @ 0nQ, pQ% lQ& 00 SmH:Px Pt|P@0S!S  >0S i,0S,`\ N@0@@KPRk t9 0)0)0t) R000@ P< 0!S( @ 0nP pP lP 00 S0S >Nq@0@@|x@TD8PG@oGFBoP㨂VVP 0nQ pQ lQ 00 S000C@0@@70SH 0nQ pQ lQ 00 S@'0S! 44z@0@@h70S( 0nQ pQ lQ 00 S,'810cS81@0@@0S@@0 0nQ pQ lQ 00 S\60S@@@06^P 0nQ pQ lQ 00 Sa50S55P :c@0@@@0@@x50PQ 0nQ pQ lQ 00 S 2X505vP@:@0@@4 P-tdP&40SXz40Xv X@@ X@TH 0nQ pQ lQ 00 S 40S@0@@3P 0nQ pQ lQ 00 S  @0@@ 0B  30S3@ 0nQ pQ lQ 00 S3 R" R#  @0@@30S0 nR pR lR 0 S20S@ 241SqV@@000@ t20Sd2 X2 `P~ @ 0nQ1 pQ* lQ+ 00 S_10SR,0S0!S ,<0S,0S a1LPS 10S l1 @0@@la0 9R'0Rf* RU T( 81D0"Sh30   \  R]\0 -LM⤁`Pp0 SS(1PG(!RJt,000d1U````@P.uBG4 0,00CS010 [S@ \S @p@P0 S|@ 0(a0CS,A0t00,A : P0 0pS 0(Kohd''|' <X&]t',nl' -(!L0 PB@ P00!@R60A0S S f`P@ P0P 00SH$@0@00 P0A p0\ 00!0AP@0A0 , (d''''' <X&] -L M"R0%Q Q0Q0(K N`AQhu Q@%PoA2 Ry 0001T````P\tAF 00C0>\QK@ Q10S xxaP2 00P S,00 S 0S00  T````P004A g[00C0S{00z 0`00@hp@X0`00CS0400cH 0@  Vd''t''|' <X&]h'T'&' -@䀟@0@L Y0Pp`@ P" 0 R00 R000 1BQ@@ @X@p@0"S,@gR000d'' -LM@40 3s`0 80 80#0 嬃0FSP Tc0003T00PP 0P0CS0H30?A 30 10&SM 0AQ 00CR@:` QP\@0 < P< @0Y@+ 00C0S @(KH20  PAQ \S0H 01BQC40 BR?  AQ 0J R@+` QP\La@ <0 JP<0@  ? 1%00C0PAQ T`<0  T  PP<0 P P  BR D ~  `@N''' '|'t' <X&] -LM2 @" 0P2 40S 0 0 $2 00 ?KPP (K@b8R 442S PS202 2pW 2 3   W ,(" P("g?9   B R30  \3  BR P3030S 0 y "70 Kz@P"2Q Q 000""2 0 0?K P 2$"Ph"PEp0ZnP" PWppp 22 DP2"N> +00C0S pW,ڼ1 (2   W , " "P "(22 >p lh2  B k<  BR 010eg00S 0  J7@|0p0CS000HJU ڃ?K 02 X00S 0  !7@ <72Sl'' '|' <X&]t' -pLM`ḁA0Q0C4 8 0< 1< 0 0C SWQOp~  80 4P(K5 LP!000 000 _P00CS000  X  00 S00CS0x00pP   PX''|'''t' -LM 2 B b@ prD0  0s (KQ0S 1 !0 000 PP@% L:!8PK J ^ 0Gt10S Q0D 00p0@0@!000CS0B,1: X (\xx     "     B   @  CL t'P1&''P'|'h't' -PL` 0 C,r 0h 0 `0 \   BP L @pT Sr@''P1&t' -P0 @0LRp` d00_0P@ P0@ @04(@0 4"@<, (0$$2@@' <X&] -L{0 X& -GMLM\5p PR@`<%QGK454A03/P (K:K,0C1: S<00W K+ @4tPD<?0GK4AfP:K,0C1: S 0S GK4AKP:K,0C1: S 0S 0S 0/S.GK4A6P ?GK4A:G-K0P8 B00S9P0 ]K @P  K0#,@PJK,@DK+ @E4K @0P KD#P @GKK4A @P /]Pp/p]PB90P="GZ9HY6U.0B~K pG0 G-K< B0 4,0K G=K<0C04JEKAPT.00 4,0K ICKAP K,LL)LQP!LSR G=K80C0 ?oR2  R 0S= :K,0C1: S7P6   R0S/ T,XpH DX00CS0 Pp  YX X0 X 00CS0 0 P0S ppWP 0 hG R;c 00'X~o&&X&\\8\0\8X X0-dDT V H H0R\\k8/0X X-dDT V HH Q\\Q8/X X0-cCT V 8 80R\\88/0X X-cCT V 88 Q\\8/X X0-eET V X X0R\\8/0X X-eET V XX Q\\7/X00-GX0'RT00\\70/X -gX 0GT V \\7/5S %R R S R0 S%S D\L\S R 00/0/0l'8' -LMQ | 50S50S50ppP 0@.K.K-K/K/KP P P P P P P T0SY \0 0Wt X0 s /K&K/K&KL50S0T0 NK45 B@_?5%KK54T 0S$0@B?ET 0P0 0KL0 .K $}K50H $KuK5x4D 0S0@0 -K KT$fK5H4@ 0S<$0@B?E@ 0Y<0 8 4  0$KOK5 0#8 KGK58@0 \ 4 @ C@Q8 CtK03/0 0l30S Xp]5 SS $\ L[ 0!43 @^!RS3 00 R0!W0 X`'*K K.KR0 0.K!KQP.K10 R0!0 '-K K-KR0 0-K  \ (tŸ0. S 0dŸ. Z0 /K K 0 K/K/K0 /K10Sk 2QD 0! K0K0 1Q? 0! K0K0 40 S00 4 0R t!P h1 P40S00 1 01 0`PD\0.Sv10Sr 0!f(0P0  0P0  岶0 嬶 R 1墶A`000 ?(K''''''VUUU+8'Քl'''"|' -L M@1!0S Q=PP# ?O1`V (Ko >q0S`l||K>@P 8@=8@80SJ D 50CS,\Y$q\ Y00L0S \0.S00S 0S 0S >s?0 00 00R0S  T?Y @%0 0(K'l'x'\'8'?Ք|' -L M`p 3+PY 4 K%P3[S&00&0&0P P6ȆF  Ƚp?66`F0S60S60S x+P `xD6`6` \Fr  P6 0RS8Q ,Q QQPQ QP 5 1@GPx$HT ,<`lthXȭЭܬ 4DLd|4 4 0p$0t$ H4 0P$0p$0L$04$0X4$0s0 0 $00$0($0#0# 3 0#0#0#0#0 3 7 3 0# 3 0#0#0|# 3 3  |3 p3X3 PPX3 P3 P208#00#0 #003 2 22+2 2  2 2 2 20"222`2000h"02 $2 2d22 T200@P8 4(S QP010S Z >0/S 040!0 R2 S" S# S1 H10S1 10S|10Sp100S`1`1V L0(K81000S$100S11S S S00x00S0`00S00ht@X1&''|'>t&'`'b''8'''''l't'd''x'''p'''''\'''''h'X&̜ hlп8\1& ؞@@tܜ <00-@LTP @@\0'' <00-@LTP @@\0'' -LML \0RK @xK+AK@gp6.K0 BE K 0K0 @^ 0K04@lh00S\00S AKD00S AKAKꜯjX&ow'p''$0\ 0S 'o -LM0L0S 00S00S 00S ! $K"pt $KhcKШ\0\@ X0R@`L0 B ?i& 0O''''|'`@-`0 @CT`@ pT00 P0S@XBX0X 訾& -L$0KMcMP؀ @Y00S  X $K"KtP@`pV#K0 #K R0P0 X @T'P' : S-L  S  S/ I* S  S%|@= -LMx1`@TXP !\@T10S H10S/ ' ,,K^p , K@00S00S( 0@0S00S 0: S@ K0p d0Rp0 B ?#0 0mT00S m''''p'''''' 0-P@LT0!SR ,} @ -L0M@ͪ<3830S` s V$K!SR{ 0XPS !,0S '20Sk 4 "; $@Kp` @ K 8Ks00 8Kd\20S 8H (8420S  $ 0 : SI("2!$!6000 0@0<0?10SR 10S10SO 10S10S : S0: S f`yP1 H1R@1 B ?M/ 0 'Q @K@p~ @ K4`^4 z00S00S sP'\''''''M''p'''''d'' -LM10@S,0010S 10S40 0010S10S qP0S(Ko|0taQ 0P 0 `Qp 0 pPQpt140 W-1!SR` ,  80 R4   V 080R4 0 X P < 80 <  (K'''''X1&h1&P' -@10LS,0@0 10S 10S40 0000S00S 0PU,KoE`눠PU ,KoC!SR V ;`0,S4  pY`P +p'''''X1& 0-@0T,@0@SL` (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx 00S40 00@P0p0夀S㤐@W $Kk!SR U ,P0 00 S P0,S4  ePp ''''X1& -L$M @4K+p KTP 0@K QQS  (04K9!T P & 0-0LS``P-@P .P T5@P8- e2PXp' -LBMP- `IK1 K1@ĐU *FI?K JKpP(K@$Kw K? @IKP1w0S K?(PpPK?j@P@& -L] 㞾X& 000/' -LK0 ㋾*X& -L$M $ 0P ! 0$0A0 0P0!1 @!ԧd K,pʧ K "$ Ľ0P @0 0 0ph0!K ,pX   DHR"$  (0R'v{pi  --LMe@PQ ӼpPq >10Su  Lyp-ٽP 0S+ ҽP i [u00CS0Bp X ̔00CS0: p: YX p@K(K0S ᢽP K᫽PᙽPCK![04 R$tpB/K0 B0 0 P 0S  偿KႽP 0: SʼPdKq P H\0: SP pPڦ]0S 0㧋EK ̒ ۻPE \HP ᧻Z L實P <娦E?K ?EK 0S &KGK 00E?K  AG?K'  A{{zG?K E?K  0 ypyᦻK0KK0K ׻P @g ԻP 00S Z0;0 ȻP OXûP 00-S X BoPL᪼PxpW  H婾;pY@'X&&U >$2FS p-L M@$K`P P0P U $$% #KpU $\@$ 0 <P4 ջһ@l1& -~ML MA~lK0S,`F 0pKPF,H t0F~UPs/X! ~,忺P h/0!3P(K0 0F~8PV/ ~,壺PPM/ ~,嚺P0pF 0F~PYp  Q `H30 00FP#/>$ 3l1&m@j00CS0 ھ0 / -LLMDPp n000d$t000 0000ShDUd4d$P p P4Q !0SJ^,$*P.0$=3U0#03 p 3Q  # P0 0.0#3U0l#0P3 P#P .0<#3 3,# F$3PaP.20"20 0(Kmp 0: S|2 2 S"d K?P000PQ+(0pUUyU00u U!424"00,"000 S0 0 00&0 QP2.0S0 00 01Q>~, 4Up! R   `B^ PQU 00 $1~,s*~<~lp00 ;0  K0^)lVp0YU 0W,U (U&Kሀ|0`V K ?A)0\0``l1&'`(5&h(x1&h(1& %1&('EWm8@(h(1&} -~MLM@00S 4@0S~K~,APK'l1& -0L Mx@$0t00S K0 00p%0P -, 1Pl1&' P0- LR<1P 0 0 {1'Ȏ(h( -p`P@L ᣸PPEU`@T@ -p`P@L nPPEU`@T@ 0-@LT `ڤP0 So@P 0 Q @;;S _@P00T@ -(0( t1( 1l1&'h(9 -LM(Rp@`TQ W0q@$00F P000S S1TIT 0$0Pڀ;;S 0 00$P0 P?P@@00* ,0S@@,0ES,0SP,0 S@0@K,0S ,0S ,0S $0STڄ00Q Q`0T( L0m,(00 0$l1&'Z h(9 -LM\1 R*PA R& D!  BR8 RQ:QQ6R   K $ KP000S&B0% Q`PV Q0P l#P0 0|' V0P#P0  $0K'l1&5&Dms -pP0 PL M` (K@PڼAQ#P0 0QP 0pp#0P0+< 30P 0Sl1&' -LMA`pPP:x10S8 SV0\A00,V00 s#P0+!/ P0R(0S 0Y#P0p+ / K Pڌ0V 0?&0 dq/0( , KL2K.PL+(0, /l1&'6ch(m -ML KL"0`,@7 K,@{&K ,A0S 2p"0  2& 0!0!1I-K0 B00,K0< B01I-K(0lK0C0X1I-K,`F‡ BF}K0,pG4! !0,K8 B0!I=K 0C0 K P `:8!$P[?K_K R0 d!R MP0PP(K=]K!SR 0*($WK ᾬP:8P N$G?K(KSR *0( T(1&'EU} -@L 0SP`pPP 0|000 `` 0S0 0P$0 0P '1& h((( 0- @PLM"K0$K@a B?P 0P0 1p_0 G1"0, KPlP"K@T#KP 0@P#K 0 0T0 @P0P00 P 00T@P'h(( -P`lpLV @P[PPEUPP@@  `F' -LM=Ё0`QP 0 AK֫P?D@TL0 q 0@ 0 X0 @P PRX00K0 0KP$0V R =P0 X040 0SP(K 0 '#L 0 R   SQ0XZ4 S <"V0 0 '(U -L M10 P0p㴑a|Q9 @_0 Z p0-   000 SJ P08l" 0P  1p 0 @00000Tp(K00C0P @_0 0 0PBp 00t00Q pQ 0 P0   0 SBp(x(1&',( h( 0-8@L0P0P E0PK0hl'1& -pPp`LU @PL0YP U@@0 q00pPE'1& -`pကLV0 @PX04P_V0@@0 P``V00p'1& -LMP =@a  UK2X10S UKiP:8(!! V00" J(!8 @P0P`$K?V  ᶨP0`VK4PJT8X E?K'KQP J(@ JD8, !`T(E'o1&^ 0Q0-L0JTUPP'0P !P0ϩP4$ !T0 400( -LMPKéP\0@T@ K [bWV *KQP ! K@x( 0-LMPK@ឩPK000S0: S|PبPU 0D 3!kP 0 0 x(  ( 0-LM@ K+K 0 S 1 PR 00SKRP#0S'Kt,K 00S&Kd+K KᖨP w0NS s0T  K0k08 0SKBp5&5&V: -L@P`8P  P $0 C0  褎( 0-!L@קP0$0 -0 K0h ꤎ( -LMP0p/S`/ @P: 0K0ͨP/00 p /00KᲨP&  P!0S  ᒨP K᧨P[0 KD/00`v (K( -PLP 00/S ,AP 00Q ,Ko xJP00  `0S c 먀娐p0 'P0S@$<cPPH0 4< PTg( ()<((3 -LM`PK@p$P210S K+KQP *KQP g0: SYP PP=0 PW ʦP ) P W@0 x(D  bs -LM:(4P: S=!R `V000K @0K⹧p 0: S , K00 Ku:P/  0 g -LM`QHZDT@<P0H!8@1P @$<b$10SP-(u00S00S 0 00! "4S `*P`0 >0p 40 K(S(LpPa_000((X(5&5&(g( -KMLMZ#Q30`@ (tp; 04 40CS񟗯d!##$###3YPp30S KA0P4 4: S ;Z!P +Y Y30S 0" vBK" AgpV0"Z 2P @$<댒P ?o20Sn(4`S42TP ᒦPuKAᦦP`0 "S0 + 0S10S 4m0C?o2 000! "(K,0K4BNK4@ @Dxz=0 CɥzBz 0&p P@@$<lPl84S(4R0(4 $dRX00>0S4(40S0SD00S 0Ȏ((<(3(X(5&T5&./ -p`@LM0 V00DP 0S0 0000SPP0C00`F0S 0S * 0R 0 0 w w0  P; ! 0 W5@?@ P0, 0 0堀0唐S GP0 p(K\\0 40 400000@lЎ(܎(|؎(̎( p-RL M`PKp@0@ P008 8 P0 g( 0-LM@PP00<00S  = J"K0p( -j@ML,MpQ'T U [# ;K,0C K@0 ϣP =K0C0 P=! SR J(~(KKA9PJY8| ==K<0C#QPJ(HP0P 'P0ȤJ;8 E -ALP p000pPU*`00CS0pU 0 0S U 0 P 0` PS0SP 0S0 0 S kP g(85&&g( 0 00-S00@L000S00000S0@000S `P P0P40P000踎(g(Ď(( p( -PPL` 0S| f@Pd <@P0/S0080`f R P`@@@@8Sg(h0 RX R  H R/< R/ $R/Q/ Hg((T(( l0-0LS T0TP@0L`T R S0c ~0@p(g( <X&z -L,MR@ 0S0S࢟0@(K0 0P50C S>....(......x20S X<K!4KP 0 000#K #K RP`P   0!$`$![ 0!0 㓝 Iz X Bs(4 : S@  S:  S  S05 S7  SG  S04=! 0410S ̈́!!" # "0 0 J  0@P@g 0 ^b040+04 סP0 00  0g(p( Ȏ( -`p`L'P7S+ 8  vaL( <AS43e^U -L\M@="TKp:hK( 0T KhKKm 0-LM@Pp P QK00 KKaa0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//@-Pp@`UVUQ.0C\`p0S*0 \0W0C& Ό' `p0 0CΌ `p S*CS*`p PC-a*0 @X`t0? S YXJ T(\D\0A  Q R 0 S* 0 B^QA^Ÿ 0B@ T RB(^Ο\AB@T RB(^ Οa B^ RB(^ ŸR0@- 0C\0!S*00P@U T0W0C  Ό! 0 0CΌ  S*CS* 800-@LT@@  0@(v -PACAAAAACACCCCAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAA`ClCAAxCCACCAAAAAAAAA|>BAAAABBCAAAAC$CAA|>BA4CA K0 T@Rb0d0?o0cs00CS0 wH(K G8c(K (Ke1P 6 l2 (K 2 2 (K ,2 1 (K % 1 (K 2h!  \1 (K@  1 (K  H1 (K, (K,(K42uP2p0`A R(K+ a@BT~MLOLOLOMLOLOLOLOLOLOLOMLO QB Px00R?  C@ 0 fHKPH 0S0 @+SmSSSSS@0Yd PG00000YOI 0DPP00000 S <0 = G 0.X& h(4&t&3(1&0P  /g( p00-LP0\0\0 ~L@LPP@0@p P ፜g( h(ZX&Ȏ( -` PL @*R7 R Q. %?R& [RS\ !^@@]P2!NoT^ 0S/S RP PS\ PS0*S S 0PS 0 P0P p-W p]WW \\ @\ ꀎ( 0-L@ /TN@@N P0H0\A\*0C0S*0Sa p-ML M1P@`KP-K P K= P <[S}Kp.SL[TxsKh`m.KZ P @KjȎ(-`  3 -cML Mc=K(0CKK3K#4@Dp`E^KW: 000c=K0C ⶝Pc=K0Cc-K0 B00 ;RS@X 0cK$A0cK; A 0c=K 0C0T*cKA00Q DXOH(K&Q< \Q401CP)cK A c-K$ B 00CRc-K B2P ! R0BSc-K B  BScK ,L0c=K,0C0@&S\ScKA  @c=K0C c=K0C dc=Kc-K 0C B0 0CP;TG 0S 0fX 0TP* R00;T 0S X 0 pD JKX,@D 0 8TS ll忚8TSo 1 @  pc=K(0C0(0 ( 嬚K h( ^xX& -LMPP R`p ug\Sp RI p0S "00p0Sჶ\Sp RK pSS) GS PS! o 0,0C5pS sS gS0000S00 R @@@$K0000ѳ@P"  -`P B.K; BᲠB.K0 BX2`3 P <$S. h( -`PLp 0Sl㓳@PP P`Pf80 PP p@ @@ @q h( X0-@0LPL`LT  S, ՙ0@ h( <X& L1- LRD jDT@ (PU: P7\Q Q 0T+᯵04#ⰲP ~0S/  00P0S/  0P0 @0/S000 0DP0 QZ h((( 0-j40L@PTp 00S 00S0 00/S @Tt0oPL0D0S pP040  h((|( |2-0LS@P' 0`.S0.S0S/S 4dP0   0 R CR S.R S.R0S/S 10S410S P:4 CSR ! xaPU 0/S20S.00 pC 00C0U00 PU>_ !P:$0BRSR;  P ᠹ됎(L(<a(p( -@` P1L0S"ᣓUp( P  0 P0C0 B,#0@P@ U h0gh0gg0ghh0gHg0gtgU.S PP 0 00C0 B#,D\< 0 00C0 B#!d v>C 0C0 0B0@"000 @ 0C #10C0 0 0C0 B #@ 0 0 0C0 B #@0 0 0C0 B #0奓p`d0& -|ALpPW : -LMp1pX< Z4S1 84S80 - k##K44Y1 @<0 !KQP"QP 0@<0 T 6@P ⰮP " #K!800 Aᛱ|r (K d  C4 S0 0400CS00< 0倱~8h( i 0-@LT:8$R𫝘4 CSR𫝘 cl?X!WV@"UT QN$KkJ8h( X0-@LT`D'L@PU p64PWV8h( -@L`V!˯Px @d0dP \sgP0p@04 = v@8h(G((5& 0-@@L 0S 0$喯P  08h( 0-@@L0S 0$P 08h(= -L o` -L$M,2@0Sw  ;KЃbYXK4  K H0 ~PP H01#K0W VZS  lPPP 400 000 WV0S  PB 0 " 00 KcKQP7  Rp` 0  :P#K0 QP /P a0 խP #K 0 K0`$K b#(K , $ K8h(H 0-@@L0S 0$ɮP08h(= -LMd`0S PPp0@T ! (@TPU$K8h( -LM` #K!$K00 @T% PZ 0QP QP (0S0Y0P40  0Ҭ40P KKa(1(KἯ(Ko8h(= -0L@`Tp AT ! SR( SR (@00勯ቯ8h(=/ -LM`0P0pS 0/S AK AHPP EK(@P  p;T Kh[_P 000 00$` @ h(#:8h( -LMP`@pTK000S$0S 0Sh00S ! 1<00S ~@8h(X(5&5&5& @Q0-L@A0 0@M@!QT\1   K S:0K0^@K^K^K^K -ML M1`@8< T/ pP!AT t0S" @T E@PM 0D0 0YP0? 'P1m" 8<P0! A$!@!QP V  KP I  K*Pmb R0`ı(K7D q/( $D8h(G5&k -1L `Vp/P. DX@ ҫ@P) LPP! FP  A@T  PP`P *.P8  P8h()D h0- @LTP`pH ATP @8h(C-p`QX@@Q@T*0C\`p \N@ P\@NPNNP N@N\*00000L1>`p000\:0L0  - R 0R$ -MLM0A R0\p.@0X!XaP^*K$ B0  C0/S+:K40C$!$K⤐KP6 K *R K$H0@C:K$0C 0 C?R*K$ B0@C 0ꂀಀK$H0pC:K40C| tKxKP:K40CX LKnKP:K40C0 KcK&k s~ 0- L  -L@Q`e\ 1e #Kh P   00S  /Xh(x0-@^\Q 4PPXh(Ԏ(  Q0-LP 0S   pPd @t L @ @T@000@ 5& -`pL@PPP@}P 0 X{H0@ Hv8000CS0 $ 0 D05&^Xh( -`LMPP$K4":0J840K0CS2"`40 !01 +  da (lZ <tU @ |0 Q}P  E=-0B0C2P0 1P) (5P/\+ $ (8$K@QaKP  v⸀ B` $($ *($ /R00C0 $ 8$($)Ёpx0`(B$܎(Ў( ؎(̎( -LMZ@0@S'H`|Ĉ30S $KJ(J(J(J(Kd ;h3i/K00 0P J< SiK"L01K3 0b JK"K0A 000 Q:0A Q*J(X S70001K=!`rp JK"K0A 000 Qu:0A Q*FK @w`0m/K<.PJ6`0k/K@$PJ,!0 ` 0`f/KP J=<@]TqYEK  @yX Ky}"K.`0c/K `PJ}"KP P@ PP P P0 ``X s 00bR cPԎ(.6  >Xh(GP $ n(rx 0-L@ PP oK0h -L M0P-S0S) ᒋ`P%> 0Q K(0p S0 E(P(KQ@P,0V ܵ`p & --L M(@P   UKlh( -PAUL`<0 R <<P @ @P@lh( --P LM00 |0 x00Sl00S `@0S T LG00D0D 4 $Ҝ >GK茎(H(L((X&Ȏ(` 0-|LPPl尴h@P \ᩴP 0\ 000S  0lh(( -0-P  LM00 0@ 00S00S P0S t F00d0d `塊 PvT4< 0啊( FK0茎(H(L((&Ȏ(`X&O -Lޣ X& 0-LM@P@K00/SxPlPQ_Kڇp K@Շp *KQP)KQP A  000/( -L⚣ ;ۇX& -L⎣ /χX& 0 -@LTP 0QQ0P0T`0000000CS000S Ē(( x0-`P@ dp L 0SP'U00CS0(00SKhĒ((( -@PD`L0S@'T QP( -4QL0@00p 7 `1S 'RT P10@00CS000S 0 Pp吀AT$Kk707V0W00CS00 U 0 Ē(((7& -0PL2 R'? 0( -Lp`PU@ %@P` 0-\PL >@P _DP0P 0@00aT,@0S|( -pLtP`000P6@_60 0Z6000@0CS000S$KkĒ(( -LP`@T PV 0@@ -LP P-L`1P=+P#P 0 lUP@ToUW00CS00 T 0 00P p7&7& -LMh3hS@`c` 0 (K43(0 0" (0 ( 000 B p2 2 00`G5먒 0p$K+R 1!Rv  R R% Pp R000 R@(Ry %Rg &R0&S03 )R7 *R0=S  0& =R, /RI ,RU -R -R0( :RH <R0<S =SI ^R: >R ?R%|R ~R$ #000=S& >S 0|S0 0=S0   +R0' &)"0 0&(((( p-L M0P0`0X0`~0@S P 0R@P@] K @PU0S 00S M0ST P(0 0 0 R  Kp訒((6&f0 w @-L@`PQ8,D,lx,Xd(0\ URq4 P 0mi5"R?  B 0b4?  b4 0R UQUR0V0V0R0SRSR"# -L Mp`렠@0P%SJ000 Z0&S `(=X0 800 S00 0 @P@P(K(( -L0M0@ p$KT` 0 DK@PK0@P SW@PV D@ 0 F'@P@ 8K⯅ 8KDzVꠒ( 0-LP@0)S0( -PL(MP`p[ P2 P82 ; 0*P(2[ P 0 @P$P[ ܑ"P0@#SP $K'0@SRO n'S @P'0G\SpX r@P'W 0 !@K9 @KV0 r0  p0@ f0 000@0Pt0 V0 t 0MX4`/'U@@PP 0@P(( -`L$MPq80 + ,K a@< %0 <C@0DS )00S^^* PU @ 0 4 0DSL0800S Q` (KUU ꠒ(( -L Mp0@ PB\`0@P0SX0` P00 0@@U@P@ K(( -L`h0@0PSP0p 000  00@@P(( -PLMp0K2`pLP 0IS0NS@@ rP@G@T0T@PPp0`Sp ,9&0K2K謒((( P-LA7P@4 p!a 0 P Q B Y Rp0 R ԥ å63 0 P @.30pR å&3 B2@@0P@ 0$cQ06&6&h((@ -P 0/SSS00丒( 0-LMPPK00/SQOKLp Kp *KQP)KQP  -`LL1PP 1H0Kh110"S@ Vt(* -\@L PRH0Q < r`P 1Kh(6&A -L MX0c 0S+ SP !C000000000CS020S @T  S SU(K[G1t2Qrh2hR0dr00@/SJLL9PQ0S /00CS0ĥ@82@X00020001A  P P 001 |S pS00CS0L10S 00CS00X0ĥ@20X@00 R0S/S0@D00 dP  R*0000t/S0S RP 00CS0/00ĥ@00 100@0H0S 00CS00إ0ĥ@10@0((Ē((>A(6&h(6&  -PL0p0@0FP 00CS000S 30`0CS0X00S $X @06 R0S V$0$pO&Ē((6&( < -LMp2BP7P'0@T#S@P% 1R@0.S00.S000/SSB10 K` `PA|ePpZ% `PUT`P@ .P +0P F0Fqxq@P0-S0S0@T0@SP *0KP0: SUe 9P(K6&E|(H  p(y(Ua(r -L$,0Q   KhWR Kh(A 0-L@PL)70P000SLT@PP 0Sth@NX@00CS00 ^N 0 0蔬|((7& -@P@pLW\B00CS00 60S >0S1S10ń1 Ť!11C1 X>0S]1S phA0ShAX G4800!P1 4(@00CS0 Y080S IKP 80S'0DvS777 h! I/K K`70!Y1101 0! $0hG01S! 7 70SU yS60S `t\<&060S g1 @1 @Ft _>NK0 0<01 0C01P0042P!RQ1S 2!   B 1SVSK% KP1!SS|1 @0! |1 @Ip101 1S`1  1SL1 @1 1S (1 1S 1SV?K0S 0 00S p;PF@T1SQ`1!\0s1! 0H)F8((( (((6&(p(7&(Ē((Ȓ(( B ̒((,(!( ؒ(7&((|(t(D/t&(7&7&7& 0/(0/ؒ(0 /ؒ(0/ؒ( 0  /ؒ( P0-@L'PD@00S S cR 00(ؒ(0P /( 0-LM0/0@00 P KsP k0: Sl  S` PK0KsP0 : S# KPP8(`  -`x0LMP@`P0K#@O@0@808@0p00k"p0K#K(((( Px0-LG'`00ST00S 8 0C 0BS(0  0   (((ؒ(// -LHM*4K/TK4L@Kp0DPK,<`K(,` PT0K SB$K7&- 00S/( -L@`pq\PUV kL" 00(GP蘛(( -LM0 QpI R%pP@0`S:S70E4   04S0 Q4    X/R/  0c Q@` R:R 0:R ` `4 0C(Ko"S P8 4 %#8 (K6&6&( -L M@Pp/ `tP* 0 q@T0 "T# "`VZ0S 0 ^0S 0S @" KoP@<> DR~  P 0 ,((Ք -LM @P`RmPp1$K0p00( ?L"pWZU lhA @A Q T;AP9AQ<YA 04AS 00CS00 @ 0* 00CS00 @ 0 $KQ A,AU P000LK00CS0P00S b@@K@4,8(Jbk7&tĒ((~ -`@HPLpP 0S%SP @X -`@@PLpP 0RP@ - H0H1S RQ QP 0D6&( 0-pP` 刀 L |@@ 0S0 S0S00PP|U00CS0$Kk8@Ē(D6&( -pP@0` L 0S S:Q `:SQ`u00Q %Q00S  $PPP0W :S@  <@/P R00SP8('D6& 0-`@ 儀 L p 0Sp00ALᄏPU`|V00CS000S$KkkĒ((( 0-pPSL R.u0AaT'oWQ p000 0 @0 0 a00CS0L00S 2<0`P `@(Ē((( 0-P(@L@P0 0P0  0-D@L000400 00CS00K0hWĒ(( -LMP/`@0 MP @@@o KapP00š0 0S 0S 000Z300P@ P @\P R R R     ,Q R 0 #"  " /R0  QpP=Z0 R"000  KpPZ w 2 @' 0h&?00(K H2Q  0S/R30SZ U#P pP 1 @ RؠK R ؠK pV1#P  R  R KoP * RF01 R$ @ 1@Dz( P R  = 0  00 @ RؠK R ؠK   BR D R T8(D6&7&{(Ē(6&( -PLM@p`t2@0 &P@0Z 000@@2 p`Z@0 n)2 1S*Z(KbIY <(($(((((((((((,4(<D`p@PQlT QQ D @0 D @00VXWT U0 08K0 eU 3[s  P }>V 0SX@0@0 Y  P 0S$<W|(D6&(8( -x@L0`000PS SI000 00 00000CS0KhgĒ( 0-LMl@ 0P0002KP0>01KuI K 00CS000S K0Ē(6&( -LxP 0SI -pL$MP@`ሃ%P0cS   \pPp vP@ VP`` ,( R\cS# T3=0S@0 P@0 W+P 03K000 3[S񟗌XDTd Q[PTf\=&TP H= P% 0<P=U 00S R00CS00 < 0 0P U (K<P/P!00W@0 t1 ,0K# H0 D @00S@0 H0ZT1Z<D<mPT<T~`姍T T TT<`~0 8K`@000 |( <-BWe7&u8({2r - L$MbR@Kpo0@0@T T T*/T :T< T-@K (KT$T*AZ   0000S(T@`P8l }P` `@KsVp~ ZT  BR @å0H H0@ R  |W 0 BR  R  BR   BR   6&(h(6&  -@AL0PS,1 `RqP0S`P000.00CS00S  0Q" U R`p00P UP 0000000CS00S R00ꌓ((Ē(( p-L M0@!SP 1Kp*S@S``00P Q0C RP00C S ` KV@0S 00S=STT00 D0 T 0AD1U 0 0S 0S6&(( -h@L0pS`P  R R00` Pꌓ(( -LM,s,S0`K0 00 0 003 0 "@K @ 0 DKLK1`Ÿ2  1 0倢0  BR 0Si00CS0D20S 0 KFjP0S 0Y00PIؐ 0KX- X`* V. R@ DRA/@`F0 SR t! BR  R @ B ~  D @ B D 0 B `F BR ĥ@ C @ V RJ@PjP ωP Q00S 0DC0@00CS0400S (K6&Ē((((6&(h(( ( -L M10S0(K@p1 1000 ``00V :YW0S @Px00SFQP p0W) Sp>40 40S@, @0040 40S0S$ SPP`0P P@P040 P 40TDoPQ0 @P@p`ꌓ((7&($ -`P`@LPP00`000`0CS000S ꐓ(Ē((( 0-LPaM@X[H0@ 0褓( -QLMp `0P 0S*00G@P `KPP `R@ K P0P@@0`SP0S0 0-@LDMP0 X0 `[Xo *XI ?X; XZ 0S0S@0S X0S (KX \X Z0 S@0S@#0HS Z0 S@ 0R R@`Z0 S@ 0Z0 S@0 S @0*SS x SR?S[S R S0S P@ X` 0Z R R @@0^S!S  00x \Q ]QR0d  d0 R 0B?oZ20S0`0 `@ `0p0T0 0x RW~  [W\  :RD\h0 B\0PPPh0:PU*\WWP \Pp -R_0]Qp \QQ0 PT0@KH0 0HKh D0 @p <0 \0 P T0h H0 \0@KHKD0 @ <0 P 0]RRd  R` `@a' R\  PQ  @K U, K\P*@Kh0 儈Ph0 T呈h0Q U  ,K\5 2T0WPP00S P0X`0P0 @R<TWp_ -LMP@ 0?S*SL [SA0^S!S00x \5]P> [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR6@P0P/P 0S xPS@ R0$Bx RP 0S 0\(KKthPX;P 0U0/S 00EP 0S/00E0S``0`@ xQP 00 10S" V/00D0x RP000Q:0 p R /  70 pP 0.Bo.SQ 0 0 P V 0Xꈓ(  '( @-00 S 0 @^C\B@x R ^ @ ^0  -@QLT0S0@@@?S*S  [S00S `0p000S P d)0000CS0P00S 0S Y0S ꤓ(Ē((( 0-@$PLT00@@@ꤓ(A- 00 S@QA0 p`^   S. RxPPU!^  ^p0 ^S PS =^^ TR pS @0C  0-PL M $`KG0fCK 㹂0F 㟠@FP Tp X-00D@FL`@DPU$K`00CS0PPh( -LM R@@0P*Sp #S $S !S<8 ?S @S. -Sz 8Pp8H(K777@A0S 'g00CS00  PW0000Q00S l7tw `Rd'0S00 0@S00 W0CS00 w 00CS00 v 0S &V00CS0^0 ]00w00W00v00 000S 0DV 0CS 00CS0$0 ~ 00CS0 0 000 0 U0 0S 00CS0000 0 00~0000 0  00 00 0  000000s05 0$50P50S00 7 0``W`V80 ԔA̤帔0  R? 80S   R  BR d ~  BR `0 0 <4$ BR  BR 7 ~  BR 30 0 0  R0S U@ V㜣c 30 0CS 00CS0,0 ~ 00C0S60 P ~ z0 0  q ~ k0 0  {b00~00A RWb0S_ "lb00C0SN00PS00C S0 00KOP0S000S=S{U20 v1 Rr0QE1@00 00WppW" aQ000S` 0A 0CS 00CS060 ~ 00CS020 000 0 a Q000S= T 00 S 00CS0!0 ~ 00CS00 000 0 00~0000 0  0000~0000 0  006&`((((6&h( 0((7&( -L4M0 @0 6p04 = 6 88 `H0 @ 600F: P Z  2PP00@S <6 0 70P P " R PP 0&U%  A0 %~ R *R@R   " X R H R F APXU PD ) Z= T740  _pAQ!W@DTZ JJ X6$00C@0C0$000D0S240@@@9L0 < L0W<  @|$h4 X BQ@ @CR<@ <($<0@T<0 S0 S$ <0@T<0 0@S30S@@40@040 0H S0\/T/00////,/3 AQ AQT~AQ(@P L L~P P L LP @D P @P~@P@P L P ~LP L }P L@|r_T?0e_oRUV40}800SN PX(KUE !A00CS0)0 tp0 pG@0000P  00BpC0 ,!p0pp01D 000A%'0000U 00 qP 0h~6PTR ` R0 R` R` B\U   R0Sܜ(0((6&6&h(( ( - L$M< 0p % % 0 D$8 @@ ~Q 0 Pd崤4 QLQ*=Q "Q :Q Q00000CS00  0P 800 AA P0Q (Q< R   R  BR ~ 00CS00 RNQ Q QY  R(KQ1 L:Q00CS0?0  R  R @R0=S P2P P 00CS00 w 100w00  00CS00 u 00000u0000 00y10S 8 0 @ CR SR0C0g Ye 00CS00 v PY00v00D0  ~ D0 dD D 00 h &<1 D0 D0 0  BR  " 0~S=Q40S 040 oH0 D @ DH0D D004ꠜ(7&(6&h((0(( -pP`1倁^0|Sx1Pp l1lA 0 0\1L00L1pD1 p<1 V0 Sh000`0`0CS0!0 p0@@Bp@ D 0 @  0 R 0800pN0p6&6&(0((h(6&(((( 800-4PL@0 K0h/6&6& -L,M\A\q0H@Q00CS0@0``@@K'0@0HK@KW 0 0C 0S0$K '00` R"Z 0C 0`F`F000`C`(K00000ꠓ(6&h(( -LM,Q80 (q0R00 0A40 0`0Q< <00040P080ZP Z 2 0 E0CP0(K0S P L/#0< F40A0, z6&(h((6&7& <p( -LM c80 s000 040 000BSP\0B0SJ̢Q< )<00040080Yp> Yf Y`0*0`HV(: 000 P00W BUW#*VQ  000 PD偐IoU㩒Y`00`V:(KPQ: F``HV: P6FUW * VR P  R:F` PU R``V:`pH F  0B0C 0pGHV00 `F  B BR  0 B0 0 6&(h((6& -pLM8K`P 0@ 0嘀00000py00CS00 p0@D ;@8K$KJ00p6&((h(6&( -L`p@.A00CS00 - 0 P Um.00CS00 - 0 P U P*.00CS00 - 0P7&B -L -L00S/ RH6&T0QH0 0Scq o/P0//ᰗ(H6& 000 00C0/ᰗ(( -@帀0P000` LRp$ x0 t 0U0d0P p T 0 0C `  S0(00S$KkĒ(H6&(((( 0-`P @0p0WL0 pP 0X S S0 000 00 0 p0$`  d0 \0 00T |00CS0,00S$KkH6&Ē(7&(((( -XBLpPR 0 Qcr 0S ((,$, 0bSA0@@0/\P3b000r0Sh00CS0!0`0S 0ZX #R  \ P   \P$- 0 00@0 P   PDR@ S @  BR 00D0CS0000P0`00S ,L0],P0 Q谗(H6&7&(7&(76&7& 0-X@L00CS0@ 00Lp000CS0K0hB갗(( d 0-`@ 0L P 8  D    @ 00000 0$000谗(H6&(( -pP`L000$ \U @0P%P0pS  0L 0H 00000CS0(00SKhĒ(|AH6&((( -LM0ap00P0[@P KN]P(0: S$0 L0 K[P K]P[0 0030 [di$T[L00CS0,00S mKĒ(Tbg( 0-` Q LP @ @T0PH0D0@0`00CS0(00SKhAĒ((((H6&( -@0P  PL `P$P 0{ 0S00){0d X 0L 000CS0000SKh H6&Ē(((((0/H6& -P0`0@L0SSUH6&( 0-P@L0S0H6&( 0-PPL0 @0P0#0P0H6& 0 R/P6&A-@ 0@1 ^P U `pWQ Q 00q A#^  r B.PU 䀃08(5rOP6& - bL0pS 20SPAT p #ZpPPPU* 1F Zp I#o#KxQPZ0P Ш&&&Z(1PP [p{  Kp,{ QZ0PP Zp{ Kp{ 0#00&&&p(h(P6&6&0L(`( -0LSP`Ѐp@0000W ap 0WVq{V0S `p` l0S *00CS0P00S$Kk pGo PQ`Ē(G( 0-@h0 P L P y@00CS0000S0K0hĒ(( -LTM@pP 0 #*(KؐY PY   0SPs  0 S S S PQ 00S00S@0S22 G! 0R+  ~  !R -  "lK)lK` l0Kt"0 ) `0l KsUD zKl0K{`lK~) 00CS05)0` V l)k p0S 00CS0)0 00CS0)0 | 00CS0)0 0p0Yp0 Z(000t!lK) #40  {)  v)P S#4Qz  0 l0K`@ fx  B)p0`0Csp0 0㓉(0H`0:{8(P6&5rO`joRw0@-0  R#R0 B  0P\.^0\Q #40 Bo4SQ#400000@ -L MPPp2@ 0%S^ P @@T$1 R 04!0@S (K0S  R+S -S %S d1@0@XZT08W0@21p>  ! #@0S 0S 0?R0  00 :P00 T0$@` 0 P] P 3 d0 @  RJ0S ^#0S 0@P6&8( -(AL$0SaP0^0pS0@  O(А㼠0Sʰ00CS00 ' 0 )0 R  0 S #%(8(|(5rO 7& -p@`QL.P00S|x10P 0S \tjPp pP@ gP`WP 1 Q@1'@V Q@T, 0SJ '0 '`00CS0 ?'0S 0 0 00S0 S 0 0`$p|(>8(5rO\:{z7& <00-@LT $ P0@@d08(8 P 0S/AQ //8( -RL0pS P`VQZ0000SnZaP000K:@0 4(00ST0Q0C  S0`10S D1 P ,.0! Q0001 0 0WЀ000CS000S m0S @@0  0 Z\vꔂ! P00A R 耈8(Ē((6&( -`!@S1p@!LP O$Td1@WV2 T1F0S. U 0S0PWPVV 1Gpw 0""060S$ """V$$U 0S ]PPVPUP @@WT ,0 h(Ȓ(l((6&P6&cT8(0< F R Q  R  P 6& -R0pLMtB00 K p` j0S0S (KPP " 0002@" #T):U 0S0 10S  160S   UIG RG E1p!00CS0p10S `0S  02  8 08\R Q 0S Q  {@|. \ ~ Lo ^ \ P  P 000 PPX@~  Lo ^ \0(Ē(8(h(6&7&( -LpG@ BP 1F0St @{FPVU @VgFpzv `P@0S0S 0S0S `@Y 0 Z  3Z 0 006&P6&I8( -P@Lw P06 R0S@P|@|`00S 0pC 0 0 SlPPPw6&|(7& -@L$McsA PPT  r&P *P nU pUT p|@\`H V XD300SpN pLH H0#0pPZPY R V p0D0 H0 Q8ZPD ?X ^ 0 L PPL  0S00X 0STp ' 260SK(K0DP 0`0^  ^ D D/o"? TY '^ Q D VQ, K"p"pD R RL *L RQ ԐToQp 0S 0Ct 0@KV p@KD RXVV `V SXppOx(c8(|(6& -L@S`\Q000 R 0S 81Dp "t!~0S 0 00D  S x Bo00P0R ` R\ `` R0 㳸0Sw00CS0000S Ē(P6&8(5rO( t1-PLUd0@SH$@#`p00S'$a00CS00 # 0 w$`p0Sږ WDp 0Sʖht #y#`PpP000E0@0CS0<00S 8(7&P6&Ē(( -Lm 00 Kh|( 0-@L_ K0h} 0-pPL P0S0 0Q0P @T #0 00 08(G- 0h"0d2P @XrXXXT0S  T"0@D0P0@0PЍSQ =S^ $Sp 'Sn "Sl 9S \SSF S"0!- $0!*0! S$0$S< 8:S 0S   R  000C S0,0S0!"0  @T0 R 0 R00 0  }0)0 !"0\ 0 a 1 }SP 0 :0 0b\0 ((X6& ^ -LM@PcPsTY 0SV0Sqhsqqq8rqqTrrrrrssXsss0qsssssssqq R0S 0K H"0K00CS 0St10K`"8"0K+P@<0,$@PbU0SK0S P 0S  {uqtpl `cL0Da04qPU, T P0 SPA > Pg Pd Pa P^ P[ PX @/(":C^  s)K"j/9=5BN"LMv -@PD`LTUHU 0S ?@ -x0`t `6LPP@F0S@2@Hp@0S. @D0   0 (6&( -P0L0@S`p R 0F0S P 0S0'QWX0HPT P000V0 h(6&P6& -LP`pSp@ P 0 KhqX0 S -P 0LMQ00S @K1ԁ 100 000 0S KpPK@(K0SH  0 Q S/R ~CKjQP 0%K%KaP000Y0S)  Rp 0CP:PZp"00SEpBZ p00CS00  0 %K @ 0 SH0 p 0 0(((`(p((d6&h(r7&6& -LMLap8K5@P810S Z6W0@?o20S 1tQ0V0f 0P!1T00W0SV0SP60S .0S @8KP P8K0 KP VX8 0@0C?o206&(7&7&7&D( -0LS@000KOPP000CS000S U𨝸@PU` `PV0`0U0P0p0S V00U00KhĒ((6& 0-t@L00P0 OP 00CS0 JK0h00S Ē(T( 0-LP@DPUz0 -LNlP -LmP 0-L@A0 -@0`SLP~Vp~0000  00p0CS0h00S 0p00000`C0`0CS000S r6&Ē(( P-L (`N 00C006&40  0 000 00  /6&h(l( 0-@` xP L 0S0 000H0 00CS0000SKh&00*nĒ(6&h(( 0-L@ 0L0080 00CS0000S0K0hĒ(l(( -$a$A0000I?o!2W0SPkPLP, 00.0 000E0000PS W 00CS0t00S$Kk E P 0 !0PPĒ(6&l(h(l((T 000@0A00CS0/00S/Ē(6&( 0-(@LP0 0C0C006&h( -,P,`@L@Dy00C06&h(( A00C 00 0C0/6&h( --@PL,M p`Hp PVP u ~뾽T$0K1 H0P @H @Hp `p@PU KT $0K1 @?H0p H Pᕽ -@L$MSc8@ 0P@0 h3`0SX=@0pS0@80 T P "P30D0 3P@"r P@P  \00 壵P00@DDAPPU 0 (K7& - QL0$` P O 0R', (@R   R`!PT    Q  00000S@0 R@ BR Kh=080@ 7&" -Li0 0007& -L^P 0-L@VP0 -L @KP P <0 000P ` PPP7& -L M Q`P0 # p @%P" BQ  R  0 m0 @WP'V/ (K10S @W Z Q@@pY %44((D @  PP    VfH0 RprV k 0007&( -LKM@1 H5@0< 0P! L1 001 (50D1 5H 0KK0D81 博P H01S 0b< 40 D!4 剚$000810 Sp48!p0 d4K/K `$00CS0 @1S#PAPU4@!0RPPT `+@1SP P| 30S Q3cP3 3儓 0 0S } 0 `P@D P; \P p+03L00 P0@000  #\0@0 $P <1<021#20#"T0"@ 0AS0\00ťPs\0P0"00CS0@ťPgP@0000 P"00CS0 0 ťS 0 "CPn: zi@h100@1S 10 A08!SKڐ!堁W@0 8!%818!@00C0P000a001 00CS0(10S 1L!0 0D! <1Y`,V`>P0 |P000`$@ 0(K P10 ,  0`0 &P00 0=<Po >P9 &P00L6&7& 6&6&((f&L(h(#4   0@00 ((0 @ -P 0(0   0Q@0/{PA@`   } {S D@ A@Y^#P0`" X}P0N  P``= H}P00 ` 0   `0A封. AQɥJ&0=AQ@ɥ0 90@Vk%S` :S/ #S0[ 0 g``0C P@AQ@ɥ@V0 0@ Q A006`0 P j 02!R1S `0IS0@`0 `Y`o 0Y2 P !cڤ!!^0 0S  Fo}S㪢Z `'S02 4P w000@"0 P!|$00 00C0"000$2  P!Q 1 00C0v00WP@X -@L00S`Đ`0PU ` 0S > 0 0   B/o"h0p 0S 0  0 0 07&  0-L^M1 0! l1 p 1t 0< x1 10K|1 B1EK01 0h1 妓PI@1E/K 1Q!@p>K0K| dN 0S Q. 4QG hQ d \! h!X1 0` T! h!YKf00h1 !0 0x! t0l! 0|! h1p!S0h1 hK0ph !p0 `0x! tlH0l! D0|! H00SlVS,06 0Ȓ(6&В(7& 6&̒(V -L M F,`K0 00&B P" 000;P1 PP  PPPPPPP0$00`amPP 0 R 0Qp     <0P0S 0 00| P0, ReP 000P0 0Z0 R, R召P1 00300 0000    BR   00p P 400000CS  0 P Pp $4pKpDx 0 0008 P0C 0 00p0 Sp;P \V0 R   L000p0SA0 R Ӻ004 3P 0 R000 0  !P 0@S P 000 hpPp0P00p P0 0000000S$ U 0S E0(P000Po|00SP00S 0000P(K0$00`7&nb 7&6& -Q@LMQ$`Kp0 0pK@&0 P0 0X@` 0NP R$@@pR(" V0 R`00 4 /pP =0 08 00C0)04p$K Q  00S PPP0( 00 000 @P 07&L6&  -P`@0L JP0 000@AP 0000p@@@,Pp 00@ U000 v00@0SU P7&6& 0-@PP0L;0 @P P 00000S0 007& P/0S/ -@L `P00`P p-L M@$K9P0S 0`$ P P  8$KpP ``P$8ݝڝ ם0S 0  ':   0/X(RQ%89 -LMrP0 U00000@0CS񟗌|,\<LL` z8@PV 8 ~8UL20S| T |X`,",^8@P 2N0S' `S8p@! K9pP^8P 1 û `0: SK8٬00`\!l`L!` P P U0S00  uP @庬Y 0"800CS000S $K@e 8@0@嘬t  xT  BP`7VY 0Ē(6& ,(   (  P-LP@ 7 P a`70Y 庺7  -Pp@\`LT@Q00C0W P7yW@X( -`@``0P0L000dW00CS000SKhQĒ(ܛ(( -`L0L@TVP @Pr7PUܛ( 0-@h0L R 0C T DS7P Y7%r P 00@7&X( -PL0@ S 67`PT 97ū0S 0 S "7`귫0S X( 0-PL @ P00  0؛( H00-@LP  Q VK0h70؛(00S  R/؛( -L@PP Q0 Թ6p`U i;X 6pU ]/X 005!!4!p -LPp`p@V`   0ẀPȐȠ 0S WT  ,Ko    0@  W  T0S@@ PW 7&`},)S! -PPL` 0R X6p@ / O6p@  H6p@ A6p@ :6p@,/P03/66@X(Y! -LMpP 08 K0S*070K0@0  $0`01 쁟U70[S!1 60[S1! (K`1@ R@00CS 0S  5PQQW L۸@0S> P90$000 Sl 5pa R R R Y+W U 5P  5P 00CS0\00S pT< 8K000 Pܛ(Ē(7&7&7&( X( ( -P0@#cLMs< 4P 0P 00 </p 0U80 @D:TR] ;sP vP [UP0+S -S 4K0`K ጥ0TrQ D<@0K4`K S,: @0 廡P@0%  000'PT <08 `V Mp`00S0SSPt p0 U@0S(KU= 40`p0      r % 5S 4pzLV 80 4p80k=V dǷX0  T00 D/t&!H/)(! 9"!!"! -PQL@T 00CSPDa10SK R 0p0CS00 p01L00<S0S  0aL00CS$hhH\>S0Sp R 00CS0f0 -  G" 0-@LTP0 R  R 00S 01S0 $ ΨP00S|0!R ! RT  1@DOoT!0B00@060S@T 00S0 (`(Ē(((6& 0-@PL dP00 6 00d(" Q-L@ 00CS00 Pt`tp X?U UP@U00CS00 ꜯ 0-Pp @ L l0S 00S Sp@T: 80 00CS0 00SKhnĒ(`(((L0P @0,Q Q0S:///(`( -LM02@0pS21S 0SPP20S WUT: T T5 P PT T1F0SPPTP 16 R'! R#0SPPdaQ4 KɁp 40S(!FQ DTQ56 R2K060SPPPQ0 Q U0 U0 U0&p WPUc0@D>T40 00 ,0 (0 00 4K22 K1 @D@(`(h(6&(( P-Lp@4`\ዤPPL:H44~PP#@ d t1S 000RT ;00CS030S @@T 3 P6U`P@PPGU@ tH`P]PEU@YX @4SDs 0F0 1ST$x@ T@`@VT @rP`1S 10STW@ T|@P@UT \@XRXr1S 10S |7@@TPdX10S oP `@DP㜑$`0-S0S`U@GkP A?ZX# \q01 !Rk 4pW+$QSP bP1 oP ' 0J000V0S0V00 `hp 1S QZ a  P00CS0(00S T"7&"Ē(`(((ҫi""" "" 7&# -`P 0@PL pD0S 00S Fo0D0@000CS0<00S a,0@T:VKh(d(Ē((`( -D@L0PS`00CS𨝘ზV00(00P,00SP/0S//`(( -`LM@p1Ȑ010!Q0@S10C1(KaQ< !R8 4K2v8 TPP<8 80QfP 40S 4Ki`((((@ 0P/!!R /`( 0-<@L2PS0}R0`( -0LJM01 1"R !R "R0! 0! 1 1"1"1 10S CK┈Pl1C/K yCK⌈P P!CK000儈@P,1C/K /0AT0*20C/K 0PU`@T 0S δP噶00CS0 KK /1ᮕ01 1 1 1 0D>S +00GK c0 20" K!031`(((Ȓ(Ē((  0-L"t`( T0-LP'@ᖓP0 @P?T00 d00-`P  PL @ #P0 0000CS0000S0K0h Ē(7&( -p@PL`U /PPEUp` VD賤0S 0-QL@0 Q0P0 BP1Ա01ı 00000 1-sL@ 000010100C0 RP0000 000CS0h00S sDP`0000 0C0((Ē(( 0-@LP@0SL00S0K0h00CS00  7&07&07& -L M@KP兲_OK5# --L M  K --LM0  K7& -0- LMp0 ( $ @P(K0 , $00CS$0 (KU(0 ( 1[0@0DK0 -L@'PoP$ 0S! p0S00CS0/0 "  h00CS0 0 " 0S pW `Pp 00CS00p ' `' 0'X0C! S00 XV 00CS00 ' 10S$KkV S00 00CS00 \ 00CS00W ` `V 9`P 00CS00 `#7&0O7& 0-@LyK0hu7& -0rSL|e## 0-`0 @L0R.0pP0=00囑=ᗑH@X@`@DS0ԥ0ťP0P0 0=RR0CX0Sť @$Kk萱6&h(6& -L M D00 4@ 0C00 0 01K蠝((#0@-P 0S SR 0T 00@PU U 00R0C000 0-L pAT0'S`QU @'TP@Q  0S 0S   3/P `P00( -0LS@KhC偛PU x`xp0S'S3P@'֐PP8Kh& E""###3 -P0LS`p@    3/@PP@X W p0@=SPP00 00CS00 [ 0 00CS00 J 0 T 67&+ -L MA0Sp 00<`P 01S `'V0 2@PU*(KX   R Q ʁ4 00 4 001P00 eꀑ(($ @0S =0C?oP2/=S/ -P`L0S=SRPEP'㇞`0VqApT 0S  _gPVpPp@( -LM1P0@S @ K$KpPU   `wL J `哯  `BKhiL0S@FPPT1 000 }@P@@TVqVp VP ld6X1HSPP 4VPP0S0SuP 0K᠔000S0 `PqWV 0s?SP 00S P0l0 ۨp` d%pX嵨UUX%@Tl &iP&/&& <7&0 >c& 0-L@M0   0@@DPU#% 0@TK/(TK  &0P x, pp LdK0=IP "\꼗((/&7&4uNc-&' 0-L 0@0S0x 0t 0l0l 0   PU L@L0L D0D P 0D P0B̒(ܛ((((7&7&7&7&7&7& 0-@L㢞0@ 0 0 @0 @TP,<000 d0Q @P00CS0800S sK0h+0B(6&(6&Ē(((P/ 0-@PLT0000@ -@PDaLT0   SD'&&''''''''&'''('('`'`'`'`'`'T'T'`'`'L'L' @Kh 冔00   u00@ h @0\0/ -@PL`4 0P  S'(L((((((((((((((((D)D)D)D)D) ) )D)D)((00  000@0N  0 000 00 2  0 000 h 0-LMPP@ 0$0 0$K 0 0$ 0 0 $0@0K0 sK0 -LMP` @KUP K00000pZP@P000/ P/00S 0/DCP/AC 000/ᤑ( 0P00/ᤑ(0 0("'7& -LM@PaTp`@5 7T0TJ*"T. 'T, T RT垦 L1` \@ ETJ \T R 另 1 nT @ eT9 fT @ bT@tT @ rT @@KvT @ xT0$PKS$0K0 #0K0 K"0K@ @`0 S#0K0 K"0K0$K$@K!0K 0# K0C@`@>'(Y' -L M@P`$qP \P 5/@ 0cR 0< 0 K0R@ "! "7Q 0A T05/@MR0-S@5/^S0  %KH@%[^R@0?S0&( -Lp@@T@@8P`D R{j0`00@0w'( -@pPLP0` VP  V @00CS00 U 0@P000CS00 C 0`ꤑ(7& 0- LR@ Q@< 40 0"P0C 別''(Ք p-L Mh 0@T 00P㦖 P K` VfKp褑(' -LMx 0PU 00 'R"R@@`  @ K`p K`pꤑ( --0PdL,MPP@ 0%P#p30PEAU\PE@0曟 \ T0 0\P`@V 3T R R \V HKE@3@00CS00 3 0H [ P%V0%S@200CS00 r2 0`0`*S0P0 C`P00.SP0@0*SP00P0 5@P0Z層0P0 `0P0 @P0cZ0`0 P0  GZEZ*AZ BZ; %Z NVBT@K(KaZ XZ `iZ dZ  gZTq0QI 'R"R000:Hv$ t  ~sZ oZuZ xZpTP @ B>P T  \^d\s0P0v t 0 Pt&7&''(&*p.((( \= , \@ \5 \b 0p00 M0 0p\?00 \-0@Ǖ0Dž \ \v0"\  \ \e '\ \\ afnrt 4X XP B@\X P <@ xX\~0d0 =Pp\ d0x ។d0P s0v0 t p0 pm AX0X P0ZP0 ,qt0  PhX0 R00 KP0` @ 2    :t  vv t   0{t 0tꄔ0HK婢0H @ +Sat+SZz -LM0$PK\ %p` 0 D!@P 0 (}!@PB 0 pW( PuY <YMPP0' 0ES4K F P j Ð400S00H l[^YPH0?S0 -S00H0,$K8$()T-v-|---- P-L ih..I. p-L M0@0 0 \"XPX` PQ P ,Kph"00 "^.0(.. -LM`8 :VP8 0䡟80 80S(K8KPPP 0S =@P@@0 K tpcWp᭐P000 X!5iWLᢐP000 4ᛐP0 K t00$0lWፐP00 0oWაP000 |P@0 Kut00(0 @Q P< gP<   BR0 K<\t 0 0S.8).$(.z..0K00M00P0D0 0C0D080;800,0/(<0Q00<008 ,0,,8 8 /@0D 9K<@0(080$00= 0D00<00,0/+$@( R 8 ", 8 <  < D ,-D  , / -0ML0$ 0d8 K 0-@L4#0000 0-@L40000 -L M@(0S00 K0 0,0K`t -L@ `P륱뤲8墲<堲@垲HPD\`⚲V\唲`, 8PU0,0M 0-@L480,00 0-@L48s0,00&-! 8-L{ Kh"!} (00-SL@ K0hD8Z@0<<@00,00 -LM K ")P[g Kt. -LPLgnt . -L P?got . p-LM0`@K0P-S00(0(0@0 @  0| 0AP 0( RT  0 0 S40(=R03/Kp><).T- -Pp`@LQ`-VPQP 000 0 `P-V0 00p 00- PL@0@P ,0T 80$P< D0TP$ <0<P0D*8++, 0-(@L0PS  00P0褝( Q-0L&  BR Mt 0-`   S^0? S00^@ ((|- -l@LP`U P HP4,0ꤝ(Ք9 -LM`p@9P4U % TP" XP PW PU p PkT X8 T88T 8 T7T 7T 7wT 7nT x7eT@ X7@\T  87 ST  7 JTUU@BT 69T 60T 6'T |6T  \6 PH T<p g eSo @qvZ~  Y X W0S PT0pS X W P`T;S < S S4 05 Ty W   T`lt P@Td(K$ 0 T0S|Tp4@TX4TZ<8~T|,4 wTwY pTrXiTmdTj0S\Te3UT`3NT[3GWDT_Xlh=TZ\36TUW@</TP0W)TLW#I SL S  SLJ2  TIWTD2 T?2 T:x2T5`2T0H2,0@0 dKK%PTq쁟 0SU! KKT   WQ K  i00P~0K  ^ UKKP pP0 P[U$UDW1/1E1R1^1///////////0 000%010e1l10s1/0z110( 1:0C0B0I0P0X0W0]0e0d0l0k0t0}0|000000000000///0000000110 -L67 w1X& -LM,0, P 0 0d봝(>2X&(2 p-L M@`}000 #S@ KPr0S  4c 00S 0 ncKp蜯2 0-0LSP0#S,@(0)P 000贝(>W -PRL PKM@ p`Xp 0R"K+0"S0SO 0 RRP 0000@O& 0-l@L0PS 0S 0SS <<< U   S(<000P00ȝ(&C,: -@pLM`P p0SD ;$ K,  P 0S  (K@"[0R 0S 0n KP P0P P  .KRS V`T:0S  P߮4" 02 :/PUP4"02Pȝ(v::U:: -LM 偍0S S@ < KhS S$ Kh谮:7;;; 0-PPL000S <兆0@S 0@0/ 0R; -L M5PD@D D`Dp@ 0S00i 2;<X&ǝ -L MT唀PL0 K>p@0"S(bK<ȝ(!< -L MTvPL0 K p@0"S bK@<ȝ(P< -`@pLPQ laP @ L0   , P   Kh03o<ȝ(( 0-LMlP@ R\a; H[0S p ,a aK0(<(<< -LM@`P 0SЭ00+P$0KP( K/@P%(/Qp$0X P  0K( K$ 0P$  LP,#($0 ( K 0K#P$0 0$0 (0$0K H:ԝ(ȝ( = -@L M0T P DR@2@!<#8z( 0v, $ r0 n8 j4 f#4P! ]!4S V!4S O!4S dH!4S HAl!P0S p,:P!T0S X3`qH唐8V q(Ko>|2S/ aPPC2 0  0S Sx 13   0S 3 !  0 p`*=&2v=U=\=c=j=q=%=x=======BB====  -L M(@Q ,Q| 0QlάP(K4QPHĬPQ4徬80S0 ,0<08S804 <P<嬬PP<奬P1 Q0B"9囬`㬡8X0apSp R |劬 <0R წP 00< S<yP0S;`(IQ l(BQ e0CSP BP a` 0Sh  R  R * P*a 00 >00(Y<0==>>%>D>>(>n?A??W>>>? -LM@P4$;@P?K@ 0K ᠢ堒@P4$;@P?K SR+ d3dRqOK`f/TL2f/00R@1!S(R!R "SS0 r1 @1 20S !a8!#4a4# S$ S ?K  K0 K q Q8 Q@1@a8!#4a4# 0C?o2S ?K \峫(4"48#8@! R*0S?K 填 P0S?K 哫1S% K ?K   1S KKK f/ӂ01Kl l h0K X `(KWEVVEW((ȝ(}}?(?(%@T@@Ŀ(&( -; M$L@ d*\0PT0 0S <<KS 5Kh 꼟((ȝ(@@ -LP@`Pp1S% Pv0 0f0Q p^!R 0R00000,b ȝ(((@( <0-L@P  zP$K0hd (0-0LS, Pȝ( -LwP  ( -@:P {CML MX 00BK IX$ P  sP00 E0PS` :wPD  嗪@00hD -0\SD XP/XCnK `F (,Dd jD0\P H4 5PH4`FFab X` 90 =KP@4SD$ W@42#P+|i|@ DY 0S@4x0 D 5P@40  5P@40  5P@40@4 %@PDdVc 0SX_ 0 0=KP  @`D l8@$1\ -KXiCKP H @4LiMP\48`#P4`F 2Fa`L`Dd 0SD4 40D4 0S P4 `0 S HSL Sh SH巷뼂D4S P H孷D4@ S 弃`|2ST4D  `2000!0@4  0 0=KP pQ@@4 S IG0@4 P4@$ 2 S S SHnP4a D4S Pv HbD4@ S qHXD4 SeHP D4S| PZ HFD4@ Ss UH<D4 SH5D4 Sȝ(A;`:^a4$6#Ab VQaQfQKAaAkA(A(Aa(P(AAAAA*pA BBB)B3B@BKB_BzBBԝ(H:67&BB 0-`LQqU V ?/@P0d嵧`!!0V<0 pPpW16CpQ 00-0LS Kh,L008& !0-1LSP@4 0S&P K0hAP00S 1S 1S -[/P01S X `P0@ LP0 $P0[ȝ((PdCCedArdAaC -010AL M 000 p`:kQ U5 1S P݅0S م0S 0(0 1S ( KtPQ20`1S P K\ \_PL+P 4UPWEVȝ(fdrCmdC8&@t(gdC 0-@ LP f/4~K0h( 0 48&(md0S/!   -0-PL M P P 0S S@@ ϦP@K0訾& 0-<@Pᐠ U(Ko. 1  00 W 00;0S00 00 00 PDw& -@MLM  fp4&0BKS0#!@pn P BK@{PP BKA0P,PPBK0 t@pP PBK AZ q8U8eBK(@p< P B>K0C CGdP BKAPUBK@mPBKAb(48TdBK( @p P B>K0C CdP BKAT(4(0DT,dBK, @{p P B>K0C CdP BKA(4,0ScBK0 @ap P B>K0C CcP BKA(400S\cBK8 @Gp P B>K0C CcP BKA4p(480$SbBK4 @-p P B>K0C CcP BKAV(440RbBK< @p P B>K0C CcP BKAT<(4<0\R$bBK$@pw P B>K0C CcP BKA "(44QaBK$@p] P B>K0C ChcP BKA(44QTaBK$@pC P B>K0C CNcP BKAL(44K0C C4cP BKA(4P0P`BKT @PB>K0C CcP BKA(4T0$KK\8Ŀ(&KKKKLK7LRLlLLLLLM=M^M}MMMMN#NAN`NNN -ML M@@@ 勻8TK @Op P Pt`V4+<[S,<[`S?,\[`P8apEbWWnF`0E `FK8ġ  @Iz 0嘃!S0#K1`  @!p P) Kh @~P`0! H/} K @nyP P0S K@, A3/K @D< 0.PD<, 0̂RBKx% AB.KK B @p P" +8[SA,8[`S>?,8[`P92a0C" 20< S :K4 A0!SK Ax5BK|% AB.KK B  @p\ P6 x5< K B A00 QPK AK0 AP0P0<0PK ADxP0x5< 0R 0K A|K  @FP 0 000S 0`p尀P(V R s  S 00  0`PK AP(KNN8&\8NN.OeO OOOvOO(&(O - BR0 Rq  -PL@ R1!0 0 X0 X0 X0 p` ( X, L0 @8 44 (< $$$$}P yT ul0 R`V*\ h p㔀\P p_Wp$Kkop$QD9U+Q5QAQNQUQ`QeQnQQQQQQQQQRR:RbRk -LM─@Y`pR a S 8Q ,Z }  }  q|l"0@K8080 |0,   |  Z|lK0"@ 0Ka   R1!`  0 S` ISM SK S^1 0 08QU ,|t <0P+8|Q* 80A0| @2<0P+8|Q *(K0a 0 0S S S0 0 0| 0h X( H nRwRD9RRRRRRRRRR -PL`p(Hf@@8SKhto 0@SS 0`( "4`#/ -PL@ "44 0"440 w w((,,004488<$<"44$4"44D4$D4"4$44"4$44"4$44"4P4PTTX\`X\ppQp`pQ(4"4(84"48h0`@PV@P } z0T0E0T0E T4"40E긟( 0-L@h40Pi080f/wWEV 0-@PLP NP8#!00QK0hWEV( <00-0LS@ :080f/v(* RP0// -L&P0 Hh @@<@X( -LM"(0   XX& -0L,MQPp`D0 @0 <0 80 40 00 V'D@K  p0P i N0P 0PA 0PK0hi{ 0K0hc@h]K0h$U@@PP0tcidyaraYrbmngntsL  YL P0@-@ 3@5C!14!8!<@P0 (p@-π@Q BaVp(a  …?@@  \P\ @0`0 P#3pa  …?@ P@ @ @D P H ̄ @(L0 R !R "R3S////( -PX0Lb2pv@v, T @@DA??@@@( ?00-@@L204 20ItP0200P20(> 0R// -PLbB0 p 't Hu@`T lW 20CS20CS  ,Ko\0(a` p-L MP`x K 0@SKp 00Sx0"S1Ds@ -L M !@t00 0 0 @aX& -LM쐟0Pp`M@?!,"K(0 d0(0 0bK`0 0'p0 QP  0 R$KkL 0SbK @D`,p $KX9&uc( -@P00L``pphO!14P S ?oD 2"R0S 0 ;ycU(c -QLM0P@/K`p؀~pP K\ Krp0 2 =P \ }wt02S 0S "`  Hu !SR Kg0Pccd( d 0-<@L0PS"( Nw0 10 (( -LTM$K0#80 0H0 30@Pc< L0 H0S< r203 0prK =$K ? %K= ?KrK 0 r$K  0r%K<r"dᑷP ML$K< ! 0p  0 R00 $R0 S p2000#1-R0" 0K0唇0p@P0EpP8000S P  ܔP  ֔P* 0pܯ000 0 SA r02L pi5$;%@PD1"=  #0|"0 Ar@P|2CP080PB80 2@P80 2@TP80 2@TPp0p T000P 00S  0t  0YDK(KAlDd(X9&Ld(&~d;&$dddd -LM@RK 0P0 KR@ <0 8 #KR08 <0DD B $Z, vU 0X !U !@#$sO(@, "!"",!0 00     " 0  0 0 04 8 < 0@000(K{DpsO@s nX04 2`B `F&$)4a!ڑ&(1&l)8)!a1ݑ (d( -p-L M@  200CS0 /P|` Pp plJ0 P00CS0/0 Y@oKp訾&d -LMA~JP?!l0ep K0{m0 QP(K  R(Ko| 0S#Kam0 QP PE ` , n 0S X9&d( -L M0ㄡ00  0xqP 2S0 K`1PTD!p@8 2S  0`0S"@ R`\EU${p@l000 0P 2S0 KP\(K @ᆔ \p@XL0` 111 0X9&(mdC e ( (/eDe -LM@p2S*n+^   2" E 2"0Kh冮"2p}dyE"2Lr"|8Khl(X9&heqee (eeeedfxff 00-"LRP  @"n/3m0!$!"$!U !U0X@U00 @D8t 0D4t  D0t DK0h*t( (( -`@PLpT`s 2Fm  B B$X00C0 ( -LMQ`@P p5 0  ԀLğ R 0*LV$ 21S 0   Z 0 0 $ 0( 0,0 T02SS W=OPß20SQPX & QP 0 2S W SPIW20  0@P@0`A0Q W 32 R R01S 2SxPp(K`b0<0 0 QP  0#KX(ZW 1`WV   B`F RD1aSR148<$W00C0x1@@PAl`d1S 0P0K!14!8!1 91!1<0 01 +1 ?0%1!1<0 d1 T 1D?0 Ki( (jjj kk1kBkTkekvkk -LLMԀ0P`@80 ` qh < RlPTpoK,00P0S4   $KZ40Z“ \VԄK 0 4 @8 < 000 0 8  0L0 00R0S +0T0 ؀0p#KPT0SYʠ;! R 0#KR0o 嗩@(Kh[ 2o0pX$Kp 00$KPp 0$KP`0 t@YXԄK 04 8 < 040K0 QP 0 00 0 0h:P 1S #K 0R0!14!8!<!14!8!<p\#K 0L08 r20X0KL ]ԅKp 21S 0 $0 P( 0T,0 X\X000X 00S\8*.X :RU6JL021S" L0240  0$400(40 0,0X0K40 p P T p%KX 0X0L00L0 L0 S00R0S 0 72SiT@p0 p p?P P\ 7BT 80Sl \7K0DK 0A 0T9 P 0 X0K 0  R 0%K80S P6p@WN#KDK@TP0 KT0P 000T 0SEKK6r|"0jS0KR pSW 0A %KPԃK\@80S 00  0R5P"P RBT xC5 $K0V. 1S+ #KR0$KP000 S#KR0!14!8!<!14!8!<#KR0#K$KKPLz8ğV, 21S( 0 P$0( 0,@#KR0࠳$KࠣT0ࠣ^#KR0 @  @  0CKT0PG 0$K pp܀m800  0oꢧ R80S00  0 P f}TZ 0  0  xm80S K@80S v @ `p WV`  04oKD00H#$0 #(#< 0 0 0 0 #4 0 0#80 0@#<00 0 0@x2Sf BT80gP^ `p040 !0, 20C0`?@@20C 0`0@@40? 20@0@d040 !0, H2??0C 0`?@@20C0`4 0@@`2? 0@@0H??`80SH02P SN ,0P@@TIJ041S ((kkp(kkk l0lClRlclsll -LMX"pP2@jS<嗦P4r(b2S 0P U2aS 0S- }Pؑء0"S'R s/t 0댂X2S a0p 0P0S2S 2S<1!$1(1,(Ko>dP43"R S*0 R(Ko @D 0(KoSP 0(K(l` (lllmlllK 0CC"[8="[<@0040x\04  0Q P bK H, P7[O  5K~*P 4s `㴑 0R  j `eVXZ  p0G`  !#;;S`@ `R0 $ R,0T T0,0T0 RC`D0P20Q 0L0 L R0 r 0#10\0\0P 0Q0h00l0d`ꈈ̈$@EJRRaArrAaUl׉6Ow -MLMP@00P0`[00  0Q P KAK+ A0 Pp<0#$42K3"K#(#<12K@02"K#$02K/"K#(#<-2K00."KP0[00  0Q P (AK A P$l -L M@ L0 R0!0!0% Rl00l0 rp00p0KRP0R3# rࠃ^ L rH00L 4 0yP000$ $ -LMpX0`0P00 ( P00m (K &0 0 02[ QP D\ X0 X0 P-L -PL,M<0 pPlP00K`8 P P@B P3 0]P` b0@0 LR0#S!QŸ P\@:p.\F\C\@\= \9P$\ P (Ÿ P? pD  P@PPL0!0@S s@@pP0S'0<0  0< 0(K^\\\\  L0 Q$ 0 q(@," 8 P p"8 @P*"* 8 P0P S "!"0 8 0P@_ȋߋP p 0 p// /9 -P`p@LM0 00P0S (KX  H r0A8 B40 40 s-8  r q` & TP0@ q x 0p P 220 P 220 p P s 0pP pP00 Pp<P 9i{ٌ Uq00@-S0P^0BPU02 -LpPx`@P  LP 0PR*"0R R 0ԍ$ -L M`0pPPPP0S(K† R q  Q R 00Q P@T "Q  PP QA BTS tD q  9 0 TS0000  Q  0 0 g t0P ZP  F BPTR2 Q PE)kԍ -LMpX0`@ PPh (K `0Wl0L 8 0R00 000 r 000 PP" ` p 0ST Rp rppH 00K/ 1P 0 6Y  L2 Y#t ySl0l#2#>p0 Sll0p Sl0l0P0  ^lp20Bp.20BlpX p!#  K0 6X#KQP 0_`  yP-܎ -@pP`㨑娡LP0S00S <q.`@q8VO"0S 2S 0S 0  0 P0S P  BP`l Q P l0`<0P0Q*l0S 2Sp  l\PP 0 RQ@0P 0%+5] p@-XP UࠓࠃPࠣ^p@^`V @T?( -LM@4 TQ10`p0 TP0S0T 0S (K1 0p0D` # 0 K0 0]W#KQP0  00P 0X:0 0#KIW#KQP PLp 00  Z0T 40B( -P/t0L%A?k@0Sp pZ0FS `C W@P0U?  C0(0PK %/( -LM P@LOo U`B \p @ ŗ 0C F00XP 5U@T  K V( -LcM@ 1Tp d! `1  SP0`!S@0`pt1 A 1 l1 h1 xA D0" RPX2P 0,,aK ! #1 pVe?K0 aKSR Dh P`P`10C,> pP0UP=" U|! 嘡 1|!SD00S.  " |1p2|1 00a?K gVa?K QP  x (100  RR R0(1`1xQ 1 1 P01 H  h ZP3  (10(1 R5S2堢005ET/  (WP05ET \T5d 05 !dP,(K RR6 @ST 5" R %P0S`0d 0 B 0  0Q JQP d d0PEd d0PDh0K/0h0VKlY 0! SK0 r d<0 `1  SK40 8 BR j  UY`1  PY80080#40L0s3[050[040040#403[010[0 0@@0 000 DcQ DQP (z ()Ik (*:R $00-LP@ 050(0/ (0/ (0/ ( --,@LM  [ ǤX& -@LS T@ KA $N tpPVt=: SI^KPE$>"E%$^ @PTPW0 KASR000:  PF,P U $?T@zKKATP( 1PP@^pP S(^  S$P@p-p$P@ pKA$HP!0#PU00`q> K0 @K @@P.K BP5W0S`Y K@oPPx^K PE E`PHP},P PX% (K| FF F@ 0`( "4`#/ 0-"44 0"44 04"40 @4"40LP5 $0 $((mO XXiOddhhllpptt0 0-"44 0"44LP0@ 555DD5@@5HH~5LLPPT~TX{X\x`\ `Op` pO K0h O -`@L"QU_@ 0-@LPL5I5F5C50 -P@L@`Ep@Q->C15->C6X3X\0\-9> 59>:>C5?n:>CF5?>CC>5}C>G 5mF5EnF5E~G4XJX ` p Q  $$((,S>,4}S>G4mF4HHLLPPTTXX\\ -L M@Pp ! "44!1"441 $$((,,0044`TQ\50 S L5s`TpԐ}0  $0$S-Y`,9h(KTcT`X_X\[\`X`dUdhRhlNlpKptHtxEx94 Z <`9 6 $5 S\50 S` PP%@ PSڲ  4 4  TU 0`( "4`#/0+P0 C@ / p-MLM@R0 ANK4 @D8 PK0C Z 0pH8 aZ@ tZ< [  p6KP L ? B0 0EZ`pK `p ?B81,%0  08 0>K0C >K0C CK9>K0C@Z2 X`xuP0 c0 C1318 >K┘ 0C R0Z 1'0"(K`p ?zB81,%0P `8 01S !0 8V;>K0C 00 >K0C K 0 LX p 剑''ro0 khɔ da  >K0C K 0 L ᘨP<ᜨ L, l9P:>00 X85   @5 L0 #0S04 KI00 >K0C0pS KI 蒟 000 Sc:0 02^e ЁP0嘨 Cpᜨ p c7X0^85   @5 L0 0pSL 55CK^) 20S= 壊0 0 0 1"]K0 PE0 $? <8@(; 08 ( (0(0(0 hh(븈  U  4!0 ؀ k5P0p00@8Q '' 0'PDP>K0C8 7 t0 !8( 0(xPuhx@vh)x@)p)9&)) -LP@7P0S 70S a WVP7P0S 70S!WVP@P@ -Lp`@ba0 0@$Kk -ML MH@Q  (#0b2PE ? 00 ş 0gK 1,%0"xr 04P04 d`PP "`0 R(K020S, 0$ 2r04VQ0n. n  , P 00 0" RP0```00d`Q"R0 PB~K pG 30S10S%4[&$[&4K%$K@p03/`- 0ܠS 00S0S%4[&$[&4K%$K0$[00@ 44 3 44xp *3d080S 0 0uĘ)p)))))0)) -@P`pLAM' @ 0BK6UTp0 SR*BK\'M@3P 00  P(B.K {'K6 )ݘNx*O -LM0 K -LXMpP`$X @tKN0,0KT0fKp0 &KD00P QpQ( ttK$ K@)QP-D`WVSRWV\/ ) -L$Mp )q QP@PH 0 c04 $? 0 92  BQ ("(0` b80 弡ᴣQ<03<0420S04  X2Q t0004 V 0R  @P/(j  <0 240ء  O<0``0  4 V: 800S<00(UT6`5 `0\(K  <0 s240 <0` 50S  50S 0> p p$550050S 5 ᲀ5000   p)))9&)) -P@LKGM M A K@ X M:4 $5 Ru5&0eSJ 0SE !000SpG|m=K 0C 0 =K 0C=5000H5 005 H0@4 0<4K5GK4 0 A QpQ8 tK4 A㸄 G>K0C 4 0^% 22Pp|4p(Kl%0S$ D L000 0  HtP $0000S 0  01PIKA SR W !@ I>K0CC 0 0S >   P2 s%1P `ܒ L000=0 H   00GK<4K2 I4 `}4Iv400(bo40SH_D2BK H00pH0HBK J W#000 S 0000pP%rG 0=  0=0  g  0x=3400C04 S p*Pq   4$ 0001 p  s oZ 4000 @ 0$0 K AQP 0 00S x*N)))9&(u3) )(!_} )љ -L M@P^`(IYp1`V |10S p10S 00 05 P`8(KoL8`@DT= SR1H 0  Pk$P I 0S$00S T eK$0S 坅0S G @(KoX0P H0 (KT8))))9&Nx*&<H) 0`( "4`#/ 0-TP@0L8v5 0 0@ 00 20@0 UK0p)00S 4 /) 00S/) 00S/|*)P000 R0-SL4M@P (KL2ЀX0`BXP0b0K80@` R C Ÿ Sß Q 0C0 0 0@0pἀ ?%KF #K\5S`9 0 #K ?#KK܄K T0)#K ?R 0;00S  0 @0\5S 0 ?!@PA ?  0#K%KcK 0R 0P00Sw  0H@0 0800 0ih)p))ZTӚ -QLMP`p1 SR* 0"Q@ xSRQKQPL ?~;$K̟)#K0 000 \%@1R 00ß0 2",0KK#KK\;`䀟 l<, L:0> #K 00S   0 q100x@ğ 0;; 1,$0 D00x ?/;400,00S(K )p))T)) -L,MK @P@KSR3 SR*#K|H"x3K SR$KK\3pppP3` ?:#K_%#@\%P 3R 00ß0 2",0@Px K?:` L< l80>00 <40 #K ?d0 cc C3H0 t2a8bBQ`2`2X2X24$K ?DRD 0H ~/(20Sh 2< p0@0CW40 l10X@(10S<40XDSJT P 0S0?SD?QP 0DQ 0<0 <0Sp@ P (|(p0<0 v(<0 S0<0 n(<0 S@40SʠH 0/ 0 l0x 0S0<00(K@Pp )0 )( ) )p)T8 ) ) ) ) ) )<)()))))) $1-L⸐`_ 0p :  0D!@PP@P 0`0`0 0S8EH0J@0`0@Sp|E0 apQd` 0@P8 !p);0 )) ) )( ) )) ) )8 ) ) )` $00-LP@ !000 ) -L Mp1P`ZW A1KԃK00 B? 0D PIP 2@8@PU `1 ?9L1W0VA0 000.a"40 X(010 #a,0 \# X 0 ZX 0 SPp0`Qd0S !Z(00d000 A(K)p)),)4))@) T00- L?@P 9800P 0 W !SR0),) -\PL0SL0L@`1F`a0Ski000c,)4)@) 00 /) -MLM`!KA H0@S 0L8 3/ (K`4L8 u0PH8 KP 0C  80Q3P0`S( 3Q7Qp<(8,, <0✀K L8 8( 凁&pW0 0 3. 2R࢟0t0S=r܂H8S;000p Qo   Xt"KT8 K.PH"T8 R! p t R1-p10QH(6 !08D8H@( 0A?oR20SO 00CK .CKxt+P@]<1@0S- !=K0C  P0ހ 1 P P8S L83/ 000!=K0C Ps!=K0C  P0k>K!K 0CA  P0!KA H80H8 MJp)t)))8)ޛ) -RMLM0 S000#85@Z@5 & 8`pb$:  P T S$(?V04<V 000R0SQZ !0h0S RnK `F  F5?Z RnK `F ,F+?0 `B ?U7S>K 0CS>K 0C SK R0 A @5R~K 0 pGZ 85-  LT ? a Q2SQ S>KZ0CHp 10w85SX"08#80CK -CK +Pc@50S00U  2 ` V`80 0@50ST 00`t P?SK A \@5QD 0S.K B("0D xS>K 0C h,0t  #bpS>K 0C SK R0 AX Fy080 01(P KMJX 03/ (K0S.K B("dP3S>K 0CP000H R00S 0 0CK `-CKi*P@5@0S S>K 0C  P0lM d0 pS>K 0C  P0)p)))ޛ) -L M@@a#YP"KR0"K 0# KЫ D = 0-@@LPU DaBP P 0 QP00 )C-A؃p@W`VX0 0#00 0-P@ L0$UT01 SR087@0P0S 0SpoP0SpeW00S 0S V 0`0S(G<K0h/ )8))6@)`IT -LMp@`WP 0  P  0p`W) 0S ^~ `RpH0`S 0 0 P0L /p00Sdd, %=,00Kh`<=)P 00pKNx*43)d))))^) 0-P@MLh @  +0AS 8yHyPy@y@y00K00\o~ -L,M`pD5@ @0`p +0S 0#KcKePp KSR% KSR ؤ0帐 ?4q`D H DSR/:0 S 0 S PP htK+0PS #K 0#KH0!8(D0 0 S:R H0+K30 Pv+P30 \œ#\   s0Ÿ0 0*0| c<0PS`30i Si P0S 3S 40S #+0 00KS0\p ?ps40 " 00C 0 RL3b0*0C0b'28,l20S /@0 : S) S-  S;00000`B*K ` 2@pWK (-0K`K(K0bS 00p10800@0 0X04K≹K$! T @` `a8b  `p`00S@0C600,P(` @0 ndp4KV4qX  T @` `a8bg ]h) )p))T)())U 0))))) -L|MR2p@ K?30\%2R 0   嘒`0 0 0)0 V;d2吐 0\S0 S Hr0S 3S ,@X KUB20 (K'K`QpQ8 tQ4 Xd  K< K R, ;XK*00<0[S K 0 0 408 d-@ R 0T 2 K0S0\p ?p%30 " 00 0 @PL3@0@00*}&0*0S P@ P)0 P(KSw 0 Vqp))T)())U ))))0)) -L$M"@P0`40 eZZ8 40 40 l Z0 U0p 40 (K g@_ T DK c8C SBYAQYS T0Z AG0  (08000 @4 S>0 $K T0PR#K0J0CK᐀ T0R#K 0J#K R 0#K  #KR 0@$Ka 0  (@ܠ$K =0 L0 0K<pL `R0 0 04p 00800` 00 v(PU@0PԄKZ0PPp)) -LK0C O0Sc ß3 X 0  :0SN P`,0Sß9!.0`4 0p0L `8` ?)$KA0@P P0V20 0B0S R@TU B0S R@TN @|2R@2b@t2@0S pkTBC~*X#<2'020S 0 0B0pS 1 '0,0W900810S 0S \ 1 0S(K @ @P p0 PR<;0S ,6P >K 0CC>0P( 00>K 0C 0C(P 0S8))p)1)V)tٞ)>))Y){ ))şڟ)5))0))))))<< )al' -x@L`Pvd00S 0S Ljp P0S Kh-)) -LM!#KH0@S#K R0SRK pP #K X"TŸ  R0 4020Sa $wP(KP܃K b<000CSW-0/  1!. 1 R#K0 #K R0  00#K40Q l!H  R0 @  ^P P  004 " #P0*"P 0 &0 S0\ YXYX P{M))))Pʡ)))00S 4 /)00S0`( "4`#/) 00S/p) -LM4M8KD0CP$8KD0C@$l(Kp:H BW0( 8K<0C: SWW ` XpUP5 DO8K(K<0C8 B0 000PP#!0 00(K0 (4P X.8K(K<0C8 B0 000PPh0S 8KD0C p xl !P 8KD0C40S,D @5 0; (;(KD B;W1 S> K<ASR:0  R0K<A0 K<ASR:0!K<AQP00*  R00S l:0S_ 8K\ <0C Y 0xK04pG (K0 B?0000?0  R09* 0yS R h!P8KD0C0`@4VI 0408K<0C9 9R00kK0 <AB``?P-8K40C0P0 '90S 0 8K<0C '8KD0C 00"!P8KD0Cl80S,x t43  Z8K40C K 04A 8KH0C0 Sk7QG<80SC 8K<0C  R0S:R;h0S8 8(7d 0K,H0"0 !P *70S 8K<0C008K<0C 8KD0C 8KD0C(@8K<0C (= 60Sh0 0!66(PkK?H0S  0 # KDAP0L M%hP 80 8h))`)))^))))p)))()7b)<))Oc))آ))"U -LM07 0)Kgǟp,0S)4E>@C0A> ?ƟT0_X K9 60 0  V唠0, Rd |6 (K@唠?J*@$\0Q @ ?@_PIK@P @_)KT0)K 0)K 0 p1R(K0p (K R0  00(K0@P0/ `p!. 1`R0 V`` `0@& P0  K/0$\Qc  ,   d00 0* 0 1h40S`40V SV P4Pd0S0x000KS Kpd0,P0y 0P k0030SQ 30SM 0#S 3S K0#S\0?0P!. 0K K1 @A. `S ) sRPK0 l`pHK@TPHK`|0 僑20 ` (K000^ K0!Q0SR 0D$0P0 $ i800iKWVC])KK`p V0QP 0QP)KD1K0?S\^!! K0QP`3p3: `P0 @ `00 00)K 0)K KKQP 0!SR 0 P (KSR* J7)p)T)8))t))()))x){X&))U )ң) -LM @p 0P̐00 00 00CS(K Pp`0V QP p @40 40@ R0Sp` 0R @P))P 0`( "4`#/ -pLlMX K70d`<0KT10 P1 L1 0,0SI8A0S 0 ,Pd00P 00@ P 0D R`pUT@PP 0GK 0RpQ R8 tQ 4  R K  (Kp)Щ))x)#X&)) 0000@/00S 4 /)00S0`( "4`#/) 00S/L) -ML M9P@@XH9 90S P h9 QP*00#0_`04SD9 ) (B4P$D9QP (P80S= 0S: (00P./(0~KS069K0 pG< ,D59K.0S@80S69[5)[59K6)K5i[0``S`  3P ; 7 #R0hwgc0哮KS069K0 J< ,59K.0Sp70S69[5)[59K6)K59[000D9 #0#    5D90P9@ -*-&00C0 @600Q0l L 3pPL9e 00$pS 0S X&`000,P$6pQ cP.\V0P% .P%PAPP5P}{ PgP  |,@ s#`0 0C05  P4`@ Sa 0H9 #3P 40 e 0" p4 !D9Px40 hQ0 L4b0 0D) 0!P#P ib00C0(K 0#\0pß `SP` 300isP@3 0 0`D V PQ`444-p0AS񟗧꠴,||̴̴QŸ<20S40000>P1 d2 #R0~ `2 0#R0sQ# 0ST20SH 0 P` v   P000  !0 #R0  CK K 0p@>K0C`!CK\ 810 S) Hn#R0 š!ʡD90S  0R %KA 0 0 00p0P`000C0V& BxP`< )) ))  j))ܤ,_L)¥H)Tե! -ML MP0AS񟗀긷HXH nP 7  aP 7 00QP  t7LP t70S \70XGXg]KT7  PEX *40D5K(7p5 0E 15 5W2:7 Rp5SF5@PQU`V:(K l PP hp& TG PF0S : 5 0 GBg 0 Y00@(0S S蕟腟%0(0P, P5 2  B. ! CK50S\ 0C.K0(0h00`0P X50S Lm(0Hq0(0 50SI Q(DuSK,@3$ RKR@ ) HZ(, H: _ Y 1 #0R) Y $ $ $ Z 0=Z@ ,8< SK@.  (  C.K /S>K0C( $ Y 1 #0^ Y YK L S>K0CY>K 0C ' RK 0 H5 H5%S5p( 5 R , 3"Q@,0Z(5 0@H  5SZ0Z@ ,< M(5S '@0 (0S "|QP 00S"0P!P 1 !00C0P t00000C0!" !rpd0Sr@0q !SRm j00@h =)o}T)4)@)$)x)X&))ަ))<)H00S0`( "4`#/) -LM"PĂ1EP Q" 2@T(K0S x 2@Epd0DAG@D`0p PP00@!SR !0 Q2Y 2Y Ao1婒0SY QP000Qꨡ0a  R R@0 S "1P <100C$o P -X K1 <"K/K 募K" tb pr Qp@ `Q8 t[K4 F !Pc l02 K d0004)@)x)2X&)8))))Tt){u -L4Md0p<0 张4 P@<? -\%d4R@`  0   0`00 0 b@00 -*40S30] S] 3 H0 R 3H S  @ 0 pL0 2D0 0<`堣80 L0< 00CSG80TS! P3 80R000 A`pD L3`A0 00?,` a2! Q,S Q0 p@0B*220S P PB8 P(KS @0 X P080 0/ !0. 1R R  \"o 1Q_0T+ 0H S`? 040 |10 ?X,40P0K P0  00#K04 "  R 0 H0̐S 0 04 $ b? P0L  80RT $0A0$0 @ 0 @L3D 0  SR 0< 0`pp))T)())U )0)))) 0`( "4`#/ -`LlMX K*02ܒ0 0,0S(KB0S p0p,Pd00P 咿00d20@@_10 T2 00S`UTIg" p "WpQGK W8  Q4 tQ4  W4  XQ   0< K ARRX,XHpd0pW! 'P 010S  0嵾@PP 00S  0K0Q SR  0 0 K W !000S X P  0<p)x)ƧX&)))))@LT -MLMDn弍@P20xK0,pG M/0t0=0S5X0S+$5S/\= R L 0S 0 $5堝= *='=0S 0 0 'PX0S$Y\YYѰY<`0V\0 PT0! X \  B. 00B(K1/B08K?C\ 0K00B!L100$Ŕ`\d0@h0;0Sh`h0QBQ00h0 1l01d0dKA@<KzAV000=S3Lqo QT00B' X TS0 BB$51`R  B Q1- 00Q  T$: R( 0S  G봐0- 倐B$00B1Q1 `R)B!!@ L0 PP4 0 sPT t:P\ *㠐H:V<:0S M0 0<8K!>C0(KA?/B08Kz?C0(K3A?/B0 =(K{/B0T0`(K~/B0(K>G/B08K?C.,.89 0KLVHRKLX0S8K(K,0C>C.B08K>C@  .8=`C Xa08Ku?C8Ku?C V0m 0KwA 8Kw?C0(Ku/B0(Kw/B,0 Su8K>C?^ ,PG 880S KAA> CKA˄KALKA|8K?CEP7 8K>C@ &000t7lG*/`7T70S 0 0(K0(K{/B00S8K{?C`0/ !. 1R0 X 0`( prPf0S pd8Kw?C0,8Kw?C0 ܼ008Kw?C8Kv?C (Kh?,8Ky?C`8K>C0.B00\5Q 8Ku?C008Ky?C  ?KyA 8Key?C  ?9 &50SD50 S 450S(Kz/B0 S (Kz/B3 S 8Ku?Cd0S t0 0040S 4 0S0Sy X4x4t4 ?s&(\0d^ hKuoF`p` ?`d  B2h b:"6>/K h?)KyA`KALKyA``p 0`AKAR`KA 3pW=S(K,A(0K,H08Ku?C0(K 08K?Cy/B0 W`C`(K,0u/B 0CS=SSb 2 \2 ?,(KyA 8K>C0(K0.B0\2Q 8Ku?C008Ky?C  ?KyA h8Kay?C  ?[0S 8Ku?C1a410S Kx@P1`p1Pq0h \10S 1P0 11 ?s&(\0`^ hKuoF`p` ?`d  B2h b:"6>T)))x))rը)x)'X&T()O)H)o()))ک0)p))))U 9)))QrG@C8K ,0C! t $5S868K,0Cp 8K,0C $  ( RV ( , RV``0 `RQ W ,`0 xp x Qxx hK,`F 4~+(Kz/B0 ST8K{?C Tq+K(K,@z/B0 S\08K?C b+W =SL5s(Kz/B8K ,0C#p8Ku?C⸠0hK,`Fß? Q)8Ku?C0S!8KK,0CzA R\ ?0 K 8K,0C zA B  R\ ?0  (K, B 00C 0`㨢KA08K}?C  8K}?C 8K?CA0P`TTT`   K BzA  R \  pRB0/  8K?C!0.0(K/B0 1 R R KAQ"0(K/B S `000^  ~aR8K}?C0(K0}/B0(Ky/B 80 HS(K}/B SvxK,pG0008K{?C0S0 d0 ST0T00! !8K,0C P RP%XԀYdp0   000$5S`0V3S  K,Al!s00`R3080(Ky/B`8KKy?CA R0;D6(K0/B08Ky?CЀ0(K}/B08Ky?C0(KK,L0F/B0{(K}/B R(KK, B}@$0c$ Q`VvaRQ0\04 0$5S(K, Bl0`0hppWS $%S0! !K,@$0(Ky/BK0yL@! `a(K0}/BK0}L ``(K 0/BK0L! ̟ L` 0 8Kw?C0  `P= l80S  0K08K?C0uA 0008K}?C00008Ky?C0 垸8K,0CC#P8 8K,0C  i 9*9}(90S t0 0H9xK0,pGS b8K~?C Pi0ST0TST8K{?CT P! GP9 8K~?C  0K,AST0TST0z8K{?C T 0 0H:0SxK,pG0S\0S\8K?C kP BGP 0S\0S8K\?C j 0 08Kw?C  0 p0S $S00pW`S8K\0}?C000S\0?000+ (K1y/B00+ Q\QKA0K8Ku?Cy@0#8K?C q8K(K?C/B0 Xp(K/B 0RpK(K,I?}/B0(K!.B 0WlS`0?00S8K`0}?C0000+ (K1y/B00, Q\QKA0K8Ku?Cy@0#8K?C "8K(K?C/B0 XpK(K,I?}/Bp0 -p`@HHLT(OP PJU @` -AL0 5 Pq 3S5(r`1 0" 0SV 0S 1"0a0  la* `1 T10S 0 0U2031 PR5 0S a@ 5*< 5x 000S 0 0@TPUKhP\0UX PH0@ P,0p))9&10)))e)I0/)0/)0/) --,@LM   as㹴X& -@L'q0 R 凶P0S 0`V|`  T\qW<@0S (0S>@ `~)`0)AOO --LM  K --LM  K --LM  K --LM  H -@L]M^KMa HpH@P(KBK! Aᣲp@P,0KD@hBNKd @DU.K B% P%8T5: S"HQP0 00PPKAٳP4: SpP% S00S BK  @0PxPPU BK @0P  5 s5P@)')ք -L0KMcʱ0PD@  04  5 K!K ,) 0-0LS 3/ 㕳|) 0-L&0 @( 0 +&@0蠔< ) 0-L&@(&@01Q0@?o-2 P  R2 P0S 00CoS00S00 \x PPP TH LQHH  0000TTT)))t)()T P0-L@0,00S NK0h)` 0-@P0L000 0 0022=p 000=000X0X0<0<0@0@0\0\0W H3H3L3u/L3P3P3T3T3K  G h K0h 0-@P0L000 0 0022=p 000=000X0X0<0<000@0@0\0\0 H3H3L3u/L3P3P3T3T3   EEP   4K44K44h 4  5 5d0d00000P5P5H5H5 @ A H5h H5S>S>K0h0 \\L5SPPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//) -LMH8 @T 8T8t0؀ YX+ 8  ?#K:T0#K @P @(K0\kPc0S0 30S30S  ? \ :K TcT00 P0\CP434#0S, (#S*  P S0S 80rS tB* 0S i@异\hp I/o2" W ڜ8Y 0R00 4<, 04 K0 4000 d0? K:Q00S8,0 0CY    AŸp 0 ? 0pS]0S |A吁0h X10S  P L10S @88Aqm 0S * 00S 0 0 0@0@ ]hp帠ppHQ*0 R A ײ )Д)0)<)()))ի) )Bp)T)Y#H)())s)D)Ƭ -@?ML M@0_0K?A`地P4X # d噲(KT0S -^0SQ 04(00S e > > > ?   ,8 [@ WT0  R,8Oo,  L,0(QB@R  P >R0(   P @T ®P  妙Ṯ48P0Sp=0Sx 88 dMR r>K 0C0>K0C p8<.00P @=0Sw0St@Tqe>K 0C80>K0C p 5[S  ZK @+ P ZK @% P Z.K Bd k)YL d"7S,8 4  4Z  X  pW   KV. @  s0  (5 RISH ?Ѐ /` \ P `5, S<(0Q p,t  (5`# qP `5,(S>:*0:0: 0:L 0'0p5 Q$0Qp5 0Bp5@0  p5  T0H, t5 !KA ,(0G  ?00 |: IP`pI)0`\Q=S.30P 5` ' 9RV0 S @\h SX i 5*< 5m9 90S 0 0`8:0S 0а|9 0 S` V 880S(8Qm 0g0xȟ-B ,K) 0 NBt D ``b(.`(.`p .K x B 8gR&( R"=S0S ' 0Ї<<00P%X30*7Z 70S Q0 00S5h70S10=S-0S D000: p 0L%000P%X30,.!v *! 60S 0 00 <0S P 6 %PF0 5*P6 `60S 0 000SP0E0*t5 50S 0 00<cQ<0P 0\E<0*V`5 p50S 0 0D0Sl0L%r8 Qڨ0Q2ڠe 0 0S lZ0S t*)4 40S 0$ 0 0 P P?P 0S/0L%r+ 0QQ%ڸ(0 0S xkZ0S C*3Y 30S P0# 0 0WP 0H00q&  000cH00S ?Z0S C*3- 30S $0" 0 0+P 0L40q& d 400cL00S Z0S TB*X2 h20S 0," 0 0P 2@T p1E~Ⱑ p\  P@TR 0 @R 0Y0S lA*Zp110S 0D! 0 0D))))<)#n))6F0)))p)()_TX)4[TB`}/ЮT A)b^9Hlΰ))R{Ų)0))))0))H)O)*()))))) ))4))@),)۳)w)))))<)LBAL(G|ʹ)U)))0))))Q\ N R  H4PU XAQ,5SڂKSΌ A SR( 0.KS> B0S Y0S q*110S 0! 0 0,P 0(0S& xQ* P0S< x 0(%0S X0S |r*`x2h20S 0" 0 0<QP H= CSR( k0H  ? A0S X0S Ls*,H3830S 0t# 0 0P L= SR( 90L  ? 0S PyX0S t*4g40S ^0<$ 0 0eP  X4 0S640S20,5S.0S $0 000.K BЀH ,5S> <0(5? @L u ? *5%50S 0D% 0 00SJt50SF0L5sB0S %0000L50P5?T5V>X50$ő-00  B00B1\!`0 P0BQ@5,F00L 000*jP6@60S 0|& 0 06 PR 60SF*M660S 0h =48`P@PL, p,x 0x `H   ? @L  ? d7;lPG|P|,8LS@D00ET@A,8P80Ÿd 8 B2 b>@"8<_P 08S 008 80S  <80E A d ? B2X b>@"8<x80S   0,(00p0,8 ,8@TPD8O@ 0@P?`@S9P( < ,@I<9PH 2 P9 Q\@_ UT@9 @99)p9#oPrp9W @9P @9@C  Pg:0( _0 5 @: pH:0S 6[S gKd @P 8: K:POQ 5Z @ 0P@@ 04 8 <*c#!$c4"+S :Q  4 P 0  0 W0  0 0 0 0;a(!"4a#Q  ; R ^V0S 00 0 0 00  0 $4"48#8 S8 (< R D :V0S 0 0 00l0  00 $4"48C8S < R V0S 0  0000D0  00 $4"48#8Z$: A/oQ" /Q Ry = R U0Sh 0*000  0000 4000 P $v(> R 8U0SE 0@000  0 x> >Q>+,>N 0S > 嚪^ 5<00R.00.@0.0P'5PFSPdv$|Pw<uP 0 40#400#0`p R W !0B8#80P S@PUy0`sPVt0lpSW0QN R  408 08Y @D  @Q))} 00-S!4!: SL  S  S  S <0P0 S  S  S)) 1-0LSp lhH@ 㪩T L10S@10S0ީ(1 10ST00S ͩP`Ʃ[ 00CS0 @ T @YT tYT0 @00CS0 P 0  0 0 SNT)))ֵ8))ߵ&׆& -pH0L0@S` > 0!|P㔧) -PL M<1P81P4100ppP1 P PcP 0` P P`` P 0(00 N@KoTP00 UT X P(K PY` @@  0))p)))X) -L4M0H 00 1p _%#HCK8 080 #K 0 00P 0 Pi0 <0`040 00V 㥨 0 00P40 4(K?P#K 0  H PP ! 00L0 K ?$KL0P SR ,@P?d$K 0<孨40040 0`p$K壨))L -LMp0P`80 @ ?#K0..&#K00000 #K  oX 0 (K 0sPxX (Ko*#K ?  8RP  ? Z0P))%Z -LM 0`S@ PU 81 (U$$ P0 PP0 0Tp0@T(KР0 @DLc0T@S`  80E A ?#K00d 4 B2h b>@1<"d0S  0P00p)0)p))) -LM`pdQ A\ a2PAl 000 SR P0D D000p 0@pKp)@ ))D )<) -LM0P@T@Td `L l0` WV @   00P00@@000$KX)p) -`p@L\MX tKutKeKT@ KШ 00-L@S'' ('0H0S  T00S HYR0004,VP000)ζڶ -D`D@0L P(00S Khp))) 0 /x) 0-LT @UT0*<r80@400 ?+ 1Q0 ))p)9& -LdM`SR00WV0S@ d `Q 0S  BR 0(KT K0  0Y0*X40600S -0 00S+P00S 0P0`d0 0 40Ρ$KkʡxP)))<)0)D)))p)))))))X)))ҷ)D )@ ) -PL$MD3p00 8Q03A @R _3CK40 ܃K_R 0a@ Vd`@ 0^ PŁPXU@TP A \#KP 0#K ?#K#KPPR  ?000 2@UT :. BSR000p)^F -QLMPp` "K< P9 P40P0 Ȁ0S 0S  BK @P@ @@P0 0S 0S T0 sBK @P@ @@P 0 $K)))Q 0`( "4`#/ -LM@8 01 00 08Q(KS@Ppqa8Q0Q 8 40 8 40Pdt`pP$H `0-LSH9,998@o10 0000000B!000!4 0`-LQ9999o0! 2B1   P"Y 0`-LQx:\:@:4:BB낸 0`-LQ;:::BB[머 -L M$5S`@Z UlQh T  10t0pcR40C<X001$0 p40 0 0 40R !S`V+`F0DS@@ @ C@.Q%@C00Y T  @V @(K ^`  @ @D -LM`R@p PP \Sq_K, K4"DiP`(KP(  p`00S l<08 (00,0 000040!04 04$0D0(0`P rW `h |`{`h20  Xk Lj @j 4j (j ˟p şp  K ፟p 42`#f0`9`a8SڒPb 0  *0*0P0   0* *θd@edA#5Izd@\ -PLCM M`B.KpP; B%p@P E>K P0C0PULT!P0#  K -pLMnKM `F@P,~ ,Put=(~ : Sw/30P  rR \00d K0C P<#@⬠K @,^ WF(>S T@ KA $N pPVt=: SI^KPE$>"ሠ$^ @PTPW0 KASR000: ႝPF,P KU $帞Tt@zKKAP( 媞PP@^pP S(^  S$=P@p-p$5P@ pKA$RP!0#-PU00`q> K0 @K @@P.K BᐞP0S`Y K@PPxz^K PE E`sPHnP},P ɼX% (K| FF F@00S 4 /)00S0`( "4`#/) -L M`t1pl100 ?+ 00K @X_` 040P00p  !lRRQ00S" J% 0%D@L !0ZXt000Z ` 00@@@P80(K)p))))) 00S/) -L$MP8 <0 @`pሡ0T000(K00 ?V00P 00K0 08000P000S 400 ?* 00<00 0 p)))dֺJ(\)^FF^,^)!))D{ -L$M!0PQ崁P!a` P` S@r010 4` 80K0 0p[000P8 0S <<P DpU P U8 000/ 40K8TP&P00弐ZP  0S F 8 BPLP@0(Kk>p))))\H)) 0-0L @ -  PQ `0S 0# 9> 0|^0# :> C0TS0S0P8P㴙0p)^F)'R/ -LMԀ#K@ 0K`pX0P` `0 X(Kf  ecK`p 80 80 -@LM P`pF  0W0(08#8#48#8W00 T< !<04080? K :^FF^: -@LP`   ~ z -`@PL ((UX0 c#!$c4"X0C-bAYXQPYX QP#P00@-P40@00 P0 SR0 -LM`p02#W 010!00Z 0 4 CKTK 4 I W4 c>0 S QR Q0 R @P@  %P$!#K pG04 c>0 S Q\Q0 R @P@  P CK!@PbT  0 (K=l/ ~ 0-`L3S t0t ttATpAS`0C`pX0=|b ~ -@PL40S:aSʱd0d d0C800S   0堶0080PP80S0 Ꜽ~ ,00-SL@0\00  PD,~0,0080S $0$ $$0K0hm)ɼ ~ ,00-SL@ ,0, ,,TP WK0hS ~ -LdMd Xp`P (88S0P P84PE2PE1PESPE50  00 0堙5X  /\Z㣳PE` %0P@0 D5Q <兙O0@0 ?U 0XR P(00,0,0$%K! 0HL(0#$K#%K0@p ` $$K0@ 4$0IKeK`Pp 0840  %K %K $K(D ;D, 001"SRS 3S`4$`V:7001V#%K 0`F34`D0 ccK#KKQPd0@ #K,<0KD JPP,``3Q 0Q+ 0CQ܃K 0PpS #KT$PPP wTPP! P0TPU !ePP !T0PPP 0p ?&K0U 4 KeK#KQP LCv 0R3`0 0$KL `0SPp&K\܄K#K%K 0P YX1!?%K!< K 1$K 0㚲%K!4000!R 800800 p2K0U0XZPp$K 0P 80S0ո ո0C800S   0ҴHOP:^@P @(K0@0 )LBAW5Wȗ~aٗ NBAW Ž -LM0@,0S0  `p40S* ᐴ(K00QUp! #K40K :`P  o`PP~ -Pp0LS,0S`@d0d ddqQ L0< H 0P@DT#: ~; -LM@p0C,0S`P0 VAQ x0h t 0P ! "K,0K P`PEpU$K9K ~M p-L MH0P0` 8@ 000 s `Kp)) p-L MH0P0` 8@ 000 X `>Kp)<)M -0LPQ P plAPY.@L`Lp0P R   T0! '@)H )}) 0-0@LP0,0S /000H ) -LM,P ,\  ? KH ) 0-L@P`p00Sh0X0dSX0`( "4`#0D006.8 Q= SR00))p) 0-LM20S S+,|2 xR0 EL% `Q0 \bXPՔDfV  -LZo ) 0-` LM-K,K,K0@p K0 0 븃 ֌pP13 `R7KP 0K %0S,K 00-K2 0 QPK -K/K,K`/Kؐ}P P0V% (KlU tU bUK@pPKT K: P0K KK V  F P 0 sPP0X:P0X! 0`eP p`hP/KR0K$$0.K /Kl PlS 0 .K /K^ P<  K20 `p V0Y" $ 8 >pu f K 0 `p V0Y" $ 8 z&pZ 0Kh K T  0K $PJ哱G )t&9& >Ym -p@`P 0LP U  # $Kk # P# 0- LoMgK 0P@1 1 1 1 ᦋp`40S+ (KbV AV LV 42cV iVkKpiKC jK01 @4: S 0@oK qK 11 娑q1P  P 0! iT K咒p Q%KoK %K 0! $lK"@P 0W1 $ 0/S ׭ 堡ZE pǰp0"K(?P01 $BpP0 ʐP'!&z ؐv 声Wd \"ᚰ1S1@ 0PRm `VeK!p c?KQnP n?!n/ 1 冐1h0P` !0S `0S ! B/oQ" R!Y1SY oKqK+ QP oKSR m0e/K$8eK Pp$`G0p2 0$ p+ opt"QP `T 7t&9&Azd@_tro ] = -`PpL4M@0` 8` Jp@'00S000  20S$0K P W 00 PT 0 0 0!5PT AT tm@ fT pT0Kp@(Kp080 ` 0pP , ? 80o0$K0 00 p 0C p@$K`Q0 QP p V@p@`t&:&U -@p`tL ᫉pPT10S D$KkfU rU`   oYXp1 .Y $$  npP" X`&00S $$ ]pPl W`VP$$ wKpP$hSt&,:&;Wt  -Lo ) -@PL`pP 4.d `ϒT  HHɒ 8垤U  ( Kh轒 KhO`X&! p-LM R0`@KpP (KP0( 0S 0SS0S  1# BS0S$KP"KH/ (P/00#01"$#pG-`@V ^ p V00`@^P6 UP@ @ @7 TQ@T* l@Q @T*?!Ì?@T*, ? ! G- 0 @$a$q$@PU# \ \0@೐00 0\@ \@ \@@ ^S(0\ ?P\CPT 0S*$Š@L6ˌ7ˌ@ R@ 0 -LM@$0 @VPP 00 0bz' 0hQP ᾭP(K ɍP -L M@$4cr'@P  0FQP (K 匍 P404 --L M 0 K --LM0@0 ;  0K --PL M 4  r 㚐 K` -LMP`pw@P(K  P P 4S  0d8T0P$  $QLP 0S 4S $ X 4P S $ SW1V!` WV000 0 @ 0 P $WV  P WV4 T`嗆#`P&" K+K R0+K4S 0 K+K " KG" ` KlP\ 00pP0S p d$9 -L`C$$0w0 00`E؀E$T0  gP0`p 04S `P 0 08p P$0KP#0 0zp P 0p~  V0pXv)5d@AXd@o -L M@P 4B BR KD凌p 4^4 i Kd@ 0-LPP@p P@ T 4PS "04 0Er -p @LP0T P ` X`p@0 p@@$$ QR "( / 0T 0< /$4 0T 2 / $4 0T 2 / -LM`PP@ p ԀԐqT! 0 00 3ꌧ0 `吐P  `0 00l0T0X:(K 10 00`0( 0 mX&^ C-$$L0A,P p-LM@ЀX P`00 0Xg Kp,KZP 4"KR 0 SH/0@ -L|MP_o!R0`@R(0S00S "R0oU (KP PU 0SMpWJ (0WSFP0 QP>P0 QP6pG)00S$00 P0 :P! 9/p  9/p 40 8 m0 K$8K0+P PP -L@pP`sP 5/p 4 5/p 4 ` -LM`0PS 0$K$D0  A0  0P@| 03@ 0V 0j~ - 0LM 00 P{`pZ(K0  8 40 P 408 0S L0@`4{@  0 H/)p -p@,P,`L0 0@+Tp -逐L` pPp@R 0 0 <0P8 L H@Tpk -LM`PQ@#K  00 (KP P0S* 0E8 nP8   ` pKp Ec` pԃKp  $C_ p-L M0`SPL@ KHo 00SP KpH/0 -L iR sR aR  p`B>s 0-LP@P $0)P0^0H/ -@LT`P,0ڤPIH/ bR0-0L LR aR 5 sR tR iR(} 0Sڈ&0000p`00B @P 0H/ -LM`@$Kp`᪽P0 $0K0,$0[S $K 㢊KШO -QLM@` Q  (KA^p P$P tB^dp0 00 ` 0P  ,c8 -L4M @#KP H 0#KK(KP 0  0 00`p $V!9# SR Q`p `p 0`p#K 00b VR`p0SH V0 SR$ `Rp 0bp $hP 000 0` 0pP᯦4 \4 !#K"4 #K R0$K R0#8]pu $ $&#K8 '#80 <0#80,0RP PP PT0PP0 S&Z^#K pU 4 0 00`0$K PE 4$$   4  !4 "4 $9pP0 Sd 0-LM0@0S K0C^ E$奉E$$0R 04P4 @x("(!ዉ"`#X80P K K@}P8zt&D:&BM^p0$ 8 -pLLMPdK4 h T1夡00 ! 2p h0S# |! Rp!dK(KfR lRI dKHh0`S ,P ʼn@P  )[h婥@ ,Ph Ԁ h囥T 0 2 0@  T p p0@h  @hP@hKpH/4t&ğ"\:&& -L`p(@PP0 `@00! 0$0 0-@PL0$0S GK0hC -L,M PDT KX*`` pPcK%` SR#KSR00S& Q UQ 4 04  0{0P 00P$0 @TPzK g(KQ UQ000 Q1!!U111 Q[P  tPPH 0 Q 00P$0 #K0@S0PT#K P KP`p`#K 0cKWV0@S0PP0 X00DP `` 0K؀ #K X0 00P0@SP=< 4$ P9U -L0M@Tp0`" 00  0d1"p 00  01,$ 000XC P` R#K0[0; #KV05#K V0#K KR 0K 0R0C"KR0? 09T0 K 0H0 1,$"K(00(0 0K0 000"K #K 0 $KT0K 0)#K0 K 0 1,$K0RKcK "K -LMԀp` @PEJCV@@P(K0Sl@ #K 0P 0@@000Spd 0 H1"P#KR0@#K @K T R0 0  0  0  H1"P؀T 0%V@ Q  X0P Va  R0 X0V Q #KK T 0Px qԃKX  T0 0 0000Sp@^fU/P/0S//P/0S/C-؂ Đ\ @ `pR0\ @P  0  0V0@@ P Ѝ R0P@P -@(MLP@`puP8RK`$ <KP0  4U -LX@P HHH0H岆@@B@8`8P@_TF^7X&T$: R-L R R 8R R R0-0L@P# R" +:R! R! !S 1 @包0  0R R 0R R00000000L ) - LM0Pc@P(K0!S R *`(p`^P4S 0l0$$>0KHH00 80 S4S00r 00!S1 !@10  p 003/p H08  0( $4P 0 0 KR 0"`p V0"က00000 0S  0R0`pWEV0P[L ) 0-L4M00 0@`pt@0 80 <0  |pPL30S0`KqP 0" fU AU 7P(KpU sU080 0KEp0@0 0<0 0D0 @$KB0 QP 4 `D0}p0ᴐ0P0 0T0 4S 0S200  R RR*R 7:R W R!@M1 R : RRRR*R :0BS<0SPR R2 R80S$1 +10` 0`Xpzpu ypq D0o_P@ f@00$Kn 5pPP^]Z8 H00$0P T0 (  R0"`zt&x:&  )d -LM@pQA^p  PP`|t`fP `P KpP 00 Pc5 -L@`pP* tV0Anp `Bn $$ 0 P ! p" $ppP 0 0 PcTq -LM@`pԂ zpP920S7)`pPk 4S $R4T QyP N S$ 0"SR Y p(KrU (KoQ P` $ 4R  4S  0P  0SS P P 0Kp 0 0 0  0P+,- ?o  010 00 0`pPth$SP V0pt& :&U@ -L8M@P`4 TKp0pp 0  yp P00S 0@ TKTKpKut&H:&  -L ) 0-p LLM$K#K#K0@`ȂH0  ypP=20SG#KR0cKP 0SBQ? SR;H #K H00$K0 QP`p) ԄKH0P0 0P" P00CT0  ` 弹PP cbU<KP40KH KDKpP(K$$0 KZ8=0P R  WV 0 X0 %K0$PV0%K   00 QP ` 0`Rp`0bp T 0bp 0  P t& )C:& -LTM@C~,`K G f( xpP  50S P(KsU P0DpP#K  00 QP  0x#K$$0Gg P0R#K 0#K<  00PX0  $K0 X0 0\0 P 4 "$K  4PS 00$Kp$K\eP < P`   KYXĔMPxPpT `g#pKآV :`K X0P0 0 d 僸Pd %KR0K`#K RK0P0T$KR 0KKX000X K$KP000 SK$KR0J 4So K P0p``0`4 ` 4 "004 R\ 4 !4 "4 R$p \01S$>#KR0\0r/s?¡á[±< "( ñXpPn(X0܃K 0p 004 X 0 00`00Ph 4$$  wt&:&m#Hl )r. -`p0@PL$M,KcK`hl@0 \wp'#KR0ԃKP 0SFQC SR?@ T 00S< 80Q `@TbP NP" aP ~iP lP|(KT <KpT T @K}`pLt&:&: -LMԀP@P[4@xX`hpTx M 0 hd`\XT 0 ,< @qώ0Ph #x0 0 SR- @T $m0E/K8EK00  K5K1S1St $Kd2PPP P -  p-LM`0%! 0 T$KAP0 $0K0,$0[S $K| 9Kp'O -WMLM`p@T XZQ0S@8 P\ , $$0$$0 QK0! @IK0  @IKQK A @PQK  @pI.KQK B A2IK0  @IK A(-Km0 B$8,K A\X#L AK @*KD\sHa40k?`@-`0 @CT`@ pT00 P0S@XX0X 訾& -ML MP `"`~\" P~P)=@@r@T K ~ ~ `Vl ~   `RK0!@JK0!@JKRKA@PRK x@RKAh~JKA\~JK0@!@JKA8~4~$ !0# YK @1P$ !0#q~ jY.Km0 B$8sYKAe~c~# BK@4X)@YK ALT~Q~  ( DyRa4"Jv? 0-p @P`LM"K,0@  up20SyP)p( ) gP aP bP =p$KlP uP iP0KLp@@,Kx@@"KR0L܂KP 0S Q SR0 0Q ] } }(*`ᰀ尐V } } Q l}   ` }t&;&yR -LHM@P`4 TK dKf0p 0  [tp T$  dK⺴P 00Sd0K TKTR lRxKTdKpT8TKp )t&l:,;& " 0-L M`00 0@P"K"KXq  tp!"KR0bKP 0SBQ? SR;0 T 00S"K0  0 *a@ P Tt),K{pT $KoT 0K3 Kbt&L;&: -L(M0$00 0 00 00 00 00 0 00000000 \|$ K 0-LM@P0K0! 0K0a 0K0a 00 0 0 0P S K0 -@L$MKe3[ >K3K_3[3K040K 030K 0  0S0sS@04)  H0 嫳PH0 p0lS@h噤( ᗳP p m(K@T@T -LDMpP<@K 0S  $o (K-0K 0.0K0/0K000K010K020K 030K040K060K0 80Kg P40[ R 0S P0L哥&@0 TP@0:PU p-LDM`P 8@ ] @\K@ \K6/TKp -`@,p,PL 0 @{ T -@P`,0L4'U Kh -LMpPP 4  0440 00 ,0 (0 2[:#:92K,0[4K@0<<@,0K *xp@`4K K x PXx,x@@ R00``VxM*DZ -L8M@P`4 TKO0p 0  -rp T 00S0| TK0PT0S 0X TKiT@e0KTKp^ut&(l;& 0-@RLj 80 ) 0-@RL\ 0 ) -@PX7LAMPgPw  $1  qp ,70S  (KoZ0$1 SpP 1$N P TP 8@TFVPP K|$ PF $V{@P $!h=00CSSP P^ P  TP 0KK o_P0S S`P K?K4N P nTP 6N Pz dTPu ,N Pp dZTPk "N Pf @PTPa N P\ FTPW N PR  (TP9 M P4 TP/ M P* hTP% M P D TP M P TP M P SX.cP DdPJ JK?K  0KK SRP\X  x SP J \SP 0 `RPM PU JSP #80K5KMD P SP PeM P SP  SP J@bP RP` 0 P,1 1$ #U : D SPN J (R`PF ,3M PA mS!0KKD P5 aS!0KKC P) US M P" NSP Mp FSP M P L=SP m0G/K$8Y1[ScP  8JmGKC P #SP,1P0,1 540T 1ᯕ="kH/t&;&n& z-z^ Q"*4_ -LM@`p[ op ;0S  (K0FS iSPC>`C$4P Y)P$P YX 000@:PT0P0 ( $kRP$$0LPIYRPP URP (0LPIERP L$ W  Q0h00 2RP CKP80P ^  P0-K0AK0 0 0 -K R0.K R0/KRP  R0P0 aP⴨ JP+ J0$mPP 0c0 QP\ 0S$I,<, 0P0 QP0`KQPg RCK`PP  PᏔc KLP QPN L`QPpF L/KR000A/KV 0S @ [t$4P $$Pt$4P`0VQ`P QP u\&xQP LaP 0嘦#81 J`PJx&?  0`0 QPvH<VQPK pMQP KrDQP K=QP K6QP Kt/QP K(QP K!QP KlQP }KpLQP uKq?0 QP mKr1S -KR0 ࣴ-[r? ñ! ás?s? PP UKPP NKsu$$s$4P`pPp |I`P|I$$؀0` :0 QPX KPPe ;BKP x PPU +BKP@PPJ KK$PPB JK\PP: JK@PP B$ tKPP) J0S* $4@ K$ 'sPp$` 0 00 QPp{$ sW$  8m8 00\!-K"08(0/K#0K ,` 0$0P00 T0jXf$$0`0 QP>$$r$4P-K! 0".K`$G$` 0 0k0 QP$$r$4P` $"TH/t&;&XInn"Q4* )2X^_J  -Ujzzd -LRM`p, K0 K! .K! -K! .K @P 1 1 1 1 0 0 0 x0K0 p0NK0 h00 `0 0 X0  0 P0A 0 @ P  .KKi@HiT!i` -@LM $K $K 0`( "4`#K 0-@LM PK Ku Ksqp@ @ K4sp(ۻ0K08l'ix p-ML M1@0S1`0`S` B.KH0x1, P h!hBKBK\SuP 0`0?o0c Pc U %P PP >u0 0B.K00`0 P BKdBK)uum"u0 0B.K00``0 P P PBKHBKT u000@ 0KKK0uKp))  p-L M?PP E KM"P > ` @T #Kp.P  00SYV  t@F0 R ! -LM@@ Ppp`#P"   QNP1 DY< JNP>ENpP 8Yp>N0P 1Y0/ Kp80 t<P/[80) h  <D0 8 . K@pD0! / KX<Pr /0[SohQl @ xrpal X"[ R R RS 0PW l S \ㄺX (m<{W 0d80S, @ hBrP@ `Khn-nꜯ p-PL$M@` 8KRKP8 K,bK P p@@+VKpiA -L M K8@6P(0( $< [KL{i -L M K8@w6P(0( $# [Ki 0-LMP "Rl@P|UK0 P ^KPE+jP8Uk8[S8[S1iSUo -L M KP@6P@0@ @@![Inp$ゴKAi~ -L M KP@6P@0@ M<![ Mp aK i -PLMM`K @0K(K,J BlWJl 7JPP3(K7Z B00'S0P(K B0 0K`PE( 0R p@P8K0C0(KS8K0C00 B'U0 ʰ:(K0: B0: 0:0:0:0 :m(@K !0!@ ⁈ P ?L0CSj 0     @$@!#   0A^ E0y900Ipp0cpp0Cpp0Ppp0 Spp0@Bpp0A/0 P`D9(K0`P B 8K0C Lm!0(K@"0 B08K0C0SG l(K B 00B(K B00'S(K 0(K B0o8\ 0C\L@|8\  0 ೆQ  9F0C0,(!%,8\LL!#xN L@ℤs00R r0S S }:S ' R #S S S S 0S< *SL70Sl T2Sr S`V 04 8 <'Sl60SQ 0lfl 0 PTXEXx'x0YK1 AQ  pTXEX`F(0`(K B0\@6Y(K B 1P(K B SeQPU31ul-50S K0 p@}8K p0Cdl(K0 B 0K BA @\% R %SP`Nlu倅P`0FU>l0\ 0 c ) $)1u>PINSZN") #7-}PPrfk !)QC9HaZjo 0-LM KTPp@@DloLQl P 903 T j -PLM  \@@KVKW_ {G 4 K ,gK  ?N&dpk -L M KX@0P0@0K } p@@  Nu -LM;@m@`P 㵭m3pPLPP,0P0 gt0@PUm`` PT0d0@ @@@@@g#8Ne03/P$=&~X&M ////0 L0L0/=&0 T0T0/=&0 \0\0/=&0 D0D0/=&0 d00d0/=& 0-L@tP %00000D S 0A0CS0(P0>S 0@0=& -LQp0)$0`0S/ R 0=& -LK 0C C\pt&t T ?@?PT`L'LA ?e>K 0CCNP ?dVp x U 70S e66dc^K @^K @⨕  R]>K 0Ct6pS PBx6S  P:  @/P4 0x6 (6 R  + R  % R   0Sp60p6 5pWap|  | a pp%ҫ{P Pp6S +eL "eK I IP%  0YBK00 %0 @⛛B.K BPeUK @,U.K Bjcp!UKALUK @U.K BZcp DQ |/ecK Id Ip($LDQ <e 0(4XY[UK @b>K0C@5 @0U.K BD5 *cP@e  fKٔf.KP L H cpJ L~0P6 6|:BK d# @ⵖBKX I0S:00c>K 0CBK! @#外BK I0S  d  d 03/6f.KH6 P bp Hd)Hp2p0S0S |6Sn2`pW 0 3/p K @gQ20-K BbKKp I!1QqPp"% & # y' thr' \Ndp#Pi% & _$ X$ Q c0PpW 03/p|6 03/* )X )3l&  z i ~i   =&i^ ir  ? Q   )5)ii    k     -L(MpP<`P =P@( DKD Kp0S h/ L+P400@ @#0 (K)8i(X# -@Li=`P0 TP@p W㜀OHH }`P$ ᎐pT {@00  MWk.d)( p-@L M|(=PP00KpH@G|`P <@ KbPu <)W. p-@L MO<PP0 |G@G|`P T@ K6Pu( KpWxd)W. -@L<P0 |`0@#^GpmGg|pP p8 NHWd)X& -@L M Kd:,PT0T TT|P0  RD @00>00Kd) 0-LMPj<P 0@ K@ @ @ Kh@ pTLP<P<K<P,F<PK0H)7i M p-L M@ hwb  P LobHPH` K* P ! ,dbKp_b@ꜯ)! -L,MP@Ph" 'p-pPD"D㞨( LK9 LKL K[`p} ,P@# [}@PㅨL K(@ I`p <儎b<0 <0R b0)a a4PP) pbhahqhP < X1 \^ 0\4   Q0 aQa amP  Ki]~! RS4aaF a0P, R ` V 0P `PpP K(l8i(D.B:4ka4DZc 0-@LP 2 K0h -P@p`L0U0S! 8{P$P$P 40S040 0S 0S(0p(P8`0S$0(P} P-LP`@ \:P VT92R: %;`P-2`*2{ 00 -LMPpP@`k00K 0K #  KP K-E0PV 0 p 0 `P0 -L M@PP=00( 0K0 `PpQP00Z!V0"R0 !"00"S(Kx40P 0, np 0 @0 -LM0 00 0pS 00BQ_ Qb0 K*PPP KU YU UzP ,K⬀ q`4@V`T /4@P00@ Kt00 0P 0 0K K(P30 R 00T` KH0`S 0SV"00|UZ6 ZS0:P09P Ur U0 0 K P!>T:KᬠK|v "10#Z d00 `@0K0 K0KiP] 2BQX0AST00SOh2K:K8#<4:KᬠKPPzPA ` P CPf|U/ 0 p( 0STc  PPG` 0!$ K0 C0PK@T 0CS ,0K0 xC00K K`:T 0CS,0K0xC0 xRaD\W@DAD\7@D@S 00@D@ TSS0C@|Tl p֥ ^9Pg0U< D 0p 0 00(K|)0  -PL,M@`K@H  L0 pHX) P W0 HL0P 00p0 HL0@(K0X:VV@PH @PTWPE^0AE\WAAPPH&& Q-L@P 00S0 000xS 00Q Q0 ddKhg[   @04\[`,p0FUT[&& sU p-P`L$M@ 8K<V V' 0P0Kp080K04PKT7`K1S:T@ !  1Q218`[+uPP  @8K8PK00PK -Lp`Pp@@ SP,Z ݊ KhYp p-@P`LM K K` Kp -MLMp*PP!0p`h!l UK1pP!X  KF/ @ K  @,PE(TP (K P8 0 R4 X5 =K 0C )X5<% 0-K1 B85 Xp  <5#70S0 S0C.K00T0SP 04[S <0W8C.K0wZ@pli))^ p-LM`@EpP 0+SKp㰠 KK K. R #K* K@gXp 01S 0/S A [R i3 (0-0LS Kh%Z)C -`@pLTPoP @ 0SP X&R -P@L` EpP  dPX0 000  <p`V+&:iv -L,M (K@p !8 K#P00K 8(K800S 4 KH#P401K ( K,pl9i -LM(@K p [(0[QS S  YK -L$M (K@vph hΟ4 K\"P00K40( K,1Klp㶟9i 0 /D&/ -0-@L M000 0PK0%00 P0 K0P00 (@ $@ @ @ 0 i --LM  ZwVw K -L@Cw1W  -0LS8) --LM  5w1w K -LMh00S@ 00 0 0 0K #  K$ K#p@$@K8)  -LpMPP2P 0S 0@P 040 000 000K0 04Kp dP@L KdK`P \P XP TP PP d@ 4 KdKߣ7`P V@P tKt@ p@ l@ h@ U1 |0 x@ |KeV.VvN ,P LK㭣 4K㩣dAdqP`Q |Kp0S 8T4V | 0A?oR20S ET0S PU LK| 4KxK|0SS  Q  R S0t0 p0 l0 h0 tKTT LKY 8)jtԈ6D&ea -p-P`L M0@ 0 0 0 SKp0C>S?`!031 -LqP0@ ,fX  _XUX& 0-LM0K h PP \&qL@P @ PP0KP020K0D&@)D PC-!Pp@` @ #@h,P$SPL080$60\ 000 0@0PVkP-`0\  H ^@0 6 0Q (0000VkP-H040#^0<\ 0000VkPD0 40#\00Q 00/00VkP@- @< :# T0 0^ 0000VkP@- @< 9# T0 0^ 0000VkP 4 <# \,4Q00/00VkP@- @ :# T 0^0P@d0 :0# TDD#^<0\ ,00$00Vk -(0ML 00UP KfD& -L Mp(K∕P(@U` KKP` NP@ P 0-LM@PT0  (KrK0r -0LnS@0oS@` `bPp`EPr0nS0oSK 0CC ᐷpnK@4S}KS(pGi  PcC4p4SP @Pd< K@P[d,K B4 !$4  0 0\d?o 2R0SP0S PTH4 TU @T0S S K0@Rp;p` Ph P pp0SPpPE4SK A p;MP0x#x#S0ISʉ ᭄`Q K1L-Q KM@D0C.K B0@0D00>K 0C(hQOp80S SH 1p80,00(/O #$#2$ 0-L@P,P8S9+P0KK0hF! "5" -Lk 1ROa!X& -pL M0 @`00 000 P嘠00 sHp0@DTQ oP0 TQPDۗ?A0(Ko;D/t&H/kH$! -LMNKA>KM@D0C.K B0@0D00>K 0C(hNp0S SH eo80,00(㑗^O#$#2$ 0-L@PᎫP88+VP0K0h! "5" -L 5OX& ' -0@`LpP0 Gp00@DT oP0 ~PJ~  OA+;P T5@+P,X$,KoSkH/t&&!"T'5" @-L;K[KM 0C PE (>K`@0( Np Nom' -Lzj QN!)X& -P@`LM P r0 P x" aGp,d2 0S00(0x`0&`0x01p0 )00`&0#0`e KRNpS 㮖lP3 MP> 9P0 GP$ UP. gP0t0 sP mP$ oP0 @}P%0㈖tP" uPp|00|0|00|00|00|0 0`x}P|Y0p00S0t0X0;;0x0UK7KK$00|00|000(KH/)t&8|'! -LKK[KM @D PE>K.K 0C B@P800>K0C,|%Mp0 h< ,KK? @D < <@0<$,0( <OM:!() 0-@LM PK7 0 B/oS" ? 0 K0) 0-L@[PK0h0> 0-L@6]PK0h0k -L M@ K7 0R R0?S  㪕K) 0-L@P᫩P86+sP0K0h! "5" -LMi40 0,0,0(0(0$00 0OFM----X&1.|- 0-L@ P\0  0(0hPP0dP#MK0hk()x -@L MH `p0 H θ똧嘗 Ep70`FVQ 2@FPX,\̉Ph  ԋPČ\,l<60S 0۔ $6 60S 5 0<0U 4K6400S0?S 㼔08:%000x0000tU 4K640P 00R0S H0@90;U 4K640P 00R0S 0(80@00800K {PP{00       +  @  B ($ Rz$  $ Rq# , @ (     )            S{300  K{0$0000 lA{0 0000 H7{0$8000 $-{0<:000 #{08:000 {0@9000 {0,0000 {0000000 I{0909 R 4K540P 00R0S 2Q 4K540P 00R0S 0$0000 0kXQ 4K540P 00R0S p0,0Q 4K540P 00R0S $0 0P 4K540P 00R0S 00007000'+E (K`E&q/E&t&P)a.H)H/}.T)..*!JL)........E&/,/C/Z/ -LJKRM$@D[KQ=KM`D(PE$0CQ-K00C`P0 Bq唁H00Q=K00Cp$%JpO 0KSF04 C R@Q K< p0@040$nK?`F  !HP  0 Q=K$0C,PC.KP0 BDnP' |  4`$04<$ 04@04040 40$4 0(40,4044L K0 HӒpJKD4 A nLH),//!K0 0-L@PẦP83+ႵP0K0h! "5" - LR R ㏒0 -LM0@`Pp 0 H000 JPPK0P0 0 0KI0 H0P e p-L M@0P$0 0`$K  HP0 ^Kp 0`( "4`#/ p-L M`P@'00   Pd00SPPP @ @ 0KKpX)V-0(0P0'0P0&0P0%0P02P0/ 0-@LBMPP' $ 40 00 0 00K000$0K 0 0P ϼi< 8KȼH00K0K0ho꠆^-Ք -LM`p@ Pp(K8#<0 00 D00 P$$ #  <D Z00<804 40S0P,M0(00x0@E0 0J@dp PqH00@5P1 PD KX)ȕj-0 -L$Mp@ D `2K@PKLP0IT0C<000(K @0D3/X0p @" P*0 J0@ 3/p0< <0Pf2 0KK R0T#K#K dW2#K P0R 0@ P#K@P#K1s- -LM⊏K`p/᜻ ሷ P@1L#Pd8$#4d4# K(2 wD0@@ 0@?K0@0 xpȻ$KPHBTd$ d 4K) -pL4M[ P啳@6@P :@Pp(K` `LK? 0L KD0 p\0K@P  P@0   ``T \  X X R V0S`\0X0 X  X  XKip XK`P@X0 R !!D0D0X0V 0 000 0L c#!$c$"0 0@ 000<0)1K1) -Lc UJG2X& --0LM K 0"0K0@@P 0K  zg K K3&3 -`@LM$ 0 塺0 0@"R0"@ 0@ @ " t@p2 0pBWQ g@Pꐟ@@@@@@@@ @H 00 #0@0 Kbp 㾏,K 0 'wP㱏wp {PpK0S Q  㐏  p㉏NzzG ` K,K! DXPpK0S Q    /z 'zKp 00 j+8KFp x 0S0娐S0夀S@ @(K?BD/H/t&94?3p1!Z3_333334F4 -LMANK>K M@D0C.K B0@!=K(00>K 0C@(Fp @8 <H>K 0C H>K0C H$V0P$(hH T0P  (PHHHK4H(HW4c4p4444444 0-@LM PK0 0 B/oS" ? 0 㾎K0) 0-L@bTPK0h0> 0-L@VPK0h0k -L M@ K0 0R R0?S  ㇎K) 0-L@PሢP8/+PP0K0h! "5" 0`( "4`#/ 0-"44 0"44 04"40 @4"40LP1 $0 $((ű XXddhhllpptt0 0-"44 0"44LP0@ DD@@ܗHH֗LLPPT~TX{X\x`\ `mp` pi K0hc -`@L"QU_@ 0-@LPᤗᡗភᛗ0 -P@L@`Ep@Q->C቗->C6X3X\0\-9>x9>:>Cs?n:>CFn?>CC>f}C>GamF]EnFYE~GUXJX ` p Q  $$((,S>,3}S>G.mF*HHLLPPTTXX\\ -L M@Pp ! "44!1"441 $$((,,0044`TQ\50 S L5s`TpԐ}0  $0$S-Y`,h(KTcT`X_X\[\`X`dUdhRhlNlpKptHtxExᑖ Z <`9 6 $5 S\50 S` PP%@ PSڲ  4 4  TU 0`( "4`#/0+P0 C@ / p-MLM@R0 ANK4 @D8 P Ki57,`p`L00X a 0$C$A K)))))A -LM@oX10SP.@q0S41 4(! #0a Pz 1 P000?>C?T00S U2z 00$KzzK$pG0* pPQ 0 S Y P01z0*))))))) 6 -LMD`p P ?#Kd00 @ؓ ` ̃0<0S  + 3 R 0  B  R\ ?0!.0S   d ?#K00 @ `0 < R2 00C0,0 ?SQ 0B j ?Ѥ#K̟)#K0 000 \%H2R 00ß0 2",0KKKx ?ᮤ` @L<4 l0><d@ ?K D 0dᜁ0D00  R\!|04 \x P?(,1傃0S U(`(pXQX`dPU|l 40 00 (Ko *[00S nppp0`<0 o<0VpPgUQP,)))U 5A)LAT)T -L$MpfH < d_ @Pv `0 <460S  0 8 R 0Sx  ?X0 08 S` `0 b8 ?0 RYQ4 4 UY0 4R0ؾD4@oP' RT84  4 4  4L4 4 B080ß4 0 0$5SCK00/0 @P!.CK@lQT0 @T@@ 0D@p`00C0 A@RP3@A00C0<0  0?00 @P@00030S\d 0@ `8?08 ST0T00  B 08 SP5X@40 4 00<0 40S1ڨ0 Kd 0@ `8?Э$K̭_@!P#@P$Kḭ4@4_,40 ?᭭<0< 00C000H R410S 1 1 1 dP 0E1 e0 < (K  ;A! A!4! !.H85@0S5 4t0K00,H08KPO?C0 V 0 `8KQ?C8KR?Cp%&` 㑩V M8K=CX V  004#8KN?C0@K@,HA %8KQ?C8KR?C LH,}Ϡ3 \ß0 ^9    1?ppp QP L3= `pL04;0== 30d0 0KMA ?`p2 r018KM?C0(K0M/B0U P<\8KM?C 20X=<8KM?C SK YP`p .D-D-D,D0?D 0\DD48KM?C 0)D0f D= ` pLd? $+4.D8K=C (K.B 0@(KM/B `4 KML0KML<$10=<9 ( 0 8 $,4<1?!pppp0! 0= `pL04;$0 <n<L00tdp 0@ `Ì 0>IP(KE&))G&I&|))TA --MLM EK@4 ^<D>Dn0S@ 8>pW<,>@0 > <10@@ 0`@ = PP 0 = ݉H<xC< 0 Dl= ̉pP L=UP `Y]P@ XY=P =}=0S (5,%0<<Q04 >0Qʰ >뤌,0 04 0A =040A d =0 4QD =00 Q*$ =00Q( =004 Q =v;@ 00R0B \;\XAuY;X0Sx =0X RR $%0 4bHBlLNLPQt TPTsR`8PpQR00 1 =*@4u0 Ra<* c 8 S d0RQR=C0SX0!QP 08 `=@(:*\50? A00p#!3x00084t $0<0pD0@p4t0|00pXsL5P5P?>C*04p8@G  ?D ?ک `?ttt`# 0`FK 0L? &`@,EK N XN`E>KX 0C  0pX4`\`$呎2"0`S΅ ] E p_R`\<(L8@F.Kxp B-BF.K B 0|$ |$8PŸS GOt EK? A E>K 0C 0 0EK A  K? A  ʞ P0E>K 0C QP * ? V P0EK A \4h\X4#'0SRF>K 0C 㢞E>K 0C$e0V- 00t4 t4h \4\X4#'0F>K⠁0C⁎ᡑF>K 0Ch4FK/0  AF>K 0Cl4h$1>1t4 0IKAV [`d4 a3`4 QSQ`4 S0100IK CAl4 0B P0 9PP!X`4F.K B? B\$4嚂# | ?`!U*PP1P#0EK AS\4UPFKEAЀ 0 ᤨJ  ?ឨB QE>K 0C EK R0 A  0㼐p,t4  B!00BV!0`0Y3B11 l4S B!IFKBAЀ?  jEK A P0ȝp,0t$B BQV`` aS2 0B0Qal4S ;=Ts@帠``x Qs0̈́ L0 E HP\4 PXŸL \4-  BQ  B!ʡ$%,PR`Sf`B `Q!a@ŔL     d" R| \4P000E>C 0R4 0 0l1͆Ap'Sx0<0(5001 0,%S00 5 \2P0\3aPPT``0 Sa1\5?>C00!#4t x00T0 Pl0,% L1.1< 0  ᤧE>K 0C) 0))))))))E&E&B(Bh)p)[BBBB C4Cl)oCCCTD)ED))CT)))))E&d))x)E&|)))^F04 P ᯫ0X H\ dR 4  B| @%LV.  R*h  <  X  \  E.?.XT+BA.B,-T$HU P|0@40IP qEK A= C ,0 l4 P Bl$F>K`P0C`` d bK 0C`` X+EB 0GK A A.lB  ^0 0? F>K0C R? PT04Ą\ H4 000t4( 00N0|402b RR 5#< 5230S.E>K 0C᪄됚z z'z {' 00X$0d0\ C# ccDD)D)D)X6) E+&ht@)))))))T)&7EU )EE&))))T 800Sz 0 E>K0C K @ p=K0C+lV.00S 0=S,0S00S0Ӡ4 ,A,\ ^   ?d A a!1<80 !8 1MK@Dp  7PP0\$0 4 R0 S$ B$ S4 84 0,|4 Yp| 0 FKA 0\4  aRpQ  Gp=K0C+KA P K+@⬩u-ᴠR㰡 , t BQ 4 =R400T0 10⊠ಁX0\L llR\ ?0  0  B  R\ ?0  00C 0P308 0B0 PB 4 B4R0ʜs崃0``Tf8 0 RT33 $5S044 @@\40T\40S t44 @D4 dT04 l404 &Tt00@d TJ 50S  80e0 T @l$ T@%@pl$x0p 0Y\%_!@PTR  t@_ dŸ 0@u%Ì `0 85P5\%R 60S@F>K0C FK 0A d4Ft4 0d$,0SP\d4P4 `4`4 d4Ɵ#dͅ FK @ h40h4 LIK L 0R 0̱\u@Wdt` a#ld4 4@D@t4S 40A o(@W ?  R 0q(|wW0 dpPt$$7Y $0l4 `0BXpQT4P$帀0x0 0Sx0xŨ0t\000B\Á0`  BYd Hh p( Rhh   h ` lS2 0B0QÑdd 0R"%x弈0  t$R 4$0C04 4 S l4`R`   $%R l !P`   ) R3dnn l4RT T  l4 RP%R X PP%PR$ d04 dPaP 0 [P$Bn  8 l P`?0Tt lR@Ό$00$020l$`S`0 0$5S V00 l1vaRP000\;0S2dm0l$ST0T00! !0l$SP5RX0PP5PS4 dO먐 O  0 O4m00080`@0C40T0400 T lR` ?0T  taR@ $00$0l0P0@hp`TS $S0`0S $uS0qpq0`VP@RxlpIxP꜍l40@lm8@`0xQem@ 圄 4Sڔ4P0CV`l4Pw4l0P0U:>P? ,4呃\D> Q t40J>K 0Cl4800/mJ>K 0CЀ d?ğ 0L l 0 8@|4S?0S\4|$0\4 \4S.E5\48C\$@?RDH?D?$D$\Ő0x\ t @ ?d @_ @0 `>4< $Y5\40\4 4Pz20Sʨ2t$0,00C0S|4  20S @5\4S 4`20S |l| 40\4 TE^KPE P 20S AC 10S30304040403BVX*U{QV.paV.HV0S p=S,@1?~ G?ᖡ 0 0qS 04 X dLĒH 0@ `Ì014 00S0S 04 >0 d04 x02042@K(KSmfE))))EE&E)))))))) -LM`R@p {PP \zq_K, K4"DP`(KP(  2p`0S <08 (00,0 000040!04 04$0D0(0`P @W `h |` `h20 9 X LQ @M 4I (E J2p D2p uz K 2p 42`#f0`9`a8SlPb 0  *0*0P0e * 0* *θd@edA#5Izd@\ -PLCM M`B.KpP; Bjp@P E>K P0C0Pw0ULT!P0#  K 0-L@P P81+ҜP0)K0h$! "5"R/̓ -LMԀ#K@ 0K៕`pX0P` 㗕`0 X(Kf  ecK`p 80 80 -@LM P`pV 0W0(08#8#48#8W00 T< !<04080? K :^FF^: -@LP`   ~ z -`@PL ((UX0 c#!$c4"X0C-bAYXQPYX QP#P0 -L,M#KP `0 00K ጴ0 0SC Q 0 ySS9 GS BS: 0XKS3 MS@kS- #bS, gS @ @ @V00 0Dt dsD0 8r@ d"Q T@ D0U6WWQ QP 0 mS sS@V@@@@#KV0#K 0 `Lx R0 ` ( 0 (Kp66667 -L2L,@ (2l0X&.I7E 00- @   L 0 -0@vL x%Pd`@D TB㔀#ᴐ000000`IB_@* )P  /P P00P0S!bP P00P0S/ -X@LL`(VVP d0 P 6V0P \0<P@* 0P-L  C  xco`HI p-L MP@H`!00V P@ xKp * )HI p-L M@\P`QH!40V P@ wKp,* * )HI -LMX1@0 PS)DP4aP0V Qp ; 1` P00 0 T :0S ' 0$KB>K0C+`\ $0K!00 S `8 #4`4# 0^ `$0K dB>K0C+,* )@* *0*)H -L$M@` p KPP @"]wW V3( 0 ,6"4  R`!Hw0 ,0C `!8w00,6&08,64 0  B 00C0( QS`͑! V0Kܒ,#K$&`?KԒp 0#K06s4 C cq0rc&0K$&?ᾒ0ᰐL0Y*S%  ၚ0: S (0( dXr0d&(Ko M@*HJBJkJJ$K& -\QL,p0S@FT:~J`P  0 @1@T@T LQ @C1@  RL1 S p pv21,6&0L,6   B ! ! 00C 00@@*IJ -@PLIM0 K->P@>@0D >P0E1 0 1   Uvl?U*0 lLv T;3 1X5: T8 HT0 84>`0>V01 S ~ 0@0 D?a @ 0d 6FPPEVJg T$= Rlv U e2UPSQQ 0EH1 Q z1,}t0 S 00 8jS05< 01 e 10 ! ^V0J! $ ! 1 rP1 !$ LQ  E! !1 ?1 :1  I 2  L!001 6 %;(1  20740; 800V0@ $(P, <0DH 4 L`\```d`Z-, 0T00;0KK50S0KK( $;PU P ?  G00400L0 S1 / \P,  0p0B AKB``p`#QPAK``p0F0Dผ$AT@h@hJ1CP@1:TP\PL9JPHP`,   0 1 d0p0(1 \00,1 12) @C$1 0H1 1 1 0$H81 1ZT:!hI !` R%"ʠƌ04! :C8 0P 0870 .( 0 ( *. 6  0TX 0 08zPp   Xd0SY,8ЀX0F 0\tL0`0p\0f&1S (1S @P 1S ,1S811JQE1C1 `01 1$S1F01 1F01 1pp+I'X0 o4w0S= 0S 0S01 1 0C #0&- 6 Kp ,PP0 ?[R1 0 S10C1 P SN1ᯛpP1`81 Fi S  JɌ0 01 Z1: D务! Z!:,6 6(01 1 堞1 HUㅢ 0! !0 S,6 0 5&p倞(6X:40USL0S d0 gP Wڜ40Se`VvP1S L0S d0 NP&  !#S 0+  1 U.1&,"' 0 B! 2(6H4  0! (60CU 00C0CSP: B 㰓0P1 11S0! "! /o!d!$6Y:,6 0&<3Rp\".,hF  V!#0002!,1`Pr820SDvpGpW@ ,20S8 H,V ,2QtRL0@S \0 K⶝1pL*)VL*nL(*LLD,*MIM+&ht@&EJMMMMANE.NIlNN@M&0K&AHN&'IN ) )@* *!PU: < &U! "!G:0U|: Hp0!gH 0Kp L0S `0 0 ! |c P`1 `# K$1K P0C0P&ULT!P0#  K 0`( "4`#/ 0-@0-L  0k0C: {Tt A 8KK0eA4 - Q0 . .< D0p#*-@=B'T/* -LC e*(OX& -@L` pњ!>0RP W0 0  P` $KkPP`0# 0Pp0S 8o0 ቓW p#*P/OO -@L hM[0:{k{PP K'ΞkE{7Ik@1 > ?툿* +)+S PPP' 0 @@@ " zjk {[k[+S'4KK00B:k{{'*k[h+S'?@@-C6?Y@$*Pp#*Q5QKQ\Q`Q&Q%*&*QQk -LIc0d2Sâ%p#* D00-0LS0@d2S1`2"R20`Q&p#*0' 0-@L 0081 QP=p@4 20<4ᾓ4K(0 $ Pqm00?0 0<#P 0 0P00 8P $PXT$0<024 0 ` PPXo^DPHPUPPᾓF  Q%400P0 0 U#Up c W=M[ 2 `"R009: XŸ^P`" 0 ,' y{ Z @ `` 0 , 0 0K(K0 H X <Za({Ѐ 0ᄡ nF 0+ R+ +8@ C @Jz@ k{{*;`2"0+  SR ;0 {{A `p( `lQ 0 T00𿚙p#*T/*Q R=R@&*p&*YRX&`Q&(&*$*/*`R.*ɚ;6eĀ.*.* -L$MP` @@p Z"0S HK܏$[2RP00$ 0@  %@(Kp#*@&*zR -P-Lp@`@g 0# 0 %T %% 0  {{(+S`% 0@$@7 D,K$Kkm,K$K@@p#*RRRRX& 80- 00RL(@@h?0 &#T/+c[X& -LX?PT@ P% D% 8% ,% %#X&\\R]]^ -@L 0 R R p`  RQ\RP RPX0'R"R @00S S%P^`X&;` 0-L@Y P l00S\ 0@ !0R3 @00SP P99000l/+Hf,|/+ -P0L000`@?< 0S-0@ 1 0S !0 0C!0R3^0 :P 0*0 00 R222222222222222P 0C^SBXX5% 0@00=0#0%0WP/0|/+l/+Hf,j`X& -@P`L P0 SR 0SP0B0Q3 00@ 0  y|/+l/+Hf,/+`@-0 @CT@ T00 P0S@p%0 訾& -L`P@᪒P  <vP:,)0 R4S /Q C0p R@P /QQ- ER .R@P ERHP @D T0t/SP00/S00 /R/\ P   0-LJKSM,@DM<484@0(4?K4 ?0A4?4?4 4R=K0C@OP R=K0C0<4SI0.3.00N3R=K0C084S3SE=`O|^ x8$l^N C00 4>3 S ᑐ@@ 0T S S00 0=NK8R=K0C0D0S=R=K0C0K0ACnl0R-K B Q K<4R-K B @84V]h]O0S3/SaR=K0C0CQ=K K 0C @0@\PPR-K BL :K00C$#u  u  u  R=K0C044S&  RKA<$84R=K0C0R-K8DR=K0C0 B 44$$0CR=K0C0CR-K B0D S84R-K B Q K @<4\0<[hS ;aS ?S DS .KK0AKKNKKR=K0C0KCdS eS cSKޏ| KPR=K0C0C0 R=K0C0P C4  KC0@sS `pSa qSs lSK⹏ KR-K0P B0R=K0C0C @P :0S*0 0C!0R3 :0S0S  K0@ `PR=K 0C@R-K K B0@ K0@ℏ@ K0@‏R=K0C0@L4PR=K0C0P :K00CK R=K0C0PkR=K0C0LR=K0CRMKP`@D3wS. xS vS`KX| K☋PPX`I$0SX X 4 PKF@ K↋PFR=K0C0C.@P0q QP 8 80S 8 00RKAA ^R=K0C0CK K\P K0@ P 0R=K0C0h C"@X  K0@K< K>@P 70S 7 &K K(P7'<07807L407007,07(07$07 0707070707 07070707S"@2 PQ 0;@PTiR=K0C0C1 `P% *K0 B(h6"K+0ACK 8CKCK▎R=K 0CPR=K0CPT@ pP # US `>0S%0 0C!0R3 0S0S 0R-K0 B@0ՏP R=K00C0 ͏P ,0K0$C 0 Q+ C.K!CK R=K0C0R-K04 B0R=K0C CKMR=K40CR-K0 BP0t5 }0E"R=K 0C R=K 0C0R-K B0R=K 0CR-K0 B0R=K 0C0 SCR=K0C0SR=K0C0S<4pW R=K 0CpPKR-K$ B00Q0P0R-K B00@XR=K(0C 0R=K,0C R=K 0CR=K(0C0 S+V R=K0C0PCTLM PE QP1 01X10R-K SR=K0C00 B00R-K SR=K0C00 B0 pLX0I%R=K 0C2 R  <d5!   R=K0C0S 9  $JR=K0C0S +  R=K,0C0PR=K 0C0S U R=K$0C0 SR=K0C0SR=K80C R=K80C K[$ K⛉P[R=K0C04SS  +K/ B?KG K⇉PG(KK= K8 KxP8iK- KmP-q_K#` KcPP#@P0S<8000KKK0CPPp/UU`   ߃P @T@ KU` @ /0-LP#@P@000/00@P 0S k -P/p`0L@oC 0T@@DjQU pDP@DJ+k -PLlpP04@Sp6/`P`\@0@0C0 VP4 $d`lF+hf,l -Qp6LS` /@Pp10&(0C0T%Q&F( $0600nPPWVP ἁ @$  (@/w婁 0P0 @ PP\0`0@0 P $ F+hf,3lUlnll 0-L@}04D00F+ 0-SL@ &0S 0S  0S `0 |P   T R 6!@0&F$ S 0S00lllllF+ -L@`PP0S  0P0 @/ަP y0P 0 00m -LlM2P0 S 20SIt@P F2X TyL/0D`00`0p QP0*`p SR@*`qQgʔ0T \0 #K10 $K1\K $K1 0X 40 0t0@ 1 p@ >(K0 Y0`p  0 0/sY`p$ Ki0儠 00 0 0(p0 0KS0h0 0S0l0  0S0d0 $0S0`0 0s0 1S0K0 0s`|/+&mt/+jX&2m`f,F+Pf,@f,\f,_mkm -LM2`0S Vؒr 0_ur.Px 0 00.000$K P tF1\ XP] KDP e71, N L@0@D>.PPE  PL1 5 1RQ rQQ K1 QP P0`0 K|P X1H -K -KD @10S,K !D(@0 (C ^ ((00(CR(( ^  ^  ^ ^ (0,t aV,|/+&m`f,F+m  jX&mmmnRkDnp/+Pf,fnnpf,@f,`/+n 0`( "4`#//A6= 7i/55.ꖻꄻ 0-LM|0@[Q0TX0Q L0LP   8K0Tj,Ipf,X&n 0-P L`pf,nX& -LMH0  Q0 0P ((J KhlL+pf,oX& -L M0Q 0@T0$R ||, 4ASAK  FKH0 KD!P?0( rQ&/+L+X&9oY&mco -LM0P0S 0 003/00S@x@ ?pz0 QPP0`PP /P 0,,<Kh/+j,P+t/+L+pf,toX& 0-lPLt4d@S 0SP LLH0P00080 t4S0tt=L+pf,ooo`f,Q+ p-L M0@0PS 0 00x3/t00Sh0 p pP0@P`层/` 0,,Kph/+j,P+t/+L+pf,oX& -p@0`LPPP I/P@d\ h0-`0L PR@𨝨H0x`P ->+Px  IP\f,Y&L+X&(p -@1QL0|51q0aS :`pP 0 D0P.P@&!XPP: / 0lltP,.T 0H^4040Kh\f,L+`/+Lf,&"OpcR+ -LMdA,pK g P L< @#K0`4!   $A$.83実S1徏?" 0P!/Z, ,#K   F#K0`    8"@Ql000D Dpd00@ PV(Ke,yp&cp@b,pnppX&x/+kxppxe,pppp 0P/0 4S / Y&L+ -MPLM0E`9t44S P tt p50SP8X (K988 HuX L4500RSP 50SPP+9S3404$0404ܔ ЄqBK  @00 ,4[ S BK @PX80S" 9ဉ BK@ @49S8 B.K 0 BQBK @ X k Ad#:렓PqBK  @D0弐 BK @~Pq,4[ S BK AXP| $HR ,[ y # Y& ꘒb2K0 @0|5P p 20S )H009  \ 000.J>Kx 0C SRIK A؀ATYX K @ `y 4 s    9a<98890S 4),8S H10S10S^ 4 =KU 0C CW) RYPER0PES L!UH1H0Ѩ PUJBK @LBK @HPEU,8S F)t4S 0t4:4W UBK @-PEL+p/+X&p/+pf,qcqOaxqAqqqqqLf,r6 k5rKrR+vrwY&r\f,l/+r&rr@f,Pf,#s,  q00 ?wpU00S x4S 90$;#;S %Px+XKcL+\f,l/+&sX&spf,t/+,dY&|/+st2t@tZtst/+ V+ p-MLM7@0SWPP P P Kp6 PR60S -00P 60Se  "4"42]004488<<HHLL]]~]xx|]|e]9^Ea]E^]:^EZ]"E4"4"24"42T0AS,`x `A^K PESPl PK {Pet4 `Rd40S XX00i f c ` ]!  4"41V S" 4"4"24"4"24"4"24"42@ = : 7 4 1 +}0$#$9? A $4 0? 1#04K0222020?"#3H0?%#?&3,0jv20j0 0%?"p200S" " l" R \bR@TSP"P :NH  D 8, $ #!0 x30000 1R 9? |#:? @  ?  ? A0 ?%8 ?&0 %0L0<040pe0!QP! PQ=0CS$ 0  9-0CS    R0 R R00=0- 9 0 Tx^0Qd/+lTj,|/+&tj,kl/+Y&a# X&tttL+uu0u|uFuiu -2BMLMP0000 00 Qa0S 0ASlTL|0@q封=0=P SR =0=00S BK@p0WT0 0 d Do o-n- 0-P8!P0L00@ P @P P P * P*@ P*@v q0  CSU # 3P R0C0000P:P1:P*B4 8#8S 0S@@D0n-4`00CS`0X  X0 X /ᨾ& -LMM? K @  7 K  @n K& -LDM`QpV |x@ PPKV201 0B?oR20t0@S00C00qp RpaV+ W1X. T T   lKq lKgjhL0 .  lKrq lKWj.0\ dK9L lp W|4a(K'}o-pk-& 0-LPM3@0S Q K0hH |31Qll?d<00CSpppppp0h$$$"<K0hK !0S SL )  d0AS&T HD@< 0S$K0h۪  4Ki1g0CSdd/[20[0[3 [1[4[ K0hs'[20[(([3 [$)[4[ *[+[,[-[.[ /[0[1[$1jS!K "KQ Q P{Pu(p xSK0n-4}`_en~~F~ʂ؂#B݂tۇlƃ -LDM@rb,PKX @%@H0K0 0 @0D0 "0@0 @@P0K DK<@ 8@ 4 0@ [YP\p 4PPPp #pPlE@@P0K DKEYPPPP܁0S 0S HPP @㤡T:t(K0S 0L  /> 0:X #:0( 0S y S"010S00\0 Dp. p07S p@(00SQ Z0@x0 `0 x`0P@PXT嗩0S@n- o-σDn-+o-q-sn-iM@ P-L S0 둄KX& -L MP3 `R#|P0p00* P P@ LP" P# P @@0 0lPW W W"0000 (K@@@00Z= "Z? o P0`F0Lp W aL^WLAL^7L\Q 0"U 0 00C0 Y0K/]0G?o P2 0 S H10 S p  (KoMQp/004P W00S `PW _mQp P PP0 00   S C o-L[&n-Єq- -p@,PL`P kP@Y& -0LS $  R R Kh4 Kh0  豈k-  -00ML 0$0 0 08 KۈdňP P P% -L,M80KD K\S@3@#:@$ KR 0` 0-PLM   Q ,X(fPK0  K@P .\PP 9kPk-l- 0-LM0Q8) @aDa!!T @$d@Oo@cc8##4P  ! "P  R / P Q ,eK0@T%<@ :%(T h X0%T @ ,%P" @$ k-!Q @-.`pt0Pp@"/?0B!B`BBGQ R:0 0k-Xm- p-L M0@ `R  P.\P ,ke0S ,deKp t0!PU U 0H <0Kph KphX[&l-k-' -L M@T T 0, ( KKhKh/k-Q"!   0-RL@P TPK0h  (K0h0 K0hꜯMg -0LTM@h0 "0p d0 \ p@@l0K hK`@ X T@ UPlP `P A@@l0K hKUPlPP厦V@|O(KP`0p  DX y R?x   :y0P t ?y't  PK\101 0!S00C00  QPP p0 Hg0 Lpa ,t tGl`00CS`0 X P0@T:(KoX0 X σ9QX[&"`& -LM005 K -LM0  * K -pL MP@aU QE4 0 -\P0 4 P Pp@@PE`FQ@@0S@p(Ki 0-L@M K0K0  K -L @0X& -LAn -AMLMa1p0W 0 0@P0qaBK0x!x@=BKl@+0P(4 m0 L(1 0RC  a0$q00!1 /0R0 (!R (4GZ4&@P$\D(n,D\<T0 <1U<Tl0 0d(0(PPKq-h/v-N&'I -L &v- 0-6LS @q-i 0-L[[[|[m/pd@P0" \~X. x @t8f0 nK0hivr-kr- -L _qX&-  p0000@0\0C0S @C & -@PL00S8PU``84 #U:+0X 00rX0X40P80 0X0`P -0- LM0@P 0 P0S* 0C 0K0 -LdMPP |Kjj@PET |0[ S |Kcb(K`pK |0 B0K/0K 0.`KK!| vK0 |0K  &cT 0  .0, K V0B|K3P |K+j@감& -@`PL Mp尀(@ "!023 U 0 (Kpp pi? (K(P@T(0S0P(    ( KB܍ɐΐ -L(M H0 $0@0080000 0(0( $$0V$8AKUX&Ӑ -0-LM`@ PX@P0 R D0D07  $ 000K0h[&`|{-8y-vp{- 0-PPL@ i0S S S0S00S0i K0h*S+S-S0SH00S i0 0U0$00S0XPP pp(0K }Rp Kix00Sl0 d1`(0X2TpT(0 @(0S @ D` @ꤑl{-h[&‘k8 0 R ( 000/  5y-p{-h[&y-ϑ -JMLM1p0S$=WP@PJK0  @h 04 c?4 4J.KKnK BJK0P`,1 B AQp10S K;G~K pGX 4 hA7|4  K0A1$JKx$  $`0A.K0@p0 B @$D Qphd d4SDLD00S800SA.K$x{-y-|{-8y-l{-{ -LMp10PS@p10Sd! RQT! RT  81(KoWTST1 \a0S T (KoTKS ἐ张0HS T(Ko<0  50S  .Q 0S & (KoTy-l{-t{-&h[&y-`Qw -LM@1`0pSP10S! Rk! RU  1 Ki)WU KSUt1t l1X U  Ki^U4`0S) S S 0K`X0  0  U# Ki 1K`X1[    ,K`"KX h \\ KiQUy-l{-t{-&h[&y-`wY`+ -L$Mp2@ `RP T< 4 dP 1@$PK e@P<0K4 KPp#o Kg 8K 80KS Tw0Sa0Sg0S@,PK PU 10S@0S 00S#KSR 04 KU 0S 00SK1 QP 0, K00 00 t0 0 0l|{-iy-t{-y- -LMb0PS@ T㠠 pA ,Kd)g 0p Kpp Pp (K R$0Y 0Sp # f0S @`K@`0K KOpo`V H10S<1 Rp 1 R 0 KkV 0S00S 0 K00[@K 0K0 0dK0 KK0 0 0 0K0D 0dK0 K00x|{-y-t{-y- -@1L0`SP1 pRp10S d10SX10SLL$KkM@10S! R? ! RT  1$Kk?UTST0 0ST $KkuTU@E@Ppx0GUT ` $KkTy-y-t{- :@P&K,L4 :K4l  , 2K,  .Kl  , &K, "Kԉk  , K, K뤉k  , K,t Ktj  ,T K,pD JDj  ,$ J,D Ji  ,J,J䈟i ,J,J봈hV BK0(  @0,|JBK, AhJ\(HQ }(|z 7Y 0'0'0'@j#44f0,8$0S RD 80YS? XQ!;}K pGX 4 I`4aJ4 1B.K4 01`0p0 B0G zIp;p4X10@s Xpl7 0 "S00SX00Cs 60S X0@sY0p0p YP`0 0S- $ 4!$X 0,$R(0($R 0@sp BKX 0崅 0 09p 80S"  0P>0Sr ` K^00 SK0 帡 ^c?K,ᬡ 尡 ǡKLP 0 p`1 VXW p T=L@P01 00A AC[P  Ta  ,L0P1 00001 0[P,Z =z-  =0S=T` ^ mK 1pT ( 0S]0SaZPZpZP,T ZP ZP01  ZP01  tZP dZP01  HZP  0 ,Z PT ! ]!mK Ĩ1 T  0S]0S Z P$T ! ]!mK mw?K1T l i0Sw]0Sw?K0!QP10 yzZP:TX A 1 Rm aBQ'                        01 <  ! p   31/XT W 0HS񟗤P     ] mK ~m1`Tp  0S\0S0!QP >K0 1` Sa 00  x 0H0u8X(  \ mK Km1`Tp 0S\0SWV 01Kq?K0C0 1` S01 aV@ OX KXV*, \ mK 1coKT ~0S\0S `  +K1S0 uW<X 1Sxl  01 X0S@]AT 0H?oT20S0H?oT20S0H?oT20X0S @X< 1sXp0 ;p01 gFP.00%800% 9018@ }P  KT1nOKU01 1Sh&1 01Z, K10   !`01 00K0 K0SK Dp[  ! c/! 4SK @5k/KD4p8 1 450S (50S5" 5 (K 0PP40S 0 GKv[ 0t1 c?joK1 p`4i/KGKDpS30SX KZ[, K0A1 @K  `0@1 0 0GKp Dp[b x30S30S000CS##1" = J@P )3porlc0S td00d3_oK1 01 c?1 40q?K0o?K0-K\3 'Dp9X|f RT=00D@ $SP0=S "8 R0  SP 0=S] !8 R 0Y  |SP 0=S !8 R  HD!TPPW@210@0W1@2@,,q0S 00S~U( P X- p 0xq 01P01 0D08/00PEU # # 1000!@y-h[&x{-'4& )|{-K^^{0jb !L.m͗ Oky-l{-܍Dy-͘v d{-[&  )?aHy-x{y-0SQ N㘡 šKơKlZ eK0 QPF `Z0"S \Z. B0 SE1T R 600S/ S! S0 F1 0Cs! "  (0"0g/K1 K f?K CpX4R F0001K0q/KqK1  BA0 K1 aKZ0S<@@T T T40g/K000@.K &@q/K0 B@00q/K0 B00 K0`00a/K00|UQ@PY pP>K Bp X(KoY0S0 0180 0L 0100001s_[ -L)P@   x l ` T H < 0HX&ם5Cb}؞ x00-@LTP`nV P  ;p@00@  }- -LMM @AK@7P (C.AK@PK蜯 p-LIM M PAK` @PTKpKKAKA @P4 Ez4 |?zx@0S0S AK @0S0 0S AK APꜯ%J }- -LMM @AK@PH K40 R AK APꜯ }- -3MLMpNK@D@)PPXY P0(8K U`PP ) UP JPP  IPx2  d I`P_ L2P D}UP ,FPP0 0U,00P`a-0SyW K1!P@K@^PP yK@1!@P`10S T< @U0z <`:UPPqWP! P 0 V_3KAPh\`ZZE_oR0 5P  (8[S K@P t)y50 `PꜯŸş }-ϟ|ٟ  43KX&p --LdM @|0 PPo@K(KB>v0Pl0   l 0Ph0 ,h0U  lxTb Te Th;LLTd0 00 -S` |0 ?oR20Sx0  l0h@`@T\*3P03# 03 030`0&0募pl`t0 h00Csh0 I|0S  4h0 0kS?'Kᇄ  PCP@h 0TKp{ p004 ;\Kpq \ KTK lv~6d0 R1袟d0 R0SdK`K%ȢP0آd0 RRY1Bn0S 0 S6t0 @0t0 x0PSp, Z竸J0S相%d @D?dR`0 d0?K(KTR?@(KMR {{'0 {0Bnp 01 0\K0>pp% p?TK4 $; ,p  @D,?4 $;LKp \0K0 `0 \ {{'0L K0{TKd@p0_ 0Q 0hQ 0 l?JY@ȡD=FOU#T^HZe~Ȣ0SP 4h0 0kS?ሔ'KpG%  PT@P@h 0\Kp p004 ;TKpu ?40$;LKpk L0KT K\Kd@p0_ 0 Q 0hQ?` 0Q 0 Pt0Sڐ竸z4h0 0kS4Tt0 相/  P@AP@$0\Khp) ?4T`K0$;]p 0GLK$0;Qp {{' {\0K@0 `0 {{'d@pG?_ 0{0Q? 0(Q 0h"Q`0 Y@-3M -L9 zjX& -PL0`Sp C#P@Px@PE)UXKRP 00RP0K0苞IPEI4}-F: 0-MLMQ@4KAo>P6 KK A@P38: S7  S-.KK B@P5 NK@DA^KPE 800X S08 >K0CCD-U0S i0pp_.KK B@xP.KK B@p@PKA KvK0襣4}-JT -`PpL@Q0 ) 0 QPP RX#%0S D%P 0L0( 0$ 0\&l-- -$-P- -L75800S ,0 0$p  /`-l-@}- @T0-L@5@00S(,0 $0R  (-X---- -MpQL MK0CBK0C+A?P @0($@0 K0$$[000nS ?S aS pS qS@x0 |@@h0 d@ P0L 垟0 8r&l-4&-E&-U-x$00S 00S/-- d0- LR L00S 08P8@p`0Pp`00-`--- -RLpM@  Td \ R Q ğ@ R@S1 4P @ @@   R0TdTt@D^ Q 0 R R\* 0BS0@00S 0@ K0 S 3^ \000lPU5P0S@K $\ \\!\ 0P0U`^ 1EK $Pl P$PV^K H 0\ \0\ 0K0$0[U " \U $U``` 0\D 1LK$\0 lH` PCQy A0'\0" P $Q  \,\Q ]\(A  0\ D R \? ]\B} `K1L $`VJ lPH` CR B0 pp\\ $\PPP 0QD K1A$\ lH` PCQ A0Qpp0\0,C\\\ QppP0,\ ]\ &&t-p-p--l-T P-@@P@TL @.|`| |P2S@d \0 TP P00@ <$0@Kh}\&l---p P  -PL0S0@0`x0Qhi'pW 0L 0S @"Pp`R "P-T-d-\&-  P-L. 0 Kh2- P-L|. 0 Kh"- P-Ll. 0 Kh- P0-L(@ [.0000 :-l-- P0-L(@ G.0000 &-l-(-ܦ P0-L(@ 3.0000 -l-- p-AMPLM0  4 0@0 4@S$ . 81 KpS@ 4SA>K 0C!CC=P 4S$4a@PP $4T00aS` 0` 0R`T0 0 0@00@@AK @ @$4 Q000S0?(A>K 0C4 CC<P -?*-/%-D-4 -1ML MX P\ - <4 KP>K0C $CC<P @4@1`  PY30S Sc \ 7@PQ`13 @cX<S0S 3PUd30S5 \<P/ T3\0K0D3 0@ ,3,(3Q\<RQ300?o2'Q20S  2p \<P0002p@\< \<R R00 R P 42L"0K0$2 0@ 2 2QT100?o2{'\,Qw10Ss 1@P0001@f, KUP\ >K PQP<S\<TqK"@\qU Q 0S 0S1 \<QP, 0BK0 000@r 00QQ000?o2$'Q|00S  d0 \<(P000<0P-K-l7 @}-X--l-D---/%-`--W -KMPLM4 0 4 0@04@S y, p 2 (KS5 4SK K! A@r;P 4S4>PP T0  1 1 0 00BK @Z`' P1 pW D1DHK K0! A@?;PKK HHZp$PO0S p)04 R000S04 (0t0P470 QP #R0p|-4-D---l-s?-0 0 00 P-S0 0 00 E- -KML M P + 2 KP=K0Cl"CC:P @L2@H204 48mLP (2 0SD 2嬚 /  P4 !aQ0S 10S 00 5@P/p1@0S 7PX1 lU4P H1H!0BK0<1 0@ 4pS KKHHP,00 0 00T   /o" 'l0Q00S 0@4P000`0@\----l-sl7 @}-X--t-D----`- -PLAM@ + 0 KpP0 A^K PE `E |Fx0` 0l0l``0+9PI4[S P0 C-l-- 0P/. P0-L0@*0000 0-l- P-L@PS/o" P`P0U0 p0d0dPU @0<0}*$0 Q00 Yl-.# 0- L 0+-- P-L[* ,0 $00S0 KhZ-d-l-5 0- L 0i -- P-L` Q!0?o20@0`Q  0S 0 )0S P *00@xtP T0 LkP80 7P400 0--.l-T-گ$-x 0- L8 0Ũd-- 0- L, 0Ҩ-- 0-,@,0 L 00S 0 0$--- 0- L 0-- P00P0-SL MP(a )00 KAP0q?oѣ2P%P00\0 Q R厘000P ,EP9`0P0 0R0@00,\  ,B-̰-@-l- .D~-h-D 0- L 0gl-- 0- L 0pl--P00P0 S-Lp@ *)00PP-`P 0 `0 S   S  0S00hlPL06P < 0?o20-l-T--. P00P0-SLM   ( 0 KP KK7P 0Pd00}S`00S T0Tȗ0HP 40 0, 0( 0-d-l-ѩ\-h-4- 0P0-L P000:@P0p l|K0hvP K0h(o4@ 0S80 0a00偗-h-t-l-- P00P0-SLM   ^( L0 KP8 KK^7P 0 =P0 -?R\- p-LM P$ ;( D1 KpP0!$K K;7P @1@^,( MP$0 @` $2PP(L,0P0$ S0 0S P P l0 Q\00S  L0P $0pP000$0P--l7 @}-R\-`-- -LM P ' 0 KP 0Sx KK6P 0S0TP0@P00 ( KK6P-dlt\-Z -L MP@ppGoᩒ PZHPK10Sc1(Ko蘖QPQNpW|)PPtQ h1RPFp7|0@ 0CP0 001$&HP 0|S 9@P 0 T% (Ko?P @T H 0P`0`TT TP0 T2' <0 (KT08` -l-"-| -L M( P, ' 2 KPN(0S!,K(K6P (0, 1C  0  GP 00|S S9P jP ,0tG@h1$ d@+4 PP @4Q4800@ 0@3/P00S L0H  00'-Cl-¬լ-7 --;- 0- L< 0-- 0- L0 0 -- P-@@P@TLPp "00Pl`h0h@ȑ00 0D00R>U00@ $KkG>--l-%p-t- 0-PLMA  0P00坑00K0P"0P%0S0P 0040@0S 0 S  @4@00+T>0 S +<>4 KKf1P-D-2l--X-p--= P0-LP 0?o20 0P >"000@P 0 00x@0t tS00Pd \0DP(0 4}P0 --t-.l-D 40-0, SL$00T 00 d-`-t-0- 40-0, SL$00? 00 d---d- 0-@PLK0h 0- L# 0蘭-- 0- L 0襭-- -PL M@PpoRZPY`TPQ .PbTJ .@PP[%% UL1H1@W <10S 01$!1 0S ! c U10@W 00S 0 0 0S  I % %`PKP`pP `P LP` A!(KL--d-l-.H-8-ٱ -Lp0- P-L"! x0 p P \00}ST00S H0H@P 00 0( 0$ 0-,d-l-1\\-h-4- P00P0p-SL M` 0 Kp0@ 0S PP KTP0 00S  L 0ӏ --l-s-a P0-L $0 00@P0P0-d-ʮ -LM0 P4  T2 qLR0S@2@圏P:00S 20S 2厏@b40 l <衟P0@c"`! !    @`#! 0X0CQ00CS0G  PJ00CS0K PBX!4K0KX/PS0 8 pp8  0I0p(K0pp Wp0a, P 000 XP00d0I00H0 0 Sp(0Lx0 0 S-L-l-Ϯ- а-&t-t-Eg P00P0p-SLM` $  00KpPp $K K.P $0*0 QP@P @$0( $0T000-?l- P00P0p-SLM@( ,  00KpP ,K(K.P ,0*0 QPK H0$KP,0`H+ 0(v"KR000-?l- P-L 00 P Khe Kh`- 800- L@P00 K0hCl- P00P0-SL M쀟( ,  J00 KP ,K(KK.P ,01pP !PPP 0RP>@|>@/` : H, ,00-4 P00P0-SLM0 4   0 (KP 4K0K-P L!@P@ 0R@8>`C/|0P 0:0pp`p@p00004 0 D0@| ? -?--d- P-L@Pp 00`P  P P@+p0 ` S Pv@@ @000 (i0-ݯ l-h-- -Lp`P @P h0hKhNP Q00.8 0 RU Kh8l-3d-I 0- LMPP  R Kh<PX@X`Xp0S00K 8R  @-p\&l-` 0P-Lp @ Khh PPP` HKhP 00 00-l-3i P0-L L0 0D00S808K0h0$@$P0P0--l-zd- 0@S0-L h0 0`00ST0TK0hˌ @0PP@ ,P0--l-d-ٰް 0@S0- L l0 0d00SX0XK0h蟌D0PP@,xP0 s--l-d-0@-@CT @ T00 P0S@0  -LZKM,PE,MPQ U 3 (KP#EEU,P @3`p尓W 3 ! 㘔!8P@*t80A-K B00`A=K0C A-K B,3 A-K B 30A-K @ B100S  2@0 00@Ђ0S0Ă00ppV"p"p0S@$S \SE00H@0S@D"  p  @#0pC  BR0! B g80 <iQ0@SAK A0! BS8A-K B0 ;0A-K B00P,1D媋 1 R ! R0 ! R Ԡ唋  E  8  2/ R 0S l0*\ 800000mA=K0C0S 0`S9-L-а-l-k-&--¬-d--- 0-@LP -00P '00P0!000  -l0LhM K X00S dH 0dpK' P00pK0p <-`-l- - -LhM) T00S BD 0dpK P,0pK0p  `-l- - -@L4;Pp `0 0C0S13  U]P0 S 0C0SL13P  0 0C0S13 P -`LP@:-P 3. 0S1PS !).tKh$.,`N*P %-P00 4.oS!0R궲. A 0-@LP [00PU : >P0L0000@-@CT @ T00 P0S@0 P0@-00S@0\0%\#0S P   R   0W7 0C200W70 0C0& p-L M`P0@P<$ 0K*/0St 0l R0 0  _Kp B 0 R00S 0C0S130 -ʲ -L M`P@pP I\PP P0  @\P 0 00P10S&" p0\P0P 0 U $+!++ 0 01P1 _F(K/,P0 A+@ ,P 0PS 1 P*:,P P*%P !: ,PP000PSU& 0K%0S 000S0 @Rđ.0 5_@ * 5 0S00000 0* 0S S Sx0 PUt d0P*H0PU *,P !(-1|-'- 0-@!ML M48 >K 0C `P8H K $p \8S 0S @HT 0S ^@! KK^(K8Ph 0Se ;^`Pa -P (P x#Ph^ X^00@HT 0S 8HT 0S /^T4(RK@65놮K@J48T C/o" R D$PUp 4( B0pPZ P PU p R'PPTp pW DG'pp44$0Q` h8 h80BnK `F+4@(<P( QL( L 3H(  KAl( h8 Th +l(h8 R.<(3R @x~048 )@@ n+P @@8\8 ,3@)@ :@b+P 00)8 fP  @z@wRX(\@)P X X= 0"KArZ %  R5 l4(R /++P  4(R R + x4 KAL( Th P R0S10}S·KA)ZTO RL U K+  @N4K+8 @R&K+ @M&NK @D+H>4 0Th PH L( ,Q (1@p R+,4KATh p0@@DcT@@0P/]P0H8 0KSL A @N_gow'l-ij-(-H-˳\-RI-X&--Ʊ- -cMLM(   t $ `       VKK L   x  |     d h l   5     <% ?P<0]K0[>K 0C (5p1 (l |(h x(tEV>K! 0CTd `E ! P 0S XP(xP 0S#T(  T`>0S(P\$6s 6s6s6s5S 6s B( z=0S5  /\P3( 0(=5S 50St5S(|  0lMl 0 SK A AK A <=0S ]K PEP' t5Sf=- * 5S MK @D*P=K 0C<L 0 x*00 2P0t )p<0S'd< R* $,5 R:< 8P4<5 3 50|S/ r   5S;5 ! TL%; < M%R %SR  Sx j 4;l+u 5S 50S =KD 少Z0P 0S} y' PE6`]K@Kp L50X5S 0S PET& 0S Y7P  [UK@F 00=K 0C C U0S 50S P @e0P5 (&P  K(UKKN00Pt5 KSU ]^K @ PEE|e98,K0 B5 05 ]>Krc0P S90 |6[PV 6SZ|%\-[cbU0PEK 0CC.K\60 S00?o28%PP G P<) *P<L60S"UFT$x%T(KeM(|J( 0) Gd忄 X?( H@6(&45@T =K10%5|@x%!(VK A50S U, P5%( %5Q((u6弅S`et5T4UPX 40S 5 HC@ 8'V d40S 5 3@ 'T H'[(p ,^a30S 5>R5=K0K 0C 0C 0K0[>K 0C0-K=K 0C B(P< PV P '5SMP@S>K 0C SR P0S>K 0C@C0 UT2 SR P0 20S0 6 300  00 p`S>K 0C SR@Ÿ UT%( 5ST35  1$ R2"?2R P 1B$220c>K0C6s 06 4BVU %(PoY*80K0 A<0&PR 80"0C?o2? 8"0 0AP06 6 R ;R 5Pj d06 6 R R -EO-v----۵d--"&٪@6W(+L'<-ж -DVdAx&2p-'kҷ1?S hˣmxD-ʸܸL-P- A0$-T-ql-]--U [nKP$ `F0S0 R?0  F6S F?U F F FR0cF0\0 F5 ,'P&P 00S&`P 垭ZK@  FR0F86 5, p0wx'x,&8<6 sp<6 @6 97 @6R #R X Q8&0 8& ,& B,& ,&R20S 20Sr0 6S PEU0S2 }K pGYK@GY>K 0C CP 0PZ R= 0 R0= ` k #2c.K0 B cKAR0 1'&U00R0SF P6S6SgP%['P;tx3PU S30SS3P0N33 ?P03 A #9&%4R!]K PE SR RNK @D' !5e 3/e dpt4@! 4 R04|%y$  &5S- 5%0R/ KSVK @P[K @[K5S |05 6S u06 5S n05 5S g05 (K5S 53/5S V05 p-L MP @SP  SP0P Kp{'`P  SP 0 Fx U 0S S TP 0S  ,S0PP Kph 6 -PLAMMAK(LA-K0 BAKJK,L0,@DA-KP B4@PB D$P (K ,D4廬,0P R (5000@ :K,0C4f"p`JK,@DA=K(0CA-K$ BP8Z A K@0@P 4D0E4P0400S Z Z pA KX@0PE A KD@P 00*S0 AK AEP0,0-SAK A0EP0 P0,00000 /R0 *R0 ,DEP0,000000SP3 0D_VEA-KA K4 B0@0{P A=K40C0A K0, @4A K @Ps 0 00SnA K@LA=K00C0fA K@YP 0!`\A K@OP A Kp@IP `!VMA KT@@PDVC0 000=A K@0P A K@*P1 P 00 !'A K@P U KUU U WL U1U 0UV 0S Xv1 0Hq W6 30!0SUW) 1U0S 0 0 0A K0,@0 r 0S 0 FUV &-Ϲ#-޹ 3fnR1D- d-l--@m 0-LM, ( h 0 $0 P P10S 0S$00 0 K  aQ @T$0, S 00S 0s w$0( :"P 0( S00$0@xp @T h0P 0|S 00 0S$00 0 $00$0 ,--4" " D-(--" -`L$M@@KP +000 04@ (0 ,0 pD V/0P/S:S XM/@V  D + DDP% 0+DP/4@ T@P/:TpP T@D,P  K@N /0, 00P0DK<@PU@P04K00 l0@@DcT@@1 , 4K00 0@0CcS1S@ر'ٱN-PP00/ 0-L=3 (0@  00023@0-D-  t0-L `00S T0 0Lp N8 00000$ 0 0-`-l-8-4--D-  -`0LhM@ qd DpK*<0 0pK0s " f-l-@-00CS0 S0 S0 / @-0LhM@?0 0 00 0rS sS td hpK*d \pKT0 0pK0s ݽ,#d $--D--ƻl-@- -LTM@p  T?t x &K%K+  ?&KXRT LK2&K`%K`%KR0T b<K $KKP 04DPZ R= 0 R0Fd `@ 0KP %Kpt夽P(N20S J20#S F20PS H1 R KR00A#P M"/2yP v(K  `p 0 %K R0%Kp xJ`P20S 20#SIY0S KP0 R0 L"} #%KK 0%K-@Bl- p-LM`PP@ @0BKs8#8,0 U 0 Ks8#8000@?,K zP V[U 0KA0T00Kp 0-L1 x0@ %h00S \0 0Tp ׼@ 000400S $1@0-`-l-D-P-4- 0-L1@d00S X0 0Pp < 000000S  m1@0`-l-<-P-4- -@,6BML M@6D @ 0 5U84 s!0W S00G00@4S7BK+ A$)<4S `44V @40@4 44S044 S<400CS0@P񟗯 , , 0 t400CS0 0d \.!0 400CS0 00 s`93`3sP1D4S 300  08 500(K@x3@P30S VU@@4SD3D!Ϳ 0300 V S$ " R 5X Q Q#Q V RV"x H4 垿H4\"H4 zH4V h" 0 C " T BQ@Rd@T Z " @ S)S 8  @ !8@Q 105 28$ 5T dT(S@V-S<$R  <$ <$ X- KW05p20 04d1X 1 0  0VR00 0RQ P 043/`0 `0RY P 9/0H50St00S BK @3/D-<- P 4----d-\-l---&Ȱ-أ--v&3-- --LMP@TP 0 K0p0. ` xz h0h ,o,0@S BP 6/ -7-D- AȰ- -@FML M` tD $/  /F>K 0C /0p4 3G.K0l4 F>K 0C 0ChD X0P S S/%0 8P 03 Wx4,Q1'3"xD 4 T  uP 2x W 0 PE~K0Pp2C.KRP "CK '  '0S x40S \0C.KTB 宻PP CK,A@0S00?o 2P`ꬑ  '0@x0W0 P4 |14 xD tpp4 P1p@P$ 0S004 0 0C>KM0(a(0APSp OP kP g 0 0S 4 0ӽ2P@F>K 0C0C @4 4@,h4(KH-$-<-Y-T--d-l-жr-- -lg0JMLM4 pPGWLWHg D4&470S00p  P判W 6 & Pu60 0 0K>Kⴺ0Scx6x0S. lpW*`6`&0S0P0$  R$Q0 P R&4 84 R % BR5Qy0000S P(0S5 5AypP00S04 B>K 0C0C0J>K0C0B>K 0C0C0B>K 0C0CC.K@@Pa 50 (5pW +0000R4y40pC WSY4I>K 0C C0C 0F>K 0C00F>K 0C00F>K 0C  CdP84l \;-!>p$0d4[hK徹0S  K>K 嵹pfA T婹PP20 0 08K>K垹 $ ,J.K B堹pp 40PP=0X[ Sq:10S: 0S6 xJK% 0IK [1C.KJKiPP"hC.K04 P10S00 04S0 P 0S1!0S Z 000S 0 0Sr Z0s0p0A Z]W  SW04 0 0K>KN-X- --$-̼-`--0-T-d-l-- <- <ľ4-t-%i`-H-ؽ0O} -LHM`1ApWk 㼷pPH  嵷pB 0\0 0TK5KԅKl1Q< ?%KDKոK$KP<LPZ= X k /\Kp#,0S `0$K0@0( 4K剷pp,0S PKMw00q pcp 30[S $0K< #   z$K- --$-Ͼ 0-\b@LT0_ H2T R ,B ^$2 2pQ ,#0 E0V$ ER$ AN$ AJ$1 R$!$! 1 (!(! 1 ,!,! 1 0!0! p1 4!4! `1 8!8! P1 p;0 ST#P 10|S IP/ H@&0SR &0 SN  Ԝ): 0RS 0S 10-S1S :!嵵:!寵0S !$K0S L: 1si0sj0JPʱ001Sd1Sh9! 9 ! 9T001S  T T/00P90S 0&0 SPh \90S !&0 S P $90S9Q0SPPP80S1S">&(P  88(l80sSqp8  d!Px10S !<Pm0l 1SDP 7 7 R0ZW0SB|"P 7 1 <7 <7 1Kp 1p 0: S0&0&0`7 R,T7T'TT,10|S  ,  1Sp6 l6 61 $Ĵ  1S66 R P |6F 60SP 50S 5 R05P50S 40CS10S 5  p P0p1%p1 1q 15P00 8(PO%0 SH41S 1 3/0 1  0Sl4 RQ 0T40S !4R[ 0 QPK K}.K,K0K0 彰ps4K@Qy  0hg\ PH0Sc!00CS0p@b T000  T$C<C 0 0 0 0P`pk V00 0 0P^ !00CS0 pT P `p !0`#܎K0 ?.KЀU KX0 0 !00CS0\@ T0S* 10@ U.10@ J$0 S61 10@- v!0@  PT< mt{j B!0@k.K@T01 /#,lP@ `ATdoM @00S /| x 1S 1 3/T--_--$-l-X--@-Ȱ- < "0d-l-@- -'  -P-$--43&-h2r٪qH--L-1p /0ol-\P P0-LdP X0 00.T0 @P$̙ 0 K0h --i -L M@0 ᭲KQ G0@-@CT @ T00 P0S@(0  -p@0`LPPP P@h\& 0-X@L0SHP4>0 0R E 0D-$H- 0-X@L4SHP44 0R & 0D-`L-PC-! 0`Pxp^ Y @Y X BR`P0Q \& -L$M`@plT PT(KT <<@DT0@0 pP@0  P' m0 P0Q 0`ݱ@P_ #0S 0TS fW@X 80K @0 y@0,K0! 03/0 00 ᱱel-`0X-\&0@-0 P$R!R!\6 \> 0 Q Q Q 0 T1 R   R  41 0 Q 'Q Q5S S 0 Q Q 00 !R0@0 0"Q \Q Q@T "T0@0-p---Bc& h0h - `0` `@ X0L P0 P w`V000--p-,---- -aLM0AS &m0 S t0*\\ P   L 0S  <^mq0S 00pP U 0S 00S 08K  t0 03/00S 0S  \0R TL (K`-l-6-&J--¬--- 4" " P/ 0-@PL(UP N0~ --LOMU_Kh ϭ @ğ R0`p L10SZ`V=9p =:k{ A38ЀX0?` p  A{ Q`pYT#X30H# QK 00#V{$@ Xڐ  1 B2Y4# QK  0d"=@.Y QKd 0",@< Q?K\ <d\1 T" 0@@P  S  RS0Q/K "d1" 01W?K0P0 P0WK W?K 0 WK  0 d\(YK `!X1##t/`1   0YK/ 5; 0 0 %A5+ !Ȯh1@S{ 0`V0vs0ЀX0n0  0X0eX A Ak{H7{ WzKp\Q?K`X d┮W@ .A--Q--P-)l-N&QKd04 q@<QQ?K<p`d 0l ``|@!L`VApQVX0Q?Kd I @Q?K dCh1 S00p QK@K(K`p(1&%+GŠ` p0 0-D@L0sm,00p 0Co0Dc&l-00S000/md-$- 0-LX0@ R0D00S 80 00p Ǫ@0-`-l- -L MK,K 0K } K 0-L0M$ K< <K80 40 00 ,0 (0 [P$ K --LNMppTPe "SOK4 Y?K!PW?K D10CS P0WK \4YK"R0Dd-<\Y?K " 0WK 0S w>0So IPl OK⯜30S@ NK#@b@3ЀX03Y?Kԋ A '~ A{{jodVd`OK0dL#FH3@,3X-HP HXd#0 #HOK d")@)Y?K P࠳ࠣ\^\b O?K"dS?K @ R0 D10SZX=9 =:}k{ # A1UK R08 A{ Q2U?KP0!UKRU \O?K1! 01UKP0dhP dP㐅)8/?  %+P1  /? 0UK 5;A%0  ᛬0@ R\ldЀOKXPYKRgl kY@.AP---$-`- --k-r|5,-l--?~\WK?\0\1X 00OKM`0 0OK0s [j]WQ`"Ce 0TP!ŠPˌAT P B 0UKP GWKP0 Pc`d00CS0p 0@S P,P \Pd00CS0p U0 0 P@x-Hc&y- -LoMf1 0S(KEPd0S KL0P.K01K00K@ P50`u1 APpxP5 PVH5po P4IP> 45PBP7 . 0P1  8P 10C 1 K:P10S  . PP "0P1 PE x6:`P10S p1 P P0" P PPW @P   8  SPP LP 3sKd0p  P 1? i=g=|3dZp P 0SH83sKd0p P1? G= p P 10S120S 2d&0 P Pd00CS0pp P|2|4g R`2d 0TR L0 dL\  ! 1 Kp1@S PD d00CS0p0 dL\!  1 p1! P5,. ^0(U^0C 00E<```^    NR%    #t PX Q0<0\nt-x-L--20bX-l-Ϯа-&t-t- 00- L@0SP 0 000@ 8P t0 0pP P0 0PP ,0 00P  0 0&!-ٰ&120@-@CT @ T00 P0S@觪0 1 0-S0QL`0 P2V P ڀ100.S @pd1l `L8X1P@  H,~8P10T0!0!00 (1( V 0 ! ̩0Aq000 000000P 0p0S000`0T h0h0 @V t0OP$0`eT-d-ʮ7--l-<YX--İ-$--p-- ^i 00-LP@ 0 00x 0t 0p Q0 `0 0X @0P 0L PP f80@0S, 00--İ--(- -0-d--X-L-  P0-L <00S 00 0(p 4z-`-l-,- -LPA`d0S p0S p j00pP`F00000S tp0S p K000080lU  `-- -- -BMLM2P 2p0SB 20S R$5 P1 N R 4S4 Y$ (K4St2BK+ @h,0K4P/S BK+ @gBK+ @bBK @PBK A埏ˤ``!0< 04 0f00@$ 44 |1D4 8 X \1o^L1LBK A0: 0Y100CcS``V10X 0o?<40$BK @44$ D48$ @ eBK @4SU00J:$4MYPo P0 0ul-----'d--$-X-S-- -L M1A pR0 Q`00S Q0)dP XP (K2)(0 R 0000@ ` KPl00}S0s00X 0S$P,c T-d--l-$M-&- -L @ Q0*0@0S0 0 0S00CG RK mU.RH T:* @0GSp0d000C R9 T+* @0GS%@P.@ @@-4-h-"--/ -p`L P@,UP0  T  `00T  q0@ R   `FVx`00CS0  PpTL000`000 0 ST00Zh&z -@LM`p;P0尀U_x ã 00P$0K*aP#lP`0( \岣~L00D P 0 $K-l-&-- -MLM`8 @ 0~KpG.K0@p3 B  7P Kx#x@5  h1 `30S, P Q PUP ᷠp@)0`00C.K00 B27P CK"@ CK`AR(K qp.K0 B||B@ bp@ KLA4>K 0C8 0(th 0B$2 8 R ~88 @_ 0 Bp@U0$SBK II 8S0AS K A80S  RI8, RdPZ=  R ( ( /8C0C8 p8,0S 0 0x8 8 PC>KP 0Cp |8S |8} 0 ߞp@@b.K0 BL0寉[Pi<00-- 0-@PLK0hӟꤞ 0-L@P0 YC -LPOj 0-L@p0 C P-L0iP4 0-LlMPQ@0K|0 0 0  T  40S P @00  P 700  |0K KKPsJ 3 @0#S` 7 |@$0KT@#P tKdP/X3x T 03 P 00 PU b pP 00 |PU S a|P  KܡtKr P 20S 9@6@@` ~  H P ` P@l0S @P@KB  P@ TO|0S @P@K%|   |0SP3]H|@P  U 11@T  `0p U0PUږt!7P* "000S0 0 0@B@T|Q PFP(-2-X--l-&p̰-{$/7A-X--а-L-\,---h-4- 0-LM P , 1 K0Q0S 1 1Pʔ!KK!0 CRx @R hS \1P 0S D<S0R0%P 0S 10S 0 0̠@ @ 0 @0@x 0 @r 0 @l 0 @f  0 00S 0J---2l-4̰-h-@-]-d-z -$-P-(-x---p-P-- -H- -L4M0@0S@K, @K@0K P@0S0l2@K@00@@Kl-W --LlM @K J0S  0@0$KQ0 0| S` HKhK╝&KK0r(0K@q/0xK 0儝'KKP 0%K`0p 0SP0 UZP=9K =P0 %KR0<00@ 0X K0 H K p0S0S 0 0 0KP 00S 0#S|0@P0C|0 0 -/(/ -LM$0S  0K # K 0-LԛPP@ 0\@P0P$0ߛ0 p-@LM`0 @ IPP  `$@›0+0 0KKp 0-@PL 帛养僻ၻ0 -LlM(sP0S@|K̜K0`gK @0 T  T@!  00C 000000C0 吢0S `pp 0#S) 0S% 0(00S (KppP|0,00T/P @ ~ @@@p0 `L0K"  "w  pp ,0K! 00 00S0lKUK&KQPtd\\ 0@>0 ޞ<00(0RP 0%Kt0d 0CST0 P=9K =T0 00 R\0K0 0ŚP{0S w000C0 @Z-l-5 -L M0pS@  (P;P0Y 000(0(0S P K,0S Q 0PPEUPH 00 0P PP 0 00 0%KP(0S,0S0 %[`0V``[PP `%0[ S0S -p`LM P@P,0S T000(0KT00 0@ R   `FV 0KP 0[ ST(000(0T00Zhz/ -L<[-<0!R/P(0<18C8S/k10/-tf& -LBM30$1 0 1 30S3@TKC  tP PF ]. H0-|ALT 0S  0 壗 tf&. 0-LM<0/LAP-0P00 K0tf& @-@0S S S 0\ \ \R \ @0 R0 R -LMP@ ?0  堀?, ` ?p( @˚@T*h KiE1$ K QTVW@ Qs00 ᱚc&= -LAMMB^KPE`0 4$ (T B  t2t p2  d2 `& 0 E)4K 0E84  8("*4[ R  0 S"\=/P@`pᰁ少0SBK A1*$[0S000 *4KRP'(DBKA@T  0ŖT TEEP1<18C8S ҁ P0,T(!1 嬖0$K4P*4[S S ($ S( 0 0<18C8S @| (4BK✐A0CY 0偖Y DE 0 B>K0C(4 .$.+& p....<.-TT tf&D.. 0-LM,EK)P GKhPl@PDK0 ,EKPP 偖 l| x0EK<  zKTP4fEK DȗTT tf& -LM3@P `psp lN`#8 qP3 LT@D,K$C00CS03 p00R0S0 gP18C8S5 P1 P8C8S 000 0[5'3P|2p2l18C8S  0Kߕ{ 0 P^S,18C8S  00 S 18C8S <18C8S l18C8S 0㘑01<0 x1 0K夕 RL<0P+  Z 4118C8S V`F(㇀`p8 <18C8S0 \ (KS 0R   RQP1K8VC8S 0LLDCp..+& T <...tf&.l...D.(? p-LCMf,GK`@P5T1 LTQ0!u$1 !`P C@P1<18C8S  P00  T)&Kp @PKtVPp0ؕ GK(GK8Igp.+& <...tf&e.D..S p-LCM,GKlv@P5`1 X夔K0CCsPn~AK$4!@⁖mPPt1LAl1T@㊓֓冓ㄓA>KP0C4!ޔuH~uso+M@hBKU $[ 0R0R0S $  GST%~$$  T$$lt  10D0 S BoQ 0Cvftf&ԈY-X&- -LAM1P P lhl lh@PHX\K,EKDP H,0< EK.0.tf& 0-LMP P @'0@S|-AK0P55*\ \ÒPPL AK5< @⺕AK, @g.- 0-LP ppGPP0\\咖PDLK0h@@ LOl18C8S0 0K0h.tf&. p-MLMP P @0@S@Kp5P5t`XPP`录X AKl!5(B(R@ @  @QA.K B, .1-8tf&PXu -PL$Mp8 ʜ8Pd~@$4ܤPP0 4P @ <0 4$8p0G$T pW W4 Q804 x P40h$h40d4ppXL@4 0$$$$Pj p g T Tx3 X!  ! RQ MeS %FSJ 0S9SES7 0SaSR cSU PSX3@@lP ,gPq  b@P~ !nSp hS[ lS@ fS qpS. ZsSJ tS0t"0x"x"0a2 P1000 Up2 pPE  \PA &PB 82@ 00;2 1 040 4<00S1/ P<0& P?!13F01 1 T T@ 00C5%0P 0@ 0   R C "0 l ;@845,2@K $R$$ $  r (4 Pڶ0 (4a P 0SS WS BSc0 AK+A݋P  Bf0S 010SA>K0CZAK A㝋18C8S `0S RAKHAK @G   |PZ 0@^S0C\ \00 P0S 0 ꄅ p..tf&.. . 0-PL@LP@00P P )P @tf& 10-Lދo -L@PP" p00CS# h X H X X X `V PPP0 P00XKh9 0S P0000 !0S0R 00 L-`0 0CS`0pSXxX0X 䨾& -`AL0P0C!S`;0000CS1괌     4 0 "S 0S!0,0 0P0 P 0 `0"S0L0Kh 9, 0 0P0 .0@- R RQ \R ^R^@N  @0 N@T 0N@T!0N\!n0( ^00@ 00S@ -L@P1 lql =`P`PP1 00PE 0P /? @V P 5@0S@0S800@PP?UP PPP P  0!SP_.tf& -LM@P@AK\1  @AK @ۍPP `pAK  @>P=u00u0K 0T P 0T@ 0000S AK ADAK  @P00AK @Rf&tf&. -L`@#PP 0 >A(RP@艫 -LM@`p@TKP U K R  x(R( d\0 PP O<P K(P f@xt .yt . p-@LM(  @ `0, (@,000 0d@P ,TKp0,E|0 !K">(`!@[P@!@K(i0EP 0S 7 0T @ 꼓 .tf&. -Lh (,D(. -L M@ | vkz_P cz 彈0P3P x<t: KdX X媈Gz KۈK.xt yt EKNef@ 0-L0MP%PK01<18C8S A@KD80@ K980 z Dm<E4C0 e,0E R Z V.P *1PP y0(0S"=Rŋ00ESꄖ p幋d巋`\XT H媋Ftf&.&.%  0- L  Kh*. --LM t0 R   K. --LM t㎉ --LM 0 R   K. -ARp`P@1LT ƇpPP`@D -LdM @ PG0Pl0 @0P0 0 \K&8pT0 l0 X0 0`@ dP `P@'Ktp hp pp `0SY W( Vp% d0 0 d (c圇p  u T9 @p@oop`0b0`0 'K ?'K`0ST`V rT< ( T x ܛ  @ T d ( d Q 'KR00SElC0S'K  (KD 3  d 0C`0 H0t @p0 d QQ * 0Cd `0 @xd Ql 0Cd `0 @md 0CPh d `0 @dU@a d PE h  d 0CP@d `0 Sd 0C@Td `0 KU@Gh  @C d Q @0Cd `0 ;h  @7 d Q @h0 @PP-U @)80<"dK,P@ (dKW-0SȜ    ( ( T0S00&S `dK!4XT08s  lt0 H0t  l0P Ttp00p0 ZdK3@l0X0 8T0 SV d tP0CS`0 00 Sd @Sd pPt0C Z`0 d XV (6Kf.)Abz -LtMp l t 婣`㦣h oV@@T 8PdK   |h 0X0 h2hT0 d2 0 P@0 D P <@PfGp@ PT0S(lP hܥڥt0(KX` T `0S(hp܅0P|  hx0 4Gpx0h @_d `0  |?P,dKt?PXp J lp  ZPp0 SX` T dKDP$<0$800$4000 0'<0'800'400\ 0 ᓈ lP$( h&  -LMP1@ R` x3000 00p`QP ,K VQP -`p 0`屈 008 ?@PPd@VX0&0 0QP(` *ɐhpf`R0 }>_?@l ,K'$ K0@0 S$K @. @ C<, K0v$K0h&-`z& p-LMKテP!0: S0D 0 SPK@` 000pKp p P @TP0dsHS 8$  K  U.0 R R /00@-\0R@ SaPNU APNU @S AL^ T00  `0`P@P-L@@ d0S 000S  8FlD..@D. -L P8߄ 0-L@v0 000/(. p-LM@P 0S`P,Kv,Kv,KPKpPU P Lp0P0;(.N 0-L@P K0h9 00SK0h<0(. 0-L@PP000S0K0hq(. -L` P@P000 P 0S00z 0-L@yP 00SS000S0K0h (.0 0S0 A D.X (. -@0LQS@\0S@p<`4P8 p# ( p 0 S(.xD.8 p-L4MBP0SI  |2P tb HK.0S  HK00HK0uPk 8nP_ 2PV KPW P1PW "P1 $ 5 [1 3 [1 14 [ <0G?0<0 D0x00D0 02K0*0K-0KYH KPKpP4 KPL1  P8 <1P. KP1  P) K P0  P( K P0  P# 0P0  0 0 0 0 |0 p0 d0 X0 L0 @0 40 HK (.D.E.0/D.|D.D. 0-LM KfP@P1[Q[S0  P 7xP0S00\@UP PP 78P0SP00K0ht@xD.\D.bG 0-ALMLPPP + P" PK P PKzK0P P PK P (P 0L00M0KhK`KXKPKHK@SP0ML0(.bktehnqwz -MLM0PEK@0 P00_P00Xd8X4ԄS4tNKH4dP 4 0$S0$0$0$0$0$0|$0 t4 p4(8 >K0CPCP P4L Pt4P(4x0S 40S||4S4|dSdP 0S0`00 S P 0S0 `0tP 0S00P34HP<3 R  d s  0 P``4 0400P4 0400P4( 040$0PkPPe 24x_Ppa0pS (h/ s(h( " BP\a0S 1 (h B s(h( q z"P`Pppp0PSt _40S ,1 $K0|44, P 0S a4(.}D.D.D.D. D.D.D.pD.D.D.D.D.D.C`p/ 0@P0&iv0 T (K0  R ЁYX40 H0 ~40 30@P .h&`00S T R $ <0/=C/// .D.x -LMЄPU(K00Q`C !SR04 S05:?0 02@0 Zo@U !SR' 04 R $ $ R R0 /0P 4 0 40@!0P000 00 @0 0 0Pa @@,$(4vyf0 KqlK000V 00`S KB> CSRD 4? ` 00 QP22s!SR'0$0PR*0 R    @ @   @@04 S@05I:@_0 KB>C1 qO   0! R!S / R  0 }0T! B΂L`S`L K<1-0BS> U6,K!21PUP00)K2P)0+KSR0,KSR  0 0 4 00*b0p0 P \(2x 0L00Sc .,E.h& 5`D.h&D.4E. .D.D.D.|@E.<00@-0S ($,ē04VFY00 . -X@L0Sp 000$R C.@B`p`B 0$ . -@L0S𫝸|0Q r}0 0\0 p` -؀BYX 0 2(Pp 0 h& ..KE. -(L@XP10T0000P 00S4 $B>`CWV ?0"0ˆ ^0T0t` !QP }p 00B> CR0C>C0 P@0D .E. 0-LP0P0 0R AT 0 RAC@A000 . 00-@LT04 MD0 QP4@ K0hu0)p0 .E.0@-0S 0$R BCNP $`Pp ? ƒ "\AUT`N 0$@ .P00  ?P/  /h& 0-LM0@PT 40 0M DK00T@ 0MDB @C @004=@C @P@C404@@ 00 QP K0h0 .] 0-LM 00 K00-B>CB/ . -PL`pw@P!㔚 0 AC A0 400 At P 404R0$rd$Kkq . . -`LPU4 @ P@ Dt4 {T 04 0  0塛ꟛ0@Kh . . 0P/ . -PPL`@ 00S E0S *Sn0S 0Sn0*S x0kR  dR   0C^S0SP@sR  uR  @@ .h&- B 00^2:!P* C\ 0-L @0@ R S0(9R0R*.R p/bR cR S :@0 B,, LR . .m} -@PL`' PPpQ PP@PlpQVTw/YP P0Sh&j& t0-L-dPP0P 0S ~40!0%,(!(K0h3@PPPPPPP0 0 @ TPP |PlP LmP  . .& .0/ . 0S-x LQX  SLLlDS@#0$  ! N} .H  .$ 0S 0S 0S 0S P////// 0- L0S@ P0PR00`30R 0 CP00 R R - L@P0 H h #-?0? & )? ' ? ? , $? ?  &?* / ?! ?  ? &?* 0 00P@@00 0-$@L$P0 $8 0H . -LM@7@G0`S(hP`. Q008(h 8" 0S0S : p(K0S08 Q00((hʤFP %p0 8 0 h 8xW080F?oP20S| $Q (6Q{ PP P0} P P 048bP[ P48XP ]P P48 8tP P0 $48XP 4P48US.8P 0884 R80 08S$8Q UD 048 D(<8R DP 4@Pe 048P: eP_ 48PpY<(KoO488080 SJ488SB0S S 8S<0S S9 ;904880S/ 48,4848 0p48!488S0S S8S0S S8S 0S S 484880 S80 S80082堢 R( B 0 ` U`XF   00 P 00`! 0fH80S IG80B Q( !؁ < 8 0  B@ SY0 R  S 0 4D0 P@ D0 Z ( 8QS``V @K 0CwK  @0(P >K 0C@`p ~&}& 0-LM ,0Q0S/ PP, w@T% Kp tP 0: Sp esX XvP Hv@< ,v0[K0}& <}&~& 0-@L0 700000  0  |0  l0 \0  L0 @8800K0h.&'t -P@0L@`@p|0@/00js 0S nW DjV V Kh_. ")}& -`@P(0LAJKh. -Lp| @P0k  ' P0;0 $Kkx ) ` x/0pP     P $&V $Kk$  .- -LX,P Kh% -La@0PSP  SE SKh S S %SS #S, $S0 )/S 7S!Kh.0P S+S@ AP ֑0S0p0 #00 0Kh400S Kh00!S P  \00S LPHKhu00PU$NKh(&.$.`D.?E -L'P P@x0QP  KhP0Q@ @0Qp`P@ p`PD.D.$E.D. -LP e>rUp`  0匀 @0SU V0 0040S U82 D.E.D.00SS/. -0LM K0!% Kl&K -@L(0S 0(06PKh2#'P 0S S S ,P P`,P?o2(0g. 0-@Lx0@, , ( 0. 0-LP7@@T08T -0L,M؎ePN~0>00?00%0 !0 S 6/>0 S "a,0S6M&"P  P >P>0S P l>nP ܭ Rc 80 SP "  k$]P 8 S0SeUU`ZeU@0S& SS SP S V VyB@),P  E$Z 0S:#\ 9$+/S 7S0 S0SH`KG0KHK Pr [Po 0,K0!hPDP HU 0EcSl L X   4  T $ T      (  d t    P    h \    < p    T L                                             00F.V SYdPT n0SP0@ _V0 0Sh V V00K Z" :0V :0V :0V p`!V V@0#0+V -VR00R0P @ 0 a0CS004K@K0!P 240@0 @0P 0Sa0@S @P@00Z,K!# 00@0S" aFQ0(| s$90V 90V 90V 0S!P,K!HP 0 /6PV" V V/ V07S <!V V: 0#0*V @V70S 07S ;\50S P!R ,50Sq !R   w(u}!R0 0!ı 6s!R00 !ı0<0!eR00d !ġ0<0<^P0[W!R0 0!ı3 yKaH&,K!"A>30SD0S7NK @ 4 P+ 00!R0 0!ıH0430<0!R0 0!ıh P0000!R0 0!ıVPP000<4(P2p P@ 120S HD"D {|20SPP2 QP 20S "8"0 0O1$8.Pl!R0 0!ı2P P P  !RT!010,K0!@O.P0J!R0 0!ıP !R 000,K0!6!R0 0!ıx.P+ Pl.0 QPf L0 kbE..HD.xD.lD.E.D.[.y.(=`E.HE.D. p".8D. S):MYi .}{v`D.D.D.|D.l&D.lE.D.D.LE.!R0 0!ıD.P|!R0 0!ıP (0P PXP  000 0,000  $10S  !  0 `*{`1`0S p10S |10S P P 0 c1`0S 10S 10S P P K20S (%F42`V @2`V L2`V P P`.`0Px"$` %30 .P02 R2 բ/ ?!!\0 ı0L 3 pP03 R$3 բ/ ?!8#0000S 0 hyxx30S080J?00S/ . 0-L@0 S0!0 -LMSP@`P8Pp0` 4@ 0X:W  0#1  W RpG Y@G @(K40 0K80 r0 40S  P R 4 BQ4  R Q R 4 Wp10 R0  0  0 < P< 4KZ80H C0 P 0 R:p@-PP HPV@^^)0S gSd0p00dS fST ^g\ 0\^  \A0 000   / -L Mp 0 ʼnP@䠟&. QP~0`PP40 ` n40S ``F0Q@0QU*0@S0S000S 00p0(KP Q-LP Khd. Q-LP KhS. 0 E. 0 ?. 0-LMd@P K4PP  0S K $P K0. -LMP2@T @(K]Pj~XP0`pj@PP 0@ 0 QP` njjW V R0S0 MR +R GR  SR 0SSZ SER SnR0SdS0Y CP,`KP&P00 0 0eS cSp0800 vS xS p0:pP  0 P0  0 `D.. 0-PLM@P 9P P@ QPK@!$q܉K0Uv 0-P@Lqq 0 $$ K0h4~&6HUdj -LMP1p0@ .. -LM`PK@ 0@i0 QP G_K,dpK`Q'|P 1S:T e0S 0S  [ 1S*PP@XE. -LMd|1P0S cpV \1RP$K4@P,A 1R@`````0000 000ugW밀`@ @T |P ` FV @Ǚ0S: gP31P`D." ~&~&- 0-0LS`@@P0L /g{@`pP@`D. -L M1`0pS@(K10Sx5P 0 @C|R0 -R DP ^P c 0P-P[0 f (` ểV T! P uX%X-KcP 3T00P0S 000\0>@-[d`4P-@0S0E.`D." -L M0p0`S-R PP% Pڔ Ki@@@@0 puf@TT  Ki֘ K`D. 0-LMKPdP@@JIDOoB8K0 0-LM 0P @RP @~UUKdPQ@K0@T@0: S g*@]UDE.&р& -LMK@dPKK0 00/ 0-L@AP0 P0@/R000SD. l0-0LS p`QP eQP@P UTD. -LPO 0SR0 R/ D. -L M`p@P V 20St20S S R L200CS@0S (200CS ʈQP O)? QP C`V5 1`q`P0Y00 SJZ.Z@PVl10S`10S 0 UT 410S010S$10S1 1 000S0 QP@PX PPl0A P QP Y  00 (Ko `V 1xD.(E.$E.&.6.6.D.D.H00S <0P/000S $0@///.E.$E.xD.' -L`p@P@T 0@T@@PUJ0ZspU ,Ko5 qT i PT 00SxD.E. -LMPP P @SP! 0 SRU00S$Kk"KAiP"K $KpP 0@`p 0 @{QP 0 D.xD. -L Mp`0 QP@PV KiM0 @ 0S K0PP/&0PP/& -L P Kh 0-@PL0 t0S0 T  00S < 00C0߀K0hۀ  B 0 .&.0/. -pP`L@T0Y@a0 "000 0|0UP0(0@0@000 }P @   0S 000&.P// / /00//0// / / -LM@P\0 UT@P(K,30Sx 3 3 0S000 0,P`p0p PaX0W`p@ P P0t T]0 00@SPt" Rp "Xl0@P_P10S 0 P00P *V10S Y P PP p ^(Kol>P@10S`Vp0mo 0 !0P00 00Xß0S:00 <00 TH P0 0Pڜ X R0FH Pp0@P\000 (00@P_5@q0 ,E._X@]@$0S@@@2 RXP:0S t20S DP W@DR@@  y@ 20PH^P ` fP T_X@@ X10SmS$Si10S SU0SR `W_P@@ P $@ 0k@P @ 40 BS@RPBvPE  H00Pᜀ @S0CR0S*QHPPE`  PPEU  0` pE.. .XE.h&D.0&D. -0BP0LP`p %> CP0 0 U1X(0QS 0`E0000P@0(ꘑQ 0 (Q30@08P 0L 0R <10?P 0@X 0S @00S0S (0(`Q0S@0 Q0@ 8Pʈ1PlP ET EU0(06@,000@00P(0 .pE.P. .D.D.8. 0-,@L(0S%>0(000. -AL0P 0P0X0S %> CP0@ 0R 0K0K0@@!$&!7D.Kms 00-0LS  k0&D.@BlE. -PL$M0 & P P00 .R0$ K0K00 `0$0SK$ K0Kb$0S 00 0 R|0K0t0!$@KdX>P0@ 0R 0K0K0@@!$&lE.m -L M@PqP K@!K P-L P00S Kh~08`xP Kh0 QP@P 0 Kh%`D.6.D. -PLM P P<0 K ! 00 K0 0!Ah&% P-L (0 00S Kh6.6.' 0-PLMP, P P0hS =S MS @sS wS mS|@PvqK0PP@PP@@P8@P0@,0K 0 10!E.$&(&,&8E.P P/0E.P/d 0-@PL 0T0K0h X0X 0P.L,H*D(@&<$8"4 0 .4l&B:AW& -PLMP. P P#TQ@`[0 0 B \ D!R1@K0,ST0@0D@D!10C 0 K##T &NK>C0 `R ڔp倀0S6|/C1\0h <KXlB XUC !,<PD.0&4&W)bm -PLM P P R0 0 K0S Q\S0H < 040 K000K000K00K0K0! ~&~&}P /P/ 0 /DD.0P 00/`E.xD. -LMP@Up`K !@KPtpQ \0A?o 2R0S 0S@V ᎳP 00$Q00xE. -LM0 S 0*( (9S K * 1S6. 0-L@ 9<06.P/0S/P 0  //᳖ 04/6. -LM04 K! u K6. -LMP@`'0-S0 00C  S0p ` T00V K`!HRp  0p@0A ^T00RpgK -PL$MH  c4P 00S S03/040(Kg40 HK@P<<@ H0 R @H@ +P9  P $P P @0@80 ZF]apDWpp@T]804 S4KQ9P 0P,*-P-P 0H0 @0 nP0Sz@n@+P0H0 PP080/0 <KPH <0+S<0oTH0 z@p8 KapGW@KppL0 @ L0H @0 0@ =SP 000C0 ,K\!s H 0<0 00 CR { { { p| { { { | 0U?o 200<S 3/<P_ U W 0R00R0H00S4@<H H0 S 0 <KePH .H00S HKp6.$.6.f- -L@PMp0 `@P U0@ vK!1KU  kK! R RU0  Rp  00 CR ~ L~ } ~ } } } ~ U0S U03/U@`g 0 Vc 0  1 U< U U 0?o20 0U- U U W 0Q0Q0W  0R00R00ESU U U( K0KD(0S0 0 wP00S|0000K00!V`00 SS UVD. +  -LMpP@7000C S ࠓ U00T K@!|f0 0 @B00C Q` T 0 @DTU0`0K 㺈@T 000S/P/E.6. h0-LP 0S H0 D@$0TS00S  0  03/$@F 6.\&<0 R0/R  BR $08& -PL$M@0Ta8 < 40 0P 0S0 R= Z   BpW2$`0 4@0 P@0#4 AAQ-P % RQ H P0  RD 嘽D @P@_oH@0R0   Sp040 80<0S T@<0@(K8& -L M $ ( P 0K     L K0 $0 ( Mx00S ` P101L01S[04 P00S 0#S 6.|E.D. -L⽤6. -LMK7 K -LMP|Nn`@@Ep`0 OKՔ 0-L-@P A'ߚ Ak {{6 QKK0Y@? -x@L`pd@ J A{ [{&k {{6 Qٚ.A?' P0-LPLPU`@40 0SJLP 0@ &7. .D. \00- LRP {8@80 R:0 P0 0E.&;.E. p-L Mt0@@  d0 KpX0P@ K~`P h 0V0~@E.D.E. 0-L@@P0 0-P/L`"Mp"`V,@Kp0d 00  D0 `p0D X0-00JD 5>(K @ 0-pLMo $@KoF0d h0D 㾆`PPDW-00EPD> K@ -LM0P@P K%P pS@0p0nS sS dS<K<K<K@`D@P 8< K -L)  R(00320 P00S Kh -0L000`@pTP 0@T 00S?j0@0`S p00S Kh\6(T0@00@800S ,0 KhE. .@D.E.D.&D.D.D. 0-@PLW3f  0 0 &E. 0- LRP`@ t00S 9J 0PS @00S g 00S 0  .@D.D.D. -LM0p0`S@ 7e000 @jPXl0 /o"_PP j@GPT j$KP D..U+ 0-@LP 000o/ -LM` @pP  0S ^S P P W@U   $K @ 0 00040KPP4000,0@@p p p@0@(0@ 00/0@xD.;.800@-00 0^ʎ1C0@ @xD.;.4040@-0 C1R0AC B@cxD.;.0@- @P 0000CQ0@ xD.;.P00@- @P0800\0@PC00;.xD.<0@-01P`@PUT;. 0AxD.L0@-D0@ P0 BQ@`WV0 0`xD.;. 0p-LM $0 0P@"K 0R`V ,Ki?0P0@"KSR$ @Kp 0"KxD.;. 0P0PSC@/xD. 0:Q Q .Q ?Q0 \QS/0S// -Lp͹D 0P`;Q@10C"@C  /;0000;.곖 -LM$ Kz$K K -LMKqK K 0-L@PP0Ts 00CSK0hI@0 QP0xD. 0-0LdS@ PS bS 0PjS BS bS0 00P lS pSmS tS00000 0`D. p0-LdPd0d@;0PN~,PVzw0X E.6. $& -L4M☆0PS@P `pt0S P Y PP @ *D(K:S9  %S .S D0K0C0KDK4 ?S \S0DKD0K0T C0K(T @@0S ,K!T0 gT0@dSH PSd DSF LSD BS0bS- 1aS# @mS= fS, ):lSpS= nS P4 sS xS P4; PP 4sx4t0S PQP P PTQP =P00 5P00}0Sy ,K!T0 T0@B0CH6Slꤚ , P l , , , , , , , , T , , , Ě , , , , , , , , , , , , , | , \ , , , , , , , , T , , , ؚ Q0R 0 +QP D Kl2n N0P0P2 RP B?շRQP 0G0EP:0P01 111 P  l10  0SR0P0PP T X xX T0000P 00S 0TX 00K ` 0SR0P KRtSA Pj ePHH(0P,o;. E.;.hD. .D."xD.dD.p0C$& l00-@d0L0SOoBpH0H0@0<00A400AA( 0 08E.6.E.$&D.D.D.hD.(0$00A00A0AD.D.D.$&0@-@\^ T0 0^ !R 0\  A T 0!@!T00@f p-L M@QP`@ P&P f0T0 *8`PK@%@ 0T X0XR   QKp .fP  C.D. 0- Lo -L$MK RQ+ P@p@ ` K0@D10`FA V 0S7W P 0 000 0000 0GP(K Fo^Q K  8 3 V8  K P0&C. 0     /C. -0L0`S 4@V PU0 000S`|% P0 QPp x Q`  BRd0Sp`53C.E. E.pE.XE.D.H&C.K 0CBK  @P Oo0S0000(K,4[!S BK A dP,0K04S S S 4 0S 4$0 QP44 48 4 0S B>K 0CC.K8C0\  ? 44 4$  ^Q044 444RP S$R 0C44 44  0F0P0000\P044 44044 `&(D. -`Q`P`LCMVPp (KCEU`3#S csP 0S PEUꨶ p ` h TSFP`Ᏸ ጰ ``ົ0 `O,Y `tP`U"0S000RRRKKdP ,0K@1P S@ 9= Pp K?KQ 2U puP 0000@ 0Q @ 0P @ Q @000 0Q @ 0Q @Q @ ,1[ S 0S 0S P  ?Th0 0 000 KKP Xl (0U t(D.`&+&E.&++N& 00-@L(P0!P P pP `P Q?Pf?00000`&++++" 0-L@P 'P P P,0K0h++, -LMT!0@ SN A0 $@P(KK 1p0`0:0 Km#K0@P #K 0#K0 UTg00S K 0/@00D0 (D00 eP0S 0 SSW@P@P(D.E.$, E.0@-P0PPP^0R @T  @(D.`&0@-P0PPP^0R @T  L@(D.`&0/(D.0/(D.00S /(D. -Ls>P 0 E./ -L MH@ K4p P㹹0[S00KP[KE. -L^0\^1!0  ^ @Q 1!0 [\A[^^ ^\00]Q00 Q]Q 0 \Q\ 1 !0 ]Q [Q`.FQ 5 `p0]X V0\\`[V0 V0 nV@0 \VR 0 0`0\  d`.``.:,k,, 0-P@ 0L RR\P L L D@D@ K0h莖 @@&d`.``., p-L M|0QP`P @`RP L0PD0`0 02$0 R KpW.``.d`.,`. 0-M0LM00P/S $S- +S00- 0 0 9S%\SK A@P0 0 0IS8[@S0 K@00K00@00KS0 0AHd`.``. -, -LM@$$ T(K0rS aS bS @tS {S000`V Fp` 0S0QU02p0W000 墮P00  S0 404 `0 (㉆P\`.E.d`.``.B- -`Le-KeMd? M B0 TTPPoV @?@/0 8f00$?$_0 R?/0  pW>.0  W Q >.0 6 Q񟗼X  d 8   R @     P R @0e-K` B00`S U =0S @S#SPPz ;SP ne=K0C0@e=K0C0 P00$ gP [P < 0Se @,S_ 0S 00@<P  `<0S  00@AV < ,0 1@` PQ @;Q }Q ;+0 ぅP} P @\P T;T+0 pQm PUs P@ ; +0 ,\\\ \0\ APP000H Sp `KP >K. P R @LD:0S00,*,b;p 9)0    R @  R @ P R @f0S p @0S@ QUT 1@ P U8(0 \2p0W 0 ĬPp8p(0 .P0p\PC_oSRPU (8((0 x8$?K 8AP7'0 8'*K, B (RpR   K8@5 p0( 0Ye-K B00S t'   e=K0Ce-K7 B0e=K0C0e-K B00P\ Q&e=K 0C0PEe=K0C00C Se=K0C0e-K B00e=K0Ce=K0C.KP6&0 \QA ZAe=K0C0Sm0S 08S .K 6P00e=K 0C0Ee=K0C ZK,PE0p 09S50;S c S GS 0x%p5 0pZZI) e=K$0C  re=K$0CP  0@^ Q4$0 LLP5 P\Z&Z  PE^ Q4$0 Pe=K0C1 CRZeK A ᛮ0"S YD4$0 3iS: IS7 gSZ+ 3#0 L$pS& wSY3,>K) QQ. S /l3l#0   ))0Sf 00@a909T90C9 ))0S 00@  V2 0S"9p '  8U@S0  K8@Y8 H20S @;S PB0110p\SSP1!0 TJK,@DD P1!0 ꃞK @P pp1 0S 00@0K,A AYp 1!0 op0eK Yp X 0 0 D]@10SQ000 S9Q|0 P0S= @;S }S 808 0 <)09)\`.O.d`.``.`-&p&-m1----2.11l`. a.11E.|....G.y/20!/D///0`0001@&71PS񟗔 @ @ @ @ @ @ @ @ X @ @ @ @ @ , @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ < T  @ @ @ t @ @ @ @ \ 8 ( @ @ D  @ < @,08lQ:00  0p `p岣p:0(00$00S;`;0S (0S[0$  r40STP(0S$PU ` E ᷘP0(0 A E$ 0< 8 0  00$  0  0 0 0 $0xz0 t:R<000s\ 0P0 0S- 0 S0K0`J0S,0`V: $  00@ 9@~0S yKT 0~| KM4P<[S 0<00K K!S0P0s0 :0 0K0 00 ̐ Y0`V:$ `0 00 00C0 RP S0 R:x`0 `Y Rp D展P 0S:p`8I8 B6`00 R:]`Ԁ00 0 .60S `l70S (0S0$ ֕ b P30(00 P(0S0$  崕 @(0S `$  HᏗpP0G$0$ 0  *W0$0@60S (0SV0$ 劕 k%0eQ:00 " 0p `j0 ` R  R  Q 0 50u{$000 P 00$00pW W @5pW,u 0F 0 0 00 H-p4W -KQP 0 0 40 QP9 pX`X0 0 ;0P  ßK p``$L0pK$0 0` 000S 0$  p` P2 000P 00 pd3p0 -K0-K 0X` SR 0 XX0`0 Pd (0S0s "1p0 z0$  0$0P0 $0P 0S 00P(0S0s"0p $ 0$0P 0P 8 R0l?HK p``0pK0`(0S$X X!p `RP0 0$ 0Vw*00000S0K!0  K S0 0@H !   R0 'kP0( 00 T4H``._.`.p`.\`.`.`.t`.4`.Ԋ&&bx`.Քht@2,333d`.3`.`. @&9H`.`. 0$ ($1 0X`<K p``0pK0X0`L0<0 0R0((Q 0{Q  \`.4`. -@`PLT0wS {S sS 0p #0P 0 Hy0P@p 0P Pꜯ -LpL`WM@oVP yP1 R @ P@@姎PW&$KkOXPP0=S! !S0 <S :S/ 0S0S U00 000 0W 0S p>S @S 00 0  xGy0 0 00 00:ĒP 000BSkD`.33 -`0L@0PT P #P# 0S 00C?o2S `0S000S000U0U@`.0/ 0-LMP5/@P  XxAKA/p8xAK+A/ P4/K0蜯3H0  BR R R~3 /ᨾ&X&D0 0CS0S i3 0/ᨾ& 0-4AL㌖0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0K0ha.0-01S \00P\ P0\ S0S Q0S R P0S0S0 00Q R  @/a.0@-  \Ğ\ @ T\    %R    a.@/ -`AL0 5S <0S (04!0<場P a q0U'0 ! R9  (P ㌴0  ,P ヴ0  4PP Kh00\P ᕾP D f04 0`P$S@/ a.X&a.R 0-@L0`  K/T  1t庒h lP`PT 0 P000ST @꨾&X& 4`. 4 p-PL M 尕P]@P0?S0S@P` Kp Kp/P@4mP  0S S T@ 0S00wa4M404 -LJ -1.i4X& 0-0L0@0TQ0 T00 10001S R0S|K0h*Tdl T@0$ XDK0h0T0@  8K0h0a.a.4y4X&@/44444 -L8J 0y.5X& 0-LM@Pᕡ K 0S 0@T 00K0聡0"S p` -L M@(<P Kp ovK5<0A-dps"0QU"RŒU<0x&PEQ @L& p # L @ "L / p # L  "L / p # L  "L / p # L  "L / p # L  "L / p # L  "L / p # L "L / p # L "L /0S00//00// P0P 00-P@!LR@0 U0 ,iU0010|..01//00/00/00/00/00/ 0  /.: 0  /.00/Ԉ00/J00/J00/-00/J00/J 5005/4.00/ 5005/\. 0  /4.Ԉ 0  /4.J 0  /4.J/00/00/00/J00/J00/J00/J00/J00/J00/J00/J00/J00/K00/K00/K00/00/ 00/00/^00/00/K(0 0- L|1㷊|.  0-@PL@|!媊)1S 0 e|. 0-L|. -@`(PL0|At 冊|. -L⏍ -L⇍肏 -L 0-PL܏p@ ] 0 0-PLˏp@ Lވ0 -L MB K@%PcK 4 -Lp B "e ` -L50. 0-LM 0  K  -LA0Y.\. -L \.C $-5L4c \. -L%K  -LA01.4. -L 3.' -L2. $-5L4c 4. < -L . < -L 4. < -Lw. -Lm.  -Loc<.  -LcY踴.  -LcO膴.  -LcEh. -L;. -L1Z. -L '.  -LA0շ.ش. -L . -L 4. -Lֶ.  0a- Lش. 0-@0L@0h. 0-@0L@T0h. -LM K– Kn6 K9K -LM KⳖ Km6 K9K -LM K⤖ Kd5 K9K -L0a Kh59K -LM K∖ Kf5 K9K 0-@L@00 0-@L@00 0-@L@00 0-@L@/10 0-L@10 0-L@F10 0-L@00 0-L@0 0-L@B0 0-L@90 0-L@50 0-0L,!*Q|. $0-0L,!@1Q|. 0-0L,!Q|. 0-0L,!Q|. -L2 -L2 -L2 -L2Z -LJ>K -LBԈ -L:LK -L  0-L 夋贴. -L2 -LqR -L -Lz -L4 -P@p1S0Ű!21( L "S` &010 $1Ux  U0a wRb cV80S  3/1S$Kk܍L0嚉( S0cp ,L\K -LMQ@0000 ePP%PPP` p0 40 P 40 H  9X` 0S0p1 `_0 1@ QHpS100C1ġA10P:1P;0C40 40pP00Q0S1 10 Qp(00 0@1S1S 0 ! >e `F(KoFQ010C?1 000 00S 0 0 00aK 0-(@L*P 孆0|. -hPL`)1S P4@ |A嗆0 W )|.J -L@` P  0Khb{K 0-L@Q9   $ d p |   54c K0h  A媘P t03S lh d d` `\00S  0^8 0\.\.CY.w.v... 0-L@Q6( L X d p      54c K0h   AxWP X03S ` TP L L D04 04.2.3.'1.O.N.%K 0-L@Q:T x         0$b K0h:    A P \03S  \X T TP PL00S  0ش.ֶ.4..շ.....Q Q Q$ /  .4..Q     < <4 40 (  /Ḵ.<..4..Q Q Q/   ꆴ.4..Q D D<0 0 0,00S  /h....Q! ,! 8! D! , $   /Z..4.. -L Kh6@ -HLD@04S  ]z Yzv.\.6@ -HLD@04S  Az =zN.4.6@ -HLD@04S  %z !z.ش.6@ D-@LP ,b0  Y.w. D-@LޖP ,bl0  1.O. D-@LŖP ,bS0  շ..00//00/00////00//00/00///00////00/00/00/00/00/00/00//00/00/00/ 0-@0L@0h. 0-@0L@0h.K 0S00/ -L . -L/0. -L . -L 4. -L 4. -L . -L 4. -L w. -L l. -L5/0. -XPL`)qW @0@ |Ad0 $|.J -``LP)qW H0@ |AH0 |.J -@LPP 0S `70P /`1S0P $0P 0p Rv m/` 0-@LP0Ya P 发 >0 080000A-`A\%X<0p " R\<0h%@DA & -L Kh 0- @LK0hQ 0- @LK0hR -LB$X&K -@L`V`-`P`) w'ydP  ^g_tPh`@ AP` 0<("!0%S00b./& -L4M@0 0P40 T; R0AT 4011!0 S01  R401=yP .,0S  R03/00S 03/0S!P 00PP <0 |0P80 <0 Rc`p:`80 ! 011S0`@R ` @0 < ̅@0Pp< ђ< P``P@0pU< PeUP<0S009 0CL R RڰDPCPE_ C B R@ R0 vy8H 1  p00P( %& 8` p0C0CS0V`0Z `1Z80ZPy80 0800 0&#0 "P P aV`x CȀ  S CU(8P PEPE_P0 ŏP y80 0 P@0C_)P e卂1 0 ए 3 Q x7Ϗ0`/@ B0R0 1 d3 3 p3 1 !0 RPfr<P P P P PRP0!R0c !ġ1S 0C" !8C8R11$PUfp0 7P Ŕ d5̅<|1P` 0YppSpW` 1_ t50  噦!@u)r P0ՀxP) dP <P >P0S  400CPY$` SCxwH1S` !0C B/!?1P0EQP0 E/R 0U0@08!C8xP00S118zP`PxP@a@1S-020( (P"JP P- 3000+PᩜP PL3P ?P 0CP >PP 3P 0PqvP P1Q\^ P 咎1Sʰ1 M^ P 僎P j@00`B0R0 w 0SpW 0 03/p P ``^ P U  `ג~00H10As0M40 R P )@00`40040 14 R40S 03/P~ PP ~ P(KqP uP HAPʬ0P0CU \000CPEqP z ᎒ ~T0]1X0P 0P N0CPb.KKX&1LaL//L&&R 001/b.P0 R0//b. -%@L M$pa00 PU!4 >0P4 @(K40 40P0 P0QP#<=>P 00W0000 0 000岁<10, 00080040 0$0 0p(p1  @b.L P0-L0D0 R00A1 0P ~< K0h˓b. -L M⌒p0 V"W0 喀 p   30(KP0 R  R P q   1@@@``Q @ R R R ƆP q R q      P R R P q q   T @ FR R@@ 4 咆4 R卆*CP `q $ V! B R@2  @DJqTb.VUUU& @ -L,M@ oSQ0@ <0 p<@T`[ 60Y0 0S @0v 1܎@-8 ,0 100P@0@40 0pD0 @00H0 2 0DSpDU404pE40\U00ӧ?0pU0 CR pC4 0ER 0800 W 20 8008 2 B埣'2/o P~ P7 + P[ P" PJ 0JSnt2000 h 0D0 0 EDH0 wH0P@D0 (Z WT@P0D0 AP4 P1P1 0P1 X 0p00@0p00@X E@DvPE D0ST!D EvPE@u9HT@D0 Y @ P kP@U@°H0S 00@  B08p0000<0S U@0 0 <0B(Ko=<0Y S b.}&M#X& -t@`PLp `3P.P0U :`PP P a=`0000b. -LMP@p 0pTp ^P@@K0 00މ 0 0`` @7l\Pu 0@P & 갞&b.M p0-PL@\`0PPs Hp R : P 0S@@A@R&b. 0-@LZ00000b.0Ăb.0Ԃb. --@LM00 > |K --L M00 > l K --LM  ` K 0-@LK0hꜯ -L Khꜯ -pP@`LM0 0 v> 0`0 0K -LM K -LM(< p8 `0@+Wp0<00 K>00 j0pS_ 0S\ 00SX崌Ppp00pTpP80s@DO@080 V\<!` PRXJШȀ0 S80J0 0\@PH800 0W`0<00 9>00 000 0eT YY   zᛎzz(KP 00R0S 0S O0PPP#P3P`V`MᗉP 0 뜠1`_|| Yṗ80 G00F0>`p`_pl|m|b.M/ -LM,  K p-P@`LM0 0 r= 0`0 0Kp -LM K -pP@`LMv0 0 P= 0`0 0K -LM K --L M00 3n=  K 0-@LP0b. -L 0-LMK9@Y'yAa$+_rPU Kr% *I00h@PU Kb%T I00000S$$K0 .`.8b.X&( -LCMP@0P01 K_KzCa 0-@LM (K$1@,@ #P @  P |A0$*!P R)Q%K000KR00S 3/P 0$003/0(K$1)(Km(Km@P2(KP.pP*lPP&(K_@P" 0@T Ɲ0VL,K n,0S 0] X&P (K1@P ̾ʾ'(K)괴.|.// -@LM (K⢌0,@ @|>rm#P) @d  OP00*!R00K$Q (K((Kp@P ,K !,0S 0^ x&P'(K(K贴.|. -pLM 0 0Z#V*0S p 0B0 0 SS@@@9P @ 0 S0 0p0@(0 S:eP @` 0P00 Q %Si0S dSN %S%Q0@ 0S0 aRe cR0 K3/P (KiS sS 200 P 0 倐ಐ@Y, K @`  R R 10 R @ 0QR K80T K`\P0S  S 00@@Q|0 @$`R`R`V0R@ KЀTh ,0K0S  0! S 0@S$SS0`@V:Q 0 繃& 0-LM@K PU KL! w |pE00K0llP \e K4!L _ {ꘋj8( 0$Y`.˸ -@QLPT<0<0`000S   0KhR`. .Ք p-L M8A`PyT9qɒ 0xJ|xwa|t %x?|PRV|wR뭒4~0 A婃PPxx  R뿗P ZZww ǛOKp/kX&׸ -LMpPVK" `~2 0KV?KK;p6 0(KaKVK腟E 0S  P R  0S  tpP {`P { mp@T Pa,* $-m aKVKx1B?a/Kx1 BjEP  VD@P  MD00均Pp嘇P: P  L: :0S :4P : =00ԑ3 0fz3 zK2,K"!0311`01   0K HrKzK?K0/K rK  1 wP,0SVP,0K"!!03 KKl PM V XU $ jK⨂h2P jK=jK _0S$P0 K.T2 <"QS \Z1P 6z 1 n@Z0[PU щ6 P,0K0XCKKx1K_K,1[SJ_KPE @ aKKK 00R0SQ y0S+ 02 {P2v彐q00PT 0zd.&ptbtf@ .`.c% <RI4.7I.nSZ A 0-LM@KPU K yC00K0PP K| oyd00S .6L 0HY%50 ,X .S\.X& 00-L(M 0000@00 000 0@0@@0 TyPP DDT@0Q ,NFK0hd\ &X&ܹ . -- LM0@ IK1 !XoKIKP 00$KIKLQ`P UZIKH`PZ 1Pp@@@ @U -p00XbBgI --PL8M 8K@ Q ~.pK,Hf尞0堦S ᳁V:, K4e0 w=C$ C< 1 f0 0(@>-K0 B0`0Q P K0' @P K @\`P `P 7' P\8K0'A\85jK P,`Fd h|hM/ rP0K0,'AP h{h:/ trP00`6K0&S\8A0\8P h{h!/0S K&AP h{h/ erP000S\8X0\8_,P0S\80\8`rzd0K,Id7 \e0 |iHὀP ḀP ᳀P ᮀP ᩀP xᤀP hៀP0:4:4SN xd 0 8PF K0 % APڠ.`$ 4SP  0@?S @P I{ 0y)Q0:$R# QßP W\ß T#0?B0C   BD3 R3 vpP 2@T Cz? K@_ K@#00S "x0S "`Hs<3S< Ug (#(S?00N?C0C G`0 0F0PP`m ePD=K 0Cm]KPEp=KjK-K,0C,`F 0C B<`0=K0C ZP$0Wr0S R~AX0X6W5S !4oXrXf0SPK,A0 $A X4|!S< "0 |0 hUI C. -`L@n0P0S 0KhEՔ -LM0`Q!p0 KL03/P< 0t@T 4/@K0p0 z K0z 0K 0S Kh0 KhT `Kyh KuhKz0SC0K, K EK谴.SP P00 S n{S, R ,0S R : 8 80R:P#3/// -LM`p@,K ޷,P  PP ,m)P'={P,TP0, xP@$U@@,U)T (@K H20 @PKdr 00-SL@P0 0000K0h -L|MPp` Z'0Px0 ))x)(K@ 0S0 !X T 0S0\ KL03/P L0`@'Px0t p0  Y@00 0X1 00 0<000@@@@0$p` x0hKh0 d@ `@ Xd0S 'P 0d  !`00 0S0 !Z T 0S0\ KL0 3/P L0 p0, @0p0 t0 0t0 @ꠏ \ -LW P x0P 0@?oQ20S QPPVPQD !P 8040P/(/$//8  8 0-@@Q0DPL@AP0 OP0P& 0-PL@P  t f0000S -Lj \& -La h& -`LzMP@PN/|| t0  0S1 0S@$KmoKP+ a<,P@1 11$11(11,1 1S, `KP& d0K0`0K# @0@N?@@T0@}|0S y|0SAT KwP |DKyP `@\` | OK|0`<1K?}K @a 4 0 ,1 Pn (1[Sk0)#0C?o27 #2RR  0" R6p7 'S$KA0'S $`K`pF'Q``V0$`K0A(\`K C Q 0R$0K 00B,104!,00 001aK 0 0n=`p0!Q ,104!,00 001`K0 0V=`0l!: UJ` {}K R K{01K0aK0K1 0 00 00K Kp ` 0KP 0[SvoKN/KaK0!.K0A.K{K0,104!, 0 T0K0 0=0<  ~k.QNEFXP'Q` -@ML`p@@ 0K idpK 4$PP @@ 0K `Ydp&H<@P 7/P&xH9 0-LM  K0KP[ K耖 0-LM KK0 P K, -LaMPb-K4M BQ@0C(lP> 0b-K 0'x`P3 "xP3 Y KV4@TY K+4@dI K4@I K+4@d`vP@``V9aVY K+4@d+I K4@d,P )0 Q'4PUNS0$P 00S 3/p0p$QKI K4@~b=K0CImK4`Fb=K0C0 S (K\QQ00H3wP !> ,! 8PP 00S 3/pp003/NoQU $P 00S 3/pp $QU ` 0 `` I-Kx4 B;9/ 0 ``Y-Kx`4 B;6/b=K0C0 #b=K0S R< a K4@b=Ka K 4@:d] K 4@,ra=K,0C 0Cb-K0] K 4@ś`Pq匁U%IKa K 4A4@s+PG  `yP?jY K+4@dI K 4@+*b=KY K4@PVwP% wP  wP wP wP vP Va K\ 4@ca K 4@c`b=K ,iP'P9|.b.)SŸx00 -LM@$q@P0 `APKP @> C 01/PP  @T003/003/$Qk -LNM4MJKWN K.p,@D@t/yI KQ4@9d7`_܀TP0N-K( B0N-KIK, B(W4J0N=K,0C0S60S2:K,0CtCN?I-K4 B$"@6 0}10  A 2q "-q )qp, $(> ,0483 @ @7$q1W(1)qs(1N-K0 B00, $81> ,04 N$1%Sp4 0!0 NR0,W*,1#MK,A(pA p\: 0M K$1,@0 @0 4;$L:5P p>؀C p$100$10M=K,0C 0C0M=K,0C(0C  090pK,Hp3M=K,0C0Clsp3SX-P $003/$q|0'V00S `TWm/0X##    N3IKL34L0B,NKA⼓0\>P S?X3?D0x3 L30 00  NK00000A0p  M=K,0C4C W t3S0Ct3mk`B "2p2@(K0A N? t3RV0`0 V  ӣ? @P2pW0W0S }1S 0}1$1S!> ,! n6$N=K,0C0N-K0, B0N uN=K(0CPpq00 0 N=K00Cp S$1M=K,0C, CPlPB ?<@S> 0$10! A04!8<00S @a0N-K( B RQ   N-K( B 0!!N-K( B 1br b/[w0 ,10141810 @0(1괴./&|.0.. .] p&. 0- MLM9 0\%9 0p*@Q`5)QU5 BK0(% @BK  @*P Y P` B.K B*'0K0$ @K$ A`(`P 4.KZ B;(Kl4p a0S`p0  @0 4`000V0SU, RR 000>K 0C0x.K; B89/P< 㑮K0 J  x0.K B;8K 0Ch` !VjP00P0)42YP0 U @&K A'`P 0Gd0S K!@\0S K!@KKA@`0S K!@KKA@tX0 KS @>K0C  H @L0@0S#"P 0S -p 04(04 0000xB.K; B8:/ P #%P !CK$pP 0  l `d$b$0 0n`0ap84SZW#Vp`X9jb h9 m۶p99'.S|. 0-LM `2p \ K(,^0P @40 PP@xp0 ;87/P  PBk.m. ,00-L@"Q P0K0hk. 0-(@L2S0 020k. -L M0 PP@BNa`P@   {PP@0ne#pP@㰠U(K;EC  40 |8P40 Cu8P R000 $RR00S@ Ip@B>EP&b 0-@LM0$K5P Q P 0 \K, -`JMLM pqI=K$0CC q2JKP$@DU\bkI K,@Pp`PX N? I=K,0CW  #oP I=K,0C0.,1 0 f0P T2X"T PT2X"TN_UT2S0 0T"XpPZ J-K BJ=K01P 0101P00 0A00000P PPJJ=K0C"P0S6 0S&X$KQUPX 0 RUT2$!QQP0P 0 003/PT2X"S0 S(0S 0SXd(0S003/PT2X"SP.H & 0-SLP@` !a(0SQ 003/@QKh R 0 -L0MP`p@0SK0L K0L03/P $K`p@180/ -LM@`p0P @@p`.Kx B;9/P$K0 @@B.Kx@ B;4/P B>K.K0C Bco[ 0@o/b 0 11/q.10/m 0-@8P0 `Lh11110q. -L MP@p`АР0 (R!  !00  P kp00)S0 0  )S P0*SR0B `p@P X 00,0` 00000(Kq.X 0-P@ML -K6p1/KK00 0d0@00 0T0@@@81 0 0K0@0PK1K0 q. -PL4Mp@` 0Sp3P `Ppp R00V0#S (K0L0\ K3/PP`0\ KL03/P, %K  DQ 0S   h0 0P  P %K $L04@H0H08p0`S,00T00@0T0<0X080\040`000d0p -L0 `)R  <@Q@*QRpB   !DAHAP0 \Kh6)Q     TLA^ @@q.a4 p-ML M`'cP  VoKpP@  BKD~PPAK+ @glPPAK+\ @YPAK+ @YPAK @*Pt(='@- D@0*SP@ )S 0   q.   -`LMM@K c00@K @p W K@pp! 08: >K 0C CP8:SPKW#K^P A gP 0 a0CS0S(Kp'KH @P{U8U2 RPQ RlK✠ a0@L: c K@Fpp %)=K0C>K 0C0P: s Y )=K0CK A +p0H: >H:SL: $6 >K0C00t00 00S 0 P 40PH: )=K0C )K+0A ,([R>KK0C A ( 0 R*,0K 09BUa0 ("d@edA?P 0-@LP[P K0h0 -LMh2 P!RT"BPT!R4"TP!R TAT(K BX!X!R`i!P U T!PAXP!  X!V% !0B 0 0B0 ሄP 0S .R  fK$p Xq@W"POP Gu 0PX  0uX"PmT8P !T@m@ * Rd P!rl XATq P!@XA RP!0r,  Wq.(& r. p ' -LMpPAK L1\10 <  "R \!0 S 051DH<LHQ@2iD` .iV P1<`1 (iV P1L`1 "iV`1 P1iVP1PH0H 8$Kk(0(0\1\10 0q.|9999 -LM@K P @oK -LM| 0S pP \0 T0T 0PP0L0< 080<( Kh K膴.8.4.o..T. 0-0L M(0 P0K000$ K(0K V"K@P$ %K09 X0-LU@4PQ]$N)K0h%k  --LM @K f R (A0@. K 0-LMK0!P L0L L@ D 0@8 @0  K. .o.T. -LM#=K M0CC\^P8  #=K0C@0iP ioK'Uj -LMM#KA]P K' 00-LMK0!0S@K0h0h h@P T0TP P0P0H H0D@0P0( (0,긴.<.8..4.@..T. 0-LM K0!P <0< 0404|00 00 u K4.B...T.0$ 0S/ /r.0$ 0 S/ /r.000 S$0 10 1/   r.q. 1-1L40@ Q !0 " !q.0 10 1/q. -LMM -Kqk/KK0l0d 0 6 0 P 0008!K  0 "@KoK,& q.H H0 (Q0/QQ Q 0q.,& 0-$@L0S00008.I 0-LMhd@ EK\c EKP@P@00 0`1,\/YK0\q..ko -PL M@ X 0P  Q K`. --L M  K --L M0PP0 /@P P<  $KSxb --L M0PP0 @P 0<  $KSb x <-L(P "P   0-L@ufP@ 0o00W <0-L@gP 0 P0 0ܕ.4.\. <0-L@gP 0 P0 0ܕT..`. Q-ppP`1`#WLP@ wP (B(Ax99zVwVPPqKhq/\. 0-LM@LP @aj3 0 K0/X& 0-LMEOKDGKPGK 5b XP0000U ($$0`2@K0.q.Qa -LML{HA be(1P\0`!k >JZ<vB0 00P00P0H0 0 00 00 0 00o`Pp4bE042]Z`2d GK:X4 KaKKGKYKVq..L k (&\ -LMPP !0@b`rfP `P `bPh 1 PI01M@04P@T OpKq./(& -L< KhA 0-LMK 0  K 0-LMK 0  K -LM0@0( (0K 0 00 0$ K0 K 0-P@@L0(S0Q WfP0@,& -L 0P.. -L M@,Kp`P쐟,0K (Kr(P'0 rPPP0P300 @,0K d]PP+0[PpySa0+0K,0[00+0K,0K$KL.h.8.. -L,M@8 zd$PjW`VPm $^Wp`V50S` []dppGWY l1l!llp ,K !0 K0 !  Y080V A/oQ" S  R :d4 0BPEP`B$&W`0,K0!00K0!0 0  200V A/oQ" 8S # 2R `F <0 a<0`Ad4@p$ V`(K9  -Lp`2PP@T j a@P 7/|$Kkx11@ -L M$VAP`pP$K0$K0!(0K0 @` ( V0B?oR20XP$ V --L M0 0 KD --L M0 0 KD |0-d#LR dd#%\0X!T0PL0HD0@<0840q.?.G.Q.P.^.). P0-L@ D 0K0hn\. -@LM KA A Yg0 1 0K!#! @@u/K{KPmK<I@P1: S uKr_P x_ t_KG_K,.g yK*gA A `PڬqQ  V``?  |1|!||nxyK1Sg P1 0yK1 ATT OoBSP@00S lo t`  R 0 00000 00jpP@ k}Kf1C!4.K..T.u.[9   .8.u. -LEMR0@S0 ` Hp4 0p!KK6O0pS.KKP1 V! 000701S 0SX"X2 0K/K@Y+ V ! 00 0K/K3/P (KV 000 @K/K R h R K/KX L V     ..3.l.q. 0-LMPQ@0 S S 80 000XK0+S  ' -LWM$p p! 4Q 唱 e#ß0(SgP3S0̃`1 @(Tj3  Q0PtgWxS@ A@ hjPX|P D_<\4Y@1 WW_KDP>KP,KQP P 7KWppW T*pi^ 0 10S 0S3 0 1S/a0h1 0l1 `1SO 2|\Kl 00 _0!K 0t1 `!t1R R@ 10 1000PXR 0*S R@B  0 P )S  (SPR (K@ 1Ph!d0`  l!PE  0000000 v$`..@&q.,&W'EW// . -Pl`lpL@TUNU P  ^P`h& -PLMMJK,@DpXPPFL D⒞P P6P ! 9P(K, DxP$ DpPX2P2 `P N2PZPhq \ዝI`AK  \PA=K00=SP  W ۤPLJU  P PP- PP#  PP HPxx&r;#% 00-4 LP@c0 PK0h -LHM0@ RK`p0eKSeKP 0S0L KL03/P <0$K%K$K%KPT K\K3/P %KR0 0 %K1/ 0-@L PcP  K0h 0-@L .(,K0h( -P@L0S 0 R!$Kkp` 0P 0hp00W20#00SR Q0p 0h Php`  P 4pW000S 3/ Q0p 04 P4 -L M0pP KT@R`p $.ῼp % (0K `V(.0 t@( T  `=[L(P <P @@ZaZpZZZ}DZZ -@LMMpA.K`@; B(pP  p%c`!c`K -@LP bpP` P  0RG P;|d zd@ -@LMMA.Kp@; B`v(pP 0 @S`KVb`K edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/ 0-@Lp PH:[000/00/ 0-@L8#8S#0Q400080,08 S0040803/P,000403/,, H0 , 4 T 8 X !Q  0\ SR:00400SS QU Q408  0940S80S001/S S S S0/000 ,00-S1SL@S00 800400803/P,000403/,, H0 , 4 T 8 X 00CS$ 1 0408 0809 -L M14pP37W00@`㬡嬁00 Q 1SQ " Y(K  0SQ'W 88SSSQ R S,0S p 0 #00 0000S `S00S H P00P0 S 0 F`03/PP0 LRR00<R0S 01B   p* d@ G 000/ -L000l0000X0 01`0100$KkE! B/"B ">10C' o -LOMP@` GK(*Z1$A 81 !c 1 02p0 81S(K 81 ST08!0C00 0Z0 R 0C$ 0<1 <7P5 şZ@P `şT0@0C0p0NC21 81 S 0$ 0R}ؤ81 S 00H03/0   MK0 3/P`KKCK A AK  0 0 803/0 P`p KvRdKCK 0 03`0300 07000```D00@P; p`쐟쀟`Vp00`l00 00 000 0 00 0 0KB`P 8 R$Kp: , l -LCM@P 00CU#*0L0 K3/PP /K oKC?K0ܠ1 0X*0 KL03/Pj /Kg dKAKE?K R0A?KC?K P000 S V0E/K00V 00SA Q0@ RpCK `0R@0  1 1`0 PKPAK 0RpEK0 `R@H P@`|Kw|0K K (K갴.X. -LK 0C ! 0!0< R 0  0 3/ 0@` S$ 0' 4' K @=K0CX4 a@04 4'004 04cd ,KY=K,@K 0C4$4P4 P704   P`U Q vPX@ RvK.K Bl@SoK.K BeUTp% B>K 0C0@0 MKߍusqod6@ pv$ O.K BP , K-B D % 5 5OK A 0OJK  @nT 0S  MK4 @⯍0 0=K0C050F0 4S 5KJKA @QPD 4[S[$`Q00Q0S 0ENK @DL0 aA 3/P @M>K 0CKK LL 1/KK A؀AYX` $?P4F##$0 0 O0F1"M>K 0C@404 N>KMK 0C A P0N>K 0CM>K 0C  P0R 05%MK0@@K 0C4 =K0C4 2K.K0 B4 D O@KBK+A @$=BK+ @=p` W`*U 0 (MK⻌T B>K 0C0 0MK⯌0 MK⩌44 4$Q030#Q0S 4A4 MK A  K@0p K>K 0CCMKN>K 0C A 0 0@P3/K K0@ A@M>K 0C0P0T@MK A R0&N>K 0CM>K 0C R0MKN>K 0C A MKO>K 0C A M>K 0C(K 0MK A 갴.AFKX.Q+dh\KaT -@!Lb0 !P 0 0 X0" -LMaA|-KK1/ MK@TP 0-K5`V-K R0-K@ 0M @P0M @TP KQP  0M K KP0 0 ˱.KR 0K.K/K.K tK$ 0` S 0$j0$Ks0K0 t0K0 4M00 4 K+ @`T N+ K"@O% KTPK 0 DK⛋1@.,4 00 0K   K@ ! 0 /K #4T. 0S+ 0 Kv0 01@K0F0@ Y0P NP(KK8KM0 KP00 0S 0[S[ `Q00Q0S 0\ KL0aA 3/Pc %KR 0P K+K-K.KVKƑp= 0+K-KR0-K.K-KL0 03/KKUT`N@-K@P1`.K R 0R0.K 0T0NK K P0 P`pT@P.KR0J80 0@P3/ 0@KK K1+KQP-KR0 I@B K.KR0 Ԁ?AK 0 2"0  0 rL #F  ?gL1F1"P3 T0 0  T0 1갴.+AFX.adh -LDM0@L K0L03/PLK" ! $KPP0`p 00!R R0`pbKШ p-@LMM MA.K`@; B/PPNK @LPNK  @HN.K B l@oKp{dЀ 0-@PL HMP <MP ,Mo00'rk 0-L8MD0 0@PK,0%@0 p`@@0< KDKK9PK<KbMPVJ0@0 0H0 0 K00"0DK19PL@o -ML M\1X PQ LQ0`P *1SH$A T )1S  K Q 0 1/P@PE>K0CC 0S%0E.KL0 B3/P @4pW<lP  0 p B.Kxp B;7/P BKX@rP|.x. -L 0P. -LM0 /PR KP/R0 R/R  0o. 0-@LK0h 0-@L K0ht -LMpPPOP@P  ?`0S  6?U $ ? ㎽$ KT PLP  01UOPK .`. <X& 0-L@ 0K0h 0-L@P0K0h -LM@ KG~ EKGE?K/K K 0-LMP@k KGe EKFKpTPE?K/K]K0 0-@LJK0h? -L MpPJ`@P P  yG0! 47PP  K0$D x. 0-D@L4S0PU0$ PP0T0x. -pxPLDT`` KPp@0 0`P$0R04x. -\@L4pS`Kh4`P 4 0fF bF Tx. -@L4S0tp4TU TU T`040 0 4x. 0-L@P0 K0hSꜯ 0-L@P@ o0   -Lo -Lo -Lo 0/x. 0-@ML 0K@@t6P0K @@L6Hj?P08@4c?P 00K0h;&.3 -L Kh -LMA0J?PU;`$qW 0 P K p`> C  01/P $P0Ό LP0L0$0 R 0S P P 0$003/0$Q|.$ 0-LpQ4͵"T R0/ p-L M(@T@Kp(}0`y0 0A003/@Pл㝵/ -LtM`P@@) 1L0CPA0!K,Pe(P PK?000P5Q Z-Q 0 0 & F 0  000 EK b@;᯵긡.&.3.4...I? .+-//h^ >] -LM`$@P qQ-@T  wP( 0 (KSP (0 9(@ {APo KX\\ TBp04 (K . +]h//C-M C` 0`pa^Ѝ@T@T, R* @p`@PЀV ЁXЀT ЁX@@UT@P@` @T@D @B`p@PB 00!/. -L ipV   R@C. -L M`X0@Spg0 QN\0S0 h `0S|0l i d0Sh0T j h0ST0< k  S &0 K<P -LDM\K&K`PP(K@P >TX0th0 &5#P0\ 0B`P(h1!0P0 0ALP H0`d0h0|0\ 0X &K! `$P`PX0 (04H~000 0䀄0 00;< -LCKBM M A 7@P 0pn B.Kp; B pP}0 tPu(K P 0 0KA gC>K 0C !=K0C "! 0X00p; S{ PiPe +RQ0 RP \Q SP00S RD S ? S S( R0000000 0C>K0B>K 0C0C00P 0S  v?:, < =4$<Q0 ! "CK L R0 0C>K 0C R0"piedA 0-L0MP@0S>C"R0K0 0R* 0! 0!$K \P 0+R0#*S Q 0S. 00- LRP@o0 C!U00!S @0<00R0( U40 0... 0-LP@P0000 -LM1P0pS`7@ 0QSPPT SM r#K0TȐ0 #K  ^0 0"400(Q $}A,0QX3  T vQ <0  0S P S h0h d7L0KSY 0 0S3(K 0WP!:@ .=P -pL0PS`p@;S S@* +@" Q pBPT.@T&RQ0000!(Q $ AQ 0S T vc< 0@1 00 0TRT Y 僲p0\"1.y -L\MP $K %K0 `0 0`T0 0Pd0 0!$K! 0<K @PP0S (K#K$K 0$KX0V V >`C V0 0 }?1,&K0R`pK#K P0#KK%KR0K%K$KcK$KV0eK$K%K 0KdK`pReK`RpdKᠡ0S + RtRI*`0 PA\Z7Z/QP\0 0D0`0W(Q $A@T0S& Q# J v; d0 Ơ 1 $KP0dK`PpbdZQZ P0SY 4寱P0TL"M.y 0-@TL0PS T P# ,0! D0R 050#5403$0(020... <00-0LS@lDP0ЕK0h.; -L M@ p0PSU T P#0 P `SW 04T(0(K0hP 4p0 p P00  0B0\  @ h pH/ `0@8 ^0'p(0,0`(0...qk P1-0LSPp@` 0QPP: S30 B r0 0 !Rv?000 RV ^( $0X3,0000 QP0 00 0WP!:` .O -L M@ Kⴍ00S T 寰K8r -ML M0@X4 X0S2"I\0S2" `0S2"b d0S2" h0S2" EKJH F:T4[S 808`S X4lŸ C0XBQSS80S @K0 K SRPPIP BK @☹BK @t`P2 B.K B \0d 0`0 00h X p;S"|X4h!0B>K 0C\WPBK @_oR(K0:R 00  `4 \$ \$a  `4  00C  ;0CSxx|Pp=P&^{sb" -LM#K0p@T(KP`ȐȠ@D0S UK0 0  01/X S  `  R 0 0`0Q#K 0P1/P R.< -LPp@`0SP8p0 S7/P 0403/0S0D03/0S0403/ -L(@P`p1S 3/P @`VTt0@d0P0SP000S@000S00000$Kk%=..<AI -@<`ЀX000 dK40 :l00403/ 0P l<!0` R 0  0|K3/P: 'K&K'K%K0 000000 060 0 00ウp`>lKUɦ6,0[S l K0dK03/pRll0 0S001$K &|..x Ї -L M0@80 q  K003/P-0A0@0K -LGM@P, 0@0003/`P$0I_KS$aK 2p0 pPP00$1[S 0JK0@03/P(`` K -L|M@pD hK1:0@00 0$``l@ 4 WPP3 P p 30h$ 0 S *PP 0X*0d KL03/1 010100 060 0 00㾥p@z&\0lK⎢o,0[S l4 0Q*0d K@p0K4/Pp+[P l2l0 0S001 K &ܗ &x Ї -LlM@00t 3/0H03/2`0p>ЀX0Zt 0! 0 ` 0lK3/P^ HK9&K%K&K%K 0L0 0 40R! L 3/0H \K0 3/pB 0\ KL03/PP; 0 R8  %K1/1H&KP%K0< 80@3/H 0 0\K3/p P00p0 t0U 0㕮.\K 0!%K` lK p03/P P(KP|. -LM5P0S J?0S_U 0Sp5p%pp@`VR `%@T! xKg?D@ 085005@0(5@ 0F00000x 0q0ὤp`px[0 W T Q` 㤔pK $0㜀K`!0`00 00 000e0 p$坧0$10&0 $10 0Kx0 0t0 0| @ lKp0 800S< l0K PÁ ,|3 000000 000 0 0lK0@Cp` 3,3xK,0ኤp0S= S@: SN@`$ KK3/P 0l0 06K2 `0 \0K0l KL03/P &K0 \0X0S 00CS@` 0ST D @P02Q $׃(K@P00S^ 3/@@OoBS :0&00%01,K0@!R!@!0d0 `0 @P) h 塠h0S`0X*@P* PQ 0!@d  0T:d0S@ Yh@OoB@`0dT:M@@|.>.L. R08k8 H .X s( ,  .> -L[Md! S8! $ TT @``! 0P@1  pP@`(K0PP1 z@Pa4D!0T1S 0RO d1SE(1SY!SK 0W ,1H4WKXL!!X SK P0G   X#H1L L!M_K4;$嬥 婥 0PKKKK PU @!@1R"2 P1@ 0S 3/PD10D1 h1D!0STP0$0c81 v h2Rt hQ @D X`N h[e,H!L0# M_K`,a (Q QK/KH` 2P 2L 2L10 00D1 Pᴴ 2   L! 婴 2L!⠴?2D1P1:1![>P0 000000 0000 0@bp NK981S`#P!5Aa7ZUX  @ P y ᖢ@aj..nHh mS> -P/0LKMMKKp@ I0ITK`P+.P 0S p0|"!l/WP TP  I+o. P:y6?00@T* P/R 00Pi6@jPI!0P.$* R"XX6>00B~K pG!4 P,0K44@,4[/Spp0 +,. RtP]K PEBK+ @. P*P 0/SP,4[_oPRS 1pBK @10%00 PU+x  P*BK+ A P*nP5@i5@Xd(K  o' -LMK@P  5@P K( P B@0#((R (c(#"c 8 #8SK  -LM8 `GpPP X`P㰐LP<(K0S @ x-P08  0K=opLӫ0P XP@00  0o|f -LM$ `PKAP'KAPK+@Q-KK A@@PP.K0 BᱬP.K B Kx@KK A@PPKL@pK+@&-K,@g.K0 B㌬K@]K+@-K@T.K0 ByK@J q@PK@@ g@PXK+@,KP@/.K0 B T@PxEK+@,K@ K@"`K@ 9@P]*K+@,K@pᤁ夑1BK0>K0C @BK@P B.K0 B(@ TU <$KKK A@VPP9K@K+@,KK A@Q@P K@.K0 BtPK+@p,.K B۫P gf>K0Cd hӫP1 u~vT  &oy/00/00/00/ p-L4MA?(0X) 0/@`K` T0T0H` D0 065KH KB@P ,[ Kp谴.+X.d. -LM1@1c20 00 p!00  000h 80sQ0`P0  )K0壯 KpU K55 0O/x%t500h%\K500 0UH5 "85l`K00 0\0K00`0 /モU xK 4Kx0ZX @Q%ZRQdPRP,KPP! |0S K0803/PP (K0800Sp09&80s $(K 0X:8P0\ KL0 3/P %KKQP TP\E_oRo)K0Ut3v0x0 P0%Jo0㪢0K0H03/U KԇKYX  0#)K R0)K .0<,!(K000 000000[S 0 0  R0 0pP^00000(K0)K(K(KP000 0SK00 a0  R0 0!Z p0 Y1K0t0 1pP 0,!<1tK(0K\K/P9 R 000 0S) </P$D0R'0Rp080s SR  R0 ! 0!p0 b"0000K(KR0M(Kp` t0 /P00 0  #&000p K"?.}X.&|.' -LMQPz0Swp@@0 0K0 P K ` K" -"K0 `T0 S!V0`vp`p"&|K``,0SPcT`K0D"(` !"Y`$"&|K0K01 0-!00( XTڴTpK0!(pp `0@00+0@080s=0 0 x | KV ;X(KpW pP``p  0!T`K(@ 0 h0oT`K 0 40 0t0S 8q 3/ 0S00XT儴 00P0 hpT`K0T (` H؟ K` 갴.JeP p-@LM`("P0pQ-6 *㳟`+㰟0 PlK@ )㣟l K|,㜟0 0F00Kʿ-㒟0 0KKp #.0P8 r@0T*U +wP lK@)kX.P(>. -L4M@  "(0(0 p`\Q\1T1  200400<1041@P 0,1,00000 1800b"`Vp 0S0p\) 0!,P(EAo(E@ K'0p `BP00T KL03/P D0$K`p0`Vp00 (>   -L MP`pp 0W,Xcp 0#!0 pP[ 0 p@00 e0Q R  ( 00 8, 4 $0T0 0X08@G#@,0S2S P Q 4 00 -P004 "8qT0 PS840 0S 0S0P00P0X00 00 (Kp -LMp2x`K0@$Pp-PP0(" S{22plK0p 040 ]? 01p00 0A000 00ppp圛lK@ u@V40SV(UPO p (01噒!J0PD 4 0P  b "0 5 4 0B. / /p 8p0 Ph lpᄾ0 04040?o21000(K 0}lKHk|.   -L4M@ᤑ夡0@pKS0 00 00.p 5@0[S(K/S  ?K/0@0K`p0PU0(P p`0c!P 0% (! (/ $/0`40 0T ,0X0 8`u0100"H0 i,PH0 ,PKp%0s jP`괴.Kz -P`LlM&K4 .Ё&KX0P&K R 0"&K 0'K! 'KR0'K P0 0"pP9w(K*.'0(QP0pQ ",^T ^ 08 p0@㌘匈l0 0 h0 |0 pW(0S@b@pp0  ,4PP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S0 p,0P 0 0 p,0S 0R @S  +P|@   +P R0h00h0 l00l0 T0S0T0T0S0X0@( 0S0\ KL03/P H00S @0SS0p0\ K0(L0\ K3/P L0H00S K&KP0 %K'KR 00\ Ki@ 0Rp@H03/|0p@|0KW80s !؁'KP0'K 0!0\  BR60 S0!R'K0#Ԁ'KR 0h0W&KK R0(K&KX܈K a)'K p0h d0` ,,d 吂 Ђ" R 0|0W 0 hWph 0PpXKWp0 ?U00S$ KԇKpp0PP p (K&K  )ԈK`0d 2"d,0KR'K 0X'K|0U(~&K R0'K&Kစၕ᠚K (`0d 2"d0吃K  0R'KX0    0 'K R 0'KP!R'K05 (KK$'KR0 0( 'K 0KP0!0h SXl SogKKp00PP PK0000000000 $ P0ph080s   'K 4lWEpl呠 >|0h UU 8 r   0ԇKXKP/|fK`Vp'KKP&K\('K p0h d0` ,,d bp`'K h0W|0W08 r 0 P 0.h>|.'.A -PLMp -KPU pPp@E00P0 T> (K00$h R 0  80s0PEPW p '%h0S 00  80s`V p@p %h0l`0\ K0L03/%K `h00V:p@pp0Y:P@TPJ@pP0 0T=:`" R0P@ 0ppAX[p[PP p @Y) 80⨐p0YXp0 XW `Xk:@pW00 T0#S} pP"080\ K0L03/P %K0p`\ 8xP SR$08@H0@.m۶AO@  0 80spp ` 8| 4 V0   R \*p \ 0 !080s0\ KL03/P 0840L0H0%K H00,0%K$@0T0<0X0p@r 0 80sV p i!`@j p-L,M@P/(0S(`,`m0P00 0F0 @ PP`0(PP,((PKp000,a(,`(P0/  d.R -LMا )1$AS TP T(!0 "PPP(K0 @0> C 0 1/@P0$A Q 0 > 1/P@P` 0U:@1S<1@1 @0> C @6PU` ,v!p0#K&0Kp&0K0V$p%p=090K 00K00K   00p)0%0K 00K0p0K  0&剖00 0K0 00 0 @ lK0 'V0l0 0 6KP5l0K`0 \0K @%` 0 (%P  (P  %,  4lK 000000 000 000,p` 4K,0s`V2 0FSL(> *KP A*K 00S KK3/VRjKԊK0<!YX803/ 0lK6 0lKd@`0hQJPp3V`@PHP0l KL03/P \0X0S 0S`PV003/PQ  01/ 0S 2".V*KjK  0lKlKaPPlK1lK Hp0  Dd0 h^60^< lKPPn㔕`, R0 $P0 Pp@H0l 0H00 KL083/P 0l 0d0 0@ K084/d00DH pDP 0,QQTQdT V``XQ 0p p@l0 KL083/P 0l0d0 0P K085/d00P  P h00d00`00\0 0P} 0lKd0 `0 |..p408k0 L .\ < s( '{#A@ .-L$&   --L& 0 ,$! (! ,!P 0! 0-@P`L4M#ߍ@0S $T K0dL03/P #dK 0 `#8PXV` K R00S 0 // -L MpW`@ 8 0 呣, 40P002 % r pP0S(KQ,  R) 0 #0S Q000 0 02 %80T 0 哢"0 4 00000S p  p0$0!0R!/S01/ᴥ.!0 /ᴥ. $10-SL@ x1SP $003/K0hx1P$1 0S -@0pPLiK,`FGMM{FD7J0S  0{CGK L@0-% G? ABCEFG -LMPW`@X GK!V( \ 0D`qK1K @0S GK  GK 8`V@5G?K P- 0K(0St GKU@,0SL GKK@<00S, GKA@2356 -LM0P@1KQ*l x GK GK q0`N 0S (0S GK  GK ,`VG/K0KƐ GK GK p0`N 0S (0S GK  GK ,`VP妐$0 P坐 0Pt嘐0P㓐0PP厐0P@剐0P0儐 0     -̦@ PqMLM0G P 000x R0 00'P0pTT,vK,sK8`  0@0S D` Pす ` {Ps%K %K pW00(0S rK% @\rKbK% A @ 00,0S rK|% @LrKbKX% A @ 0000S rK@% @<rKbK% A @ 0/K 0b.K0 B3P+ tx``!R00,6K<0rKSn0y0$ @rKbK A @ 0rK00=,0d$Sn0y0 @rKbK A @ 00$00;8rKQ40 @ $rKbK A @ 0rK00=<0#Sn0y0 @دrKbK A @r ;0 0 R rK# @ůrKbK A @_  m`0 R rK@# @⳯rKbK A @M x !#0= 0S rK" @⠯rKbK A @: x`0`00=$0SrK" @⋯rKbK A @% 0``m(0S rKd" @yrKbK A @ x !#0=00S rK" @frKbK A @ x`0`00=40SrK! @QrKbK A @ 0``m80S rK! @?rKbK A @ x rK!#0;! @K#LB_K0e/K0 _?K20S 2ZKT1 0P1 2@L1 0H1 0e/K0Z?KD1 U?K10S K0e/K0 =KapB0 t!@"l!0  1P!0 SD!0C 1š(K0 1  " 8 $ 040m0K/KL03/P 1S !_R0k 1 z " 8  `@p040pS....o0. 0.8ALA..tAL X# 0-x L@Q+0 @0p0卡d K0h P 0-L@;000(0,0000ud K0hꐯ -LJM|A`0Psh!  0 ډ1SCD\$0娆K@0P 0PP@0 Ս(PoU@@TGoK0 ቬ0 00`P軍j^Pf^,P4p0P,pPp&s79: -LPM0a@0 $0@sP!  0 (m$1 SQ,<Xh@(1@$4K 1 @K *@0S$0!`PoU@@Tt0 00 P0PP 3 0/S  GKG?K!1@@ 0/S  K1?o21QU|1N0,!@<1(0@`1?o21P 1?o2 1 1S 1SIOaoTPPUGK0 ᨪ0 00pڋ\P\ 1S 1SJOl` 1S 1SKOL` 1S 1SNo #s|.%&' 00-SL@@0S000 @0S0.E 00-SL@ 0S > R0000 !0S0.I -Pp`L]MԂQ 2P2@D] U(K0W/KL0 3/P1 L1.DZ+ 0S( ]KR]KT,0KI1P/S 4]K⫙0]K0 01 & 1SwV p`  ]K: 71S1 0 p`1 $ 0 SAT2wV 1S x1S $! WA7 0KK0D! ǩ@41@,!Q^K1S  0Q ^/K㶒&  㭒00!15:% ᡒP n Q 0, ($!` ^/K⎒P\ 00 8q4a101R..'o/  -L0M@PT4`p!PP 0T KL0T3/P KP000T0SX0`pS@, XT $0S400b@ @0S00$K@D&7!0"4.3 -SLM@pP 0#00KpK`P 0/KXXT3P /K8/K0f $ 000 ]Z,0 0" P0S, XZ)00KK42 $PP Tq 0 x0K/K0 C"T0S `㋏K,cK |t0p⇞ 0S Kq Km`,pYV KoK$ ׏0c 4 分/K0`0" /Ko@v 0  K0Sa  KKⲏ `pV a 0  KKN1 PS DR 0  0N 0S; @0S@? 10<0!04000KKg@0oK$ 0DL03/00 R,K,K,K0S 0p!KM8qD` 0S KK KK8` V0 + `x0 SX c V0OK  `" 0@ KK/K3@ 0  j R0t 0KK   $5"B^@)FTw\13 -L4MLPKbp@% X 2 P0 夅 X ZP0 Y ,-D---.\...@ Pp勅0 @Pe@ y(K Pp}1PeS` 1S !N !៥ @p@ddP0  Pp\1PeS` U01S  1SJD!0{ @p@d( 1S 1S$1!k @p@d 1S 1S(1 [ @p@d" 1S 1S,1 K @p@dt 1S 1S01H ; @p@d8괥."A.+!" $1-SL@P` Px1S x1xAPx 0-@LPMP( @KU$1L H0 00 @0@00 00L0K0(00 0LP D@ K0=. <, -LM08 S $0 0 0 K.<=, 0-LMA1 AdA 400CSPU 1S [ބ٬P; 01l1Ph1P  X|4 0 BR 1111D22P22~ 0  00 0 0 0  00 0 0K0 0  00 0 00 00| 00000d00`0괥.|. .f4. `0 . <,.P< T.L  -@P`LML pKtP P  PP1 00 BP P< "0 4 P 0!K  KH0Q K | PP(`hq000C R  R41$0 000"xP0t K88/0!0 00Pt0KKأm V Y PPP000AC, \ \ 0!̓P^ X^ ,0 SL $0PK⪣ K">SEt.zI.3P. -L4M`$pP@ QP@0\ KL03/P L0 @P$ 0S(K 0SK010.\ @\D\W @  @H0S0,0Ԑ @PT R,P PTZW0P0 0R> S|08P0p @^ B @YdYW0@0 R<0S@t.P.C. d00-\0L0P H@P00QSP0!RQ0.|.. -L0MP$@0L KL03/P T0 ƒQ  RK dKƒQQP  RR$K  0.0@-<^`@WV 0S. -LC>>??K0K!z{P4P/P<<0)P0<0"P0<0P0<04PP<0 S, 0<0 P<0 S@  0K"D{080K#>{0,0K$8{000JJJJ 0-L8MLKPop0@P08 @\ D0D@0L08Kd0 00K00S괥. 0-L8MPLK@GP0, P\H00P0L08KT0000X0 } 0S0000000 0K000S괥. -L0M@$P0`L0L Kp3/P $1 0803/P8  $0` 0,P @L K04/K/ 0-PLxM|@8 K0K$< PKKPKSKỷKF0$勺P 0|! oK0|._ -L0M40@S`Pc0 00<KvP 003/00$1V Vt  KS0 000 0xp< K7/( <0K$X M[ 0p-L4MPQ@<0K$ 0x`0< K6/< K87`Px1x1a1S0C€1Kp 0-@LP 4 P  P00S@}0  P P00S 4! B! | P  P00S ll P R 0 Hވ 8وP 00EI3X -oML M C  01/P 0$0>@CP C|. 40-SL 0  AR / -pP@ᜐ圠LX0b2 S40S00 00 S40S0|1 @8 S$100S00 0VUO 0-L8M@8 LKT P $QV$00SU LK⍫ LK˸LK 00 |10K0UP ካP P괥. -LM`8 \KnVP KGP $A003/0 R   01/PP 003/@P$Q0H03/0 pPKAX^ X XU0 803/P  0<0S KK3/ 0!!!5# p P0 K3/P,K+K,K+K0K0 3/p 0 KL03/S\K \K7\KOpP 0SXp@? 0 |10y0 0 KL03/P 0 x0RuPp0 KL03/P 0 x0R (K KQP  x00p 0SxP괥. A / -LM`R@p 4PP \q_K, K4"D3eP`(KP(  ᩛp`0S <08 (00,0 000040!04 04$0D0(0`P WnW `h |`w`h20 P Xf Lhf @df 4`f (\f ap [p  'K #p 42`#f0`9`a8S(Pb 0  *0*0P06 A 0* *θd@edA#5Izd@\ -PLCM M`B.KpP; Bp@P E>K P0C0P᎙ULT!P0#  K / -LK0C @0@WKA VKA Xe tPP@ 0PK A ,UKhU 8 KpPL%H 000 0SRK @PN=K 0C VK 0A d5<0L50@0L51800S UT 0@% b000T0S!@PU Q=K 0CU H0Ph5 ,5[S RK  @RK  @RK @PV>K0C  X0WKA }RK| @P=K 0C  0UKh5Sm RK < @wPR>K 0CR^K P PEn@P DòU>K0C R0& Ỳ.` DiP=K 0C #00l5Spp&W zP``PPX5SX50@@ 0XE 0 0.0\0嘯 0!U>K0C !W>K0C " 000B.KD0; B@P0`VS.K B  #x{0000. p  #`Pz #QPu#QPp0 %SDD PP #p{P[4@5 Y @ 00 0p{P HY#p\z{P >  5 #P1 P* 0(& D0S 5K D c{#\  `G{@0S 0 0#@L000@. ` .{d@5<Mf -Lɛ 0P 0.. -L(M0$00 0 00 00 00 00 0 00000000 $ K 0-LM@P0K0!  0K0a 0K0a 00 0 0 0P S K0 -@L$MK3[ >K3K3[3K040K 030K 0  0S0sS@04)  H0 =PH0 'p0lS@h噤( )P p m(K@T@T(E -LDMpP<@K 0S  o (K-0K 0.0K0/0K000K010K020K 030K040K060K0 80K P40[ R 0S P0L哥&@0 P@0:PU(E p-LDM`P 8@ ] @\K@ \K6/TKp(EG-0(pSGg*PBQ] Q^rq`h,`QN sO`@SH@`#`3S`#V; . DQ>*t> 0DbV3 B^: ^QUQ3qrⰠ ,Z& QQ!sOⲐ@S#3 S#^ IQ*0S*A\!^PU\  S*A\!Xb0Ѝ0 SR00R0S 0 $ 0( 0 ,04 8<R#3///A-!@RP40B 01S+ \Q  SR( 00 01 SR Br_s? 0Q(`p qO@PH 0`pB0T0 0  T0"\Q0D , P 0 S0/.P P P P/ @P/PP*P/P P// -LMp@0  !R Q oό4  p4/ KR\8" 0SPU"R P  `aV U VX Q0oό 0p0P"/ /0 0  -LM0 0 0 0K KX0@-O@@ TC "@PAL@@@@@?@@D@ P@D P H 0$b 0#b 0R00@?A @ P @ @ @DPH A0 -P`@L,M @KD0K DP ,@ >PT`0 K#KQP0P cK`1/T 00c -`L\Mx0 >0p t `0 <0K0L0K0P0KT K`lP`#KL@R_CK40K0@0K0H KD0K`ZPCK@Pp T?%KX\#K?!\D8 <0A. R0H&K T0_d0 %# J0PdXd \?!\d,T0 0hlQ[ K"0PVuW d  r" ?T1 0@>`C0R\ `p ?0 ?$(0@SR`<0K0L0K0T KP0K`PT0SP #,\ 01" 0L0#KQP@TL0p Y0t0Px0XYVE(K|./ -L M#KcK4( p40,0 \ Y@ \T PR@PHR@PUT ^ Q0 \S40,K000( K40P($K -LLM`܀V4 0 PP T !dK`pdKpBT@R00p XX0 0&K0T000T W0#02SE 00X00 K 4K04P:4`0X @0@K 0 1,(0R  `BZ0`J4 0` 00 0 K40 K$K$KR0KP0  #K p#KK 0P0(K 0-L0M0B"T @PA@P A $KrK0000C R / -LM 0  0K  k K訦 0-LM 0  0K ] K訟 -LM 0  0K P K$/ 0-LM 0  0K ? K( 0-MMLM@0sP0A.K0 B;Q0s NK @mNK @N.K B 卋K0{dЀ4* -Pp0L4`@ *0SD10>ЀX0@(@ 0 Q RQP YXW @1<<1@0S BT0 0"Q 0S ,Ko虱DluєP,lP1<<1|. -LMP4@p!0 P- W0\ P\' P"U rq?`0h2岀`0s  PP \80 4 (P4 80`0(KpWBTU' -pPLD|| @ 4``0I 0 `/ D@ 80p UWZ*  @@ @.hGإ. 00-0LSP@U U\0 XU000T T0,00 @D #إ.T.l/RX. 00- LR@0إ. -D4 ML @0  tk p p0d (@0p @ 0 @嘡%@@(K.qkإ. H00-0LS@eD0(! R 0K0hإ.. -@LP0  04 8 <`p` 04 8 <00 00S00  SR000 0-` @LM#KPop1S PUBT(KU  (R  SR S"0` 0㓥!2S R02Y0(2 0 KQP 0-L 0D@P0S4j00S00ӵ0ŵ0P00إ. -L @`PQ Q OP  y0P00E00 0Q  0PQ/So/ -SLM 0 0K K -L MP@00 `؀  P0 RQ 00Sl   (K `F&4 0&8 0(4 0 (800` 0&l<< ( `0. -L\MP\K@`ps0PS3 0„\  \^V 0SQ00Q0S W0l0 l(Kw8jKR 0E  s%1#R  0%K40p0 0 Q VX QP08R  RW 4 0 Q Z QP V 0ZRUp0U0X 21 SR܅K%KK8”\%pPT0 `0 q?r l0 0\8"`0"HRQ0d d 50` Kd0dKPMW 2l` 01S ^  SR q?r 0s(2 0PXR 0&KR0^œ"!`VR  l  0S 2 "  023%KR0W? }i=d0`\0 %KP0X` Kl0尀0o"0\K0Pl0 $ L0 d02S02D0S qPS lDp@0S 1< R0!p0S q?r0 8S 0 %KԅK ^\ P|0 ` p0~Ȍᲀ  X00 C "( W,0 HS8HkA-pP2uSvw_10000“b\œ@FqL@$H @ - (P \P ‚!S Q   (0 8 Q S 00SP00// l0Q!R0-LL0L HR€;IPT0@0020>jH8 -L8M P` Q @`qdQ2"@! P0 * 0S$ 0T KL03/P K%Kp`  P`Rp R"&000$K|. -L0M0Pp` 0 9d@P0 00: 0R0 ! P0"<0?020x 20G02LKߖP @02<02802D00HKNH8I> 00- LRP@0S DH^00U0S^D 00"0"@إ.. -L MPp @`@"05 0 $ 0( 0,2Q 2R0 002S R02S0(2@ 00S!S8* S S4*SS=*S-S+ S0 SS$ S! SS S*  KS S BS SS S S00S  CR  0S0 S S000 @-LP4\DL\T Kh 0  l I808S^]/.. 0-L @ (  P0R0PS 00Sg 00 0-LM0P0@S KCPP 00S T zfK0D0 #! Rإ.. -LONKNMM @D`  PPj``NK 0|  @B.K`;` B pP <bp k(Kyd -L|MP Kp@` P@F0K!@P 0S X 0 R8L1L!LL00S 00(K (KP0 0S0\ KL03/P K(KQPK(KQP 00   x@ 04/@(KZ:Z ZY X i @Y@  ( [8 J 8\ -@PL_o-UKh' -LM@P0 C0pK0'4Po0S  `VRU p 70P 003/8_oVKhJj 8 -MLM@0P 003/0A.K0 B;*pP pz`P  ‚ˢK 0-@^LP8Q @ .2"0282w -p@CMLM`/@4 B.K; B0P44 0 i0 L$ H 0$ Y@#;$  4r P!14"S> B44S᥂zo@ U01U01 (K PP =K 0C 0   4r CK? A 0SY 0I,D0CK ASY 04o_SP 1 SR 1S  RS1S1S2pB@?↯<4 Q <4 SPTJ 04"0SE04S00D04 P= 04`0D l 04 8 < QR@ Q@$ r"0@$0 Q031 Q 044 8 <" 0嘠ϞD 偠D40 FDURX -L0M0Pp` L1L!LLT@P* 00孞 0R0 !?020 20 0002?4 p@K5 0S0"P00L KL03/P 8P bP003/N'J8> -L P@^T@@ 8^ @T$)d ` ` `b` ` p Pp`" "0 q`0`~``Pa 0p`T08BP082@T^ Qp`82S4@0 8~<`p0hx R  @Q" "40T8P 2SAT8BT0Su   -cML M86 0 QP& B.KP06 0; BP@(Kc.K4<p 08&PF<6 P6@ 2bK, @D6 D6S rW !R2"pG.K  `  `  ` dhl#V!bK Aaaaaaap@W8C.K Ukt@bKp` ApPxBTwQP < L& D6 81b.KZ 1! B,?? <@`8T1V`!a&a??``aL&D6ᙝP<  0KA 30e\6 0eq'X6 e>KK 0C A 0    _pK?AQ P0EbK, AB=K 0C   Fp ٟ=K0C S R @d@ :J8U -L MR@U|0| ||0`0P \ e"{PD04 o KDJ8 -LMp\K`W00Px8x(xxyPWd8< 0@(K'K2TQ\@Q\σ~4<0K8K RԈK40x0 'KR000X 00S 0PSWw? 0(K0$ &KK'KP0K'K 0KP(K0 *K 0)K(KR0W68B4T%@2r/0 q?080s?0 0KR000TQPM)KR 0PHWD6u u?vτ0'K 0KRnBo_P0"\KD0S SP ОDԛt0  8x@ }U x0x o?0 R S RQx 8 0^(KM`PW50c%%? 012U |0 0o_)KP#  ԉK|00X0܆K@PK0 20\KD0S SP rDvB|0܆KC)K |, 0 0)KP0 K܆Kl 20C K (KR0KKP K0 \KzD0S PS 5D9x0T82SK0"P0ʜ@Pyt0"2? 08B122bDTW (K02y?0"P0, K40"0 0d 0dK04 P `PU0d0 l0 0%K0PSb0 F 'K&1#KR'K%K%K'KKl0P%KU0KUK40o04"\KD0S Q<PS D崚<@B#38d0 $1 0dR !R  "#(Ro_x0PP 0SPo/ @T \ `TV U \ QԉKR |wτ \ KPVJ8 .U -L`M@Y`p 0P 003/0PU_4T KP.Y) ( LK"V 00%K  dK; P &K%K%K$K0 TK@0 T K P$KY K0 0 %K1/P0 (@00S $KR H %K @1/00P 0"P25/0Pl/< -LdM00 SQ H,`DA0 P|K| KP0Ga|K10@>SPA0 P|K| KP06a|K10@S`0p> C(KK 0R(KK ? ?K?Qd@P\ @`@10d p07/0@`P(K|. -LM`0p048!PAX@@ \^0@RX d 0P࠱ࠡ? 0^  0 (Ko/|.> 0-LM@0 410810!P_0K K KP0 0P0PU_0K K K>0PU K5/_K0|. - LES}  Kh#| -LMS@`0 00}X& 0-D@L0sS|,00p gm0Co0@&/ -L MK,K 0K | K 0-L0M$ K< <K80 40 00 ,0 (0 lP$ K --LNMpp$U|e} "SOK|4 W?K!PY?K D10CS P0YK "WKR0 |ğW?K " 0YK \4 @R wD0SL wPI OKm40S@ NK$@v~@3ЀX03W?K拟 A ' A{{jodVd`OK0d#Z~3@p3X-HP HXd-L#0 D#HOK d,#=~@W?K P࠳ࠣ\^\b O?K"d"~S?K @ R0 D10SZX=9 =:k{ 6 A(2UK R08' A{ QEU?KP0"UKRU \O?Ka0! 01UKP0d㠁P dP㐅)p/?  %+P1D /? 0UK 5;A%0 !}0@ R\ldЀOKXPWKRB FW "Ce 0NY@.A//////k/r|//?~TP!ŠPˌAT P f 0UKP kYKPx K} @WO?Kd C}@0 0OKp zK@PT*)>K 0C @ `P` @ 0 R 00>K 0C  p `0S 0#S@U@Y700(Kh/` 0-LMP@0$0 0 0 0 0 0$K 0 xp 0S 0#S oK00 S   000C000$00P0$PS0  t -LM@Pp p` j W0W0 h 0KU00P PhzK"g -p!LtM G/oP`0"K(0 p@ KK$y Kxp wKy@( 0R tK'xp 1S xp @0W ) KA3y !K xp Kh/ .0-L@Pp00D I U 0 p 0 ; 0TH p-LtMpP0 K 0 _p@ KK ywp`ww@ 0R Kph/ -AMLMQ@ӘP0p00 `7000 0R 8   X8C>Kv@`V CKw(Kh/ -PRL`p @ X 0%S @TR' @0 S $  0X ,R  pPP00P @ @0 R Q*U*  dR700  h@PR U 徕P P屖ᯖ  0-qL@0 v000 #-`p0L@/0s` wp``q j v0p0wp`PU0 S   0 R va`K 0-LMd@P0$0 l00I0KQ0p4 0R  K K0h/ -P`p0Ll0@TT 0S V P @ Kh 0-@PD0QLl]0UK0hC. -@L P,`|l080 C0llH, 0 0 8 `| lD #0Kh  p-L M@P#l000`V Kp 0S 08 BK K B 0 -`p0LP@ @Pp$KkH8 冕@H, 0@Wp3 D D p-L M0P 0 0l0@T K WuP 0 F 0al0@T0Kp 0S) 0 R Q H R0 0 \P 00 0  kP jP 00 0 0S h1S b}P 00 0 @ 0S .+p @ D0-SL@L0S)\0S4QU?DQUILQUSQUaVTa1CD00CD0D0HS0H01CL00CL0L0PSޔ0P01Cؔ\00C\0\0`SД0`0_ 1,P0C 1 aV”aRH1,P0CH1HaVD嵔DaEP1,P0CP1PaVL娔La81,P0C1 -LM@0 PP @0 0<0Ѓ0(080Cph`Cpi Cpi`C C#$Kk($K -p0L#h0@l*H0S D0S080 C0D0S SKh* 00-SL@0080 C0 D0s0G080 C  QP;kK0h[| -LM`p2X@؀D0 0* D$ ؀D 0  ! D؀D  0 0  D 0s@0 0S D#K 00 0 0 0#K 80܃KD7 D0*X 4㨁c(#"c(,K! 2=Q % < ,P0 ' < Y  i 0 DDdX= D 0 0S 2P`` iP, (K 0b"!4b4#,K0! d&   ` `0S  `60 @d6S@`p@ 0-SLP9080 Cp 0`0$0- :0)P 0 P@@@ 00$0 :0X 0 P@ 0$0 zW@`%@P@ -Ѓ: $0l0L`%$: 0 OP$9 0 WP$: 0 `V0$0  : 0@Y 0  -LM0c@ %0K0 t0 0l0P #0" Hl  _%P P 2 P D P{PU%P P1P4 0!c 00)0 # $KspX pP P r %K$rp<@F $r0 #6᠙ P / (s$r %K brp# rp  qrp` PsMsJs|r# K5L<bktc -@Lx c0l0\`PUKhZ 0S~(P0$#Kh  -LTMa@0P(0 l0S 0$I0@hK+p 0h0K p0h K1P  i ( 0R UpP @ p Xp U㰀  @00<09 Kh/M -LM@Q`p` R  P00 0 WV L $Kk~$K 0-@L 0S0 0K0h -L(M,Rp `l( @P| 0Sy 8،0&0s 0Sp V"H0S$pN0`P v D0sb S  $000D0'$J L( 0R@ $p$0A0AS`$0 V?D0S<   H0D`S lpI` 0HKc70l RHKP 0@ <y'Gf[Y( 0R$Kk$Kkz( 0R$Kk( 0R$Kh/$5 -LM,`0xP00 E-K 0@  Dqh Qo -K+ 00 0d0S JP\ 0h Kd[ E  0n E 07 Zp Xn E E E 0' 0SX E0 g E0 y 0S؀E 0 6 0yp = ,0 0S HOP .K T 00 0RI <Q/P$0A0AS 0,K1@0 K0 0$ `0 Kr  d6 S}0` 㙃#P 0 K0 0T 0 @ (Kh/bJjv 00-#@0L 080 C0 AN p K0hbՔ -L MP`@T(KpW4 P4   U W R @p RX 0 80 C#K)& *#KIx5OW   : -PLMP@5 P PP PRX!XX.< T00B0@0lKP# P- P< ! P P ph0Kh P l0@T @x xPA8,p\KhPKh@Kh 1  { 1 0-L@.$ 0K0h 0-QL@0  0S0K0h -qLMpP@( $l @P00$K 0S w,0 Sl   0P(0K ,K3 PlP@P 0P0PC͎ l`P 0S ?$0$0= = =0S ))@0 S   000l0  @  0S 0@ <&U, K 0S vP0 S   0f} -@LM> ^n1-,pxx# K0\!5X0T (K `Pl0   PpcP 3 Rp耟PU =l( Kl|l0 S   0l@P  0!l0  P  0S Pp 0l, 0-L@/p007SK0hx0 S 0VS0K0h -LDMp@0l(0 PP oP T 70 0( 0R @=0)`S შP <0d K  ,M=@  Kh/Ք -L$MpP|@s0P h dl`P 0,@0 `(K Z`P 0# ^Np`Ppp p` 0```pW0P Z)``Ix<0 <0T 0Xr#KT`0` 00K0D" 0Bep"#K :0X 0S1#Kpq` D0 < p < 0p0`D0nP NP` kP#K #KpP xP#K:#K*cKp`dK00 00SlP 0S cK A`p$K0`A00000 0* AV 0Sl0@ 00 00SlP 000@T*0 0C0 0l5 *:Ct&X -L4$@KM`0dp P (042KW@WT0 T0h(("4h#$K! @= )=@$Kြ -LM0p0`00 d0SJKPP6 U0d0@!2;S@$ K 030T b 0-@PL00 00 4080P PP$P00 S (  0݈0 S   0Ԉ0 S   0ˈ0 S   0ˆ 0-@PL DhK0h贈 0-LM$Kjp@K0PK@P P0P0000 P00P 00$P(00L0ipD@ p-LLMPP1!0aH0H Rk,0S , 03/@T0S^ 0 0@D0KDhp?0S ` KpdKi&KSR\\\ 0 S   003/00(00@(@PP0\ K0CSL0 PK0L0 T@KP @ R<0@D3/,0R  R 2/LT b ʚ; -L M 00 }$@ 8(p t@KX& -`L0PFp P ڣ# "P  RP@@#C 0 0(@0   xD&X& --L M  K -ML Ml@p0P(0 o`BK0 @j:B.K0 B$( 0R m Kh/Ք --L M  K --LM  K --LM  K --LM  K --LM  n K --LM  K --LM  V K --LM  ~ K --LM  > K0@҈D& P-L,0 ĈV00D& -Pp@\`LV`0P@ 0-@PL0AGp}\NK0h 0-@Lp g0S0%K0hԆ 0-LMPd@ 0K0 = Kw0 K0^hp9[ $00R K0h/i -LM@p 0`K 0 p 0R mR0  KG0P K,ZK,hp :[$0Kh/i 0-@LT0mFR@ 0-@LT0 GR@0Q/ R0 /R -L$M`P@0'0S  P P P:`P 00K0!0 0   H008S0 000(K080 00S # `p0PKP` 4K !04P 0iS.S P` 40P 040:S& p-LDM0@P ` P Q@T00\Kzp@ 0R V LK P @0SKph/ -L$Mp`@T@(K 0S P P0S S @ R P0 P E0S 00S㺀000 HP P00  jN P-L-000QPl0P/$0/ p-LM`Pl@ 0K 0  K0@U K8P f 0pR Kph/i~i -L0MPQ0`(0 0p S@ S$0SRR #PKM뾔[0 00 Q@Tl0@T"00( 0R ́)S0.S /S R W R G$R <K@,0 S @$Kh/ -LMP0@00 X010CzS񟗚M(9(98M(9TM(9(9(9(9(9(9(9(9(9(9B C(CCCDDDDLEhE|FF$^F$^hG(9G$^$^$^KtL(9L(9(9(9(9(9(9(9H9d9,:H:$^$^l:;h;;;<$^p<>$^$>h>0???A$^`BB(98NMO8OTO$^(9OPOORRRMMNRS@S^SZ[[[,\l\\H\pMM\\\\pOOT=(9p]R]?]]]pTI `Pp DK`PHT X=WP T6X T&D !@P<0 0 RY a|X, Tq X  <P 0 `P a v<` 0p 1+|P  0 p 0S 3P Z0 1X, T8  BqTx, 0 px P 1.S 0 1@AP0'' AT l  0_p@L tX BpT Q80S|8bX, [T 80K0 0 0 YU80XSu  DT 80K0!0 0 80 S_ < .T @0K0D0K0H0K0L0K 080K0P0K 0T K<0KM00L0@0P 80<TpPPD000P 80<TeP 0@00P 80<T[P& \UTu @0K0D0K0H0K0L0K 080K0P0K 0T K<0K00@0@0P 80<T7PPL000P 80<T,P0H0X, Xp IP GGTX# 0S /`P /`P00 )V /0P0 P,,,000X, ~T 80K0!0 0 $80XS (gx?0 aBpXP ?cPX@?30?KT ,4`P 0S<TA 0 ApT.X,@ &x  0@4  80K0,08@Y0 d`DK@ PhXP700@ A DKC@40A;A@@dPA[B@40@@ 0A  Cp PX؀A pdT`A P 4P 4P$: A06S 06S, T2 80K0 0 0 X80XS T QH DCHX,`plX, T `Xx`,bPj `<` zpPf04"` B|YX,`plPX, IT10X 2BP0X 29 P 0X 20 pP `PX # @~X, X, 0hT3  00p@R, CX, X, h/ c     9 U Ar | Ý  u      ! * E Q ^  ~ t q        m ; K e        )4  L U zX, X, T P@0K0D0K0H0K0L0K 080K0P0K 0T K<0KL000P 80<TPH000P 80<TPz0@0D0mT P@0K0D0K0H0K0L0K 080K0P0K 0T K<0KH000P 80<TPWP6T =9PE$ ~PX0S P 3,  ,- gP   ^P PD  QP  KP  EP  ?P6 `P0Wpp @KDK|p 00 8Ksp 00 P DK@K|X8K8x L P  A P! DKLp  pP ,`K&WTXDK8P $ P Ab PX  P80K0-0 0/ Q80S ~ `P%/ c@P`` @f;PT00f 80K0 0 0 fQ80S R AL @KDKP/1P0XL P@0 kRP L6D P! @0L&0- @KDKP/P0XD H@0 LRP D6D H! @0D&0T Q6P LPX, X, 0,X, 0,X, X, X,  X,  TR @0K0D0K0H0K0L0K 080K0P0K 0T K<0K0P0@P80P <TP 0SL T* X\,'sP0x|644P qP +"`(K0ԁܑ0 0 P$h61l6 1p6hlD1t6H1x6L1|6P16ptx|161\,WX0P0 Z, P@=t0 S* Р :s0P  0 ,t0`0 0 K0 |P 3 0S 0K00K00 0 00 g 0@0S 0 S S0P\S  @ D)FH ;UC  K,YUP(K 0@o@ @ 媢@  KK Pp& 0 Q Q0 0A?oQ20#Q0;Q0S@ Q0 0 R \R0 "R! #RQYؐ 's0 S00"S PZ0 `0)hKP 0S0(# YP<P- 0S! O@0  0@0S 0 S S0P\S  @ G 0 G@\ `JPl @s`\@QpP@\@ P0S P P0 S P P@M@ LS0 0"S ( P @ X>0K00K00 0 020PZ GG0Q3#//Q :/// 0-PL Ế@P0r -` 0PR!0p0 L@1 P`P T(  G$Kk!0 00T:T( G$Kk* -LT\l0l lT0S`0T  DDP `@@0P0Q3# P  p-LDM`Pl@ 0XK 0  <K XK <K<KXKp 0R >oKph/ 0-$PL@pU$K0hPP 0-L@P 0 -LMhq@Q0P00 T1T!Pe`K< z8lK <  jTt0Q  P 0 0 0 0R& n P Z  0 t Z  lRh0@0 \HRD0@0 <(Kh/  ( 7 O n / 0-@PL$0$ $$pK0hS E P0-Lh0h hh PᎽ@P ᷽ )9o@P h0S V P-L[$0$ $Q0  T  m 0-@PL,0, ,,PP 0 y P-L808 88T0S Khkq Kh迼  -PQL`P0 |U0t  @T Vp 0S 90S7@S   0-LP@P0 T0K0hP/ 00-L0@jT @0 T0-SL0 & Kh  -@QLpPT2T"TTT0 R" 080 C0 2UU*һPPt t0 t0 x x0R`9@0#P P @T T0R88P `)|0 |0T T0RPt06 t03 88Px x0R` p,H0S >p=0S 3p20S l(@V f`P`@    ) 8 -`PL PpP@T T0pS7@ -L(M0p ` Q0 KT0S0  @T0x r Pp@PP  0X @K%S@K 0R lKh/  G _ -P`L4M\KLKߺ<Kܺ <KA00#V1 V< \K᤻@PTx  \K✻0SS90SSLK⼺PT0pᴺpP| H 0|0  <KP" @\K,P\Kp<Km(K\K;T T0R88PY0Sx x0RႻ\K}LKԺT 800 /XXmP <K cP T T0R88\P `P pp "@LT0 04 8 <0#80w    P-L808 88Q00   00 Khw    0-@PLQ0&P -0-L M P pbp@@K0 p R-LP`@B4p p0S  -LM9 @0 TPp 0 /H@P@9#1P̐GY p0Sr!BP` `x{Pp(p p Xp  Dp 0#0Q 0F?oZ20SV l3p 0h1SPw*آp@P` k0P6S# xֽP hѽ`P X̽`P Hǽ`P 8½`P (ώ`P ḽ```M 0pr D0S& S& #pe @ p_ H pY $ pS [x pJ dOp0l00B Sp px rPp1 080 C05% p" 510 R%P S%P0l0p080 C 0 xp p0S p Xp H0S l0$0I0KYp Kp 0F?oZ20S0F?oY20S x0S |   :Up l R  0 #Op0  0 b p00sP P P ޼P[p Vt0F?oZ20S 0S FoYQ V@P pVA2Pp0S0pr 40)pMj#pLdW%PpW%PI pCT0Sn   pI 08!p^@0S    p5 08!p- Vn@hV0Se h1Sb RP^ t0 0p0L|TTpP 1 RRp`0PU0SS x1x!  RU RL1D!Hz`0V AP ` 0pPEU D 00 0R gQ 0(Kh/D t& f n { a# I Q ^  a4yvK       L   ? Q \     ! 1  f z 0-LP@}p 00K0h D0-sL`@s!S ! !p0P`S  R H R pP)1P pP?P w?P l pP0S h1S QP 0h!pP^ I Q -L\M0t0 0`8 1pSPP  p@H< K ( !R3 @ 0l h@ TK`p@ ]}p" 0TK}1聟pd@ `@ \@ X@ T#:dKTK}TK} l0K l0`T0KpKI@TKH}T @l \h0@HaXqt0 T=s[10C>S00@"$K!@03@0p@t T tKLp޽0S 0t0 t0#40 l x SP l@j 0Hh0 0 p0t0 @ Ք   P-L? 0S< P@0`0S5 S P Q \ @ P.S0.S|0_S-SPP,  00  ?Rh"0T000_00& 00- L@P P0CT0000Q  RD00`@-`0 @CT`@ pT00 P0S@XLX0X 訾& -h1LS@PePPE @ 0.PC_oSRPUdP TP @ʹP ,0 .sPPED 0-@PL'U_ 0 tK0 d~K0 TyK0  DtK08,0)(& #  @      BK0  =K0  8K0 3K0 |.K K0hC APO  yV ] c k r z   , q      ( -(6ƒ \ 1 Q0^  ,0\  ,0 -QMLM`RNK0p 0 P wp0 0 0|J 0R ,d.K 2.K l d0lJ0SPE@D p 0S@Kh/ ]  -L,MP80 ) 1d`4 Q4K@P!g(K0S  忳P@ 平 PpP@80W Pp W2gĻ00 Pp,P R ʸP 0 K 0 0 \=0 R RQ 0S 0f떻0 妸P 0 K 0 0 8=0 R R p,P 1$03 C< BR 001k  P@-0S- Q0@ @^ .^^QRQ D B R @ Q@ 0D0CR000 -`p@LM4 < 8 0 VZ:W 40W00G<0S00T@D @BV00(KRY"0T?,SP0ZP8 `YPU`!` V?U0W 0 R70 @0 y.0 000p C0B00 @0 V:D X̺0 0 4 @WR  GS` -P`LM0p!0Y* @ U W700(K$@PpG`  00U W 00  P     \Do   ( T/T%8 4 00 _8K\TU W@@U W\$0@00@@pGP`U W @pGP`*& -SMLMPd@0P P 00 ppTe A SnK `FyBp8P%HIp T=p B 7IpWD    CK0 t@p P7 CK@Bp C.K B0x   T50 0R a   K  CKp 0@ V @P0P@T*2p0S4 (p @pT* T 0 Hp @ p    F!0V$#$("( FHpq @   F0Vp$#$(B(   FD5@!c#!$c$"(D% HpQ @@  FD%0b"!4b$#  F@d   C.K.0 B%P- C.K BhhHp& 0S @00S HYHp00(Kh/N4 -LMP` @0Tp(0  ( 0R! aR R 00H0S0K -00Kl0#0I0K$00KW0$ 0  3G$Kh/  -L4M@` 0L SH P (0S `0 Lp0"(K 0  0K   Kp000 00SpC\ 0KT<6p 0"000cP U0 0!000  債`0 0L2p0t!00|V PE,p 0S(0SU$ (0S40K0P<0K8 K@KH N\P@ \P @@0K K$@p@@f_ KXPlPx Kⳬ ᫪Z 0@ T*00Y00A_ @T@(Kh/ p-LLM@P`0@ `K 0 墳 `K۫!> VL 5K3K,  R4K< 080V` K,@ 0R [Kph/ii@ -LM@`P0 (0 0Kpm K⧫KH00xKPK⼙K!\K 0X40 $0崖K00 40 K0v@( 0R [$Kh/kii p-LKM`@P0.QK 0 4 QKn0KK31KMK0Q/K0,L@ 0p4R x[Kph/Ii -LJM@Q.0QK 0  QKD0KK31KH00MK0Q/K00@p (?)O?Ka $  P ``F$` 0 0 bP B$  @V 0R *[Kh/ji -_MLMR~K0 pGP%00 X>p_ P@\P R 0@0R*5[S)5[S= S:SSwR5S[K ApQ۲@V@T@4S8 :0CSR E@ @l`P K_>K B A p 0S NS0 8MR1S S  @0 0R ZRlb0P Q Q 0$%C5[SH%)5[ S0S@%[>K"# 0C  5S@%@)[Pk [K% AtfSd S05 5S  R0 085 5S  R0 08[~K pG@  `5  6!>15 5 ?p380S 401S ))5[S5)[ 0^>K 0C0C0^>K 0C 0C0_>K 0C00 Tt)5[Sq[K 0 @⇀[>K[ 0C  5[ [b)5[S^}K pG5 J0 ep0 01S )5[SB0)%[R= %[R%[ R  )[ 6  U 6 p 0 %&(Kh/i@  p-LGM,|@P0` 0 l0JK0K!#  .K ᠚P>K, ? 0R YKph/V p-LTM@PH 0hK 0 A 0hK`yh Ka>p 0R Yx0h KX0 |0\<0Kt0H0 p0P0 M>pk0S0h KX0 A>Kph/liHmiH -Lp -L 0P Q -L 0P : -L ML0K00 0K# K p  K/ -LM@pQH 0(0 0p0eK`ǰ eKe/K4=p 0p!8  0(0*000R e/Kp1 =p080 C0 .SK◰ SKѨS/K=pװ0VS dS/K\=p˰0VS <( 0R X$Kh/liH WiH, Pi B Oi T (0S/ 0-(0LS000@@夰V000 0-(0LS000@@哰V000( 0R v/ -LM`LqP0@@(0 ` ;p@@ K$` N=p <[S<[Sl;@.8/P K KH K0=p K*=p `VPP 0S ZP `0$ K0"H=p ( 0R >X Kh/s @qB@| lBfB@pB -L,Mp0@0H L 0 PU  Ha; R04 P0` @KP0 埨8P尣[   R0P0 ``c0P00Y0 010! LP0 儨P0P P Z # % % % # %s (K -LM 0K #  < KgB -L,M@0`(0 (0pS H D  0 )2K80 3KL0&$8PK$"KHP D0 0 HK<0 @ :( 0R W Kh/ 0 ; -qLUM@ (0S\YK QK00 0 YK0 Kr00 0`( "4`#/R0@-0P0@ D^^!Q0 # R0 00 R-@@Q@LMT<0  ;0@0(K1Q 0V00P0`pQ : RPSO  ầ(A PC P l `0 p0 , `0 lpW  8  4 4 R0 4P4 RV``< P4 TP ,!R *(S0C@0 )YP @0(,Q0S(1 t 08@4Tͮ0@cSc -LM@ 0K00rP 0S00K -LM@ 0K00\P 0S K=/K -LM@ 0K00AP 0S "K 0-@0L8\K0h 0-80 C@P0L' =Q$ %`0l0 RR 0S ``0Q  =0S 8 KhLp08 b0` -Lp`KPXP@ 04 8 <0P0 004 8 <@ (0? Ღ@0K0cSc -L$Mp0 !(0 hp@ 0P$`K0&P0 :pb9@( 0R UP0 q:p  8K⓭070K;X3K  4Kr 8KZ:p Kh/ -L MPR@p1!"  T, 0P 0`@ R1 0R00 0N 30 0 0P0 0:0 00P00;0 00P0060 00P00(K P 0000t 0 00p0 00p0 000    -LMPyp`W1@tH$H40S y (P Ky8p@p y0S(K8WP 8U U( OXp ly \0c!`p050 0)K0.(00꨾&  M 6 -LP\P @ ^00 ``0N\Ӭ"0 00 \PU0, -`Lh0Ps 2p@h0S `0`08 `pl 440$ @<H&e Ք8 p-LM 0K080=`P@ PU@ @T DU@P  00Kp -LMMtRp0D1 0`@00 wP@Q R PPW L H U`PHL1 FW@10 0RT(K0,0|W600 0MK40MK0P 0 Acp051K,0 @S6 U751[TQ8@0K0@!,0 ZV4W0 P P 4 WKT`P`W P`0  m@10 0R TUP  DMKⅤxPV4gWP0 X T^WP`0 4(KoWh/r b@w  A  -L M@pP`Q`,Q0,P !,ERP㤀U`,@(K`:,P  R ,00 R: 00`,P ,E:P  -RL Mpy00P`U:p U @ YPQ00V *]"0 p(K0U00  0 0Ky@0V 0 H{:p  0Kڣ0V  o:pP -AMLM aR0p(0 $00@TPB T@ 00BK0  @p( 0R SB.K B|p CK╣0zV *:p  mp PUe Kh/ -LM 81SQ S  0K0 0{P K0S KY1[#  -L4M0H SP@ x@@ `0D0 0@0 _0? @0o0 <0K0D 0JpP4;@0T0 @@0P0<0K00D 7`P <0 p8 4 W$P  0K8K4K0K8HP`@<0K0D y0pP3 P0 <0S0L0 @K ZI00pq0L 0R*>"0P 0W80 4p  0 8Kx j 4  0K¢008 pS  S S000 040 408Ks0 t0[4KX0K8U H:P@L0S@0h` F0 0x0P   FF(K<0K0D !0pPQ <@LXK 8Ks 0Ko00pS yP@008S  S S000 040 408Kst 4K0K8 HP@8P4 1S 2S0 0(0'4 0  -LMP4@000 0pT2 40K0`0 AIKpIKX; X8l0S,0S,00嚘 1S,08h0嚘 8l6S,00嚘 !RT28X2 X2h 1 S0㸣P2 X2P"l6S H T 0pd30 0R 6Q0 0K0p Dk 0$p 0 0 K0sp D2H T 0p|D }T 0pD@ pT 0x}pI2[t0,0Ll0K?K 8kpfI2[e@0"0,0K ?K YpWW^e0T"!P !X,l ,aS  R/K  QP 0P2 <2 010 00}S<2S K!88 *P <20C<2 00  00T"!P !/K  P <2 0 0 P2,0P2 (Kh/  (  = U @d 0-@LTP0hq 0 ah0h0l00l0pq 0 Rp30p0 0%0 -LM`@p 0尀SP$H` OS000 0 0 `00`00 6,#K0 ` ${SE 04000(4H0#0u H(KoW#K0,0 $ZS 0003@0S3H000s8040$GS S t00080 zSG{k{'{z40S# zkg{{'{ zt0S( $0P$x0!S00 R*S:kG{{'{*zu8 S zkg{{'{* zg$R00 \GH0S0Sl x i 0R<0S 0S2 2H000s8040 14 0P0l18 0P0d10 0P0\804 00@0S,0y Xi/Hy2p`%4p0s 0S*  0R% $1s tpp(Ko:0S00 )2b2x0 (Ko(K??v  D        B '&  d     -@LTPp \0 $Kk08،0 0,0 \ 0y0W3D0S0S <0S $ R  n! #`0 `Q ``Q000` 0`Hp9Q0`8 `$`UCL -LYM;@0h 00 0Pl1 0Rt1 D0S`X,t0 l; h+0Sh P  Rl1@ `00p1 p%p  4p1h` F0KHPPP t0S h! BRh!R ( Q  R *Qx 0 000(0S0 S= ) ⢞h1SS F 00 0S\00` F0p18|1 )0H/h!9 08!L1 R J R1 T= 8  i8!1  $ RM DQJh1S S t0S x0R, 0JS02000$ 01 D< Q(  JR 6 1 0 <5h1 S<0S 0JS60 0 <$h1h!0RSx 0JS90 00H( YKఀ |1?3S 0 JSM |!p?#0 |!? |1 2S 0 JS< | "0 |!  |1A5S J0R:^ |!pA%0 ͝|!A h1S |10S 0JS30p0|1p,K ! ⳝp!KKp1p( 2 JS P |! |!0SQ0W0 0 2` 0000W00 `p1x@4S 0 JSc+ p @$0A @v@d``6S 0JSP|00[ ,K !avp1 p6JX:0JS870000, S:`p1xh6,0lV*l10 , 0AR&lWK%l1億%Rtv `dT  0VD0QTa SX,0 3 S @ 0`0 ShR PU}j[{k Ak7kl1 `0 P3p pC뗏 \R SK 0> CP 0D0 @QD  R0 30D1 _K _?K SR0|1|!8#<$0Ł ő(00 "9 `( 0S` 0   ᥜ`Q0p00S@ 7Oe0  ᎜000 0) +(`p, paap P` hP:LP YM 0,,S\ Q:(,p P  hQ:@Q Y& `,000I0C0 0  0C 0CK/ pWw0t1S @t1W/K,00 0R K HeAh/  g cSc5?A6e5wɚ;6 u ʚ; C DC ! Kl1x`` p[  8M`PF pGQl1t0S l1 $ P l1$Z <X x 0,1 K?KL1 0H1 Y?KD1 0( $a a D S4"48#8YT:QP0YM: 4"48#8SE 0C \ R  Y 3R:0($lB>D0C$$ D44045P!/Y, 0B.D0B-K B0 ;K,0C,$ -K B(C=K 0C0-K# B! Y :K,0C0F  x@Tk0 0R {CTAND0T$#$( ;K"( B,0C00C B!(Kh/$Ք$ $ -ML,M`QJK0$@D(0 ;K$0C0C(`8 ;`Dp  @\80@8 ;K$0C<0CX80T8=K$0C 0CP80L8 ;K$0CW,0CH80-Kp=K$0C0C B0=K0C$ D^&p =K0C\ XxPHP\( 0R C R 4帾h0s0 Kh/$  -PL`op 0|l0@T0S R `0S= R)`P  ှ 0 .@ % -0L8l 0@  $Kk蘾t宾0 PTyL'080 C0 D0S𫝸$Kk*-% U% -\ Q pLn0 t\ \0.000 0S / -PLCDP@ 0y`h0 0A0S 0< S `0= HKh3Քl% 0-@LPT jEhE fE8dEbE@l0S 0R $q A$%0$1(PE0(100S 0S0 -LM@PX,08 P 0St =(\0؀C  \pgp8aC(Q QCpaC؀C`t  Cl0 30F$KKFk#KP`,  0UQ4 0 $`Kf,P /sZ[{k A{7 +SH]@<0 (PeA ʚ;ɚ;6eq%  0-@PL00 ˺U0x0S0K0h -LM@`PU Q Pt0S  0 60t0(KP0<Q+ R( 04 8 <PD  4080 C 00#0 㰀80 C ' o㰀80 C #K0 0 S a P`02p 0K<0 垑 <0 1#K#K0 0 0S0D0 00S $0 pW ! 03  0 00 0Q C @R̘ 00ppWX0H0 Hc, 0` 00A0t`<0% %  00`( "4 M`4#S Ѝ/0  @R-0LP00@`a`F@@@@ : PePU\ePP/<0`( "4`3Z1S P///P/P/Q 0 4 8 <\R/0 4 8 < \/-P000P b8"#4b4# 0S 0-Pl0L@T0 P0@l0 R/0S 0 4 8 < 0# /PP/x0St//0o\  R/oS"P / R P/Pxx00 SR P/0 8RS/S/Co//cSc -LlM`t5t 0 0 l @T. 0S PU$ P  |Kۍ ᱎPP@0Sx0S t0S4$ |Kt0 0S! 2pP00 0R ?|0t 0|00 ,K0T0(t0 00 090|K oP^ g pW:$0 00 pP 0,KT0(t8tX|KiSp |K>P |Kg|0t 0|0XxplᵍX" 8PP ᪏ ||K: p|KDpt0S lP 8pgP   A Uc  P < 0$Q  " Q  ܍P0 x (K5 LlK<   妺cpP1 t0<0t00,KT0(080 txQY X ᦍP ύ|KU |K╍pP |K⾍Y $Ȍ L(K 0 x (K5 LlK< k  4P033u(Kh/-&  9& & f& -P L  Lp`C01S ?0S ;0S 70S  *0 @T 0Q0 PSP 0WAU t0S0x0t0@& Ք0-t R 08l  P@ 0S / 0-@LTP>P@$۹000 000 -L MpP`P Ĺ@(K080 C0^ O@P00 4z>@P p I0000 A =0 48 A $( !0 # $0$(0 pp@0 2upm0S b00@ @ P  0@4 8 < R 00000@@} & & -LM@PTH 0S080 Czj W V x0S pHKhKhf$`  P (0Q,0Q ȸ `P Kh80( 0000,0P0S K 0x tt0S  $0R 0x0t`$0SHxKh& ' 0S/0S/   -LM` 0R00 0 40 l R00(KP pP0  6V@ VP  0$(, 0R0 S   0LP34I=@Ph(Kov       @@   $( ? $( 0 "  $(, RX  ی000000 04 8 <0Cs4 @Vw(Koc? -LM0PS@ (K`l 00 0@0 @0 @@T 0p P0-L0@T0P/?K0h+?0 S   0#? -MLM`a@0X 0 姥P4ғ0S ,!,,Ʒ41?S@<P@0041康 0R4 ;0Q@pdBK$  APMW"PP mp ;B.K40x "pWMpW4P8 88剷U JM9 041Kh/:' Ք < -LM KK Khdr -#ML M8 0xR8 0 8 2 0( 00 ]00T20 0R f;8 0C0PPB 0Q@0@1@S@@ T8 v >K08 0 8 08 (Q00.K8 08 B008 ; Ka  弋8S  嵋 屋 孋K @^mK K @nKK A @n 國8@e 喋8@S-8t 0 n`pj QP0#03 WV00Sp^p`dZYX0#03YX00S 000ɒ70jj(Kh/*" -L M@q0Kc NK -LM `P@pP!@ R0p'ppW KP#d00:!(`P@ V0壳Z \00-@ L@@P\  ` d`U000S DK0h U0, \   H HR 0A" I P' 0-( d( @e \ 0-<L@P Q 00!\0 ! 0\00H0SL0SP0STP0 00SJ!\00 - LM0Pp$`K!f@,P T P pP0 S   0@ K 0-LM 40 0P#K@TQ U?\0H 080 Czj W V> U0 S   0 HP  0R 008!6`0 &Z  Rp ,0Kc 4 R@0 @0 0X000U@U (K -LMp`0 0 l0PU@ 0R' &60S@P0Kp H00#0  L00#,   P00#(  T00#$  @TKh/ -LDMq`0 P00 PX`7@P 0`B`\`\ X0X93 ?o2"2  0 Hp8山8@   0 0R, 5   .0 ` K"P 0 0.0`H``PKwp  0 0 S .0` KH(Kh/X 0-PL@ P0`0 p0( P/0$ S/\X0H -PLX0`S0S0S@T2 NP  0RX0' 0 <P@ @0@  \0;0\00 0$0800ZT@ @@I -@PL`PU RVhV <1SKh30S 0880 `Kh 0-@L< 80K0h 8 -L Mp`P@H040 T? H0 400 RP \0H0S`0@W W\0 `0 厰\00\0\0 0 S   0X \0@ 0 0\00PSP 3/\0@0\0V(K( -LM1@ T0 0 Q  eRPpK7@] >]  K`K  K-(PKKW K(0 0(0 DRP  >RP2S 5RP0l0`V$ 0K „0S 0S X K ᴄ00 0R "4 P0 RP 0 ḋ(Kh/emu 0-@L ((QP zK0h;e 00-PL5P@Dׯ0 0 00S sP y -LMp`8 R0 lP  P PUPP @4 TW (K HQPX @08  @3p08$0(0 0000@@000 X0\009\0H0S0I R S: SH0S5I00S1X0.Y+ 0 S   0 03/ 6#0 3/#0 X0\0@0\0##W W0 S   0# : : W 0S 0S 80 C 0v #0q4000Ph (KoV -PLU`pP@T3P H0S 0S @ 0`@0  -L$Mh$0P00  P08l0 Dq 0#0 (0S=@0D V0)` PP  PP 00`0 0R 2pWpP l2@ @0 @K 0< 8 4 @P` 0D 80 C0$` `H  D0K 0 0=pD0`0/5  (0S= R)0P0*0Q0+0S`R00T0,0U0-0V0.0W0P00#P0 5R)P5LV00`V  .0` 0`0@@" H 6PP!X0 080 C0D00D0 b5!10o` d X5000S`b` P  (Kh/( -LDM@rPPK0@K00 0` `H00dp ! !0Sp( ( OPP  P r]  OpPˉ00a XKa ,TK]X08  H00H0 4 T0 D00D0 0l0pW1`1  0X0D180`0(S80 @0@$0P$$0 B 0S 0 $0S S"0040S 0SpH h0 pOPh0Xpg00d00 0R p10000(Kh/ee -LM@` <$K$K@P $KK4(  0-LM\0@  00S0\ ,K0$K$KPP00$U 8}(  -LMP0Ā00@ 000 T @(K\p  $`V  0NPZ 80`F80`V00@p\p\00\0$0S$0 #`p cKb ?cKV0 08` 0B880 $0SY#$`p cKbX ?aR0cKV0$08 @$ -P00`@LT\00 S@0S/0S/Q\    \ -LM0PS@ (K0`00 lO00H@ 0@0 @T \0p -p`l0|@LT<1h@T! lpN l0SP @\00 8P _PU0SP @ 0S  #P |00|0GPUl0S P PP x0x0ol 8i|00|0) ! 0`( "4`#/ -@`0LP )0 0"V 0 S <  0 HK0,@D00 0D08@`0D0D 4 D   DP  8KG?C0K P BA8`p 0܀`(K.0 BPYK A] 8KG?CK DBAZpP E=0 0R[ V+ 0S080 C 00 0P R\YKA 0S (K B *0S 00S KA 0  %P  P (K B  8KG?C0<1@T,@P P 0W  HP @ pK. Az0 ` 0`8KF?C`` n{P(K0I/B0`0S``(K0J/B 0| 4X0(KQ/B0G0lh00 $4"4(K8F/B#8 Sl00"0Q0S   劦0S@0|0 0 0 0 :pP0{ 0 00 ?t0 t0 0000x0 0ScK IA (KI/B PR(K-B08K>C0S 8K>C0SP [8KG?C0D!8KG?C0H P8K=C(K0I/B 0# l0S Pl $8KF?C0SOv# 00 (080 C0 h0 8KI?C0S8p0\  \ 0(K1M/B0 8K>C0!S15: 01ʃ , 8KG?C0D8KG?C0H0SQ 8KJ?C0ƥ8KF?C0S 8KF?C \ 0,8KJ?C090R R RP t"K,I IHz0(KK/B00(KN/B0`0d0h0l 0Č 0Ȍ 0̌8KK?C0S   `I0I0YS S0Y0S  8KO?C8K>C8KO?C0 S \`V_8KN?C0@ 0(80 C 00(KK/BK 0 A _`P 8K 0C0(KK/B0580(X000`8KK?C0` S6  H> P0 oᩒ(KN/B \00\08K>C0(K 08KO?C0.B $0\0R0 S} 0(K-B0(KK/B0 SK A FP `Se  P` 0@S]Y $0SX 8PS@ؤPPK8K>C0S <048 #0P 88KM?C0(KP8K>CM/B 00C(K.BN(KK/Bᒦ8KK?Cp0l埤Sx0 Px8K>C0S (  04 8 <00PP0001=001 8KJ?C0 , "8KF?C0S 008KG?C0<1  @@8KI?C0S+ '<8KQ?C喻PP0 卡0 凡@8KI?C0 S! p&S P#H0 嗡8K0C LP0LY FP5 I+0`(KF/BP00P0S0 (PL'h8KF?C0S 2+\080\0X0(Kh/<* N* + %+ B+ ]b+ + 6+ D- D 0u+ + + , 4, V, m, ,  |l, , , k , - - n- ~- - -L M@p`,DQ0,PH!,ERP㐀U`,@(K,P  R ,00 X 00`,P ,KP -LM<1S0  KQ 0S00 0呠{ 0-<1LS`pP@0S PU@T  P@ <1-SL`pP@@TPU |P@ -@LTP" `i*@f*0@<1P 0pS /@l0 R 8q 88| 0810S 0<10S/ R R \XQ /0<1S 0S  R RQ l R /0<1S 0S  R R RQh   /@  -LTM2p0dK00 ? 0<1@T 0 SRPUO0x" PK 0P Kd,pD20 0R &%4 P Kp &K P Kp ,00Da0e H!R#P,08pf0e 08t6SP`LP`FPV 0h0 0h i V*W~000P\aU8@QPNP0 Ɍ3(pƒt& P `F^ 0,R0DH!0R ^0, 0h1 0000P K0 0F\ , ("(R  R ` P K❼pp 0P(Kh/- - - - - u 0-0L<1`SPp@T 0R0 @ -@L<1S0 0`<10P  PR `0S080 C  Q PKhRQ p-LMP0 080 C0AKp 0"KO"K@`$  0TQ, ( `Kf$@ WJ[{k A{7 +SD2P80 @eAʚ;ɚ;6e. 0q <1-SLPp`@T  RCP @T  R R Rl R00S0Sd V`0 0X `Os<oV<10SKhmJ. :. V. 0`( "4`#/ 0 R 0SQ/x -LM@Pp"d$h&hU|00U|00K  Ku1[PEĠ#Č Ƞ,Ƞ\K2[SW @ PE -L MT`  U |0@0(K0KZu2[$#$("( 0PEU*|"0#[4"48#8000L!PQ \ T@0, -LEM`hF0TP00  0@Q pT:| Ⅰ0 0RU $!0 @K9pp@p@Y! :N_K08#<4  0t0P@,K! t&0R v尠PE&p R  (",  t0 t 0W (",$ EE t K t(Kh/c.  -L,Mq0P00 1R xA @T0K4/P [_Ⱐ|00 0 0RJ $e[V $ RKt[D DH$HTEK[_@{@VT01X0`[ R R H '@{000h PK P0KF$`PD嶟 Ut000(Kh/l. p. .  -LtM0 0R0 5P000 {000p0 X50 0pRO #00 0t0 0S B x |0 p0 $\\00`00 x0 C0Bx0 6[D#DHDHx'xTvK T T @T'b{0 0|dx0S hKsF[x0$(XᶆKx 0SH{0 0Jp |0R0S00 `@H`K 0 I0H$Hd6FKSS0#0T K 0`K⅌  t؞ `" R 0 AP0 W \\ XPQX T K 0dK_0 0X0 0\0ݞ0X0 \0 0 P 0Xt |0 n1~긦[Z\ RX0S{ t S # 3Q Rt 0pp j0K PXd  婞[6[ `BS Iz0 0峞`H`K Ds88 4Q4 @z00408  p叞 PB@T0 @,1岩0 `Ks0(0000@@08 480R\   \ S$0 S05 0S S0Z}p00t0?o2R03St0 s\00\0\090\0(Kh/. . . / w/ 2/ R/  -L$MR`p P(@'z 0 0P@0 z@00000U0<K[S, t00K K:P Ktp0K0 (00 )0l0 .0h0 $0``K` Kp0 t` `0@avF0S 0s`? Hɘp܀KO,0S p 4 DK a Km KPKAQ  X0-K100 ܍K)X0:d!9#0 "R  Kp PPv, 8p R`#`3WppW,  0P `dH`VP0 M[@K(K ,8 - p@LP0`0(0 0#%,`$8`0 傕ptp`t`p  Kh#Kh#1 >Ք 0-LMP@p0S 080 C 0 0 00, (08 0EpHH K0h000@ 0K0A1 RՔ 0-8،< 0L@ P`v 0 PWꈻTꔻQ꠻ 0-@LTP000CS00p 0 00,0(080Cp$$ K0h芗K0h1ꬻdՔ 0-@L0 ʔ 0 , ( 8 @ H p(( K0h_K0h8$uՔ -P0L 垔@ `0Sx9000 ,080(00#/0$p 00Kh/$ Kh c1 Ք1 \00-@ L@@P\  ` lU0@P00S00S  8ʖh᭴K0hS\ H R00A" 1 -L,MP`@0S pVt6 0 da0h1 00K`P #[R? 50000000  SVL xp0x0t0|0h0hp0l0lt0# 00 $:0c(0 080 C 0 0(KkbP%*?h1S4h1h1S4h1h1S|4h1h1Sp4h10S 㬐X4Y Z @F딐吐0S0s:kg{{'{$z0S0s :kg{{'{%z\r p R 3 #P R ` H0 H0p3h1iK(P4AQX@|P0@00 CrS00C00 CrS00C0Z0 S0000Bs \20(0 0Bs|20P0 r T20P0 V9 `$$V4 \ 0 H0   Q `  x $ \  $ 0H`Q`  y R   : `R0 4X s (. S Q$  ŬL0( @p /i/pp8bp@T8h孉R$ |Д??1 1 1 QD 1 1 1 2 2 ,2 U2 s2 ^2 2 2 2  2 ! 3 0 ᪔t pb\0  R @@ H4P\0@0\0\0@Ӕ} -L$MP@U`p `0S (K0 S 0SS  0 P 媔0L80 0,<0 ,0I@0 < P1SN Z| Z Z0S20KR iP #[R0Kci0 4< @R0 %w0PT020KS MP #[R0KGi03< @R0 %[0X\00 00[pG, 801 :01 (0"(P0@  gt, 801:01 (0"(P @ 0 <0,0<0 v00CSlH0 ,PEYO0  0 00pW28090@ 0 P 0 00p0S  CRn1S S00 PU Dm0 0 8086 0 l0S *h1Ph hhlp0S0S 0 RS  媓\  0` X垓 *3 T3 3 DQ3 #4 3 3 4 4 =4 W4 v4 4 4 -MLMHK0,@D00 0D08(`0\0DP Oo | x D   D  UK @ A`p 04pD.0 XH|0 0R U` K A t`P_0 P0DP )Th0RdV50P     P   0 S xl0@T 0S `0S 0 @0S ` PP Q. l @TS ` 0p  ƒ R ` R PP Q @  D孒`0 q(Kh/4 5 3 .5 g5 5 )0% 0-@LPP0 AU0K0h -LM@PU w1`vh&hC (K` gp` K|p/ KlK`V(p R00t pSp> p (KlK`VpP0080 C0 0'%ppᄶZt UP000#?PUt0S Y 0 QP Kmp0p0t0 &6 " -LM`@#P0 @1s@p@`(Ko0P#19 *` PQ QRX "R   ,,  Q (Ko " Q!) p0hp0008d00 W*: PRT0 Ѓ(   00,0 pHm0S m0S 嫑(Ko00`VW#P0S R  R R R R S0   ;P  $f090000尀p00`vr, \P 0 (   P, 8 t6 p \P(KoPD00@ 0k(K Ք5 T -@Lp0PS( 080 C0  R(D`P  0 `Kha\0$9\0  4xIt p0| Sx0p t  ᢮5 6  0-@L K0h26 0-@L0$ - K0h,T6 0-@L ؐK0hm6 0-@L ̐K0h6 -L M@p`,LQ0,PP!,ERP㐀U`,@(K,P  R ,00 V 00`,P ,IᴯP6 00S/\ H R0/ 0-SLP`@ @ P@T -`pl0LPU@0S@P P@T/ -PLP@F Q 0Q`080 C|0IP`080 Cw0 0 S@4C@0`lA` 0 @P$ 廏 Q0Q80 C@0 P .0%%0 0@ 6 0S/[/0Sk  0-SLP @ 8 `pP 0 @Tg  Q 006 X;  00b Q  R2 Q Q00D R00S& Q 000,0(080H0-p<< $Kkt0S $Kkxt p0| SXx0p t zj W V Y x`h00@l0S R @qc@0@10S -Ք6 6 b 0-@L0 iPU00x `0d Z0P T@ 0N R002000D8  P-L`@pP#X0  0S0#0080 C0 0s Hp 04 0ފQ0 Kh -L@ `P i 00l@@;<4 5PU P= pP 0 `R0 :R `0BK00p84H$CK @P x@4S 8^ +P(K PP ;<4 0H@4 H PP84S$0 080` pBK HD `D4S$BK+ A8@P@4S 8)T h@h@P 0P84 0@4 B>K 0C0BKD4 H 0 RY @EPY:RWPp\R R R <$@T:BT4 P@DT4 @4SN 8Kp <$ @`X; x:0P0fL , 0Q :Q00$ C B  RpG:R:   F JD$ <$D BQ#T4 <4 CP @D pG `FT4 s@4S 8,l+h 00;P <$ @p`  DT4 [LT4 VLD4,@`HO `@4S 8yDP$0A0<4T*FP`:L4` :RpfpW 0 @p0p84 PW 084 0 S@ 0#SS pP P/P&U 0-LM  0K K 0-,@L P x!0 00/ -LM0xB,8 0pS 0S`,0PP %$KK A b0P P 0@PI!0 PP U ,( B,(R#000S  R  ,( RB^KPE0C R*K A b0PF PC @! ! "# :P #P R R 0Q\S0 Q\R  :R0 0,8 S>K0CI R  0 A0S@Z\R  ,( B:R|R  /e& 0-@PLAK0hL -L`= k@P@ dPuf 00@^S0S:S] p00@\Sp0S:SP 0C^ 0@0LT1 0L\TSp$ ES/ BS CSNS RS" FS 0fS cS eS bS0rS tS nS 0 R@AdP 00Pd @0:SS0AR0@A P Pd : -L`= pP@ d2PpGPd0df 00@0S @AdPPd0 :RRAS@A P 0-L@# P 00S 00XS@ 00B ^a0BSW0BA0BS70BQ<,00 00-8@L0P 0U0/(F -L M`pQʟ ;PV00`c }TP00CS0 Pp0 0 S,K*D mt@W00S( bP  _t, [tP 0KذP000SW@0XP40S 047σ4 ,Q P04  S 4 ?@T Q P0 ` (KP/ /[/ T00- LR@ R 0YPiP 0/ !/ 0-L@HP08G0/ 0-P@LPP0 P0/ 0-LP.P H0@QP 9P87SU00/ !/ 0-@ LPS P@0 0 0-LPP H0 @RP P87SU00/ !/ -L MPUp``@oP@(K R 00C P 40 0 aP0 40T00ST!`@R ////// 00-8@L0P 008!/3F -L MpP0 PW00p &SP100CS0 Pp0 0 S0,@K0$0 (ds`X00S |aPTsHrP 0K{P000SX`Z``VrP 0KeP000S rP rP0 rP0 hrP PrP 8rP${ :4RPvp(K8!/[(= -L Md0 @R R AP;,@0@00DLP0D K8!/p!/ -L MPt0 `Rp@ @T 00P@0 'P`  K8!/ 0-L@P08D08!/ 0-P@LPP0oP08!/ -LM@p`P XPQ@ 0@84ST@p$K8!/ -, LM0K0B0;P Kp!/ -LM@p`P X PR@0@84ST@p$K8!/ -, LM0K0B0;P Kp!/@    / 0-P88pL0@  0`0D'Q@-@S`P ^@ ^ p\, 0S'@0S^ p\ 0S0S0S@ R@@0@0S@\ 00SW@+ 0Sh0 P R  R 0  \0000 R ^P ^  @0 ^ 0S90^3P QR  Q0Q  S  0 0 0 S 0 R  R 0  \000^ 0 0 R   R  R 0  \0000 R PP P R R R  Q0Q  S  0 0 0 S 0 R  R 0  \00 0p@-PS  Pr0S R 0 p 0R5 3:p 0 @S5@T `V `@T@T@0@T@ @`S@00 0 P@T@ @T@0 @`R00 0 T `V @Q@T@0@T@ @`S@00 0 P@T@ @T@0 @`R00 @-@S`P ^@  ^p \, 0S'@0S ^p \ 0S 0S 0S@  R@@0 @0S @\ 0 0SW@+ 0Sh0P R   R 0 \00 00 R ^P ^ @ 0 ^ 0S90^3P QRQ 0 Q   S  0 0  0 S 0 R  R 0 \00 0^ 00 R  R  R 0 \00 00 R PP P R  R RQ 0 Q   S  0 0  0 S 0 R  R 0 \00 0@-0S000R 0 |@ 0S  R 0 \:rQ:Sn0 0 S5^ PUP^^ 0 ^  PS0 00@^  ^ 0 PR00 0 ^ PU Q^ 0 ^  PS0 00@^  ^ 0 PR00 @-@S`P ^@ ^ p\, 0S'@0S^ p\ 0S0S0S@ R@@0@0S@\ 00SW@+ 0Sh0 P R  R 0  \0000 R ^P ^  @0 ^ 0S90^3P QR  Q0Q  S  0 0 0 S 0 R  R 0  \000^ 0 0 R   R  R 0  \0000 R PP P R R R  Q0Q  S  0 0 0 S 0 R  R 0  \00 0@-0S000R 0 |@0S R 0 0Q53:S  0 S5^ PU P^^0^ PS00 0 @^ ^0 PR00 0 ^ PU Q^0^ PS00 0 @^ ^0 PR00 -LMp HZ0`@H`FPPR0T +:0 00 z/ S9#4 80 00 JZ0 80J B P: S:4 \= \: `P@(K@@P` t%/ p-LMQ0Sy A1` 6/`1!6/  ! Q10P! \`6/! Q 10P! \^`t 6/4K` 1!P6/4K`0 06/4K`~0 6/4K`u0 6/4K`l|0 6/4K `cX0 6/4KPZ40 5/ 0@ 4/Kpt%/T&QF d}rF ҍDSFF I~F NF AKF HHF F F F F F F F F -L@`PpY X X X Kh}00@-\ l /o@ b2%", 0 10 RP^ n /o@ b2%@ ". 0S0S R 0S  P0 R/-$0( 0 010LQ\   $ $0000t%/ 0-`pPML00`< @P7p00KTT yp\@ \Khz,0@L$0\ K 4/0 0S sKT& G t%/00,0S/ Q05: 0t%/ -@L00Ps P$0$`p0 ``FV`0P0`4p8`pU <PPP P48Pt%/ L0?4 0-8?@ QLP:4@4@0P 0t%/ -L MAD0@`H0 0$PPM @0@ @$@p T:0 S,$Dp0pW R# $0HP L0 Q(K " 00 @00  4 C 00 00@4 J   0 @00 00P(0( 5/ 0SL0P Jt%/T&*G -Pd@LPpL`1T00SPL0PL01SwPXPPt%/0T0S P/t%/0XPI X /t%/ -L@M@AP\0`Sp)`0S&`0S S f`0P00P@0`$K @㸐T*P 00 \@,pr[@ dKy\0@T0d KP4/ 0S 'J 0SP 0P0:t%/%/T& G -lq$@(P@`@6e2U 0冑0C001$  0LS  h0S *0s0`FP0Q00Ql0 R1 *!$q P P$  QP 0R 00 0S0`Ss 0S P J @ $KkCt%/- R 0(0# 0 t%/ -BMLMEppWpZ0,K@4 004 0,4 04(0 ppCKCp0090@<00`o`U(Y Y +CKp~ ,0K04@CnK`F0S}YZ@400S $0 >Q 0 x1D(CA3^@0HC3< 000 2 3!l < !|C $2hhh 01C0 0@S 0 <4 84 44 P,P\0`dP XPRt0 0t0t0S3R05 0S#11:PPPPLp(KM`P P 004K2`V~A C9R񟗏"H$H$H$H$H$H$#H$$#L#H$H$p#H$##H$#H$$$H$,$H$@$H$H$H$H$H$H$"H$H$H$H$H$H$#H$#,#H$H$`#H$|##H$#H$# $H$ $H$4$0 0=00 0800 030( 0 R0C+0)0S&0t00Ct0 t000000S0C0( 0 BR 0 0S0C 0( 0 BR00 000 00000000<4K0;4K0 :/E 3R00S?00< !,Y$L00S0p097t%/T&OG XD`G /oG 0p0S/t%/ -LM4"@$P PP`r (0 @2#$`\P] BSpY  ZX0H@DD)X!@җ X-1(@X@< 2S051 0 0S0 U00 S " 1X0威t@  USU QP$KQ0S  PYS  ZX , <K0@,Y  ZX X0X@0t%/7  -AL 0pS 00S PP900s$P`d0SPV P}X0X`0\0S`0S PP ``0`$GWPPP0 0`0U 0d`V`p U01`5:RTpV 0S:S*G9X0X`0 ``t%/%/ -L MpX`(1:P@TU% `V P v`P8 h0l 0B1P $1h@(A  R  !P!@Pl@  Q :00 @00 $~SJ(KT@1Q*Pt%/ -bLx0Sg:0S 2@c@Oop d0㓂$$@PU' 0S$ 0  B SQ0 @0R`A:|p p@C7"} @p0D d@/oD@@@D PU Y  ^ 0 B P GP  @0U 0  b Q2!  0 PSpmc0  CQHLDX\ KK KQ P   R S) 0$0h0xh01CP/AD`h0 \@ + h y \ (K Y  @` 0S!0=S 0SX4Y :0 $Q]wT ʟ! \ \[ Tod SZ*h* !h $Q`\ (K B8:y0A T jPl\h0`PA0P'* C!R̂ \ H" Rd Uh0 \ R @[(Kh\gh `\ $ \@)`' (K0 00 H‘\gp5 h0\@(Q 0H2 Sjh d0R*\0g1@Xh `$\@ (K  QHAd1H QVP>lgpl( ,0 0( ,0$0S0 0##0 20 >0 *K R0"ό  0Šx $0SD"x$0S  " "x$00$0!D*K0 C^HL  Kh0 00 0 0000 %DdR| 0D&$D%"D$!D$ %XK|K 'KP D H@v. @ L?% ?#T X?$ KP?%*K&000\@t D0$L^%zhh #c D#^ !X D!R D !M!D% #H"DdRD K&*K%<D p*K!D&*K r0#- DS R5 S RQ, $h DD*K  Kh*Kc 0C " R >01"ό0 Kd 0 C KP 0#!DD*K D%  Kh ##DD$!Dh% 0$%h 0S !p!D*K D%*K#$0S"x$0S"x(\ KU  RR $ RO D% #$' r0'00 $\ P"  0 x'x00 u(00(0q" 0"l,00,0h000d % D#_!D#R KD1#*K&S!D%!D#L0 K R04 KdP00(0i 0$0h06Qtp h %*K# 0&% K&!j<0L l'd 0 KB K#d 0Bd 0B K%T 0B_   K Q P RlQ P\  0$$%_lm 0$d K0Bd  K0B$ -LM@ AG02 >G0X0 T^ 0gK2c ? }K pP# 0?K0`0@ v K_?K E# 4 @`H`X`D`L`\`a a |a xa ta pa PPt1Sp!RʄQ|!R00 1Sd/` `Vp!pFV0dV00`$`p0f1 F#Q PK 004!R0 SR P`H@$ $" /KЀ80 FXp1<"R:1@"R60 YXx3 Q9Q2 @0>C 0C42 8 'PQ@x0S iFg0K 0J3xPQ@8|!R qW UF20 (KD2 MF rK [YXD2 /K`"&`Pp!&/ SXrKK$ P: 1!v> 001K 0A?Kvn@ `F 0a A0R! 4"0!& R1 F 0$ 0 QP`p J 00 QP E0S E0SXxst Ϡl V 0H0}K2 pP 0 KgK }npꟆlQ0rK1 vΆ, a`\E KoK !rKp@POP  0 TA@P P$0P" 0 K ?K R]?KPA _ 0BTR"^C@T0S ]Pà̌?K@@ P 0 @M0 QPQ ꃏKុNE#00KE0S@xCE00 (K0rK1 LxЀQ0a12c1XßD2 $E D2R 2$2#?K 0RBT"^SC@T ]Pà̌0E0S 0-@L Lp0,)&T0T0at T00 R PQ R  /  8 0@- DQ 0P S@@H  ^ 0S  Q 0#0S00p8H  Q j.0 0#  Q/7t00@-0PP X@o> 0" P0 0l7 -@LP`p @P@0%  P PP0 0i|60 0@\6 -L M`xpP% ؐ0  00 U@`P@nN@  0 pP  A`P PX M(KXP Pp(KW ? <(p`5 -`PLQp @Q P@D 0DB(000S  <0 -LMp@`P@( C K ٺ 0P0S C0"S" 0@000S0 4/KC0"S1Es\0@T000S PK1Es$ ,p80 0-@L K0h -L MP`U4  PP2S.pPD P@H BPP M \1000 `0{@P- 0nS: =1P00PPQ! Q P 40R 0 IQ0 @Q0M@P(Kt000S UpR(K0oS@GEp  4 -BML M`pPBD `P:~1@P  `Pn084 8}>P @c8(`B>K 0C`CK@4  0@@ +p 00P<4 p @@ 0<$+p \<`P) H3H 0K 0 K+pR  K,@LB 9:M 0KK #  K  *P K -L?M 0KK #  K  *P K 0-0LM K"0K2RP K(0 P000  00 /3ĥd2 0-LPQ9U@ ZA?( $ 0P 5/028 0-LPB+U@ BA?( $ 0P 5/082  0-Lu@P0003/01 0-LB@P0003/01 0-PL00P0S@ 0 0 03/0L1h -P@LTPQ` $ @04/0 0-PL00P0S@ 0 0 03/0|0 -L@P>Q`P@,`0 Kh/(0 0-LP@P 0 0 03/0/t --LM0 0 zp@ 0 003/Kl/, 0-L zp@0003/0 / -@PL MԀ(0K 0`@p3(0S Y@@(0`$ @6/ $K.T -@PL MԀ(0K 0`@p(0S /@@(0`$ @6/ $K- P "}yuqmiea]YUQMIEA=951-)%! ///x/p/h/`/X/P/H/@/8/0/(/ ////////////////////ıdP<$|dP<$|lXD4$ -LLM@pT00PP S S S \?00 (KH?0<0 0SJ  < P Y0J"p p0 T0SXTT` < @ 8  0A0 4 D V; `Ff \`3`"V= R0PL @D 4P Q>3@5 2 T *`L0  J < ^ L0@@ T p<3p2 7X` ( V 80<S  Y>0305p20 0R 0(K8@<^P0 0 4  T4 85`%5`5p2 VP;0X, D Q)R00 L @D04Ppp S>03@05 2 T *080 J < 80 W@ 0"  p0< `8 g@ T`502`P Vp0,8 X` VPT`P VP@ T !`5 102;0<0 ;0<0  &K ` < 0 @T X \ 4 8 0 QP k * A<RdD  l2,! L0,   S3"QJ 4 RX 4p 0C@D0T0 0\PP S>034 5@050240 5 T * 40J < 4 E004@@ Tp0< 3p2 7T R4 \P, 4 t   ` S3" >L b@` L` lL L` L8@`L B@ 8̠@H b1̎D` @ ܄KPKK`I 4 RX 4p 0C@D0T0 0\PP S>034 5@050240 5 T * 40J < 4 004@@ Tp0< 3p2 7T RW P FRs ` 4 ` `R  P0\ 0 l \c P\0 ` 8@<Q  RX  X \  \ 4   T4 8 5% 550p2P FR PB0 p04PX` W- S+UX  B@D T  P\` R> 3@ 5P2 T *00 00J < Pv00T @R  0< p`0 40 0 P 08 @ T5 2=QF  BP  Tp400 `PV Y+ P R(XX A@D \Pp R> 3@ 52 T *00 00J < 000W@  ` < 8 Tp 00 p4 d@ T`52 p8@<Q  R\ PX  X 4   T54 0p2  B8  04P0 p`V W/ 8 R,UX  A @DT  P R> 3@ 5P2 T *00 00J < P00T @R E < P8 \P p 00 P4 @ T`52 P0 J&K  P@ T # 3P00` %P!p0P1` 50@ T!`512 T , 08 XP0 ` @ T *TP+@ T*`TP00 0 Tp 4 p` 0 4P Rp0 @ TP=03p20G5&KJ < hP@`   T0p0Q # 2R` T , P8  BR4 RX 4p 0C@D0T0 0\`T  S>034 5@050240 5 T * 40J < 4 2T00 S40@p 0`0 40 0< P8 f4P pP0, \P 0 PT` 8 Y R6  BR34 RX 4p 0C@D0T0 0\ S>034 5@050240 5 T * 40J < 4 T0 40Q@p@ T0*= 4 pTPTP|@ T #0T %x*= pT r`0  BR-4 RX 00C@D0T0 04p \PP S>034 5@050240 5 T * 40J < 4 T00 S40@p) 0`0 40 0< 8 @ T0 #9*# , ` pPT 8 @00 TP *=0T p4 0G`4 T040 @ T# 3, 500T 0%5p2` 8 4 < 8 004 T 4  `4 0 00-LM@0@K0 p-`PL M@ 0 3 4/Kp -LMpRP@\  U`PC/g)Pa` T1 0(0p0. (K0S% 1 0 P0 p0:0S0`0 P0 p0:0Sꌠ :0S 0(Kd 0 ` 0: 0 z: 0  x\@ -L M @@K谉} -LFMGnKQBNKM @D `FPpF+4 ?2 [P@)T  [P@T 4 0FA` &$ "$V0(K: 0 (K: 0  -@`LMp P1P /m[0SP 0rS(0rS00P 0000@ D0K0 Kh}0rS @ 0@ /0K9 0 )+8000,v*P| ,D 0-404 00L0 @>P80@0800{ 0-L@>P80@0800 -LM0    K -LM0    K -@?LmM0PQp1 p `  P?p!K͌Z P}t?p!QKK͌T Pq0?p!KF͌(X Pd>p!GKF͌(W PW>p!KC͌ V PJX>p!KB͌80S P< >p!|Ǩ0S P=p!TKB͌l=@ 0St=0SDH0\͟ \@4 P$͟ \ D  Q̟ \ P̟ \  h QX̟ \ $ P̟| \   QT˟ \'( |  P780@1 T0 P0AlA  |1 0x1 d1t1 tx1PQ,0Yx!10 -! `q tP@ Z,000 V?j f`Xʈ`0ws!<11 P,0|!B 0 11 00p#=S1 @0C1 |1S+` 0C 1 A 帡 Q @Q0P nZ,0!0 0W?f  1`SA帡Q1S S `|,0封0pD,00xJ=p , H0 ?3p3 Z H0x1!0Sx1 b01 I@P@t0A 1 B P 0! 1 ;PPPL0Q 1 40P0`1 .P|!0B BR1 0T! 1 fʄ01 !t1 =a! 1 xA X @,0tQ0p0P` pW,00p0T? d@X Px1!0Sx1 !t10t1 xa V,0@0APDX,00x<pH , H0 ?3P3 V @0!|10C!1 R0Q1 ʁ01x1 1 !=a! 1  t X" @,0t!xQ0p0P` pW,0t!0p0T? d@X P1!0S1 !x10x1 ڀq嬁Wʈ!,0P1Q`AD,00xp<p , H0 ?3`3 W P0(5p 00R 1S$ ,00!`0Ap!!1P0X P(U,00`p0X?3 #h=01S!| Q(,0 A0` p t! @0Qp!!1P0, `V,00`p0Z?3#h=0R t1X!R& ,01-pp! 0Q@!!1P0 @T,0 0p@0X?3G #h=01S!|PQ,,0 t  A1@1x! p1 `0q!!1P0 X,0p!00U?3#d=0D x1@S ~,00` 0 ?33`00wsD,00x<;p(K#! x!10( TK+( [K+{ ( QK+( K+( GK+( K+( K+( |K+hZp1 0KA a P@`pPP  U1AaPv R:Ka С A Q @P`PP   U aСAQz@!R! z.KЁ A Q @P`mPPq 1 U `AЁQ_`Z11112@Qc q P`pNOKAPPE U `qJ@1p 00Rd80000S`ꌡ11 1Pp!U000Kx @ `PP@ 0V  ` xx pR00t Ppp`KPP 0U  pt@0T0D0p `@PKP@ 0V  `p0Ppt!W00H0K|Q `P@P` 0V @|Q -L[MpC`[?K@p Pp x1 @3?K͌l1Q?Kl t1 2?SPK͌D1PDQ G_K2?c`F͌(1`a `K{`2?spF͌(0p0p pKn2 ?C͌ 0̀ 褀K`1?B͌80 ᤐ |KS t1?̌|0 0| TKF $1 @?BM@T0T `0t!xp(KQ?Kt1 j G_Kv `K 0pK 㤀K |K 0TK  g p-LMLL `P @0`0P @Kp,d p-LMLL `P @0`0P @KpcT0T 0  D@Q 0Q(00?H/dc0, D0D @ 0 R ,  R$ 00?H/b0, - 0DD  0 L R  R! `?VH@PpqU,010 0RD   (  \@T 00b0,0 00a-L L0 H?3\0 ,,  \00D|a0, -L M0XaSP`(KPx@P"T= @00 Rp @p0R0 T0 P X@0 @x0D0T pB@W`0 ?3Q HQ@   0?33H0P @x`0,0 00_ 00-SL@P ,P000 00_-H ?0 00S 0 0 Sx0D S   R 0S 00^0,0 004^ P0-LP T@T0{0T0@T0 00 /] -L$MB2@0P`00 V| t2*lh2`\‚0T80 ‚@24 8r 0< (Ÿ  2 H0 0"$0 @ TpXppD \p H0p`pphp pip0pjp0zP吂8 4嘂<$h0 T@jXD\i`4 04  1 0 %0  00  W(K舠| x|p 8 pl4p d< \` @ P P0D H0D0 400]$8$@ `$0 -prLMPPp T@P 0`  PZ3$20"Å"bbbdbhb``c ````cc`FPV ci pQ p|L 0p RS `b0``` &P: ```0 &P/ p+ !p' ``0 &P  %OEZ000S :3S V$K|$^\@$Kh0S !PjZ4 ZD 0-@ZL$||:8(0( 00 R  K0h,W -L MPP10`PC+@/T->  | ! _|o#*:!Chd1W?Ch3:| R 0S 1qȌ0 S Q(KQ  10 S>t!?ph`pG( PH% U(0 (K>v<s^pvm8#j:g0'd#az #]H#Zp-W-T`_Q|NoKpHrEyBz?{<@|9h}6pUxx!,&+!%nvu#s#o4%%$%#d"e"@`c -808 0@L_k( @$T(PP -L$M0070ǟ 0 < 74 080 70L0 7J0H0 6}0`0 pD0 Q00S[  p #p PP] pTPIQ Ĕ0 s 00bR SP 4T P60 P0/N 0 ;0  TQPEPaU 0 ;0 4p@ w @0SV 4@ @ P0u0PPcRTT 4U P%5 0(Kp PP  4P 40 s 00bR$ 4$ 50P0/1P~Q  q lRQ $ 04 T0Q00S<0 S0 pk 0P@6 pb 0  $ `0Q0  40 n $4Rs8 R  P0u0PPcRT 00S<0D S{ 30!` p4 O0P@h p+ 0 $ 6P 0 r  ; `R $0 4p Pl pp 40 s 00bR44 $RJ0P"0 0(KS0P@-  $ `0R0A 04 04 0 s 00bRS44!0PR40 0 ;04pm4|S0P@c `000P D00 s 00bR A/o 4"x1x0!`:H00`0044 0040 s 00bR44QL 10! 0v]4L 0 s 00bR4k00g  @0s444 00TP0u0PPcRTT@ P`PHP8P(PPlONt,NMAM$QKD II 0-P@00 0L P) T TT0H -LLM4 8P@$ 0P`V e :Ó\jQ A300S(K30h0 X 300S  8Z tP P@ \0-L@%P @%P j$PP0QP  P P000 mR R0@0R0 1BQ;R" S0S0mS0 C ;S R00S0 S0S0;S0C  Q0R0R0R0 S0耆d< -LM0tSPp䔟 J|P M0m 0Kr(<`0"( pD|2S #R $ lPK?T0 aTDP XX R4$44 |0T`# 4XS0300SJ p0SG 4S 4S> 0t#W2l"Q匑T 5P[ p3l2Z; L1S80 7 `P3 800P, <0 {8 4<018 R! 0p22Yt2!2Ux2  PK 2x2h(KL%R4S 4S0?o2 8p2l2Yt2 PJ H2t2 0D p$l h $ <%$]U $P1l2Y $Pl2<l2Z $Pl2?;~0l2Y $P1x2Z $Px2?;~0x2W $Px278x2U  $P1t2Z  $Pt2?;~0t2Wz  u$Pt278t2q|200S0X00 r(0"([C|2Se1S0% 4S!hH5S^Al@$l0 00<0 0$  T X| hp  ` lT pH t<  x|L<@$88 80 0Q $0X 0/0; -L M\`pP@T 0S"!0S S0S0YT0(K 0  -LmP 0, S0 2 l` -LM@bdqPpQ$K p` QR  0 $K00$K PQ,0 ( P`( ,0 ,0 ( P( ,0 PEᰐ帐 少帑P Q8(0(0 0!$:<D -L@P!Pp p@Pp `E`PE0 0"@0V@0 t 2@  -`\LP@U 0S1 RU0S@"0@SKh -lLp`@S0 SpV0S"Q0S 0SV -LMP0 00`P@ @ jJBK0pPPPI0|" QU 3!P | [X$K6tyh6 - LML0L0 P  K 0   K5 \0 Q0-0L@D00S :T "0p00x5 -0 0`L0PS' :#CRQ# # po0@P: #Cs## B\ 0:#!BQ##5 - LMH0H0 P 0K   K48 80 0Q $0T 0/03$ -L`[Pp@P 0@ $0SP0`0:3S 8 80 0L 0:#`3@ -LM||#  t3tS0l*`d3B0<0 X3P08 0 p 40 P%Wu 4p p P@q \p   0 @s 00lR00@0ϐ1PB PR RZ RW00d S 8 `2`0!`pt u @@X%pk t00 ?R 4` 0 S[   r  `R R  1 0 (K ! \D 0 ^(K:p P@0 ` (K@0s 00lRS  @0 S @@ ` 0 < 0 @Bos 00lR00k s008`0`0 0㬰@  02tH2(2T2D2$Q0p0Dw/ -DSD3P`L@P? 80$ R, ; ʌ3SX#3Sp 0C#3WQW " Rp 8L !0 00@ 000@PQ 80@ {p0K0P @0 PES 0 $P(KDP <0$C02@080)(K ``h -ZsLW`@C y@P03Q4 Q'W- Õ@ @@DP00  W#, BO@\  D@L| @W@3@TKh 0-@PLP T0:|"C02TP0:CT 000P 00 6 /ᐌd808 000S :3S /(<0< 000S :3S  b/808 000S :3S /<0< 000S :3S  B/L808 000S :3S q/@0@0 0\ ʌÜ\ 0  !/ 0-0 00L@T  J3$S |B0pQ 33K0h)P K0hk0`<0< 000S :3S   /T T  P 00R0S*P4@//|000 000S :P / -H0H 00L0S :P p Kh 0-0 00LP J3$S 3S p K0h|B0tQ 2K0h{(0p-$$ 0  000 000S :P / -LM008 0p`V# ,@K [$P0wp AP 0 0p kp@ (K 08 @@HP  P 2/ -jLP R3S @P4P30@SKh} 0-@L J 0s3$ PSP"0P |2 $R 02S 0L3H |20"1#3003000 0P :3S// -8Q@PLP( ?0S&  0S  0S0$,"0|00 R   R   R  P   4T `TT *2S Q P Q0  T0-:|bL0PT!@RN   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @ &  (!R 1S ^  08!R 1S X00S T@ |'(@ Q0@0@!R@  @  T0-:|2Ha0`T1LSP@/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  X00S L00001S@078@0  ht808 0 P @0?30Q@ 080/ (0( 0 Q0/(0( 0 Q0x/\0\ X0 0 T@0ʌ|œ78@0\Q0@0/H0 000 00H 0-P000 00L@ :0Q@0?30R@ 080/R/R/ -PSL` 0@H@?-$$ 0  TD0ʌ|œ  \ @0R78@00@0/@/X 0-P@LM00 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/t0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/t 0-L@ 00 0K0h 0-LP@  K0h -RL M@ 0P P S CKh  Kh 00 0  -LP@`#p Kh -L M@00 0  @ K -LM K -LM,, 00  K  -L0@"`  (  P \ GoD  Q\<PH    BQ   Y(K0GS18&0 00 000 00   P 0S006 , W10 000(K00C?00(KT0`Xp`00pGW%ڬ` 0W00 0 p`8 0  000000000``000l -LP@`3 p0 00Kh -LM,, 00  K -LM K\0\0T  0 8Q Q @0<@0/6S/t< <0 0001S 00 @0<@0/tP0P 00008!R !R @0<@0/6S/t,0, 00001S@0<@0/dt\0\ 00 T0:|20(Q Q @0<@0/6S/(0 000@/T0:|20(!R !R @0<@0/6S/0 @ /D0D 0 P0  Q ARLP//, 80-P L@`P! Qp LJfY C<00`V $00P00 00 Q 0S0BSLP //,0, 0000P//t,0, 0000P//tt -L M#3 0@`V 300S`H0c`0QL zSP HR  H4 4 pAWQ ,  X    !0pGWPEC R0 6q R*0 ?33Y0",0P D `Ĺ,  xPPp(KP R4 4   BR 00pGAQ0 4PU 00C )0PEUP  (KSaa BZ 0 0 PBU4P ,0   ^  0   !3Y0 40R) Rp W,0几0D Q0 `O,0 0x0p0 ?## wp4000Q40 P00S`0 0CPVPpW (00P0/ 000Q /p@-@PpP`V0A(, ,1C Ba00V00@PpP 0S 0@//P 0S 0@///// /// -,0P!PL3@A,0p QH`@?cq``W2800D嬸xp0?330 @WD圸Z0?#R RwsL\ 0 @ 00C 0 00|?oT 2 R0S P/(00!//`-(,^0R0SQ!R@ -L,M<l |0^Q0P ,!0 8C8SP H0 P00S0x0  H0 PT P00|0 |0SP0,0t0 T0 @0 =0h0 P0@@0,0T@1X0 P1L \0 `00,01L00 x RL 00P `0Dw h0x p h @0Q?330H0 `0\0,0000,0\0`V0V 0Zp@Z1Ad P `\Pp,pLpP 0A @D08` ?388l p@0P0 H V8So00S4{  0 \ p000|PE p0SB 4S 8\  >l @P ` 0 Pp 00pS 0P 00P fp C 0p` 0 0 B0c 6 P080\00S0\P0@@ 0mp000P   U P! f;1l  0  8 Qp000P f't1l  0 8M RPlp U  1P 0 1Sl@pP6 V 0` 0 L5S( 0\ 00RPlpU 0P 0L pP0V0p L  `4S 80S00Q0So L5S3r p-LMP0P`@0 R    80t p  PZ80  H00  0 B 0C/? 0 0 Kp0 00H -LM@ @ X\ `0dPPhlp`]\P  $K80 8000 0BPCp`op`$K؁ 0-@PL0@T0 -1!00L0PSHp0?sppS,, ` !`@aT:pDx4p0?330 @V DZ0?# R0 SC 80 00  P0-L0@8T0 p-L M@PP U 00T00S T PP @@KpU  Kp`00`@PT ㉠P @KpP/  -RL`p0,S@ PPP 0S @ pRQ A@0"2"#,"Q/  00C0/ᰄ ,0-00LS 茄 -L$Ml9li0h)`@P @  p4P P8 3 0)0<0 ^ Q  pqp!gRUp=40 CR PPx8p0IS0c0PU XጐPPYPUP ȟ LL  R"4P^0 q  `RQ0010(p RV ( RQ E P 0\U70 7ا؇ؗW0 00  P0 P R|' R  R  lP R LP470 R4  8  (K40Spy 40PA{  R E PvpQPEP0P0xP[  rPQPE`V`vPp 0 0 aP 0 CS<00PS 0IS5%5 0<0 5H` 0D0 5`000 0P< :D0P00p X 0 ᮞqpnR pGpWp00P0S 0S yP50P$  4P0  <0 R T$04P<0 $ 00Q |40 p40 4PU001R A P XYY $ 0P0C 0<0 R60\300S V0 P0CSXH`#00P # t30l3P0p``sp U 0PE0PxP  P U30<0 3s000  0 p@@ 0S @2P0PP0UXT00P 0 ]P2  ,0@110? ^% 00P <0P0S lP, ! 510  H = 8R.#=SS S@ @  0 ,0101P\1dT100S i fP0S a]P\PP0S M QIU,D}t@0|tpl؁PLt`P|Pd~~H~$~0}}}T}8}0}(}||x{l{ { -L MdSd3P0\C @00 p0S0  `W_ # 3p@ T10 Th)P b` @P 00 00CS F .P ʔ2 n0Sx20` d20  (KP<BQn(   @DR  T lPT ` R ! :10@ `❺`@ `嬜l1 Q&T `` @T  Q P%     lP l@T  `   p @ReBF @D`@ ^ ` O  p ` R  h R  %P ~lsyy@tPyxxxx$xLwL0 1PL0H  ,K !0 80 bX00S P00@  R0SD0?༴@P  5/@TD0`0<0଴@P  5/@T[ p 0-LM@ RP !R "R Q  (@0SK0 -LM00 0 KXT 0-LM@<<<0 0P0 @-K0X -LM@@@0 < 80 @@ 0@K4XT0@-DB000 \S@R ^S? %@@; ,S'S \S:Sb{cS10LL A0}dA0C000000000 SPU. 00ES0@P00 01P\00C00L0'000 zWQ -LM(0K ,$d0(CcX112c0A!!"b L0(!02!1@K赁N g 0-LM 0K z, `0C@2@0L0 B 0LL0 !12@K0kLT > -LM(0K U,($lL A0@ 0$4ƒ!b1cP!b1c 0@ A 9 ,!#3!c!b1@K-?L *S0%p - 0  -L$M8  㒕PP 80 `0 8` & 00R0`@`  xx mnΊ@ < ,RH6Ty \ 00@0 008 0 @ 8 080  RS  Qc%R 8 p+0GGSK#IHFEDA@?>=<;:9865420/.-,+*)('&%$#"! [     iT0 S\R 0S0\S 0 S000 V @0pC0@ T$ <000 00 0 0%i/>0 0000 00 0  00 (K080  "!.Q *Q080  @0 R@90 SP0K@% 00dW0 00@ 0 d p00@0 8 h90 S 0c0 @000008 0 $0 S k 0K0 @000008 0 0 Su<0 050 0pK000008 KD    0 oH  00 D 0 pH0 @0@00@000 8 0 SBPN %00@0 c 00@ 0 S2P00pKD0 6 8KZ%+0c 0@0 0Dh@0 000@0 000 8 % 00iW0 00@ 0 p8 hdP" 00(K0pK4D 0K/,S  p-L M@0@P`0S PS"  00 K0"P 0 Q0 Q`00P0H0x 0 Kp:0 Kp(LtRRpRx -LM0S 0K0 0KK@0S pKYU$P0 `VP$@U @ 0PfSPKKD`Q`P0 ' 0K Kt -LM0S 0K0 0KKP0S pK4 P0 `VP$@U @ 0PnSnPPKL`A`_P04(0PKIt -L M0`S(0K0$$!'0K&Kp0S= (PK0P4耟A,P*0< qW# X $@刀0sSPp @TWV 0S g@p@@ Kp KHt< 0  -LLMX {l ᜒP P0K$ h0 0X K:` R0K @P Pa \ 3s0p0 >0pl0 0SM  R T0KS K`Vz #V =V ==`P 000`d0 lPw  X3V -0 0Y*S\ Ɠ0P\0 \0S0, \0 gVP  gd0 PSN :`4 @P\P@xr`,p\ h` V AT@ 1 Pf= 10PP f ` VP0\0 (KT@K$P 倁 70Pd0 I d` ~0, K$0VT`K P 4倡 P 40`d0 @[TK0Pl0aP P 0`@d0 >d0S (K kd`@0H p0<  ( 'h  $x 400 0S0-L@,08QP P2P,0P0 Q0-PLP@P040, 4P0 -L00 -p`@PL0\ %\0pS sS lS@ 0\TT  1D!01 CR0@CUPW YV -䯟LqMQ`P G PH 00 40RQ yOK$  =KpH W0 qQ R KQ %Q rP Q, 40,(K@P%T . ,pK>g01 0DXSXaVU^SRQPONMLKHGFEDCBA@?>O<;:9876543210/.-,+*)('&%$#"! ( 00 00D =P@0A?S@0@0^ R!1! D]R񏐲!~}|{\yxwvuvsrqpPlj hggdE"a`3p]\[<YXXU^ \ -00A|l0@01K0]P(KJ@`VP` 00040㷏P, 0000@T$ 0D, K!@00 Y 3  P ,40 .up 40P4 0pW 0G, K!S00 夐 pG,0K1&@D0p VT)s'&%mD"> 4!B;Z    $30@T @D,0K1S0@ POQ9 ?Q  ;Q  Q0 0%Q a0A RA0AS00OS3 A, K! ,K!000 1S101 1Sx10x1 0@T_ @Dp,0K10@ P OTYw10A R0 OR,K1PT  T 0 0 R ,0K1X@ BT0 ! Y1 *P ,40 8tp 4004000@OS ,K!!000 0'SS 0S'S'S00S  0C, K! 00 RQ  ?R ;Rn PeR~ Q %Q0  01 0000 0B 100 OR,K 00 0}SS 0S}S}SVJ0@T @D,0K10@ a0A R/, K1 90pW pG,0K1!T0p ' ~T 0pOW,0K0 00  R  B0 OR,K1 ,0K10,K1 0 '00"000&@D0VTm|y00&P 0p0 ,0Kq1@ 0@ 0000< P$ 0!T0y ~T F  G0060pOWQ0, K1!p夐0p ]0pY0pY ᳪ0p @0p0p00pY0pIoᩒ0pL0SE0L/S'%$#"!    p@r #@0@Sn HDHtP  ` fPP0 0 ,KAa  00P000| 40@ 00@> 00@84| 0000  P@ \0\ P(<v 4 (K@0P0 CR |  00 0x l 0VqV0pGWp\0@p\ p@ HDHt (B(r@U Pn&Py P $0,KAa  ,K$0!a 0x l0P0P 0 lV 0\ 0 P\ @p 0\ 0 0\ 0 0\ 0 0\ 00\ 00\ 00\ 0Pq (B(r@ S0l  000 f0 !؃P\0 0 ls 0x l P@k=<庆 (Kl   0 s0  ?U0P% 4 0 lKl HDH 00@ n0 ,Pst`PZP 40,,KAa 40,0,K40 aa4 80 04 80 0 l@lX  PH d < h P/ p-L4M0H`K2P@P Kp X0 00S !R2Kp蠊 - Q !P 1`pPL@7 0 4S0 00"0 P,Pp00|PQP`  YPpgŅGPQ  Y|0P0ŅPPE00 t 0-hP@PLP ԅ҅Ѕ ΅$̅,ʅȅ00 R00l t0 000/ t$0$ 000P/ / t$P00//ለ -LMP00K 0,0圃c!1!1"b2c L0@ 0 0D0`@B!A@C0FP$K赁N g P01cK//ᔇ -LMP00K \,00 a` B0C 0"2@0`AB@C1dK P$KkL >( 0P1// -LM@{00K 0,圁a L0@ 0$4!b1c!b1c L0@?AA0 T0 !S1e1cQ80PB0?P$K-?L *S 0-L-@ l@l @00@0s I OPJH ,KK0II ,KK0hh 0--L(MDH0@  @@S񏐶y@*4GG1kc%>hO'lD. ~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRsP+lreO+%BX0'&%$#lM      ]0cPL0 ʈ$ 4H P0S"h4#KLK P0S q!00 ,KK00cPL0 $ X4H P0S"3#KLKP0S40 0>K!00 0cPL0 ʔ# 3H 00sS, 0cPL0 X# 3H P0S"83#KLKPu0SP30 0 !00 0cPL0 " 3H 00S"2#KLKP 0cPL0 ʈ" K2H P0SV LKP90S p2H@@B#,0 "00 i0cPL0 r! K2H P0S* LK\P0S 1H@@#0 "00 B0cPL0 H`! Kh1H P0S LK5P0S 81H@@"0 "00 0cPL0   K0H P0S LKP0S 0H@@"p0 Zg"00 ? $ H G  ĕ x x ܖ @ ̒ 8 ؒ D , 0cPL0 4  K<0H P0S LKP0S l0H@@"0 %"00 0cPL0   K0H P0S LKPa0S 1H@@d"0 "00 0cPL0 T! :{kSF{ { 4H 00S LK{P s0cPL0 |# {kF{ { 3H 00S LKcP [0cPL0  # {k k X3H P0S LKNP0S30 0!00 80cPL0 ʜ" {k k 2H P0S9 LK+P0S2T0 0{!00 0cPL0 `" L2H P0SN"1#KLKP0S20 0Xe!00 0cPL0 Mʘ! 1H P0S;"x1#KLKP0St1T0 05B!00 0cPL0 +! 41H 00S"0#KLKP 0cPL0   0H P0S"0#KLKP=0S00 0 !00 ̑ \ $ А H G0 ` < D< t 0cPL0 8  (0H P0S 0#KLKkP0St00 0!00 U0cPL0 ʼ  0H P0S 0#KLKHP0S10 0!00 20cPL0 ^ PQ'%  00@Ddh` 'wf=L.00` SR: 30YL0|0J p@X=0Uy 0PEt@T<'<'$p@0(0L-000 0S 2=L 00P00CSTP ,0L 7s@ Q<0(0 S0(0 @d<,K0a pL<0U0 0PEt@T0SpH ?N?O?5?v Lu A?H?Xi L?r J?9?:?;?0X p0P0Xp0 t P l5L,%00` 5`05L\%00q@D `@80pD0 E@ 5L%00` 7p` @ s Q`:00 PlU R~0PEt@RxU`6LP&00` ZP 6R0[`LR  R0PEt@RU='''<3K2K 4K4pK10K#8l0R` 1YU d` ``U PEt1@Yd`7s@DQț7~@DD@p7`00S<0Cb  0t48L07p` @q d$ R'400  0 '4 4K4pK30Kp8@0;8l0'4 4K4pK30Kp@0 \7p@D 0@D''q10)S ?0S%T9L00` L<0 080P0`0Xp`p0P0d  0VP <:L008:`0bo\:LT*00 `Y`Lq@DT p0\ d dT0 \0` 00h /P :L00:`0;@L`p6;@0 ;L+00 -@PL 0S $PU `P(80S 5/$P(5/00` -@PL`P 0S $0S pP@0 QR 408 B᣿400 @8圿U000p -@PLp`' 0S$ $0S! PP 0R| S  P00S   0S  00>?R? 0-@PL 0S $0S KP0  $000 -LM`2`"0`PP0(0 0S $0S -P@pT7 2 Rv @< Q0@<.,K 0A+ K S 0 <@ P00cS R#2^ SࠃࠓP0S@0S60l0@TP  N Q00cS R#2Q S Q0Sl0@S@0AEX0@0( 0R $Kl0Sn똺LS??? P-L 0S $0S P0 Q@oA? -@QLJ `VG $0SD wXP<!(P6/`P= 8pW  ( 0(3/pP, 8 b ^ P0S0S *p0W0C0p0  (08#J8p`o ST0C@0P0T($03/ P-L 0S $0S P 0:+ 0-@PL 0S $0S P Q 000 000 P-L 0S $0S P0D R , RD0+0BD0C?L? P-L 0S $0S P S>p0@@G-M@@0@>0^QR APQUA`Q |^ `\X PU V`! V! 1PU `vZЍ-0  0Ѝ^ 0Q0P0SP0e`08#8V0R @0C 0S P0RS`bC0P@R@0 P2 0 PSЍ0,4000000@?o280@0 0<0 00 $  B( P 0S03`05 :U`03P340%PE P!0'050%00%P!( p490C1pp Rp`P00L3 0S C@ $Q0 B("(R$A\Y   \?( @$ T:  Y `(\ L (*Q BR PP BRPU : 8 Q  Rq, %Q  Rk

# 04ᾀ W@pH0局&R Bp08P<0Q*lPt `Q *P0CSP18 PV(K, Q*PF\0CPSP18 6PV(K -P`L@0T@!T  ^0  0CS@B @000 -LM8@< tP, Udl `0pp8HPXT D`P4 H@Q x0d`p P,BA@@\S`Q^h0S/ 8 6\f PV !9096&0CR \0l S8 B0l0\0 l0 tP0PERl0tP(K0tPPE Ulh0tPt0 S< R S Sl `0px0d`0l Sx0 PpB QS`d BVv!fA0Ct0⾀pv0A01I>Q2L0!8ӗ1х1&=  tP6xpl P0CPEG40 8 0 tPx0\Al0:8H X`T&" D`4ᾀH @ ᰀ0Qx008 4p0 pGRlph`0\ 0R8 G l0\000Sd tPPP`}x0l %hl QR010#<6P) 6SK \0S8 B0l0\00(K8&VP0 ) )l h0\0S8 B0l0\000S(K蜢lT H4-0 L$M4 t@pP@0C8#8T0ƈ 0C 8!I.S# ;#8җ1Ӆ1&=  `t 6QN0C^0C?ol \2t0 8X`Tpm0 `lH f"`H`S= 3^Ol08H XT " D4@@QH 0 , CA/B BPq`&PF8P0ƈ09096&0C0C?otl 2N Stl \0l S8 B 0l0\000Sl(K It1Q40S Q6 Ql0P@D A8 @ L < 4 @@ @H @ 88 <`D H0 l0L&# P0 0\H P`D0 H0L@8lm l0`l04S1#*\ &R \ R8 C0l0\00(K\ R8 C0l0\0u00S(KTlT -L M` ,0IY0 !20X0T0X0S0D SpHor 00 #4 B $ B B  0B/U"T6WC6@*01T[:\ lPPE@D# 0S0S@1TP1 T:XpD pGopr \08  s\ 00 00@DA TPP\  -W  B@  @ 00 @SP ,08Su A C, l 6\ AQ@@UF (K00 @Szl 0 \\@R300 P V0Spӏ S00W #̠ #800#"0 p0oS0c0ŧrj0S=0 p000` S *SC00 6R;Cl ͟R 0 0C0#2 2c0# 0l0S  00#  #800#"0 q000Q0S09S ES IS! [Sg gSg  R]YV$ 90S0(0(K/0S 0>QK  J Y:3 0 X 0 Y %*I y0 ,0 JSR  B00V X; R( RdR@0aR00]  T, RZ0 0I000S.  0 0S0   0S,0SQ: R,0S  R0 B0200 0[00$0S,0  0$ 0S0   0S,0SQ: RM t00   0 0  RC 0,00Q0Q0$ 0Q00R 000 0 0 0#40 0  0 0 S0 S00ӈ R01 0 0  0S 0 0 0#40,0S E0 0*0,0S)  R0 B0y00,0g  S 0 Q0S 000#40X0q000S 0 B0J00 B0C0/pVy 0 H V 0Sqt6l 8`Ƙ Რ &!909&tl0 BI0Qtl0Q Yt0SVF :V㴖o 6S9 \0l S 8 B0 l0\0k00 00#400 03 0  0#400  0 \ R8 C0T l0\0*00S~J0 0 0 0 0 0 S0 S00ӈ R01q 00 0S0 0o020 p00060,0 J0[0L D!B Pt0S*l0\064p p0pt0&l8`Q  A R, *6ƒ᱀9096AAot0l 0C t0l Qu St0 SV} S S`l8 R R,  00 ZZZZZZZ0J?o R20S00 B IR` `0 R 0B&Ɛ0 0 01I>001&=  AAo`t0l 0C `t0l ЋLmBlT\0S8 B0< l0\000SN4p\0l S 8 B0( l0\000S00/*V4p6 &R \ R80l0 Ct\ R80l0 C0000}00z00w00t00q00n -`PLPpP 0SM $0SJ PGq@A Q00W0S=0S 1 0!1 0S yp* 0S1 U Qj6S S L D!B 06| 0 1 0P |0p0PL D!B \[ -@PL/ 0S, $PU) w`P&0(pQ 5/0$P(DQ 5/0$P(@Q 5/0$P(8Q 5/$P(05/0qW`0` -LM`20 <0 0\0 Pp40  08Q1S00P 0Q} $0S 00s0V00 `f0V00`FGQxFQRt4 0 QRoFoS㪢Z80 gV @!( `4/@Pn *! ⑂80@ 00A402P  CX0`,L0T  0 P(`3/ 0 8,(3/ 0 @L(3/pwjD 0 v(3/68!Q ( @ R% D PR!  0 0600&040$0(Koh0<0( 0$0S|d0<0$0w(K@ @0 < 000w -LM 0 P 02 K -@QLPm `Vj $0Sg oUP_8 p嵭!(6/@PZ l!@嫭 0 ,P(3/ 0 8,(3/ 0 @L(3/D 0 (3/8P4 @0S1 ooD0bS`V*, 8 , @ @zL D Du q0&0C&΄ 0 0夆$0˄+RC-`  d 0 R0#01&d#R PB$3R@@0B  ` tlap |q`& `&&, ,|,d `,Ƞpl a ̌   ̌ t ap |q`& `&&, ,|,d `,Ƞpl a ̌   ̌ t ap  |q`& `&&,  ,,tap,Ƞ| q`&̌`& & h`l | Ġ aq̌`& q&, ` l Ƞ q  ̌ p' a'T`&lP RPB%Q@ A ` l 8 q 0<p'a'T`&P R< 4 00#01Q&d# `  l G-RBM[B(0@A0T0 `P0S p,0V @p0S P,0Y P0S @,0U@ P0S   ,0 UB!0 BߍP 0 0P 0 0 /@ 0Q /0Q /tsRpC-&`P咆Ǡ 6l2B@ &'!8 8b" N 0C0 L  D A R,A B4P C$0@P @@ppqG-R* Ƞ Q R RIVB0 N@W]0T`TT 0 `T 0 T ` 0 T0 `T0 T ` 0T0`T0T ` 0T0`T0T ` 0T0`T00@ 0UhH7F`FcV2 R0JLRR RuB. @B0P`P PP ` pPP0 `Pp0 PP`0 pPP0 `Pp0PP`0pPP0`Pp0PP`0pPP0`Pp0PPP`0P00 0T>n B"  0 Q 0C7'bc"2JL 0 ZJJ|0 \LL R  0Q @08Z!7&cJ2JL 1 Nq,/- U/ 0`0/KZm]G-:PT0/SM %pQ͌0!S /\˞U A@`kṐY @11: W: 0@Q=0@T! Ѝ QQ Zࠁ -LDM @0 ` P 4ZVT TP4p QQ \0P4p\+ VTp σ pT 0R  !QP4pT XA   A&SP TÀ qXQ=0pP4!\ 0C` P4 ` `T$`; BX T$T;! 0QQ=0 Q0"0202 0 `kd0 Td>n 0\ `SR0/ Qh P\0 !ap0100PP0 \0P 0\0 P0Z0pYpp` 0NP0ն0P0 X0vSP0s#6 X0v`00s.X\ hRK P Y> 00`X0 pn@Qe  ^0BQ Y> 00A .0I000Y0C0PP# X0X 00aY^ P@ 0`FqZ 0S pF0@C$F^P@XHX0d LK ( 00\0T r 0@AQ , K"^ "N Q 0T(K 0=A-P@\A0RP0@+}n\( \ 1>000R R# P0T0S R S PR00 P0 S0Ѵ000°0Ѵ0P0G-鲀MXPPRJ@!z00k`0 Vᶠ?Z3 V:৞ @@@0 0@#4@06`V cP\ V &028@aC8RHPA$H0`V@6Zw Z @P0 0R0 ЍX&0i X" @28C8PlU! ` P0 0P#40&L0bTC 8@C8&@28C8PlU!p P0 0P#406 LcT !&`FhA&hRN0 A 0#406Z cVb0C`6@ P V+7ʰP28C8@lT!  R&AI )0"(B(   0#406 cY 0C⸐6R @PU &I &P28C8@lT!%  R&A8 I )0"(B(   0#406 cY 0C⸐6  `&O @0 0@#406 LcU ! R&A `Fh&h & @0 0@#406 LcU ! R&Al`Fh&h &G-Z M6k SƕN ,4`0 0 400400400400&@<@N0d( S"(0    0#40ƕ@DlQ.( Nƅ6 ` S08QC8 @|pq pp<  g`8C8( V"(`   0 0#406` cV"G("( ƅ0(AaB(V! t1@fN.,(B(8 T#8s@000  0@#40ƕpF0l^ (B(ƅAQ0003ӕӅ0`0,@8C8pd( W"(Dp   0 0p#406D cV"("( ƅ00CTNm `4`dA!N( V"(J6 S `ƅ^@0Nc( Q"( k> ƅ Ѝ ƅ| ƅ0ƅ`kp p  `"$` 0C `0T" 6 Ѝ t h :&@-R Rk.  k &k.@@ "$ :&@-R R k@@&  B&k.@@@@!ƃ0@-P0 @ K@ +,K( J&̀8+k. $ˀ0PG.V 0S 0 ,S0 + Q0I0&&&&08 -k~L@ƞ8#8 @ \`P(8 ⸀ "$ &bS1 B0&[ 0  8#̠  4##<00 Ꮵ0PP⸀ƎT0@-@k΁6 S#(B(.+0P  0P#4P06 cTB 0C@6 S0Ҽ60k.@@0@@@#4 06 0C60@06 -LM RpP0 , R I.0 40 0`&M80 @+(+N 40 BR7 pQ j \ 1! ^3 "Y#0kS\0*! X8%8#80ἆ( 8 XC8< 4 /A!88C8k0 00#4 0缆0hQ38#8 H0ἆ48C8! X8"8C8k0 00#4 0缆0hQ38#8 H0ἆ XA0B8#8(B(k   "$ 缆 hS28#8 H0ἆ, MkΆ00#406cR! 0CZ 6ڼ0 / ! X88C8!Zἆ8< c4 ` C 4 P  \ I0 ,  R3 "YQjk>&MI.0ἆ@0 XR!0(B(k   0#40&0bQ3 B0&LN.V 0G. 0R < S >+ 0 Q00W0&&&&(K(Ko &MI.@0 j 0 ("(8k.0ἆ8C80 00#4 0缆0hQ38#8 H0ἆ<A!88#8k0ἆ0J8#888#8k.0ἆ8#8k0ἆ+R+R,R I.0 EPK R  EI 0 A|    :Ɠ0@-V@Q@F   !I.AQ!ѕ"х&  & BBo0) ) -LP`@? h0P `0P @T @2@V$@T yaratcid -LM$@K`p( KPP K K7p (UKdP 0-SL@` Pp0Q C `0Qp7W p#p6Vyaratcid -L M K@P /@oK -LP ! -L M Kt@P @oK -LP  0-L@P @0 0-Lx@P @0  0- L@P @o0yara -LP ۩  0- Lp@P Щ@o0tcid -LP © 0-LM@KP 6p  <O@PK0謩@K0觩@K0yara 0-LM@KP y6p  <1@PK0莩@K0艩@K0tcid -LM,PK`p0 K@P  R6p 0T 8@P h@ Kc@0TTtcid 0-L@PP 0P 0P0tcid 0-L@P (0P0 000loob -PL`@PP  P 0-LP@ \0P 00 P P 0 QPrbmn 0-LPs@ \0P 00 P  P 0 P0rbmn -PL`= @PP  uP~ -PL`5 @PP  aPj 0-LP*@U d0P 00; P: Pp 0y 0 QPrbmn 0-LP@1 \0P 00 P  PZ 0G P0rbmn -PL` @PP  P -PL` @PP  P 0-LP@d0P 00 P P 0 0!QPrbmn 0-LP@\0P 00 P  P 0 P0rbmn -PL`d @PP  P -PL`\ @PP  P 0-LPQ@|\0P 00b Pa @P 0 P0rbmn 0-LP0@[\0P 00A P @ @P 0q P0rbmn -PL` @PP  2P; -PL` @PP  P' 0-L@P$0P 0A0gnts -PL`@PP  P 0-L@P$0P 0:0gnts -PL`@PP  P 0-PRL@ @0 0-LO@P 00 000 0-@L0P CRAR0 P-L 0R P Q oM |M 0-SL@P T``$P8KhjP Kh<Թ -LP@P Xp`yOP  J `T@ 0-LP@P P=0 000 -@PL 0 0R iPP 0 00  00P?O`P Q $`PK -PPL x0 0R9@P O`P Q #`@@K P/0 0R /dP/0 0R/< 0-@PL X0 0R  N0P Q #0000J P/,0 0RP///I -LM@P ?o  2P0S K0S0 P 0  P`NpP 0 S  R L  %4 PPp Q00  8% H H -LM@P 0 0R KQ" 0  C PP`cNpP 0 S d  3 PPp P,00$0$ $0 84$ H    oP- ?o02 ^0S 0 Sz4 P-L<0 0R P eoG -LM$0@S`PU  K KP,0K P ,pMP 00 (0KP (0, S XP8P mP P ,0 0IJ 0 //  0-RL@P 0S% R:   P02O0P  ,0 0X0X X0 @D0D D0 8000 00 0    d   D  0-@LQP P0Q0 0-SLP` @ 0S P@<P QQ P>Kh 0-L@<PzP0/sP Q lP Q>dP  K0h] 0-SLP` @ 0S MP@<EP QQ :P/4P >/P  Kh( -`LQ@ 2>Q# &Q P Q' <QP&PQ  PhPPQ PR(0S0$00`>S@ /S~ `(`  R R00/R00>R00 B\00S{ R `R  R R00/R00>R00 B\00S0FU0 S  iP0/S0$0 0>SH SQ  0R R R BR  R  R R BPQR 0 R R=R BPQ1 R   P P=P @\Q! P|`FVy0S0(0{r0``000 0` 0 0  0B00"SX0 S 0R "P P0J C  >RE00  X @-\ <\ AQ R\ <\6 &\@aT lTt\% @mT pTo\s\;\'gTt\;\>@pT@;T;\<S0SqTu\o\t\;\" Q-0L  *ho -LMMMK`X1QK0H1 O?KL1 N?KP1 SSS@PL0!S0-S0-S0@S@S -S 0-S>Q@@  L -MLMPR`p^P 0S @0W 5 sWV /R /.0BKH0 0 S* ۙnp@0  i,U< 1P,-+0P K%? 0  K0CW /RW  C B/QW0@C0@T@!BKH ᡙ0$ K@4D 0  K0X,p ,P,D,p V,t,p0ޠPT  -LM`PI@PE3 ,!,pE K-pG dKe0V@p `0 0 `z,p)  T  `0 zp 0PP$K0`p `z+p  2$K6-@K$K+K@ 0-@L  -K0hK -L*zP 0 0 ༧|  -LIMMK@ 2NK00 kPX @AT{ 0 R 2/0pPzf PB0mK0 3/U@ 5/T yT T@AT8A 3 p0S7 03/P Z :/y81pS @0 R 2/0Py$ P Z :/W8 003/U 5/mK(K 0 0C/B 0 0C/9 0 0C/0 0 0 '| |0| 0 ph h0h 0C/\ p L ( | F ` X < X 4 ! -LP@P-  PPJ$0SP  Rl{eP P IPP 4 `PPPH % P0/ -@LMMMKH T! L 7T0 HL00D! S@! ,S/KmKQ_KNKOKP! RK T%`0P! \P4 HL0 @04/@PSoKR_K@HL003/@0 AP(KT@D1L!HP <80H SL D! @! (KT!R00 0 0K/Q P $  0/0/ 0-@LK0hJ ((-L; Khp%% (0-@LI0% 0-(@L@mߔ0|%H 00-0 S @ UT:0/S  R0P0/P0- 00#0 A T0!RSR0/T0!R0/ -PAL@pᆔ`P (GP 1m`P iIὔX`(0( (0 |$t\ D \ ? p-L,M PPT Ao/ -PPL@GE@P@^FP`p @9E@PGp4_h0,p0P4080<0p(L ((-L Kh(Ȟ 0-,@L@ p0GD 0-L@/K0h+ p-L M@P4 00RBS,0 S R$ 1`V/ P` 00 P! 40, 0C40P- `KpS 0 0 V-G)GKpR Kph0h h0 `?X0X X0 7D0D D0 a/8 bL ql d ` -@LP,`EpP V 0 !G,p0PF,p0P -LM@P pP D!0  T`P (0S; 0  HP (0S F!0`0(K$`V00 00KP 00S`  P  P X  `0 7P F( (0( 0 ࢢ  8 , < 0-P@L@20S 0  Q <0 0K0h"l 0-SL( (0( 0d r KhHFx l (0-@L;0 -4PLUp ,@焑Q ` 00E`£P #A焑Q PX@ @X@  0 0| +\ P z 0-SL  P< P 4Q ,00D D0D 0 80 000 0  c  0-PLP X0 0R @P|0 0  0 ҡ { -@PLP` 0 0R U ^P @T @pO MP@ @T C 0  0 D   -0LS@` dPPqPP Kh 0  0,q t 8 h 0-LPC@P H H0 0 40 0RP <0 00 -@L MP`40SO &P@(K P 1 0R0P00 00S 0O dd p IP P zP P 0 03/P 0pP 0 S 00R 0(Ko!0 00CS 0 0pS pPH@4 404 0.(Ƞ0 t  40-SL , 0C!40R  Kh@ @0@ 0-4ॠ, ,0, 0- D 8 8    -p`L,4PP 4 R @, 儑ᄡ  ,04 儡@ 0T:804 80 -@LMP`80 K KP 4 0Rp` S"*,P'0 B!}4 <0 B04 <0Kd d0d 0.X,P P0P 0.D#< <0< 0.0` T T F< D 0 G 4 H P-L@Pp1 `0VHV. 404 S S6 H000,  0 0,0 000,0P , 00/o00"\ R `vt`P* i g d b` RnP`D D0D 0^/}௟, ,0, 0^/ টl ` H < 0P 00R/ 0P-L (00RP80080X 0-@PL80080K0h  0-@PL 80 0R@ 0P4@0 0-LM@P d0 0R@ K0P 00S@#:K0@t 0-@PLT ,0 0R@@0 -PPL 0 0R4`40S @40S,0pP@`B` -@PL` @0 0R@ P @z0P /o40"0\ R00\/| -LM@PP t# Q (K40 Q8 `H0 K FpP @P9삟 cpP 40 Qa 4Y3 <0,0pP<04  ᭒p,WS<W^Wo?Xj ((0 0p 80  )pP: ,00 QV  < 80 P80< R B0 / I@ I! {0 4<,0 q1P4<Pb},y?EX* yp<l?!z4 <0, 0pP4 <0][| |0| 0.ph h0h 0.\T T0T 0i/Uݝ<l L ` H < $  -L`SPp@ T  P A000 $Kk~A 0 0o/  P- ?o82 ^0S 00 St0P/ 00R/ ( P/?o, 2 \0S/00 S/P- ?o02 ^0S 0 SP/0 000R/l-P /o800"00^ R  R8 0-LP @P P 0 03/P P @0@@0 0-SL@`P pP $P p\>0P  pKh7 -LP@PP  PP @p`@l` 0-L@P $P0PT 0-L>@P F00 000\ 0-@L0P {@y@0 P-L 0R RP0S"[o808 80 |$0$ $0 tD 8   - 0LS@`5 LP. @X1|qPpP P  P XP0U UB#10@U"B< P*0? H@,KocX% XpPp@%1< $B @P 20000P X p=P =P ,Ko 0 -P`OLMp@ϟ40 000 0 <0 0@0 080 @Q pA QWpp Q <Q =Q 0P Vr Vr V X YxA Qo Q Q Q Q_ <Qg =Qe ۂPb @PY^ 0A!2 0QR Q Q Q Q <QJ =Q@ D⺂PA X Y<0A!10 Q0 Q Q4 Q Q <Q( =QP ☂P X Y 0A Q@ Q Q( Q Q <Q+ =Q L xPp(K`PaPQ 0A QSS Q <Q =Q ]P`Q 0A QST Q <Q =Q HP X@QQ Q Q Q QE <Q =Q @ 2P @P`Q 0A QS: Q <Q =Q P @^XP<F`Q A QR Qg <Q =Q( P Pf@Q 0A QS Q <Q =Q 8Ps`Qo A QR Q <Qg =Q ؁P_ @`QY 0A QS7 Q <0ASPƁPSLQH 0A QS= Q <Q@ =Q L ⱁP7PQ3 0A QSr Qv <Q+ =Q ✁P"`Q A QP Q <Q9 =Q ⇁P> PP`Q 0A QS Q <0ASrP @P`Q 0A QS QU <0AS \P P@PQ 0A QS Ql <Q =Q4 EPPQ 0A QSy Q <Q =Q \0P`Q A QR% Q <Q =QB P`Q A QR% Q <Q =Q P-@Q 0A QS} Q- <Q =Q lPwPQs A QR= Q; <Qk =Q  ܀PCbPQ^ 0A QS4 Q2 <Qy =Q <ɀPP @@QJ A QR$ Q" <QB =Q |ⳀP9PQ5 A QR@`PPQ) A QR@`P`PPQ 0A QS Q <Q =Qq ₀P @P`Q A QR Q <Q =Qs dkP@Q A QP QI <Qh =QE VP`Pp0S400P(K`Q A QR Q <Q =Q] 6P4`Q A QRt Q <Q =QH H!P`Q A QR Q <Q =Q  P3@Q A QP Q <Q  =Q P}`Qy 0A QS Q <0ASp\PiPQe 0A QS= QU <Q] =Q PKTPQP 0A QS= Q <QH =Q P@ @P Q <Q\ =Q P0 Q <Q, =Q TP#@Q 0A QS Q <Q =Q P@Q 0A QS Q <Q =Q sPPQ A QR Q <Q =Q d^P@Q A QR Q <Q =Q~ IP@Q 0A QS Q <Q =Qq 4P 0 l < d L H D H P 0 ܾ \  `  h , P T h  l  d  p Դ  , س 0 ܲ 4 8 < < @ | @Qe 0A QSe Qc <Q] =Q  ~PLTPQP 0A QS& Q$ <Qk =Q ~P?PQ; A QR Q <Q3 =Q p~P *PQ& A QR Q <Q =Q ~P@Q A QR Q <Q =Q z~P@Q 0A QS Q <Q =Q `e~PV @Q A QR Q <Q =Q M~PPQ A QR Q <Q =Qt 8~Pn@Q A QR Q <Q =QX \#~PhPQ A QR{ Qy <Q =QJ @~PFPQ 0A QSo Q <Q =Q }PA R} X( XzP<RP  0A QS Qm<Q  Qf<RPE $4 0X ࡖPQV 0A QS] Q <QN =Q }PE@QA A QR Q <Q9 =Q $}P0@Q, 0A QS, Q* <Q$ =Q t}PPQ A QR Q <Q =Q }PPQ 0A QS Q <Q =Q k}P@Q 0A QS Q <Q =Q dV}PPQ 0A QS Q <Q =Q} A}Pw@Q A QR Q <Q =Qa ,}PqPQ A QRx Qv <Q =QH T}P~PQ 0A QSo Qm <Q =Q> }P8PQ A QRN QL <Q| =Q |PTs@Qo A QRI QG <Qg =Q  D|P^PQZ 0A QS Q <QR =Q |P I@QE 0A QSE QC <Q= =Q |P,4 R1 0S, <SP) C SR S0<SS@Q 0A QS Q <Q =Q |P @Q 0A QS Q <Q =Q n|P@Q 0A QS Q <Q =Q , Y|P@Q 0A QS Q <Q =Q | D|P@Q 0A QS Q <Q =Ql /|Pv @@Q 0A QS Q <Q =QT ( |P^0S @Q 0A QS Q <Q =Q; {PE P @R~ 0OP@Qv 0A QSv Qt <Qn =Q {P&e RPa =S^  RX  RS P0SL L -LP`PU@5pP  ᶅp P@ 0-LP@P0P0 @00 -@PL 0 0RPP 0 00   `V 5pP  儅pP00PP/0 0R /p P-L 0 0R P`U V 5@P  UV@ P P0P 0x D@0 000 0x $< ȫ ` B` 0 F P-L\0 0R 0S P4 404 0 WPTة ` P- ?o02 ^0S 0 Sx̵ P-L400\ 0SNRox -LM$P@U`  R t!0 P 0S1K$0K P $PP4pP 0 0 0KP3 $0R/ kP( @P% PUpD7P$0 0@ P Kp$   0 P0"S D D0D 0 8K"70"SĪ | L B/ 0-8P8@P@L0 00耳P0SYV갡 P/?o8  2\0S /0SP/ 0-@@@LT(@@ @+0@@\hL 0-@PL (0 0R000DP/0 0R/P- ?o02 ^0S 0 SrԱ 00-SL@P 0$0S 0  P 0  P tth@@ @@0LLL@@808 80 ܟ ğ ZTPZ | -`PL@3@P@4PPp @3@P:6p \P@GK 8P 1 0RpP 00S 0/0 03/@P P  < 00CS 0 @ 0@S  P\Kh @w@, ,0, 0 XL <H $ | ܟ 400 0-SL@P8S t4 <0,04Q<00P0 0 0 &(뼝 l  -LMP`Up@$   P 0  tP (0S @l @0 PE00KK$ $0$ 0 ܔ М 0 B -PpL4cP 40S @,0a, 40a@T:8 408 h -L MSpP`'V@ T 00Q @00 K( EQ@?T (  Kip 0  0F/력P ( 0P 00R/̤ 0P-L (00RP80080蔤 0-@PL 80 0R@ 0P0@0H 0-@PL 80 0R@ 0P4@0 0-LM@P d0 0R@ K0P 00S@#:K0@ꔣ 0-@PLT ,0 0R@+@0 0-@PL80080K0h 0-@PL8@@@0 -@PLP |0 0R`w40S,0AT n@@ 0  0O/࿎< L x R -@PLP` 00P@ pG8040S !,0X <0, 0a<0@0@8@D D0D 0S/80 000 0S/v눡  x  T 0-LM@P P0 0R@ K0P @K0\ p-L M@P 1 0R KpP  4 P"80,0!aV# P ,0P <0@04<0KphdKphD D0D 0W/80 000 0W/$\ H 8 l P- ?o02 ^0S 0 Sꠞ 0-LP@P P 0 03/P P @01@0 -L M0@S K  ?P  $0SKhD -LP@PP ݁ PP r1/`l1+` 0-LJ@P $P0Pꬊ 011/ -@LPp`P P1S„  0P 1.P1 p` P 0808 80 AJ$0$ $0 BB| T 4 p -L\ ^ \-QRS  0S0 00 QL R S "  0S € 0 0 0 0 Z P -PR0L,M0Q@ P 0 ` p Pt p ` 00R0S00(Kp`0 @ 0-LM@P0K0! }0K0a }0K0a }  0 @ SK0 0-@PL0KM }   }![  }0![    SK0 0-LM@P 0b",4b4#K0! } K4"40a } K4"40a }  0 @ TK0 0-LM0K@P v}0| a! $a$"  k}![4"40 d}0[$!$    SK0 p-L,M@P`P 0S R00G$P KpKph.0-S 0  0 0  00 0 0 e P0U00 R 0S U00긐 0-@L T000 0-@Lp00T000$0% 0-L@T 0 0-L@T0 -(0( 00L0S t -(0( 00L0S t贰 -(0( 00L0S tt -(0( 00L0S t(0@-1!0 ?^@@ !0S0&\ 0@S ^ 0S 0\ 0^ #0 r? ?PPlRP ! @P00 |? ?P 0PbR P د @0 0 /Ȯ 0 0 /ᠮ 0 0 1/x 00-SL@1/000 -L MT0T0 0@0SP uK  6t  /C -L)t- -L5 -(0( 00L0S tdAo// -LM K" Kvt -LM K$Pp Kwt@ -QLM Q Q  0  K  K0 Kt ^t 0($/(/$/ 0Y.<+ < 0/(/$/R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@! P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@P}8000 0@0 0#2 /UUUU3333R/  BP0P BrA0A/  f|: S0@- N S  Ss00  Sw00K r0-00w0-00!=@SP@ V F SW ! Ss00D r0-00w0-000S> ) SS Ss0'r-w -  !P> 9: P3 Pt 0 C   0 SC  Sd00  S@ ?00S-0 0 S-00  @x0x00AS00AT 0 C- 0 Cx 0 CS0 SA00za0-00uc00rp00ol00lb00i -L7uPPP3 w@S P0r0S00S$ 44H 00Sv0S 4H0 0+ C :R :S?p%:p#48` CR0 R T0 0 pSpp0S@(KvPd3H 00S 0:S T <⅜?p H 30 (K3H 00S 0:S n;S 0R0D0 0R=ʸ"2 H 00S 0:S QW \2H0 0:S X XB~0T0 0R' :R$ 0 R" 1H 00S 0:S H 10@0+ Cb^L !T0 1!0  ~@1H 0 HS]L0< T!@0R0 0S H R :R 0 R  H 0C0"00@t^ P< L0d H  4p d X T L r pr آ lTLo H4 l ,l ` k k  j  j @ -L Mb2`p00 S" P@T P2P@:T60S" 000200S 0:SG?(K0X000P1j8Ÿ -Z cP @P-T@" TQ P PhPn -@ hP 0:S" 100S000(K0Sx100"\1 X0" @10Q 10P10:P W00 0 000 0  :Pz 0Sv D"X0 x0?ljꈉ4HX ș Dg XX L ̘ g 㲇 -L$ -LQ* Q Q  R !0 0R 0 0 ȀR`q@V PT 0 h0h h0 ஀@PTAy 0 ;yT 0 ,f f ,f e e e -`0P @ 0X00 TLp:@DV@1 q 0 0R ! 0 N#pP   Ix0 @p -OoPB@LMT`p"P !PP 0@0 @@` 00@0 @P HKx0@0@xp$Px@pxp##@xpTH00 0 XD-$$ 0  XꔂDQ0  Y0 YQ  ;Y0  Q-LP```Mk00@ AT NkV@aR! / -pRLP` @@T T !03/pWG / 0-@LP#T 0K0h/0 -`QLp@P RP 0 开D  p$`,@(P 0Rx00 -L MP`p @P 0U0dV X  WPppH0PP  KP-#dd p-L M0@P` 1S ,0S tp$0S mp 8pKp 00-SL@ j0 P @0P "0 0001 1 00j00w 0 -0@`LP 1S ,0S *p$0S  #p\ \ #&\ \! R P U _ U  \ R  R *T   _\ R(K\ \4 \ \ \H0 >3 SR$K D04 SD FT <P40!R 0 H0 0Q0D @\V PR@  Re R  RV  R T R  >SV‚ P @k PRF UT \I R*T_ Y  \ R Uu 0>#0!> \H\] \2 \m 00DK>SR`40 cKcK` P0cK`U $   L  8 D0&0C>SP40 P  P0.!!># R% P>S P!>#"RPE 01S400C040 0>S0DKR` 0cKcK `P0P#K 0p0 0P>3 00 0040A>34PA0E pP00C00V { -L,M@ `p% < Wk<%  \ o\w \4V- @0WWQ>\ \ #&\ \! R P U _ U  \ R  R *T   _\ R(K\ \4 \ \ \H0 >3 SR$K D04 SD FT :P40!R 0 H0 0Q0D @\V PR@  Re R  RV  R T R  >SV‚ P @k PRF UT \I R*T_ Y  \ R Uu 0>#0!> \H\] \2 \m 00DK>SR`40 cKcK` P0cK`U $   L  8 D0&0C>SP40 P  P0.!!># R% P>S P!>#"RPE 01S400C040 0>S0DKR` 0cKcK `P0P#K 0p0 0P>3 00 0040A>34PA0E pP00C00V uG-MRP 4@  lD8Ȓ`Fq>SU7 U :U nUT U[T 0 SЍUg  U L&U7 UF0 T0 U<  SU 0U U. >s  U U U >s < P5  BpB Ǡ \ T0 V 0 U  "U>s > Q UpW 0 P PPP  >S UP >P>s W  X 0 rT >sRP c8Ѝ -LDMpPL A/P P00QD0 9@W< 00 0 L4 0Xc 00 P3`@ 0080 03H0 9 T 80000  _T  R?00_T@@T 2U  X 80_ X00 0S RwA_EPEUH0L 00000 D0WPw 00 4 p@@0S6 TR  Ta `P XD  X} V2U X@ 800000_X0S6  TQl 80000VQ# T@ Xp 4@p!0  `VT@Xp T5  T@ `PP00<00!00U` VQ Tw<00 T<0PPj <0P,`0 0 4 jP000(K<0PPP00<00`P00`P,`P0$P0P0000l -`LM0Vp0 6*0Q>3Sq S1 Sl S@n S S04  E0@P0 Z4`0 Pp0`T:(K@0>3@1># R@004P  P I0@000 U4P0F>SP`1`>SP1>3"SPE P0Y 0P  p~`;>S@04  E0@nP0 gZ4`p 0YWP P 0 pJ` S S S`p0TH:(KS  G>S?R ` >S G?R `0 p`SYhG-RM,@0 lD`Fq>SU; U DU UZ UeT !(PS P  ЍUu  U T&UG UMpŸ TUE P  S U U U4p P>P PP U "U U p P>P PpAPPYPU B V \ TU  "Up P>P PPpQ >S U PUX }PPY P \o T >RŒP bpP>s Wp >SpPQ> Xp o -L4M@ 4 < 0 40 D #(0 8 Qp @XLp0A/4 00 0 000 W Y 804# 03   _Y RP T "80   _@DOoRB  R 2U  Y  _Y RQA_EPEU|"0@00\0#Rp R0 Rk R@m R R0  H0@0 Z0P0 Pp0PT:(K@>3@1># R@  I0@000 Z 0E P> P >1>3"SH0 Y00  p~P=>R@0  H0@j0 cZ0P0@ @@p 0TWP P000@ 0pHP R R R~Pp0TF:(KR  G>32P > G? P0 pPRWe -LMϟ` ^ 0 x   l?  R(000   0  Pl 0 $S000 0 0 0 0h |0 h0| S<Qp  S*t ` @pB`YpGP PR@@ W:p44Pt`|0U P0lp`0 h0吀T0 |0d X` P0 \P HP P@@  `0 00 p ` <@ 8 4` D \m0 m A? d 0@ 0@d   pf0l0 0t I U" 8-x0   _UPW  _UPPU <TI  X  _X RQ>AOD@DTj|0h@  C/oQ" R :Pd   Ofd p Jfd  0t h YPh0P d`Rp 3h Pl00 Ul0 R  Uh @p X2  Xr W9;T Xa +x0 _XQT  UtK   00 (KS0 i00 0X< Rh " X* @pCl p t` `YpGP PR@@ Rh;3Plpt`0S 0T*\0 H0 @0 <0 80 40 0 0|` x d X` T P 0 0 90 :0 p A?p  t  0 x 0h0 0l 0|0 0 0 0 J W @P V{  V Ud9T V  |00000_V0S  W0I  |0 0000_WppW 8T  V |0_ V00 0S RAOD@DTg00S l0A0 0xtp0l X`lRh00 Wh0 p0@@x V  V | 000_WQ  V00 !-h0h` |0 10 00 #00  00 p00 p0p'00TP UTG WUDG p ` xpt` 0 iPUp`d  60 TpWF td` 0 pW@@ XN  XL` 0pW\F UCi0S.p03 !/ 00-SL@P* 1ƒ!#S 0S 004000000 fyPP0N 0-LM0@SP0S* P  QK0 P 0  -LMP `0 0:R00 40 ):q 210S. $yP) pyP 0 W 0\ .#2\D >hp00 塡*) rBpp0` V< 0 0 T` P&  L` P X :Q 9 000(K0^S D  ]S -S-00p-p0-00H )  8 )  @ S* ]P3 R3#-PQ\ -P] [PR:0 `S! 0!*-Q 0    0 S H :R? =R0S0:0((S0 00  0-S]S0S007000= 0000HSE* V =R~ 0S00 ` 00]S 0S 00X}:08S000]S-S0S00vfp`| _P 0S `V0S000S000S    000S`0S* p@P  I  0 0pCc0S  c 0S)P 0S 00HS* V :R ]R00  ]R-R 4@ 0&   0V0F|CzR  ]R -\ V0S 008000\0<00 -0 0-00-000 S 2* 0]SQ0$  SJ4p0c  c ^ ` Br0C0D R! 0SJ   ` ` @ 0S * <00 " 00 00 0C00SQ p 0<b  pRWB00  0R(Ko^`2000(K 000(K0S 002000(K]0p]p0]00H  V 0D   ]R}  0 R:3Y0T A/o" R S `p   Q  \ SY@0000 00 DB"(Ko1_7 )w0 0D RFSCB& % L@L4L0L8KK@JJ$" hXEE< -L M@  1 `0P8p(0  0 0  0S 4040( 0R  K t  0U ] 0,Kp*K,PK+ K*0Kp  0 7L<h -pRL@P`P 0!&^0pp -PL@`  aH0DP"%T R!0@B @@!I 0` -@p`LMP0 S 00$K0SV 1 V00U U0SzvNMLutsrq#mlkjihp`F0`FPEp  B0  B$Kk*`0 F  B0 SP "0SC   PPEp`  B0` 0~  B0 PS "0SA  $Kkp$K \0 000$K  B A   B ,> -L4M욟: 0 RL0 0@`00 y0 Sv 0T0 0<0 :8 0P0 H p唚P0 Sz*|Q Qu $LXP2"0/.,)(&%$#"!      y^, 00L00 0R/(K0S008000( 0S:U0S008000<0S0S 80 E Q*4(H00000 Z 8 000  0(,(, R*A?QP{Q P>Q:0S00|700000 0 0D @ G 40K010K0 740 @D  00S 006000Q:0S006000 D0 Z 0DQ 0 S*0)S T ) Z 0! Q*00)QL 0PS005000E k 0(0(0 tZ 0 0Z0 0S 00l5+Q000 :?Q {Q D%P 0+Q ?Q {Q>0 S*,Q 00 S *0}Q0$0}Q R00S 00P 0m*Q0 S  B0 S  B0 RPV*A?QP {QORLHC 0PS 0 009P*hß@ H @ Z 0Ss L3000 0 U < 0R0p 0S8p Q 80 E0S0H80 2 "0<0 0 S]  B0 SO "0SB  0 0 S/  B|0 } u0  H B*Qn0 S\  B0 T g 08p P0S 00:  B0  A   B   B0   B0 *>0000 E P H000< @ @ 0RQ X 2Lh=H=p;`;4;:$:^ ]t9H98775d32 -L4M⤗ǟ  S8 < 0 @h Re  `ZD` U:L 0H0 D7Dw0 YP@0 pC0 S~* R 0P\U 7U L.U [U JU D0 ZD 0a 0 S: 0!  Z*0Y20`S00pp$PE_oR YU@D0S 0S005000 00800 0Rm(K5U} N>E0CSM x 0JR 0S0050000H Y 0*Q= Y\Q `0P\U0@ S000  P4\Ux0S  < Ri*UP0S 4 000P4U 0S 0R  B0 S  B0Y  BP`h 0S 00W0  % 40K010K04  0 S-*R \R0)S H0) \ Z d0{Sk/0 S*,P 0PP$ Z*0Y\Q Y  S\R` 00Y0S 00H2P000`^Q @0 w `(,,( @01P0000\S0)S  B0 G Mx  D`F `;0(0  (0 }R Y0S 00Q 0L0000#R ,RLP "R>310>#R R@0P`@RP (pp(p 0>3S S0Q>31S B R R R SRdD `1C Lp(p @ 0 81 00 0  A(KR(D 0L @ 0000 0  V(p@` @X YP<@ 0>#R0P00L @ 0P(K S\(Ee$&% -LM K -!MLM@<1<0pnK`FP@ 10 8KԁP 0 0 R6(K腮KJ  ],0K0# T PH 墇P\HT PCK|H04TK 0PP 0ᧁP,[P @T\H᷆\崆lL8 -L!MP1!0A@P t1( 0K`pxPCPノKP 81lP7$0K 0#D @ < 8 4 L( .KHX PX BP%THT PBnKp `F0,TK 0PP0GPZP @TTH0S h  TO( 0R $KTF,$00L(# X !! -GMLM ğ  ` 4 0V0 4 @U F^K PE 0EFK0C.K;ApPx4S 0E QPT 0 HPl40?PPtpP~PypTp h~Pplh?P pT h Xt40 0R(Kxb`x4PSPX+ZP&ZPx4$`0S b`/s~ "P4 1 8/^~PppT  =PZ0 Z"0$ 0 $|1 x!P0 p1 PLL x444  4 !0P4 P10$ 0 $0 P0 A1 }pibxxY,L\  T @ < <   `  X L D -LM@ 1 0p`K0P (0 \T( T0U0KPK @K@P@0:K}P*[4"48#807\/0@0( 0R K0U0K  KT#\P\@P-L -ML M00Ɵ| x 4 0 4 0 $ 0 4 @`9-KEK B A$ Xd Td Pd \4 0pPH %5 $ %t4 F>K 0CG~KCK$ 4 pGI pPP# > @Po?[00S+ [0=S0`S(X  V``V `ሀ]xD[0#S@ @T P40 0R(Kt40Ct4 [0 P44K00 @4 P$[ P0 @44K00 3 P |3 |# ZS# TSt4$0CRt4 e  0pPp4 CnKP# `Ft4 V w@VT0D00lT dt 4[ Pھ0 4CK@CI Z34[$SX SV dV DdV =dV 6 PPfp$[R&3M $4GNKt4 x4P@Z|$0  0 p4[ S   P t4S6 P 0  p`  A~P P P{4Z0S  4xh{\t LLh p \ D8 T <   `  P 8 X p -LdMP !px!P@K8`#8 x 0  0d l0 ` \ X T t0Kp Kh p 巃P3t0Q @,@K@*R@P 0S t0 @t˂x00 0R(KlM0  @@娂 0J{@ L 4X X < -@ML@K -LTM44A4` !p!P@K8P#8 0 1  0d l0 ` \ X T t0Kp Kh p 7PtQ @,@L@Qt@0 @tU0 0R (K@@ (z@L 4 -@ML@K  -LM+Kß̢ 2 0 p2 " 0 ;p0nK2 -0IP GPW 1[ S S S| S ``# @ Sq S  000 S S S Sb  R 1[R@+S1 -SlQ[U: @U2S  Q+ 2 _0_o2 0`+SR%0S* @Sa2"LPP i PpQ[U @UO2SrQcP̂Ȃ 0+S -S/ UPPUxpx? XPr;@0 S S@0 S S C0SR 0 C0SQ ^_oR0S @S2"PP`  C_o`R20 0R(KUPP2 0_o2 R@C| Lh -MLMB@  0 0 R 9  PJ K A0A0C.K;PU9SR NK +DP+HB2p9` R9 l9HP@ #=K 0C9 P-8: S1 @|1 )00,-90 0RJ(K88d`P 0 @P 100S@0 )0@0;}P 8S ) S 0 )0@00 )0@08 d0 )0@00 J@Lx x  ( -L4MD@KP`p iW H0K< PH@T@T 0 !PPHA KH@;P KP( 0-L(M!^dd@0 @0$ 0  (KKKKKKRK 0RK0}L 0-L(M!^``@0 @0$ 0  (KKKKKKRK 0RK0[L -`@ FLPVp 0 ` 00A ^aAPWAAAP7AQ0 S A@P 0 R:0Bp BS 0ą0S  0R:0B00 00 0-q@pP?0@XL`P ?XD? vO0ST?02:4T!2*0qa p `R?p??` S*"" P* U Q*.  0RS* U |00?0Q*00@0  % 0R ? S*: 0 T!:  \ X T L H  -`p@@@0@PLB,00 ₋@9 0-LM @@0P ( @PP K0  -L,M 0K00K 0h0K0$0K0, K(0KN7P <,@($ K@ 0K P  -L4M0K 00K0@ 0Kp0$0K 0, K(0K&7P $K00,( KV 0 -L\M!` P0@h P DK !@  @ 0 9p` l(PPO @T1Tq0pd0  0   @P7 RP%TK(PP0K0X0K0T`0 dZP LKXP XP0Sch00 0R(KLK  pP  PJU00L8 $  -LKM1!00pL1 000 QhdPPN @L1La0`H1 0   :@P6 gRP%OKPN?K0=K0< 0 HPM/K@8 @z81SuL10 0R(KMK P 5RPU00%Ld ` d L 0/ 0-L M0 0@PQ00  (K0|)K  0 ""C C^0 0 0R K00 !PP0L -FML M@0 0pmK0(0 和 PPBNK@Dᗌ+  Pʈ$ T@!T$@R( 0R KHL -LdMp`T0T0 P@K0(0 W d{( 0R KXL^4]4 0-D@L@M@PK %`L 0K0| 00`( "4`43MSZ!R Ѝ/ p-L$M0 0P`Q0 0  4@Ky0x( 0 ""C C^0(0 0R Kp8 )`P86DL -ML M@` }K pG( , 0 a`P70C X04+0R0# T @CK HP  T0@T_0S@US@,(50 0R"(K+S@CSX@ 0 KP02QNK @DDp FlL 0-LM K -LdMp`T0T0 P@K0(0  >( 0R KL -LM@?00@ 0 0pK00 L  ppl *g'?eaP  .P @ iH)gt.P$D],L d nQi$@b")b) h*̠ ` (Р! xp `t!&|p 썈`@ lA|p% pj*\.`,Ġ `hqj,$a!  X )` (naTa)P-P'ࠐ P@Xj*,Ġ bQ!.i, &`A h(j.% "p L,Ġp`a!.ht,` $Haa *Lp Dp` P,n*("  agX'`(@* &%T@匀 \a g%) jH*$D ` @L`$aq ! %0"Q0 ?P0%0?SL`@@e }FPePU*K0W@@pG $KkhF -LM 1P0@`0)K 0 R001 13R0 0~? S pp 0~? S (KV `F0"01 13R0 0RKL p-L$M0 0P`Q0 0  4@K0x( 0 ""C C^0(0 0R Kp8 )`P8aL -QMLM@` I~KpG0 4 0 `P70C X04+0R0# T @CK sP  T0@T_0M@M@4050 0R"(K+M@nLX@ 0 DP0]RNK @Dp GL 0-LM K -LlMp`T0T0 P@K0(0  >( 0R K<L 0-!$$$$ $0 0#EgܺvT2 -@LtM@ lK7E 0l `* `&i{@ `h@j *t  "jdP | b)&,`Pfkȇ" .\@b+nP,P%X@lˠP] .`@!n@T`dL% !P` X`e[bhp 吐 $ 0l| `dK ` L !, 0#t0cpmvmzNS  $Dp " 0pl0eYpx0`pl0m4n6*=30艄@X0 +>Cp3C(7C0!H0pb+>C 3C7C0 0a{ 0ᄠ i` `&@Ixp p`k ` $a\,`P+A0AA80e[m46*=30ꬉ <0+>C3Ca7C0 d0hL p`p'+>CdK 3C` 靅 P7C*0 " . `;Pxp T)0 0bpjX0 )p \p (i 0荄0 @%@a @$@0 hpe[ pdL p(pp' p`h `z `$``& `@dK fiP'.0Pg{ PnP&lPP%fkP e]@.nX0( @ dIp %D0 .p+>C4x3C7C+N0N∀0Nc:< "e[ g}`$``&h`-d dK k 'aa. 8g{ nP&PP%PHfk [@.@@$@Pn dJp%pp'pDe[ }`$``&`4dK h' <,g{l̅P&c; P%Pb x 0fke\ ,@. "`@0倀 )LPE刐 lˠ!D@ %.p@pb@ ጥi 0 "g \px0e[*@ `@$b{@`` hpK0! p#0 p0 a;Xgz$P,dKLP'` `,g{P`fi! 0aT0c=&@P dfkPe\# pc;8py% e[4a'`,g{l @!0f$T@i`@ 0`aȅ@ Px @$ `@0P` 0# HI0 `P,pP%c<Pp@ " lg8pZ-x t|``lˠ᐀) p$`p'xpP cˌdK0@ pipp (K -`p!!?P@eZL@U@@ @ >@eB PT @PT(  G,Kot>@0@0SP -LM`@ 0 P?@ n##|(0K#4R &K!̠!'0K$K!4 n"K B!K#0K%pK (KT 0F ", S "$   0R` Kh=EL Q( 00 R( xB@-d @4  R  *4 8/x x0 S\ R `0S Р@- d@ 4 *8/E+4xB:/ Q0 !( /46S//0 a 0c <c -pLM,@K4`K $ P0pp4 0 .pQ pp0,4 8 0 -pD pp 0,4 8 0 -p7 pp 0,4 8 0 -p% 80S0C  BRS 1 ! 0S*̠p0+4p 0 8 -p`(KD0 Ss -ML M00 Pp0@.K(0 nKp`F  <P"#3( 0R! KK A7p nK`FdPT t<T"(@D@0*k4uDIJLHtHP 0-0@L@+PP0aD@Ph -LlMS 00 00// P p-LM4@K` PPV0E>S 0!31 00 0  Kp>SH 0!31 00 0 C00C00Į/ -p-L M P@U0@ ` ` P t0t 08 R;0Kp a 0 ( ( ح8 \8+ @-XQ -Q =QR-@+@R +QoQ uQ gQR   +S -S =S000@"    000000 0@-0P AXS@ oS; uS6 gS 0+S -S00PXST 0! 0P \PSPQP\     0 !#  I@ -LLM@wTPp 0<`K LKL0 H0 D0 @0 @ @_`P 600000$X0 0 \ 0`` pa0HS  v'}pC~p `+X@ 0-Sa=XX00X0 0|PXA@ Q񏐀~}|{zyxwvutsrq%onmlkjigf aII00W  |<W  ;I?S R:``Q h0 d QP d PE Bh0`  \  =Xl +0H?oY20S Rv*W\00 X00 R:``Q d $P d PE B`  \0T0 00 wS8X!=XQ X R:``A h d0 P` h @D Bd0`  \ a Y R*W\X0 0 X^ ,X4`P =XXX 0X0 ``Ad P+ d @D B`  ``Q d P d PE B`  xgA 0PK  yP0@0SmZA0"S1Ds `` RA@`NA0@`0 `(K>0SV-+`` h!` @0 (K`X` p+P-@ +0B XR R p0+R XR  -Rpp p X0@PPQ`@00@0`@ 0`` @0`` 0  0-L M K  )p` K P-L 0 }@o`/00/00/00/ 00// ///00/ // / -@LPpe/`+/V Pe 0 000_P7@P P`raP T000op@000T@PN@Pp h l -L@r\P` C0p080p0 `@40p0꠾ 0-0@LTP` @T0rS PKKh{yP0+SKh:8jX -L0K$M #, K_D!0P $0 ( J 0100S4)p@$ P 5 0$K0( 00S.$00K K @,0 e/?@4h0( 00S d}$?0@K,n$0긟4-} } } ,, -L$MK 0,, 0 K 4 !0P $0 ( A 100S4p P 0$K'0( 00S($00K K;4 0,1\?|0( @00S d#$K?0@K, $0`+$++ -LMT1T!0p`0S6<1PU 0V:0S P@T0S8?0P0000S  0K(0  ?0S  ( m:pP = PK7Kdº\0PUL຺80 0@ $஺Мp))X) 0-LLM,PKl`KD0%0 p@ pp@ (Kp>0S @WppP 0   pp pp@ (K0Pp R@ -LLM0 PP/ 00 S 0/HD$K@0040 S0+$D$K@ 040 UTU0P 0 RM Z00 0X0? R 0 0`p 0 0#K0@D0 0^p3@0@0 90P0 0 S"0@UU dK0 @ 9U00T0ScK , 0h"pR0 0402@@d 0 @p9D"?PL<,P@ 0 S@ T(K0+4B$K@040 ~0/$K2040 w20@0 P0PJQ0QA d 0`p!&?`pA 0q`p2`Rp 0X0@TP X DK 0 "9P0ZTP @UX Uc#KSR d 0 9 D ?!(0 4 @0 @p0 X02! 1`X(?pP 1(?! 0#K0@D0 %GzGSQp H  H ( p , Qgfff@ 0d #K0@D0 4000 x0d 0#K0@D0 @(K8P00 P"`!_reD0p40@!CQe/I1b 1 @ 0E @0 0 !0 q@@2`pIG-0@Q帡MQ:\f ` V2 qV3 1pGV \* 0T TSQЍ\` V 0qV 1pGV^@T @00`p 0W``p```W 0X W0p`d0W` 0\ W0 Q0#0p`*?[!]-FKR 0S0/0 R P// -ML M @B^KPEp`+( P @ 03/( 0R KdܑL -L M@`P``a V00 p!5SP+ PR 0SQ  0S0 B@0000 P00$ T3   P- 0   0 (KP& T  00S"Od    `V *o`(K0 ,; 0 @ -KML M/P"p `@0 T( /T  @@T/T  U0 0Rc(K^7/T3UU0@/T p=K 0C4 @$0 P 0   R  5 0W/S 4: S% S 0 0 0,0   'CNK+ P 0@ (03/P4: SW/ 303 101:X;/0@@0c`L -MML M`88   4 0尠P@ 0 p4 5;T&*0U@& @R0 R 40B?o24 $00RU4 0 S4p00E0+0S004 04 4 4  0$ SrCK +2 0@ 0 3/ 4S 0@3$04 :/PG   ß0 S00  0.S V 0S0 SYY4S 4S K4$ A?P4: S $P I0HQ/03 10I10$p 0 0P00:/P0 @4   2/4Sz  0 K$0 AP4: S 0$0 Q(K X:0S0Y0S  0}0Sd CK +Pd 0S + P@O: 4/P 0 4p 04P0 40- e 0.Sb0SL 0.SI V\ P 4p0I0 ;P5 40.S0 @4 : 4R~  `K :0/0 00cRxzQ K @   B  0Qv R r ``Q=K 0C |갇L?**[!-]0 @ -LMMnKQpP  0PPP@PPP0S @ }R& R [R {R R  c(K @]RR^ @ ]^^ ]^^ QAP?{S }SQAY  B0S088  388 T#:0 [S ,SQY 0 E S:    0 S]S S  T*00(K0]SS -LM 0` Pp 0S0 0%0{S @(K S 0{S@p0 DP 0 }R R  K( K7 0 -LNKM @DM0  ^K     pk \\ \ɌRB \  KP \K\@ -`LP@PTQ@D PEP@DP t0000 S [S \S ]SP/0S/*S ?S/Q0 S 00 0@-@@0 S0 #S3 C SP0 S "S@$ T\S 000S \000"SP @0@0 CR S 00000 -QMLM 1 ! A0P@ Q`   0R/K Q~K pG G0K R~K#  p x pB~K0 \P@00  0p{L(h h `k @k < -LM5u0$pP 500S U0KP#S#t60 0 0OP@$f 0S h%` @ 0S @#S (u1PKp " 0@S0 0 40  0Sn ԔtԄԤ p 0 S 0 "#0S $ 0000@SN  -P  -P0 S 0 "#0S $ 0005P}(K -P0 S 0 "#0S # 000 -P)0 S 0 "#0S P# 00010[#S 030@ R X$0Pg  (K0 S S -P0 S 0 "#0S " 000x ~-P p w-P;0 S 0 "#0S1 0" 000Z⼫(K0 S 0 "#0S ! 0@00CPd60@S0 /@(K| 4-P0 S 0 "#0S     [>@`B20p0D0`00 2 0S@C. ` `@`F v0` [0 ;`0 0 2@Y0`0`00C0  ͽ [@` @`@`rL_ `U _ _ _ \ h<Z @, 0-LˠM0 K 0-LM@P@Q  0ˠ0P K0F^p,K0 P ꨇT -@L@0pS`"@@Q%PPR t@P  ჾp 12c1NS@*  rp jp  -`L`x@ӭp0@P@T \0\0 R@@ĭ8 P00ḭDhd ȅ -pLp`@P᧭ @0@0S @@n- R"@dҮ@@ؽP001@Ⴍ`gdDD -L⧽0 00fd -`HLMP%pP- 0S 0V "  ޿U(K 0K⑨0P$0  R@㰁Y&R 0 ㈁ 0R 0Q dRXRHHR 0@0(  ZG B&R/&hFXKHAT x U 0w T pw $T ,T S w w pV R q -BMLM 4ܔ0ğ       0L D4 0H 0 @4 +0DjP08 4H0 4P BnKCNK `F@D\ @P 0S 400#S @T\ P 0S 3S0PP\ P 0S 3S0PP\ }P 0S t30  \ n0P 0S p<30\ a0P 0S p 303@F0r +,`KT(pD& \ G@P 0S +PZ PZ \-Px" p S-Pe TT2TT0 $uQZ 00?^0 ^; *^ 0 0Q?^ 2^& *^T T 00 0 *Q .W Q1 /Q 80S RP ?^ ^<0 /W (K[^ \^40S T0 [^W /W TL ^^!^00 PP T X0  ` 04P/S \S U T0  00Sy -R Y`T0  Რ00]SVX0L SPPPT] pe fT ``ᶠ``]Q``V \Q 9 Y YW= /WZ .W D0S @0Y3 80S 0Y/S- [^ \^+40Ss 0 000000 0 0mUT  `(KLPPT\^ *^ 80STB 80S0S40D0S @0Y 80S 0Y/S(K H0TpC<0`040 00 0  0 P/Z T00 40S <0  /\\h@0c P0-L@ P w-0@00Q 0Q o@a0 E E 0-@lLPm*0PT  0@b*0PT   0D- 0 D D -LMp0!@  H"  0 8 ]p@\ P c aH20 0R](KPU 0 8BpD J  P; D2S;P<2 #nK<<2P CP+ < 0 8-p! 0 @ P@D2PU*@ <T00,0K 08L p@,@-@T@@DB @TL -LMp0!@  H"  0 8 ָp@\ P  H20 0R](K\PU 0 8廸pD J  PP; D2S;P<2 #nK<<2P P+ < 0 8妸p! 0 @勸 P@D2PU*@ <00,0K 08L儸p@G,@-@T@@DB @JRL -LMp0!@  H"  0 8 Op@\ P [ YH20 0R](KPU 0 84pD J  P; D2S;P<2 #nK<<2P ;P+ < 0 8p! 0 @ P@D2PU*@ <L00,0K 08Lp@+@-@T@@DB @PL -`P@@L@PP bPP= -`P@@L@PhP PP= -`P@@L@PPP :PP<= 0 00 ϶MH --LM0 0@ Q 0 00\100M 0 0 R   R  0RKDxML --LM0 0@ Q 0 00\100M 0 0 R   R   0RKLL -- LM 0  2& --L M0 0 5 --L M0 0 J -`ppQLPp @Q ᓷPD@, 000KhkhK P 0S 00 //4 -LK:KK2 K@LpKD`K"P XR  H K@Kp  D H%DX4K p  D) P [R D% 0qY@-  X3K7K;K?KCKp   L X8KpP <K X p X ` XP T?DT\ 0@1q00p`H#(Ẉ4K\pB K XC@Kp0@P0@5T0TAT1@X00:d00 0R(KX00X0 Xp 0%[0 0fJLll,l49 9 P 8 8 8 xk3 =8;8(0 00K80`Sp" 00S 0S (0"S !# 0 k#WV0(K0 VQP0' 0 (K'" 0 Ah = 0-@PL/ 0S o#@T0)0qT& /S T'*0Q/S$ 0 AR! R B/P@Ct0@T@!@`\P;P 0008@/S@$@@C} f} ^ 00-@PL@M4 KD TKL0 @0 <0 EKႳp K0S K0 -L`P p@ P^p! V U 3h ೲp` ᒳᏳጳVἲ@@. \ Q?o?o 0@c\C-L\3 \PP(! /@`p&!/D! .l @L,$%+* `2 pf0C22@ P0@@P`L8& f :L9 960 / 0-L  C-/ P! MQoooo `@f\L\9 \`P&p@(A OdA NlЀLDE!  Ѝp7 h7 Ѐ@ P`F7P@PP@L d8d`:L9`9t``@0 / 0-L  <0 0-{Pk @ KE0 0/A0C0C@0 0-kP[{@{KE0{7 Q/A0C0C -LJ KhQ@ Op A -LJ Kh @ p PP-L ` Kh虱9&00 -`L@P DP 0-PL@ |DP0 -`L@PD oDP -L8M0Q  $00 K0 K(8 -L -LMPPP @T p00}K0`p 0`:@$ 㛲cc( 00 R rc 4-L% 00 0S Khb00@-C"a0!s!!@00nRR0c0L1R aP ( 0B B``C00Q$IA-@0D \P`0Lh@SQ@:0pD W``U`VS^!: -L MRp0  @`BP  CP @XY  00 @(K(K -LM`10P@p( 0Q1 00K@ )KQ 00#30#\0#02S00R(2[@0( 0R$K芯P @ @($ ᔯK4L -L=<;:987643210/.-,+*)(!&%$#fL7,K 0! @7t80v>C 0C`< 0 L00  W`<  ;0 Y`<  W h`< L0W0 u 0L  080h `W`< e hWf 02<  ,K(6 !+80W0C`< 0TWP WJ 0,K 0! c080T 111v>C 0CR`< 80 %/"b!!!L080 0'0T0 c0 8KT0`S<  00ş8  ?2c11180 0L0 00 `< q 0 8K`80$/A!b!b0C<` 0_ 000C S`<` 0A ?#K000C S < .`$K0`FX < `\? R0`F 0 0P 0P$K0 0#K$K 0#K"0N ^X 4K⥬P! <`#=0 W<Wp8c0s0 c`<  < TR <` ^ D  @R D0^0 "#  R z H/o "<KPuzXFe X  D8 R:Q ``"2RX0S0 b$ 0(0S X  R  D  @ 1`0 $ (0<  MRp/ #b!!"N0 K/ ϠlR3l11R00  10 1 B000 `Hp<` 80DSd080 `HpX<`  ABLB  QPQJRm| ` <0 (0b$0]D0  3! P! $Il'X n   Q| Qt h`<` 000@<0 S 0A8 RXD0000FRX RB!2gqqq@;W8p 8d.< >p"HP@ BQ NB Q$ M b"b"b"$ <0 `(Hp< `8 <0  RD D @7<  CR - @ R @ R 00@  q80KpD0  0E0P  8<0 B `($ VHpR D < .0P Π8 <0 A! `( $ "Dp <P 8 2 0!0( 0c$0< ` 0 0 0u! p-L4M@00P0` 0 LKD00D0 L KQ Q Q ; 00 0RKp@ 0 3d!Lt,t,t,0@P/ P @/ -`LVpP! @0JS  R@ D90JU R  RS0@0D@R B/0S00  Br/\R/0 0R/ -L M0 XPDqPpF PA   p`A T!@ 1q@W40  00S0(K0 P0 0 @P 0 4`P 0 @ =   0u 0 0H -fML Ma`   Pp0 R 㾪pK 00CSN K A&p? 6: S8@GKY>K 0C @5 D D O(_^K5PETAXA\Aj?; 5 5 C>KE 5 5 pU  0 E E D@PgP 60 0R(K O00@0@00@0 L|- 0    --L M0 0  K -- LM 0  u K -LMRp@` R00?t00P @ P 00 P! !  3x1WP5 0 K4KVP Y409 V[WP0P`0 0`f`0` 0 00^ (K4`CP% 0P0WP C0PP 00@ (K80 %P80 V P80`,\T -@LM(0S1 `0 +PP 0(1/0 QP`p0&  00 0`VS <0`VK 0S  0C`e0`p0 -@LM(0S< 0 1PP 0(1/0 QP`p00  00 0`VS <0`V0 QPK 0S  0C`eT0`00`0` 0 0-RL0 @T0l0 R00 0R0 P P <P K0heE -`4@L@(PI$0P/XKh@` 0-0@L@$P5 0P(XK0h- 0-8@L@,P"(0P3YP0ģLA-M t1t!00`00S0P  P XQP 0pS  U8 CR8$0D0 pS "X 0^ #R ЍU   "X ^ #R.S A a  00Cp0@  NN!RR 00R4  R  *4 8/H 0X\S 040:8 R РS /y xB -Lp`P@L0L0@D尀 ۫W  ᮽ hrD -LP`@0 A-PtH @ \ -+*)("!%$`\ mJ rOv ?Q00000 %\@ 7010pS;^ cThǟh @dT 1U QQ00^^70A00-Q ^Q0000  00N00W0C0 0#Š,\Q @\0@0%Ao 00&Ao  00=Ao#4~ 00z00NSP0<00C0o50000 I G G70N33 32Dl2ܔ=1H - bp` LPPg !#3b!b GaAVJ 0S$ RQ 100S 1003/P.!@0$p ㋧0U0Nl100SO\10 0SD 3/D!V 000($10`03/P, V@ @$p 00  0S00 0S00SU@0S P0 @0V@H  000400t11 0 |0ܒ0tt/ -`PLPy `pPv A@Pd  00 Qc,1咃)12a10BqAW% X PXT $00\! 0S7 <1003/P0 0 $000! 0S 000S0 3/ W 000(0Pp0003/P 00000S000S T2P0000./>3d..p-= -`PLPx pPu A@ Pc  00 Qc,1咃3a1a0BqAW% X $PXT $00\! 0S7 <1003/P0 0 $000! 0S 00 0S0 3/ W 000(Pp0003/P 0000 0S00$0S P 0$000,,,+8+ SR-Lp`P4 000S 3/0Y @IOP T 00 00 Y @IOP T L00 @ @0 0p`Pl*8*(*))X SR-Lp`P5 000S 3/00 Y @IP T 00 00  Y @IP r T L00 @ @0 0$ p`PL)))((4 -PPL@ Q iPPp`L@JP ZP`V 0p"S 40P0P -ML M@P` Q08  QL /QH P.00F qPP:p᠂x /Q1 Qs P P /RR.Q4  J   BRm/0  I0J P@E#K Adp@ (: S( )S /Q Rn/Q @@P00`(KIQ .PQ V 0z/S @0W8 <8^Ku PE@ ᷡP4    P/  8/Q0#8 x V/0 P00P0(KC?0 V0/0 P00P0 `P h U2>00.00*?00&00"0`0 -0Q@PLP6 0a`0׾P9 0 0\0 @:\0 S \S 0@ S @ 0:S@ 0L0P 04   0 l$##@-0P:P\\ :R^0@S@0\\:R\@^ :R^:^ 00/0@-A@\  \:^|^00^^ R B|S0 0:SS  -ML M|ǟ| @d l !Th P$ H4 0 X } T KD D4 ;/0D$, K <$4I3  H,0K0$Co0100M `@@!  t0@d 0D4 CKDd0S:SD4V F0}000D4 Ll !  0 00 tH -0-L M0 @ 0R 0 0 0P0U100M 0 0 R   R ,00 哛 0RK03@LH 40-LN @@0  -L4MŸ P`p 0 dl20 RA dKD0K<@KH0K0L0K 㴃KNPH YL0 P0 @PP0 I 0 L0 P0 T H P0 I PH  X100s !&$RG 100S @0 0RR(K X0sL P 410P0 ,P9 5SX"WV00#  @ Ps0PT0  x0ST0@ T R"@3:  |0 &ft0`p 00 ` ĝ0S"@@@ p Lnt( d @    ;-,@ M@L@00:PK  0- {{ {kG[F  @:0/0/=A z0- zkk'k[FKE{{@:0/0/=A 0- {{ {kG[F  @:0/0/=A A{0- kk'k[FKE{{@:0/0/=A -QL4M@ 0 $0  " , 0 0 ( ,KT D KP00@0#D  K K 0-L M K, ,K(0 $0 0 P K 0-L M K, ,K(0 $0 0 љP K 0-LM K"0 0 0 徙 K  0 -`LVP p P@PV KP/ -LsM@ p` g?K|K0 1 @ @ O50Qa a TA}oKXA\A0 H  0 @0 0R(K8hLP- 0    -LMϟ@ p 0q3 0  1S01 `̓ Г $?03 ?03 P@U  P0!%Uȃ  $ 0S0 R 30 0R,(K P0 P 0C `S303 @p0zSE8~}|{y(pniedbpJ 0 B0`p B RPO 303 @3 03 0SI3  @DT񏐦|K 8Pq0 5P 0`0CS00003d0CS/K10PP[ c c# P M# +@MQ$"$ 3S03 3@P UK303 @903 ?K3 0 o3SPkU3P03 303 3S03 3@03 3S S @PEP U0C @`3S03 3P03 63S3P@S  ,K003SS 00C003 0X0 0S MP U PQI 0#C  # 03`03 )  #S`L 00CS01000X3c cS XR    0#o#0#        #3 # #0C`X VM# hV h@ @@HVL`  M 0,K03SSo 0P 0CQ g S P U3S303 @s3@<3 03 l3@03 g303 #!000C3 @[ 0@3 W330903 0@3 K3;3 330;03 #3 # p# 0# `j#`f# #+`^ ` Y`W3@93 03 3@<03 03 3:3 v03 V3:3 o3@93 03 3;3 d0^S0 3 0# 3 ?K,@@3 3SpDj #S # P $  c ` !  # , K BC TpD-Rt ]RJ R 00 0  P 0C `S P @ P 1 P c 3cC 0D S(*'0/K0Q# 3 3 @0C c `  s  APR+ E  P BR@  T 1*PNU \0U IU\ P BR Q *P@sW30S 30SWW00CSpP0s T:sc 3@DSS5*T T 3 #@Su 33P3 K v30 l000S 3#0CS3S 03 3`03 Pp 0@0CSP00T .*P03 p0ES3S P} 0p0CSP0@03 3 `Fs0S񏐗\'P<p+0E P 0P0CS0 X*pP sP @0P0CS0\/0AS00P0CS003 " PW*@P(U0P0CS0E P T *P0NSp0P0CS00@3 PS3~S %P! 0p0CSP0@%03 3S 0P0CS@0 T0*PwiU nU3 sWT qPO 0P0CS0 0R-*Ps @PAQ 9Re*P@ P BR @ X *PU P BR@ `T *Ps&0P0CS0pW 1*P@Sp P3U#0R0C SP00X :*pP@0P0CS0 u0R*P03 3S.p@cs3@ 03 w04 K03 ?K3 0p3 U+3@PC 0 P #0C003 0X0 0S P 3 3 S @C P 0 P 0@ B0Q 0 R0@3 ps  jP30A0VP ]PT*0pP RPT*pP)Un0P0CS060Q*P@pPS3s 03 03 @X8K03 _Kc spw0S6W8 PJ 0C , K0 @oKL 0ᵳp4 P ᶳp 屳,0K3PS 3pGS303 3@03 P TcsSU 3S0303  3 P3 S0 0@00S0 3c 03 9s 03 _K`s3#S # pG0` R)W9 ᓳP ,0K B@  L 0KCp P p 3pGS303  P Xcs3S303 C 0#1P0 3 `0C 3 3IU!d # ^P#JRH*0 P RPT*Pl3p3 M EPW*0P0@3 p5 0#" P^ 0C , K0@?K 3 N3 Ȳp0F P p R6@bSP00X H*P@ P)X'* pP/ # P#)R'*@P PbT`* P, PX* P A_0U0P0SK0p0CSP0s <:30 _ K30 WT< P,T**sP  PQ*P#]X p3 p.P@@ T  p P P3# /303 0Wcs n0P#U B`# 0O aPT*0P03 :c0cs3 # KP#7R5*33 P@" =PW* 0# P 2PsXq*0@P%0c@s3 "PxXv*0pP@ PT*P(csC @ csC @#S C# STs0c c @t t3S30C3 mTC #@t e3S:0@csC @QcsC @LcsC @F껭cs @@cs @;-00cs@3 3csC @- @OpcsC @csC @@} -@P`pLE0 VPF- 0   ꜵ 2p-0LP@8 !00S7 0`v 1S010d B00PP0! pW@0P? r`PP 0 00 @ C PC0000s%  Q  Q* PR&  <0@08BP P00`0 㴭P ; BA@ ?#0@0 Pd 0-@PL tP0 -L@`pPLt0t0l尀 T  ấ@0 t$ ԓtDL , 0ʏ -LK0C. 0($ !$ 0  "100A@  08 oP08 \  AL+\ -<+*)>'&%$#"4    p \Q d     QD Pi붟댁LTH ȃ ( k <  L  0 * --LMPpᔀ @|f&t6`0S00  P P㠀  P000 0KP  -R񏐻dhgfedQA00   R0 0R00  00B Sp 0 Q00NQ Ќ 0Bpp 0B ^X @ @ @ @ pEW pRs0 00S P Z#  # 00`K(K00 0 p P +^1 -^@@   0pN WP p0^p@pp 0^ @ 1pNW0pNἀ ☀ 0@N T @ ☀ qp0pG0N Q@ @H8CWXp@Tpg00R0 00 u0XSR xSP  0R R00 g :g{Q@R࠱ࠣ@G R@ #{ Wʬ\# Z000S @ `K(K00  R  XZ@p pRS X Q/ @ @ @ 0N X8p@XĀ @  @^ @  pRA0^ ЌW @ TR Ш и@ (AfkR[k#k B@^ڤ@Th ^ \c@ #{k{'#{ ( 墪pPp 8 @R0b00 ?0 0 0 ˟ ۟ 0 Ԡ t@5?55?5?A~ N(IY @) Z  0``Q0QI`FJS^Ylʬ0SVZ w@Pf ˭Pa 0 ` 0孭0S Pᆪ{ - +K,KJ{-kk*0S 30jS k&0B0 Kp1{V  3 R #{ 7# 墫ᠫឫᜫNPP$   ! xKK# !P  0@P 0Q 0B R xA༒A Q6`q  uxK0p00K KxKKl 咧0@ SZ# P8 0 p0^ @ @0^ @ 1 NR @@ IN%^s hS\#{0S1G{p0qk{'#{ M\, \7P#{`@kP{'\@U#{ A5N k#{{'p@ \#{ FD\l 5排 ^ ?At (|  q  @KP 00(SB L0 0 X@KP 0t0C0 偩 P0 00 00 0 N   10 4ᗫ@P 4P }Y P Ԡ0S L1 0 0S fdb`^="00# gPP VpPPkP  \V 3匣 Y jYPQ :S NVN{+S+S k 0AK+C#{{#{ 30 SQp{{VG>0S$&RaZԠU#{@ 7# Qt"崐  B" L2,K.@PЀ s VN{+S+S 0sԠ 1 0 i l@ #[k{#{ L° \) \#{@k@{'T#{ \ \. kl\ \c@4\@ @7Ơ LЈ #{@{o 0(K60sF{{gkg[3k -kEk 0S:0:g{3{ ,K,K PKR 5ju0 K0Se46S3 { ] ^N{^ C+S\00EM???(m |#{5AK+C-{  #{{*<0 Q#{ KK?0X SZ h0 0 x0|#{0S3G{p0qG[k#k @%b\#{0S3 b0pA!kG{1{'k{'#{ JbSQԠ 0(K5& 0ԠS0Sڠ0S V `r0SK#kkGk#k ߨݨۨ٨0S1 |2# 0 00 9{ *p2# 0S%"00 <Ÿ@ ` \j  VԠ0k S 0S0  VK $#{{7#{ VԠ0S 46S10kS0S0S%dP Šڨ0S@10Q kSO7Syڔywusqx KୣPt0x 460 V|0`Spn 46Si0?o2jQ0SMl00jSk&pB]S0S@ ?(?P96C#: : 0 Bj u$#{@ 7@ #  70S l00jS#:k0c3Q[0Rq, 006 0 0㗩֩P`p 0 0 Pp  p0K0$p 00 K80K0`40Kⴛ P 00CS  01:Kp  80804 45 ;0"0 0K$0p(g f lf e  0 0 e0Q/0S/S/0@-PP0@ S 0\\0 00@\[ -p BW"RL$M @ D @y P@PP-T`R +T@P00T{ Wp ? K K 00"`KpDK #K0#4 0K00C Ra CRWCA CR7C V^#KKQP00\00S 0#K0P@D0 D0PK^00S pZ 0E@0 @00(KZ ^ 0Z0 @00(K0 #K 0$K p00XS00 C R A BRWw(KWp 2#K 0$Kpv @2#K 0P$Kpkꙙ 0 0 00a- -pL$M BW"RH H P@P-T`k +T@P00T W  ?X#K#K#KKKPOKQP00 T00SEK4 `00 42"< R0K@00D  R@a0DSW@DA0DS97@DW6v $KKXR%KQP00 T00SK4 400 `2"< 0KP@"0 01`#K"0 01`#KZK V0EH0 H00(K0Z0& H00(K 0 p#KXs #K'#K"Kiq00XS00 C R @ 0P#Kp(K A BRWI 0p#K ?? K 0 0 0$^ -LM@P`xp $KUT 0S*$屙P   K@apK%S YT@p@$哚K@! MpKH@ -LHML@KP`pP 0P KP0P0p0 "K -#MLMxax1`p00P00 @PN H1 `0 S ֗ P(/ j뎮K J  v{P% P P$P vPP0 0R%(K P 8 P PP0PS @P(j( Pז\L[ X[ -L`TPzp@  PP `z`P` -LMK@w{p 0: S  yp  `0K 0 K0K -L$M@`< 딣$0 40 080 00T0Sd30@0 40o e0D0 @P U0@ p p0嚘PPu @G0 @0 00, zp P PE U@80S4080SL4000 0,  A P@ 0D $K  T LT  h00 5CS A/0c#:S 0CS 00c3 A/'R A/ -QL MP4 0 `p U*40@c 6/P  ^ U :000S00 40(K -RLDMh @00 gQ h`00lP L0 劕P` h 0pPTXp TP s@Dh@0pP0 @P 0``T 00  7/P00T40 * 0I8` P0 @  pRPg0D@ 0+N-'Ydvutsq9 khaB6b` {l s| 0SjtKt`Kr K0 SRV r0 QPG 0P? |0P, 0 ! -R ?S$̟ o!0Ȃf KY!aef+1aa <0Ha0 IQG \p  HKu0|   00 5p0, KH0" 0 | t0S 0t  pR05|0HPK00: 0 uYH0[S0 0 R Sp0h000| 0p|0HPK0S00 : 0 buYH0[S0 0 R SpY 00Yp00Džp|tKtKqt)HPK "uYzH0[S0v 0 R o Spk0  0 | @p^|00 S0ڜYV 0R  I MQI SpEYC 00Yp00Džp:|0P  1H`K0   tY+H0[S0' 0 R Sp|0ǟ0 / b !S 10HPK0   tYH0[S0 0 R Sp|P'1 0HPK0  tYH0[S0 0 R Sp|0 1 (0HPK0   tYH0[S0 0 R Sp|d& 1 0HPK0  etYH0[S0 0 R Sp|0%  1H`K0  HtYH0[S0 0 R Sp0, KH0" 0 | Rt0S 0t  pR05g|00 SW 0Y^0S0Y 0 R S YpO|00S7 YG0S0B 0 R < Yp80  0 |  p+|P 0S'p `PoP Y0 S0 0I0Rp QWP 0|    ?p| H`K0 00C# K `/@!b10   sYH0[S0 0 R Sp0000| 0p|0H`K 0R  B00C" K  B!`1 0  ksYH0[S0 0 R SpUP|0" 1H`K0  IsYH0[S0 0 R Sp0000| 0Ups X|0T! 1H`K0  sYaH0[S0] 0 R V SpR|00H`K / b !S 10   rY=H0[S09 0 R 2 Sp.AL* ų|= A H< PA X; 9 *D9 8 T8 7 d7 4 & 3 h3 ,% 2 2 1 QmL! ! l- n    $I, + |0H  1H`K0  rYH0[S0 0 R Sp|`00 !`F@ ` 嘀 0P @?oRfQQ^cfaaN8(^PP`` 0N@aaNAPAuPPRRaLnRLPŏbhaaUhU RnL P4b0<000| 0y^ 0|000| 0Jph|0 000p]|00 SU Y1hT0S0O 0 R I YpE|00SE Y1<0S07 0 R 1 Yp-UPUP0000| 0pPcRY?00Y ?00Y?040Y?0P0 㘀@PVX> gX 0   p  B/A!b@P y0   00 p  HKxqH0[S0GK0 R Ypdn xp1H`K 0  [qYH0[S0  0Q YpomP} k  HK>q -LM@`HKDP@. pPpP0 PU@@K+ p-@PLMK`@,`0 7V@@Kp -LMp`PL@L0@^l8 0 P@^$KP*l -LMp`Pl@l@ Pq^lT ,K 0`,  00PU``@^^(K)l -LT0P DQ43  @)P<H) 0-@L@@ 0$Yd0R0@-0 T@0PP0Q 0@0@ T D00(h bm0@-L00 1@UT00S   0XtX0@-@H00 1UP0S   00 !0LXX@-@PT00 1 ^R`WV!  00 !WW0@-H00 1@UT0^  0 !0xW@W000/t/`000/L00 0/80P /0-@PQ@0/0P /0P /0-00S |0 \\ H0 0000 00 9дd, mNA -LM 0 0pX!G!`00FBK(OPEXdIABd`)YIST000H 刀 1X@@T$K_ N| 0-P@L@P \0S 0000P$ K0h\ -qp L` @P\ @DR000CC110 0XaX 1D0   p \?X0H!H 0p 0 0_1000CC1100XX0  00p0 00  0p@0 0?p0p 0 <p 0H@ ;\ꤲH0Բ ܱPh (̱ -! LP @g`\ AR000CC110@H 0T`F# 0 ठ0 PTP ||00 Q P[< ,pgqpn0` [gfffPL! ЯtLT 0-(@L@ @[P[0 -@`LⶈP# 0PaP`pT0a0Jh@X y0`AA[0O[pG00wZoTAXA\AXP  000  D.h 0-L⯾,@@0@P00S@0Գ -@P@_}L`P(p0@aaN[0O{[ZO00TTaXa\aXP(0(  0 0VP\T 0-0 00L0S Pi[P0SZ 0CsX@ R`X[0@T P PP@F[P Ĭ -LM1!0P@Q0p00 `O VE V8 0)  `00S0K0 0K  k`P$0K k`P k0`SV/0KT  KkP.0`00 0R$(K ` 0 ꀐ, KⴀK␐"nkp`  0 @`[0 0 0KPkPцL --LM00  K -Lp`>L0L0@DP mW   Kh*D @-1/ 0SAS/0-$(0@# A  A A A0/Pp@- P^ 0S^ `@S 0TT0`0`pPPpp -LM4 Q@ ! 0匐匠 pP4`0 0 U`@D X00 0   wlP:04 0(K(KX. *  * -LMpp P#NK` <0 JP  Xp  P0 0R:(K0@0S+ S 3NK 0 /l0S i0%  0l 3NK0 l 00S3NKP T 00S꼅$L D -IML4Mğ @PP `p0 ` 0S SJK  `0 0R(K JKR JKRV# JK A 0J-K S R 00eS:@PT8 0SL D`D V> U 1R* @@@0T&\\!^\ʔ 0 0 R0L?o20S 0Rp0SR pR ^ pU R$ D0DPS 0SU R D0DPS U RT 0S DPD@US0SA-@dQ M%R @ 0S  R 0  0S @T0000 Ѝ`lq ᶀha( R 0 0-PLP0@0T 00@ @0T0@K0h p-L M0PS `@K`$` $@0S 0S 0SKp -0MLDMK@(KDLH B00K 38L#0 KLA K P@hK0`F0 (Kp1< BP0 1K0@A00> 0>PS x2y K<A1#r 01t(0000 ` PPP  (K8 B  P8K80C I008K80C 8KL0C000Qf(K 8Y P0 K@@0 08  P '4!48C8S (KD B 8#80(KD B0Z{8KD0C0S8KH0C0S S S I0 0 0(KH B08KP0CD0C pI0 0kI0 0fI8KH0C0 0ـ@L @ -LAM` p0P (0 VV@ Q@P' BK0 @` Pf ( 0R$Kh0 RP @@ .RB^K PE 6$0K@dDI00ꍀL P 80 0P  R00/00 -0LS S0S4  R  R R R0 S 0E/ 0 0S S S S S00 00S0 S000S00 00 p-LMPQ@`  R R Kp R!RR Kp00 AP00P8#<48#8V R R  `0 Kp  Q Q8, K P 0  $P 0-@L P0 -L$MT1T!0@P P`0 = P, LKIP% `D[,0"QKB _PD1x00x02`}`X Ez0#^0^@`}@ Lh 0C @Ii -@LTMplK P=1儡0|0  P0x | x0 PL 0  R0S R R R0 T @P`LKp0K L KL` P0p0  xYP(Kp`V`V 000 j`Vp0S 0PP0ST -LdM`pK@P0 plPK @0p0P tKxK 0 P P0S004 (Kx]P0x.}tKxK0  P P x}pLKLKxH 90P0 P0 0 00S[B 0 8 -MLMŸ K0$NpK(AS 0 P K*K, B A h"K A X"KTK A0J * s `P@ 0#S2 =K0C巻P, P=K0CPᮻP# @P 0S   @4^P* T 0S S S@ ᑻUP0P^P 0DD`P0@=K$0C00 0R:(K@K=K L(0C$L=K 0C(0L$ L$@ P=K 0C0(@T =K(0C`@T 000 IP =K 0C0(=K 0C0(@yL 0 -0L,MD@K p`H0 tt>`$PK$% )P @0S @HP (0S0 K| -&MLM&LK\K,N@D̟P MK8@D(@NKN K&K@00 0K0L` 0a0S 0!S <-K0, B0=K0C P4"48C8S pR=K0C*0K=K,I0C`I0  @-K: BP0<=K0C00 =K,0C03/P/ 0 SS00R0-K< BS0p% P&,K`&,K B` K4A@@ &Px>0@0=K<0C&,K0 B0S &,K B& KQ =K00C0&K0A m Pi&00{=K$0CpRJ.@ &P?-K B0=K$0C K @f(%=K 0CR0:$%R7 %r4~&,K B-K B R  P\ P @0fu L h \- -LUMP`ğ` X ` p\1 0 `OvP KvP >K d1 08V00\1S0  P X0  @P4A R@0SV X0  }P xx4`10 0R(K0@l1 <@=000Sr  .S 0S Q@Q@.@DOoBRc d10R:0  YPʲ=0Tt1 0  DD@Q0p1 h1 &dATQ 0 N DD@Q0t1 0\1 ] 0p1 h1 0 1P0=SA =0S S" S \1SI t1s]h1S^p1S- xxl100Sp10p1 0  Qh10h1 <.K 'PJd% 0 0 PBD=00@=0 0[ w9=00U0p t1 h 0 P'ʭ0 P #=0 t! rt1s =t10=00tTL -LMPpU`@ 3 0 S[ }PP 0 K0 0 00 00000 |0 x0 t0 p0 l0 0KS5 S S6 y<00<0S& S S!0`  0 0 0Pd KH d0 `0 \0 X0 T0 P0 L0  d1iOH0S 0(K0` 0 0 0`  ` 0 |0 x0 JpP d0K0 0K8 0   0100i?0 0K0 0K 0 0R( KP! 0 `P 0!K 0      1P0SwX  d1 h0SD ԻP -LMPŸ @ `p0 ' ,(p! fP PW  PQ P Qp0 0R{(K0@SW 0@S0S@2 @ #>KD2  1/K0K徙D2 @"?KD0 ?K P@"40SD 82Z@2 0 SH2 @2 %PH2@"D0Z: 0S ppZ: H"  0 @ Z R  QpTH"P@D2@" M ~rL -@P`p 0L0 0 0POA000 R#4000@00@/G-0HMp 0@P@0 84 0<U0 8`'0 `0`& `8lP.P00P%P8eZ@.@00@$@t8G & 00 " Xȟ0b%% `0!08`<$ P, haP"`P@%$`Wǁ@#P @ $(PGi !@ 0`"`ว,0l P, P00 P%PeZ)+C0)0O B @# @t4G0&0  #8 P7b%%0`0!04<`<$  P,@ǟaP" P@%D`Vǁ@#P @@$  b PF ,@  "00m @&0) 0 0#[4@&0& 00# lIp&0% 00# b&L6$0!`0=0`," ,PD` ƟP# PP%@lɁ`U @!P@@$  b,PE ,@  "00m%0) 0 0#[@%0& 00# lIt%(0% 00# b&`@,@$T4@ᚃP" !D a #@@ , pğ @$ @)0$ 0TDc>@`! `&$@8ğ `j P"0@P%ğPeX @# @$<@D&0,#0l΄ %` )3`隌0 $P !3 Pa0 ,@ ",0S $P0) 0# 0tc8c>`!, D@ `TSj"PP,PeX,C@# @,@ß D )0$0l̈́ `! b0`Ԣa 0 P " (0P0#@@E08b` )` xŸi P P%0PXbe[`0 0#  ( `020*@@(0bE`0 ,D` l̈́  `!PPe[ Б0  0#<0ม8 ` @`&`@e @! l͆ 4p P " \Pb+@  0$ 0,@pRL`0p: pPeEY@0Y@@I $Kk -LM@p0 0P(`K0 0  p!? 7R8 bx b   0RX Kh}oL -LMH"H2 0@480 0@ 0p 4K1KO 0SP @ 0 XRP@P@0 ``+ T6 >.0 N0P,B,RS R+00@' U% 0H0S* S5 S. P 01n(."4n#..(.< 0T. , a A  00C208 CRP800 0R(K^*30[4 [8<^*40[^20[3[44 [8<Lo.S^ X*0p L -LMK]P K -L,ML1L!0`@ TP0  Xpo TP8 ?o2T0S E0 0R0(K PK @:, K#<@$S X $ CY ,0K1 $ S0 P, K!0$ R0 0S nhL $ -LrM@ P` p( tKe?K1 |@ x@ jBOB0TAXA\A1 eoP    0 {K dZpp 1@pP ( 0R $KP q00x 0p0nLB- 0    -- LM 0  K --L M 0 0  KH p-L$MP@tt0l $ ,K00 4 ( 8 ,@ P @X@8KA`V Kp D r-LQϠ\ KhX%n -LM010!0p`0 !(0 Rp@ PK   Rp ZQ@( 0R' KQQKP@X @@T PU 0SP@KTF0@0m$Li 00-PL@ P0 000p(0Pp(P,Pp 0h0PP 0P 00 00,,TP 00 0P@ $ 00-L@  7 0 00 00 0 0 0 0-LM 0@P 0p 00P 0   54?o20cK0=' 00 0 0-@PL U 0 0-@PLop0PPkp0P(hp(P,P0 -p0LP`a IP[ 0 S S @0 S S 80PJ  @I8#< Z @> H"PP# @C 0S@ P@T! 0S S S@ 0AS APPQ0000 oP Q` nP@t `@P8 $ d -LMp P@,0(Sn: -(PTX &K&"[T4"4("4"<8#80I 00SE 0 R?@D@T0: 00S6000@DPP@D`% T4 00S%P 010P I@0`" 00S0AS00nP  0(0lP2@-@$KA00$KhnP (,@ Ḽ(P 0-LM 0@P   p P K0 0 0$ $0K KP K05p 0$00$00 ?K0 -@ULTMPP`K ` @@0ŬPLPlPH @@0 㸬P=PPPY * 0p` QR Q3 0S*QQ   pQAp 0S`:0S bOl0P\0   6\0  @h `0X d0  R  R RX0S R 00I @T: h n\  0JR5`0 (K  X  0 LKX0 띀d  D H ߻ p 0 @` d0 ԻW G`4 ǻ @T:@`0\@_n(K  HDS QAR  R p l@ @0p P AWU WK Wi p WY T' QWD W: Wp` ` @`^ \LQ  QAp@ \ ^ Q\2 @`0 @m(K` ?` `  7 ` R4   0Pl@  @T:#`p m'p>d m,O -'QLMpPo| jPi<,k`@0p000K 0 0  0p $p$00Z(04Z`30!,`501,`%W1 -  (``P `80 OQ 80`C ` U  P0!03S `V: PVXIW(K`W,`0W 3 #- 5- % 1!!00@?m(K@00(K0WK #((R` `84`F2`F1`FS 0?`FAP᪲V4C  0F0: ;0(K0X' #((RP P84PE2PE1PES 0PEA`ႲU0  0E08 90 :04  800 Al4Ae00:`08P -LMLp@% KZNp dK!0R0%0 @ᷛPLu 00p0 0@P  KL@ K N KLM0@0 / 0-L @\,\@ \ Q :^ : A 0#0000 -LM$@\PH 80K( V8 0044n:KB8@L;0zC$07i8 1y-`BCL^8` 4 0 ` ^   00c8 0A932 3 A00(K  0 00-SL@ 3/K0hk -LM8 @<S Q `'`8  0P  @`f&PEE AA!`F`F!f&@@ AA!`F`Fa&P@PEU% BAA RG! 080R@\RRc  B10`[8R Y`00K  0p0 P0  I@ pG`f&PEPET%@D D&"`F`F"f&PEPEX% B B""`F`Fa&PEPEU%@B@D Y0 G$80Y@A Y Y 0L 0H 00K Dø0 Pྸ00` 1 B01 0DP`0F0C6# E B$"@D@DF$0C0C$6# B B("DA!0C0C1# B B%"AA! 0(KYY& Y" Y$ 0 0KP00`Y Y Y Y 0`p0 B01 0P`8`0\0X0T0l0h0dy7 t 6 -`LP~00s !R ! PEU6@  tP G0 0  .PU pWU@yPp X 00V  @@pG   00G g 0 @00< -$1$!0@L P0 010 00C11.R 0  0P0 : S`忻 P @p0l0Fl0 @  00C10 B0@@p, ʚ;ԡ G-5p%0  M0\ 00I10@ @\` P @R P@\@ p`0IAP@@pP@\ P- PPPp0IQP`.Yp ಐ@`@pWp `p@pEI2Y 񏐓}#~}|{zyxwvutsfqponmlkj]hgfecba2cABdQelQL2Y REPONMLKJI(GFED#BA@3>=<;:98765432%0/.-,+*)'&%$"! 00000@000@ 000@Ѝ002cABdQeQ00⊐ಐ 0@  p`B 0J ಐ ` p4 p `p,`!0@`p#( -@L Me| ⒁$2al B!!0C H M!!1L ,0@0 } KЫ Q -LAM@ PpBnK `Fp 0( -pP,4[ S ( 0R$K.eTL0, -@LM`` Pw-pPP 0S 8 K00S.SK -LAMd0d0 @\B^KPEp0 `P  0RK6eL 0-SL@P` @0S IPV 00V00 -@LM`pPU 0V0 R PU_L0P0` W00KW 00K p-@L MP`t0S 0U0S @0SOL0@0P V00Kp@V00Kph -@`LM KQT:8K,@@ 0 0jK0̗  Q 0 0{0 0v -@lLM KiQT:<K000@@0 7Kt  -IMLMT ş0@@P@ P4 5l 0TX4 0p00 t|5d0PL4 h 0 0@5mK0?h4 C>K 0C`FH4 0 ` %  /\ ` d$ 0 \PiP400Z0S T40  \4d$Sh4 ` .KW4D4[S@dD@H4?@H4P?l<0  Kۻ0SLgP;0d0PL4  0 ෪X40 0R(KWH4/0)S( 0L$C @ ZP L  %ꢻ0S ph$  JX40 0RL(Kof<H4@!( ?0  JT"t  |$ "判  $ "d  $ "p p$ "唄  x$ p JpGpGWC4@ 0$PRT`) U | @J뀤tD   JX 0 tD51l$`F`0 00 .V 0 x!ꌁ 0 Ul 0 ꈤdt唄:P4SZ}T40 y  8u@ 0 0tD   7JX 0 tD0l$`F`0 00 .iVgl  JDb(L &L~~$ T $ 8   t ̒ <  ԑ -LlM\@Kp `딅P0 0LKLPKw  h  l%[`1l $[S` $[ᰥ[d 应[ + 40hA  l0 I`1S   ;`1S0 ^  0P  $P  P   P  P  P  P P`1SXh0SZ RP_ 03I 먂 `0(I d0 I \ 0 I`1S   ~0 `x 0 `r@0 `l0 `f`0d 000& (K >  h0S QP_p 0`H ꗹif8 H(K (K 0 u!0 nm0 g[0 `H0 Y50 R"| 0Kd0 Dw8 h u܎ X Ptp D Ќ Ќ p P 0  0-@LM Ta TR !T^ 2Ta QTPK0TI T= /TU lQTP 3^\1P@0(  T0  TE (Q TP @T T) Q TP T+ PTP P TP PTP P TP PPPPPPPPPPPP|PPtPPlPPdPP\PPTPP< |  8  Ȋ | Ȋ x Ȋ  t 0-LMPKO@ xPK0 0P0( oK0蠃 00A o M-L@M0 0` PPpKP @ .0$T @D }5000 0R K$00. 6j`L@ -LM@8 4 0 8PK4Kp90K`50 4 4Q0P RP (KR `8-\ 8 +\ 8 #0@0 0ಠ 08  Q匠ಠ10 B011.\M 80 @T@ ppßW' 0S#380 @ \R  R 0S#380 "#Tp 7))8 *,& )Ġ `& &d0*8*p  ` 0080   080   0L080   0 B   :80@ p @  T  R 080 @  S # 2RP T=S; 080 @T2 80@ @TQ 080 @S#2Q\ TS 080 @T@ @ f ca -LtMQ00  S 0Č @4 8 Ȍ@<̌c(#@"$l,.,aH!c$"0l.$DŸL80 0a$ ^!<0 2Ÿ040 QS0N0a@%`0 N2%cC2`b2`bfa@1AR@0 :D0 W0E0PRReQN0 bd0 $2!C+J !; 0!# =+J   +J "  " +J   # +J "!  +J J! 0;J=K-K<0C8 B0 EPDK@DK =K0C0S  0D; 0KAD+ 00KS0+ P0S"  K@@P`q0V4  0d E =K-K<0C8 B0  PD+@T=K0PS=K0@=K0C0DK T:U=+J01-0 30;J0000;J020 20;J0J000J;JJ+J01-0 !30;J0000;J0 200;Jp+J0-1 0->JJ C C Cb=W ꫝK I @PQTT ,n`=K80Cp=K<0CPD0Q00 P'0PTeႥ0 PD>0d D  =K-K<0C8 B@P0 lP@PꫝK I Q@PTT d 0@* =K-K<0C8 B0 PV9 ]@D;PD;@0VD; . 0 d =K-K<0C8 B0 PfS~LM0@0d 0 =K-K<0C8 B`P0 PND+0D d  0 P=-KD; Bp0SD; *L@D;0SD; * 0 d 0 PD4<0d D  =K-K<0C8 BP`0 pP=KK K$0C0AP`@p@C 0P 0 UP)O=K0CD; D+  PD+ @G-K BD;p0D; ;0d P@ pc =K-K<0C8 B0 )P=PD :#D;J0D; P@0d F =K-K<0C8 BP`0  PD D;0D; 60d - 0 PD D90d D  0 P@y-K@`$ B K KA@ 0 BsPi=K0C0D 嫝K IC \9P@PD ' 8i`=K80Cp=K<0CPD0Q00 PD0PT^៣0 P7 0H+uHKᐣD 008B0d H D  -K8 BP=K<0C0 ~P`D;-K-K< B0D; -K  B@wp-K B R9K D+P V  K@ 0 UP `0d @} 0 GP`F@P=K0D;9D+47D D  0d ^ =K-K<0C8 B0 $P=K0C0D 嫝K IC 6@PD ?TyTd f`=K<0CPpD-K0Q8 B00 P0PT@-K8 B0 PD;P0D; D;@0D; D5@MK @DP02 D  =K-K<0C8 BP`0 P_-KP`$ B K KA@ 0 BYPN ,5 0d =K-K<0C8 B0 P;D@TD % -K B 0R0-K, B4`BP`4000 0 | 0H+^Hky D 00CTH D 0 =K0C0S=K-K<0C8 B@P0 eP ^D;@0D; XD3@MK @D02 D ~=K-K<0C8 B`P0 BPKA0 D VPD =K-K<0C8 B(C`P@0 D &PKA0 D :PD =K-K<0C8 BP@0 D PKA0 D  PD =K-K<0C8 B@PH0 D P-K@P$ B K KA@ 0 BP>vD=K-K<0C8 B0 D PgWD =K0C0S& =K-KK<0C8 BA0 PSKAD;L! 0A=K-K<0C8 B`P$0 P ;=K-K<0C8 BD`p@0 D )P0@0d Q0@ P`0 P80  PD \QDP@0 D P H#0PH A` 0 H `P~0 PvD D@0 D Pi H0PcH A` 0 H 8PVt0 PND RDP@0 D P? H0P9H A` 0 H P,0 P$D D@0 D P H@P H@ 0 H mPPP0 P0 \P 0H+KAD;$ 0A(=K0C0,$0C !KAD;D$ 0A-K B `0Bd$ Tڭ=K-K<0C8 B0 )PTڭ=K-K<0C8 B0 PwD40d D ==K-K<0C8 B0 PD 20 PD;XEp@D{ 0 P`-K$ B K KA@ 0 BPuD{=K0C0S=K-K<0C8 B0 P*b=K-K<0C8 B0 PV4f`_T ڭ=K-KP<0C8 B0 PDx60d =K-K<0C8 B0  P1=K-K<0C8 B0 P%f`z=K-K<0C8 B0 P g`ꫝK I c@PD;TcT \wp=K<0C`P-K0V8 B00 \P0PT0`F:L-K8 B0 MPTڭ=K-K<0C8 B0 >P=K-K$<0C8 B0 1PHh`m=K-K=Kd<0C8 B0 P|KTxڭ=K-K<0C8 B0 Pl=K-K<0C8 B0 Pxp -L M`^pA@0 <  00@P@pĜ` PPKDlMM$000 1 2Ѝ/0 -PSL`p@@W V:0@4#DDH$H@PU 0P@(00V@D : 0-`VLPA3: 0@4T0, p 0 40@T"T0TT400S0 XT0(00$, P@@깢( 0 0 -QL MP@`p$0S 0! $, (0v(`V{0Sw(0S0! , ($P, SG100Pm, 0 ^,0a  ,  U$ ,7 \P: `$(,b"  b$ $, 04 \0,::(00, (0 S)PU$P0 ( ,0 K0F P&, (` , (0 0RTPTP(0$P0Q (0,  K0 K 0 ( 0 0 -QL MP@`$0S 0! $, (0x(Xp0S(0S0! , ($P, XT̠ 000gPx, 0 Q,0l U $$("(!,  $$("(!,; \T: $(,b"  b$  !, 0$"448#8 \1,::(00, (0 S)PU$P0 ( ,0 K0H nP&, ( , (0 0R QQQP(0$P0Q (0,  K0 Kq 0 l( 0 0QC-W`@p 0 <S'A&a$Œ?pF$@`P pP0 < S'A@&a%Œ?p0:P `QP`Q Q@ AP <@0U,``Q`  ==Y*0 0L8 7 -L$M` @ğ4 0p00 3P0@0 3 040 30D0 3080 30H0 30<0 30L0 Q 00@{=Q 0k0Pr Y6 Y Yy V XhTP0C10Q_ 00@t=QX N0PU < 0C#" 2@T007:SHQD 00@]=Q H20P9 V@ X48 0C#! 3@T007:S'PQ# 00@:=Q} D0P V X4 0C00@Q 00@=Q @0P(K PQzY(KV@ P T* P P Pdb` P]PQ 00@=Q LȎP @Y  YR 0@0@ 0S VX0S  R 0 R0 0@=R  #6 6 6 6 6 6 6 6 6 p@-0A0S@ p00XSA 0SpRp.PC+SU.PPP` 0000`  0C ^7ࠃ0ࠓ`0CV0 TPP  0PN U7P0P>NC< -@LP`BT @0 x0U ࠱ࠣU0 .PF0 #2 S7`0`000p 0 S7`0`W00 ^P ^00 0 0/@0 0o/@///Lr -LDM @0\`K0p2 ( 0 RP 0 PC P( 0R K;GHLl0 - LHR0ŸL %ȠiNMhCK4 A8 葟姢d@L I"!'b rjb%)@ LCqc`Q@p0 < aN2<0S9VAZIU<0`00 4`K0@K0 SP#X0S    00000000S0 @(K40K0 KWjP40K0 KD<`PV 40K0 KHVPZ 4`K0@K 0 MJPU ꉈE.ų%I$Mnh -L`Pp-0S@2` T#  0R.S@0D0bS.P@TD \PT S\P  @0. 000B @  @R(0 0 -LM0 0@^KPE0pp  0 PBnK`FH P *o 0RK8F,L 0--LM0@R0  c,PP*K fK$F 0-L@ؐ 0`00K0h֐ -LM?  _ K p-L Mt0t 0`$PK0@  0 } 0 T0 00q 0RKpEL -LM0`Q`" @P0 Q0 0(FP 0 p p2 H4hB 0d2 <40l2 440t2 dӇ@P /K "h= P R 0S Sv 0S So p@T `"@1 GTh Aqd2 K:P@DQTD:Y@DP R<?Klr p`R4 QYP@Dd2`lrd Y dW @DP dr  ڕ0d"R@D} qԘPU lH `2` 0 &00(K`(KpR xb|R#Yq0 S S0 S S lx" :PP0 0C?ox"20P  x2 |" Px2 p"W|"A* pSUa R^ @xb |R pRtb@p P @T P P P@ P W:( GP P 0G0 0xb.0 h  G(K( Fp2P 0p2 w pGp|"x2 G`{0* l -LLM(1((0P ^`( p+ X@K .0 P' W Ԁ0`0 0 0 \K`KJP `G  0 ( 0R K` IP `@`GT[DTL k% j$ -LM`p`@PT) X ``0,0 җ(K,K0 IP ,bG  0 KX`` ,J@,RGT KIP @i  0-L@`PQ 000c BP00 00cRE\00 -LOM`HsHpH VL P@0  V 00/0@0L10 0R(K0Y` .CP "0 p S S  "! ".\  RF\ Q.R@ 0SyH0C SH! r0 p@ Y0P1 H! hP P1 @ѴH  H1 pG 0H1 P1 `WR:P1 H!0` Ha C 0S@ 0S= RKK8  :P1 ߉PP1 S  :S.S00<##40S0R.S:S+ H1  @A 8! <1 4 Ȗ0 0(0 `0  KvP@W00T000@0M<.K pPPX CTL    -UMLM@,5 0P<˟< 0U `8  T0D% 0  P@  T T   850 0R(K:0(5 (C0P45  `4"48C8 @VS#U p0 00 0P0 5 0 (53/P @V:,%0B?o2d5 R0S<5 D5T5 04P04 H5 0\5 9$0l5 9't0-Kt5 9 B0p% xM.K0X% 'x P% L `5 pWK:P%TP#P2UE 5  A  PP0 (53/P @ V: $  P @T0sU<Q $%R# ,$%Q PB'RUPPP,$0T%`%8GpWP*H%RL @45d@P5@ d5R00Sj050S, 0  050S 45LU@C u@@0GS ?:0e 囒;EP5X C  0GS ,:匒0@%0TUቕ@T00 % BR0S  L545 4E0@%060(5 5PT5 lP0% P( P@P@D|&P5  A  PP0  PTH5S \54%L50Rh*45U0P45 7PPU H50H5 P,%$ RQ=%C>K0C  $5 0PT  K T$5 % BRPPXPU$W5D5  ,% R R R h5 05&PPh50% R$%R H%R%i   Q p%P Q*P $5 Б%$50P 5 $h5 Ph5@/C>K0C  $5 4 0P  h5 $(53/Ph5 0T/\54%L50R455*U P4% 堔P=P$U 噔 5 CR00X0S/$h5 ېh5%P05 fT%l%EP`h5 05 $% w$% h550%@E 0U05P,0L5 LC뾘 0 @%00%5 t%EP5QnK`FPpX.^p !l1   h!0S  rt1p0\.  ^U00T0S @WT@@PXT` H5S]ڃX5A 0SSQPVP"\@FA05 0SJQK % A0QDLU(B\5P 0\5 45L 0C0B K @$5 ސD$$5R@$R<$r LU(uB\5P 0\5 g 45L 0C045  1@ L | T H -LM0S`@03 S.0 0@PPp1 P: 80P0 wP+   0`(CV 00S S  K0 0@PPp  0 K CC -BML M2p0`  8 R 0 * RC>K0C3K@ d<4 P0u# I0@%T *V$$"<匁2P  0 840 0Ru(K 0  CK  @ ! < %:@@PE PP@ 8<0@ 0 㐣P> 0P00<$ 0 0^BX6  0@C\0  R     @T'G 0 0] 0 jB 0 cBM 0 F 00S S;? Ld (  -LM`p@P0P0 0  `0 P(K`0 PP -LMP`p@P 00000 P K0 P0 RQp-L$M``@ P/0S9 0S 0S0s7 S 042 1 00 00( 0 ,K,@ $ P P0@0KpR R }@/ 0 0Kp0S0@0  0S f@ 0 0Kp0 x T( -LLMPğP `P \0 0P X 0 T0 ( ?@P 0p zA0p P `PP 0@ K0 L P0ð RR RRd0 0` S Sh P0 S S H;P 0   R+ `sH pPp``$0P@ `V R R R`  T:(%@P pU 0D@ PH\0h dS HDAA`C\ 1XVH@ <:`FR7pL W 0p`FT0V(: L0 GL0T`FP0 \` T0 ` @@  10H QpR`FP  +@T`@@뀕 0` T 0P00 0R4(KL  P/ڀ P& 0 0` H0 匕H0`9XH g0H @0T  `00T 0H00`@ ` P=T L p-LM@P`0000  0fKpMM -L M@$$ 9 K@MDM 0-LM@P9( 0$0  0K0LL 0-LM0 0@PU 0t  00 000@zT 9 PK0ᄫPUi00 HLlL -LM1!0@  ,pKP `K0\! 00 0 L RL0100 L.\U 0 00K R0 XS 00 9\0 \ @ PE U,( $ P(, $Q0 8 c# $Kc4"0, 0 -L4M2Ÿ0 @P0`00 2 P%0P@pK:U@0 00 0H d2 0P0 0Lp \p  pP`H 0 KT X YM ƂP0 pW&/000 0Rr(KN@H0 0H00H0 P墂PP0:YFW T0SH0L PT 0P:U`H00S L X R:L*$ pL HPY\p0PK L 0U:*L0 T0S$ L R 0BS L0Ts Sb _.Y`\pL00PKYPL ʅL0S;h L -L(M P0pt 8`K@ ( !P * }( 0R$K肓0@0; Lp -L|M|ß|  P 0 0 PpK 0 @B1T0 ,PK2\T0N` 0 r 0S Q r v PQ  0S` rq v00Y0S Y00`` `0K0 2圐 0@0 2KT\ P UN*:0VT0V J1 `!XA@T V00 S 00SV:0@0Tv㜐0 `V S$*: 0 S* 0C\ :@ NJ0ђ/ 0 0 Q1(K 0꿒 0 v0   P0S S 0Sl0X S0 J ᜐP @0d0S : L -LMⰕ ,K0@SPN S(XZ Ur U U v00N`(K 0`p0S 0% 5% X ;0}`P-,KP8/0 QP$ 00P @ P =00 0 00 (K蓲 0* RD ;0L UW,K-KZx 0 008/0 QP 00`P\ <`Vd,0  0P8/0 QP`p0 2 0 0 `VR <`V,K0 P,K0Pg0SvCs,KR0] 0`pfKp Pm%K K K 0S  0C`ppV  KPy 0N0\L 0<`80@ V0 0-KmK KV ᩖ) YFmKL00c` 08/0 QP$ 00  P  @ P <00 0  0`R0 KP 0S : 0C`0`8`弐00 @ V0-K`pR2 K mKV0\`F0J00 @0\ r< 000 ``!08  -L,MS\0p < L  P <`D0 L0 D #`8p ؃00KH0 WPPU8@;0P 8   p@0 8 卉 @0 T^ X0 00H<PT 0P@@V@TU 0ED  R% DQ DRO 80Y5* 0 LR0.  PZ CYR Z Oo PCUB0P @SQ00 %  ED Q" P@@@ @@ T @pZ  R0@<e0P0S8  (KSy P0L\  @ R:P\8 S00 8 P@kL0SW ~P Q  0DPL@Q %Q# 0Q 008 <80 |;80p(K @P rL ^ 0 R R R R Q  @ 0 QV R -@00LG`F0~p 00QP0P@ 0TS P -L M@P0.S00K -L M0K#@p@K R .S.S Q0B Q-RS  .R0 .Q AAQ0B Q//0*S0.S S /0S ! C]R.S  .SQ \S  0 "!C]Q//]R0S! C//'"0 0 / 0 0 / X /0 4832;:98-6543210/.-,+ )('&$#"!  Y30@R]PY&lbjC⧁j0C000@Y 0@00 pPk P.03052f:( 0 (KAQd R4 1 0cRC1  R  00Yp 40PS`(HQ4pPpG W`WPW&4 8@@T)0@4I0Y ׆<P`40 4pW 4p 0pg'P`0 pgl7""P`P*00000@ 0  Q,P -L,MH0 0P<0 4d0@0 4 L @08 `P0 Qp- UH [Q` {|P @Q p|P @Q【p e|P @ Y80SPQ@p<0 D B08< P<R  8 RÄL 0CSH R00(K\Qz .Q<0 0D0CPv8<Qr<0Q S.Qj <@ @]|P 0pJW00 R0xSO2@ 000 F 80p SZv0D /R_ ]RGQ)SD0p2080 SZgQ 00S%0HD 0c3 X A0< 00@SV .SM< PDPT0  0KF0  T0]R @%0@P/( 0 (KQ  P D X"D 0S 08 pZ R+  P0R 80 SZ(@ 0 (K004S 80S„L0 BRH0S0 0,80 SZ 0 -PaQ`L@16*0pS. R/ 0wP0*X'*P@  @ 琠岐 T  C d 0 TC0@Sp0D背(00 h R-P3P#RP3LM U `4 p@ A0 <0  Q5 @P P P X(00 (KV@Y?00B@S00PS@8 P8 40S @T* P pɄP<0p0G0YB -LMP K -L,M`S@@ %  Z< ` 0S `0SPp PpWXP 0S(0p0(K<` p00(K00 00 @0L` p0P 80 H` PU 80P`V* _Xp@ P00U0S <0H S%*40 40`40 V 1 HY0S - P4?0S``VH04 S00ꈋ(000S L 0CR* 0GSP0S 0P0 00pL0 D 3D 0 PP P 0AC\ 0AL^ \ 0S0SY8 0RH` ?0)40@0 pBY<`AZH`P 00M@0pFN? -LMp@xx Pp`~K 00@ p@  p 0RK@#3 L -LMpp @J_K`p0 ( p 0 ( 0R$K20 LQ/!0S/P0R/\/\:00/ 0-PLP*0@S @R R R Ċ( 0 0P00QzP Q0@S Q- AL 0S R: BR B 0S  00A膊(00 -L@pTPP2 !0W$0X WXTP` 3P @TP0P  MP00GP(00P_oR Q-L`@S 0RP@`V  0PR@P0  -@LTA`pQTPAPW1Q@?00(0000 Q-AL% 0S" S0S  Q :AQ0A ʉ0 0ĉ(0 0 --LM00  K -LM@$KEp KTKR-0S0 \ S \00 -PLM BU"R0 4 `0ph p@ᖄ P-TD `+T@00Tn U PV^8 1Op8 " ^-  T  R& @@0D \@aDQW@DADQ 7@DTr V^  T  R  N.@`& ! 40S R0J00 0 40 (K04 0R00  (K8 V1=Ohp8 XQ 0A P@P A@PUP 0 0 0X U -LrM@ `P eKp( tK |@ x@ O\ 0 TAXA\A{KQ Q 1( @0R$K0h L- 0    -- LM 0  K --L M 0 0  K$ QP-LMP4 0 d 000S000s !R !p 54 @9yP @H@` #/1R8` = 00Q*R  "!"""$"( < 2P< / 00   Հ 0 BX@p @ RIBP  0@8p 8Q 0080S  (KT 0 @00(K0  0 -@P`pLz0 yPz 0-P@L K0h -Lp`Pr0t0t0l@  W  (@0 v4 $Kk| Dx|y 0-@L2P00S  3/000S0K0hˇT -PQL`0 @@P 20U200 -L@pP` V  k00001PP 0-L@PxP0K0h! -BMLM@q1pCnK`FPF0 0S pP@TP P 10 @U:X 1Ppp0PSP @TP 0@U:X 10@@00;J@QKx00p@@N KPH K<00 p|Qd DTSR 0T\\\0CQHLKB`PA`A\ \  R SS T 0(K @Ɵ夦 N _eSeQQCRC@ T BpQXo PW @ S v>C 0C;R 0 z00 pK@QĠK` p K0  D0C/A!b!b0CvD AT`PbJ2/2BL1#b0w?C"0C0ԃK/A!b!b S0 B .0 z.0 z< 0 z< 0 zT0Z 0 ?" ! 0 0 0K#K#KX0P 0|~0 0(K0S#^N !V0J\ / 1V0 iVd 0?0 R ͌.1P0!V#K0u? VPy 0 0Ό 2 >"x! 0  V0K#K:∛ Fh P0o P F>02lVK  P0SP@=00 S,KP\,K B@!L^Y; >KT2  Y4 `bFll0SP TrD0@BFLl R ?ohh A @"2 0 <2  r01[ Q h0oh  C0 0C0YP Y%}T 0H0 ^(KK }L20?K } 0%묖 L -LP 0SS2FFC`0 X?o20S;R,R R0d Sp0 x K:> F,lp-W t  ! t p  "F lP ^tp |  t  p pတ `x`r0FS 0S>S>S@d V9hʅ bph&lvpvtvuvxv|vvvv { `lt p(KdKP ` V0 >SS 0S>S>S0@h0 T0K|0 P 0,S@0K0 P 0S, Kp dgn`h`aʅfxp l6p6t6u666x|& p (s;$@ `!#!U!@2U@@xPUpP p0PC B`K/P] F,hh0`Pt@ @p0p>p0 ` 删 匐 @ O@!2a11W`#"Q20VN` 0 2Xct0剡  %K MP0 V  0 t0剑 %K 6P0 V@@ -@ p t x%Pp0pSt d| f`` `@ 0 JD Q@ 0@KX`  g>f΂0`@K0GS000ř0`P40@t p0 hꬩ<{Q3 -LLM@ 4 j#PL 0T00L 0:S0@/SW 6vL:`P?@58ʟP p0 0:H0P/S .iP T0.S0S/SPPP)+P< P@%(KRz@(KHYPJz@P0h0 0H0 ,0d0 0 0 $044\0 1\0 0 $044`0 1`0 0 $044@0 1@0 !0 $"0#44T0 $1T0 %0 $&0'44D0 (1D0 )0 $*0+44L0 1L0 @0d1SDPLPT 7R1U\0PS`PQppH,0@`0@X 1!0 @04$ 0t < 0Sx0 Q` P - l ` 0p 80 X j P@4 <$ \ 0W0R 001!RGpP0X0080`S00 D`lV04Tp0P V+@T S00t0L@00Fh^0 TP, ^0^ $0^^4Č0^S 0@p 0$4?y@PlD0SL0S d 00LVS -  Q R0*;@0 "F,l R 0D"F,l  R 0S0C"F,sl  R$Y`H232 42̟0B RlD Rl ,`@   P0D0 \ :<0 6 PS40 GKV,JOV|h 28 00 hpD `80U`PUL tP00@SD40YD P/ 0RA 0Q-=<0`@0paQ3 @ R0.\ 2Š@G;F̌@>hYD 080D00Dds1\ Pp0h0 -AL@0 ^`a0 tRE SQ0- 0-@L@P0S tK0hHd PP P@ @h@P  V 00 Px[ܒ -`QLPV @ TpjX9f @@ @@@hFlFpFtFuF oKTpP 0:S  P `V _VLpg@p`ePT`V pp 2F"F,l02YhV40 T1<080 T U0 R7 S0# @T A@@420C42 42SV @sT(KS 0R0P3/02S04"R4 0T 3 # T 3R0`0`@S 8 0  3/02S @i 8<4 F -LM `PQ p( ,@eKtK |@ x@ O0U1 >KPETAXA\A1 1  0{KQ Q Q Q q q  1 ( 0R$KqT00g L -LM 00 Kf -- LM$ 0   0 Kxf 0--LM0 K -0 0@L`XMd`00CS`0 PX0 X `XJdp SP UX/Pf DX0X 0`00CS`0 X0X/p S RX|e D --LM$0 0 XH Kd D --L M( 0$ 0  XN Kd D -LpP@ c0S000 `PP`#+P.0`VP C0 00c  i000+PJPB V: |i 0 B  cI_mpc IWm --L M0 0  K -- LM 0   K 0-LM` K,*PpPP) .@P&   P(0R!ʬ0 p@ 0$  0,  0( 0 0K 0eK@Kqp0000@b (| 0-PL1c@$C@5c0 -LP`@k RT0U :T:0T:KhhT R-L KhuTK 00-sL@P !R ! 00 0S 0BPQ`0AP R 0 UPPU`P0O`P `I`P0  o 0`0 R-L@ ` R R ^0A A0\00S000B A 00 0b P A0pA0P  B!  u]P0U* , uTP0SW #uMP0U*  ! uDP0Sq   u;P0UY* P KTKRp(K ' u)P0U*  >  uP0S uP0SL   uP0SP KTK'p  uTX0P P KTKp s uP0SP KTKp  uP0SP KTKpP KTKp  P KTKp P KTKp  P KTKpP KTKpgP KTKpyP KTKprP KTKpkP KTKp;dsP RuT Y1` TKp P$R`0 7 uxP0SP KTKp> AP0Uf* <@A0 SOX0P- K(K`@@@@uGP0Sk C u>P0SP KTKWp  \0P00T,P KTKDpuP0U*  TKd0 5pd0P KTK-pP KTK&pP KTKp@ B uP0SP KTKp  uP0SP KTKp  T0Y1!P6P KTKp 00B SA0@A@ 0@D0B Q$R uP0S!0T Y11PuP0U:P KTKpy  |tP RT Y1` TKpc TKd0 pd0Z$R0@ 0-L@I[0000 -oML Mp|? x00 | ' 0 v  1S0106Km&0   R 0 S '0&  & K & . 6 7 6 6 6 6 6 0 v 吖 7 f0S %Snf0 6 P6K5Kg>K 0C@ `6 ` 0DZS032CeT?N\MRidb<- vzr@T %T6 V 6PJ60S6  Qs  TV t6S 06 6S 60@0S 06 =K0CPP 70 0R9 (KF$\P 00 S+F0s' `GKY>K 0C @5 d d OTaXa\a.jˠ0p^^K D PEe `, @ECKL'e `Pf E[P`f 0@&0@00iKP ʟf x:0   n Q knK `FRb k.K B    `REK  &KQ S06  k>K 0C006@@S@T R  R@pSnK`F0T  6 6 6 6 6[& F S& & %[R& & & P R& & 2 P@U/UF 訟0 `@PEU R 0& QPEU  @`d80^ P 076[S 60S6 j>K 0C0 Q2  5[S 060S6 K 0CQ [P@0 C R R R" Wf p"6& e   S kK! A R0-0k.K Bp6K6S66 06 f 10 0  l Qt kK L& [@6[@S 06KP@F006K6[ SR&  0S \@@00 D Rppqp0 A R$Q& R06 6! 0& 6 & 6 6S0c6 +0@6K6f S0D06 06  P@w6 Sf & 06 P Lp \ l h '`x`_d]\d\8 \ H  6f @f pV6&10,K & v F V p5j `0&K@& & & & yP@ PP0 f 6 w S 1&  6&S606  0kK A x H>f %K: `[@06 6f f@C^KPE m`V66YK J06  6pf ?pF 6 f PaTf T X0P & 5K6&S06 6`S6100i.K B0 6 0B0  0Bj.KpP &6B Z s05K6 S&  f Pt@0*T( 0 D R`0@100 D R6 P@@P@@P@Z@PZ@ P@6f pV *6S6&`a06 Vv V  FTO XpPW pGWp 0&K@& & & & /& f P|06 6f p6S h6S6&06 Z 6SQFT!|C^KPE  _nK_@㼆 v 0`FvP @6 0 0@svPPV ; C>K0C  㔦 _&iK0 A p 0&v 0`tf Tf w pYnKEKv 0V &K@& & & & `F.0㩦K@6 k>KYK J 0Cd!.Q000 0L`L0S00SdpFpG dWڽiKdPD& }6S6S6&6@JT@T ڌ60S`@ 6 Q  6T0CS@+S&p$WPP @DT0S 6 Q.@DT ʄ70P0@0  Q3  &6R`k 6PSdئ  7j^K0 PE0w6 V X60C6 600HJP0   Q  6@CT@T ڌP `@  T@@@T#TP @DT0S pP6 Q@DT 6^   6`XSө ئ V `!6S6  7,K60pjS  6 Q  6@C6T@T ڌ60S`@ 6 Q<  6T0CS@'S&`\ZPP @DT0S `6 Q;@DT ʼ:00P @ 066Q6 iK6P iK6 /P 6iK$P& 6&PCU*U0㔫 PEU R 0& QPEU ;0\0P0 Q/ iK6 P 6S6&`a06 V-06K6`fS} 06 66 6060RQP [S~KpG F`pGD6&S0YKK P J`K   Q6 C 0@f < 0@LT@T`]PP 0@DT\ ` Q>@DT 0 .P  @  0Q 06 _>K 0C@6 0 <  66 iKOP/ 0& 'P _.K B  Q iK:P iK2P& 0iK(P ^Q KQ  niKP& iKP 0& R@`&  gQ 0ciKP& iKP QN 6[ iKP iK& P &iK& P &P   `iQB _>K 0C@6 <  0P&? 0R00 & Q  6S6  60S  6 Q  FTb6&06 606 S    60NS `T6[ڠn`@p v & F F F iKZP: 6 V-iKMP- @v Q 6a& h&h Y@^ U S&6a`l0Fl6 R@g Q 6a& h&h p QS aR k~K pG }iK P \&0S%K- C+ S6E%K0cB SBNK @D D ̟ C0 P0BB00BD0\0@*N_.K B00^0DC000C& 7 Rp6[@p/& F F F fb^p@/& F F F fVQ6& a&  6`06 06KQV kK LQ66& `0a& 6  iK& Pl 6[&m06 b/& &f@& & & iKtPT& 0<6 6[ 6 k>K 0C0YK Jdp d`pG    Sv S01 & @  Q`a    Q` kK A` 4  Q& @ & & k.K B_@ F   b Q& @ & & k.K B_@ 0  S &OS6&0 kK6  A? HYKk>K J 0Cd` 2>!B 0 0fdp_K 0C R0pYK Jd@6V VЖ ئ @ 0 ,]U0 p D`D 0S X  S00S 0 ] 0ئV6dpЖpGF6 V 06 &00 ER0_.K_.K B BK00~6V 6 Q1R `& /k.K BknK `FR `R !& `@x05Kp06 RppS 60C6 t&@dplU尦PP @DT0S 6 Q Q@P&  & & k.K B@ %Q@P&  & & k.K B@ S&6a`h0Fh6   Q66`0& & a6    Q66`0& & a6  Qp` kK A` Qa`h&h |c` 0p`QYK0 9%K J 0Qc@p00L0F pGF `6&0CS?6 qsiKqPO PiKkPK& 06 6, KCp"-p &6R&&  & "\200P @ 0FiK ?P& *bv V `iK0P  & [ f@& & iKP iKP x& k.K B &  <& k.K B &  /6`D0DpWpriKP _iKP ZiKP 0 knK `F +` ,PIIIxF D hC$@6  kK A Qj F %Q )6P6 Q QV C>K0C  㔦 ^X 0iKA p@&0@00f,Y_ 0 0& R&& YK JF dp6& `06  _ 0 0& >6& `06 @K S01 & _.K B0hiK9P F6kK A  ^_ 0 0& &0@00@p0 D RI`a`0 A R$Q& R" !`&  f&R" @v `_  S01 & =R& 16 `@K_ h`6 0& 6 @6 6, KCp"p_ 6@v `1`V )6, K0Cp6"pI &R6 0& 6 -LP@`Q44 0 PQ -@P`pLQ0 PQ -kWLMϠP0 JP|  @00 (Ko{kG{&{ 800 *,B<@ UPp Upp`PX  G RBR  RV#Q B RV#Q$B`V*BVA UL U@ R KP㨏N Pa P RnPE Q VN VJ rQ Y D@VFBR(K */B00 B 10  0 4(KoX10  0 (KoN R@ pPBQ @XPE Q rQV00  X PE QV V rQ PE L`H:,: -LTMbŸ`D P0pP KU@0  P Pi P00@0 U0002ȳCK8 0k {@{{ u @ R0Sz R00@0 4K0K KPPX ( 4f $K@HA56\ +Cskt[Fk7t{{s[k{{kZkGkIY0`0 1k01{{0`0 IL0Q S0aBL UL0 E0CY d L D BL ih @  0 B/od " Ql H Q AD D  BR񏐇a7< 0RP 0XN  k@(K0C>0 SA.< < @0c0" 0c33ѐ:g{{ $KH\ A6@?aCoc?`(?yPD?0 '6(|0 +@P 0X0 p0 0pT0 |0tp Dp 0Y / RT R \ R4C6h0|0 L00P\0 |0 LQSQ  AHL 0ChQ T R1 \h0 0P\0  `P Ph0h0 `Pz dh0QDT Q l `R`L  L 0XS`0S X0S\T0S L0Sd0\S?<0l   h X 0D0d0 p@ \@` up 00`PL0 2 D0 @S@RX cT TQP @0hSQX PW@TRd0@ SL00+  PP \0X \ 0P\0  P  P0h d@(K@0S0@0 0@0 gX3Q  0/1[{;{'kkKE{{:N{7N0CB:N@{:0  0J St0S @0S S {7{E{:  @ T  p  RX |0 @P D0S  @0S00S t0 |0t T X RX {Y{  )!k  "K {[Q ! {k& K` R c{KJ `k[kXk K8 \ Bf X{`!T[^*0 E{4k  Af G;[D[5[ <+Gk2knJ\d 2KGk2keJ Z[ {'k;[%C{7{*0  Z; T W pp Xp x0@0 pP   ! SP@(K$@?@?P1( k{{{ K8  B{ AG{4{Fk{Z:80 0   QP 0 (KKKT L\ %Z  iK{B"K'T Dk{k& \FKD`Ph0 DT Q l d  h0 !h0 `#h0 PPh0*`P&<0QlQQ `Lplp@ t0S @0S S[ R `Lplp@=pX \PX} {h|0 PP|0S[P PPID T0S:p0SYX0 Xp PP4 00 JS0SR0p<0 @0S S PSP<0\ Z\0 S  S9R0J  p X pi@@(D00C0X0S P\0S\ H`100?X ;9Z0@{K&? k[4[Z Z T Sq  S9R0J  X`V{[%{[KM\0P\0 V< RK$&R !**R 0dd Q$ \ ;{'k[E{7@{*0   J Q J T0 @PT0w Dp QX  t pT  P T X Rr p\k K${kkk K8 I B000 Z0 PG \ PDk6kt0Z J0S  \Q `hP\B4PP$ ]P9W5 `01p100 Z Z0R0J <0\\0 n \ 0P\0 p0S.X0  Z <0\\0 @0 `SLplp@ 9Wp9  JD00C0" p0\0 `Lplp@<0 \ ?@$@@D00C0 p00Lp `9Wlp@ SUp0X0 < R F<`LP Q` !46SP/\46S//// P0-L@00 R@P@0 0-L@PP00S0 0 R U0 0@! -L$M0@pS4 q@DP`"U180 P00 <0 4 D`  `@P H@ @ P0 C R0 R0 Z*D`80@P0H@ S< 0BV *0 S0B 0CRV@D:@4PP' 000 PPZ 0*!1R CV * R0C 0CRV@D:@0(K -LM 0 0NK0P.0 W 0 KL!,! T! P! L!  0 0 DX 0 R?K H D @ < 8 4 1H L~ -L! -L! -L Q-LP @T0 `P  gP00@Q  R @ -L`WS@yPP  JP-M Ѝp@-@ P` !LNT !@Ap -LM K 0-PLM0 P0P @P2`1$K0 BK0K0pW 0 ?B0 00/ ` -L @M0K #K@  H@p`K -- LM 0  X K  0-0L@Q r P 00 S P1 0 PP   ! O0 @0 -LMP 4K0K4`0 A Q@4 0 05V% 0S| Sl 4P8 pp] Z80z0 Q# RL 0 0 V" p0 ?0SQP (K0S Qt0p0 Q A V0 !PPJUSQt  P 80 U   0U80jSPp0pP  0p   0P0p 0p Q=0S 媠 pkW4Q 0P80 49 80p80 &80p@ pg80  P80 S 080 0 p0 800a80 80@p_ 2 J0 pxc 0 p80J`p@0 0Q/ R  B / 00-PRSL@0B!R@ RP   `2 0@!R@  P --LMp 0 BT?00 Q 0Kxp  t  -Q, 0 S 0p`K(K00 `x` Q 0Q00  00A S00 0P@!T 0PBT1Ѓ00Ax @0 A R \  EPJ xp x  +R -R    x  0B Pxp 30Rx尀x 0R 1BP%x0B x  0B X 0 x  0@00B S0尀 帀LdP\\`00 x0 FZd  @ R   R /o" Zg{T @Z pp Z{ +:0 fk01[kk 05SZӷʨ0S 0Sڨ %0jSd+0j {A1k!{'k0{' dK{  00K0 0 PLp0K0 00Q0 0`0 70XS xS `x` 0Q Q5 00 (00/0SY 0t xp 0 Qx000S000 R  t ,x@K P x00Cx0  Px0 0x0 0 00t Q \ \Qx T  0B X xX ⴀ  R  P PR1Ѓ0QQEZ1Ѓ0а x  p0K 0 pJpWT  8{01k{'{ p |K Pt g |0p A Xp  0p  |0 p 0 @0S 0P0 pBW0 Sp  00St 0P00 00S P00 S"0t 09XP ` PԐi!0V0 ʜ0 @0S@Tx pP  P0t @ 0 p0 0C| p0 Pt ` 0 00 0xKt0KP *0xp S0t p P@.'Q @6  0k,,v,h ?Ch {{'0CL"* \{ 0hu46 z5G6pGh0 Qp L @{ 50k {'0RG { <0Rx 0R 1BPS I B%R񏐡~}|0 00K 0 0 lKPM00 0 00 @R0b0˟۟0 ? 0 Ԑ `PPD   ! Kt0P9 t   !K|`0Fpp0 Pp) W00`C0p G`pP BpGppW  V 0RpGH`FSGQs0SXV p P  pP 0S0S   0P@@S@T 0S@#% X  !00 0Jv 0 0| 0#R00pS00 KKH . `P Q / `0tS  ! t| Pt 0S  B\40 S| 0 B0 | rpT| p00 Q C/o" R (K{9Hk{FZțJʜ0S TR PN*x@K)Py  0 0x 00(S 0t 00n?@?AV瞯< N(?x`0 B ` QP00Q000 G @0  P0  P +   P!P-  X@`0S``Vi00 0` Jۛ0 3PPq PPPt  B\Aʜ0SM | 0 0R0| 0 HtU Pt p  Bp 00C0 t=0@0 P0 0 R t P0S0P 0CSSF 0 00CPP t  PԐ0@C0p@ |0 @Pt 0S p0  0omkig p0R" 00S S S tY 0t  00 "!Q*0R00 0c1300t S-r X0 0Λ0 000 @ UI^Z{狸0/zKSH9O S!0S ڼ00:狸0 000c0 @i{H:ɋڀ0 P 0 P0 Ԑ?(? g ,0[01k{{ p 'Q T0  0kpp||h ?Ch {{'0CL"* \{ 0hp46 z5G6pGh0 Qp ~ @{ 00k {'0R{ G nꐀt`HKPt p |  Bp a00 t0  }P"000 00U  b g  c00 00 P  10 0 0  R0t0 p 0 00 p a  0@ J@ 0 t|0t 0|0 7s 30[1Ck {0dK{ S !    Ql 83Rp 0]h0d K6 0" X `2{0dK1k05S00{'{ 00 00K0 0P% oQ| t <q0|0 00˛ 0QG!0 00C| p0 |0 0BS0 r ttڜ~t p00C p0 gP PԐ_0S p0K0 5 `g XP ` PԐf 0S t |0S*0|P| 00 0 0#R00St 0* X\V&  0 RdQ00 S!00P 0 PԐ00S%0S !0P t  PԐ0 P00 0p0 0c?(x  0 00 t V!00  0` St n!0 S0S000 P PԐPt e 0|@@d@P|00|0 !00  B -L00 -L M@ P@`PT 0@000 040 q00@P "(,8 80W#8 4AqU*@L @!8 8 R0DD#8S 00 R  001 (K@P   ! DG0`00 ` -LM3ß08 @00S 0"0@0 1 40 040 8040 @ AR 0AP0Q p`0 P@ R PT0 V-\ # 3Q R2 \0P@VJ(KQ`  0 \ L pL 0`  P b0 P0P  a a< X<PW< XR P0) @/oV" RH 8 00\0#03Q0S 0a @a0! W \' 0 X *  X*40 R 08SY00(K XR_ P0\Z>0(K@04S  0c1# )P  Ri  Rc )R08 0]0h \ -LMp< 00 4 8(0P`00S 00 00P 00P RX P@ \ \ P 0Y@0Y P0u X| R  B!8 PX pX ^@q 0D0CSڣ0S!pPc 0X@0  0 0QZx*@` T0DS@I0 Q 0 T @   T@ 0CC10B40DPP`%408 0S48 0S@CU  0S Sz Sj LP@"00(K0 @\PR @(K PP pP 8 @@ 8 +QB -Q > AP rS0J 0^\a 40X 01S  S  SW 40@PB``0 0u00T` 0T V 0PCSU40< 0P@0 S S0S~ N0p000 40b@0p< 0nL"00 aF PeP408 0 S8 wVL@"00(K8 A IP @ >IQ@@8Xa8 r@V 40 0Sl Sm S @008 p<0 (K@@J`P `D@ 21 2 Q`80080 P  \ PZ P@Q Q@EpPLVD`X  ` @218`G40PE0@80 80`0C80 0@0 @000c00S `wTp0:  RLPD!@0S+0SM 0SI 8 =p @00`jUUEP 0@ 000S0S ~Pi `h4   BR"@I 1P5!@"@A \ / -` LBϠl\@pP \"P 0 WP0 0 V @`F`V 0 BPp PU0E  0 BP V@98 0-LM@KPK   0 B0C2S ( 6cKBKZKBK { k K0-0AC^ 0S R0A  S@- *@@\@0L0C00Q00Q0  S  13S / 01R *0CPR/!3QR:// 00 00Q00aP00Q00A,00Q0/ \$̳ 2A-R`P !! 1R31 a p@800^31: B B  `S000 CB!S 0000 R 0R    0B! -L M 0!S*0S @0SR @K@K0 @K@ - q 1pL0`S3 V00AT  R+00 0PV@T `PR x0PhV!@0 0D1S  $00 pe|^ 0-@PL0 R xPQh00AKhH `<0 0PAKht 8d|d0  0#100/ P#8#4#2#10 0// / -LM@_ p ?"K`,!(1! V@P0 0S1`@`$K1P   ! Aspo (0(R8421S/ / 0-@LP0@00 -LM0SPP0@p@S0P80 D ` V*0  Z0\<0 &*@  X`^ 0< @P0 4 0 pp0 @QP40 X@` p@W 0JS 0:SpW80p8(K -0L@<$A QPyW@ @ PU p  PP. @ t1`0SrPP@ 0S 81e$1`PU 0S 0C  P 0`0SJpP! 0 00 0'. y0S x05d00yW0S 80$ (0R0y , `|^8^ -`塂0`@TPLڃ0TpP X 0 0X0 i  @ ^ @D@5 )  S2!:R@@D @#-0P10^$3 1\ : -LM@ P@DTpI 0 \H*32P >:0P80 4 ` @a@P 0  R0 R0@PVCK@P@4  Y  Z0 Y @P0I0C00RN0>HS 808(K@0@Ppa0P80  088 0(K -P@Q`L* 0` P0E T#5 `116< +CT @ *P PE` p`T17 501P56 +C0? -LMPkWP 4'J66V(0 ,` (K0( T 0 C@@1` $K,KoP(0,  `, (0!30 (0  ST0 CND@D@5`@ $K0S0/0 R / -H1HALMP`@AKsPP8 NpP20S  Q4 Kp$ 0: S_g0P   `0 $ ,| ( K FO000KF 0 F 0 л (|G 0-@Lh900CS00 Pf90P00CS00/y -0LrS. wS( aS mF00/0S +S eS%0S fS$ lS, xS0+S ,  0-SL@3  9 P00P! !& 0S 3/PP೼000P @ P ]00 `W00aa8@0`` 0I,6PF 0P0 000-sL@ !R !P 0C 000 0 S /6 0-Q1P0L0@S2 0 SI ;000S? 0)$0 3/0P:0000P @ P 00< R 8000f  0@000 0x0PlI5P 006E 0 @000| / 0-L QS :S0lB @K0hd0LB @K0hUE0000B @K0h6@000 0 0000/8 -L M\S`p@ CoR$塏 P $ (P ) SS (\{0᱀X  0(Q\ 0  P  KQ5$ 0$1$( X$ X $$!(1s(Q00(QSV 00\(1 ( Q\:0 h P(P0\ P 0 SX%XU!0SPC BP(0 qP($!(Q$ qD, 0S00r -L,M P`ßUL D  ` ! PH0 2/,(0Q00 0 P@ @@pp@P0K p< PB ^B  @pW`VV 0 P_ 0R@X"pWDPJUY@p(K 0 opPwA< 0 ?pPO 00  P5 Rp@!8  P8D`V VD V 0 @P1ಀYHpHp@ @  hPH0L  kP @ @(KL H0 k@ P@(KD0PJUH0  pP   _hP(Q`EV 1SU0$Q(qP $Q(1ճ@k 0-L@  S0 K0h C,0C00,1 0-LS@0 K0h|C00,10 R0-L@1  0K0hfC,0`C ,! P0-L 0At 0@NC -LGM41@S5  e Q 5/p0 ` P 0qK/K p.K-K ,K@+K*K)1K(aK'QK&qK%K$K#!K"K8 P.K QKKP p`0!KqKpaK1K`0KKKKqKaKK1KK`=K0KKKpK`KK< Ƞ 4K KK0KK尠KGpEDDpFGFKpĀJ0I`EŀǐHpI0JF0GpƀEHD`KƐǀM0LpNO`pp 0SR`QPpʐ RDE`FGpːP 0< 8A/p^ APpM_Ām[PQ 0phPMQ 0phPBQ 0phP8 Q 0pgP.Q 0pgP$Q 0pgPQ 0pgPPQ 0pgP U(K(KBO00B ,!a -4!L@ `PP/1S 0L1(@P!PP!R PMPP !Rp :V A`_oRA`A`` 0-@PL P0P -`LPP@H UQ0pzP< UQPEE,!00D ^ ^ ^ ^ ^ ^ S `@  `@ SSA@ROA0@ Q0-LP @41S0 P0P01000A 0 -pDLOMQP`, w@P% 0Uq1  WK APr 0 pA`BAP`(K P_  0p '0 VF pWC qA/6` ***!# p!!" "#, "$ ,( 0,$#4 ((Ƞ''0  0p't0..p!|.!"#" p!#|' "$!"# $%,,& +0 $#4(p/,x3 ̠4)*0,-p.012 D!74; !x!""#"$5p689: ?00@ABDEF G崜HL0)t..Ƞ.ŐpCCCC嶌 (Ɛǀp0!G!!GG尐 ) L A AAR!Hp''' C pC C C,BB))x)CCpCCR,BBZ!!!tCCCpCR.ĠBB`z `AP\0SXIXTx q 7/@ PL( '9P 1Dp N2ḡ !0 NV Q`eUQ0PP4Q$a$PP 圣 #@3Cp` p`(KTß pO` ??P?ĠQD  < x8P Ÿ 004p  +? @ '?V Pj pR4 W qQ^ PŸH ^^^@4;P3 0uD H $ 0ePI*> 0BH,0<0(u }pQP2V< zX!P00 p 84 p qD> @ >K PDP NK0S 0>PP>@`P>P> P< x8P [>`>>>ꐤ axH -L M@(` 12f0pSP( p R!ءP. `0( a1  Y DD ,Z105,5(Ko1gꂑ WP  0 " I9>0ء(K 0-@ 1L3/,( R00 0-@LQ ,00 210Z> 0 -fLMS`- p@ H>0@0(KX 00(K 0S0 00 @0T0  0S  SS  @ p 50 0 5 0 PP 0A101$P@ 0TPS 20 2@5Y85000(5  5 550 00 S S 0Kp %K0ZXDX# X3 2W 00 2!" ؁R0H     P 09:pH5:@ P w?w?Á Ñ 0 *P0j "  T+P 1S0S1S +0 29 20 29 20S 28 2)  KP?P: ,ß  R0  " KK""$K K  R  K  KK ,KK,,KK" " K"$0KKK.|K.Ƞ# K.#(#4KpKKKK K0Kq +=O00P ep _@(KS1S 1@ 20 271 @=00SK p 20 2(Pd1d! 0[*0X*<00<0S<`K M*P  G*`P pW0p!! 0 x< + +:0SԀ*0C~KpGK AH4 D4 @4 <4 [p@ sp  $p X p  ( 0R Kh+0P7P  7@P7?0@0 LD<h -LTMş @ ` ` \0   %00 RP_Y :Y h7 0 ` 0 QU(K w0QPY 1S %P䡄 0    {?p @Pp|:!h0 Ro  ppRpWq0 d0 BPih0张pod0YT pqP0h0 0! 00B^:A.Z*L N l0 A0h0 !l0 B("811"ȇh  0P *0 $(0 0S 1S  R!<3 B00C S  *% Y "0 "` R"AAW !%T K0Pd0 d0YTp P 2  0 pd  $d02(00S* w0Q:RPXpK Tpr  00D SX0 @0 @0KP< H0 HK ?p]  X0L 80  80K4KP0 /0 0SP`KPP0  0P $pP; 0㸡d0  0Re1 S0"1!`d 0  l RZb {0![ $00 d0 :Pah0 * 0!{/Ⱐ1>0 6 0  ~ L -L$M(p  QP@`U ഑ 0m rp! ppp I)!8#8  pC!xS'x  ⇀ ^01Xp0!8#8B08#8S 0C8#80 0 S0081#810Q! B!(0 0S (K0 R1S0C1 0RX 2 0(4@ cK 0 4K +P (00(0 p0 0p WT V)1"0C0S4K 0 4@ 3K{P(00(040#[0!0]VQJ1!0C00CV Y4@ 尃K4K0H 4@ 3KWP,(00(0Q "P 04 K3K80 4 AP806(00(0  {#p000 4K4@ 尃KP 1 C  BV* "P 14 K0C00C4 3KP(00(0  L# G# 0-@LQPQ0 "P 00 -#0 "P 00 #0 -L MP0 ,10C08#8S/0S PtxPoa V0FY S1V `"@Pb `V0ഠ p0 p0  "00(Kp1 pp J1!F∀0V.1 0p\ 01W 0`L08#8S 0C8#800\ 0 Ƞ1,Ƞ1SL "00 R 0VP00 00(K0(K"0(K 1 1 -LM@`Q r"00 26Y8 Y/(P, P 0- !`PR 10C08#8S 1 !0 B ("(RP 80 C"80S 0 " "(K3 0 (K0K  PP 0 pR1 "0C08 #8C R* P0 P  "0(K1 0C08#8Boᩒ P 0 p# RR B 10C08#8SPSP  !Y8 !80/o"y !{p 0K8p ! 6 P `0 RZ < Zs !뼁,Yj  HR!f p !뼁p X0HK S1H  `Pz 1"0CX00CQ 1X%X P!!1 P P崐! f! PU PpW0*` W!  `PF 0R I!  `P7Y20)80 8!802 0 < +! 8 P`, 0R Z !q W@ 0GS1<  !q W0G S1 k `P WR 1 BX%X XP!P1`p  M `P Q1PEPPEX%X XPp!  6 `P 0-LMK0 P K -KML M``PPß @ Op $ 0 F20@040 0R(K G@T R B@ W / P (200QB Q2?0040SXS02G0T Pp@ UXRP>  HZ@ p4T CC>K4  ;o0 W *0/S0HJ 0C/RF W0pQ l=K` 0C܄4 Pd dV! -/p"10S X `0 S00R0FX} U P100t4S lp @jkP 1@@DOoB_0K0 AQ/0PP0U4: S 10@0L ܔTi L4\ R-L Q0P:Q:0Q: Kh*B 0-$@L@9!  K0h -LP]@Z -@T!  Kh -@LdM00KP  )0p \p )0 ` )0  d )0 h )0` l` )00 X0 )0@ p@ )0 p Tp L x s @` `0XPH t 8@ < @DP 弃Pḓ帣HL  | @p ,lȠp@p Dp`pDp !8pa`pHp  " 0 `(  pW'0Q 4 R   P3 `10C08#80C0 3 P00 RpW 0p gW``0 R  U`p 0R ` P ` = -L$M@P`Qp .00W. 'W W W (00(KWFW! Wl WF0S 0S 4K 80KHX40尃[7 W :0GS(0tW,0p1! B ("(R  1p  CP(KW W% W# ,K0:尃[P 0 00p(0r00㸁(0= `p 2 ]400(K,0`t1! B 0("(BR0O ( O 0崀1  P 4K 80Kp 80Sm 43[  1 m P W #W# WB(0币@XEWF p TW[0 4L(KG%4 尃K4KvW (0币10C08(#8X 4 尃K4KaW> p %W  PE 0(04 尃K4KJH(4 尃K,꼁 X  mP) 0WSLqYG  \P H⨀H(4 尃K,p꼑 Y  FP 1ᴀX0C08(#8X弁XH!1 ⴀ   $P p0p l 0C( y각 0H⨀H(p0!1 p 崀!  P -@LP`P e0 00(0`00Q(0 -p@L,0$M@ D H0 1 PJ a`F`h&hV< < 8 Pp@ `Xh%XV" @H$H @  `FP h p8 0%0!01@0  @/ p8 0U @EH$H 0#0@< <(K0D <0(K 2  U 10C08#8SQ[0D <0P(K 2 < PQP WP4 14PK0C00C @3K @P 0QH RD 0% 0ES1   QH @R0E[ S1X &P `UV 1`Fh&h T`!D   P4 `40K@ 80 cKT @PP 80Q0H RD 0G 0ES1C a Pd !0U B  BS9 rQH @R0EU S14`1 P _ P= a1`F``Fh&h @T`P! 4GP7 4A=  <!08#80P !1 ` `P! % P0 @T0* P0v000/ 0-@PL , B@ (U% 0"0Z -L,M0@(pP  "< ` $08 @0 \0H0 00KTp L0 p 08p8` P`@ LD0 02` !@0`!@0 D0%8f#" ,"  % d! d!,H <P  2l0 ? 10 !>2h0 ?!1 `܌K`&0 %K " 0# K E?K&K "0#CK KA?K ܌K ЀE?K``&p'eK̠Ì ̠30 C?KmK  "0#nK` p`pnK 0p0S` K-KK.Ko0l0 (0 /K(0LK0= 0 KdKJi,T\Q`܅KKK܃KoKeK K KeKdKKKlKCK$Kl0 1t Ġ̌| p !Ġ ̌x gKGK@$P%MKIvp q~#H,p 3l ܄K(w yp (yQI^ wP p VmK`&p' @P PNKK܀ ܄K@ P)790 )970 .܉K(K  !,à)K " 0#.K,KD @ @P 0DK@$P%K`pKdK p` );40 ;40 (jK.K`&p'dK`pdKeKP@ 0܃KKP% (@$ ( ))  K ԋK 0 K !KKԍK@PKK@P ܃K<30 <30 ܋K.KnK`&p'@PoK`p(`) p,Kl 0@PPXK܃K#K dK @ PK!DKEK܅K@PK܃K"EK@PlK`pCKC%KfK`p@PdK!%K`dK!#K`"C(K -@LQ PUP`  0pRPQp b!p !0P0H @ KhR Q b!p ! -@@LP `YP7 rd0! 0 #0#0 $P H P0Xp【H【 a $ QPP$ UX P㈁9$  0 #0#0$Xp〠H〠\` P   v$ QPP$ U R-L  -L M@P 8PH8p,`KI KU@   K 0-@PL 4@  P 0$$0P=P:P/  w;P <P0$ 00` KDK Pf`zAPb'aGP ^EP,[ hܬ T^P OXP YP!J | G 0D @0 R <0 D @ ` O 0D @0 J B0D @0 E 0D @0 @0$ 00` KDKP .P 0P+J P P P0D0 @0  >P P P7 0D @0 qP wPd  P) 0D @0 c#P~ w$P %P ,0D @0 VP P 0D @0 P& P &0D @0 B*P +P D0D @0  P7 P 0D @0 .6P 7P0$ 00` KDKEP  yP0 @00\ Kd0KDKd@ D @ Mp EK ? <4P 0D @0 P0D @0  DKPvD u )0D @0  *0D @0  +0D @0 y0$ 00` KDKP V 0D @0  0D @0  0D @0  0D @0 DKǫP : 0D @0 J 0D @0 D 0D @0 ? F0D @0 9 G0D @0 4 0D @0 .0$p 00` KDKP  <0D @0  0D @0 t0$ 00` KDKP  (0D @0 0$ 00` KDK}P{  0D @0 P 0D @0  C0D @0  E0D @0  @0 D ;@1 R 0KP#DK \ KD @ m p0\ 0  %0D @0 0$ 00` KDK8P  0D @0 0$ 00` KDK&P 0D0 @ KilJI _P10  0@-(@ U1!^  QN \SD0L00@-(@ U1!^ P\0PU000 -@`LM ,KP (K(@p@0T!؁,H(@T`1`! @D  T(@ p,  PP$K$K|pP p@ -LMq00K< D PpG@0 0<0 x PU @<@P U`1`! 00 0 80 EX80D PU0<0 T (K(K -@`LM $K K$ P 0 q @pG P@D @ P$P TKK  KP/0@ 0A0SU*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0@/ 0-P8LP@04 02P*T 00S84 0`@2T:0800 -LM2Ÿ0 P@R0p`00 Y 00S80S 00 Q(K4P  P8 01\ 40KK`0Ġ`☠K8  0 0 ' R= P8%YD 1 c1'à40 0` 4`V 08  R88P@PX`002,"SR,BT 4"R 00d"00820 0 R)(K I P02,"SR,BT 42SC?00 c/K8 02,"SR,BT 42S)00 !Kp 80Sl XFXSP`  " K"P 0 S c/KoK0 `w42S04"000@ 0~((P X` `0((\= 20S P02,"SRl,BT wKn02,"SRf,BT a42S00QX-028 808 `0 R`SQ P408p R48 0\R408 \P0` @ yUY@B`@ T T 00S`7<2P`R ` 8@P@@ wKQ@ J{@ ?02,"SR ,BT 42S@ 'C L̝ / T З -P`pT@L@M`@ 0 00YPޒ(K -LM@ß@ P@T0 @`ISQ? r4 rD 000V``V20`V`0 R2`0b ` n0X@ Z ! 1i@T X Z:0 0R(KV 0 4S`RU @@@}V 04S:0`S0qKp~. A Q @PPK /00 PT   V@7`p W4 P +V  RX( QP 0P0 @ R R0 p0``~S _W` `pG`0``Y~``Y``Y`LKVQ@q -@8 00pE L 0@- "A @ " @{ 10-S@LP  P 10 2 0! 20K0hp@-@P` VP p0-P@  P 0S RP0/P*0    PP0/0/ p-LM 1 0 @ R 0 ^0  0Q0KphK KPUP*`KPP `K`1E"F0^ R KQQ*KQQ  R 0RKp ꘽0 L -`0L,M0 "!D  L  H cL0040  P 0 pP0@"Pp (P@8 a86/PD6/P8p6/Pp40S  00 H0 X@ <0 :pH@ 6/PPXT 8@ 4P00 p Xr: 6/PU UQ 00  S T8P40SJ 00P00HX@*@0C00pG0A<S B@1!<0 0CS RoQT00L*S*SY:@00@Cs 0L H0 j 40SA<0 00 < 00 PD0 0S 40S 00 0U0@08P C00pG0B< S D1!@D 0 R000 Sp*S:0)$40S <00 0R000/RX @pHP40 S0E PQ @0 CV40S H0R0000S0P40 00H@ ᐒ"R8 *p4P4p Y *00pc0 0 Z p 6/PU U 04  W  Z p00@80S(K@0< C00pG0AS D1!@&40S@0 Cp0U!6/P8p6/Pp<D 0 R0<00 (00@ <0 6/<0P 08 @0 86/P8@ 6/P0 080 <0@G6/<0P0P0 b6/PP06/P0Ppp@0@H<00<0 6/P<B6/Pd6/P@U"! RQ @0 C!10S D 0 R0P D00SC@0 P@0 @6/P!6/P@6/PP06/P0Ppp6/P8@ 6/P0 080 v8@ t<@@0C00pG0A R-L Q0P:Q:0Q: KhOT -LM 4PS@  $3/pd0 0Q P pĎ4P4S $ 3/ 000$K0 0 4-dLVP:@T@T 00 S   00 S   0@P`0d0p@A -PLMK`pᘟP$0: S㚼@P +@ 0 0S t K0dT K@00 K@ K( $$4/ 4-s0L@P`0 }P4 $ V0000C0  0R   10 00  0% 0J DD - 0RL0L0  0 0 S  A 0z -LM4PS@Aa0S-0S*  TPd  P0 00 P!    0    0(KpPK $ 04  0 W 0QP3400 荍$R P4100@000S0p pp0d 10V0 p0 $ 6/0(K  0  0 0O 0 A0 000/ 0-@LP  0R 0 00 ˼PƼ0 0-@LTP @T 0 7p0@Tќ`0  0S S/P/$(0#   @// / //// 0-LM @K $ 0 0 0 jh h0 0QP00S 3/ R@ T -LM`PpK00 $0 00K,@ @ (0 (K P@ D| @K -L M0SP5  0S p@; `00 dT BB Q  x V`! [ 0 0C `@0 p`@V` T `0p@0(K T 1+#3/P0p0CS@D0 ,0Tp@R- 0 T!1 P`#3YQm R~,03/Pq00 0S00  Y 0 p 0CS @D0 `0T @Tp  00 1P @ 000 =Pm s R*V * 000P7@D RD,03/P,`Ve*`C Y:hP   I0`0 `NdP 0  000WP 0 @ (K  0 B 0 0|  0 B0` @0- 0 8 0 3 0-LP `V 0@0@DT`0@T` ,0 3/Pʼ0@00D0SKh/ 00-@PL0 w0 Px0 0P0, @ᖋ Pᐋ0 0-L4M @D x>R@0 <0 80 40 00 @T00 13"000 , KDKYP,Ka00  -@0 DL4M>RD 0 @0 <0 80 40 2K1, ", , KDK2P,K:00 0-@LK0hH-M  0ЍR- S 0^   0-0 00L0@S! 0  R 0   0%  0R0U0  00c00B/0 P @P 0 0 $0 0<  -LM@Pp`pP  K◛P04 :CoR  S  L H0(0P   ; 0K; 0K  -LtMR"P`0 @0 C 00  0 0R(Kx K|K0pZ |6P0 H"H2x 0Q0P p APP0000S!pK @ ᧜ Pf F0B/SKDIHGFE9CBA@?>=<:9876543210/.-,+$)('&%#"! 0 0 000000p 0x0 0 x  倐 00  t0K0Dt0SP| p,NPL LT@  p-L M@0P⚉00Ta\V( Kf0T1S O⾉0T1S X0`G00UTX1\1S wKp\1E0nKp0UX!\1 0X!\1 0-P@0L[U0 \AQ\ X10CSX1 K0hJT1Oz0K0hB`00 000S/  -0 00L@PT0#00TAT0` TAT@ X1@0X1ԉ0T0`X1 0 000S/ 0 000S/Q 0 000S/  -L4M<0< 0@DK00  0RKT L ݙt,@ -L M@PQ4PKT0@K 0 00ep`  QQW V0&`"(K V0 R0 Q `(K`(KQQV(K R0`"(K 0-LM@,0,0 @@@K0| 0-L@PP P _@0@0 -Lp@P`P P HP  WP@3*] "0@0X 0@0@Q 0@0Q:// BQ:// -,1,0L000 A!@00QP P`bP 0 PQ 㼐 p'@P  ! 0`R GF@V`@0@S =000 !B B!$Kk w `wHwv 0-@PLP 8P0U0 =S00=S0 0-8@@@LPP0K0hu 0-LP⁴@P 0$ P0H00lu 400-0L@P0 P3#08u -L M10 000 @pT4 _ `P jP0=SG @PT40SJ @A@P P)Y - R@`@@@R*Ya2  "`P, 00  D!  00 0``@(K00 YpQ1S (KR@`@t`PPX Hpttss 0-L@, p  0@0000l H -Lp`HP@PP  bP$00@0 H ,0-L@P0 0@0c ,0-L߆@P0 0@0`c ,0-LІ@P0 0@0$c -@Lp  P%`e0:0 p-L M0` @P 0p 0 00 QP 0 p: 0Kph辕 0S0< Kp -L M@p X0 Q0P:0:0Kp ӕ0!-!0!Q00 000000 0#0, 0#0 00!R0Q0 0R000 0-LM@1S 0?P"1$Q 6Q 0  T& @  @1S 1  S( P  P    K0P q1K0hg0000 0/ - ULp` QU @ @E 6/P@ -TL`ppAT P PD 6/PW PPGP -TL`ppAT P PD 6/PW PPGP - @UL`p)1S P@@E  7/P/@P@@@@UE !0Q000000 @P @@@@@@0PpT1S   0 0U0 @0@0 01 S Do @000@@1 01@0Q- "!RP 0  \0   R 0P 1SB0S  !0B0C  -PL@T`0pTp  PTl 0W0$Kkw\ ? Rg   T  L 1S Pc1 Q Q0000 Q0 Q0000 0#0 0#0000pP 0TP000^0R" /o"!T0#00#00!0 00`0T 1S T  p !PRPPPPPP RC/A 0\R#R! R/R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA -L,ML1L!0`P U@0  XpY U< 0SUD0 0R7(K0 0R1(KoK PKY P:, K#<P$S X $ CY ,0K1 $ S0 P, K!0$ R00S ꊮ8 L@ -pL$M BW"RH H P@P-T`k +T@P00T W  ?X#K#K#KKKPOKQP00 T00SEK4 `00 42"< R0K@00D  R@a0DSW@DA0DS97@DW6v $KKXR%KQP00 T00SK4 400 `2"< 0KP@"0 01`#K"0 01`#KZK V0EH0 H00(K0Z0& H00(K 0 p#KXs #K(#K#Kiq00XS00 C R @ 0P#Kp(K A BRWI 0p#K ?? K 0 0 0( 0 000/ 0</0 000/ĵ 0</0 000 /ဵ 0< /0 000/< 0</0 000/ 0</0 000/ᴴ 0</0 000/p 0</0 000 /, 0< /0 000 / 0< /0 000@/ᤳ 0<@/0 000/` 0</0 000 / 0< /0 000/ز <0</0 000/ᜲ h0</ @/ /H-M 0Ѝ -Lp`@P7. @T0P@ -o@ "P! #L0TM R0"@(P( 0! R0$K  0S RP/0    P/ -LMQ@P Y8Z J (KXY/ TBZ 6@ Y 0H @Z00 X 0h0?o0c5#8 c432<0 ܃KZ P @(Koo?o`FV` Vr 0f"ZN (K0I KZ00@i o`5/o?o B!` VK VC 0f2&5p ?@P 0?40 00 #K @T 04P`V 0p8 < CKZn   (K 0 coo?o`FV` 0f4&1 @0f4à1 KQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 040-L@ P00000D / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/00///Q R R  // U /Q R 0 000/0 0/0/00/@-Q @ S Q P 0S Q P 0p@-Q@`& T^% 0C P PC@DUT QP PCUTQ pS@-Q S Q P 0SP 00Q / U /p@-Q@P( S(  P0C S @ `QP @` 0@0Up@Q @p0p@-QP@`# S\   STP P Q@DPPQ Pp0U0pS @@-Q S P0C S @QP @ 0U00Q   U //q 0/00/   // R S 0Q000 0/0 0/0 /0 0/R  -/R S 0Q000 0/0 0/0 /R S Q 00 0/0 /U/R 0 0/-P0 0 0S0s R S  0 /0 0/U/0 0/ R  Q 0/0 0/0 U0// 0-LMp0p 0@| 0PK0 00 H H0 0 BKD 0RK0eȡ L0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$ $0 00S0/  -L -D0D 0@L0P p`pp@`ꤟ //////8 // -L4MQ`P@pT y FKg1 0 0T TK(L KP0 6/(K蓪0 S)  QXP 8QS: S0S S. S 0SQ/Y1^00 0\0X R 00Q 0S@B QT " l00 0X0 D00 800 ,00ExEDDxD,DDCC// -LM<͟< PQ 0 0 =-= 0 0  0 0%SS``?S @0` ` `   CZR'%$"! %    0c\P60.q0 00 0w0 T p0 ` 00K  0t0 00 0&".'p`  cH D0 0`] 0`0 `0 0 t0K s 000T0S @0 T@Q@ P   Q U5P2 P 0 U5 BP2RX: U 502 5P2X*0 0@C U 03@D05P2T0 00  p0 ` t00K0 w 0 00  0  ` 0R0-0`vpt0 0K W V0 P@ 00  d0 Q P`p0@P0C0 H A Du0 C00 C R 0;0 0 0 0 G   >@ 0 0lS0  0 0  0 p0`00 x0  0K0 t 0 0 @0 ,0K c  `@ ` "0<0 0 0 0`SP tE  0 MP0[ HT` dOȡ h0 00 0000 00@00 0+0 C0 P 0 { ` a000 0s0S 00 0m0<0 0h0 T500 0 0`0 `0 000 0`0< , 0 00 `p0 000 0 0`0 `0 000 0 0  `p0*S 0 C R@0A@0 C R0  S 0 R @,0K c L  U 05 P2 U#3x 0ZŅPP Pp0A U5AP2QeA U 3A5P2QRR R 1> p`0 0 A0A0RP 0AHC D0#0 U0E000 0R(K0 [0 b0 s0 0 @ s 0 `0X0 80 P0 0W @ S 0 `p-0 0 0 0> @ : 0 `p ` 0 `p0 0 ` @ `0100 `0 0 @`   0 `p`  d0 `0`00 p0 `a p0 ` p` 0 `} 0@ T@ T0 0 ^ LD\ -`X0X 0pLP@PU J0PES 8/`uX@pWp 4 - 0LS S S 0R o 0R0 8@o -@L`p0@@P@ `( 0$ ⽊PL D -MLMA@P `X p0 m0PhX40 0PR.(K 0CKEKJI 0 0P "t 0d }L0+0 \4 Nx\4  4KHx5KD LD{ -0LS/ S+qW( Y%`P@ U@  0S#0P0S0S 0S0S0S  P PU 0R0 ^^Î ^@T @Ȍ ^ -BMLM00T .TX%XD U@ 8 <$ PE0 @`* C~KpGPU%:0 00jP@ V:OkLk84<$ @ZP@K\PD40 0R(KꞢ8 L -BMLMp`TT T@ ,T @XT 84 EX0 A 0R>:0x0(S 4"48C8U @40 0R/(K0x0(SX%XUPE CKI< @V:jj84 0 <4 fP PU:00 0 0JjP= L -nML Mϟ&    0  @T 1S 0 S`1  ?@ X@00& 1? @06  >6 0S6 S==K0C☖ @voP pR P* p CKI  D P R!Rs P YPʔ6 @0ᘖST `P6v PP0S`V6@  ^  0S <& & X- @  & T06 06 &0& S63 6 d1S0` t6 0Sa S006 1&021=K0C6 =K 6 AT *pgnKg^K`FPE0P0& 04/P񏐚6 S006 W0d6S66 66 60SAT 6@PP PPP6qw 0;F ᎡPl6`S6c  W`e^K PE@E~V  `=K 0CC6 c>K 0C6 ?` 圆 L  f :fnK06 : `F06 F 16cK FH0  0 p 'PP U0ڰ& Q `1  : X0 0R  =06 $666 6iK CAR 0H@L9/Ci>K0C2`E)b!lv PL 0S P  6 @06 T606 0& S& 6S6S l< 0 x6&0 Q](KpW A6 00liK6A C   6 P6 `1  x8 X0tQ7  %00 P0`1 g 8 X0VF6t6 0S06 f00 JP @ 0P w  &P7@X@" 0 0R  #=1 01i 06 [0 CNK@D 00t 6_P&0&h X0@+S .0CS(  ; 0K %ꘖ / 0& @0 !I6Pp0 t  5 X06q_Q @U`D CK @cKL01V6 6 p06 ڤf `#& v@U D 6@ S ` fU CK A6 Š6v`160006 06  d40@ X0 %06 /{ (06 06  ᎂP0&q3 @XI0 AQR RP `1SH 0   R0 6 6 x OexV  R[`!!! QW   2&@x&X0Q <0&RC A RAT` *`g^KpPE&tPp 04/PQ2N06 /@2 X@ 0 0R  ;`V AS06 1S&06 60S1 S006 06 1c~K06 x1`06 pGP1: 6 Poq00&فPX1016eNK @DPD cKg H]K PE H&  i&b y60P+06 0 P0D )ꐈ LCлȹL\xl<XlPDPȬ TP B("(R D0D bP 0@6  g 6Tx6Su 06 t 6 fVE0 0 0X0(6"( D6 P TP B("(R D0D &P06 h&R!6 0Rj 0`1 z 1 0XP0V0   :i6 X㰀U  H("(R  T B("(R D  R,#P l2|@ X0r0`! 6S<06  s&0 n 0 i 0P 06 [= 0 X 0x  i0 X3 @hX (06 0cNK@De.K BT6 ,PrP 1011S1% 0  4 X0 06 8_06 6T0 6|0@+S .0CS Wm O2/ /M-B  (0<!`p Q1`ep6`Ѝ/ɚ;M@- ",A@TP Q`p A `T Np`@Ѝ/ʚ;0-M  R0@P0 R0Ѝ0/0 0CSЍ0/ 0-L M$PK@PK04KP K,0"c110K000K0 0-@L0M-  2a  Ѝ/M0@-(@ N Ea0@ Ѝ/Mb -AML Mq1p0<4 0@$ 00 P$ dPP `CNK1`K+0.P 04[S ! 8$ 00@ 00@ 0Sͭ<40 0R+(K`UP840 @S 0S0S 00@ @@4@C p @᝭ q Lpa -CMLMp03,#8 0 D$ @P@ 0 CK0`010<4 0>000 P^00L 8,G Sb S00; 0 ```p 0 P0X8$ "d8$D400Qz(K0 @/00 ; P0 <0 0;  PS h8$ -8$8$ c8$ 0P2 P: P3 c ,v4!48C8S 8$ ,8$: 0Ġ"Č$#$4!4 Ƞ,Ƞ(8"(#8́c c c ~0o L$@ @$n`@ -AMLMLL pP`0  R; 00 0zV@ u@ P,0CK`@0 PT 00 00 0R(K PP @@0.SC^KPEL0 Y,0K@dD0  >cꭚk L,Y - L@P`:P Kh< -CMLMß P p8$ 0 @@ m@ c R/ 0.R@ RW S5<$ %.0B2?o121<4 5T! <$d1`0T010#S<4 ` 0084 LP`V @40 0R(K<$ C.K2 BPw<$d1@  R<$ 0s @D D0RH4 m `Ld Dd 0S? .S: 0084P.0=S 1S. S< S1 T0 xPD4SRL4S b`lLd Dd <4 0084P0S`00SL40L4 0  H4 RH4 D40D4 <4S0<4 Ld Dd 008$ 0m`<4Ld  Dd Bba=b]ꭙ0 084P@TN0<4 ei L -LdMP20`@po W00TY"   x !DŸ\!   / ̌V|@ x  Y V V (KW,0K P|K0  0 GhaP0P (aa0V?o2``VPⴠ  B R,0K0 B 0EaPP aaaa P⺠E(K 0 4T4 0 ~ 0 pG R0   a a a 0 a 0PS  u 0P<E0f 84 -LMpP@`/@D T@/)qaV ja0ca `a 4"40(",4@0$K  0( M* (G*ܝ -L@`Pp帐ἀ E0S@P0WU! (aP$a@ D GaD*,0`( "4`43MSZ1S Ѝ/ -L(M@|x%} 0%`p8 D xS| 0  0 <K< $0 4 bK{xK蔜 -LM0P8 4  @$dt各吤 0`p 0 S-0 S S  P%  P2 P]  P40f )0  SR 0  SRS(K0d1P00d10d dt~ 0P000 @t~ 0P  P  P)  P&090060 /P000 C~|?~ip4  9~0000:0@ XP ( QP090|090x BP010n  8P020d  .0P<0 8 RY @j?P01?0# @0 80Fl8 @00< "E4 0P<0 8 R: @K?P01?0# @0 80'l8 @00< (#& P @ P010  P010 8Ld4g  `ff \D\PddЙD\LDԘ p-LMAT ,Kk{,0PK0% f $`0` `,00 00 Y{Ka SKp@@ -L|M0 0pQ U( ! K;{ 9[$`K0#7f @K2]& j&& %( 0 [R KPPꎖZ L -@LPy 1!01n0SPpuOPp yp0S -QL@U x3s|p ዙ01P 01000yc {VxyP //lP //t -L`p@>WP0PS 1S   W00P0S@ -ML MP+; & 0@ 6 000 ^0T :,UNK,`05d! 0  d!.`1111a0OK娗P (0? 0ό6 d10d1  Pe ``@ j`0D@S_aH S S\  S S00 Q`@ 0S S R:0 0CS00S00 080|0P5 - 06 8(00(6 B>K 0C 6 ^>K 0C & CK5 f +5 1'Pf 04[#S;S p  *P *4[ S S'6S60 S S @COoSB@T`0 K 0Cv`0So V `0`SH`DHp .S`0SVP@ .@T00`FV0S 0 fP % k &00 0Q0R(K6S/60 S S pCoSrpW"`@ i_q Pp`0D@SH  \R@* S S00 Q@ 0S00 0CNKP.P `iR` 1x#|#rD%DQ 0dD@`zQ%0 SQ \h Y6, ( `$V T T@ D/oT" ;T@@TU@T t#6P ;TN  00@@TW  Pp 60$P@`/ $6 ㊁Zt jPE @@ 0zVpc P$0S@ 1 R "! !0###R0DDD0$K@Q9:: 0P<0S0S  Q #$0 0@0#$ Q0D0 0 P 0S0C  8#8 C("(00 $K⽠@0( 巠@0( 0{eO 0 v p-L M1@SP aP8 0S,000>P8Kp者Kp -MLM@<<Ÿ P K8LqŸU`(K P< Bw00 _ 1 R18K<0C0S<0&%@RXjj`? L<0 l60l 0` UpC UM8K80C00 0RJ(KV:`K,HH8   [0S ! 0 " "Ƞ"S CCC X 0ႀ " 0X tˡpp@0@0O00긁 L\S -L M @ p^PP 0H2`a 00 = J9 000 0Npⴜ0Q(K -LM40@S00S040000 `1D00 0$pA1< 7p0C 0R40 0NP`p P| W 4NV0 ^ | |  0SPW00 `D s `  R 0S  ps"nR 05 $0P8V:D0PD 0P3U0V1D0E2PX%X.U* 0 ሟP 00000P@L0 (K0@V$08 gP8 {1 c00 (K00PV$DP @00E S,`V ڈ1  U 0410CQ 4 0 B Qs" 00lRX3%Xu1PX%X`10 `DPD0P0CD0P0S%ʆu P1PD  U XD %X`V `DH  A PuD 0$10C0S081 ,1 ~cH00qdONMM -LM@ p`WLWJP0P PASP[*0῞ P6 @0^ S^ ^SP0)P@P 0S 0  00Sb 0 ~P 00080080(Ko(KP00 00S Q0008(8 40P(K4` `D0 0P 0 @ @ <0 8080 80C 8440 0< 0@`p D0 0C 00@400  - @`501@0JJ@0D$ 3R @N !A$0@DRLP@ T00t2@@`RDAKhG -LlM0 ƟX@ p` 0Pp0 (p 0  P| h p0 000` 00@PE0SE0T Kl \ Kx` hp d0 t `p 관Up PX%X Ga 00E0d0Ppd00d0 `P ڴ R5h G\ X 僘`0PHXP%X 00CT l tx P0 )hpx @  0x0A00@p 000| 000(Kp0hp@|0`x 儐 0@0p|)l@ t 0 Y*  BRp≐PU R(h#"(PPUD0Kd0 L0K h0 % RH @  RD!Pi `d h    0)Y* \ P B@@ H L D `0Sl0 RH @  R P3 0d hl0    d hd h`0t0<0K0 0 0 0bP8Z <0Xl0 40`St0 P t0@0 sK0 @ B("(xN Y 0t 0ᴜ0Pt0 @R 8 #8Rx0  00 t00 oG0S t0P 0 |0x0  Ax 0x 0 !(t0P x 0 20S M0x0 -L MP @hT@p 0\`@D00 'P P* Z00 8#8R50 (K 0(!S $1 !0$1 0 R 4P 0 P0S 0$P  00S$! 10$1y00 -LM@80 0PPEXY0 %X0pY 4p p U P!` `Fh&h0  ("( F` `00LPI} YgP4pPP Rp R010!)f P` `Fh&h 40 ` `E E 40 pG Aಐ0@`0@000PPEX%XW^ ` U1! )80PI )P PEX%X. pW ("(! P E @ P 0  000(K @  p PPEX%Xc8  W0P0E(K`0<P  @  PPEX%X -Lp` @P 0S00 0-U@ T X  R P0BQR R-0P0Ӄ0S 0Ų00@8#80 0\0 L0 X800C80TU@ ` -L M @0T @`p@DH$H^P%0S70   ᶚpPJ( @00T@`0@DH$HTʴ0S P 0P` P(KP T0 P(KP(K 0-P@ L0P Q P P\0h P0Q 0 0 -@L PR`  R 0 Q0E@P0R%  0S㲀Pp> 0pGS \B P 0(P   0(!0S$! 1 $!0Q 0P @p0弐ᲀ0p 0 S 垷0! P ἐpGxP'x 0$! 1 $!(B 0 -LMP @ T@p0 0CS 0@D` 00 "P d~}P( 0 0 0YP00 8#8R0  J(K 0 R យP 0 0 0P00 0-LM@ Pp10K0 -LM`80 p 40KP @pF I8KP20zY0   ``↠ ⺠  \  `ഠ 80Lp0`000S0Y(K 08 %P 0C8#8 p000 P p -L4MpD"DŸ Pw ^@HP 0 _" R 3:* OPv XP`b XA1 C\[: @ Ƞ,Ƞ V%: 0C8#Ƞ ` !#k" 2 0" 2 |H00 0 RD(K HR  00C L J12 S Bp SD Kp D 8 8 K4 < @ @pK`h&h`0 aP202y L -LM@pPQ` 00 2   Q v:1Q0" B`!24 00 00 40 V^ X[ZFWVHT0PUO Q * 2 13/pW 0S* ",, ( A,K0  PF0S: 2 K04 KE0PVP V$P 0  0 K0PUP`0PU Q:0(0$P@ 0  KyP,   ( 00 Ko{P 21 l,_| -L$Mq`@TP  llH`dAPD]00CS0=@4a Pp: @Y@DOoB0S@ K0: S ]P 0S 4KO pW  + [0 R@@۶ rA03 KlT`0 @00CS0Ὂ0 (*X&&8o -LAK 0C0C(T:BK @uP wB.K B,@` p|dbedA| }-o 0-LM@K0$`0 pP  $wpP0 PP Khy4xL(@P +pLKʝ -L[X& -LM K+ @ K+d @#K K+ A @ K+< @ K @ P K K A @~ Kz -LFfZ $ $0$ -0L< _4  $ $0$ -0L( ZO` 0-PL@U0 (0":k0cS0: A 08 80 $0Q/ $0S/q 8 L$$<<0 0R/$ 0S/p `# -LM@Tp 0Sk/PPX`@Q0@ @@\PP 0(Ko/tX& -LM`PzqA Sp1A0Q,4SQ 0"K#K04 K  0 XpEdlP3 bP) BP uh dz\KeP0 fP 0tP! nP0 sP0uP vP00 0:D(0000 00,40000}T0S 0S 0S0S0S0S l<嵆PlN&t&X&H/& -@LM`pPZlzy@ @ X3T# Pp* fPD LP8 P8 HPA lRP6 XP PP ` puP#rPhP/ oP0!C!-\\ R0C020PU UT R7 Y h㝡w0@S` pD2@00 00  `pWPPVPaPTqp ḉP   Pb 0P0#0 T!YaPP`KYp@ lb% B RYYYZY`Z4ZYY4ZYXZXZ0S  X  X + 6/P00S `B$ Px YP$ Px tPPY pP0S @X -&t&H/ 6%Ք? -LyM@`gx)0Y刉则y0000x)nQpd9p@DTT)0 RS S@ 0S0S0S ŠaP03 NP) HP LP nPP$ RP0lP* fP(! iP00rP vP pP000000000X(0000000000 (((SC 0S001 0S1006?W7GW7@DCW1'2 71 G P"P1P/X  1!0`001緻0S}K<W01 0S101 0 C C10S S/R }KWp0Sw &WKWT1: S0S 0S 02 2/XS\&\ 002 @IPU   i0P2 c v0g 2 P0@ /Q50CSl__L___L___L_$ Pw   xP2SI 1 "`0000 S\ <L0, S " 2S /P@ P2  0C2 0/S 0V/S/00`4"00B0 S !%!*"@2P$002 840S S/R! 3K0S -WpX* KQP! KQP X00: S 7 C CW0: S 0: S |v : S  S  S kP= P: Sx S1 L0S !|l0eS 20S V R V3Ÿ00Ÿ S2"bQ VP2!PQ  <Xr@P0S; 0: S 00V\10S !00C0!S 1! *jPQ X0~U |0Sx ! alv0Sq ! 8lozVT@0S 0S d00SX00Sx WK?Vpw!㛞1: S Tw '''''Wt&'d''''''',-& 4-&Ք"De&&H6U?P? -LM@PʅduT&NpHD6Df@8Fl$PP$6($08`m6 80 R 0/ 8`xTP($ .mE帅$P0(058`$0m0%+0@mP30P L5L%8`ITP( 80, 0$%$3/ 0(0 0(0Sm씟`QPbmP 0[mP 0000#0 vo#0 o0; S 004 ! 08(1/8d0`0(?U$"4`` ` V8080 CS A3#0Sl0 QP @1! 0SЀ 0  $!`Xp ` 0 um(PU 8003/pX0S Y80(03/pQ圢 2 #K0 Ÿ `0 KQP Z  80 $0(3/ ?#K0#K! R0. $  ]>n 0  80 (!1/0 $M>0  `p` `p`0)  m 0 #KQP`t 0   0 #K! ! `pb RE0 00003/n S4l S(=lTMt& 'E81&e`''''<%@%'|"''''d -LKM`p$tJ Mp  $0R| S 0S} +iP5 aP( GP0, PP: oP L V6TgP hP000mP" kP lP00nP tP0S K0 0001000 000;00600$0l9PU 0STnS0oSP0 00,㦵P oPP,ᔵP{ PS 0S8BK堔PQ 1SBKn0PA 1 KN@ZH0(X$1 $1ZL(K0F0hoP  0: SKnP  9P 1R p 0 'PP K[SP-nP*OGK 0'`pM?K 08 00M?K E?K @AKt`@@K?K O?K YT@),V!OK 8!(1##81 V!KK (!1##(1 1c1s#p 0 D0T0`S,1 p<  #!l0!!"#l0!!""lM?K 0 00M?K E?K@ AKsT 0S #؃`R pf\ 0 0TSLSV,5 0SV/*,1  K?K0SV+*EK 0~O?K0SV)*GK 0o 0 O?K K?K lS)KK (!V'#(1 yV!OK 8!1##81 l!1!  0@AK(se'rX&H/t&0O~!hT^HD')>LgR o -L M, ( (0U6P(000%0PDr0C?o20, (Jp( !( ,00C,0 ,0S9 (000-S40$41, R(0pP EP SP lT PS7QsP xP00(4 $4  34! 3L! 3 (00(0 ,00C,0 t P@㮴㫴㨴~@P7 xTSTL381S p#p@SSDcQ^rPdHs0S 4aVB(e 3PM81S% "2 0Smn 2 ,0S (000S (0zP (0`qPPR(000!S (0 L徻,0S #(000S 㤶PpR:T``0:D100P S Ԁ!0`00} 1 u@P {@P| 1 Ut@Pjt t t(081Sm`@0`姀]PQ081SqUP 0 pR \RP`AP3$081S| \ D0 TU1t't&X&H/'Te'-8' <P'.B'YK'!&T'&h'' -LM@P`/P@P6@P3 DrDB Hp?(2Q-= 0Pq EQ R[ R] R1 0!BSQY KOPT0: SP00 !Hpd10 ER!zNpEhP LP" 0FP PP fP000sP0 iP000 nP00vP wP 000000|ƅO KRO@P0: SpGP ᰅ@^'t&  + -LMP`~@o^N0B@p$  Hp 20Q1S `00 ?0PE0 @T6OmP pP qP cLp mXD l !\ i H 0 S0 NP00 '0K0 NP000[8` * R 0S /0 00S MpSNPH88`0S Mpt&H/ ' -JML M@p[~{nRb kGp1 @DT iP0 vP fP 0 0 0㝴, Q1DK A_NP4: S T PzN0!CK⎹ P` 㠖C>KP 0Y/S / ,0K0$C`@T p#@p @/R0W/P 0 S :XPp ឥCK Pn't&r -LDMP@}<4<$ dKNP%KdK&K/MdKMP%KdK&K%MdKMP%KdK&KMdKMP%KdK&KM刴@3#3PK@@ @ @@ `3< KTKT0 P,< KTKP4< KTKP8< KTKP<< KTKޚP@P< KTK TP ֚P< KTKКP&P92 K<P <KPp"=<0S <K㲚P<0S <K㨚P<0S <K㞚P<0S <K㔚PA0`S KP!0S0S [p p@PhA \1R@ PP@ 0p/S p3p00S" ST 0S5 ZX3 Y/ \xPP HP LP P03@fP RP ,hP vP00 00 00 Y0T 00<0!S5 : ȩP  @,A0S #S @,2   ᕿpPN 0`#A. ~0P0 Ep0=p,KGp  0S0 00050C SAd80S ^@Pκ0S- ޏ$ `g` 0 3/PP 0$ `g p`Yh0T00S WvG(7&2t&2H/k6(%?Ք  -MMLM`xJ x1 00 1x1001xXX:L 00֭P s-0 ЭpP(Z P zNlP@,PQ VA@6P񟗺ТXXXXX\PHXXXXXXXXXXXXXXXXXX@HXX\XXdp|XXXXX0USP( ?pQ Q 0(SSS 011 8 0010101LP0 8P+ , p0  4"R ώ0 p0 0 嬹 4"R  p0 圹 4"R 0P 40юpB,0y010000010000f0d0b ^ ^  ^ QS00 00011qW 2o*FU1SPP60`FV!R UU0U0%;~P%!1S KAFP4: S011PEU괩(ht$V0 1c/V 2,{(5P0 50BK% @\GBK @⑆pPBK A8/pq@P D$J8t4 9rD04 4 4 0M.KNK BA4 DPP&7MK A DDVDDD<7P4D@B>KNK 0C$ @d4S P$OpP6eZꪸ0#S MK AC.BK @NENK@gs0E?o2? MK ACtWBKX @GPPBK A.f//.p5rW v2PPBK @E`s#G帨00CS0 `rP Pp PNUu0 P00CS0Kr0 V 10 S:00S:0Y6!V1 111S1S +,Pdp|!~7D1 8VcGP HQ.P-p0V,4 wB.K BH 1P40`FVhP@AP  f/凰0 ᙷT  4?,P 1pȝ((CD 7H/C(DFDdDD(&CCCC D(8&t&Ŀ(Do(&DC43DԈYD&mdC5A( -PLMi9 0P @P` @ qPFKp!=h`00CS`0X UG@TKX0 X @<(PS& -P`p@0L\MhP dP `P \P XP pP  t0 <pt0$`FVlTT!Yt rTdT x0 Bpx0!|$|SlP aPP Q @RH" l0K P@U! l@V0 R!ニl0P|0 ㄋVP' p0@S'E|$EalZt0,pK1('^ x 0|@Y S pp`PpE 2P 2S 2S02S-2S*2S'2S$2"S RX R2(_ "R S4 0s|$ bP 6EPo "2Pf 0P>] 1P^ +=3P` AP-_?Km 0 B宖P |10S"|2RSP_ FP0Y IP2TP6 aP02sPd iP" cP fP02lPD rP= <02tvPH tP  uP02jwP zP<d= P  ʌ  Y 4= (= `H| Kb[=10SPA 82;028@[k0 C;@T(K202%02;/`ᤣpP000pS Kg<p~ 01 W /ᑣ`P000`S KT<pk 01 V /~P000S KB<pY 01 02_?K0:j0* 0P |10S ω2 S;2R28j/pMP WKeAPT1: S :  `P _/7P *0  @P㨉\?P *X?\AK[Ap eK*0R0d  VT P9*1 ?P1  *!14)S o`o`?b02a8呉p\p802V0 SQ 0SW10 bV00 0`0 `>K Kp `\pP ``>K Kpp2S WK@PT1: S022S 2S2SQ` 2`S2S|w0 t7yP p0SP L(` ;?p ,*WP/ (P4 f/o 7,0$7('4v?S㠒"2"2 :6PT 00P U_w\P Z p㾈2 S2 K~@pH) ?0 0%K(   %KcK 1/Ÿ0 cKЀ4 4:2,72(7< 72$7|u L@p) | D@ppVdH%>p`) > `p$.;P >%U;`Vp%P;rW 222222T|2S"2Q|"t !14!8!K0>K]/K^K9P`F`1p!0C`1 0K0Z/KY?K[K 9P5d1`Lt1h1 , R0cK xl1 *Pe?K1!01!0Q e?KcK 0P u !Ԯp`_ YV02Sw(Fnt&dnqnnnP(H/mm.nnmT[m((mmo(gmm (Un"n(on(p((YoUordAKoedAgCl>oto( (oop4pJpX9&pq2qbp(`qqrpp&;(pCq`(K0]/K>K^K\8P x1 St!#!p!!#`!SpW X+1"Rb~*> R0;|2 PR"2R SP1 p10Sxo2SN2SK<1DFS 2S/2S,<;P' `p`" 0 9,0!`" 009? 0! 0 " 0\9k7>;e$$P [?Cx50S 㬂h!000\1 <`!00 D1 4!P10H0 .!0001@&@K0!0 0 c 嘞P3S KuS0 `lS sS" hS `|wS* &zSp3`3X᠀qxpnp]k00h0 0e43`Ha 3 ] `,3XY p CX0C(0 0R2`O5>KPe!00 0 Ȃ KP3S "lS LS aSt. d"CS*sS mS%wS zSHL#Kp0 L3S  0C,K!P @P!J@Dp``Hp!< Px!6 P`! 0S1@!|3/ K@/KXP HP<1& H>& 0>&8 >&5)))t&):`>&H/>&Q x>&b )>&s  l  j 3 T?i   Rgui  m-LP 1 Kh@9) 0-L@LHP@,(K0h)C&\SHS 0-L@LHP@,(K0h)PD&_T] -LdM5P %xP o6P0 p) P5\5@P L^6H2@P0<"@ 4244X 6 DKp DQ D6P  @ p1a 00 @ p0 @ x0T0 P0 L0 H0 0 0000P0 0 00TK$@P  TK4 DK@@ <@ 8@ 4@ 0@ DP B DK>444 0 X0 ,0K4 #@@d K\K\P 0p7PPUPh0PP 0/(K: \%Ԉ)@aD&a``,`8) -P`|6LMtvtF P 0  .pL6Y q 4 @ QA 0cR pR+ bR9JJ0CS00 00 0S/Vx V`p 0, K0"K03/ pR`UUi 4 0:4lZ VJU`pV3`pY} 0 0 00 0K$ 0K00S 0VS 0X 0S0000 10S1 0S! 0 P0! 0 Q 0s  10000 U`p d@3Y K3P' 0A?oR20S Ka4PY)KSR 00 0 #  R S S3P0sq  F3p*4Y  3 03fH/t&@) 8n&[ -@`'ML M⨆vV I I   ,p6p9PCU19 U$ UYT' K @tPP^-K B00^-K B0]-K4 B^n0 *p@G>]-K0 B 10>n0S0ST> rL. R   t [ K⧤ZKP]-K0< Bi: 000  2]=K<0C0!0 X 0 s90!00 , 0 f90!00 0 Y:`0c 00 0 MX9 0!00 0 @9G9@0S 0t)t&`Pdx`T᪠P00z <ᣠPt (9()(x@ᗠP00 ᐠP000^ # ^-K0P B0R ]=K$0C0 1 1 9A@?P]-K08 B8 000 @ ]=K80C@: @ԑP/ϑP ?x0S 0$0]-K04 B0 $&(1/ pG6W` VWY K  @ŢV K 4@]=K00C0]=K40C0SVY w堗0S<0V4 0YK A/pP +i@:K,0C878S \7 ?I Rp0`Y=K 0C0 7 ?9 0 6 R0@u0S R0 f`&.pP  YK A/p  0S@S K $@_PPS=K$0C wC K $@hP`;%hPPp%pYK Aa/p Y=K0C0: S<%@, 40S -@P %] K(@pP$  JtP0GpYZc0S]=K00C0V}K0,pG0V=K40C0]=K0C qp)d$|]=K(0C`^-KK> B0 D P^=K 0C0r04DP ?P0#]=Kn`(0C`0#00@00S:K,0C('R 4SS *0h# `P  l2Z$ ` P Z82$0S0P 33"ZPV=K,0C `p`:K,0C4SS V=K,0C 2 QP*vpp]=K40C0 2b ?,!0[p X  v^=K0C04 KA%pؘ K]-K0P4 B0  1$" 0b#p|00S 0;0 ^K?A V0t]=K40CL@` 0R$| S\ ) 8)77H/`)t&E&}99 8&)CX&8))==O82e>>>>͜&u8 ?8??8)t)E&!`8843k>89:9!9Q99:99Ք)9 :/:B:b)5Q:)e:|:IYI5:;;/;I;;;);)E&%<B<j<))u<')) 8|<<^=K0CV 0]=K40C ,,pW `VuS  !R {\ +S :0 Q+  P ,} P +P +*  QXS 010$0S  Q*p0SfP!q0S010 0S 0S 0!00!0S0Q#1ѣ10]=K<0C0 0]=K80C00^=K0C0Uu +t +X20SU ]=K00C0KAs븂p@ P 0 K"d(@.HKKA@ّP6.K BX\ nL .1-0 K #d(@.:,+++4},83Y-K0 B0H#0 PY=K0Cx0 K0[=K0C@ A=,p$>K0CKK(A0P KZ AKPK$P ]K Asp h T:K,0C4  L.K0 BDkH -<:*ML M p`Z* * *  u%p@ 9P0pGs00W +ZT[ 2NT[ FT IT DT*K A)8#80* Rl0CQ (X"(tST0B VTQ OT0 0 0 v9mTd fT0H iTR bT0*0 0+`8sT[ vTf nT0!00 0 Mx8<0:  d8 0s000(0 <0,7,80@w 0 0  0&i0*0 0+7]0!0 0 7Q0c 00 0 07D*=K0 1 T1 D770'40S1$t,0: )) K  @⹞K @ⴞYa稆X 6 R, 0S6 R0&B*p  M )K A+p lF 0*S@:K0C 0 R0$9[S >K 0C QP*`s0U; +d0P: %Xs)K Am+p 0S )@P * K@4l0P:    Z ]PPZ z:0S: Z>K0C0>K 0C Dp 4$Z K`t@Pr0`4gP bP#80Rs^PZ #0St:S0( $9[S K @*0p# :S>P3D#8cH>K 0C _pp  $3!0#tWp d  s:4 KA჏p8(?:: G0P: *\ 20呃KA !0 Sڤ:0>K0C ,*?>K0C R0: IЀ!4PQS4   : PX0::+$$S$QQ 10S8  0  < ):SppW  )t*>K0CP 0 *(plr>K0C K R?A : X0:*!ߘ  X0:1 : X0:#100(*IH/t&$K&VI=>)8$*,*= *O82͜?8*?:0*I99::9/:B:bRHQ:e:|: AIlH;;/;I;; --P`LM  P `K)\EPt/r )P(p@N((p0 Y`pT$ "pQ$ 0{@{0 싟{SH{{S (P0{{Z(P<;Sڳ(P0ӻ Q{v $P Tv AG8 ({0*000R(+  R$ 30"R1<;020WCD20SC sC@4P$T8X0@|L\ Ldp 09 0j K0P 00R0S fqW 0;8;08;P 00l1ppGIKq41 00S  0:{ 6+S?q KH00S0?S < # 0< 0: 0 $q@0 00@; 0@0 00 008;0?{Gz?eA`RMb@ARRRH/ T.*1TMT|TTTt&RS7STSrSSSSS.*p&*SS.*X&*T&9UjUvUU.*T/*=R.*UUU`Q&$*,VtQ&l'('p#*@&* K0`0S0?S Z0P 00A 00> 09; K00PS 0? K00S0@S d1K 0t!; 000Z 0! 0 000K堩1 00S l  gW0 0S"W n&0j&p0CS ,H-l-//-8.`..../@0P-S@˒P/ @04 p$0p Ap*40SP a`F PZO^>PģQM 0CKs"PM \B j喒P@ `3tC d@P5(5(5(5(5(5(5(5P5(55(55\5(5(5(5(585(5@5(5H5L@ RwK@HGG000 p 4 4 B ?W  `Jj00S'%c`P!1P`0b 2 R  B 'B0 S A AU+ 0 B!fB0!00`BX) rolif cE p4 ,; pٔ0S6X1` ) pǔ0SU 뽔P pp@@A 0i Vp `ꬋT/+[t&[v[[[[[\\X\[1\ -AML MP@PʺP㰇8 P7'` 0-S& 7=P 1=Pzi p @ `FPX@ ?PE0S0 P @DDA@D얟f{b@Q 61 Q}< ُ<P -<P@X-   p pD0B5S񟗕;t8t8t8t8t8t8t8t8(<<t8t8t8;t8t8t8t8t8t8t8t8t8t8t8t8t8t8t8:L;;t8;t8;;t8t8t8 <t8t8t8t8;P<;<<t8;<p\ CKp H5040S 0hP h00 bp d0SMt4P h000 04084 4 0S |h `4 00,tL"P 4t CK 4040S P3 000 0t0C?o#2p R0S 3 ރPكփPуlUr`3@DXQ!8TH3Q00PE@rS# RSm iS  tSr xSLr袟@T*vt 0S :~2B R00/S q|m%0S T\f 0P@n 4-FD  0S 0S  P2 00W  S A=0S 7@ 0? |-@l gXa@T:BK ABK @N 0 BK` @ BK ABK @> 0r QP0$00S BK @BK 0 @ a=dXf,`_`/+s^H/\f,^^x_j,^Q&^S_#_=_k,t&EX&hf,LlQ&GPf,LK&___  `Y__F -PLLMPp@O&"fP SP@ LP ? TP; dP> sP2 nP* qP>tP. vP> 00.p>>PE>A R t}p>h>0S\1gT> L>H>D> >"aV=0SA#P tP P=0S c!0X0 ;H h ;`D ;@ d ;< ;` 8 ;oo4 ;h bRd0S`0ZSYP Q0 +1`0 <`00gS <4ks0`'VP .`Lx1!0 0! 0\!  "L [Td`֎03SH10S `00gS( 00S$Ǝ@lPp0! `wh00S hpZVZ 00SD0,:H_ H9D9@9<9894909(K(o-q-q-n-n-Kt&n-n-cn-Ro-n-q-q-߄ o-n-Z|n-q-L[&$o-,o-q-n-n-n-o-o-n-n-n-n-n-0  #>0o-pk-Xo-o-ͅۅsr@dX O -L\M`PJ/P8y8I p 90`FV"$&R 4&R<&R <&,&RG 8&RD j: ,ckP. dP" DP" bP "fP hP046rP0 nP pP06xP zP vP@6$80 60$60(60,60686<6D6H64&R <&R 0'7QaQ|K:P@p7C'K P TՊPLW0S  0wP 0000QW 0  E_[PxK*P061 (fVop:f0+Sp&x6 000y!< ß(6C'K000 :X P00G00X1 |Kp @ PHVT(VTVTVTxUTU000C0A DP H0 00C0 B#!d v>C 0C00A0@! 00 0P 0C #10C0 0 0C0 B #P 0 0 0C0 B #P0 0 0C0 B #00 pğQP~ 'KPP͌0/@ad0 ꐈJZ4W00 #qp'os`F0+P# U0#03R0SU 5%P{P tx. \9 KP0J!`0,#,R004# F@ PKopPE X!EV01!P"E0<6S"46S" 02Q" T2019܍|06S l+ P0 BV V 0 χ0 P0_ Ὅ,6S m/PP 9b 㦍<6S46S@d1Q|0 @6D&S1x0Kx0 t0KRp!  H&0R\!\ $&0RL! 8&0RK0CPC li~\T FsPG>K0C0CH| 4  P 0S6壧 E>K 0CPUEK A@pb%|1+0 4 5 sp"0|%0%a0ox6P l՝h6`6?QXb$K86< 0꺮60 & F 00y0P 0S rTP"@P U0S P 0S rr5hD0S5Q +}pUP{\5?@2 P% 4 050S0r5 rP } oby 8by$2by$|,bx y l&bhD0nfHDfff( f4Syڐ4S  Q@420S M!@Pfa+foP}e*v4:sP 4ipPQ@PX?TeL erc,?@P e e4@`8sPP0@P`-BNK@D+}4lD 0Ad4 0hd `4 U0FK Ap003s2U p0B?o20S q R  1 4S q20S 20S 00'Oh---o|-j}l--d-H--t-t-l-$-̰- ----T-L--H-8-`--0-d--<---@-&`-l-&H/ ȅt&Ȱ-X----(--T-p-Ք"X&-K\-^ -)rh--L/X-h-$'2{<6-@KWHN$X` d/ . ,-4" " -L-c -LM@P@Dx5p5<h5G`5,XpP H5 m}850S ,E  P[YT'wPM `t脟 0PN9PFvPJ$000  p40`DVAT 4 000PP dS,X|0@D R&@48$  444$00K]0@K$wttt qtnt~PX 00@&3`'0p L JwP3# 523 @R xS嘁P  `Xu P P0Sf0C冁P `  PdSvp@|b 0<0 00>00r00010~|xtsh2h"Q\2eT2pf Pc B18C8S ˄|vPq堁-1Kl U0B?o20S! P1K 1 [\᥀=PS  0 010010K 1KK18C8S 1[ 00R0S P=?o20 P P 1K.18C8S 1[ 0 PϼPS 0P1K>h.@. .t....3ZG.t&&f.p..x} O^&.hf&x.tf&D..<.p...$T &.&N -^ML M`f+PP 6 vF ^px60S`V=X6P4 D6/DP 4P 6 VP 10@S% dP0 lP cP 050@00%^B.K B㔇`0-S0S P Ĉ0SB.K B〇@_KAP% ?o 2R0S Z0S}4p +P包 z4 z@m5: Sx  Sl0S  pP HXw  X `-UK AP  ET5BnK: S4 `F +6 y}3 P @ 6 P6 ^>K 0C CC P pX T 0S0S8+0 00y 0S0S-& P 7 y0S `&0ᕇ  (K 0C y 0SBK- @ p`BK Ak:`-K BG 0S p`W.t& <X&h&D M_2^K@ l1& 0-鸃c00L@@P0冡P 0S00)~P t3 shsQU릯묘z"`|0V* s/R}P0c0#3PVP X䂟T 0+0C0SPP  }P@D ;0S /P X2 T*PbP 0S 8!P 0S202P R! 1`V `PET 0SުPXP廥PԪ㓪`+@D~P٢sT10S H10S0Q,ѷ%1 @R1N}PPGPbP@0QP  돚hꇪPP 6 EP8 X(0  aP8 ePx1W{AOh nP5 iP+ lP0 ,`P$ rP uP0 `P 000 S00000`0t S000 0 P_d0@#9P HtT W.2H/h`.t&G2X&&2&2l`.t`.\`. -L$MArPTTğ LC@l4/ᛠ\4P@ 0L00H0 +P ,4 $0HA@Tn`PtD@ @@ <@ 8@ # pz30IYZs0崓0 1 4 K0 #[3[R S 0 H080S, DP "w^D0S  <0S    @0S +r@P Zz@{"P20" d -R R -R i^eR^|iRy kRv eRseP8 QPN EPv IP) -P paP& dP$ SPh ynPe kP) mP2 iP0`^VZ0SW ?S``SrP) sP* pPp080 G\C0P^U?0S< ?SPP80@^T40S1 ?S@@-0<0 '0D0 $0@0 !SC0S@  R;ڴ3K04 K3K 3h0lnӷYa.75a.0/&"a.݊&H/_5t&@/a.a.ht@v5X&555'J4!5515SaN5U5F5gt -@`PLTMrp@ p1p`FVU XPlK=pl RgP uP GP0p0 0P0S@0Tx@  Dx p`V  p!R5l K  `pKE P R YR[ p V lK p T x p U v p|RPU m TpPL@@H 0 R 5H/t&6)6  ;6E6R'ԈL6 0-@㠄L0 0 RV t"cOKV/z> K`1 00 0 0 0 h0 *01 1 H>H^1 0p<1 #0>K0  >wp,JTO뼮1!P1 0cOK B141 08!  La 妰PP#0u `.1 0CS> L>|-00+m#OVPX NPJ 6P3 ?PR 4PpTPD HPP#16;3kP( gP) jP fP<0`1 pP ʴ 91 S 0(!#cK# *#c?K#041Y ptP@W8 )W|800p8 (+cK# 00 k@x @$妜Y@8 囚pl K婚pP oK# 00cKh p  1 R 1 AiK  P h*/ */6 */*///*/@-@s@*/ps_strings missing TVZi@ekXlS x}lp HHȊDppd̛# X)Z/p5^@d\I,lO\\iv <ll t3t3P8P87R@@Qt[$]Daa\h iZxxt$llVT\] dDramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory 0/kx0@@8 x@@L\M)$ 0 @@@~@@Lunblock and -DNO_CONV?L(pjԷ\oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat%s %6sCan't get mount information1024-blocks1K-blocksonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-agln] [-Ghkm|-ihkm|-Pk] [-t type] [file | file_system ...] aGghiklmnPt:only one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %s Used Avail %%Cap iUsed iAvail %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %10lld %10lld %10lld %3s%% %8jd %8jd %4s%%Usage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s ????????????????????????%'*llu %*llu %s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)ifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ...  %2i%2iH\pEZ# _^F<> ?1PATH=  tpfds1c%ml,3 r '\p;nC vK# b   EOF reading here (<<) document       ! & <N* / 6 = D I Q Y _ d k o s z  MK*=&}-+?=+@P"Y"_"e"k"q"x""@LN"M"M"abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'(0$`(1$(1$(8$8(0$ t(0$(0$L(0$\ܜ(0$,%c  FSҍ /j N&  GT%;W%C H!/պ)N"+L                  l,dl  |&" |)$< < &&0&(=(@Cp&xXRI4&4/&& &LA&dAl?m&@&VYd&0Ȃ&&L (^ &&hƂe&&HlMl\/p&@Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directoryerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcfrsuv [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dCannot continue job (%s)[%ld] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%ld] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%zu more than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchp:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Illegal number: %sCannot set mode `%s' (%s)HSabtfdscmlrpnvtoo many argumentsunlimited%-13s (-%c %-11s) unlimited error getting limit (%s)error setting limit (%s)internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeIllegal number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultIllegal option %co %s+-Illegal option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Illegal option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Illegal eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sBad file descriptorCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# PS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... illegal signal number: %sunknown signal number: %doption requires an argument -- sillegal job id: %sillegal process%s id: %sevalreturnshifttrapbgchdirletfcinputrcgetoptshashprintffdflagssetvarumaskunaliasulimitwordexpPPID20181212 BUILD:20260202205320Z SMALLNETBSD_SHELLUsage: %s format [arg ...] incomplete escape sequenceunknown escape sequence `\%c'format %s too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed.. $+..7*\/..!. &. m  . /x0U-:>.t>.??/(>r=/>20P?/?.L@a# 8A/=8A.|@/AA @ /(?/(>@.@8A/////#/3/#/3/2/3/3/#0000 0@@0001s/r/u0}0000;0 J0@Q0C0X0^0{/e0l0 4/C$3/C9/C$8/C@///J/S///Y/////@a/@/ i/ //00@00 &0&/%/./-/00000 0@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gTIOCGLINEDtcgetattrTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.DDD0EAEUEeExEEEEEEETFgGoGwG@MF@}G@G@G@G@G@G@G@G@F @G@G@G@G@YG_GGGGGGG%GGGH HHH$H+H1H=H@DH@IHNHXH^HiHpHvHFG|HHHHHHHH[GHHHHHFFHa4III^{IIIIIIQIII"{UIEI;IKX|HHHHIIIIa4&I+Iv3Iv|8IAILI"QIUIYIcIgIoIsIEyIIIIEFMFHSFXF_FfFmFtF}FFFFFFFFFFFFFFFFFFFGGG%G*G1G6G=GFGKGSGYG_Ga4III^{IIIIIIQIII"{UIEI;IKX|HHHHIIIIa4&I+Iv3Iv|8IAILI"QIUIYIcIgIoIsIEyIIIIa4III^{IIIIIIQIII"{UIEI;IKX|HHHHIIIIa4&I+Iv3Iv|8IAILI"QIUIYIcIgIoIsIEyIIIIchanging %s byteorder to %sline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environment%s: unknown machine typeattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes failed to read bootarea from sector %uread sector %u len %d looking for labelno space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] RXSUUsage: %s device %s device command [arg [...]] Available commands: rwnot %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. forcesuccessfully scanned %s. %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s Wedge dk name too long; max %zd charactersunknown command: %sstrategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s'unknown command `%c'hrrrrs'sNsus s s t 5t Wtgt~tttttt$u8uMucu{uu u! # $u& 1 2u3 4 5u6 8u9u9u:v;2v<Pv=hv@wvAvBvCvDwE0wFEwGEwHEwJ[wLxwMwNwOwPwQwRwSwTwUxVxW4x\>xaYxccxdxexfxgxhxixpxq s t uyv w yxy:yKyuyyyyyyyz4zTzlzzzzzz{{6{S{c{{{{{{{{{|YI{ |0|C|R|e|p|    z||||~|||} }0}K}m}m}m}}}~}}}~&~D~_~{~~~~~U  ` > _׀/%lu/%luusage: %s [-aBFfIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1Can't read %s partition table%s partition table invalid, no magic in sector %lldsecondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld decimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. realloc [n] write_disk(); wfd == -1Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Sector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsExtended partition busyExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitiongiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafiIluvA:b:c:E:r:s:w:z:bad disktypeBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s size (%lld) is not divisible by sector size (%d)DIOCGDEFLABELCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]: X|HHHHIIIIa4&I+Iv3Iv|8IAILI"QIUIYIcIgIoIsIEyIIIIreturning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo blockUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFbadCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directory%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 Invalid long filename entry for volume label RemoveInvalid long filename entry for %s %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersInvalid long filename entry at end of directory %s No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  $$$$        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s CLEAR (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %lu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %s** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** starting CAN'T CHECK FILE SYSTEM.Alternate super block location: %d conversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'MISSING '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%ldcg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONG (TRUNCATED)TRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****cache missed %ld of %ld (%d%%) cannot allocate quota entryffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-s=X_r}< Xky9&;&9&:&,:&D:&\:&x:&:&:&:&:&;&:&;&,;&L;&l;&pX|HHHHIIIIa4&I+Iv3Iv|8IAILI"QIUIYIcIgIoIsIEyIIIIhrrrrs'sNsus s s t 5t Wtgt~tttttt$u8uMucu{uu u! # $u& 1 2u3 4 5u6 8u9u9u:v;2v<Pv=hv@wvAvBvCvDwE0wFEwGEwHEwJ[wLxwMwNwOwPwQwRwSwTwUxVxW4x\>xaYxccxdxexfxgxhxixpxq s t uyv w yxy:yKyuyyyyyyyz4zTzlzzzzzz{{6{S{c{{{{{{{{{|YI{ |0|C|R|e|p|    z||||~|||} }0}K}m}m}m}}}~}}}~&~D~_~{~~~~~U  ` > _׀SFH0eCsp|SFU0eCyYIHah!IdontNeedEFI(s*K>;q|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+ =rGy=iG}";Mt?-8mWC 3KOOCNyD<#*=(Yc3Dh&mu\ M}--чHQI-чHEZIчHIчHIчH32IчH|S'@ )Ѹ%*1@ )Ѹ?I1x )ѸDNa:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuidCan't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:partition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size]New size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverError reading backup GPT information at %#jxNo secondary GPT header; Run recoverNo secondary GPT table; Run recoverDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:sector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidGPT_HDRgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsQ_nsetifnwkeysetifchansetifpowersavesetifssidsetifpowersavesleepsetifbssidsethidessidsetapbridgesetiffragsetifrts  3X<&2\>&:@=&9:>&<&t * >&5p=&?<&Et<&D>& =& * >& <& <&[hLL X @setifprefixlensetifflagssetifmetricsetifmtusetifnetmasksetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandusageprintallstatusmaindo_setifpreferencedo_setifcaps zi?&yi&&&>&A&&&>&" B& B& B& 3 HB&`xB&>& ,A&$>& A&A& !>&!>&1<GS_ kw@ 0@  @vKyinit_current_mediasetmediamodesetmediaoptsetmediasetmediainst  `@ V0 media_statusmedia_constructor}HC&HC&HH4C&}PC&HlC&((C&paddr_matchtBPKPGPLI0Q`AP@P4KsettunnelT>&D&print_link_addressessetvlanifsetvlanD&|D& ^SIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockSIOCGIFAFLAG_IN inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeNONEWEP40WEP104TKIPAES-CCMPAES-OCB%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211BSSID/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211CHANNELSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: BSSID too longmalformed BSSID: %sSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS CFPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM ???unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAaf_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6link0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtype [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] mediainstSIOCSIFMEDIA mode %s instance %d media: %s status: supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno networkno carrierno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctlSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@. ((/1@8DLf:C U 6]p} @@>ffs:UW\ ejnr%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousautomountedextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdup!!S1/N!6 (U w@!!!!!!!! bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.!!S1/N!6 (U w@?$W@:@=:mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %sreload!!S1/N!6 (U w@?$=:@W&@ .softdep!!S1/N!6 (U w@usage: mount_kernfs [-o options] /kern mount_point "%s" is a relative path.kernfs on %s!!S1/N!6 (U w@@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %s!!S1/N!6 (U wW@&j0o0*y0 0@00000 0 J@..0... .@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s!!S1/N!6 (U w@=:usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o <<<,=d====>;>X>>>>>>?D?l????@?@_@@@%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask%s (%s)0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot();y{{{?y{{{Dy{{|{usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%llumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY&?l׆?_ -WUPBROADCASTDEBUGLOOPBACKPOINTOPOINTRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printbitmask_scan"2>HTZ oT|̚T,:JRJfJvJ4қڛ8CV]vڜ $)ddOaft{tt,ƙ͙%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x0x%0*x0x%0*llx%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)%s: this type is unknown to this program ...(%zu more bytes)Invalid port: %sPort out of range: %s%s: !returned size wrong!%.2f %.2f %.2f hw.ncpu%d = %lluuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu 0x%llx %lld.%9.9ld %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d regcomp: %s: %sregexec: %s: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpfetch_urlsendrequestrecvrequest***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbervbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20170803malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gz ~& ~&}&S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: filename expected%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: extra characters after \ at the end of %c commandw commandread commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i$'H.2;.H.PT.\eش. v׵.ֶ.4.ֶ.շ...Z..,.3:h.D.N<.W$.ar.~9K.9K.g4.x3.2.ַ3.1.O.N. g\.x[.*Z.5C\.UY.aw.mv.A=X|HHHHIIIIa4&I+Iv3Iv|8IAILI"QIUIYIcIgIoIsIEyIIIINAME= :jmount_disks       !"#$%&' str_arg_substget_available_cdsX|HHHHIIIIa4&I+Iv3Iv|8IAILI"QIUIYIcIgIoIsIEyIIII edit_fs_type_extp* d@ G    P* ) 0J c, s edit_and_check_label X|HHHHIIIIa4&I+Iv3Iv|8IAILI"QIUIYIcIgIoIsIEyIIIIdisklabel_freedisklabel_change_geomghx f | }  u  Hk i ~ t l Pi Li 4 u 4y w pl d xk q o d d n j j i m i disklabel_set_part_infodisklabel_write_to_disk<{AIouter_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var normalize_clonesreplace_by_default..T.4. !"pm_from_pepm_whole_diskgpt_create_newDlY$Yg(ghDff`Z[`_ p,VXU\UU4 t|usrvhWV@R;q|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+ =rGy=iG}";Mt?-8mWC 3KOOCNyD<#*=(Yc3Dh&mu\ M}--чHQI-чHEZIчHIчHIчH32IчH|S'@ )Ѹ%*1@ )Ѹ?I1x )ѸDN{ Tg{yNLIAy~ inside_ext_partadjust_ext_partmbr_init_default_alignmentsmbr_create_new<pJdJ8,T@tdD܊4 \ p `XԊl؏̫mbr_get_generic_part_typembr_get_part_devicembr_freembr_read_from_diskwrite_mbrmbr_write_to_diskmbr_add_part/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6) [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 9.4_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksmount point (or 'none')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-9.4_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-9.4_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-9.4_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-9.4_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsSwitch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Bootable flagSafe eraseUndo changesUnconfigureEditForce umountAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionCannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (ADI_BRH)Kernel (INTERGRATOR)Kernel (IQ80310)Kernel (IQ80321)Kernel (MINI2440)Kernel (TEAMASA_NPWR)Kernel (TS7200)Kernel (RPI)Kernel (KUROBOX_PRO)There is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] [-p] where: -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -r release override release name -C bg:fg use different color scheme -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog9.4_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-9/latestftp prefix/evbarm-earmhf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmhf/9.4/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filesysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)%s (%s, %s)%s (%s, %s %s)-t -o disk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2 %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %d %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.craidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi/boot/dtb*.dt*./netbsd.ub./netbsd.img./bcm*.dtb%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10schpass -s %s rootsource for 3rd-party packagespasswd -l rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousdisklabel -r %sinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %spartmanlvol%.2dvg%.2ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%lliPartman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.c/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c%s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEparts->disk_size > 0parts != NULLgpt destroy %sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt %s %s -b %llu %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1138: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1100: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2100: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1743: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1773: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2067: internal errorparts->geo_sec != 0t != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2198: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI Boot***************************************************************************************************************************************************************************************************************************************usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_handle1control_handle_datacontrol_writeonedhcpcd_reportssiddhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1Odhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_geteloop_event_add_rweloop_event_delete_writeeloop_q_timeout_add_tveloop_q_timeout_deleteeloop_exiteloop_requeueeloop_signal_set_cbeloop_signal_maskeloop_startxsocketif_discoversplitvadd_environparse_optionWbcd e6 f g h  iUj$k l" m nW.o pg*q)r s tr uÝv w" x zy A B" C D) EJ F3 G= H! IJG KN LV0 MW N] Of Ps QST{ U V W X ZD1 4 6 |~ }     g  T  /1 / 8 P  @ H R _ i z x 6   q0  n  default_configread_configrt_compare_protommkkrt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtllrt_buildrt_deletexkxksa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initsa_in6_initU  *   )  4 ^z P K6  make_envscript_buftoenvscript_runreason0123456789abcdefdhcp_envoption   " R {     1 \     & D k     : O m       > P h |         4 S   q        $ 4 Z  $ l  | h $     ) H h       3 if_copysaif_opensockets_osf j n if_routeif_initrtif_ifa )( PT@P HEPT$ @DCget_leaseread_leasedhcp_openbpflog_dhcp% % % )% dhcp_bind& $  & &  # &  "& dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_readbpfdhcp_readudpdhcp_recvmsgdhcp_dumpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1ipv6nd_rtprefipv6nd_applyraipv6nd_expireraipv6nd_handledataipv6nd_recvmsgipv6nd_handlerad7 m7 x7 7 1 1 7 1 6 7 6 7 7 +7 67 B7 P7 dhcp6_checkstatusokdhcp6_validateleasedhcp6_openudpdhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrequestdhcp6_startrebinddhcp6_writeleasedhcp6_recvifdhcp6_recvdhcp6_recvmsgdhcp6_start1 '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_dump/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: connected to Access Point `%s'%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version8.1.9--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 8.1.9 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-8.1.9 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware addresseloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.cread_cb != NULL || write_cb != NULLwhen != NULLcallback != NULL%s: SO_RERROR%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption `%s' does not take an IPv4 addressinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argumentunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleteddeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinTESTSTATIC6ROUTERADVERTUNKNOWNPATH=%sinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=%sif_down=falseif_up=trueif_down=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid=%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'%s: executing `%s' %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%snd6_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtsrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_USELOOPBACK%s: SIOCGIFALIAS%s: if_addrflags6net.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6fwetapxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %sbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s: open `%s'reading standard input%s: reading lease `%s'%s: %s: truncated lease%s not foundNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: timed out contacting a DHCP server, using last lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: dhcp_open%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: %s: short frame header%s: checksum failure from %s%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired, extending lease%s: DHCP lease expiredDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired address %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %snd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_addr%zu=%s%s: delaying IPv6 router solicitation for %0.1f secondsreachable againunreachable%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.c%s: ignoring unicast option as not masterdelayingunicastingbroadcasting%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f secondstimespec_to_double(&state->RT) != 0%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: DHCPv6 DAD completed%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to request information%s: DHCPv6 lease expired%s: failed to request address%s: failed to confirm prior address%05d %s%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6DUMP6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\BH 8MF,8H L8H l8T8H 8H 88H 9`,9H L9H l9BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~H &H |= E H |A E H MFH H TH H H `@H H _!]![!/etc/group/etc/master.passwdJPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pid !#$*0- ).+(/, '!% #34 :./, .   :       , /.       .  .  .=                               9%'A)*& , ./(&-0;51234<=>?C"DEFHGB$21678 !"#6$@8&&&&&&&&&&&"""""""""""$$$$$$$$$2222221222111\+GU9U   +: januarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresv0%llo%lld0x%llx%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME/usr/share/misc/terminfo%s/.terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist