ELF( 4N4 ( ("("$CC he"\\@0 6QQ O @@( @0 fH!@P@Q?P1Р -L/chee c@cmain() returneddc   ! X(@@T @@ 0/cc// P-Px d -LM@PL00S @0 K080 0 0 0q K3K(zcCCtAP/00S 000/(zc0 0C>0 0C KĢ: K묒: K딂:  Kptb: K("P9 J200 |240 PU]pQ!L!Tp0 JliK$,2,B 40!0!>0>00!10B#6 !$1 03/0 03/03/ 03//o,/FLBL>Lt1t! p1p! l1l!!+o! 1"H (K0p00 : JA@a> 0 DSBO[  0K KKp `0K KK,@ހP;a0(K!CAA ccx@Ac -`pL(M @P<Ku(D` @p c0< BS00\DK$0 O,0S00DK$0 ,00S40S040 <a4K, p-LMP`@`00 0 0000 0PP dKpd l0$P P ,0`0(@4P00T0( KP80L0<0H0@0D0D0@0H0(0(0 00vAAA (A pe, 0-L@dK0h 0-@Ld0 00-L@~P0 0 0000@(00 SP/o/@c 0-A0PL`0p$ 7/ 0`$ V008#8Kh/ 0-@LP00 3/05 `8#8K0h/ 0-p0LP@ TX00L00 S /o" K0hS04cc@c` p-L M`P`0@03 qPB 00,R P, 305/`P Kph0 P RʓP n\0@X0Kph @0R{ Kp6AA@jA@c4cc` 0-L@ 婄P0/o"K0hCc -LP@P㘄`P  3(00S Kh'c 0-LPd}@P074U   K0h   c 0-P0LP D0R08W@P0U  K0h@c` c 0-LP@A@0=P  T0 K0hc 0-LP@)@0%P T0 K0hc 0-L@P0 K0hc -T0LP H0`R8@P /o"Kh@c` c 0-<0L@ 00R0$P0 K0h|@c` c -0PP 0PRLɃP 003/U@  \` 08#8$Kk/`P` 0 5/k $KkA0 0@c` c -L⏃P勃@P0 0`6/,T0``6/0 0P5/,0`Kh/c -0L 0R]PYU@ 0$ 0`6/3>``0$ 6/T0$ 0P5/?>`P$ 5/0$ 0P5/ 0$ `8#8Kh/@c` c -lLPXU@ 0$ ``6/T$ `0Kh/c/ -0 PLT@``0 6/``0 6/`0 Kh/ 0-LP@@0 T000S 0d00h00p0x0l0x0K0hS S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` @c@, -LM0PST@Be Sa 嗑 (0K0 p0*b7/pP 凑 (@`0( `` 6/``< (6/``0 (6/``0 (6/``0 (6/``0 (6/``0 (6/``0 (6/0``S0  0 (6/``0 (6/ ``x0(6/``(0 6/``L0 (6/000S00(0 00$0 K@PAgA@c -`0 PLT@ 003/V V ,^  00 3/A= -LM00 㶴 K\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -0LPT@ pX` X0S 00$ 3/@08`P#8$ 5/$KkA -0pL`T@ PW W x00 3/`0V00 V0`` 6/$KkV`p00 7/A| 0-LM 00 K KK0 0 0K  K -LP`o@PP00l1hd00 P0c    ] 0 0AAc -`SL@Pp C  P `Kh0WPPP  P $VKh0 A8A -L M@0@0 S 0K  P@oK@c -Lp@PP 0S 0W    T   0`0  W R0 00W0S 0TV0 TV0 Kh̰cc 0-L@|妀0P Rd T0@0@0000@0  T R0 TS00 @K0h[̰cc 0-L@~0P Rl0T00 00T0S0   T R0 K0h1̰cc 0-L@T0P Rl0T   00 0  T R0 00T0S00 K0h̰cc 0o/8c/ p-L M0@K`0$ PS|P 0 KpT6 0-0L@TK0h㒮$0dP 5/0 dP5/0!00 K0h8cb>]A p-L MP@X1PPHD1D0: S#0!01  00 !0,0 5 W0 !00V0$  ( 4000 `0@ 6/0P KphR   A4 00  f/0$ ,0 0( 000` 9PL4{08 8KphB|8cA@c,cpArA9 AA\6 \ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd 0-L@+0 -1LP@`TKh0 dp7/U  尲U 嬲U% U U 墲U 0 dP5/奲̵0dP 5/0 4P5/ Kh菲8cb>]A 0-0L@Txx}P0PP0 4P5/ 0 4P5/P\ ZX8cb>]A -LM1p@TRK:0` dP5/0 dP5/P 20=d0P ,P 4p 40K1dp 7/0 4p7/ O0 4p7/ 0 4p7/(0KPU 0 dP5/$0 @?L$ 8c]Ab> -1Lp@TP0` dP5/0 dP5/ Ʊıѱ0dP 5/0 4P5/ 0 4P5/ 0 4P5/P垱8cb>A -L M01@P@p(吰,印0劰4凰00 ,(04tr  㦴`0! i 㟴(e 㛴(p 㗴`VP0i X ( ,004(Ko[V8c0 S-L S S Kh KhM8A0 @o/@c -L MC@PK -@2L`RpP0CRe*p2R 3C7CR0 0 $Kk蓸42RX 3C7CR008#8S800 0}H &yH004004 0$0PL00 0( Q 00 15%0c ( \ 001X0 0(0%5 0(0hl60d007101000zP008#8S308#8S0xP0 p!H(P8p l<H00500`P5008#8Sq308#8SkSW HdHdAcB A p-LM@`P@d Ꮆ\0\ ,K0,0 L0 P (0 D0$0 {08 8[P(VKpb>c,b>c`D D A -LË 0-L⺋@000: S/ƴ@cb>c00@o/@c` -L Mw@PK -@2L`RpP0CRa*X2R 3C7CR0 0 $Kk2RT 3C7CR008#8S800 0gG &cG1414$00PL0$ 1 Q 00 15%1c$  \ 001X0$0 0%5$0 0hl60d007 101000hP008#8S308#8S0xP0 pG(P8p d< G151`P5008#8Sw308#8SqSW HdHdAcB A p-LM@`܊P@d \0\ ,K0,0 L0 P (0 D0$0 z08 8KP(FKpc>c,c>XcH H A -LⳊ 0-L⪊@z00 0R/  i@c` c>xc 0-@0 LR + R= RV !0 1dPa05/|1|!dP 5/h1dP`! 5/<dP H!5/{0d4! K0h/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/0/-/-/-/-/-/-/ -LPpN`@P N/+u0 2/ p 00S 0@0 @0000@ -L$MP@`ှԽ08 K0 0  p7/0P *4 K * p7/0P 0 K "( p7/ Pp80@040 0000D1 R `, K  P  K,@0X@p0$0d0 ! S 01 0 0S0h006Qd  5L|0000 100 0(0K00 8/,0$0(00\0` (,!AABAeAAHctS APS S S -LA Kh~ -L Khu 0-L0@ 0l0 0K0he 0-L@^ Z0 000P/QHc 0-D0L@T0P D0 00 K0h;Hc0P/Q2Hc 0-0LPU0 0S S+ S+ P@0@ 0 00 P @T 0 @X0P0000C00 0@,0P @@HcRW SW 0o/Lc///@0Q 1CQ -1CQ /00// W@ 0-PLP2S @@PP,k0 -LM`7@p3`0PLXpgR g0* Ru2 0P0 0 0-000 00!002 02 02h00x"Pd击0 70$pJr0 +0(?r0SRp0STP@1 wP @1oP@1 gP@|1 _p10S h \>>0<0 h080 D10@ 40 X8!<Knvd(K S1-p 0P0 000 00 000 0 000p 0㞪p0x ᕪ0* R 0@p S @ 0LcA@c0Z c>_a`cZ A` ] U (Z V c cchQ-\d>c$^ -LY// -(cL@`qWʀ 0! `!"0""   !P0S& حP0S+P0SPP0SW( ]0T S00Q0R  P0L"00 Qh 0J0x ᄪᐪP0y j ᅪ 㝭0S | 㔭P0p @P ,0S -0S( !#0x A\P0p qP Q 0R(0l0 S$00 S YX0S`P\ dQ=$0PX0@ 0Xe 0!H `q0< 4   !e cd ddLcCc -\0P@0`0\00`@pLX0`0s X 0\00 Lc' 0-L@0fP0 -L0 @o/@c//0000/QR R / / 0-<0L@0: S0K0hb@c 0-LM@(PKAT 庬@T 0(P 0S0\ 0S*0QR0 S!CK0'VUUU\ `P/0 !`8 00 (  , !/ cd dd// 0-LM0@P K1p00 K200p0000 000000000 K0p000K0 0!< 0`4 0 (   !/ cd dd -`QL@p`SPPW a a a b c 0S0<000S0;UTb b b b |b b b b b b b b b b c  0 00000 0 0000 000(020<0F0P0Z0d000000U񟗱0c Hc \c hc 000000000000 -LP@`0  00CS0 00Q0 SK -L M@0 bP 0o,x rRP|`P PxP`Z  RL t0S 0S ʌ P00 0S0.U01 StPX`P> 00S p0S8Y0S3U _2x0: S1 oV4cSڀ K&GSW`@PU 4 94 h PZP P0S00S Y U  0ᬟ|0S4 Q  |`0SVP * Rd d I pFA 0 V 00 0CV R00V0S P 0 t(KoQ` (Khh>@cCc:xh> -LMp`@ pɷb4P cb c p10: SRZ e0s(@(1 p@1 jP0P0PP0 00@}0 @v0 @o0 @h|0( K(0 p0p 0 h0$@ UrP < D00bKAAi i @cli i |a Pc&A8}#Cc -L 0-L@< 0 0K0hbCc -L0 @o/@c )-LⲦP0% Kh` p-L MP`I@cP0F.0 P05/PP Kph跶#>t0 @#ƥ )4@L0 )㼥40 dP5/Kph4AA`@JAHk `k  -L -L// p-L MP`P@ 1x0: S)Q0|0|@0 x|Pt+ 04@800<00@00D00H00P Mt0t0Kp0|0!00˥|ȥ0 7P,Kph0@c4m jAk \m m l AA -L| -Lxo 0-@Lx50 0-L@ 00* R0l SQ G @0(00* R  Sܥ@c` A!ƠC9 : \S0@-h0@1X040 4 004040C@P@CL00L000 ccP c -@ ML, t$0B 0N?6Kn A@-0tt@T h# 000S (0S Q . 0S"cTc -P@L VPU`p,@0S* 0 QP WV Q00S  osP dN@\N`PP嫳 `ҡ``TcAA/A -t0LP@T ` ` &0`0$@P  @ᩡTc 0-LM@K K$KPgP K0 K0 0-LM@K K$KPSP K0 K0 -p0LM 0 x0KR@P d` R wPK K,K.P  K0P 00ӄbtc 0-LM@K K$KPP K0 K0 -LM@K K$KP K K -PLP@`aVʀ 0! `! 0    !0 2/P 0!H `a0< 4  , !Tc cd dd 0-T0LP@PQ0 P 0 3/0  0K0h/Tc -T0LP0S@@P  B  R `6/U000Tcc -pL M`Pܠ܀}P@ P' P% PU PE`F@P P #P `PT00 R0SP0 0 @`P(KA4AVAZA/ -L M00\ @T   4/KTc00S/ R//Tc00S/ R//Tc -P`<@Lg/ ja/080Kh/dc - 0L@ S(@0` !P0 R  P TP X00S0@@@P @00 , !c @0-L@p !P`0S"P ( R00 @T P # 0SHH@`A`0 !! R00 cx x 0  )?)/ 0  )?)/^/ 0-L@q d^Q0P0CVq 8Q q (Lq G0\AgAmAuAA 0-P,@LᏲ70 K0hlAAy 0-L M 0@ Pr4  ( 0 0  (  ,  04 K$0 ,00 ^kP04 KnK04cy /0! / "// -LZA -LTA -LpQ`@.  P@x0 DWP `F``p|`@U:80Z,0 (Z Cc@>///1/8#81/1/ <  R/ R/ I I0s S40Ho//0H1S0/ c/4zAQ0 Q Q // AAAaB 0-@0LP\3/.0`R0DK0h/ 0,,$$#  K0h/AAj>AA -LM@ 0 3/(K03/PkQ%0 3/0 P) `T;%.T !7/'!0A`YS < 8 D P  x Ԁ d , ؂ X h t  \ ؃ T x \ h $  $ \ 0c0C S' h ` ` ` ` ` ` ` |    0x 3/ 0h 3/@ 0X 3/  0@ 3/ 0p 0 3/9 12/0 P 03/0A CRS <00<0 < 0R|3/ 40p 8p40S0`3/00t 0H800,3/0 0x  ( 8 R0 003/70S 7'0S 0L3/d0S03/ @0S00 3/O8OS0 00@3/0S L803/0` h, h$3/@0S 03/| 003/ `q0 V 6R0 X 3/ FR0\3/ `V0|3/0pqRh3/60lLt0|00l0Tf00X0O0L@80q080 )@0SD0s0D0 #0 D00F00?0x;0l70``$7S0P S0D 083/ 0(3/ 03/ 03/0P000000HH 0Rl43/003/0L3/d0S03/03/@0S-/003/ 04`0 6/0\03/\0`0 0 046/`004 02Sp7/ p0A0CS003/0<0 :%&0%0 040 b0 00 0\0 %:00 00 0x0 %40H0 0"l0 4@0 d204L0 ?0 %900+?p0 00?0 00 0 0X0 1 00t0 |2%8 0 00 30T0 TX0 | 0C0 0` 0 ,2Yd 匑 Ÿ h ` ` H ? 8 )P H  % @ `! p # x00 0 %:03#0 0st>A3?AAiAoTB2AAj>,AAAA;A3BAA/ ABB7B(VBAA"AB(A2A4A*A6AivB:A@AzACAJAOAWA`AuTBATA-A@AATAXA^A_AdAArAAAeAt>@A u>//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O)- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8 -@0P`P Lsc4!0 "8`<` D @ ( H D L  D 0   0wwww 0-@00L Q( ㎑K0h- c 0,’@/?oh2\0S/0S/0h1d1/ 0l/ c 0-$ 00 L@    0 l t  0 -l0LA `pmha,2 4Q0,2<0$!  <0$!V 5Kh cR/L-,刡0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ刡0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-刡0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ ! ($0(000(/ ! ($0(000(/< ! ($0(000(/ c -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480 -LMp@TB 0@ T T0 T9 !TX`` P0 S =S J M>@P0=S PX \ Ĩ ̨ X 0  SR0U=S@&@ \@@P(K [  /ZP @K.@ KP@ 0-LM0K P@ 0 P RPC @.K0 -L M@0K sP Y =oK0-2P? @P4@54?3P0/x-2`? @A@P(PP`5P6(5?3`x/x-2`? X@A@(0000Kp_KP MKPH0 b/K1 (01 0ΫP>_/KǫG8H41$!0R$04$0/rcO- R\bY I* b$\" in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 // p-L M`P@ P@Q0P0sJX03/03/0?00?Kp 0K P 0S 00S0@ S0@P c`cdc 0-AL0S! 0S\X l\\0_03/UA 00<000S: #: " ! 3\ #30 00C 30%V:P#:P!U P\ #30 00C 300000C0$000BBҢdcAi!iH cA1?/ //?0 0!0S 0@o/ c//0/////?  22//-P/6 c N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N c c c c1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N// 0-$0L@4s 0S 4 + 00 000!! 0(0000(0 ! 0(000000(0 ! 0(0000(0 ! l0(00(0\ ! D0(0!0(0, ! 0(00(00(0 c 0-H0L0S0@0  "!$0p03/0 !!0 cdc03 / 00-@L4 Z< 4 @ 8 L < @  < 0/ 0-P@4 LZ40<080@0<0L00" @0200< @  000/ 0L 0 00/1 41H00 001/0</ -0` @ P  L       $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@04p<0002X10700 0\1 -LML1H -KA04pHL2 P2 P凢!@`!.KYL2` KZH2mK01, K1 17801"H" L" G H"eK!.KH JH2S 0000p 0 00 `L<`r0@0@2S101(K c@00S/ -LP@`4q& @00S80            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X3 101101 (0\!  -6LM SSpP`400 46CS(Kt K"Y00 0 0 0 L0 K0C0C0 ` !` ``@0@20 $Z@@ K>Y0K!J!<@PK41uZ 0  f.@P @0K k.040 0 @ K0 4/0Z@42t T  tL0 0C0CL00" 00 0 -@0La0 , !0  P80T V0,H1   4102$Kk/L00CP c002/ܻ 0 " YX@-SP+!6  \' PjV@0 L00L0A>@C`p`C\C  P1  0L000L0 A@P@Ap cP 0 c 0-LxM P  p Q `` QQSL0t KA$X0 K0 | x0 lP K0 c 0! R!10/Pc -LP` <@`0 S   /0  0-P@L!0S<00 00`(P$@@ @4 0,!605 000`(P$@ @ @4 0!5,05 000`(P$@ @ @30 ,00!t50l5$ 0000`0(P @ @3 0!$505 000`,(P$@ @ @30,04 00'!404 000`(P$@ @340`,(P$@ @P1 0x40 <@0@0 @3 0!@4@ 00 000`,(P$@@ @30 0 0!3 0000`0,(P$@@ @s30 0 0!3 0000`0,(P$@@ @^30$0 0 0 0!@3 000`,(P@ @H30$0$0 0 0!2 000`,(P@ @2340 0 0!2$0 00`,(P@ @3<0 0 0!H2$0 00`,(P@ @3D0 0 0!1 0000`0,(P$@@ @2H0 0 0!1 0000`0,(P$@@ @2L0 0 0!\1 0000`0,(P$@@ @2 0 00!1'000 00`,(P$@@ @2 0P!00`,00(P0$@ @ @0 2(K"B cA| A A3A< A cP A cAAcAAA$A,A3A;AHAWAiAyA -pLMP`K` @\U ,0Kd #\0 0p 0`@R0  0 0p  00 0 0+?oP20S R R (K cdcp -L|M@KP`p` #UP0T Q0D 0 0@ 000000* K c -LxM0`T@pT 0S PK` TT@ P0D 0 0P 00000 0*$K-c -L|MPp`V- @K` Ti\ iP0L 0 0@ 00000 0w*(Kd 00-p @lLBQQ0PS0cCc@sc c/ -L M 0K @l P6 0S: 0Kb P8 0SB 0KX P@ 0SD 0KN PB 0SF 0KD PD 0SH 0Kl: PF 0SJK0KD/P0!0000K# P0KP 0@000KP 0000KP 0800KPX 0800KXP( 070AA{AAh}AAAAAAAA -LM@00S400S0 00 ɜ KTcXc00/G- ,0@`(PXP^ Þ L`pa`Xp R: R:pZ6\ pxLP Y p L\!^ppVpW p pG`$` V*Y pp'  ` 0S `  ,PPЍ`V p`P S-LP@` B S6 S 1p1  P@D`F@03/L0 3/W(@`PH PU D03/P0 3/X@Pp`@03/ L0$Kk/R8p@03/L0 pH03/T0ccdc - ^L0 P \00C 0Q u>A - @L`0BPp<.P 0 0<0P`PD0 $`0 0(,pvc 0 A< -L MP@(P0,PS`!p!*(KW1X 000 0 PpGP `W U0(0000(0,00(0,0000/ -LM0 @` X0  @2d0(Ko/0,"0 S M4S  0PRy$ X X V@D PpT*0pG>0Wp!80 0 @`FV@D P0T* Y*pCWp! BW0p!0 0 A3A3C?o20 0@`FI0V@D P0T* Y*pCWp! BW0p!08 0 0@`FI(KAdc>A?A -@`L,PK M@%0P p Tk(K0 0S@ ` p`00 0 0 -LM>8  0N@T`p3:Tx3v# 0 ?ppPpW 0 ?PL 0p0#1@0 80X1(KP00C<0 <0 00S ` p@0T0;00 僗0 40 04P 00S!>\0> ZJDP P 0S 0 Cc>qA 0-P. N@LE$0v0 K0h>ꄂ>Cc0@-ASp`T @TP0 0 0@$ -LM`P0hpU(K @Jd10K0 KNU@110[0  00P`PE -LM`0(0,000pS@ 3:RH0DP DP0P80000P0(`Pp0Kpvc -L M@( ,  (0Q P080?oU20S R(0(000x1D00(K`V P0A#AR K44 Q Q Q70S 0H0H0 0 BHP0` B0 00 HP0`>0 BB6*100 "*V00zbWp4 00 k_04 0 0 y P`F$0D0 004 pvc -LM@Pp00 0(,8`00SP (K?oV20S 100V100 0!0`Fp0P(00000 -L$M Sp`00S:4K 0 jP(4@^:0 P@ Z 0@@ <0 8 ^ʅ\8<0 P%d.ʌ P @R i(K 0 -LM@`T4@  0S  0000  0 0 00000 0xP P@0S(KP pXcTcA-P`@PpU\\0.b Q   \ *8  00GS0!>000P-// -LM)0pS@P`  ( "%+PPV@P@VP @ۗK*0 VPV0P0" 00"%Xʗ( +0"%VPVP Pu>AAA -LMPlA2/ R?0r? 0AQ,CQ B& R  C4 0 >0?`0?0?0? 0?p01?0/30///+0 00x0 0000  000L0  8KhcccccccAA*A7ApAA -LMpPQ`=bUٖ KP0 02@Ÿ0 *R"@  t"KvL1SP 0SKD> Ci (K q KKD KKT:T\1YT\\1ۖ\1@֖\1  іϖ1!0S 1*B0S 1VPUx1 R0S XP1 R0S  0T| 0AD@T& ! Yr0@ Tm0 KKK剖\1 3 HA ceAu>FAA,A;BAAXAeAqAwA}AAAXVc$cmAAv>A'A AA&A3A?ALAAA -LMpWa`RaPP03/xB0\L3/0T1`2PXHq0 08@wl42 0z0jl2 00cl2 00\l1 00Ul1 00Nl1 00Gl1 00@l1 009lt1 002l\1 00+lD1 00$l,1 00l1 00l0 00l0 00l0 00l0 00k0  00ks$Kkd`$Kk蠕dc c A& A3 AB A_ A| A A A A A!A&!A(A(A)A")A-)AU)A})A)A)A)A)A)A(A(A)A -LM @`Pp 0S P 00PAP 00(PU峐(Q 00(0L0$K@0?  0 L0 00S  0 bt jJ  P$`)A p-L MP \`@ Ht OJ 00 `$PKp p-LM41@x`QP R& $ ?0     P!T0t0N$0`0H40(L0B0880L00:Kphz  c *A?*A`*A*A*A -LMtT@0a3/03/-  0P 0S  !00S0 H1  00z 0  QU 0K0 05/P:Z 0S L0 tP0 0~pS( w W$*430S (0S L00R6BS 300 00St KI 00 00 0夠 儀 0 K>41D00 :S L0L - 0S0 `201:+*B*R8 ?+> Q R3 < SPP 0  0P0 0(l1S#Z07w0S00&R ! R &R ! R QP1UPPP0 (0B00P(0S 4p R Z 0(0L0(K0 06t K0 I 0 S S S 0 0 4QxpP_P0 l0 p 00 0儀 0 [ 00 00 0dc c>*A`cCc*A(+AG+A -LM`1 @PMpQpWH1  00S  !WL@倁$ 0 0t KH00 00 0 K0 @ @ Q0 A 1@T=L@0* R8 6 @0TT00S 41~pD 0 P 0 /pP t KjH0 W0 04qxPp0 ׎0 4偎 00 01(K c`cG+A -LMX1XQ8 d0@3/`q@@aW<8ʀ 0! `! 0   , !Z Z& Z.0K}00P0S00[0 0!!`q0   , !(K0Ks00P0S3[00Kz00P0S000 Ǝdc cd dd'>u+A N40-SL@00M03/000dc(0P$0141D00Co/ c c!:!P/ 000 S/@0. T4S/Q0 /0 cG - LG - LGT -0-  @SḠ((K `" pU 00W00S` 4 )1 4 L 40 40j@T cdcc -@ `PpLVQ 0 "PP 0`@R  UPp`U 01P41D0 cc 0-0L@ C(0"(  P R0 H4Ph$1P420P!%R @A"800CS00 80K0h ccc!c -LP`T@<l@[@[PP00D3/003/03/D0@$0 0cdc -pLMP(Ko``` `XࠟPU Y@ Q0,03/0(Ko/Y@00=84 (0C84 0<40C<4 0`01 [& ^Rcdc -L$MP0 `00 0Vs  000 0p P0`*6080 8 0<0 1D0 <000040 00 0H0 I 00`0@0 9 S@ 1 @ 0@`0 0@0@ 0W1 00C0C1 0100010240S ` H0S 0 @Y 0< 81  D 4 0    @40S @(Kc c 0-L@|0T0HD 0S0\ 0SHK0h <0Q<%   <% @@ c@-@\ QR  SA  B      00 0. <$  B<$ 8 0Q!SA  B!! c/ -L4Mp6@0H0 P6`@5S80  R8 8000VP0 0S40 4000  @|0 0L0 0d 6T;0P<0 %60@0 <0@ 0D0 1T0 D0Z  P8 R40S 804 S<`q0400 p L 0pR    0p %D 8 P0P00S 0p ?M4S ` L0?o2*2 4H03/m`tH0ST Z  Z. 0D @1 TOT 041STH0S  H4<%$ P4200P180S 80 <3V4 ~`/%%: 8p<0 W lpP 8p%:  000<0 0QM  $@0 P @0R8  0   `00SO }K %* )PL0 1 0T0 T 0! Tpz(K c cc -@`L MP@ rPPP@<@  *600 Q000  p @ 2/0 2/03/  00 0;UV 0p<0(Koh:\00  S  S@0H5 40 02 S0D5(K cdcc` 0-LM0@0PSKNPK00  0PP P 40 U0*03@d@ -L M@`T:~00(Ko/$::6V0100 Kp$U?P唠P00S0בCǑOP @0  <@0 ' 000@03/003/JP cdcc -P@Lp`9H$$:$  R2(DF0@00W@V UPPP$, !R  # R$60 X 0S(H$H J$J@L  c0 0-@`$ 000L 00SpP@5S d0)H4$? DP4RL5LE000<50@@0>00' 7<Lu8unt1q0p H4!*$01004P4 20040@,1 0$1@@0 @0@@y1 00 @@00Er0 00@@0 @0@@y+000@@0 @0@@y Y<0(Ko/ cc cc@cG.As.A.A.Adc/Adccc`ch!8/AT@c`c?/AcD!E/Ach!N/Acc 0-LVsW4@ U{W @ w0@50dc -L$M0 {(({$1P`v@@!(0@@g(0㓆"V8 :(K0 'PP20 0040K0009  4TPp4pW U: 8`I80 |Z pccCcCcV/AXcTcm/A@0!S800 S(00 S0;0+  !/cd -L0`S0@!* P Sl0P S\0HUP0SD?P($EOKhc/A/A 0-@ !:L 0T$ TD0 c ->L0 M~0PP@ p00 xR R R`T1ċkL1HUn`Z(K$1!k 1!k ZQ#00$ʠ @FVJ00 Q  h4 P4  tx t0$Z RQ 2HXJ+JZJ/Adct>0A.0A 0-@!:L K0h c0 /d 0-P@D0LM@ 0SK0     adC-p0;S AP@ 0R0`VP B@`p WV*d-T0+RA 0S00CQ ^ d  -AQ`++D%L 0L+;;0; `k` ;/0S0P`k `+ +++ 0++t+l+ h+ |Ud+ x`+, p\+$ X+0?00?dc !i !! -`P0匀L0pB@N@N@TO0?0000?%:P,m~%5?[JZJD c cR0A -LM@ᜀzT:00(Ko/$::6WhP!P1$e?``T*L0 HS @03/003/ Jdc c0H4 / c0  ")//0 !Р!/0 ! !/ p-LMPeMP$ OK,`-702 ~?2 02 0  \ 1 Q   ,0(&#(0 <@0?6/KpxcHcc4002?0/S 0?0 S/Hc 0P/Hc 0-l0 0QPL0OP0 P8@ 0ASA0000xcc -LMH2HR<03/0 QP (B0S0"S  & P|(Kor|LPi 0Sf \OP|u(Ko|XP>0p P?#Kl1l080 `a0SX=@1a<0 <0 C06SPp1D | 080j:0800#K8/P#K 0#KJQ Q Q u|Q Qxn|pl|hd`(Kdcxcc0A@KL0A0A0A dHc51A 9B>1AQA1AA0A0A1A p-L MP `0R1H!H!H!H! $K@P$41$ D0 @|0d03/@`40P@0  $K@P <0$ 00400040Kp@dcc/? &6 -p`LP&.6`!~M0@:0@P 60U P00P p-L M0Pt?|0@l0`@@D@T0 0 0 Y40 u#L0000L0KpH1A> c -0RL$M8 <0 P P818q0@0 00K4 K@1P? 4 0S0 S8%jDFjFd 0H D0 1/1/X1!H D0HE@YS00P S40 003/03/X80<83/ 0Jn$JQ`Jd{(K脂>dcR1A 0-$@L y000c 0!&-`L@  cP@(@`j00PKh褽c -`LpPY0@T t{ R0@ R 0H{{ ~0$0%6P Khbc1Au1A -LP0T0`V HVEP `$ 0S 0ES:`c0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/ -LP`p@P @ 0 Y40PT`\00XpD0 0L00h000⡼ 0@0ܼ00S/\c1A 0-L@P P00K0h/c 0-L@P 0 R00K0h/c 0-L⪲@P 000T0X0\0`0d0h0l0p00Pt|x0M( 02A 0-@LQK0h裲 -LMP`@40 0P00 Y*(K00 S+ 0R'p/ :P 8 /8 p :P< /< 8 :P80 p0RP040@ -LP?T!T! T!T!T!$T!,T!4T!3A -@`L@00S(lPP U2 U U$ 00 03/liv6Sn0m|48o^vh\vppU" qU %U P3/pP8008080@[ P80 P00 03/n6v6So npp W~a!a!Pa!b!b!a!a!a!@a!b!b!b!@a!b!P80 D \ `R0A?o20S0`0WP 8008080@x :RP P  80  x %Ry R P Px0)Sy0SP80080808  PD103/Pw00 03/11u6S%pG W'c!(c!(c!c!c!c!b!(c!(c!b!D0S0CD0PPP u D0S uP0 xus0SHu> XTuP`s0S0tu 4A4AA3Ac>,A3A3A3A3A4A3A -L M4 * 0 ( 00 K0 1K K' 0-`L Mpp,` ,0K$0㈀JbK(0KP0@ ` ,KP0 S @5P J0@(0K `0 ,K $K'̂> -L M40: 1KK $ 00 K0 K K 0-L M0 K<1K K (   00 K K'` -L@$MK K K*   KK  @KKK -L,MPp .K@`.Z000K$4)0K0 00 @0 0* 0 00K/K.pK(@Kp K -L MKK0 0K 0 KKKV K -L(MPp` &K@h.U0(0K$4!0K0@ :00 0 0(K00'pK @K003K 0-@PLP O0P00 -L4M4@D5,00C1  pP+ 6K0.1 @@3K060K@000K>0?09 08K0PP 0@QUZP(K E P!0  ` P @0 Y @0PE`\@ -@Lp0`ၶP0P0⼶tPP P0⳶t0p0`t0z0⥶ -PL@4p`WT0VT$ :TR 0$Kk莶@t`@H cP 0 S08 @TW00S 3/8 0  S   8 d   @@@ /P 0Sd``0VQ :Q|@THz\0Td0S`@ -L,M@@Pp0d0Sk0Sh80 00 03/xZs0`0\SAHMsD40X3/`G0@` 80;8080崃K008:0?4 K0 l0 8K8 8K80P;80夀 Pd P0 d00 03/ hs0d080` 0⃵d0S `0⻵(K0⳵d R񟗔m!m!m!o!Ln!o!o!hn!o!n!003/`0Zv0d00<00<0H00H0P`{0↵00 03/,rd0S0(S@080 D040 0 R0C B0 00 00S00 03/r000 8 K`D0S` 0CD0080P0 0`!00 T0B|`!PL0 $!0L00!D @,P``D0S0CD000 03/_r00 03/dVrd0S 00 0S 3/0⻴80p m:4A_4Ac4A4A4ACc4A,v!4A4A -L MqP@`\P d00C?o2?6\0S3v`` V,`0S)0⇴U0Ĵ(Kd0SpP P 000 0ⰴ00 9.P0ep W | -PLl Pd P\ PT P :0< 1`0000q >P P P P P >/0( 1d/0000ꈂ> P-L P P P P (0<00 01d0000ꀖ>00/00/ -@rL0x0S 0$Kk#|`V @ 0R L0S80   80`3P&P  P0 0⹳ P80 @00 03/2qx00x0t00t0w R00 8080;80 0@T PeP_o Pu0ST PE%T R0U0 0 03/ pP0000ⱳ v}M5A$5A -@L`4PU0]x00S0CUx00△x0SKh[ 0-@PL|q0A0P 0yK0hAt  t w0K0hk -@@`LP0 <0 0\HP0 T0 00T00 0@ 00C080 @080 1T;80"T <0d 80<0000R 0L 0L0d0S0S80@;8080 @0 0Khd0S0Kh00000@@w -L @`LR@P P0S P1PPRL003/<0\ 0<00` d0080@80   ! 880000080080p08S  0808pP6 0Z0 0"3/p7880808S S S 0"0!000 03/8op3/oJ0⑲[0J p0⇲Q0@W Z 00 03/to@00u<0 0h6p p0[&5A5A5A5A5A -0L@S 3/`Q`a0P00P0pt0WS0ou 0t003/ 0t00+ yt0 0 0Ա 0t00 W R00 0pv0ᄟCc 6A -@PpLM4 0@ ,@ (@ `0S K `P@ 004 K00 X q- ^ /$0/ -`LP"P@$@T @P  0-L@"P0$0S0K0h 0-<@LPR@T叱00U @d p-LM@Pn $1P^ 00 03/n$00%PU !R00 03/n`` @P:0`: 99000000CPKphc 6A&7AQ7A d -P@`Lh0K10@J1d0S7!(!H!h!!!!!\0` 0C18000԰00Kh lI!Fp(0K1plIq Fg(Kq00 03/<30 @Ek0 $=kKh2Kc8A8A9A -LM@P<0`  p6):   (0K 000L0 P n90 ,k0d0:$Ky09A -LM@p!<0 P`7)( m:0qF 0 E9$  0 j10S k (0K0 0p*$0$0L P1Rp1 Y90 j4:0d0$K!#30 6!:(0 8  `\ Q  C40l0@0d 40 0 d0Q 0 Xj0 l d@j9cH9Acw9ACc9AMb!9A9A 0-LP9@9K0hc -L,M\0h0@ @`%0 p P< 8 0<0 H D 8H D 0 Bj9<00S 8< 0  2jtj 0 0S90d0t0S 3/_0@ $ \20 8/Y0 KL0  0pY ``v9(KT8 0   i0d0d9x0S 3/}?@0 ,03/ ,0 3/ ,03/00 8   C$  0 i Y v,!\!\!,!\!\!\!\!!!!80P`0 li<@T0 4/80 00 09`800 i0HQ(0 i 儐0 <9/(Y0000C0 ` :/I800 tji0HQ(0 Xbi `0 <6/(Q800 Li00`0C@00S@0  di_ ,03/ ,0,3/0 J -i0 ` 80B$ 0dl  Xi80&c%:A>:Ah:A:A:A:A;A;AN;A\;A;A;A;A -L4M\ ph0$< @0 0 `@<0D H0 801080 30 C7D H008  hW80Sg80 0  4 0\P 85/t0S 3/@0< $_0 \P20 5/d0S9 06 00K0800 0PPH0D 0 00 00P0P00K080 0?PP00 0S6 0 <h0S00ʅ0040\P 85/ ^801LPU,#㠡, #à0! t0S 3/@0< $_0 \P20 5/ 00K0800 0Mp P! 0 -0pL@P4W`@0Lp@00 40 hf4P0 0I.@P0d0$Kk80帀 00 0 00 0X00\0 P080h00$0P 0W.$Kkc">A> -@LP0H`   p x 0 t 4   ,  , \ P P0 H00 Pp000000 0 D$Dl!!!$>̱!E>A -LP4@z4`v4P0l P~0Kh蟨 -L`P`4p@吀l0S 0PP)kkk4P040 CcK>A 0-P,@L P@ k0dV>A p-LM`@40P ᜭPh`@3*h`0!S\Q lhP08 X0 SAeA-Ak>A>A>A>Ac!d>A>AĬ!>A <0- L(q$@00000c \0- LH]$@P 0 0P000000c -QLM@ )h0a@pDTpPK 0!K`K 0A 0P P0Q0 DP@ 0P ` 0K  g(K,A>A>AeA?A?A00S 0L0Sp // 0-QL@P g0S L g08?AF?A -LMq PpP\00C0 y `0C00 414100 T_0P0 0Um(KQ\0Sڰ Y`0 S ڴ d0SᴠP0 `PG@P 3@P0Dh0J 40x0K 0  R0 xK3R04K 500x K ES$ xK`P `:x0[ , '[0R8  8 v [ S H S  0,0SRx0[ 0Kw0[K30 p0K0 h0K0 X0K0 v0[@ |0Kx0K0 0K00H P`R8q0[ 0000 00  00@ 000000000R @0[ 0SW SX @0[00900@0[00:00000000000040R`4` `4`40D!0K00K0``P 圠 b0P0 1 H0S0 K00K V  Z! -@SQ `SO cK 3/P a E,0SC ^0000000:0001K]4f2`000 cU <>L>R?Al(6إ!7B 0-L@1K0h -`LPP0@  wf0 0 ]吥p@0V hxƥ `~ 0XR00 i4嵥ԛ$ 0l<Z?ACc?Addd - @LPA" 0T T T T `0T 41 00KhKh:0Kh cUUU R0@o/ -Lp(1@P0\0S 5`P 0S P#0KhD -LP`1 @0KPPᏪbh`h^h4BP0ޤ r @ R / 0-QLM@ LeP0 0@U,@ @eK0,A>A>AGIA -L@P0@P`00d00`0d\pe4P 0⌤phggpp<0 Pd e@\pPPW$Kk803/PAeIA>A>A>AA Q-L .esIA -LM`(0KPp0 0 P40t 40d@P 7L0   K0Z d>IAد!!7B <0 80 40/0 8< 0/// -L MPp0D1@ 05P310 1 `4 /PQ0Y 0 `0 4 VU_$r0ڣD05)55qf (K訴!l>> -05 L(M0  K$ 00 K0 1K K0u 0-L/DA@0  P80 W.80080N&0 -L(M KG0K0K0K0 0K 0 K 0K0K 0KD K0u 0-K L(M1KK0  K( 0 00 KD0 K0u 0-L(M0  K!$0  K*K[ $ 00 K1KKz K -PL`A 0-@@0LP.hQ0P` U $  K0hq 0-L@.P@0Xq0K0hĢQq -l0L@0p0CS@PRn00SLx0SIypWF|`gP?1 0n00Sx0Sy0S|`MP%0 0n00Sx0Sy0S|@2P 00( 0zCc,v! -`@Pp@0M 00L(;00 0pKc -@` F0LM@Php P D18 Q9@A XT00 0{t Kc 0-\0(L@!60DD@1 (0$ 4cR$0D1K0hc -T@L`0PS 0S 000 0000S 0S000 0000;+0S0S00 0S0000S$00&Kh# -LMPp rK$ d6rK7Kl K@H6Hf0 `P0K tKP0 F0h h0K0㰆K`0K0P0 0KhKd Pu'["(X  Ɨ  ZK%5P%K Z K 0V K@ 0 \KT@KPR $"@%(X7GȀ5刀P($U K0 0 \KTKP6c0 0 0 @ ☠ 唠 匠 @NT*  \ R@P  @ R 0^R@@   0 ,$ 0    z (K @R `R RPPVPU ! .bRVPRR <PR`RRVKPRPE^.P`X0 `XEP XPP T @T  X  C \ \ K 2X PV K00@ \KᴥKT@KP5 !$$("Y7*t2",U K0P0 \KTKP  P `0 @0 0ሠ  IRʌ R 0`PB+   P q0 j0 \`SP@PE\ \@ [J[!$$("( R㰣K0[N [$ /[M [$K[     !"      @ I[ @   P,,,+ HKDK @K<K8K4K V;T8 -L(0M 0 0  { K!@! -00ML06 0 0i K!@! S0-L,M@K  !K 0K:0(0 K00 0 K0u 0-LM0 0 9K0 0 01@0% 0 K0*0 0p0K K`PPQKK41Q0 QS  Q`;00Q 0  K" ࠟ8K0 K 0t0K KpP#i [n0[4~K 0 0 ~K(KH$0x0K pP0K KypKPHKA8K>cP@0cS 00(K0uJA R -LP`pv@P ~P0 ""H0cH0$ 06000000 0 0T0000@`! -L(MQ K@ KB0K,4K0K0K K(( K@0 KD8 K 0u -L$MP*DA0 0R80 0801c#@b@_ $Hp@;xa KdKWV+^(409%3K0 0p@0KL00KL0[=0K $0 0L0 @P0 U0 080 40 3K(0*06KL80Kn"410K0 K p8`Kꔀ 1L0PTp\00D0@0XhPL0@0⺞(K  CcH!0u -SLMX 000D F K0 0D ! N -LMD@l4  P00D0 K P00D0 N -L(M@Kp`P0< K@P 0< KP@0S[9 [8K!$$4K("( p ` P <K $K p-PL,M8`K0`P4 K@P `04 KP80S"[10[0 K"44, K8#80  Q   4K80 ]Kp -L(M  C KQ,$ K KK K* K@ KD K0u p-L M@@0 P Da 0P40   H0b",4b4#04!400 S0S000Kp p-LM@)0Da PxD3 TK?4X0 X 8  !0X0/K K<0D 00 0  0KpJA p-L M0@ CRP`0 00wP0S D140; Kp0 `0C0S 0C   D!4  a(!"$a$" $!$ -O F0@LMpPD9@18@`@@$S@@T @(KX/Uu L?U ?0CU~ *0CUl  ?U 0  00 00KmP@0  00 0 0-@>UU 0U00 @>U<00<0 R:0U 0UF@L>Ua 0CUL u:0UN 0U  @P@1 0@1=U U?C0CUK 0U  @=Uy 0U@5^K7~Kp@0 )P 0 !@Psp3@S M3[/K"44/K8#80   00^-U# -,U <US 1v8Ud@ C 劒 t *=KC C @F0@@ ,3K0  3K @ 0 3K hPP@3#0 $"448#8RS00 ,09ӑ0;0040 l 3,0@=KC C @F0|3K%43K0 3KSK]:0; @p00 0K3 0@P0@S3 33SF0;Xʰ0 S@00, @ 00  @0@ 00* PQ0K|S pPP|3K"0*Ԋt3K P5>K @P @T P: 07>K`4:7.K7K00*n3K 0 h3K P0 @P0 7K00C30 30 3: @0p0nCKiCKhsK@P030 00C3ёh9U 0U0 2@`0)U  BUo R@X 3 @PP  T @I@  @P B8U 8UR<@P90 @,l8U@ 7C0CUI ]g17U50S@<@ 5KqP8@ 000:0 5>K@P20G3KF3[0F3K 0 CR@ P ER@p0S 7nK 0.@P0\3ls[kS[0D#[UE3[   D#KD#K  @#K 000?  F#[E3K@ F#K@75.K000: 0<0@6U 3C7CUP0E,S@5~K0 Pp@P0#$$("( R !@P6U D6U4 3C7CU  @6U N60U0S!!!8!!  P5030/o0"S@ @tt@PqpWm PU@i0@0 5>K@P_N#[M3[@0C100 5>K@PQN[UJM3[p,K0S``P,0K3Q#QQPP@77@P4E05^KPC LC @P3K"4I3K4H#K@00 @0@0 DW@0^ 0 P@ 05^K0 09@PD140   4"4 05^K @P0 0CS 1K`@5^K @P0 K0CS 10Sk 5K&@p7^KߏKp0 uP> 0 m@PN05~K00 b@P|3S* !$$K("( K!      @m#[KK M[ @0K@y0 0D@r @0=@k @06@d@`  @Z @T @O  @I  @C  @;<0@0<06; 00  0 0  d@'cd@c Q c c c pd c@c ccl> Ccqdvdcdcc<cc(!@ 0u*" KA NY0PC P3K0LC HC L3K0 H3KX0@ @00@05K0 %@7>K > 5K:0 S>$!!!! !!!l! !!!!* [0 p3K0  g3K 0 5>K7K @P0I#[0"30[0p3K0 030f3K:00 0x1g#K7K00 5>K @P KA[0p3K0 030f3K:00 017K 00 5>Kg#K@P K%}[0p3K7>KP0 030f3K:00 0l2g#K7K00 5>KD@Pb L3[ # #1 00 05>KP[0p3K0 030f3K:00 03g#K7K00 5>K u@P80I#[0 101\0p3K0@030f3K0 KgCKO3K:00 03@ 007K0 5>KO@P00\0p3K0P030 @f3K 0 KgCKO3K:00 004@ 007K0 5>K-@P0P0[0p3K0 03?0f3K00 047K 000005>K@* [0 $p3K0  g3Kf3K 0 5>K7K @PL#[00"320K3[0J3[0 f#KO#K \0L#K* t%p3K0  g3K 0 5>K7K @@T@7>K  5KR0p3K0 j3K:00 06@7K00 05>KgCK@P{PoKT 0V00VP0E0V00E0V0EI FC0U 0`30EZX5>K R 0P#K p3 l3 06I#KJK 00G#K 7>K 5K w@Pl3[0k3[06PwsPP@/ 5NK R0P3K0I3K7 00p3F3K:00 07000D0N@P+l @7>K 5^K^ ZR0p3K0i3K?0g3K:00 0L8@ 007K0 0&@P0#$$("( 0BS @KxPP@ 5NK *R0P3K0I3K8 0:00 09p000D0@P  04#$$("( R @R 9.K0 @P 0@ 4@#ĠČ0 Ƞ,Ƞ3 L, (^`!!!!!!!!!!!!!!!!!!4!K  @PE3[U`?0E3K=#=E3K00:5.K0<0 @P U   @U  @Q Q Q@fA @AQ QQ +QQWA @N A @0X 5KP3 00P#K 00"K#K* h LK    @@R@ 0E3K5>Kj@@@0u>KA -LM2(@!60bD1`80pp$0p00((0 S  㥊PP p #AK ⪤ 0D $/K?P00 0J6僤!   p  ȁ 4! -L,MpDa@0 6P!R*V P9PQ0U S p q p@1 0@1P  P Z U|(K-P80);DH0 D 40 ' H0 S.D0H 0L14H!;P1800 080 L1 0H1$ (0d0,0000'@1 0@180080D KHKP ;H10L1@0K00< KP@0S[9 [8K!$$4K("(R  $(  RtP  <KP;DH0 40 D KHKSP ~aKAKA0 8< 0/ -LM@D1pP00  0$P5 4  `8 @A0I 4`0 8VNa0Β00 )k$$`X (K!\>|> -L(M DH0S40<@0 @@5  K, 00 K0 1K K꠆ -LDAP0`@1  P@1`0 X S@1@0@1680 .80080*KA 0-Lm@1@  P@1`0 R@1@0@10KA0R0⭑800800`LA*LACc,v!NLArLA 0-L@Pf sX14D180X00X00 -`@Pp@0M 00L(d00 0_Kc -@p F`0LM@PIP QP D180 0S9@A VT0`0 0 c$Kc 0-p0(L@!60XX@1 D1800S (0$ 4cR$0D1K0h%c -LMp`P@ş 4%< ?\$ F V Z8P0@K0 KK00$K\> -0(L@!60pp DaP80 80000$00Kh/P Kh_c -L4Mp@ <K%0 <0K`P P 0㈡J @ 0 @0 <KPP  (Kp {x :K03K 0 /0K@0 @0<K@0 P0 PZ@ <@@P0@4@P0,(4@P((8@$(<@P N -LM0K0 0  K謒> `0- 6`0LL@@ PP P  0Khn_c -P0p 60LM`t@ P KP D180 000@ 00 00_c -L(0M 0 0  \ K`!! -00ML06 0 0J K`!!  Q0-L@  Q  Q P000 03/0d0?o <0cT4< (*M0 Q  Q0LALALA 0-LMDP 4  \d @@  00D0 *K0@@   00D0 p -LHM@`pTPK0 X0K0 000W0 0(0P Vp$K`X0S$[Q0["4408#80S0?0S00?o 2 Ă,$ $("( \0R0S0 $"448#8S>0 -4D0 F0@LLMp Da9@8 1P@@$S@@T@,W4 3WF B27WJ 0 00 0 0W_P@0 00 0 09T3Wr 0W 0CW@(K "@ R@X 3 P  T @  @P80 H0S0 \K 0`K00\ K@P`0ST0KX0K0Y [pZ [ppS40xx0 \K 00H00\ K0P`0ST0KX0K0||p0V H0S=0 \K``0K0@0\ K@P`PTKXK 00000000Sn 0P ?000&   K 0\ KDc  \K0\ KDZ-@O0 @1 @TF _@1@P@0`0@1=@; @9cpdpd udp -LM0@`P* D(08P 8 K$,6 K$(4P 5 K3@K$$@4 K&$1 K @0 SK0`K? @08  D p L 8pKT 0 -L`M1PS@< 0D`K 00K$K|4 00000DT0KP` PM0[L [$"448#8 0 DP< 0@00 0J[0l0h  tlG[5: `K[I[0 0(p 8`H[ <$0fK SRWVQ! 8I&K! ap'$+4"0  > "T1j/(0P1 ,0H100L140; dKDT`p0a]0# `0 X0 \0 T0 P0 L0 0l2` K 00 `KT0KDX K6OPC PeQ0[Sb L0[0S: S\ PKp`0aU J0[K [48I [0d0 dDP<d0 d&&Kh  '#h0 l0$h0+4"1S=xLID00(0SM@00 000 5:0>0"dP0 TK`0K0 000T K P`0S$[Q0[P K"44L K8#8S0 48D1 80 PR  PL ~PH   3/P pLA NLA -L$M`ph@P ☁j X409400000Sg S  `CY!QY -0DQl0h100P 0X00080 080HK0K40 #PP RiPKU. U/ UT`d^!0# 0K'! T10K0P10H1L!KlKdl0 htPXoK KH0 S@10@1,K$`cA$>eAMA!!AVMAdMA -LPDA`0p>P<1)6 0)01 S R P Q PP P X808PP RP80080 Y! .P 80080. p-LdM`P JH10@,0020!40L10H3/H113 *0S tIPH1KpS] 3< R00pK0}p K JPvMA@@0uMA4>MA -L M0p@ 0 Pa0  `4 PQ0Y 0`0 4V]XL1H 03/?00 ;00=>00 300?00 +00#Ab aWtdV [d/0t4cF#Ὁ0H!0H!0 (K;"H>h> -H1P`L l0Rd PP0GVP,G@HHpHV4 !"G@T $KkGꘓ>MAMAeA3?A2AoB -L M@2PpW H1(KoT`D00LY u8""d""",""" h0 00000 R!FFW 0S@00L0S03d00!C=R (Kot 0  0pH1.H*0H1' p P0S  x3 d00xC0 M00 2@0S *"*F0S 0S$00H1m p4 0Cp4-W(KorWcMAA NAAH""MAMANANAMA!"Cc!NA -pLPW`@  8 $$"$D00H0 0W#T`00 02P3  (0h#R 000PP202l4S H10  W0 202 0< 0m4S H10  0S2<2P3@20202P3 0<2P30 0 2022<20mSp40p4L1H03/$KkX 0-]@LQx#RK0h茈d0x3To 0-]@L=#RK0hxd03T[ -`L1H LP0p3/P@ T0 T,L1 0H3/L1 0H3/P@H10S( T6@00;00E0@0 0FFH1 $F@BNAHNA p-LM_K@`P *p0B8#8S 00Kp:@ <000l$RH!     8 -L&MOKp`PPP8*0B8#8S4 2 Q.H1 0,00@400300R2L10H3/H1f3  3X R00'K0'.K< HPH1 K-P0u4>{NA -L`pol@_Y00H1WH*0H1H1Np 4"<4;02P  0h#`0R02ձ02ű@2 02(0@HL1<$03/DQ$'"'"&"&"&"TDPD D@<DY(CE00cNAANANANANA 0-@L0  W6> C"l3t$(0W?0,0U?000P3@>040K0h 0-LL1@0H3/PPP3P D\GL1HP03/0P30P3P3;P3NA -LMpP`@ @Q㧆 0pdL10H1 H1& H1  xcc=FdG^PF G p`T%CT\w Q H1  f`D5 @P0F PF>p0 00K,(P$  `0P 0$F(Kk?ap0 0K  \` `t+p tG` 0QD!R ? `8$Kf K,FD1 F0 H16nQ  H1U E?0W P3<P3>0 P3@0P3P3  E"> C F1h3? : S<?080l30p3: S0t3  2t3/.  Q)")0Cp3l!0#` K!P3@ 0F? F!l3 K000000Ft3S lp}Fp#R 0XwFTuFsFl# OA*OA5OAOAOAOAPA-PAS+BIPABNAOAOAPAPAPAPA -@`pP@0M 600L( @  0SKlc 0-L@P0K0hkS `0- 6`0LL@@PP P  0KhTlc -LtM1P3(K*>0 P3 plc崡 0P 00K ` p00@0 0W܈K0H!`C V `ǟ @ *(((IF`,08(0<4 LH9/H4 )# * R  #R K D  K<DH! Xp@@0u4>QA -L(0M 0 0  姅 K(3"@7" -00ML06 0 0㕅 K(3"@7" 0-T(0P@P#0L8P3 @l3$0S$ K0h蝆lc -LMp`P@ş 4%< ?\$ F V Z8P0@K0 KK00$KH> P-L@ C0 P3A> S9@A VT0`0 0 T$Klc -Lp@mᇂH1P|H1p4 P !S* Pd0P_PO'P0@ uᤂ#PᛂCc/"R/00S  0 r 0@o/// p-LdMH!P0`S }?!60#Q0`;?0@ ; S00,0,00ij2h0&hc40L10H3/H1 3 *0S` cmP3<P3 3P R00pK0=p K4B`H1lKp@@4>QA 0-L P3@  L1H03/P3;P30 0-LP L1@0H3/P00J0 0-L L1@0H3/P n6L1H03/0 -TLM V@0P `4 00 p~P 4 RV 00ARM R 0 p 0Q`dR \RB TR(Ko+ ,@ X00X00P$H@ R H!!0S`x$80pp ,p"a "~T!P0H1A>(KoJ(Kot  & P0 0 SO L  SȠ@*0S= &<p0 : 00000 00-0 :60l100\:60 0s`oWP  Z`y&#o&(K 000041pD0000` 080,0441P0`ps9PptcQU`c 0 R0W` G F V` `lcudndQvd(3"d4" -LMPx0`pX@ T0P&60HmP 0@ 00 00P Kclc 00 2022 00 000H00D000h0> -L`@PbP0D0)2, 02<05 2/Kh 0,0 0  0,0/ 0A,00/ 0@00/ -LM<0`!P6)@p 0S    0 =8> 0 0S0L0 [(0K0 0X0'<0zPX ` $K    0  [=x0S 3/( P 2  (0 0 C= p@0 7/c 0"#0@ 0C S 0ڰ2@ 0RARASA9SA 0-@PL:3 h  0 -LDM@P(h080 0<0< p@0 0k 0S 0 0   \0 80`p +48\0 0 -80L@SP <0Sl0!<<`V0L 0D;8` <  @< 00S8PTTA -P@Lh003/P` P P>>@h003/p6W 3h003/* -LPa"L@T 0  <m?,Ko p| 0S0 00>(0S     0R<0W:"0S0C0     S0!QW LL9P \0S 3/P0\ 0000 0  0;; 00X0S000 1,\ , ` , @,0?P   0    JP P W 0Rv~( \ R( ,` (@` 4>mTA 0Q+d -@LPay 0B 0<@0 0>Kho0`0S 3/g 0 KhT-d -@LPU 0<X01X 0@1 00S` FKh10X0S1X  1@ 0 0 0<= 0 0 01 R0S 0=@S!Kh -`QL@0pS>P 0\ ; 0`0R`0,0`0\ 0 ?Q00100000C0 0 HA>Kh -PL`pp0<00@ @ h0 03/<0@0 O= -@`帀L7TATA -Pp1L(@T\`h00 3/|@ -@PLarQ p0S(0S$Kke 0R!0X00S1  h0 03/ Q\00 00< 0-@L@8K0h=! 00C 0/ -pL@P1# U  U  U 0  0 P P,Ko<< 1*(0 ;0 萣 A7 `` 0`0 0 U  U#  U0 03/08 RV <"0< T0*(0 03/00 0 9 00$03/ 09 0=>TA 0-L@1 0S0|80S0,z T- @L<P4!pT` $1T 2C7CT07 T9 0T 2C7CT00,N<0 R# 4S @t Tpp@hPW<00PA@3P -̳c2A4A -LP' 0` S @ <0S@ 3/@P 00C 00 -LM`@<P`9U8@P50S ! pPCox000Rxyx0 0`h0 [e P T80H H}P4$Kk8$KAc0R"d,APf"TA(`"Q"A X0- LD@P 0P000000̳c 0-L@ 0P CS <0S 3/K0h -LM@` 0< 01SX03/ 0Pq< 0<wP X  ;w< R$ 08Q p{\0  0000d P" (Ko7#,\0_X_w 0LR00 ;,w (Ko(Kdd'UAd$q"-UA -@Lpa6 00< 008 R:-v' 10S 0S 0< 0: 0< 0 0` 0  0; 0 S P\ 0, 0S <0 <  0  80S 0: 0< %#0  0*P 0  P3)0 PSU eP P @@4U,04P Q3:~dL>WUA}UA 80- L$@0000̳c -LMP@儐儠80S(K<0` 40 R P [0 X 400 0 0 0N6L6@UAA0Sp@-`p@? *<0Q40CC%#%Q0 p@ CcMb-  2 05S=00 `a09#80 8802 0<<0 -@LQ`pHP3  Kh9 -@LpF'`PpD  ,PW0S00,0!=2?408P<003/33@ 0#S 1RR00R0S40\ pS pZ8^0,0;200R80 0K0C?o20$ $ S0&\, R 4 40$ $ dNEFXPi'TD -PLp`&@P` 0,00202?cḒ40003/I3 ``d -AMLMBK` H @pDP00SI000F/K3,K9P| 800050l"lRS006SC A 0#[R# 4$ i Skd R 0$  84 P84YY0$ 84 Q484d R  QH04000000 3[S? R*6 |3[S(:X*0 @00R B@000S0S00ą p 0pp000S 4 440S*Y(K4lPt 4Xd X\ XT XH4 P@YeAUA`AAUAUAUAUA VAVA$VA -LMR@pt`t80@P S<0:l=S508Q D R<" R,T0 3/80S'd0S 3/. L80S?D0Ot 0,R@ 00 8t r b0Ԡ

0,! ,! ḢL!4 * #/X100T!\003/Z#- c?0SR 0x0 1001000 //@@@VAVA -LM@pEpnQ<05&:-0K/ K 0.0K{`.e,#VE -V@ Vc0/[1 " 0. [: 0h0-[ 0$3/V``P0W/H5 0Sh0 03/P65 h0 0 3/P0WP 0 (K -LMP`@<241`0000 0 000000000$0 000 8 P5/ P Kh42P04P800@PD00P0x2 \0p2x0FhP|@PPq Hq tq,L4c2p 00Y1 00P1 00FG1 00N|>1 00Vs5x1 00^j,X1 00fa#81 00nX1 00vO0 00~F0 00=$0 0P0 #0 vPt1 00 0nTKhAVAH""WAA%WA.WA8WABWALWAVWAaWAlWAwWAWACcD"A" p-LMPd0`@ P0@@d0<0 0`40*^P KphY1Kp萯@,A"WA -L M`Q00@A PF p㴡1K_ RAWI1 Q PRB RttPUPQPRPWX .<1Q PU(!8 .1Q 1U!  .0S .. .Q-V (KW p00 -W00l-t0WdUpP-U,-P pL`KO RU WA2AeAWAFAWAWAWAS+BWAXA3?AWA -LZo -@PH`L)p 0S 000 P0D0L0D0@@D@j4KhWp -@`HPLp p 0S Q D 0 0 00@=p9pLX0S p@P@.pooY3 -L`HP@o0Lp0X3<0S8pju P-$0 $03/03/$0 ` x \3tooo~oPU 3 P -L 0\ KhS -@t`L~o0 03/p PYoW 0KhCc 0 -L  Q 0 03/0S -L$MPke@P/ K0`P0$0(0 `0 03/ 0 $0 0008i/  p 7/0P@4 K0pK 0 `p0*8/0P/0>088 8/0P,0 8!8/0P008j/  8/P $03/(<03/ 403/03/Ae@XA 0-PL@ 0 $0 03/$03/(<03/40, 03/03/K0heb"}P0@-h5h 0L0\ %%10B L0%)! %C1o< Q Q 0@H" 0@_MbCcCc;XA -L\M@X lK 05K0lK$0 K6$ -`0L@$0 3/LPU 1SS p-L\M@P`X tK705KH0T@9C>H0tKX@ ,0 P $0T0  Kp -L\M@X lKYAZA+ZAMZAbZA|ZAZA -0L@P`*0) ((댐匀J0S V +`(VT(2"<( (($Kk(ZAZA2A,AA[A1[A -\0$ L@R0)00+P*0,0 KoOOPVP(!ܔ> -LXM`Pd@ㄐpX |K<0|K6K`` 4 [P ?o\ 2?@T<00P0S\00$KC' -LhMQ @Pp0@4`+N+ B0X |K@506K040 0|KS80 8P T\0`@ @p 40 >]AU]A ]Ak]A]A]A]A]A -P`@L v 0 <W P= PN0 00( 0DH1 rw @r Lm PXh `[c1 a ,0 TLVX0H!2 SD!D1 6G `'B``Da H:H#P  r, @6' `'"``Da H H L PX  `[ 0 a ,0:T>]A]A - 0LP@5  p d` hX lP mH n@ o8`p 0qa t x|@!Rj\"\"4"4"4" ` dX lP mH n@ o8 p0 q(`r sa t x px d`s hXn lPi mHd n@_ o8Z p0U`qra Nx $"^A -LlM@ddpK$X K0K6K< P*蔠K 040` ` 0 S`h0&hS `P  $0'P 0!v$0 03/4Pd`KU(K00S00P080P$0P8PX$X K 06K0K8h0 0<0 PK 5P 000 0  PPC0^A -LM0000000 KF^A -LXMP`@dp̐̀X |KE$04 01`0 0 )0| K6KpP$ \0  T`0|K6KL/o"/pW<T0$KG' p-L\MP`@X tK L0tK,0 0X` 5K'00P0S $0P0T00Kp2W -L`M 0@8 0 0$0 0 03/B$0`$0| KPP 0 R0 0Q| KP|0Sa0 0Pc>0![$0 X tK:0V5K10X0 ;tK,0 PPP0|0 0 03/| pPP|0p$0 0a P| KnP|0Sa0 03/dx K PP 0 x0 X tKh20,0 0tK5KPPPP 08 0Kl>^A 0-LXM@PX lKH05K0lKPP $0 fK02 -LM$0@` ,PP (KPP 0% T1p Wp!04Xa  8/PP{$0 Z 0KĐK0 00*:/PPQ0K08P0 5/PPU8P0P0 5/PPE(Y 0 9/X K0 KH0 0D0 @0 7<0 306K$00T0 PP$0 ,X 0 008/  03/UP P $0 $03/ <03/ K403/U Ue 000aU|P xP  < !4  4K0  0K (KXP$0% # $0X Kb06K20<0 0 Kh0 P00 3/P0 0  z P1Sx0T1 R0W0 S 04pW 7/Pp 5夐 8( 0 $  0KАK0 00*@:/pP0K08p@0 7/pPd4p0p@0 7/pP(Y @0 9/X K0 KH0 @0D0 @0 3<0 06K$00T0 pP{$0 ,X 0 0@08/@ KiX1  0K(P VXXy P# K 0  P 08 0"        R 0O 0K P 0  P000 0Ho@"##0婒T11Y0 3/<pP@JTP lP $09 $03/@ <03/ K403/WQKV K nK pcK K KW p0{בpS2 Sh/&TbEw @X ;Y 6Z 1/U7pP Pb h&87P/\A r^A^A>^A^A_AK_A[_Av_A|_A_A_AA_A_An_A -LM@p`040 p]$0 p0 P 0 PPlZP4](K2 0P 5/PP,0SR$00O @Ÿ ,S000 00, QP}#.4 W0 0 2"14 0P5/PPh(0S 0 0 00 4P9/ 40P3/Y  Xf 40P3/Z  X]~X0 0 !0< pP7/Q Hp ZƬ 8T 0(?pp1  P ! &0pH0 0@0 Pw 0 (K~>~d,ccubA0AbAbA@bA@BbA%AnbAcA"WcA@_cAcA@cAcAT"/G-MA 9090:0; 0808 Qar᠃0000LS \!0 1\Ѝ\00S @003@ @D 1(0=0@00/d -LL 0S 40 Kh/0S dcA -0LL \ d Kh/\ 0dcA0/d - L@0`S P p 403/d V00Kh/0S QddAN  0O   ! "`"Рo -@LPPL0.  `@@Dϊ(00 Kh>Cc0`0! $0 / cd 0(0S 0@o/d@0 "!/ 0-L@n  PPPDUT ʀ0 ! 0$ 0D@0dAd 0-L ! Kh 0-P@L|(P $0hP$0 ,0KO  R(,0`1S00!0ddA" c 0-L ! Kh0$/d -d0dPL`q$0`Oo@dt$Kkk1,Pf10, dP2/ cd - 0 !x0\ Q    D $ `10U   d c 0-0L`APf0 c 0-(0L`A0P !10 c -LPp*n  P00US\0!H@a10,,q$0`11 0,dAd c 0-L@n  P`0,  DRQD @!0!0,1,oK0hddA" 0-@L0dPH 5/,0 K0h/ 0-@L0dPH 5/00 K0h/,0P 0 Q>0//d@ P- L 040 Kh/00S GddA P-0L  d Kh/ P 0,d"eA -LMPp@p0000  ` 06/PPXG0La 2/y/,, 0 4 8 < @ D H L P0m  P   O R0X  P@Kh0,0 0@KhcFeAYeAdt"oeAeA 0!< 0`4 0 (   !/ cd dd 0!< 0`4 0 (   !/ cd dd `Q-ROB@ALMP`U`V  )21@ 0180 l  P@ `U0 0`p00 00TW(K@U 00  80 @Z Tp≐@0 `1P40 ڞ 2/`Z4|eA c 0-LP @@@@ol  P`@00/d -P`<1_QL@0`AOSp _Q`AO_Q`A L _Q`A L_Q`AR 021 pp0 0A000S$ SKhFdeAfA -0 @`LR_T`DPPC0PpD0sP_T`D@8 Pd -1xP`L@P| h|Y9d H,0S 4mxF0 @0`,0Vp0,!0 w B0!0Y00% Y Y _V@OOA V0h  S_VO   _VN @d:fAifAfAfA"D" -1L`@[0 p R1 /   , _T`DF _T`PDRRPCPQP$B@  A P% _T`D Id 0-@80_QL0`A@Cf0d (0_Q0`AF#kd (0_Q0`A I#\d -PX0_P`@@`BB@C@AL0pS0  Kh@d (0_Q0`AR#1d -1L@`1p`X_T`PDRRPOPQ_T`@DBB @L@AW#t#T#t#t#`#l#  ,Ko , d cfA 0-LP@0S0@0 @p -LM`P8` `\00p(K1@ 0P  8/P < K0( `x 0t S &BS@ L S  &S៳0 c!gA @p@$% p-LMP 0|!SN &BS `=\!S= &S0Si  P0A 0SiA1  P@`p4 0@0 ဵ0P` K ` 6/P@0 \` 6/ 0` 3/Kp0Si\@ X00SiD@ @00@  @p@@cHc`cc(cHc`chc/!/!`!//` `! /!_!_!`!`!`1/c 8!0/c#c4 4#1/!`!`!$`!-`!5` -LM`P@P000@00 p0 7/0P P  d`6/0d` 6/KhAc@gAYgA -Lo 0-H0L0@ !0 4P5/0 , !0c 0!< 0`4 0 (   !/ cd dd\ `P/0 !`8 00 (  , !/ cd dd -Qp@L 0d`6/0 `P0d 8/0 48/V*V00U03SV010!SV0`4P 5/ P0d 8/ P cCc -0p@L0 dP5/`P Pd08/0 48/V*V00U03SV010!SVm0`4P 5/ P0d 8/CPHc 0-\0L@/04P 5/0 00dK0h/c -L M@0\Q\a\!@00/h  PD p8 $m p `0 0`0.0` 00&0dp 7/0dp 7/ 0 dp7/0dp 7/0dp 7/0`0 KikcddP1CckgA ## -LM 0CL0F0@l64&0S 0  PP@V :`Fd0 0S B `FVKcQY' -pLP@`0!0 48/0dp0 7/0dp 7/0 !!c@B -8 0L403/d`08 6/ -0` Pdp40L@3/ ;7/0 4P5/`0@ Pdp403/ ;Kh/- 4/14/-4/-4/-4/- 4/-$4/-(4/ -L@`g -L000C`0J0 0<0S 80S S <0 0Fr0 80RT<0 0I$0<03,0D00  J0壀000 0@0,`0 000S0@0@0000L0@GPPBEQR0<0 E8  P(K8 @03/d03/00K4 KمP0 L0 0R0@ 0PZf$Q <0@ 3/ R 40P3/?0L 0ccdc>cgAgA -LMP@ l 00 K 00 `".6/`P #00!01@ 00P$ x 0 0dp7/P1 R `, K  P (  K,@$0|@4p80$00 4 < S 01D0@ 0S0009Qd  ԗ0000010C? 0(0K00( 8/,,0 0(000 it, gAAgAt#chAdA ,1A - 0LS Kh0 0- 0L@S0x K0hP /P/ -LNM`@pPJ/QKV/ V00000 ᧡`P`KKKMP  @! QD )hA 0-@RL 0 0R 0R 0R 0R0/00   (0 00D00 4P5/ @o_W@@W@AW@EW 0-LM QϠ\@D@_RD @@ ^   4/K0c-0 4 0/-0d / 0-L M@<0PzP R \ R *R!SH  R < &    q D @ D<0  D!)LT 0 P\LX`` 4 ,PP@\P Q  R QZ<0ZSM(K0::0C: 0S ,0S \ 1 !10R !0X4H << YTLT XP0 HLTP0 ,Y`@` X\ 4 ` B X``\ 4  ::0:0 & P -@`qLp⁁::SY20LR M"L"80S0p)b  P  d0%S  DPQ  -LMP4  P p0`00 400  A  !0 B80 T dca  P  &  R Z 2/< ReZl 80 "LMLbD q @P Q \Q YU  0@s S"4AQ4 Q#, 8,\ ,0@8 @8  Z 2/ p00`V000 s - ( #(K ** * YP qꂑ0S8080001@gDhA -L M0pS@` V(0S% 9aP0  P㐠 U(Kq000 S0#03 0 a  P0  0P @HS -LM`p@p0000J 00 P0 5/PP l(K胟 pL2@  @X`  P ("( 0 00 00$ (0,0 0S3 ⓼Un0 on2U]L^M]2L2PUP*00K0 PPp008/P 1 040K08:8/0P =(:).  p 7/0P(4 P:5/P<:40 *΄ PP :^40 ` 01q ʁP”uhAYeAdhAhAhAiA$)#40P 0S/0S<0//d\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd ddhh -L M 0@(0C*s` K1p0d0 (K `P(0T`L0$0P0 0SQ (0Q (K,`P40,p``X000W\0Q (Q0<00D00 87 H0R0 R1 0SH01H0WH01H0pp 8 p 4\001@080@@0 q #4  4 Ii2H02,00@008000@@0 0呃%40040d -@ 2LP/D`q@pGW$KkB0@008 S4R p 0sj S"40CS4c  ,00W] ,@ 0S!, 8 , R 0,0 000001  @ 08 08 @@0 ?08QR8 800 ЀD>XD< :RD01 "0D20LML q @0@0 ** * Qd1iA -X2@L4P\d 5/dPX”\0d`0d 6/DX2\d 4`6/X”0d d\Kh/' -PL<@PPP X `"R X2\`6/0`2 -L MP`p@0X20`rx0`*X?0  0 8/ P  Ki0X”`2(P\5/ ^X2d 4P\5/0RX”d 0dp0\7/X2d 4p\7/X”0d dp\7/X2d 4P\5/1X”d 0dP0\5/X2d 4P\5/PGX2d 4p\7/X”d1d dp0\7/X2d 4p\7/X”0d dp\7/X=dph \7/X2H 4p\7/X1dp \7/0 P X2`"\P5/0`2 P PX8 ! KAJA'`&liAiA# 0-LP@]  PdPp0000/-0*T00/-0 T00///- $00/$00/ 0-@$0L 03/$00K0h// 0-@$0L 03/0 p-L M>0 `B@ P  B` 0ŒQΌ Q @0T00 P05/P  0 KpiA -0L@P L00T0X 4`6/T0 d`X6/KhiA -L,M8 x0P d0 S S04 00 pؐؠd0S (KS CS4  C0 40KA(0@8`(0`03/PW 0@@0 ` 0.P  piA?#iA 0-@$0L 03/$003/0$00) 3/ $003/$0 03/ x$0 03/\XP$003/P0}PU03/$0 0 N' -L0P`@ f0 0T @ ` BT0 0Kh/ 00-@L H T 0 -0L@喻0!d:/0( 0"( `0840 3/dP? 5/00` 40 3/``40 3/ |jAjA p-L M`P3@`0000 `0 6/P dKph0<S@8008000@ 0$0$0000Kph跨jAjAjA\#]# 0-L@P 0SpU  P<00000\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -LMP`8@@ 0 4p7/@ K 4K0p4@ 4/0@4 8/P?0'0K$3$F@)@K@4?0(0K0+0K204 4K,0K0@ 1 -LM@08  dP5/ K4 K'0[) [+`[?(0[&*3?=0* [0PXX@p04 t0`40,`[ZVbn`RPp0d 8/0d` 6/]\///- QP0SP0@00d$ /kA Q/07kA -0L@4P 5/ 0`( Pdp403/0( 7/0dP 5/P\`\p0 48/ U4$KkVPU80 CcikAokA<0S 4//D0S 4//@0S 4//80S 4//\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -L@`PT0( 0T0d`6/Kh -L@P`T0( 0T0dP5/KhQ 0-@L(P H00H00P0K0h4e -0@4PL, 5/0P4`( 6/P PP0S   H0_ P0@0S P0<0P0H0@$  P0L U  P`H0p6 ̓,p0< 4:/< 403/ X0L00 4p7/pH0p  p<0 / - BS  P)H0 0S%0L0" 0< 48/04< 9/< 403/2$p 4  (p,pLpL0S@0SH0<0S  PH0@ $ P 0L00P  PP0Si  `  P0L H0 P0<0P0H0@$[ V\N \PHV P` PpP X` `0HP0H0@% V P0S+ڵ`P ) Y%0T,0T0@ 9/`F0`F\T0 T 0D 9/VX0d`$ 6/@kA -L@GP0d` 6/0d` 6/T0( d`6/L00L0I -@L`$TP T FR  P`@@4@ -L@P `T /R* Bo0h TP@0T /0S  `!@ l p0d@ 4/0d@ 4/@&kA -L M@Pu10 d`?06/14 d`6/18 d`6/H0` ``` `@`0@`SlPaD0P000 埍Q00  (0L0 (KorP d:/0d :/0d 8/H0<0'%H 00`@,0  00000040P L0L0H00H00P0$ $00000(0xQ  P $@ T0P `zL0PP0L0@`dp0 7/p0 d`6/0d` 6/\``p`P V0B?o20SP0S<00 ~`FkAkAkACckA -L(MP@P4r0 0P 0 P05/pP  p$K*0"P 0P P5/P  P>N?d0d0d2d2dh0lP  P;<PH`\0`P`O$02P0P 0 0@0!`0P00  0 0 P0`0 P0$P0( 0,`1,P(0P$l> @$0`!`$0P$0$0  $0  $0 $0( `$0,P$00P$04 $0 ` <K^08@ D0 0@0 040 d000 h0,0 H00(0 wP  PH0(00(0  DK寰PY|mH0P X$P TlAAAjAb#lA,L N:lA@ANlAP_#DAjlA^#aAclA-P0P ?R"0/ -@PPL``40S00  R  Kh40 -@L` F@|PP 00S `p4@ T@  L0@0 @`VL00L04@@,cd -l@L F@XKP``]4@L0 T0 L00P0T040L0,c -PLL-@`T 80`pPH09400Pv4,c(> -PL@``P"4A@ PpW3#@Y4,c 0-L0L@ P0S T 0P00s00`RT0(0C d8   h '#L000d\ `P/0 !`8 00 (  , !/ cd dd -X0L@S`P0XPȢ p0 0!\0`!TP H   ! Kh@cd cd dd 0-P@LXP `0` 0?S5{D0 2 03/P0K0hCclAdP) P P- P /P P/ P  P Px/P P `P\/X/T/P/L/H/D/@/</8/4/nAlAmAmAlAlA!mA@mAcmAmAmAmAmAlA --@LM,  KnA'A -L0MS@ 2R 0 3/cs2LKH K03/P0S pL 0B S񟗎x#x#y#$y#`y#x#4y#CcInA -@HpH`L`P2T2 0 ezCcTnA -Lp``P@11W 1W 0W% @|1W' 1C7CW2 03/@P3 @@ 410S-@ @ !000@ 25 000P0S#@ TL0|0 cR(0B,dP00CP0|0$0S 0 @@0 0 0@0000 @,cA @A A(@ZnA cd Q-L SqnA0( o( /d p-@L2!! Qi Qj QQ CQP,$  R C$ R0S,0 0,00$0$ H0(0$0S2@ KDK03/203/2 0< K3/P 20S 3/`P `1X` ( \0 00 t0aP 20S 3/HKpAYB cd{nA`nA,Az#nA 0-L@PP " " " "K0hc -Lo -L@`ҼPPH@0000081 G6P Kh@AA 0-LP@PD60 -L M`p᧼K?0PS'0AT$ 唐0S 0s S$0S08 K\80 $140 (100 0,0 40K(@ $@T$Kl(6#yA 0-LP@o01SB 4K0h R $ R $ 00oA 0-,0D L,@ 04/0@-01,D@0\ 0@/ -LM`8P0ApT <1S 0,03/00Ņ0@D0ŅPeANoA2A3?A p-LAM 0`QP @ @ 8{G/K< 0G/KpKp,AuoA -p`@LV@0s5 S2 r/ PPE_oRP! Q P P Q PP Q PP Q P Y U @`FPY P 9/P 0-@LL000K0h/ -X0L j(oA -L6<1 SyA -LM(0@S `,(0~XPP01V PPX P D ARJ:@ PE,,00@@D  BD H0H0L ]M YN UO QL0P  BK(00   C ?(000Q?0@  Q T RC G .X00X0 K0S 0,p  8/P H 0 D  p 08/P 0  2/$*!PoApA -(0L@S `lX 01S 0S P X00X001S 0H  2/ 0,  2/KhX  D  BQ:@ Q0oA -L MpX0@P ` hw 0p 7/P  0L0Q0CL  RL 5P SP0 K pA 0-X0LP @ R00K0h/EpA -LMPX0@`p \=T0S L 0 P P 5/PT$0TKlpApApA 0-X0L@P 8T0S( 0 $ 2/0T00pA qA 0-LM@pP`ᘡ 0S 0S$0ø0ӓF&@`0SAʨ0S: 0 SF,0㓆&X3 0 , 2/0 S03C SQ P 4 00 004  9/P$0` 0 $@ 2/T (K 0   9/P,0 0  2/$@3qA -pP(@L` 0S P`0S 0 P 2/,` 0 P 2/$` -LM`(@ 0 Sp 0 SḀP+$04X@I%$X$K0 !pP$$  0   p 07/pP,P0Sʨ0S$ 0S ,0ԀLE), X 0,  2/H#4 -`@$p(PL 0S @,p0S 0T!  2/@T#4@ -P@`LT6/PP A(@Khl 0-@LK0hB 0-@Lh"0 01 0!0!!01!(1 1!0(10 -P@LT0`P"@q" -LM0@Spb S S S 0S00!S  SW (K"S S0S00001I0S 00,P5/1 00,P5/P`1UV 000,9/P V1BP`00!01P0`!BP00S 00,P5/ 0P0,`6/1 00,P5/ 0P0,`6/1w0St 1S 0s011S 00,P5/1\ 0a0,P5/1SO 0SL0SI0S SDPB 00,P5/PPP 0pRP3U`.W\p*P( 00,P5/\ 000,9/P0S 00,P5/`` 0 S:1S 1 00,P5/P11 PVP1P X0C/6    000,9/!P 0 0000,:/!Q0 P 00,P5/aPV 0?@Y C `P C/<011B/X0`1 a 00,P5/P0000@000 000000 000,8/040 080 0@0 00 P<0 40S  ,0 3/0S0PPSPPP80S5 0S3 000,8/0 0000@0  00n 000,8/00S 0\0<0 0040 0P80 0< R@0S4 0S 000,8/0=@00@000 0<0; 000,9/  ,03/ P00`0D  R S! @Sk 000,8/00S01>  X!0C/NP7X<0YF*  ,0 3/P:8  ,0 3/P40SH S40080@S fS8000$0(0<00<0 _40 S? 0S   ,03/   ,03/   ,03/   ,0 3/ P  ,0 3/P   ,03/  ,0 3/P80S? S   ,03/   ,03/   ,03/   ,0 3/ Pe  ,0 3/PX   ,03/  ,0 3/P?0 010P0 P00 000,p7/ 0p00,8/0P0000} 0Sz 000,p7/ 0,,  P1+  + ^ 000,`6/P00 000,p7/ 0p00,8/ 000,p7/ 0p00,8/P"  1040 18 > P  0<0 0< R40S400  ,0   4 R; 3/40P0S1>   Z㰠  Z,0    M3/ P80S800  ,0   8 Rd 3/80P<0,0<0 4 R 3/  ,0 3/3/   ,03/ @  ,0 3/@0 Z 3/  ,0 3/3/   ,03/ @  ,0 3/@0 8 R 3/  ,0 3/3/   ,03/ @  ,0 3/@0 nKqA -LM " 5}OK    0 3/ P~?K0>K0@`; 6/P 0 3/@$1  1 1 1 01 0@2 1!7Q01 wK23/P5 0 3/@0}K 3/(K ,03/P1 0 P ,0"3/1  CR @##############ح#1~oK~K01 0 3/TV 2 S2`p02 2"S}?K0; 8/11 11 2B S1001 01 02 ,0 3/P (,0"3/P !,0 3/CP!,0 3/IP!,0 3/SP1!@001 OP!-0C?o2 2 ,03/!@ ,03/!` ,03/!d ,03/@<@2 1!001 P! ,03/!` ,03/!h ,03/! ,03/!p ,03/ "Fh`V0SpY2pW 2x_,0a"3/pP @♥`Q!,0 3/ 0 !RV wK23/P !q  ,03/@o!q?K  ,03/!  ,03/!  0,p7/2"4p! ,03/`q?K1 @;@2"SSgڂ1, K A T, K }?KT0`p; !8/T1001 01 202 fqA -@LIM.MK⇜ 00 0K/0  $!(! 111 1014!(M/Kp0>   K# -PL@  Q4R( R@ְy`t0S V o`kVg忰(1$!`0aVKO0S屰 ,KoQxxN奰 `G0 S1ꜰ#Ȱ#а#ذ#### ###$#,#4  0@T`!\0Se0 0S S 0SR0S dpXX R^Q @<0 ,0 0 0 0 0  0@ 0 0  0  0  0  |Audq RQ  A$ Q AQ }p,{qAqAqAZA2A,AA[AsAqAqA1[AqArAqA6BqArArA!rA'rA5rAErAdrAprArArArArArArAsA1sA'sA,sAAsA BOsA_sAnsAysAsAsAsAsAsAsAsAsAsAcDcsA2A,AA tA.tAؗ> -(0!`prL0@?o20S !r0A?o20SP(h%Q =@P P Q 4P(j%P> 0-P@L 0 P@HT00 -Lp``4@S@ \T(*|@P 0-0@LD \ PXP \PP X\(0X40x% 0-@L\yX\0X400S 00CS00// -L0M`QP@ \4 -L Mp\ P0`h06*U(K@0 U@1K#XD  $T09/pPE P 0 -L Mp\ P0`h06*U(K@0 U@1K#XD  $儐09/pPE 倐 0 -L@`4PS@%.@P -LM 0 R\0S 0 00PP00 K\> -LP|0@`V PU 0P  P PP (d"Te% -LM`Ἣ@$` 04 6P  1 P (Ko, 0(P000B>40 0h000 0S(0(40,40p\4F>00 9/PC(4Y, 00 0p0 7/Pp@0\4D0`4Y0ST!0h440L00; 9/PH10D100:0 0P0P  0  @00P000l0܌1pP0<00 0x0 0?0ag0 $Pᮙ)04(KX(4h444l400A#,#tAxxAxA#p#\>#CcxAl#=uAxA0S 00CS00//0S Rʬ  R 0%*0/ -LêJ(2`SP  mPPTQ $$O -@= LS0@  P``6/0 f-=R B 0`6/-0 8R B `P#85/P 0 f= S @ `PA05/0 fyA -@L$M`80 P *0 SP*0 SP*0 S 0K☓0 0K⒓0P< U*0S X `08 0@0 < 0FS2(K0`p d0`h0Pl0Ut=S3: 8t #8:/= S< x 0`:/=p`=S00> 0| 6/P 0p4 8 `8 V< V V V Vt Vx V|@ X* $X S B= S3: 8t `#8:/= S< x `0 :/=p=ppS> 0| 9/~ 0-LM01 0 Kȱ>0S  0S0?S00// -LCMPpᚩU@$b 0p#PT  PP T0T=P 2S P0 # P  `ԢԒ0 e-=R0 ( 8/ P =' S  ` 08/= S  `P28/= S  `,28/= S` ( 98/`VS  ``06/= S  ``06/= S``  06/ 00`` 6/ha-=R0 ` 08/`V= S4 h ``06/= S: t ``b06/= S< x ``06/=KoK@=S0> 0| 08/0 SW0p J?KlUPOi(KsTQ $T]}%?yAyA#E`> -LP@ᤨ`p@ 0`$2  P H$Kk 0( 0=  R R " R pW-0R @ 9/AP rpP0}\=F \0S`h0P  $Kk !P $0(2 A#tA#AyAA/00S0Q."0/$c 0-L@- R0`0S00`P0d\0 0-@LT0 0-0 0-P@L82S0 0S0820; \003/ 0-@L003/K0h& 0-@HPL0S00  R  K0h0db -Lp`ʧp@P-0!00PEU00 0{P [PP2S~`003/H0S <Q0Kh{AA?{A/{A#@{A$c## -@PL}t 08"f<"iP` 0S ``/ Q<0Cc -@AP`ML(  =(4P <8`4@0`P0 0L000 TPpP`!P Xp`\Pd0P t0 0p00l0xpiPP  PPS[| K $0b%0P(4d]{Ad{Ak{A,A#v{A#{A{A 0-0@L$0P @TK0h%cd -`PL p@TG@T R00   @0 3/0 0  -L0M Q`P2R 0R @B 2R4! @s傗 @pT@l2V t2V0 =`X2Vb 5V0 0P  N0 @J ` V0S  01S V? 0 L0 L0KD0 0#K00?00 41D0H` @ ,0 4` 00SD K@PX!   1  6P@ @V@T 00SD K@X $K0 C~Rt 0aV @ pW _x-W t0 0$@d04/P @NTRZ\@@}fcdcUU@Utc$$ H00- 6PL @(P 0@0 @0cd$c -@LPTT0 6P@`@0P@H000Pd? 0-0L R@0p Q  @T@ HP <0@,zP 0S@@$ccdc 0-@\ LP &P@ <vA@ 000S$@ 0d$cd 0-P@PLP Q.05(S0 0000C00$c8c p-@LMP,Ks"K /$0P80 P cR `0e@QN@@@( T0S Rb|Zc[Kpd$c -LP`0@S!0S 0

 -@HP0L`P h⻂Kh' 0-0L@S00P0P000ᙂP00h P0 -LM K 0-P00L 0@SV bR 0TpSpQ [POH003/Pp000`0S0000S 0000#W0"0`h00 0R09"R dV  P 00SH003/00(pph|A202202T// -LM`pP0 03/@P) 0`H06 ρ 0t@pp00x00㰒|0@H0UD0 HX 0S 00L0P  PL0P0PTXP D00S 3/PP $Kᔺ0P@h#|A# 0-D0L@0S 3/K0hg 0-@0L00S 0_0S  0  00C0H003/80S 008000000 K0|A -LM`0P 0 0K p@P*$0K0 0 G@P$0 00Rp00(00@$@,0\0@@0\0 08< 0PP0 8@<@$@ K0020 $00(00 @ ,0\00\0/ 0-$00P@L  (00 ,0P !2!@ \0@P0\00$(< ,\@0\/Q-RS  \(00P//</00S0/ 0-@0L0P00I0  H00/000/P0S00/00/P0S 0S80a////-0 $ S$ \^0S 0 / -PbL0@ X0PV 9<0$K2K0 " K ! K0 K K 0K KKp -LM80 0 00 K 0K0K0K 0K K -@L R 0l0P$00 (0, P PR2\0@P0\0P`` #X/000/ 0-@P0L?U92 S003/ 920920K0ho0C9292S003/@-0 0\ @ @T 0T,pc0@-8@Q0PU\\0AP00 $00/ 0-0 LRS8 00@T  @R@* c|A|A }A -LEMX0QPp0@00 X0  +1KoKKs 0P01S)![*1[401!0 PX ?P0!p/  B0LR00(K00^!84!<8#8 #?0000!@ #?0000000 0-(@LT00 0-(0L@S0HPw0(000K0h/ -0L@S 00$QH 9"R8 Q, 0b b0'! '31X}00CcMb -LMQP`@ Xpp @ K=2K0K LĠ$K"`K!PK2KK -L M@ 0 P0SK -LM   K -L M@ 0 P0SK -LM   K -LM0  K 0-LM0 8 K0 K 0-LM0 7 K0 K < -LMKAKK1K K 0-LM0 0KAKK0K K -,0LM0 0KAKK0K K > -LMKAKK1K K 2> -LMKAKK1K v K -LM KB$ K 0KAKK1K Kd K# -LM KB$ K 0KAKK1K KQ K# -LM K 0KK0 KB K# -LM K 0KK0 K3 K# p-LM`@PP  (K(40 $0 0$K K 0K0 (0K0KKp p-LM`@PP  (K 40"@KDD!@K2K0$K( 0K K K KKp! -LMpP@`P  0K <0*K)pK2K0 (0K0&@K,KDD0'0K%@K$K! -LMpP@`P  0K <0*K)pK2K0 (0K0&@K,KDD0'0K%@K$K -LMpP`|@P  (K 00"`K!PK2K0$K( 0K K K KK! -LM,K KAB$K KK  K" 0-LMPN@P0K0KwA 0$0S* Qࠓࠃ\ࠓ^ !R R0 -pLMP K`T @P@KP @ 0P ȴ0 @P 忴00 "=-LM0 8 K0 ! K -@LM`p 0P@0 U  K < 0-40L@$ HWP0K0hsCc;}AB}AW 0-LMPK@KP 0St 0SK0 p-L M`SP@Kp$K$K$` $KP 0S St 0S0  R  R  /0 R -L`p P(0 @P @@ <-LMKK1K K K K K Kz K00S/2 ce}A -LP`p@0@T  0Kh/0 cp}A -LpP`H0@T  0$Kk/0 oc}}A0"P/0ἳ Q0-L@ ( 00}A}A}A p-LLM@D 0 E00 FČG0IPH0@ < 440 D0 0@8 X , AL H ( BT0 P0 $ Tx0X Kt0p00@0KZ`P s0d``0h0p0S ݙp g჈Kpl(6}Ax$}A -LdMP0p@PP0`S$E0DF IG0H@ T $H0P `P 4PL0 d0 0H0xP \ 4` 0p l h t PF0 0U *(Kd !R8 # 00S D0 0Y00@0 000<0 00080 000X0 p0  r \Q Sr0x K00 0`0KՈ0P p R 0 `p T{g0 Qd\0hh Wʨl(6}A $}A P-0L  m@?Ahd -L$M( KB$*K' K @͠㌀0`K)K"K`@ ,KpPKP00S0S &0K%K0P,KP00   K 0-@Lt JVx KRLp K0hL -L@P`Pp 0Q00, 0 JP# 0 KP0SED 0$03/0S`GEF0D 4$$Kk/tQ TxQ  Tc -0ML0B4  K}A -LMP @0-00`0 0G F040E D040 0X{@ A `@0  @?0>HGI0x  G/0@@0G @0G, 00(Koֱ}A}A}A~A -`QL@ P ıP $ ằ (A}A -LP` 㩱@ {㢱0-09"RH Q 0?3 િ,  B%# 0TcCcMb~A - 0L M`,0 (KA4,KP'0K"K@P p2 !@P0 0pW@ K L@#@-0@ 40P:PU`S:pW UPU@T\ 0-L@0Č PP00S0 0Q0U:\ \Q T0P: -P8L`P pP @ `PUP  0 P 0 R(PpWX X0 P( P/  0P X 0S:P  h0hR`P ឰ008@ X  +~A~A6~A"~A -L,MMPH @U  q Rp |f 7sP0P` w#R (KPU8f_P0ZTP 0S080P0T0 0078 KP[X=P``0 jP PUp0 p7)UPp 0!Tp0S0#[4R  00CS P!@ K|P[YP PP 0 -P tZ P0TP0ቐ SH0S 0<)0  0S0#[4R0徐#30 0P0S c H0 巯P`8 w pH0 H0 PH0 pGw8 ᤯080ppS.c~A~A -LM`QPp @( KP#0[S K@M0S -p0LP `k0`P @  00 D008 < @p 00003/`P 0 P 0,@(00000400@# -LM K 0-@L00 H003/00  0  00C000 K0h 0-L(M@0D ( E0 80 $4 GF $0 IH $, @ H$ A B  8 KPP 0dP`0K0~A -@L0p*Ac?A -LM0@<Ppq0m00 00b00p`$W3 1n LP03ED I>`$ GF $ IH $ @04A04B04 04 0S004 04`0S0V "4`spQ  1TOd0P rJ~p M2೔``0SV\0S4$K  NR00 R0Są \0B1'<0S01`00 400AQ 000   -@LP V80SP0`P,PP 0ႬTP 0{`Qdu0`0tP nxP ipP dKh_`V8eV -LMp @ᓒT `0S5P00 0Q P0s(Kd01S @0 q <KN@0 WP<K Q 0``0S`P}AZAdA -`XLPP0 @T pW\ ^AX   R} PU0 X @ P W- 0  4 P$ H \\\\\\ ? -L pd -LMP`"p0SGC,㗫Y0 `n`&f`00@P0   00` 6/PP00008`0 6/P? 0 ` 6/P/`06/`P"@Q Q$ PP:P :Q((($0A$K003/<0 3/40 3/ 0 #,  cpd -LM`Q`0@Sp D4@X@T0l0N@000 PpP 0 p KU@T)@(0K@ ;pP(0 @0( @ 0@0R  S@ 0Pp0000S   0 k00S @c*$pdc -LM K 0-@L 0x0  Q$$((0   DK0h>    0R  0pdcc0@-00^ @P0 U #00C0"4  RP -L M (@T 00 4/  ,@TKP/  P-LP@@P U0`u# (PP 0-@0LLP#p !$5(000(0( $0R*R4 4Q p07"0p03/0P'Y0$l3t1$'Xe p-LML@P-dclVP&6@ K|y00S K03/PWKp2i -LLPp`X@P) 520,000 y`,Ko_ -LL@p`9PP) 52 y0Kh -L$MLP@dcV`h3夢0h3Lp֟1 0Q,  F/oW" R 0 0000@06>P 0 00`g -`e0 `VL`  p@0S  ( X.PU&` 0V:L`  p@0S  , \P@ `$0V:`L V Tec 0 ps#p00002`0 0 0V: } {63`@06T0Rmh30CSh3{(K$7`7$Ax2$Cc AA 0-L@Lh30h3QK0h Lh30d3 0-L@LAh30CSh3GK0h4 -L`pLP@d3S $P0 P05/P -L`pҌLP@d3S P0 P05/P 0-L@Lh30CSh30K0hL/ -LPL@p `0e300S 3/3@0303l3l0 L0o_P WV$Kk -p`PLL@[ KhL0g/L0d/L0/L0/L0/L//L0g/L0Sd/L4LtL/L-LlL/L $L cL / -LP㯥1L`30@ 3~3,3c #(c S$Sl l    _̋ `:( 0Lpy $0Lps q0tf38:$45$5$td -LM@LP`ᤋ DG1Y`110pⰆ01f1110g3% L`!0021 2121202L0夂x100 00 q 2S " "  P $Kk0S[`w@0SdV0 0 X08/0@ J0 P|$Kkl@`LT *$K,7$8$7$A$6$?$@$7$X,4AXeA1$NA -L M<L@PT f3S| r(dg60`@ PP\3 [k0  t0  o h30Ch3h3SUBL0 00 P 0  00 L000 P 0$  00 j(W ; 00S @0S,4S)0003/`L0 b 0 '5 T 4JL`(K@Xe8 -PL⧊UL@0`d pe-00S0  S/c -L$M\0pP<0 &0S 0S 00 0KP B[  @03"\D  㓑!808  80 a Vb`` @  P@1 02`3 d800 0Dⓘ(<Ps \0Sp 03/m   $ 0D⒓#70S  垾0Dⓐ 7 R7( 咾  `   `@    }80S  t 0D⒓#<0S   f080   [ K P(  F@<0 0S\@0 $0R PS Nu tP%@P Nx%@(K0Dⓑ!1 0` V20    0<   8` ``V`0FS  |JQ @0 P  @ 0Dⓘ(7<&0jAAAɁA߁AA -LN0@\`V P0p 0S0pZ  F DP 0SPEHⶢ 0\ P 客P 婢P 夢 GP -Lp@`0\P 0ST#$Q 0 @ -Lp`\0S P0E\ #<@T `0S0 PUd Qh 0 Bh `QhZdRd`+A R-L@P KhR`0 S:$PU 0$0At sCKh   0 -L\Mp`ᇈ@Pv`P00Yp嘼?` 0S 0 CR %S50% 8 epP 0S ۼw^( TKs 0S_ 00CS[p5` KhKh0 7`p \p Xp d0 > 0^p[SW   !R00VK0MKT0Ks_0[RpKS0K]0[Q0K\0[P0K[0[O0KZ0[N0KXRp[0SK $4Q0$W040 WCុP 咡P 卡P 刡X pGH‡0\04T KhKh0 8d0 R0[S  P R 01 0b0K0T KhKa0K, K!! R0R!0 GHOd3\TK@0 00CS R  B?. 0&K 0C^0K`KC4]0K\ PI` KPB0S`P  `\P1 00Sx,    Y r r0$0001 0 0`00@0 0P һEY #0 CR Sʠ0 }<@P6 78Qd AZDQBD W0\0  P  0 ᑻW00S 0&0%00 ~Ply(KA'A-AYAeAAbAA*/B`jAA΂A)pI$AA A!AC0CW3 ":a?W0$1- `+L3W 47CW0CWm 1WQ Q Q00 0 SM Ptr0S0 !R 4!! `$Ka|r1S2 0R `8r1S  p x0R$100S  0R0S7` KcP-`GQGRQ Q Q00 p0W0 S EW@ iT`000y0w00 K0 Ip X Q \X 00$@t0 4/\ h5f0K00P`\|fh@iU@pUDUvtnUcc$$* 0R/.R/ : " -LD Q <0Q -1CQ0 >0 W@ W Q-L :0S= Q Q 0= Kh0=A -L~0> 0-@L~T0 0-0 -L`P~@Q>S ~p3O6 d0 P rlP ^:0  0 軄A|d -LM > K |.R! K pQ [xΐ, K XQ [`ΐ, K d.R 0[l1 0K0 K K -L$MpLK P@ja,0K0 0SS: 018#(# 0 R R  0@ T(K -LMp2~P3p@0000]0E0 P៲P KK] `LK5Pf]P. 0 #P. 0 n"P0"` `0"`0 |=0==0=p2 R. X"L5> 0 ,2@ 0 00 ]2P>0>N^0!Kfm(Kt D"8S) PQ@ <L8P4T@S00w0xPs<0 S  AA Q aU 0C <0P84,Sx@S r@80 S 080 40 g@=S `h@<0=80=40=80=.$AA|d? y$hQ-7AIA A AAՄA -L M@K K 0 )PK -X`P𝤀0 !`!800 (  , ! cd dd 0!< 0`4 0 (   !/ cd dd p-L M`0P KV@@ 00 0yKp00C|d -PL@0Sp` 0S000`=0=>S0M=.0R=000 P B. f 00P0PV$Kk|d\A -LM0@P9= 8! `,K100#S> Q=!p X <=``  R gV ]KP gn K <=  0 P  3V Ki.? -P@Lp pg`耄=S2-! 0AP9= 9 =P<= <=  =0S'  g02N0  $Kk[P 0< 030` 0S030$KkB?d?Ccp$ ; 0 /|d0-00 /0-Q00 / -L{ 0 0-@L{T00-0 -P@`L pP fVsp@P }W@P @U -Lpi{,`@\00P P 9 UFJ00CS0 <000ܲP ǯy0S  (0➲PP h=0P0CS$$$$$ U  CcT}A -LM\ (8#800 2P K -LM( 0P K 0-LM0PS @ X P2 $ B$% 0  P  K0hK0! -LM`V@P  0 p 0 (Ko/N- YH UV0PP@M@LN@E$Q E(R E,S  OT W %f000ĐȠ0P`Ԁp`00 HaP (Ko(KUSBCc 0-L@zP p0 0S $00CS (0S SPS0000 -LMP`Up@ 10`0` 00%P&P$00'PS  Khm *PK -RLM@P  0S  KhP0 CRꈋ$$l$$$$$X$$U Kh000S 0 00PKS  e0 000S 0 U U0Q 0Kh{0S ]eU y0H#pS@c`l 0(*0 0CS000000g00U S0 0@  hg0 4i 8j <Ÿ SU0Bg0S0ih0j0 N0ML8 40kO<#l##0Pk  6Pc000 -0PZ  %0PR   0P (ѩ &0 PPPLA(A-At?dB1ACAVAAsAAAЈAA??@AAAA////S1<11 0111@011/2 -L0M 0-0L@0Pq=0SZU - U 000 00P000000 -L@0P@0000,`0000g000H0@ DaZ00CS00⤩謏>!$B 0-C@Lߊ000 -L@m0P<00,`@00000D 000-000jL0@ H` 00CS00jY訫$d?̱!E>AP/ -L M@l0 R 0> P P K ,0RP 0S |?! -LP@`0S '`pg`0`' p-@L MP`zT&@PFKp00S000 D 0-@0( 0CLR P0(00(0C40(00 00-LM@P0KVP K040KK0 0 KK PK0KP[ p-LMP`@9PH0 % K2K0" K!KKK% K$K `K0Kn`Kp@ 0-L@ _ PU+pxΡH0~$  & ~H0  {  K0hٗuA' 0-@LP  K0ha -D0LM@0 0K KK @K0K@K P[K -LPp`@ %p@ (l_(JPU<P& -LMp`@PP 0 (0K"0Kx0$D"K$K( K '@K!@K 0  %9 (5O(@T<K@& p-L MP\@S`X{ 00  R= 080#80C?o2S?  008  ,0 00  R= 080#80S0S @P H0 0K Q1[ 0o>Kp -LM@`P0CpL40 00 3<3 (Ko{ XBT& А0 80 `P80 C " Q ,T=,K>S X" C@(@40K0 S@_T3<3(K -pLP@P`;3@`7`^,100 S`4V3 %  (`cH    S 800-0SL@];n0ϖo -LMP᠂ ]H 0H00S 00S 40S 80S\ᠢP <  00 S0  S8 S4 ``PА k #g#EZm `P!@X@A`0 0?A-AcAAA͊AA AP/ -LeM`Pmp@ ϡw {2P p00(00,00 0$02@ 00!0  vP0H0H" X 0$ PP *,0P ! EP! 0 S,0 00,0 00SP 2 -t 1XP ѡ(K40 R 00S 40S 00SH  P4    R0 RR4 ᤡ40S  0$<P*0 @0AXlE0| #k/KyPk/K@PA-A$c?-ABAUAAAyAAɋAdًA p-PL M`@~H0 T@D T&@PFKp0 00 -LMpH0`( 0CPR@@0H0 ([K!(0 02 00 lP Di@$ 001 00 XP 0i@   ^  @P iX忚  N CP P s  00 S0  S8 S4 `00T000 `PPW @Tc080Kd070K[880h \%AA-AcA(AAAMA ?rAA ?A?AuAAAA -LM@3p 6006S\ 3<3&  & (Ko606XbVc080 P80 . K - K"[((R  ZP  h05 >TZ  ZP `3<36060 h0 08 #8& -LMP`:@,p.P@ ,P0 ,0KT0( 0 Y 06@  Cns@ K 0-0SL]ϖo p-L MP`:h@hP  c00Kd00K1[88ཁ0h0Kph p-@LMP`T D00K00K1[R !<0 0 0 >;5H0:H0H08  "KK,0 Ġ0K  0K 0"K0(̌0 ̌ 0 Ѐ 0(Ġ  0 00(̌0 ̌ 0KH0 0 !0!;H00 9>  9>># 0 0 =@$K0 tT0 LU0 LV0 Ek05H0:{aU.*a 0-@L|PeK0h -L$M`RQ W<0 O <0J>0K< p3[< 0?0 <:Q00/2zR0Q00/2qR0Q00/C1hR0Q00/2_R0B 0 p( <0pS+0 l  0 p< H0 p 0p y(0p s 000 h  pH0  0 |[p2 pQ  R"Q00/2Q0$t 0 <1 pQTQ>K0 )Pcp3[ᬡB050 hP 03K3[pW0H#40H00 H0 0% 150V0CH0 0`2H0 0  @ <0K< dQ00/2Q0T  P t嬒@?A-AcAA̍A ӍAA  CcVUUU"`A`A U0$AP/ -LM0   P  Kd? -LM@Pp`x U 0l!l{&$K000?0 !$H0I$I@DH$H0D8#8 S 0S) 00 P2" P$ PS A `10@ Q0@  0*   T0 @0S8#8PU`S B S @ ??A_AsA -p`L M%0(P0CU,@Q00@  Uʸ!U00SQu @u3@t@.0|!|>4@2K0T@3 S!uH7 0 42K"[4"48#8 S2K0 !S  S,0 <. 0S%00000'$ '(  p '|$($L p@0 0S K(0K K &0K'P 00&0K ?A݆ p-LM`P@P$4'0K$8&0Kl0(@K( K$0 %40K0$L$K 1K%@K PK޽0P @0 lKp@?A p-LM`P~@P`0( K$K$0 %40K0 (@ PK1K᷽P( `l0 DKp?A 0-@LNPVP0,00S00  R= 080#8S(!3 );P0H0 0 0S00  R= 080#80C?o2S) *m+f00V tP P RH0. 0 0SD  S< N CK0hHu+H@ -@LH0``PPpn`Ѐl00U+  0** $Kk" 0-L@APGA A@@ ?04 A( A3A K0h? -Pp`OL  0   @T -LMHP@Pp` P&0`00 1 @P SP[ 0-@L_PP0    _ 1}PU-}K0h' -LM@Pp`2T@ @  0 `K K &d `K    K -LMP@p` UP @   {  0 K   [ 0[40K -LM@p`PH0 W  O  $K3  B < 3<38  t0 (0 ,0 0, K%0K0 WXRU  FP =$ K> SXCP3<3 <0, K ( p-L M@P_`meP iPKp3@  , 0$K3@0$ K  0   3 1  C     V PPlP PPP 400-0SL@!0ϖo -@ p  L`APCQR U10 0 -L`@0p\:X 8P PU0 Kh\ PUp}A -PLp1P^:p  \ ^0 $Kk  \*X}}A/ -@`pP@0M 600L(D @  0ᨖK c 0-PP0L @0@8yD0P l1  0K0hܖ0 c -Px0p 60hLM`X@ZD0P l1 000@ 00 00K c -p0 60LM@`P3D|0T  Z 0P 0 0 ᤗ(K0 00 :/p cvd 0-@(,0L(!60DK0h c -`@Pp@0M 00L(C00 08K c -Php 0X0LM@H`C0P l1 00 05K c -L(0M 0 0  M K(%&% -00ML06 0 0; K(%&% 0-L@R |1R00 0-@0(L@!60((C$hK0h> c -L@P`R^ 0 Kh/ -LR Khk p-L MP`xRAT 0` 4/@P KpvdA -L 0-L[R@]Nl1  0> =`Sh 04 / \ `P/0 !`8 00 (  , !/ cd dd -@`p}_L= 08/  t=SuPUԂ<= S8  `P#85/= S  `P05/= S  `P05/ 8 `P#85/詑A 0-]Lp1-@P X嘂> S.<<=0=Y0>030 ȑA?ՑA 0!< 0`4 0 (   !/ cd dd 0-t=L@S0T>P0C>=0CS=>3;3K0h ->L@S`p OPPVt=SP 0Uu >PS蠆 -LM@ !PpP` `(0KP "[R- 2[T  \ K0 B R  , 0 AA -@L M0K@#PPK 0-LMP@p=S 0 5 0000:S=000 KPx=[S Q  W0 :S ?%(?%(?%?%(?%(?%0?%(?%8?%Q  Q K0  D -L4M0@pPQ?%?%?%?%?%t7S -`7<`7=0=d= 3/x(K=hhX K0=0r XKv8 XKr80Z K|e5[!6&R!L%[H~1?001t7GS/( P80Vq G8>0?0?`70?t7S 0 } 0 ,t7S H/oh"-P K"0`P0[NK S 00 80Vq 8BKACcPE%A -MLM`A^K PE@p0#EP0U0C0S$4 K S;U$4 2Qu 5'0CQz  QJ  Q~ p=S#2Q #0CQ 0Q7-$0S$4 0?00P2Q& 0Qp=S; =8 0E sP#2Q >0CQp=/ !QS = N0 ?;A0CS {{Tp 7$4SS$t $$E /  ("( E ON000$4 S = Np=S = N0p=S =N0 :S >S$f$4Sb* L  S 50C2#110L 1 0 $4 B7H0Q 0QN0 N0N0-*  0-L@P T :S :S 40 \ 0 x+K0hp5%CcPE% -p`@P㰠LM000 00U  600T(K0S # 40 8 8  |40{P00@@cA -@L`p=S릟pH4  3/>S.t]U= S`0d 2 :/> EP=0. :^^8X X3XR=3 \=3/p],KoQ -P0?L0M0p2K(0K `@KPU 0 KP0 P! -LM K l0 K -@L`0pPh=3/`7W) 5`729#9 Kh@ p-L Mx-0PR0CS@t 0@ӕn R 3 0HH| <@KphS @0.@ӕKp?7?A -`=L@S 3/`pt]U'r PP `V|~= Sd 2 ``06/= S``h 4 (06/ uP NIA - SL(MP`p@7 >Kx5 >KDK5"0@ K.K -L@M3@@ > Dx=S S6P$)"" 8PP> 1PP@ dKD5^b0Kn U C5@PV0@0d KP3@ > U=;=$K)A S- 1R > P=x=  S :S PPn PP`0 S 3` Q (<S3 #|`h~0 PP` V@p ( !*(##@$00- /h'/p-R/t-R/M -LdMS@\ 3` <3K4`0 Kf KE`bV p 5;PUxK  4WP `pPi 3<3 -AMLMBnK `F0F@t$84 mPP84VT$pAW7 +$ BWn  Wp=  W p=S yz#W(  W30 S  \ RP`p=S`  -4U#WPQ )3W 0W\3WS=D p=Sq`F0@#S0N09 V# BS0N02  S0N0,  BS0N0&"W  W2P0 0G. P 0SPE 540  0 (K0 P P2W= 1W=1W= !S0N0  S0N0 V BS0N00 jP S :S x=S S S@!|0>031 F44 0JP 0 F0F0S2P 9S#PÚ 0P P P9S9  090 $PP ;p=S} > ;S0Tӥa|%F*-? -LlM@`p=S t=S?< hKx0 13=t0 =S >S3;3(K9S7 YU 0S990090C9:0K 02K p 0 P <5 0 03/05K :S@.05K @ 6  xVPUq'W ?:S击PƻU 倻PU 0S000000C0崻&:0K (P (4 0 03/x娊pP'2 0 x弝ᓋv xӔPPቋ5["05K *(0R  -   |0 p ˔ G|0  £D :S㇍ P0S p P  0!:b(+010 0#4 001 0 $ 0#4 0h2008/>p0 p (00D100 0<00B$"C1 :_ KS* 101]0Kt 0>p0p(0."(0%XeG?A -LdMp=@S CFP 3@  = S4 h `P0<5/(K00 0|0 -=R0 ` 0P5/  -=R @ 0P5/<00l0K XP 0+z& -P R" 00D 3/=-0C==0=1 N& n- R$ H 003/00Pd0K P, 0*_z=0.i3;3& E- R$ H 003/<0 0Pl0K PB 0)6z=0.@3;3 -=R  0P5/`t0K `7[h)S  S = S>`P4 8h #85/> 3  =0S P{o0>|00S|0 &X 0>= S`P02 d 6[ :S;6[&[d[80 `8V :S0`e[GPP) pWV0  ^K00< 0`ep(p3p20@@00x P$ d[gʄaI8e0[N8f0[O8+010 0#4 0010 0#4 06[ H80H847 0 $`06/0 *o00R0S  6P 3 #*88S00C88Wp *sᗇp0 0 0W_WTTCvx 8 (#P 0,¡c0[ Sx0 %Px`#xF&I)l`Q  ?p0xPE%>Yc0[`%y > -HX,%Py >0= Ẉ0xPE%>>nc0[ S$V[P xX u u u 8Kd[ᢿ u0S uu'c0[`PE%X\x0 P xI)Q 0,j1p0x`F&>Yc0[#xt > -HX|#x >0= M0x`F&>>^[#Sm Su0 0l0K46[_0CShc%td%c% d%d%td%=0=:S :SY^ `H43/O=0=Kx=S >Sڰ"P? 0>< :S9=0; :`SH4 W[`PEUP#@~ U .>0/000000l0K6[` 06K&[0000x-W[p0 R RO RI2pL p0K >p`fcP: l0K> .>W001>0#^Px 0 Y0 0x06[ 0fKE.6[06[ZK`0&[LP0CX T05[,06[(03[$05[ S 0P0P .xwqDp`P?˒Am?x?̬Xe[?AAAAcd9ACAZA{AAAAÓA -LM@ppX\=3/PP0p= Btox=婒S 00S989=0= :Sh%g% h%`k% h% h%hk% h%pk%xPP ?> ?989x-R9 L;Sڦ_n> `L; J("( L;x},1m 0I.0 H:  )0% n  =  = =ۮ  =  ;S0ӥ= x4 :S x=S> P Dx=S ~G QW ;#| :S 3   q: ; 000======x=SY Sh3h3ݞ =>080 ح  KP& 0v P$v ! x=S ?7 1 &0 0C0S000ӕ ꤢ- R000 ` 3/-iZh[v0>9pk<0.R 3;@030 *:R132Q= S``2 d 06/X  :S xQ   :S P(K@A  -%3?2D 1AA8 .A @I -LP`S 0CS>02 xr'K0h>S 0CS>x=S, 1>S02K0hI[A -LMPp`@P@ Zf@P $K 2V0CVl*1Vv 1V< 9P-09 s94P@4P=Dp=SH 1VJ 17V1 @`0u@P- w4P@&3@* x2(1V* 0V #' Ἦ@P#p= S :S    #-S@70.@ S4P@3@ x=S@2iii8i( c7i -L,M@ LPX < q,"\ # @w=p S2 d `P05/= S4 h `P85/0t=P0t=n_m0 P p1PX[  +I<uq0`,K0(0@ K @` <` J?eqxm4[gQ RBZq0x=x=S4[S:Pq0x=x=S 0@0 <0 0@ KD0 0!d3[[p ##[0|=0`D0 @ K0L@` <` d 3[[(!##[0x-=R1  'SS, 08 KD0 08` 4` 0` P 80[@S60[.S30[-S00[S05 [x=70[0B00C)*d 40[00Cⓩ)20[0C⒑#1 [0 B0=H?x=S<& 8S4& 0px=S |md  d=9 0 p뀝d  P  d) %P0 p?  * *+`5*,0T5`@0H5bD0@508504530::> 0 P s:4K㠠H,0K10S S2 ?00;^G MᴠX0F KP4[,K SBQQr  `RQ"1?0;;S4 x=ڎS0 =  0F KeP4[ d00= -x-R, R RA -#Qb?Ӕ= ڨ#Qژ0=3*Q8<: :<:> 'h pX )0X=_ `@p0/-,-Rj>0=3R:8<: :<:>  :<(0F KP4[S:0: 08 K@0 @0KPn@0Skڸ[y6KY )~X2 =P2=徐ᇍ>ⰐAzPUG89H4"d=T4h=1H41 ;1$;1T410=14=18=1<=8/a= q)1`D8b= h)0`8lH (K2R:;:yH0-=(1R: <:>Q zrQ urJZ%}A?ƔA ڔA?,AA' v'N$oAvAzA A A5AS%o%n%f%F%IAeAF?_eAAu'(O * +  >%n%D?%5%`5%H%1%2%82%M%Xe0N{AA -l=L@S% `tmP pnqEẪ"\"፱b`urW ƱE|tX X}t 0-@Ly=Tw0-0 -p=L@ST=P 3@ -0`P-R2 d 5/= S`P04 h 5/R2 d 05/-=R0P0 ` 5/P = S``02 d 6/X 44S //0p#R" /84S// -L MP0Bbj?0᳐(0 :/43\"0:/(0 :/06. 0\0#0:/\0 #:/)4#\:/(0 8/43"\08/0/08#80 R0003(K -BRL`p,0 3/,0 3/,0 3/,0 3/ -L MPr2,43/p20p2ǭᘥPEx:: 0@00 Q004%t%(%%%@%%,%NA -3,@AL` <300T00Y嶮XRU p ,P 3<300Y,Kop = >W2>PpԮ3<3 -LMpPBb?sp?pp (09/43"0\9/ 0(8/63\p(#H07/\p0#7/\p0#7/53\p # 07/0\p$#7/03S \p0#7/6\p0"7/\p0"7/?<0 \p0"7/\p0,#7/\p0 #7/pp(0 8/43"A0\8/p(p0 7/p<1\ 00!0"p8/Wp4K %1>80 80 \p8   !xΟ̟0XK@=00 K<P1\ h00 P0 0040 0P )P P (P P06P0 0p1i0H10L10T1`0000 00101ᐟ `0 ⮛`P0 0 3/`PJ 0@G0SDA2w c?Add+c -P0L#0?$1@S +P 1S n U1 10 E 101011 101` c -LM$1@S *P 1pSX 010P耔(080 000 3 40 BR0000 S <2"0  `@`00PS40 0PEX. P^ᯞ00`H`V!:1 1`d01 10 11S !0C  !S 1ԕ 0 1ĕ\` 16/1 101ƞ1S |aQ幞1P 0003/1 01 010,03/1SJ 010  $0 0x0AK0,0(Ko/00P`FSPV   0000 S <0 0  =  803/p10101f0 P`R4  PE^`(KcCc% -LM$1@S(K)P  `0 d,P5/1P SPV`0 d,`6/` 1 \Pd5/`0 d,P5/P1 S`0S]`0 d,`6/` \`0 d6/` 1 \`0d6/`1x \`d6/`1| \`d6/` 1 \`d6/`0\` d6/e`0 d,p7/ `V`0 d,p`7/`0p, d8/ 08^`0\` d6/`0 d,`6/0p줟耔00 ` d,03/` 0S  "QP$l0p00 Q04S0l0 l01S`` 14T PU`0p d,P5/`0 d,P5/P0S`0 d,P5/  1S 0 1/P`U 0t dUP!Pl`06/00C00PP`0 d,P5/P ;PU~] 0 1\` d06/`1x \`d6/`1| \`d6/` 1 \`d6/\`p d,03/`0S  "QP l0p 00++\04S l000pHSp0l0` d,03/` Xp耄10110X*101X1011S 0CS 10 10` 1 1\P d5/`0 d,P5/QT1`P%P  b>40 40嘜 1 1PQ 1000001 1 1 d0 1\P 15/1S01010'&ATcdAd 0-L@4K0hE -L`p@Z$!0S !t@S0C0i0@ ,P5/Y0 ,P5/0P,$ 9/t00S "SRP0l p  ! P$Rl  l /cdTc d -LMP0@`0 p0 7/pP pU0\H 9/ `0v UO`8 #88/ 0\8 9/0\< 8/U0\P( ) \0( 8/UP\PC0< 5/0\P4 5//0\P, 5/0\P< 5/ V00H \P5/0\P 5/,\0ES8 08/0\0 8/8 \08/0 \8/F40\ 8/U\` @06/$K -`pLMh@P\ P0 CP 404 l ?( ?`dp\`hP $KdTcccA -@0P`L M|&0K%PK[ &p& K`6% KX24` 0s Κ01@0` 1 1\P d5/V`>P%0[ h Q S'  S  \ `_60S h0\0P l.X1 0CSh LNN&0[S0@0000010CSf%%4%%%$%@%x%000U00 1NP[0  00T[5uA|15P151 ᪐ 0P0lZ$K000PU00@0008U00000 U00000` 00\P0d5/T000` 00\P0d5/T0`0 \P0d5/dM`0 d,P5/P`T`0 d,P5/PAVAqAAAA}AAfAٙAAH?,1A% 0-@PLhM0 pK0 00pKK0 -L@L`0PS GP 0SU00d 0-L$0 ` d\@04/0 0-L$@` d\P05/`0 d,P5/0 0-L$PNᙘcט0 -L -4@@``43L`=#=\p0"P7/2",p7/$0 #002#,p7/0@6600\"Kh/ -4@@PP43LP=#=\`"06/"\`06/2#,`6/"?0 \` Q- ( "(R0#6/2#,`6/2#0@000\`6/"\`06/0\"Kh/ -@L8X0\P 5/2 ,P5/2P,` 6/ `kUP" P @P" bU P0 \`*N6/0 `|p0 `VKhBHCU$P@ 4=U0P,9U#PA@AQA~%~%x?WA`A#mA -L M4  P\h p 0 ` 倠 ,@,4/40 @R  Ud3K0 00 0,P5/0D @(K0 -LMP\h0p4 R0 U 080 140 `@4 TPP(KZ t0S 3/000 $0\8/ J000 ,,03/, t0S 3/000 $0\`6/ J000 ,,03/Z` 80X d 0@@002c40 080 Z 00 vACc -LM\0 0QP5h`p0 @#p g |03/}J00 ,03/p +40\89/ X0P80 40   l0Y 00 $0\8/00 0,,P5/#t0S 3/0\ $9/ JJ ,0,3/t0S 3/ \0$0A~AACcH% A(0,0000/ \ 0-0@Lph0 p-@LBMC^KM PE` { /Kw K40T@KC S c @KKp%0 RT   RH  | R< |  R0  X R$ X T R T %%% >%! 0-L@0\0 !@Q0@000 -Lp@P0S 0S 0a@P  P@ 0-LP@K0h -0L`@hPP 0 \00,,@ 4/P 0 0 0 0h0 03/P 00 0 0-P@Lw0,K0h5 -LM@P1Tp #3 #300 0 X00S 0 S0 (Ko0 `P`(K @L` X 0 P  0 @00T@CcMb>A -LM@lhpP`PP6(K\0u"Pp,4,$0 $4!YT:@<0 R80S@p<0$RtD80S0s0S<00  <0S( 0/KP 0L#Z 0</KP <00 Rp  P  `80S<0Qt0S 3/0\p $7/ @D ,0,3/p<00St0S 3/0\ $8/ &D ,0,3/<0 R@ 8 Rk4Sh@f0!Wt0S 3/_020\ $8/ CX0\ 8/0\ 8/ ,03/XP<0p00 ,03/P@ #>K00p<0pm \0(0K0`0p  80 SU<0Q 1!0 Cc MbNAFA' -LM@\ pPh088!, <08 RR<@<0 #`30@`S00 0 _ 8080$2\ 0 p*Y 0(K/ Y40*p x0S 3/#00 3<<0p 7/3@0300 #,##*0 #tm##  <0 PP0R pBV@L``(P0S9PP 0Q04@库10pᯂ0U:A( 01S ,(P ,80HX 000? H00000 X ? -H0P`@0p@@BX0AL#6T@1@ (@U:P1@ᙏU@D   PDp0(0帄0S08 00PE⏂ -0L@L0TpPX 0 ` m}(0 R%)00 0 a}8SP /v 1|P 0S0  0 0  00>} R P0,( ,8L0(( (80s00aR1x Ax -PᙏL8hPvV @ xT10CS p17W000(0 nP0H ,Ko Q 8!031@Cc&,0S0 0 00, / -LMH0`@8S0 LP000  0|ppA(R)%0 00 0㚏|ᬐ勁p 8 0 8`0 80X0`2(\:/X 0d \:/3X 0300(`2\:/X 0dp \7/~ p0S7ᜁ8dpS40S, X 8S 0 0j| 0 0e|(0 R)%00 00Y|(Ko_mD0 S040 8S PU4pꙟ M0PH  @ 80 (R8004` CcA<0S@ @ @0< / -LM@ o> '~ 0  |8xS``Y`PpP0 {Xp`2( \8/X0d \8/3X 03p(p`2\7/X0dp \7/VUX(K&1?0Yv  V ,,0V 0pS,80,XP4`V oP 0S 8S  A A38S) Y 3( l P40S L8S 0 b{0X0`2(P \5/X0dP \5/ Y0 Y0 0(0DP$0U00 \ nPX 4U @X00C`X00d00(8 S7 >00S 0 |(0G|W$(0S!8Sp 8< S000.448#8C^0:#: P0`4 0#>W(0S0d0k0 0 ( zP8S`1`p P 0 80z$8S` `ꖜA -(0LP0S $Kk=H 0p ( L@  0 z(0 R%)00 0z/d`bsD0S k8,S(0R%)00 0 $Kkz^ `규A -`p0L@L0PW 0T   0 jz0  0 0  00`zAs8S0L0(( (8p 0-P0L0@P0,( ,80 0-P0L0@P00( 080 0-0P0L@P0,(T ,8K0hy p-L M @uPPKp0X0 (``2\6/X 1 d`\6/3P  D8! 0D8lP D(`F<0D8P g8:  5< .<0X0 (``2\6/X0d` \6/@) lQ0X0 (``2\6/X0d` \6/3PS 000S  R BUݜAA A -PH0L@O[~k`~V0KhZ -PH0L@OD~j`~V0Kh -PH0L@O-~j`j~V0Kh -PH0L@O~j`S~V0Kh://ll 0-@L 30330_}T x2S K0h+~ -L$MpH0@O}j~H0`L040 ?@0 }8S @~(KT0s(x2RIT0P@0LP00@0(0x :^#:00 @08 PD0 d@< D0<Sq0P  80 80 (000 0D080x8,#JST0 028S 8,S008@S04,0 #20Dp!=0Q<<1@F8@000 xT0D 4 X0T0X000 00(040 @ 0yx8,S404(0R)%04 0 0 dxb<0<Z0000H0  H800>0SFT0L0 0 0J 8S8S8,S008@S04,0 #20Dp!=0<Q<1@F8@0 00xT0 @ T0 80PL ^P00998Q#8#48#80<00<0 H000  -H0P@2XL6`P P 1pP$ 000`pX000P0  PP |,80,x||,80,h| P 0-@LT08-0 -L08 0-@LP^lPxd|b|x2S 4Q5 ?0*P 0'?w -L,M@P)=xRB :| 6|  僼+40 vPPxp2,t2xE[03fP (0R)%00ZP (0R)%000  vHP (0R)%000  v4PQ_U Pb_\4v0x25S(0R)%U000E031|20(R 0 Pv?U徯_08Sx2 U,04v4<P80 H<  0 W @81S0X0 (`2\8/X1d \8/0X0 (`2\8/X0 d\8/d  ?oXPX`2( \9/X1d \9/\;X (`2\8/X80 dP\5/doPXP`2( \8/X80 d\8/dnXP`2(P \5/X0dP \5/ .cP X\; WP P P PpXp (`2\8/X24d\u 0 8/Xp (`2\8/X4 d0\8/Xp (`2\8/X4( d0\8/Xp (`2\8/X2 d\8/80㿀Xp (`2\9/X d0\9/<04(NC @ Xp (`2\:/X 0d4 \:/Xp (p`2\7/ +XR0dp@ \7/8004<:00 PXP`2(p \7/X00H dp:\7/XP`2(p \7/X8P dp\7/ nXP`2(P \5/X00H dP\5/0 P88S nH~PU0P 0\000X0@X `P((T P%(hP% p(x( (P% (ȜP%( ``&( `&`&( pp'( p' p'$(, , (̞ 0  .0`0 P 00ĕ  ̠ Ƞ Ġ 00  0 p 0Ě  ̠ Ƞ Ġ 00 0 0Ę  ̠ Ƞ Ġ 0 0( 0 !,$ 00$(  "" " " 8Ѝ? @-0 SR0 ,@SR,@SR,@SRS,@0 @0 R03S0x0#00/ -L$MPPp@$ Q!@  TRT``S@a   DKWP DKRL DK M KA0  CR-LQ0  | -oPpLMP`@s Rp VSS00CSgdw&w&*0<1P4N<1! S!!1! |fk,0003/K0h~scUA`dgAXe 0P 0CP@@d!#/  N @@<0P 0CP,0P@!#// ̇ ?0S0-L@c. Q@AD0<0T T 0 404 0 @AA  P P/  N /P PP0// -L`P80@T \P @c 0-xWL@U" (R  BR(13/4WU PEU4WiD73/4W 8S 0CS 8 083/ 8P80 0"0 -L Mv~0@S!P !R 0X"0TQQD@b10/ R U T 0 S1S 0!  S?Vl:XS Q 1V,XhU} Uy,QhP qG vPPQ K0 S'0VlX'e  0!/ R U!VV0 SlQ0!V&R! 1?0l8lQl($ @AA @AA -L M@p1q2 0iP>05/cv^ 0ho00`0S PZ 0 p200p W` 0S2001n8^0 Sd0001c00fF8)j0S00d0Q00@Sg/1!t11+7L`01 RA 1ES  s00aR310@0p11S01(K16 "6&0- R    R    R   "-" R   .R 0  S0@00p8Sph0 S,(01 Xe*A @c c`d&[A0.R  "-" R   vP/P/////-R(&& &D&<&&D&0\ 4^  8P p7S0S @ -L Mp@崠`v>0S4 0!<*P㌀1Sʀ5*@T`(K01 00 P 00< 400U *PFAcmAeAA|AjA -L`@PP8!8Kh10000x7vnS00tq 20zt7S S S0< 00CSp&&&&&&t7Sh8D!0 0<00;0800808070B;0;,!@A -LLMpP0`p0 s@0 p!M@  x dK+hP v>0S71 3a0 xh7  0 xh7  0  wh7  0 wh7 0 wW 4P4t8St7tX4S d0tg6 V rM_N4 R`78`7`78!@AJ0000 000/ -LMh1P c1 R S00*0 0S0:1D!0CR @0@0D10D1! !0 0 0 000 R000 0Kn\0D1S 0S00 000 S D10CD1! !0( 0 0e 0  ̽AA΀\Q:  / AA//// p-L$M@8PQ$1 00#!" 0 0000) `0V :3/P 1 0t | 10 18003/@ H08003/0<0000KpA!@(A[A#@ -@pt0t`L:l0^`婎8`9/0<pp0@PU,0:(0:$0: 0::#@d&D&<&L&0S 00#, QQ #/ "@AdA0S <<#8 \ \ R #!/'"@AdAP0//d -QLM@p`P ڐ1 0|"| $10$1 (K\XQ1I(10(1,"1h1 0O d n/X  h7岐`71 0!Q `W h71 !D `80S0S% `03/P1 0,!D. 벐,10,1W1 1 1h000 8003/8< 0`R*.0K0 K9/P 120!S 0! 0`  W㲐`0`4!S 4!q 0$ P k3[02[0eC"@Ad!@AQAAAA(AޢAA 0-@PL:3/P:3/0 0-@L:3/yvsp:K0h/ -L,M8`@VPpW#1 ᴐᲠql0 0#!"!0 03/P1 0 000000| 101(K \0R 1 < Dk 101 :(Ko/A6Ap"@pAA -LM@`` 1RPnP1U`S^1 l0 0tt1 7 000PK08 RDD" 0 RppS`7p0pp 3SH0L RP00H0 00@Q&@0 00T 0(0 0(00S*|@P  # 0 3/P $K B@#@ͣA"@"@A -LMPp(0`S@!R!  %0K 0 0R@%@[@N@80S*2PU@ 00 0$K (0  S*!R ( ($0 3/P@"@A#@/0-@S0, -L MPY 40 0`  @00 p40  0#$)< 0)8 0)4 0*4 00 p000800r00000S/ f00S0000000     00000 0(Ko00S0000000010 -LM<00 \||!0c \@@S`7@ @@00 !# 3  4  4 "$ 0I Pp<\K@ 101(#|K LKIK<`0`@CY @I`00 T0F0 &ʔ0SPU6T  |K| KG4l KK~0K}pK lK \K|K| K ,(K |K| KG4l KK~0K}pK lK@DpT`@9 `0S 1 # R  B|K\ , |K| KG4l KK~0K}pK lK0S1#Y IlK R` 0@p0C0 ` @Dx 0  `0V0C0  P0@U0C"@A -LM0<S !"  8 4  K0  ShA"@<X 0-@L{XP0@000"@ -LMP<0  0 0 0@1 i 0 000(K`0840< t0K" SR : 0 0 N+0 00000 p` |K1010( 0 0@4c8<0l0K 0L0K00K0*K(\0K A8} \K0P 夀 00 0@CZ @100 CX 9 0$` 00S0 CX F4| KK~0K}`K |K lKl K lK\KPe 0@1 0 i /0 000cI$~ KK 0 }K  lKl KH00X00 0@ Z 010#S@CT @0 0 00 oF$~ KK }`K\  d lKal KQ Y0`J000 00@Cg {||*K"ꑤAAA////< 000/< 000/ 0-<@L1 P |h0 #30000"A 0-<@LP1 eh%3 0000EA, 40!44  /H#@ -@`0#800pL40040040P 0縀P 0  04 0  04 0  04 0  04 `V㸀 -L M@P@0`0ᴠ00 帠ᶀẀpp  ("( 4  H$H@ 008#8000  x*Ḡ q(Ẁ jx'xp c4 00  " @H$H@ @$'@08#( '8 *807᪨ (8ᨈჇpx0'8xw0)400  000 (K0 $ / 04 8 / - L 0S<<H0 0S00R`'000H%@A -LBMI_K \@ p`$K`@@a^ ` \qNPPN LaS10C^QS $@K pAW$KXGAHqW@@$pK@ATp@$@@$@AB"$$P "(!K'K"",&K%!KJOK$ K !Q$Ka^aA!NQ $K !R "Q0S$KH#@mA -LAMPKoK \@ p@,K^  \qN`` @S 10C RQ S! p @'@AB,K,$,@KAXYHAIX@@,K@ATp'p` ,40,8,̠0 EP,0K1Q,KA\AA1LQ00,K01S0#U0(KmAH#@ -LM1K=K 0 00 S0P  L1 H! 0,0KH!QL100,KQP U!A L Dd(0HL@@P0\! @D \PU*T+ p1  c0 A,KX,K YHIX,K^.ༀ.#4.0#ĠD1KCK#Ƞ#1K=K @0 00 S0P  L1 H! a,0KH!QL100,KQP U!A (@ B@DP0R !@D H! H!QPU*T+ p1  b0 A . ! ,K#4", K !XYH!IX ,K !R. 0#$D1KC!K#(#  00 00h0 Cp0l0  1S l0 0>0000h0 p0&p0(l0`' 0h0 Z &&x&&x&x&& 㐅 P 1 `K?`= =z000V dTwhi0 x0 P` !x0 `- P= U  h0SJ Q1S =^ 00 0h0S;h8 x0 0P p0 4P 1 `K_p0P4!LK_\<P \<xZIoᩒY   P  &PPY t0000l0Gt7S0A00S00S !R 0t;000S)0 )!! H" !P\ P B^ʐ  00 0:*000101<0%h0S S SD`` d!0p 0d!p!5  0t:t*0:000&``0d` l0 0|0 i0pPwP 0d 0 06 d0`t7S0d&&\&d&\&\&&X 1 9)09000l03  0   P1 (90l9000d`X0@0 `71 8(09z$00$0101Xh8U1 8p(08d0 001 00 0l0&l02S1 8'0@8Fa0 6/ 2" 0 S.0002021 LK^> 0pS.00C02021 LK^> 0PQ1Sz 3/w1 LKi^P1  HQ 0SH1L1 P10CP1QP1 S0 900S00000d K0Pp0 101< d0`0@000cd`00t0 0  p0 궡0 x0 t0 00SJ Xud V0倀0WX 0! Z  0 P0  P ux0S 101u0d0 0r(Ns(0 0(00嶡t0Sd  `t0S 4`0|0Vd` p0S 80 R ,0 dp3/P 1 ,4#0D4101ddd`0S*tu`Pd`   LK 0S^0S[0SX0SU0SRXOGqK0[ 0SpH SK SHK<K BK00 ,0K4#t0 (0x0 x0`S:u `Y (0 C8#<4 0#4 0Vd` 4 2y 04"S ! ( 0 `2("000101sGqHK <K<K 4KZFppPt0d0 |00@S" 1 1|!01W00000101Eq00x0 CfR  p0 H0\00Z000CC@00R 0 p0t0tp puppPt 0p0`'?o2<7 04 S1 (00(0101AAA/A#A:A:A`AvAAAA~AΧA&AAݧAAA#ARAzAdAAAͨAAATcAߨA:A,A@2AOAxAAͩAAl0%l0`10`1( AAt7pS`7 Kw@P0<0%'2S30600K5 y#P 20 h8P@@`  @! !b%T (U 0R7@s000JUT 's`(V(K000S@0@@00@0S R 0"42^ 00 0 @W W`70 h2 LK'` \t0 00;t7?o2S0@0 W 1 2"0'!2|40040`7 1 $3$#0,3k$00$0` K0:P~ `0 0@00`d0 0t0`0a06/`Xsh10h180080t7Sv00Sq2S1$ 4$0(4,D10D1q0 7/Z S d  0t$t4H10H1HqW 0SH1L100P10CP1!W'R LKi[ u-L10L11S% 3/!PX R LKN[0 T09000000 0Spp0p 000R LK/[ q1S 3/1S h0 06 -L$M@`P @*p@q oX `0S1`g` @KZ0 0H0 3@00@0 Q1`a 9(KA 0-LM,0PS@I,,0S 18  (KZ  ,K0@@KA -LM@S@`pP S S 1S p?/1000R S 0St7Sx7S^ 40040DS PS S`7t7S22S1 0J S21 ?/Gr0!?L00L0 SF Sx7S40040 00CS/ 1 D00D00J S*1 4>H.Gr0!0>L00L00Sr ,SN S@ k S< h ! 0 - =P00P0ZS\ SQo1 p=-Gr0!l=nL00L00S SD > *SQ0Q0K8 1 X0S㺟)  R75[?0Q 2  LP,8L0S ;!0:1`7 0 00XK00=$08V d7 Id78d70 00XK00&$5[   P! X KP 0P`00 0P  h8X`'1* 3/?S`X0K L H{tZ x7S 40040 0 QY-1 5%0 5~D00D0A\*1 \5p%0 X5jL00L0\ 01:2\  R 1 $4 NH00H0oS1 4$0 4=D00D0^p W 1 x$pl4 ,H00H0MW h R p0 GPp0 !  4 `00`03o`7r} 1 03#0 3`00`0h8V Z 0, p`V 1 XKTW 0 00 00- 1 p2"0 2W B  p0 Pp0  I`Q0P 5/1 HR  @2T"0, <2L00L0㸡qἑ lKWp 0tE:S 0 3/P1  <1!01~000t7S0Q8 5/`7 1A 00!081cl00l0t7SQ0 5/{ZS1` l000 XAߨAʪAAAAA۪AAAA/ABAXA}AAAA3AbAtAAˬAݬAAAsAeA"AVAfA|ABAAíAAAAAAA@@Ax7WS 000h8V  `P 2 02Q05/1& XKT  0S 2 ܾx7WSY 10' XKT 0 Ph8 V<10<1h00h013/_ 1 3/X1S 7'*d00d0t7SI0Q 8 5/At'Rx7S 400407 W0000 00St0 0 0IQ*1 h8T(Gr0!l8L00L0hP 1S 8(Gr0!8p00p0t0S" 00 0|0 p0 0 x0 "0 CR*1 L98)Gr0!P9L00L0 0R0 R Rx00x0  0 Sx0S!1 9)Gr0!9D00D02R  RPP|00|0 p x00S! \*0Grx:!vH00H0Z1 :*Gr0!:dD00D00 S! *0Gr:!RH00H0sS RpP 1 P;Gr `00`0\V1 PS  XKSt+;Q0  0 00t00t0>1p 0 1R0 `7 1 , XKuS$  0 Q5/ 000 l h )&Kp  0Rp  !l 00Sm Q5/ 0000<, Z1,< p0p 0Y 1- = p0kK@l0[P !P =-p p0 p 0 t Jx Gx(0Q'1 =hK0 0 00 0 0CS0 sgj0[Jqp 1D.p> 0x>  00 i0K0!pp$(B(8#8W'!k 0p>     Q Q0CS#bqg [p1D/I d?p!t= 0?L Z1/?2 /Cp0p 0Y 1/?# p0kKl0[P !@ 4;4+Op p0p 0 t Jx Gx(0Q'1 :hK0 0 00 0 0CS0 sgj0[ Jqp 1X*`: 0X:  00 i0K0!pp$(B(8#8W'! 0p9   ĩ Q Q0CS#bqg [p 1X) l9`  Wf Kх!Ї$&K10) XKQp0)6[0Q0f0[0h0[ 0i0[0k0[0l0[080 ,P @0,001S XKQt0(Q0xx80  0 Q5/x00x0Q0 x{0/S00`'2 1S XKQt'7Q0 0 Q5/|00|0&00000?0?h80101h8M? M? h86161p0S l0p00h006[9||0S 4v202 F 0P d@p0004P ]@|040200LS1 |6|&Gr0!86L00L0꺁hhX 1 XKQ$&0W 60 Ph8V<10<1h00h0  0\Q:1 5%Gr0!\5}D00D0LP*1 L5L%Gr0!5hL00L02P  P P0Z   P0S! $0Gr4!@H00H0a0ḡἑ 1 XKPH$0WD4T0 h8 V<10<1|00|013/=X㺯ᴒN  TPH20210v`7Q / ? 67Q`7 !6/0S`77!66`71 XKTP`@#@ß   3 ß "0W0 1 3/20276`70q00101 P400401 XKP0 PUt7S S 40040 1 3/h8V mx70CS4004000CS 1 x1x!0( 41uL00L00q00101 P400401 XKO0 $ t7S S 40040q 1 3/jh8Vg !c0GS|t7S['8 ',&',&,&',&'֮AAA+A,ABAlA{AAuA˯AsAAATceAsA$APAAEAAAAAnAAɰA -0-P@ LM0 K0  K@hO0K K0A0000S0004 R0 000u/ -L M0@t7S2S K0K -L M`t7PS2Sg 0!1Rc (K0pS\:@(020100010020 0083/ ? 071 0t1GS00 kD1"022222220 " 8,\" ZNX282S887-7 0C2c70r0Q   A0   04Q   60@@pCp K3254 @ -P LL0R`@8pL ξt'R#80(R#0 83/?G/@0? @D00Q0000L00 00 R  001H0 -LM`qF帡_KT; 0 Yf 0( x2 ~0 4RSK +x2 P8  R #R"K   3/?mK l2K? k2K71j2K奾1GS0c2Kc"[✾0S/S1pCq(K K⍾0/K0R"[R 0Q   ‾0   0R"[R 4Q   r <\P0pG@ @ p-LCM1`S@PKp IK [PP IK`P I?K0,0Q  R ,?!0IKR1ā!\P -2LPS@ 0aS 0 6/Kh% 0-0L@3A0ASe x00 -LLMh8P @BRV +'\+'\+'\+'\+'4+'@+'H+'\+'L,'T,'d,','\+'\+','\+'/'p,'+'(,',',','d+'l+'t+'+'+'|,'+'+'/'/'\1'`.'/'/'/'0'0'0'0'0'0',1'41'\+'\+'<1'\+'\+'\+'\+'\+'\+'\+'\+'\+'\+'\+'\+'\+'\+'\+'H1'P1'`GE0 0; 1@(Kn0|7h7 n0@00 ! @   AR! !@T0009`75S S@ SA0100!e R #<[@7`7#20`7<`7#=h7#81h71`76`7=`7#>0#8S >!0R1!!@RlKY@P[d4Q= fK@Pp 8. 0l0K0h0K00g0KQ<<g0K4 0g P%"%K#%KLK 0SL0K h0[0h0KT @ lKQO~h fK 0 %K%KLK 㜼 pG};OopB1?0!6&R!  @ T00!01R !Z@y; UL I1S  lKfY@P lKO`P 1S01Ł! BmZ@<2qW lKGY@P lK0`P 2 f0KlK1 S@0m`l Kpd0 F1d Rd0 d@TA ;pP @ l K(hp 3d @D("(!h7 8.8S0# B)  /@Q0'0'0'1'1'0000 㒣&>9 㒣&*9?o2|F8z?x`72x8sn0p:S| (0 3/ .@ c#'d#' -LMP<p:0%@X`P 5`R H@0CR 0CR  R ? Rt79  R0$00Y`: K4R :0R `t4R^ 0CR 0R 0CR^084R^ 0CR`7#204R 0R70;3Rq 0CR 0CR 0CR`78 3R +0CR3C4 3RY0 ^0p3Rl 0CR =!0CRH3R w: 0R r0Rp0 # ]Zzx7S `h800h dh80000g80(W80?x7Sh ,  0+po V0BP C200  R4l`8h3/` t(r v>0RP100Sh8D!01^0K`75?^0Eh8?B001 ``0DP D ᣺n^0`P V C V@`U0"0|`7=$`00 0,0 i;00 Kh(0  0KʺL 0000cF%*CEd cX%' -L$M@ `E9(P[WpP`0'V`F``Sx ^' BS{ +? S  S  S G9p'S  S  BS0V SQp>0 (  (o03A0AS2'S  BSL  S\  BSV W?B0CS> &S&  SQ BSV0SQ h7 `70`7X&SJ ;. BS  BS  SV >  &Sk :+ SDV @0SC00P0S Q>⩎0`ⲐVC嶠C 㷹 @0X``%S BS*7 BS  S  / BS\t7S9 cP&1 3/ $S r SGp%VC0S@!V&R!: 1?0l8t7SS3A0AS13/4PpI V&3   R< g8(KR <35V0S;';'7';'7'7';'h'  t'St7p'Rh' h' VQ0t8 v΄0S `V2Ɓ0  RQ 0X""0\Q 0V >  V0S h7  `78`7t7Sx7S03A0AS7S7S4p`7  8`7{ <`7V0Ss V0S7lV0SV0S h7 ~ `7 ;Z`7D`7 U ;Vq > `7 K 6Vh0Sh( 0•b`7? 0V[0S.0‘"Ut7S2 `F LK⑸po B1S00S00 VYY6Y ,0K0 S C  RLK H0R@ Pp t8-%EO -L|M?@QpP ?Q l?Qv 7C0CQ  It?QU 7 0Q? 000`Pqh0GFSD'D'D'D'D'D'D'D'D'(E'lE'E'D'E'E'E'F'G'LH'I'M'D'$J'LJ'PL'J'J'J'J'DK'dK'K'L'$L'8L'DL'D'D'`N'D'D' O'D'O'O'O'O'O'O'xQ'Q'M'M'Q'D'D'D'D'D'D'D'D'D'D'D'D'D'D'D'R'R'=QW =Q_ F0Q0 0CS:4P`#=Q =Q`7N50000=Q 37Q0  6C0CQi!-0 O`(K$=Q 0QY=Q0CQ.* 0CQN! lKⅷx7kKSh( хl K l Kķ! lKU<0S4<倌倬`0 x<Yʀ ! `, ! @aRa/#0 gU,`PW0a/C0 ! 10`00  !n1S S S`740 03A0AS7S4`|`740`7`740@S"P`k10CS D' E' E'E'D'`70`701!h8 `750`7`750`75!x0B8#8S> Ñ3A0AS=13/1S|7v>0S2h7  1 CbR.0‘!8#8S'!!`7R00`7!`7R44!@RlKSpPIh0[ S`[9YLg0[St7S>hX⊰ fK0PZ:3/0g [l[Pp h0[S000ȅ%K" 0#0 vh [LK⿶U f KPp 6[S>ñ:3/U K4W9 9 fKH PP`YF P!R?lKISpPl[Qt7S hH/ kKռP !1` kK @P MQo`!*RlKSpPl0[0CSH'H'H'I'I't7Sk [iR b0KhKPP EP hK t'R R0hKM4凼`P@ hK @P lK1&[3/`:l K85t7S hK @P l0[S t7S P4P ` !RpP 4䈄!> J!`7R 331S`75`7!R R R5ny4w5u1S h7`7:mx`7:i!`7R33c!`7R22h'P0402ӑ 10`7CPV!0B8#8S ȕNp@$1S7 W0h0 p WY㎐8 P 1S # "ґ0&!0B8#8S ȕ!18h71019괁 X KRpP lKp'/o"0C,K`PP 6P\Š,K@Q@A0 SlQ 0, K!@ RR! 1?0l8 ,0K@PPlUP e lK"03A0AS7S0 Spt7S' cpP_1 3/pX!RlK尊QpPOX  P 03/P 1lK6S003/1zS#N'N'N'N'N'W $y pP 03/Pz z03/W 03/W 0:03/Wd $03/!R\lKfQpP lKO 0PQ f ["F 6ii8iii9iiii7ii o? dddi) 4)' .@@.@hiA* *F.@ @ cAch7, ㎈ᨈX#N.^ 1/pG tB WP'P' Q'LQ'dQ'[) WP'P' Q'LQ'dQ' H @981r9#i H 0Y9'90^00¥08100^00¥08100^00¥08100810?o200t7SS!0B8#8SF(ĕt7SS1 C=R.201:!`7R 0 0`7v>0S10x8h'1h"S8t#8,C("(R.0! lKP`PlP[ U>0 ᎳX kKֳ4` 0BSx !R r39S0Sk0 p WGppQpW_0R@ lKd0 RTp Wp`:3/>0 00 0Sڐ0 00 >p 0P 0 9l0K0 - P`pW:3/Vpᙎ00Sʇnp W0.0CQ0 `74`R$$  `'`'Rn lKP`P f`700~00 N00@0S@@WP00 0`PG0T0 TP`P > > 0S h7  `7 ;`7B`7 ; > 0  [`7P::x7S t'R `7   㪲 h1|&S68 S!V&R! 1?08l8x7St'R8&S h(0!Sl8Rp8 h(0!Rx7Spt7SlZH7 000`P 8g X D X $0 3/'`D} 0-L@M,00 `pPL(00 000$ 0 a P@(0KP0(0`0$  0T0,0(0Ka0 mP(  4$KA1mB 0H2$,p(` ?!,2 0H0KD KPw>0 0 0!1$ 0,p(`H0KD KPb>0 0 0!1$ 0,p(`H0KD K͌PN> 0 0!X1$ 0,p(`H0KD KẌP;> 0 0 0! 1$ 0,p(`H0KD KᦌP'v>0 0 0!0$ 0,p(`H0KD KᒌP 0!0"M@$ 0,p(` @H0KD K~P  <<F(K許AZ'AB,cA(Z'AAıAϱAڱAAoA|.@c  0-@LP00 -P`L@T0S00`00C0  `hV --L M00  KA -@ TL`hTvRPP HS0000 ( SPPPAA -L M1P@` h8 Spp> 00,0 2Kh8 S,KٮXde0, KcG4 K,KʮX0, KglceA(A-A -LM1@P` h8 Qxpp]> 0hh8S 0f c4K $K☮0$ Khc(AeA=A 0-1L@ _0i K0hcNA,A -L8M`1P@ >08`000" 0p;Y  >K[ DKW80@ j0 80K0bKS070K"#K 0D Kpc$K`A -LM1@Pp` =0 ` 0V00  &K( ,K$0, K 0Kk0pKEcK衲A .@ҲA -`pPL0S0 3SH0L RP@\0@@PL0 0@DTT@0 m0p00@FT&QP0oT 1 # T0 Pp@D(0`F`(`/ -@ptLQQ E봒^ 9#9(R:fo69@8 #(R P , WB,@   #(#(0000C0`75`7$Kk$6AA p-L M`1@ -=V00  0O"4V2< "! R 0 0 0S  ! 8Kph/A.@A 0-@0L83/0P ,4P ,K0h+ + -L M@<0 2  2"%|000""? d<01 0080-D1 < Kh.AFAjAAAA A -LMP@5P`1 <0 0C00 00S i V1Sp1 <0|  0!狓oP R 0 0 0S  ! 00KKh&.@*AFArA -`pLP4hHP |0 0 S*S00@刐T -0S 0C8C8S0 1 0<0 Vx@500CcdA -@L`1 0 <pPUKh2S :0S 3/"42< "!D.@ŴA -@L1 0 `440S}4$Kky41S 0 P0S*00Pp.@AA 0-<0PRp(L@0!qG 0 @ -LP0`VF0T@8 "@S 0!S@t'?R `'@0 S@S(@Rp 0RP @`7    P @<1S1@@F @=T+-V; P;  ! y06 ! pm ! ?f?0 ! xY?ppl0 ! O%L0HHF @AA"A)A/APBA A7AZA>A9ABeA-A -0XgnLU@` - P v6P5v61Pxxtptt1 S2  PUp4$Kke @/@FATAFA2AYA 0-L@P3PLL000AT  KP❤0@/@*A -L MpP1@` :0! 0 ٪0 `00! 0>020`003/09909*= 20T1300 0 0 0@0 01 `a R @`Pp Ki:32/@A @#@ ( @0( 8408008,08088> 01/l'l''j'j'2 028 0/202/ -LMQp8040#Qd78d7 .0 41 ( ( . h  K 10-L@ `70 0 ,00( `7=`7d78d70iAqA~sAG/@ 0-@PL83/K0hn -LMP@` QVtxw v> G" Q!PG/  R 0r0UKx7SD1@1  㪉PP0< <!G?0 R  ꂵAAA]/@A -@L`8p3/PP\00\0   p-L MP8 `3/@P\00\0. 1 g90  ⮩h ⩩00h822h80!P0003/0990920T100PKpp/@صA#@ -PL`8p3/@P\00\0  h8 0 0h822h822hih80!Uh8 99 -P`@L1>P1 0-LP@P hG G=1S 3/0 -P@`0L0p0 #  0?0?h80101 M? 061071 N? (Q 4$Q 0 0 u1S$Kk/ -LMP ` p_@P 00 0YK -t7LPSS` `7M@ iN@p10 R0S P@hH\M1 -L Mt7`SS@ `7]P i^Pp00S TAT10 R0S wP@hH)0S i V1S1 "80D D0 0EPA0 K/@A -@m`Lp0t7S 0 hX0U t7SS PP $P1 70 000/@ A -LMP@@@`pn0AT ݐ  _P01S⮡P1 70, , 00$K@/@-A -`LPV  R 0S Rp-Ppp`.0@Tj0p P 0R01 S  R 0S R P0 @0WpP -LMPp@`/ P@T-0$K0S ڭP,1 070t t 0T000AT  ⿭P0S ⶭP @/@/@-A -L MP@U+ p/P  Ki/0S0S i V1S1 60D D 0!P  Ki K/@BA 0-@hLP 0h8i 4P %048@P0%0@80 -t7L@SP m`K/088$8/hhXP 0 02222000099}0pv>01p8C0t7 S13/aA -1L@` !]Pp/t7S118888$8D/PPp ᡦ( ⚦h8 """" 99>0?`7?0?p'RM?6!t7S`7<`7?0?`7 000  k Xphv>!QGQ $KkL0@jAGAaA p-LM@PhQKp` ዬP ;P 1 <10<1͟ P 1 5`'`0` 0LH  0 0 0`7<`7&0@}AAAeAAA -@LAMet7S<IKin  `⟥@.VU }.1V6 S2 0S! q $ K !RRPq  Ki83/0\$0K1PPS@57S &1R6'S "t7S`7 8Sli^ P-6S -.;`70`7 Kij30< <0C 0a%$KW` ·Ab0@A -2L@P n00C02021 30 <p2Pa 02HQ 0SH1L1pP10CP1JP JpV 1S 3/P,RP !,PpP`UKht#A -`pL+PPP+w+0U x t,Ko++h+@T 0U P孜+ 9/@A}0@ l' -|2!L@0SP` 22 9H#9tQI031 g2Sr :0S 3/"42< "!0.200C0v>0SU? #~Q A1 ]20 h0Sh7  t7S 1 0!0s2+~Q A1 620 \0S1 R`76`7h7  1 x E`767`7(V @*[Kh*Kh@&AGAdAA0@AݸAA'AFA -LMPpt7 C/oS" 4 *```*1 `0"*0V  (Ko** p*@T *00(K0V `t7S2  P D"|0 08" S*/I00h8S =00 0-0C024 S RT P1S: 080 ! 8<0 1<0 00HP 0SH1L100P10CP1HH1S 0 R B0 Y 1 h1 0 1P Qܑ13/000S(Sʐ1  0 ? 0*h000Sʐ1  0  *2S 0 9/000I@Z0@kAACcd~AAA,AڹA -LM2@SP` p8#8^ q0 7/ KiS4    924Ȕ2<!000v>0SC p!,20S 0`ǔ"  2 !W0 1S 3/8-8C800ᬁ0 8/: 0S 3/  Ki? ~0001 00 @GjP202~0001 x00 |7S 1 `76`7? 1 ^0T `776`7rpq@AAeAAAsAA A7A0@mAA -tGLpT T) TgP hP 83/@P ? 83/P@`VUP/@PgV 83/P@`@PgV 29S 83/P@` 0-@L1 00 0"P(00K0h(0@A -`iN@L M@PdhX̙UhH 0n 022220000990?KhA p-L M^<2 @R0ŁP`4`!=P@>`1 0!01] G'( #(07t1 PV8080$8X1W,h08(h [P( (1 0 01in F ' ' 0(' 0' 8' j^6D'@7<7VZh8 h  h'     T (  h8 Kp0@A0A1@OAGAؘ'fAALo' -L`pjp@PQ D0QA T T T T ,TH$H@ሆV`h@&h` 0-P@L /s000 0u t      @v w 0  " @x 0S @@001@0/ 0-0 0SLP@0.t'Rꬦ''T''T'T'x'0 0    0002100000 0۞  מ 0 Ϟ  ˞  -LM@P"B`P000z $Kp0 Pݐ0=0H0 82 t7S0000(001011 C.pP.0X XT00 00_00L7S`P7HgLg0P7iBAA@-206 2S 101, ʠ,ʠ\1 016300000 @Č\ 0R  R (R R S0t'Rt@ 60R R R R 01 0S ">)R01@ -LLM0P S@pL^ <K `7 t7S <0["0(Sᘀ*.Ⰰ'X )#[7R 1 <K->0 07000>Ⰰ7X 0)h7R X ` #[@7R```7 @@ ``X80  #RH L0S0P 00H  0C IRtA@P0@00D(KY p@A0X 00@0  B    0@@  0-R,@@T QAU 0      #[ "$  (0l0  #RH L0S0P  D@P000  0@KsDP@ zD@0H  0CV00C00000(00(00000t'Rꀮ'''''''''0 0 6K  <K0 0 00ZD 06\  \  \#*9S00w0 00#"!# #ᇮ0( R00 X00 <Kڜ 6K ֜h 0 0<K̜  Ȝ 6K321303St 800L0 0H0 L00d0 0S <(H0S !%*0h@ T0 0T 00L H00CX0 X (0` 0C\0 0P0 d0\ H0 S1p2Y dYK nAPH L0I@ T zP0` 101P00P0 d0I0 0@00(0080h0h `0 0`0 \0 0S\0 000(X0C/@0P 8000000C001l~00 GG?P6 PgCX XL o 0[ Q `'b t'R8 Q[  @  8 QT ( H0 9/PH0K1 <K+H 81081ӻA#@ͣAL1@A+AAARA A -LDM0 08 < 4 @ \P P`  ` \``P` PPPRZ\\OPBQ8@@ H D0 @PE@h{pPD0H 4PP 4QpP 4pWP@P 0 0 @0 m0@@ @@T@80 000p W 8<x(K <0000(Ko\1@lA{A 0 0- @LT@@ \0 0-@LT002 @D @ K0 00-L @?0 -`7L`pPT 00h 00 000S R  00 00 P 0 0`P0 000 8P0000@ @0 00 000 @9D09P#40dQd ä^`7@[ "0@hx 0@xΚ0@00S R H @ྚ0 0 00` 0 0 屚`0 00 0 妚`0000@ @0 0嗚0 000 博@9S0ą9ׁ#40ą@DAdQd DݼAw1@{1@1@1@1@1@A1@1@1@1@1@1@1@A - Lc 1@ -L$M@1` p *0"`0 2"W0550KPP000 m0p0 Ƹq?0080 800 W0   00 000 0 0 B (  3SH0LPP0  CAPP H0 00AS00S A  0p `(0 0(08@01011011 )p`y 0L00L7SPP7HW0LWP7(K1@ABHA -L,M`Q@p E1 b)0)`0 9N0W _W W W^80KS>HHtPP t7`'S000 p(  0/  h' ;0  W000 0 . 00 h q00000 0 G0 0 `70   40S  0 Q 0P00 000  000C0(09W PW0 1S (0 000@W W1 (0 0KPP 00ᰀ00(0101``0KkPP000 @ 0岘h80?0 000 t7`'S000 p 0 ;0h 0 G0 sp7S000 j0000倦 0  0 M?0 0 0#40 0p_0000 *#300pU0000 *P #à @00 0 6! t7S0 0 0 0 0 0 00 0 0Y 0Q0 v>0S*00 000>0` 00000B0 0`70    70 0000 0  p00 0 8H#8 CR,S  R Sh(  B/o"YQ8 0K @0 < PP< @00 0 0 岀8 0R㴐 #80 @, (80S 1 '3 0:0Y(110011t7S d #RH L0S0P _ 6?PPe30KPP `'00 p 0 0 ;X000 0 岀00G 0 " 1 1000110 a0 m`70   40SN00 0C0(01 e'0 0KPP 00尀00(01010H  0CS00S 00C00000 `(0 0(00000=080r0 /1 PWt'R   '1Grppq 0 B1 0100L7SPP7HWX0P70LW嬈2A@(K, R :01 &P0 L0@00A1@AAA3kAATc#A1@A -`Lp:PP 00(0K0@ 000p   -`LPj:@P 00(0;0 00`0 -L MG` h!=0- 0  p@ 0KPP 1S 0|#|000(K 0z00/ t'`0 R    0  + 0 `0   ⠖00 00v00 S 000 0000 0  0'00 0 000t'RV0 000 000 000 !0 `7   -`70 2`7`7 00 0S*00 000>0` 00000B0 0 00@1 0@( 3SH0LQP0 i=PP    F  00000 01H0 00BS00S  B 0(0 0(000岐4   붑% 2@?A\A -@LMf pP=t7`'S000 0 0  ;0`7 . 9) R*!  $"$8089R:!  !808x09`7  n`72`7t7S```D >P00 U!=0PPS@(Q PU0C0(SPCUe!0 R ! 40  40 Ⱁ P@!d`75`71 00x 0 10S00C00S0  R  R00 (K0!2@xAAɾA۾A -LM`T1P!pR@X10X11S $20 0X11 0 GKhG<>0/Q?U0P00L1EUS0 `HaPE0PLaPa`Pa1 $` 00V1Kh/KA6A0 / -2L@SPa0 6/Kh 0: 08x880 |80|77090t(10101/* * 'h&' 0-:L@0S 3/ `:S00K0h/ 0-hLP0ST0T    00U 00!@R 01m008cd<2@P0/dP 0!/d 0-@L L0@0bA8c0 R  ?8cA 0-D0LP @R,:@T ˒P@08cA Q-@` `PLU tp`PT \Kh0 0C^SP,P$p0EVWA4AA3A -LM1@pxg 4!1000$xhXY ' ''' '`FV'D''0't7S S 0 8:0S 3/$Ka0 6/  t7S S a0 6/gV,'d''''t'R/I032+P3Q' `7  (1 I#  pW`7<`7hi/P <10$1Gz7SV񟗘('('D'D'X'0a 6/Wa0 W W&7S}a0a 6/0x7rVo'''''1Sg !b0a 7Sa  UV <''H''t7S 1S 0`!!h740!qX r Y sZt9[9 0W901 !\0̿t7S!>0S8v>0 01 r9Y9 00 \0᱿t7So900o9`72`793/1  t78 @S$9o9Kh藿h82K<2@8c03@AAA 0-h7L@0f_nK0h: -LMh7`j Pp㤁v>@WAN WP W!N|10@t'RL %) &) ') ()0)91  )90!00(9 0'90&90%9011B0>9 ?)@A B  00  1 *pWPh8S  w $Kk0: @X 00: 0%90&90'90(90$K3@p4@Z3@4@5AcA4@ -LM`7@!1  tQx7S8(00S8. h (0   K 1(Kh/@A-A -pLMP`K` 0K@K0 0 0` 00000 0\@ e0P?o2^ 0R: 0R : 0R:0(K -pLMP`K` @坏00, K0d0"0\ ` 0 0@ 000 0Je?oP20S R0 (K 0-LDM,00 `@P(0|100`$ A 00KpqlPJ<1$ 000K ,`(A `lP91$ 000K ,`(A PlP)0'00开$00 0,`0( A0 K;lP0$0t0 0h0,`(00 0A00 K&lP  ,,(K1mBeA'AL'AcD'0A֐A4@ -LM@0P 0SY` Yt# 00000SW 0P 01P 0nPP 0 `(K@0  @T@AJ0P0^00ఁ0X:0c:A 0-@  0 L !    @P 8_404PPP,uJnX0耖@B -LM@pĠ`P A< <0S D?1P @!0@ 0p0G$KcdcA -L$MP@0d001pX :RK ,1PE 1 0C(Ko0S`S`3`#a0 少  A> 0 R" 0P  0PQ`p!P 00  m P P00 (KcdAcA -LMP0p00@P0P~ 0S} S} S@0b RL*A001QC0S  1 00 0P00 ⊠0* 40 0 jm400  h000!A\> \0S- _0P 0@@m0S P0P @2@ \㨠娐 U@1S ʈN XP(K@@0a01` 00 m00 7@cdAcAA0A8AA 0- @LK0h5@ -LM 4,4 8 #8 KQA p-LM@0PS` Kp (K0 0(0KZALP/D@P/00S/H -L M    0 `) KDc -LlMO0@PJ ,1P`0pP0P0(000` 0```p  Ҍ ΌP 000 0C0`Œ``PN  00C0000 0P@xKS2 8K0K0@0s*$`pd(KJedDc 0-@DMLL 0H1 00 @@P 1 0Ppl!0 000,P(p$@ @@ @`|i 0!0 0040P,P(p$@ @@ @@ii0 400!d080P0X0,P(p00$@0 @ @`0 QiA(KcbADciAnA'bB -L4Mhw@`P " 0 #0P4#(X * !@PAC30 0S 0S*c3`P@ !`pa(K0 H p 0Cp0MP !0@K 0C00 00LP 0S S S5" 0"3'0 4R8 00̿$ 0$Ϳ0S -:S+00(0 0S0尿# 0#᱿3 # 04 8 < R $(,S 匿# 0#፿  0S mP `0#$ 0 #(#< 0  048 r@P 00^$ 0$_ R02& Dccc 0-00L@4S 3P1 R0 0S`@`2`@a0SLP 000 010S100 cc  BR/ $R/ #/0 0S/ -L MP@1S `pJf 0,K@1Z @Ta  K0S 0CS0@q 0S0 0S,K* @cKe -L; @0@1S Kh6 R  R 0c 0-L@ H0Q  0T S    K0h c01,!,"/ c0!,21 ,/ cM!4! #4! B#4!0 PЍ/60S 000!S <S21/ 0-@PL  !>000000 -L@P`LBT D@DT00SH@* P/-  00-@LPP @0 00-L@P @00 -L0  KhKJ 0-@PL3A@K0hs -QL$Mp@`0 Y@K_P Y0(KV` @ @ PU0B00S @T@K A ?00S 000S0L0  P0 DKD0 0T^0P@H@ `X 0H0 0 R0 LA^0P0 :^0P @@K H0  @H0 -LM,0P0PM 030```p 1@T @DT 03  2,00,0P. 030 00V(,0%0K`F  03  2,00,0 03  2PP,00,00KK@d -`0LP@P`p*V 4 0 S H0S 8 R 30 YP SH0W 0S 0CLP 0PXY@P    " 0PP %0x0l0H0?&|Z㰆 ,19 0ɇ6 06 ?sAc' -LMF`@Pp !> (K,0 嫇,0K $@ @ KA 4 #4 # /l0Sp p l p0 0S  0 00/ -@L岏Pp`1Sl01l dp 妏AL墏 1` p P 00101S@@nqd@-@dd$,d,lH,$@l  .  -@plRl2@ML p00@@ J0A100bA Ӫ>  ˪ EgF? > 0P`p!10 00p,P(`$@ @@ @d0 000!X10P1 004p,P(`$@ @ @c 0!10 04p0@,P(`$@ @@ @c0 400'!0 008p0@,P(`$@@ @Pc0 400!l08p00@,P(`$@ @ @P0 c$KdAiA'AcAcAA 0-LMP 0@0T@0S 0CS d ` R 0\0X 0S @T @DTK0@cd p-`L MP 0L"@T RD0B@  R\ X R H0S D0CS@00Sd0`0S H R D BRKp@c0SM 0S Ѝ/0 R/C\ 0C00/0 -Let 0S0C Khx \ ^DpUT 0S 0CSR$!d 0-P @L;WK0hwd 0-@$PL-8k000d 0-@L  R K0hW( 0-0@LMsP @% L2S D0C SK0QQ Q hQ R `Q XQH0S D0Cc -LM<0PS 3A0AS `pLBT D@DTK00S%0KS0 00[P0 R00E:0 0003/0Kp7H@ p-LM@P`LBT D@DTKp00S0K0S 3/0000 :i0K`H@ 0-@Ll1K0hQu 0-LM@ P <801PK00S 0S d -@ L M@ 8<@ @<K@@d -pQLM<048 `P 000<$K<@PH  ❄00!>  p0K40 唄4 K,` (` P <ѿ@`.P <ſ @`Q ࢌ1S0 ` 1@0D A0, (1 0(1<d1id 0-@LM!<PPEUP u<K0-!> K$0 9$ KP P P 0LtMQpP` t.t.Q #B%BQY VP U D.U !BU< R R   pN  @ TU& =U# 1CU 0 \Kׁ lK\K 0S LK !>8K3K 0Tl Kp00 |0  K1!(00R|0 OLBTD@D|c1p<U Ks1!8|0 0SZ 0 80 S H@T D@DT ~0Q 0S0 \Kq lK⹁| \Kⵁ3 LK 宁LK 媁 0l KYh 0 Y @ lK C@t{UL )h;U 26UC 2C6CUw UP @(;U 426U 2C6CU ps:U 0UY~ :U0CU6C20C2:T< U( ~:Uc s26U 2C6CUv pR`:U 0U0ST lK1ᴡ d:0AT @DT9)UU00U0S T[1p@ 0 S0Z/ @U0S00T }0SZ |0S9U0S /p괡18ဠZ(8UU  0 \ T800 8 0P0 0 PTpd@P 0| 000?893 !>8g4000000Ug -7U 26U 2C6CU7U 0U `⍀0X` d000 0`  p@7UX 0U (7Uf| X p"6U< 0UV|K00 |0Kp6  0P;T) gH6Ul 0UT6U% 6C0CU 60U5U 0U 0CU3H 3@ 34 |K⌠   pP |0K(TX lKd ,0 |0K0 T* O*t3 p00 0  +pX Xd E0t01x0@t010S ؀SS `0؀ Qf>W 0pW p  00d030 !0Sp0 0 R00 p pp  X  0 00 0   p3 !0S f 0]3  R    0SM~00pClKmH2 @0S 0S000`S 0 e`r0S -WZ 1 p 7p p-p01|U@ | ~-  ~ @P( R0p10p_(KlK0U 0U 0U 6C0CU 60U h0U 0U 0CUvUZ ii iAii@iiiA#i%idi@'io c"i!idc>08 P R/ !  /d !  d^6d6d7d -LM@Pp L%`0@00@@P.10S@CZ T#100@ !>8K<0 V~@0K <K4@ 0@ c%`P H03H0LBT DDP*@ T 0X 0B?o20S5 0S2 P @ T 10@0$(KL@T H@ 03 @T @DT@P 0  s80S 3/@P d -L M@  048<Q-  048<R$0S! R R R p00S 0CS4K #  $(,R"0d -L`㏫P 0@0L0`0D00@0 0<0(080,040D00040,000@('8(h' (t(t''( 0-@LK0hb -L4M0,000 S@($@P 000  001H0 0PH T080 0S$@P 8 00 p t )x 1P0 80| !0@0 40 @40 0#`P @0 H00 40H0! 8#< 40#4 0 0Č0Ȍ0̌04 8t< ,Ȃ#Ȍ00 Ƞ%$,̠ ČD ȠT,Ƞ 0#8Sv,P4 $'4,$8(#8"(000010 -L`P,㎱@PE w00008$00(`088,P@K0 ` R 00@&P4"4 8#8 ! R 0 1  &4"4 8#80 A&4"4 8#80 1 057d -L\M(0@Ბ0SP,`|  RRd0&KP 0  00 "p pP d lK sP^d0@0d06[0&[4"48#86K60S   &4"4 8#8 ! R 0 1  &4"4 8#80 A&4"4 8#80 1 0#"44P8#8 S0 #0 30 P|KlK 0|KᥛP (01 0(KH0[  10R<10S  0$P5H0[6 W 100S 0P (0(t R!  x K$0 u0 0 0 $K(0K8K89 -LM0 4 8<< c#,$c4"  #$  #(  #<  KA p-LM@0PS` Kp,K 4"48 #80,0KϻAUYiIlMl Q 0S  0CS0#0/Q 0S  0CS0#0/ 0-P@LU *U  R BY{P0E0T  -LM40@ R  K 000 +o;K -LM40@ R  K 000 X$K%0 -L M    0b! Kd -pLM`KP` @t0K\0 0`@0 0 0 0000 0TJ?oP20S B~Q (Kc -pLM@K`P` ut0K\0 0P@0 0 0 0000 0#J?oP2PPU@ @T@p@W T@<(K@T 3@ꀹcc 0-@Pp`DML!p3$@ @@ @0`0 0,P(p/Q 0!(3$0`$@ @@ @0`0 4,P(pQ 0 0 0'!24`0`$@@ @0 08,P(pPQ0 400!|20`$@0p2 @ 008,P(p PP0 0 0!(20`$@@ @0 084p,P(pPP0 0 0!140`$@@ @0 08,P(pPP0400 0 0!t10`$@0h1 @ 008,P(pPP0 400!$1010`$@0< @ @0 08,P(pP0400 0 0!00``$@@ @0 08,P(pPvP P1vP@P9(KiAAc#A(O(,A  K0 r( TK℀ 倀 hK=r0K0 0TKK␀ TKUZ (ᰈ  mμ z|401S3 РCZ(ݼZ| XpW8 LX- DpHW ( X 0  R R  H0 X V 0  RHhK| ᠼ|KVX z@3`0S ؠCZ'ጼX%  r Z  hK 01CY0 `kl `P ]`PD   q 0 1 # 0ShK |Ru S" pWWQDRRR  R  0 Ip 0  0CS R0 s 00bRSJ0 $4"4 C8#<40#400 0000 (0 B C0( Bp80p,0,00  PPQ B p04#!A 30pp0C00 PP07~p 0S   hK KhK G  C cddd -LM$KPTK0 0oX0`( "4`#KQ -LLM!npPh  @ZKp JKeKpdK04# )IY ʄV "`pbB$Y $0S 0 3SH0L0S[@P F"`pb(KP0 0C0w2P Uե"`pb00000C00(Sheĥ9  0 ¥ 0 BRwH_(P`(b(`(`(a(`(`(`(@`(a(`(`(`(a(S1`(`(``(_(_(_(`(`(`(`(`(`(`(`(`(`( P#Y 00S00 RY% #r PPP PSPl!p*SPSP P0S@PL   00S ,|1x2120d#0S  3/h O$30S 0  ,$00##  -Y#x20S 0  %00 (2 0S Y 0XK4 8 <0Cs  oEChPQ Y Wb RS_ʈ0S #Y00S!00 RY HKo0 X0 1\K 21` 2`0K0L0K00V`P 0S  PP  <K-0< KҶ3`P M\Kl lQ 0000 04 8 < 03   vodcd@5@cM(lAc -0`L@\1@$Kk]d -LM0 pP@P 400( K  0 P $K(XP X:o(@1 xXd'dh&hVp 4"4 8  #8WS  R  1CS0PH0@0!aV:X`؅0 JV:pHWV 0 %T tG0@Tl000WV03S PPӣ$ףf003/@cccXN(6@cdh 0-^ 0SQ !R R:0QS  0C!6@ -L 0locd -LMpQ`P40 P C儣  0 兣02"0 4`0S XA0B?o20S  0R:!R232 |B[!_(Ko 0 80 P0 $"44"8 #80CS00 RP:P01@ T00 1K00 śPTP0 @(@2(X2 峴 UPLA  0 0BX@400 0 X0 XYZ 8#< 00  0 0000  40#400 08m m 8@P ^WgdcA -xL⫛ Pe@X 0@@Th`pTVuఀ0@0F඀ 0-@LK0h脛 -L`P:@0 P @@S @08@H #8S00 (0QAA  P/ -L M    0"  KĹc -pLM`PK@` 9m0, Kd0"0@\ 0 0P 000 0B?oP2@@TPQPPV(Kc -@LMPpK` `m, K0d"\ 0p  0 ` B0P?o20S00 5P00(Kc -L,M0p|L P`,0 Cơ%`peʡ(K048 P 0S0 p!>(C 8K<0 l4p 0p 坡0 H0 <K@0KHP圡 0  04$#$0("(DRD P 0p"0C0H0SP40@M008L 0LS0 0SD LPA 0 4 8 -L M,0 0tP8 ( p$0 0 ʠ`00K ,K@PʠKL忠Lc -LM$>$n > P>E(Kl TK0Pp0 D =0S S M吠 唠l0 =   FPl {!pTKlP0SPl M l@P0@S ]+@PKPQUQ"@PB0UPl @ 04 8 < R7.@PN $(,(b" b$ ",R c(#"c4!#<Sp03 p0l`1, @000@S S  @P@p03 ;0S ,P04!48#8U"@PBl(S!@PA Q0(0 C,K@ 10;0 04 8 <0 p 00P0 lP 0l0 徟 @P@^0S Pl 実!@PAOl001S|0 M0| RPl C  04 8 <0 |0S l0p0  0P4 8 <0 0010C0 0@0 0 0 x0 0STh D90S@a 0@KPP[  @K0l0 Y YJ 0S@/0t0 t 0SRQDY Y 0t 0C0 PY Y bKi!>6KH80Sz 0S @Et0SZ@@D  `K$j} dK0Px0 0Y3@0 G0p*}t 0J R*+Z 0  040p0P 0 i0J* q00 @ `KiY@KdKP x `P  `Ki i@K 000@@@T@ @ bKji!>6K0S|t0SP0S~t C0R: `Ki@KdK0Px0 x@K`P@}   i@K 00000 ;0SOt00C $R! ROR0 #"  02R0D 00 " B0 S  !:S6 @E@7 >Ki!>4K0 0S*0<0 害ᬳ0P x0S  ἳ,K<! @g000x0 4i ᩳ000 >Kh!>4K0 0S <Kix@K0Px0 t j3pPU 30SPp0SQP%P0@`D0H0L'qD301S 0CS!p0# p0L2SD0C O[000 0SF pP{ɝ%@PEj T U  pP     ^ p #Z0Q  R TJ hTG `TD XTA Q> H0S D0CS@p610S TKp%}%@PE偝l0S TKp0 0lf%@PEj0lp STKp0p0 вTKp0 40S lKKPl0S 001|0 8'@PG<, P0P#| 0l3/|@K*x KeĹcdJe ccdd@5@ -LLM89@P`p000`,P(p00 $@ @@ @E84`,P(p00 0@$@ @@ @E4匘 0 00'!t88`,P(p0P0 0@$@@ @D 0 0 0!$88`4P,P(p0P0 0@$@@ @D0 0 0!78`4,P(p0P0 0@$@@ @D0 0 0!t78`40h7,P(p0P0 0@$@ @D0400 0 0!78`,P(p0P0 0@$@@ @D0400 0 0!68`,P(p0P0 0@$@@ @vD 040 0 0 0!h68`,P(p0P0 0@$@@ @_D 040$6 00!68`,P(p0P0 0@$@ @GD 0405 00!58`,P(p0P0 0@$@ @0D 0 400!p58`,P0d5(pP0 00@$@ @D05 00!548`,P(p0P0 0@$@ @D0404 00!48`,P(p0P0 0@$@ @C040 0 00!l48`,P(p0P0 0@$@@ @C040$0 0 0!48`,P(p0P0 0@$@@ @C0403 00!38`,P(p0P0 0@$@@ @C0 400!h38`,P0\3(p00 0@$@ @ @C040 3 00!38`,P(p0P0 0@$@@ @uC 0!2(p0|08`,P0p00K 40@$@ @@ @]C 0!d2p0pK0X2,`$00 ( @ @GC 0!20K02$ ,`00( @ @1C 0!1,`010 K0(0$@ @ @C SP  ,l hPEE1\1`PP@ T@!0@Tp +(1 1 0 (K R\\ CBQ ,0iAcAcAAAm(AAAA$c)AcAl(A c+Ac6AĹcAAPA cZA|l(bBclAvA0*A*A*A s(@5@.d(ccdc 0-@LX K0h-KeC -L @PP0S PP `0 010qre00  c`p` W*  `e  pG`FVe 0-@L0S0 000d 0 /d -L8M`(0dP@p  )@ 0 .P@  0 .P@DK`P$    0Ke2 ,0 00K.P@ P"0 PPPP0K0 0[0K.DKK -0`L@1@$KkĹc01,!,"/ c0!,21 ,/ cLP/D@P/00S/H -L@`P@P 1P/ 0-0PLM@P R RKd'Ka'0[0 P0S0ĕK0 -` LPR@  RP PRۮpP1P 000\ Q jd0 0!0;0d 0! -l0L0S  PD 8#8!P!00  cd !>0- PL@0P/d K0hc -pQ00`@Lf8&#DfD$$<PP W@d@l\001S 0CS V  P#RP P0d -LDMPpdK `&@P"d0 R@0`0S'X@ ( LKc\K\KLK @P LK `P 00LK LK  KHP FPT``KXP$1@P /P00; -`SL@P pP0 $Kk/ |P/ -`0PLpPQPEU `f @ T T@0 @U@  ]c0PEp -L,M,0@PD0 0QD01<0 04 48#8 :T0 \1 P 0D0 <0 B0S00 i (@(K0L0 0 <00@0 40 0H0 080 04#40!SE@0C@0@ (08#<4 0#400 4 00#40D0@ <$  ,0@0,0X@ J 00CH S  T R Bۗ(`ph7@ޗ000rT@6pP dB×(`phǗX7@`L0 p0L0 2 ``b0! 000<0S (080 8  0-0"> 080< 40400CP 1T 08#(#< 004!408#8Q :0C0Ƶ#400 0Ƶ 04$4"40#48 000 80 #< 40#400  P D0( @  8#  匐M)`p 0)OH00 0H0 40040 !,0@ ,00,08 00800p`n PUĹcJev -QLM0 0@ 0  0 `H$4"48#80S`:0P0 P 000000pNC10@00'`pg0S( TKaT0K0 K0Z 0S 0 (048<R  @P @PKPP.K0P |K pPmT]`帖+弖3Pp 04 8 <  a 7 #RH L0S0P 2PP 0 0C00 0000x<@0a(0@ 0(0a00 0 $4"40h&ld`&d`Y0H  0CV0h 0 00_P10 W `@00 000PT@  ` 04 8 < sRSs<< 000S00X0Z!+%! 04 8 < sR 0 \ 0SY PV K`P lZp+3PD|K@3pP9  04 8 < sRy 0,PPr3o0wPhT@P H0S Yȕ+̕AP$400PW%00 `qTt@P Y妕+`pk媕pAP`LP Hd咕+`pkp啕AP`@|KLd`04PS0 @00 $0 W0P&0  #R>  39 04 8 <hKPP 80S hK80K3/PP hK? J`hK0 48 ]P3 0S 0S-  PP( 00SPP ,0   ,0 0,00 0 00 ! 0  K0S 3] 4P|KB T0KRV K^ (K 04 8 <80S |K!80K3/pP |K  _ 00S dU彔(1PU 3 0  04#$S R0%<#*(P0<00 0(DQ  ,   404#0 @0AFg, W |K0 0"5 0 4@00#400 KPP R s\ @@_p^ 0  00 0K| KKpP03 `30S ,0@0,00 $,P4"4 8#8S : \1P0 0 0,0 "@ 0    ,0@0,0 3  20S 20S  ,00,00 㰠K 0  PfW 3  20S 10S ,00,004 0Q0  ɓ*͓# nPP Q U8岓) 0)崓0U0  00 0  K 0Pp P PO RL F R  hKx0x x141x00h0Kⴥ4q( 0(rX1PĹcJeȹc ct#c#cdc c7@A -LM`@p  ((tTK0S  SP S0#03R0S0S 0 00000 000B00SQ QR $K"^0 $KP R 0 0$0 * -L,M@pTP \㘋@P7P4 0@#00 @0 0CS0(((((<( <K PP<0SP B8K`<KP 3ST1P0S  2R`V\ᛋ` K20>80S3[PP03[0 P 0@0 0S08 K0@K<0KPP+@Q' 3S$`< 0V V;P08 K0@K<0K֧ ^ R `<KaP 0007P1P@8K0P`$K@` `!0S`@0K8 KjPP`<0@ V1P 1 0 `aR0C08K<08 K0@0K⋧S S Q ` -PS p-L M0@ SP+ S. S- T 0S   K] KKp 0"K1Kd`P .P0 0  @ K\qP00P0 K0a d -LM080 0P`Sd@ H&S<6P*(KP Pk00CS~0(Ĵ((((((Ĵ(T(T(T(T(T(Ĵ(Ĵ(Ĵ(Ĵ((l((Ĵ(Ĵ(((((|P t0|00SC  @0 pP@07`  @0 I\@0`S)Z S `VSJ`ZZ0VD0 0 @0 v\ `F` ,RD0 k\@0`0|pd@(V ]\8K'P~00CS( (D(X(l(d(d(d(d(d(d(d(d(d(d(d(d((d(d((,(d((80i080p080 CR0ŕ80S@@80S@@80S@@80S@@80SKK8KP80SJJ 4KP,00S3[83[8 W`0|Pm1P 8888bP~ 8KP80S3SS @p - @m8KP8W0 CRwL(Ĵ(|(|(|(|(|(L((((((Ĵ(Ĵ(Ĵ(Ĵ(((|(|(Ĵ(|(|(P(|(|PB 0 P 0CS(((0(8(((((((((((((@(((H( (($(i080 8vp0000D600D135 R R D8 000 84K3K83K8p&l  0$*s  -@PL `P0S\KhP -0@S L  l0`  B   B PUKh R0 0 J 噜d -LPZp̀0`ATp@W< 00C@S𫝘@p0S00C0S0ۏ$ 0$܏ @1!  dddĹc $1- l0@PpDML!0 000,P(p$@ @@ @7 0!0 0040@,P(p$@ @@ @70400 0 0!P080@0'>,P0(p$@@ @P0 7(KdiAcAA p-@`ML0P0@@ @0 phP 0,@@T "0 Q  B! "KphACcdCc ,-L1P54 Khd -@L'0"0R S  B! "2 2R2S0t`P"0#Q00S qPP@UP#00C?o2PKhdCc cd -LM0 p 04$#4 8$#8 Ƞ $ ,("(!8 8' C^ࠃࠓ^ Gώ,`pl CSP |GŽ-`pmƎ(K0C40 0@0  40S (P  04 8 < #"   "? < !AT#哎# 0#ᔎ6 D0 D0`PP#00 }M 0-偎00 !R S  $(,R  P: @@0 p00080T14010 01   0B0000_2S S?$@P: 0 000 001<00 00 0 0410 0 )Y %Y<0!0Q1@0A40000S0 ``0`0 `Vn   Rk  !Ro8T-00`'1p01W 0 !1Rp   !* !! Bഡ R*!AQ ڴ! Q Ƞ,Ƞ B! R Q   p 5! B!  B WY R ` ``! R /00!` R  B   B  ` x pW2 p !p8 #<40#40 cX _X@0 0100 01C0T00V(p,@`Z hQ=(`phAy0  40   24p0@p 0`0PS 0R ,@PLR00Yl !Ს!JZ7ڴ!Z)10C10X@0C0#0 #, z%XĹcddd-//-/-/ 0-@L-0 p-L MP d @ ` d0 (01  0 Kw( 0 LP(g P Kp1M  " 0-@LP!0S 0S 4P00qP0*H P 0$d -L A -LA -LM!>P@  0K40 iW,P (P 0 p$p4"4q0C0#40 0$4"40#40t1`V U7 04 Kn$K0S*q0S S%t R 048<Rx R  048<R U P 04 K?P`, 0x t # l0Rd@0 Pd&`pf'`Rpg*$dd@5@ (Ĺc\ `P/0 !`8 0 0 (  , !/ cd dd-/ 0!< 0`4 0 (   !/ cd dd -L@p@P@`G<Ke$d -LP`@} -LP`@ 0-LP@0 -L@`Pw xhVd 0-S@L@%`i0p0S S 0S/@PP0 8 1@0고070@7dXe -LP@`;h0p0S S 0S/@ 0S@070@7B1@Xe 0-@PplDML!1(p 000,$@ @@ @P`3 0!0(p 0040,$@ @@ @P`20 400!h0(pdp0`0 00080,$@ p @`02 (Ko[iAgSBX)$dA -LM`@  $ pP 0PSq R R x 0Rt $0R7/@K -LM0S0SP0!0@PSR \ d 0  $( ,0 K0 07@9($d -LMS`pP( b!@ $ Kp U`0 KKW` vVd (0"O0S  #RH L0S0P  c@0H  0CS00S 00C0000T7`$ 0`K(0 0(00000q0 0( )040#40 Tx T00|0P8 00`$KSESI 0 #RH L R !   @P ` 0 ($ Q*$ , "$  $!$ "$  04(0DSʘ000 0T`00 堉,変(`T `JeĹc -PL@p`U1! #00S) S' 0S&0S%07070 U@  hxlT 9@8@X W 1@/@@Xed p-L Ma0SP@ 0RPd0C50/ P0  K 0P Rd  ++d KpS 8P P0S K0P d Q  0Sd00K0! 0  0`( "4`#/<08 SD @R C0BP// -0L48 40 8 00 4 8 4 0 8 00 $ 4"40#4 00$4"40#40 -LM KS Kh - RL \`"0 @ 000S  , T0,  B H 00C0 dPdP 0!P R   G8@Cch( 0-@LP 00A;@0:HP0K0hG -@`LDMpVX(KP0U U X PXU0CS (l(((`(`($(U  0 ;S0^0K0]0K%[4"40H`U 0 ;S0@000Sk10 0#2S S . (\Kr# .\Kk!\0K3k .\K~ U0 0R R 0 ;S0<00l1d00p1U 0 ;S800S0 <00  AA d(#c -X`P𝤀0 !`!800 (  , ! cd dd 0!< 0`4 0 (   !/ cd dd 0-LM 00 00  及 KAAXd 0-LP@0Xd 0-LP@塍K0hXd -LpPᤜPPRAṜ6/`po:`1, 0 00S S S,ᢜR00!@` ` $8 (#<4 ̂ 8 #8  ,(!( 0`#8Sʬ S 3 00S 0 JPY Y`1, 0 00S S 0@ (00S 0 o d#c 0-L@ $00CS R  edd  B B (K? lmK iKkḠ 04 8 <00S[ Sc 00; m1L" RX X0100Ch00d0x1= S;0;x1`0`S00 0[201 0 SQ=x1  X10S;0; 0 810S;0;H20KXPP(+`pk)`piH?0 `h0 `00 00H`VnC! `p`L"c dHd dc(#c #c -LGMp_H0[0 H0K.`pn KmJ0 50`0S@%0%*0K  P 0 Q@%*h-@T  `p`(K HP@0@ `0#2S S7 00S  04 8  P0 $"44 8#8C0 1 00 01 0#21Z0 00 R0S> F `p`I 04 8 < 04 8 < 04 8 < 04 8 < 0S (0 C048  0 1 00 (0 RJJ 00 R@0 0K  uPc 0  QX@@TY 00C1 0 1 1 S  0S,;P  0P00 "  Q 0 P 00 ~0P1 MP P0S S pp %1 1 l0K 00 $400 48 < e0P0 Hp[p H0[pb p긊~΀ L 0 L~0 4$ 8P  0SWH0[0zn~΀  0 o~91S" 00SVpKU  K 04 p$#4$!$8(,"( #8 K~V 9  P 00 K !fKfl0K p00$K400K2opPH0[Ј~΀ L 0 L~ 0$4Kop 4s $Ko00 00 l0K 0000$400npP00 OH[4 H0[ w}΀  0 }\71S 00SV`K .s .Ks 04 `$#4$!$8(#8"(  Kk }΀ L 0 L} 0$x1opP  0SV  0R:0P(UI ;S  04  ! h!2W0  h 60S P 00 0 e100 1  KH KH0S S 00S 000   KK10S . 4. $KxWP(H0[P  0@` P4 8 <`FVP 0#0##<00 `F4SP0C0ą#40ą"PœpĕpĕZ0RPS|P} @`p 0 @ ` 0 | `p 0J4 8 < 0#0##<004V`C`ĵ&d`ĵ Pţ ĥ ĥZ; | @`p 0 @|` 00 04 8 `<0S  04 8 <@ Ss|΀ L 0 L  0 |p0`< d0h0l@00`FV:ڌr|΀ L 0 L|z||  04 8 <@ 0CS<0S0 04 8 <@ S&\|΀  0 f\|  6p P  04 8 <@ S(406 {W 00 04 8 <0 04 8 < 000 lKK90 P0P0P 0 4 8 < 00 0A hdPdA#c4 cXd AAA#c cHd0$cCc c dH? #cP c#cT c d0!S0 B0P0 o 00 3S0H L0SP0\ 0].0P0 W ! 0[0<   0CS00S0 0001 F9!~ K|KF 0yK4 0S 0ln80Ex%΀ L 0 LFx 0[4 8 <,10$1010000 ;81?`0S x哼P$?`W YP@?`D  R 1R8!8150S0;% ?x!`p 0!L?x0`0`Sk1h1j1i1@L 0XLL1S .A: 04 8 <0#$0 #(#< 0 a V*`Jf ~0 00 w΀ L 0 L  0 w 04 8 <0C1 04 8 <(10 0!48<BQsR 0 !4 8 <BQfR1 Sh:0  0 +R RR Ӵ 00S0  00 Z0 ;S SS`K 04 8 <$!S0S;S K$1p| 0$1 @>w. 0./  0/9wFK1@ r fKZK ;SS SS000$10$1;0CSp`')h')()h')h')()X()0 04 8 <CP40CS(v A`p 0 A ` 0  `p 0 v0 48 0 000C0S6 40  04 8 <$!S[( v΀ L 0 L 0  v001 0p !t0x0|$10pG 0S0 [ڈ9v΀ L 0 L`9v0ZL9wv΀  0 9wv0 ; S 04 8 <$!0CSPq 1S 04 8 <$!Sw000p8Av `p 0 H8Av0 c0J0 00 0S  04 8 ,x1BQ 0C  0C  0CS70p10l10  04 8 <$!S+ R02 4'%=0#000 .  04 8 <$!R00 04 8 <0C000u `6040F;u!`pau00y;S5  S 0 4 8 0ASZ100#S 1 Su @`p 0 @u5P 0 4 80Q: 0; 04 8 <  BRS4!0CSOD5vu!`p 0! 5wu90`0`Sk1h1j1i1I 0I 04 8 <0C1 $;P 08C8S; 0  1 0C0CS103/P;S81,081Z 048<$S{ `100CSvG103/ 0`sd 0h 0l410FS u΀  0 u*0`Ft̀ L 0 L 0 t0SC 0L!4 R8 < P0CSڨ2A, 04 8 <4!SFR4p1 03/H \VF10C100 H   04 8 <0CS) 1Va 04 8 A #c dCc"c d8@) 0)* 0*~t 0X 0000 1S ! X101 `001QāA0 3SH L0SP0\ 00P40SA01<  0CTʌ 00 000` 0 S` l0 SG S| (| C0 ZP0m0 +1mLPP" 82 00SX0 d"0 0000 -1 0CS,-0|0 Q@ 0R  9 8+R ,# R   !BR`08 T!4 BR 0T0R0S 30 zm&΀L 00Lzm0 0 (  `@` p05 d0md0 $ (     $` $ W (  TKO8  !  `0 `i!0!Q0$S0P0 @P00S0 (",$("", Q "  "! BR ! HR1(",$ "$ l0Sl Su 0S01p0S14!0 CR141L1S5ЕP0L1l#`p 0#l`,Pp 1R 4!S Sh 8p,P V,0;t60 @,0`l0(`S_ S /P&` !0=0 DT  $ (  J8,P4 00 St0 40< ,0 00 St040<,  ~ x'|t x$'xpW|GpGp'tpn8,Pm 14!0 CR41ŧT`00S 8o,PK $84h&l|0`&d`(`Q p0| 00 i00| 0!`0P|R1+00  PP2 7P%rP e|0  00P e0 ' 04 8 < 40 8 0 R`010 1ISa5k)`pi0 $`pdk0Sڄ $100! CR01$1x1000 00b+0S !<:R 0PSMPK(PIPGU`dP  }\(0Pd0 p Qs &p  SR``U`VONh@@BWyU| x 0-1H @0C10L0C0 0R100  q0"chd -@00!LPRp`0 0R|pP 1T010p00 0 R 01 @ @! !1#c"c#chd 0-LM 00 00  en KJAhd0 101/ -L4MP d a s`R S@@Q@TV QR QN p  QDJ4 A\@Pp1X0 ` TK6 PK6T0Pc(#"$ c$"a8!T #4 a4#CQP0  CQBQ,K$AP @\ A B^,K"@X0@D0CX0 X0@`SALKX0Y(K \1`1q0FS1aSF    #@P a0` CR000AS0 @P 10CSQ0p CR00 @0CS0BS0P 0 BQ000p CR00T 0 FR GQ @GPFQ@#c#c 0- 0@PD 0LH 0L0 DR@Q000CS00CS00@0CS@0 0-@LQ00 00! / 0 0C0 R 0 C\ C\00C01-S AR 0R0ASS0 AR0; 1 0/P// 0`( "4`#/ -@LPT`KP 40]ɺ?Pf0 L0S01S818! E011Kh(P c -@LPT``ZP 40Z:WTZPf0 L0S01S818! Z011KhP c -L0 !D@dXd1M/ 0M/ \ 0-0L(@+R@ A3QR0Y? R+RY/ R K0h 0-0L(@+R@ A3QR0Y? R+RY/ R րK0h\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd 0-@L0  0:00 0-\0@L00SHPDcz  T(3S00K0heJeJeUAP c`) -L Khj) -0LSp@ S RWT x0S|0S0s0S0S0s`T(` ȀX  0R 00P 00(0 -30 SP S\ W 60#4060#400P 00000 0 0 0 000000W0@00 00&a0`` 00 00 0%  t @3 x<3 0 48 0$0(0,0 8<"8  0"8S@hdP)Pdh*:@0S,8! |!/0S,8! |!/ -@L4M .K-<0(K3K,0 00 0K0PK0O):@hd -LM,0(  K KJK KpN)hdP@- Q@0 Q 01D 0S pWS`:0S pWS`:0| `PQ Q Q Q(   D S01 0 S01(  8R0C0S!P cd#c -@LPPp (pط bPd2Sk 0!tQ[h2S02؁2S20SP (pRaPd2SW А lx3PEh2S02`o`s2S20;1`!U 0kV *0F40  \ 1xQ ᑷQ,KoSl"R p2S0xaPt2S<0l2S p2S0CPt2S<0P cCc@;@c -@LP FPP RPUT1S+`V( %@0 P0\\1\1S0\1`T 00X1 l 0*XX\1FP050S00Q #QKhR  =z -LtMP9Kx2pS@(K`$ 0S ^|K  |K  K|K  |K  K|K  P|K K|K 0 K HT2 DP cO)Xd -LM\ 6&tx KP 6&xrfA0b? S / -`LPPp (p呶PP (pQP0X8@@ TL3K@DP @DP ~@DU 0T@ 0D3t00 Q!\\UL ( @T3K 1 0K4 3K)+ 4K20 ~Q 048 '0`0@S410@Sʲ0TT#T1X%XS%!0P900D48ᑻs07@hdTP)Pd9( -0`L@(_1@($Kk_Xd -8L@(`p_1@`p`($Kk_Xd 0-\@LkFL 04008 000J$0$K0h!Ke"c dCcH.d -L M@R0p  /$K`P  ' P$ 10S J0CS1) N3K08 [3K0 (B0080K7@K01( Ư'0Q1;08C8 S; 0;J_$N_Y?Q<j:_%>_T!X1 L1\!C1S01P0!01S00010 1S ;S_(_0S010S01;S P ɯP JNT!X11X10T1014110L1;S0;0103/`KecpN)hd d8@Cc -@aL40P  $Kkn8P ;` S HT X1\ B R*1C1S014cR :^'^<^%^0000Ke d d0#c -LM@Q0p  $Kk"``P DQw^&{^+R90S(0Q(0R  Ӳ11' 1S H  B0R"*U^&Y^0 0 B $!  t01 L01 2^'6^<UKe d dCc -@PL~0p  Kh踱`P 01; S !R H0H00CR :401 zFKe dCc 0-t@L0S000S=0 0S0 00S000S=00S00!00#cCc 0-(@L#0 K0h1H.dv) 0-@\PL0==09#9S K0hNP 000 Ke 0-@L(8&`$K0h / -`@QLI01`pP01P+0B8#8S1 ; S!R0?0$KkR  0?!0!!Cc -LMP00`Kp0` @0 H(0K\0 0L0 0`@ 0 0 000 0?oP20S  R0 (K -LM2 3p1@4` PW V 2 p02 0 S Kqb @DT0V2 00 P2 00@$3R@b T V2"2<02冰)0SPP(0 0qP -K'2唂 2 2S SO 2"R00W0S -KP @2[ (K( 0  02 d02 12 2 S0+0|" x2 2( S 0B R 2 R " R  pR t" ( ?KhR t0l" P dKc"K`2 \K[!K&W?K x0X1 ( 0  02 h02 12 2 S0+0|" x2 2( S 0B R 2 R " R pR ?Kt" ( hR  嗟K\l"  d"K&cK$d0`2 x0x0[K\1K&W?KUK d0X1 0k2 =2 2 =C2 0Gsp @: cKe -L M    0L K d 0-LMPQ@ LP =m 0K#R #P K000 -LM $ 0 孭P (0S W PU !  P ,p@P5K Kh@hd -LIM`!Yp V @(K0S\@ R @00S!IoQ㪢 0S0R@ ,1 001  00!,@+,R \ R81 K_K, :@P+![81R0[SSl Sy,1[S0[S$1 S QqC RQq8 嶧@PKⱧ@P\婮 @@8IKD00KSLP (0S !Y`V !@` o@P5S @@S0  1S01s00R R@t@@SR3CK1C,1[SK0^8 (@j+@>KeH%chd -pLMP`K` @%00, K0d0"0@\ 0 0` 000 0?oP2@@T`V P0 V 4`00  V(KCcKe -LMpP`K` 0@0 %0K\0 0@` 0 0 000 0U?oP2@@T 0S0 Pޭ(K cKe -LMpP`K` 000@0 m%0K\0 0@` 0 0 000 0?oP2@@T 0S0 P0奭(KKe -@ pLM`KPK ` 4% 0P 0   0  \` Lp 0PoU@@T <PP ,piVP奭(K.dKe \ \ //W= 0- \ML@P`!0p,(`00 0P$@ @@ @ 0,p!0(`0 4P$@ @@ @P? 00'4!4?,p00(?(`0 08P$@ @ 0Ο!>,p40(` 00 8P$@@ @ 0 00!>4,p0(`00 8P$@@ @L> 00!<>,p4`00>0(`00 8P$@ @|040= 00!=,p0(`00 8P$@@ @e"040= 00!=,p0(`00 8P$@@ @NT= 00!@=4,p0(`00 8P$@@ @7= 00!<,p40(`00 8P$@@ @!040< 00!<,p0(`00 8P$@ @  040T< 00!D<,p0(`00 8P$@@ @ 0 !;DK4,p0(`00 8P$@ @@ @0 400!;8K,p0(`00 8P$@ @@ @0(0@; 00!(;08 K0,P$@@ @0 (00 !:0:$8 K00,P @ @ 040: 00!$:,p00:(`0 08P$@ @}T: 00 !9,p400:0(`00 8P$@ @e0409 00!9,p0(`00 8P$@@ @N0409 00!9,p0(`00 8P$@@ @7040L9 00!<9,p0(`00 8P$@@ @ 0408 00ȟ!8,p0(`00 8P$@ @0408 00ȟ!8,p0(`00 8P$@ @040L8 00,ȟ!88,p0(`00 8P$@ @0 400!7,p00 <(`0 08P$@ @@ @0407 00!7,p0(`00 8P$@@ @040H7 00!87,p0(`00 8P$@@ @0406 00!6,p0(`00 8P$@@ @|0406 00!6,p0(`00 8P$@ @d0 400!46,p0(`$`0 08P @ @M0405 00!5,p0(`00 8P$@@ @60405 00!5,p00x5(`00 8P$@ @040@5 00ğ!,5,p0(`00 8P$@ @0404 00!4,p0(`00 8P$@@ @0404 00!4,p0(`00 8P$@@ @040@4 00!04,p0(`00 8P$@@ @0403 00!3,p0(`00 8P$@@ @0403 00!3,p0(`00 8P$@@ @040D3 00!43,p0(`00 8P$@@ @z0 400!2,p0(`0<0K 8P$@ @@ @b0(02 00!B0< K,P$@@ @O0(0L2 00!<2< K00,P$@@ @;0 802 004p,p!B0(`D0K  0p00S S Q K 0'@ ,E@P,0( xQ|Q0s0 00 -` LM$0K0 ,  #0K, Kp@PdP0P 6SU  0-@,P\ QT  ,#F@PI,0( QQ0s0 00(@( 0S@ 010j1 SQBAzQ `p`Q0(;0`1 (@((111114110@ ឥ@P  K GE@PT0P ,P EG7@0j1꜇c dCc -L@pa 00`V V /P0S 0S 1V;10;0 V DPPPU P*1`01F0PP  PPPU1`0117P`aP1`01P[10 1Sx !PhdH#c -LAM0,1 0  (1 ` Vp,1 V@  TTQb@_oQRPU 6P(KS V V   ἾP  dfQ@T@Zx ZP(1`CV̳))8)4))ܴ)()GK WPP1S0000GK KPP1SP+S; K -PP aV 2Va K PP aV 2Va K PP aV <2Va K PP~ aV 1lVa(1`CVjꬵ)ĵ))4)$),),)4)̵)001  GKR; FK ;1K= S01K 1[01K`0`S1[i01Kh1021K1[\01K0 00 H0C0 T11>0 X1 1?0 <180 " " 1 Q 0 $1Q FK0 10 20 0 1K20 20 111*PL8@@ACcCcd 0-;L@S ꈷ)))̷)̷))0;@T> ;S 0S (P  0T;/ 000S; S !R 00?0 S0S 0S P00 # P ,00  P @Cc"c"c 0-0LPS(@@T(@;SK0h1 QK0hY0@P 0 0-LM0K K   # K2@PWP nK0 -LM0K K   # KP?@WK p-LM0K(K( $  #$ K`@P (P =P  Y@9Kp -LMQ0 ` (K 0S S1p11@11p11@1P0K` 0 0, Kd" 0 0\ 00 000 0d0P?o20S0S* BR) )))))<)`)))))))))))) )<)`) S  SX SS0 0S  CjQP1P#US  ӖCjQ@1@#T#c#c#c#c$cc cc ( -$LR  KhL{BiAJAOA 0-@\81LP01  P34110 `p`(>(K 娱P P 0 4 p $t"$x'xW (>!`pa(>Pd04!48#8S A坭0 4Jp! 0 K4 8KᴨK |p xp  0pK4 7KᴧK p0lp hp 0S㈐6 p܃pP/7[([p0p0MP(># 0(#>'[p\噐P 0 0R:(0 K p  P spPUGPl 0XP H0K ʲP\ H0 QP%P N:UP 00WSu bK\K ⴆK'& 04FK 6K@K⸄K& 0dK`44KH K0KrpT0(P\* >"`pbG0S&7[Rt0S p Sx0S S &8[R (0 K (0p1 P ="`pb(= P0JP 1dA 0-LM0S'0S$P"0!0@S P% R \0 Q@ 1 40 04 H8 <$ɍK0(0 007@)1d9( -L M 0p0P@xX` X /@0S  ៫@ K0S  @SW @0dS*@(KP@@P(0S Sd0<d02[@DH(0$HTP -`LM(0Kp0. K,0K*KPPB[2[@@DH!$H2[(0(0 P(0 00 K [@DHQ"[$H T P -PLMp(0K`0. K,0K*KbPB[2[@@DH$H( [ἒ[0Q S10I0 P $K@DH$HT# 0-@LxM|Kc!lKPU U  |KlKKlK0 0 0   K0 tlK xlK `lK xlK  -LM`0 A0PK 0K` Op0  0 000 00\P Lp 000P?o2X0 P Pp偍 Pp庍 (KpW9@Ke 0-0L@S S 06S x0S000006S  H P0000D:@ -pL,M00K06 K40K2KP2P㰀- P6S^@n` VC[3[@@D/H@ +$H0P&H0 @0D oc[D h &h& PH0 `(K0C8#8S1d -pL,M00K06 K40K2K7P%vP㰀 C[3[@@DH$H`@ 0 0H @ D0 -S[D0H X0%X0 qP P(K`Fh&hV -LMP$@`T0 P P  @T@x p(K7/P2[ #P 0K0@"0K$ K&KP2[0C0K @#c9@0QQ0$0/ -L8M  K#c -L|M@KP`p` H0@ T0 :D0 0 0 0000000 K0Rd -L8M s K#c -L|M@KP`p` H0@ T0 :D0 0 0 0000000u K02d -p0P`@ᨐ娠LM 0K` KT ` K@T0K` 0 K 0 0 0000嬀 00A(K9@FA -LM`Pp 0R0%0 *,0K ެP@$K, 0Q0%0 *IS @0@AS0 (0K P (0 QPPU @D0S$ T  R @,8!08cS@DT0 I 9pAHtd -P@LT<08 PL8 80< < D 00C0000C0 0p`p0 X  (0 3$0@0rd0 D @  !0rdc -L\MPt 0l0 0 Sh @ ` *P0K ,PIP0 Q`%` *x :IV h9@KD H0 0L0K HKD 0 屩0P`0 `p LpW p0 $8#( 0 $#, 0i("(0\0  0 \0 0 W 1(@PH`6ꄨb7! 0!c7W 1' 0'0 $!448#8X0  G@7&D7W 1(@PHh0l ` @(K凊7 7RQg*0 @@l7p  x  | T'T6L'0 RST*0L0/@PM 7<0@080@0@@<@ @@ 04 8 <0x0 0 (0@00D0p0H0X0S0d0  \0X  $(,R xd0 &Pd0 (|0 0Pd0 0] 8@X0S $/P>WW 1(`phE6"`pb66P 0 p0 @00 0`%S0 x0 p00  $^/  (x0 0C p 04 8 <00 4000000P0 0X00\00l00d0S0 0 XR0S Q   X BR$/S X\   BR 0 0   #0 `00D00D00V RP @@  V} $X0 .X00 H 8#<40#400 X0  (  H@X삟vX0  00000C0<08 8 80< L< D 0`0C0.00C00Vt(0 9 0R0% *L0K IPP L0 Q:Q a@5&5W 1(`ph`|Mt0Ph0y R |C5 `0q    R X0 tL$^. @X0i ᆦP<08 L8 80< < D 00C0F.00C0Q pv `0H0p SX0S(0I@000@0SX 0\ r0S,0  ArdHtdcD$c0rd8rdH$c -L0K M#) @j0PK -`PL僈偈@@Tp"p@ 0RD0S峈,Ko诈00C08@<00S 5" 0"5< T4#4DKe0rdcHtdH$c 0 /0rd d-L͈PT@`@0S8$Kks0P4"4@c0rdHtd 0-4@4PL0S 00K0hSKe0rd 0`( "4`#/P/%JP/ -LM40@ R  K 000 ֩K -LM40@ R  K 000 㿩ϤK%0 -pLM@K`P` f0K\0 0 0 0P@ 0 0000 0?oP2PPU@ @T@hp@`V Tဥ<ׇ(Kv@T $@@c#c#c -L M    0 偛 Krd 0-LP@hIፅPP~I01M/ }-Q @  e -0L 屡o#c#crd 0-ASLPH S S9 3B 1SP S3B "`pb1Q'* '*<'*X'*t'*3A `p`"3A !`pa3A !`pa3A "`pb3A "`pb3A #`pcKh3Q Q3B `p`{3B @`p`@Q Q Qn3B `p`g3B !`pa`3B !`pard -PLM'U@ d50S X5X%X0T50(000E}(U \0K( ܡ(E0/S0㚥@P ( \K3(0P 0 :00)0K0 (`&  Zsp4嘠Kp 0 ( Kp  ppp0K K*pKޤW0000`00:0\K0 pP13\K0000<0,p( (0C:*p+p)* +0<00K0pp0 LP Q% 1)@PIQ 1(@PVH ZV KVn V 1+@PK0/S|0@Px(K@7pP 0  2尠KTK\0 0KXp Dp G\KXPp 0` p GW}b20S2 .\K(p\0K!D'V9 ?V1+@PKVP V1E =-@PMVQ I:V1/@PO1)@P0IS1*@PJ1*@PJ1,@PL1,@PL{1/@POt0<@P@m0>C@P@Cf1-@PM_1.@PNX1.@PNQ%c9@]AAT$cA -LOM(P( PEK^0P,1  1O `pU`1 `p`1,11 @P@K,0'S (&P (10<1 K (&P 1 Qp%p * 5CW  <\P(1p 0(!: 0PH1  =0S PK .`'H1Pt-0p0Cu1 @`p`@l1B  0 j1`V OV 3V V <0S K . `' .\K\',1,20\0K00|C0SpNV V,11"`pYb :YpwVV:U,1V1 '@PG }@P( 5SFV Vg O:V{ V,11&`pYfx'U ^@P( V :0FSK,@0`0 0*P;*`<*h<*6*pX2@@ @<` p02@@Pp<`@01PP 0V01`(`( ` 4(X0 X X)0.0/0)0.0/04,K0! 8~s00(0寠dAm.! A`p`A @`p`@k.(tp410<@1 410SwX8 @!C0D @Ti p9 8ODL1 TDC8q @0PLb81 VD`FV UL \KσDC`8Qp8` VkA%c:@-AQA#cXecddrdLtd;@xdHtd00S @!`0R  P1 \P00PP1zP P P   0 L1S 81081 H`V D`F  @B81Tp ODp@181 @p#p8`@/N03\K?0U )0 .0/08090:0;01P 0S(0 0(018 )0 (  00E0 #RHL R\0P  0800B81 80D1 4!41T 0441  [ BTL t2Y㏟I0@1 Y S@!  "RE  @! LrWDpG00S0@1 SX HpW DpGWT0@2S?C00S`0P1 NyP P P41  0 41  81S.0/ 4<.0#4/0LB\K~H1800w41 41 -0$ P B 0S10 Y KD D1 0`SzD10D1 810C81 H10H1 00 @@E@R4`( 0T@ ( 0 4 ys04@@(@(00)0Z,11$`pYdA )@P ( 'i%i,11%`pYe,U P ( FmDm,11%`pYeU @P ( c{c,11&`pYfU} @P ( ^d^ZYUjpp(100S0%(!% *>K0 ( נP !00Q:00S N, `p`Q,K,(KP`041 ,V0} AVC +Va 0a 0X@(1 K28K4KHK @P  tPHK b$K_@K␖@P 400D K  0 @K>P ဖdSz@T 03/@DXP XoD@Az Zp|zWT 40 %0&pSR000S H0! R 0QP \ 0S\  0WV*H&B̀# 0#&f#c@c#*rd -LDMp50SG 4H@KH0 0P0  HKD 0 @QP6 0S3 @P0ܔPP+ 0 @@ 3SH0L RP\0 0@ P01<#P0 90P  00P0S;@ \P;X {`T ;0`TV 400 0S 00S` `` @0 :  000  T0 " v T0( )0,0-0.0/040 V  0  @   yPPPp 90P  `T0 `0X0 P0SnX(`G`(`0 P0V`C`V(0FSq*FAᾔ 0a0`ppG(pp(0p(pΕ`ss0s@s(0:( C8*`#<4+`8#(#<04 8( #8 * +0``` ?PC YC 1)@PI1(@PH1/@PO0` 0 }6 0P01Q0R09 }0T 9 F B)pz0q0cRQ aG(``X ᘗY0@S%F `p`V%(K\$crd 0-L M@:T0 p@PP P@  R 4K@P 4K2K0 RQ@ *@ -0`L@%1@$Kk%rd01,!,"/ c0!,21 ,/ c@-, @ . @@,@   P/p 0-@LP 000C 0-@PLᔧK0h2 0-P 0L#$#"$#"4#  B0 AT06 P @ 0-L@PP i0 0-L@P ]00 -@LP` *<0400 00 0Wq@P  60:@DA -Lo8U UGT 8K7o KrdQ@- 0AS Q0B \ R@ P R  P0Q 0R 0-L@P0S 0P SP\ hP,00,00PP0 -LM,0P0PV @8\1p@TBODT8 F,00,0PC0S 0S  P AT BODT` `00# d d00# h h00# l l00# , `8Kn8 ,00,08KP Krd -@,0L `0,0\puQU 0S   veFvgpuP 1S! 1 ! QmXuP aQ0@ 4&I`$~0 1mKhrdc -LEM41 0R01 @0AQPP`p(Ks -0SS/pHQT6Q H0PPEK, 1[S`KC?K K nP 0R REKWnP-0S3:0S *#4Q0 X \:0S P*Tx0| RS(:0S  .K0K*3TCpT?Yk@P7p 01X00959p /3 P000000 11l9 /H0S- 0S$ 1崐S  YP $90S ` .K0K)3WP =kMp P P H1[S  CKP vEKhq 0 D8Ѐ 0-q 0 8Ѐ 0.d0 <Q00 00 ;xP 70S000d0007 .W rlzt|6L2 SD0C6X wP W0 -H0QS D0CSw6XX H0W40 366(0HP W ajhstpd0S BS=SC/ 1B pp&l^t3S$ IK=P( o0 0 d50J/KIKDpP'50S I/K.K(1%0000K2(qW  ap 1S B?SC?1 1BSC/ 1 + s1䤟S01  qtğpKܠ pK  PmP( KޏP  P- ԏ4 `K0K\0 X0X0 H0 <4 KT `K 80 xP( 0J/KDP30S  .K:(1#0000KH0U  HP ៏hqs1\S01  sY <39@#0K<  P 0J/KCP20S  .K(1"0000K2 KsOP1(0,0<,0vP dp p0 0 $ `K `ICV, PIC1`U .FpX01S @4ckr10S1  rzH0U  PHP ݎ`K@P $0S(PWu0r(q%cT:@AAAc"A8$crdh:i?iku(ijuP iNi0iil'APi Ji(eiHi%i i i i ߖ>Si Ii !i Ti c@cc -`L Mp*fPLBp0 TD@DT UJL2SD0C0@! ; R  R`H@T D@Df00PUP y`YP$QPQ P H0S D0CSUVPP(KUP \P0$c -LHM<0PS 3A0AS`/LBT @q@D@DT  #/$~W֜$K00S0hKe /0 000S(pP$ 00000S ` .TKT0K +0 00%R.hKeeH@T D@D0[Cc8$cc%c:@`A 0-@LlK0h -LHMP CW x3`.LBT p쀟D@DT  .,1S 000$K00S!hKe .$S00S ` .TK$T0K TJ+0000f.hKeH@T D@Dc%c:@yA 0-@L1K0hvxQ* -LG. 10S@?CP4$KkY.!R* 'd R QR :X UXYT*R QR@1:@T QT:@@2S ?CS #.T0@Xe#c -PL` @P@ P @ -8L Q Q Q Q L`)0AS@GQ #Q 5QQ Q QA -L`bPaa?d0 00 rw0@0L0`0D00@0 0<0(080,040D00040,000w@c*|d*c*df*f*b*b*a* -L`@w0DP0~knBkaa cKhaKe0008C0 04 8 < 0/  0-@PL!>00000#800 0-@P L@000000 08C0 04 8 <00 -L$M@0K0KK 0-@L^aPxaP0 -@L M0QP`E 'Rh 'RX7)("($xpt <K<K,K0 Sp*00S-0  0 0 0 0 1 0 S00S"1000000 KhS000CS0pS000CS1 AA 0-LM`@P K0 0 P1K K<p|X |K|KO K|K[|KK K)0 00KrPpW> 10S !L) * K  XP0S OP V,0@T BODT h @P@ AT _,T K$K00 00 P;@%c\;@ AX;@rd -LP(,LbV@p D0F`@Sp8,W @Op/o"\ R\ Q0! (^ R@R@ ` H0S D0C80GS SVT#SB (S S0F0 8P  $P V {@0@$@@@  P GS S %SV000 00 00 00 00 00000V0S  000000GS S~`#c#c QRp-LMP`0=0 CP.P R C?RK KV0[ K0 C0K@T'X tKtK+ KtK7 [KtK3tKK] X0 0<00K0 b`KpA DR @@Õ -LM8@Q :0AS 1 0 001 000$Kp$dSR 40S $0'Q Q 3  h40S 0X$\1 0 0; K0h>k* -L M@1p`0.P,K ,0 (0 P T &0 W  OT  ,Ko@` K@, ,0,0$ 0C 0C pd<%crd@%cCc 0-(@L{ K0hrd* -L M⌀og0,0 (0 m)pl0@T) KigODT 1 P,K.`NP  &@BKeXe -L$M0,00(@ S( F@P 0<S>@P 0 0 ` Pd%R Qh 0D0 40l 00 ĄpP 0H0" 00P8#<40#40e8%#$0e$"SH 00S 00 0 0 0 0 0 00Q7Q 00̌p"(0#8S!@h* -P@LT0pS-( P` (` Sd0Y إ`0S "QᰀP 0SY00 4 XaV (0pd@ -p@LT0`S 8Pᎂ0P H RW@ p-LDM0`S(8Pt@P# 4 PK[<04 PKL0 00H0 0D0 0O40 T K 000 ͅ`SVTـ_KpH -LTM@t0 8T#8p0 $00$044p p"4 8#80 a0VP/oX" T  "R  $ R `V t 6/$ RX l KX R&pR QE RB rh  < `R8PPPx RQ| RN r5hPY R R rQ R rPPP QRt U/o"  "S  R U; 0PRPQ R R R R rh   R R R r h   xx0 x0PR RW`0R R r $ ^ P8 WR R0PlKN  2/PK "p0RD R R R ``` QQQQR R R R `t0V/o"  "U  R lKVlK(K p-L$M0@S8P `Kp<P 0S( 08 S `P`P0S0S0s!.08 0` 40 ,` 8KP΀` YPS0S 00K@80 4  8⻀ -LMP` Y$A$00 *x4 'x 0, ,@ 4  *.' . A 8 0<0 TY $ R  0 8/(K R6&R3& R0 R R R R$  Px R| R R R  xP 804 Sr <00 Srh   @ -L,MR`T !\H0 !8 @ D0  &X " "@ %X  qA L T`zV* @00AQqTL(K RH R h  &R&DRL Rzh   xP0 sPP0G @ <K03K40@ 00AqT 0SH0S h0 6S 6D Sh0  <KxIP @0SH0S h0 6S6D S Z h0  x,P @0S 0S   00S0@@p;@00@-S0 0S0S   Q Q= 0'0# ,0# 0#$.$ ("(0  ! R 0 1'0# ,0# 0#$.$("(0 0 '0# ,0# 0#$.$("(0 0 10(0# |V0# F,0#x  " " "0%$$$(.0"(0  ! R 0 1(0# |V0# F,0#x  " " "0%$$$(.0"(0 0 ,V(0# |F0# 0#x  " " "%0$.0$$ -L`P@@PJ  000l00!00$ ,P(`0 p R 00@&P4"4 8#8 ! R 0 1  &4"4 8#80 A&4"4 8#80 1 0,00Sh09h0@7sd$$c -LLM(@aP,p` 00```&` R&0S1く RB 0lKS2 0S/0s,000]P (010(K"44P8#8 S0 #0 3 0 P H0[ X  0P8 (01 0S8  P0S   &4"4 8#8 ! R 0 1  &4"4 8#80 A&4"4 8#80 1 0H0[ X 6T -L4M0@SPp6Sx0S|0S 0Ss0SQ 0S `b(0@K@PK 00L0S/`TX1@X`PN=!0S  R rh0 `20S+  NK!> LK5KL00S PKZP1` R S 0S0S0S h0rZP 0x0!V `P0x@ KH%cD:@ -LM00 0 0@Sp P(K0S0S/P0S" 0S(01S x40Soo`bWPP 0S 0S0sh0 x0S|0S0S0S080s x0S|0S0s K3!,2q1,2800 x0S 0KؠK0帀Kx0 080 KPQ`V KXP ~\ |0S0sX K!>8K0l`K80 (0K!0K0`0pWP0S100 fPd0 K;KȀ Ā 尌K VȠKQx fKwB\Lx0,*[S |0S0S0S 0 x0lK`KPcH0[`x0S|0S 0sS0SQF x:[60S (0K 00Lx0K0 K8KP +d 00d000SP {0`( "4`#d0 dZ[0S100 sw =P P1P0PH%c c4$c -0L@S`(P`pt0S    0R, 00! P [|P S8{#y]^0Khf]sdKe  0-@L06:d 00d0(010K0h -LM0@SP0S0s  0$ K0"4Kk_40K!p$KP:`01 ^pR WUOQL`JW"^pWUQ`\p`5PU P@T*0P050A%@Q Qp`pRQ'"0Y$ R Qp ! Y0W pRP'p5 W0YpRPpp5\0YP: 0Ypp pRppp)A@ p-LYXQC- P0HQR  @PD<p`,X \00R0S P 0S @@YS  00sd -L,MPQpP0 ` Y 0S@/PH0K z@P\ 4KH 3PF P P0@(K0S1 0S.0s+HKL0K HKz@PIUA; 0S$  RT H0R S``V 1% 0%kzHK000 AZ V H0S 1%`pePz`z@8PAy)`pi}UHtd -LM7!,2 p1 ,20lKP00| HP S0 0 0S\0K 0Z$ 0S! P Z`P`H0K`| K APP H0  WH0ZH `40P@ 3PAP|Hy0\ 0B?o20S Z`PP 0S 0`Z\ @TY 0S0S0S 0SM  FK@6@pKV4KWHKVP-m1PL0S VP sRP XYH0 L0 `{] TPP 0S EYp5!,210#,2(KPP0`S`3W 0S0S0S 0S PV KTPP0 0 4@TBOD@00 0 刀 匀 ps p KlK wTPhp0 RdHK`03 PD0S@0S<0SR t KHK[TPLx K HKUTPFt x0RB0?30S q 3 *K 0 BQ0:`0 lK0 Pp`pW 0SlK)0 4  0p> 08P00,($@@ @p`"8> 00!(> 008P4p0,($@@ @ = 00!=4 008P0,($@@ @ 040= 00!= 008P0,($@@ @ 040D= 00!4= 008P0,($@@ @˩+040< 00!< 008P0,($@@ @ᵩ,040< 00!< 0<08P00,($@@ @pᝩ 040L< 00!<< 008P0,($@@ @ᇩ040; 00!; 008P0,($@@ @q040; 00!; 008P0,($@@ @[d; 00!P;4 008P0,($@@ @E040 ; 00!: 008P0,($@@ @/040: 00!: 008P0,($@@ @040l: 00!\:0<0 08P0,($@@ @040: 00!: 008P0,($@@ @0409 00!9 008P0,($@@ @Ԩx9 00!h9 008P40,($@@ @Ῠ040$9 00ɟ!9 008P0,($@ @ᨨ0408 00ȟ!8 008P0,($@ @ᑨ0408 00`ȟ!l8 008P0,($@ @z040,8 00ȟ!8 008P0,($@ @c#0407 00!7 008P0,($@@ @M&0 400!|70t7 0<08P00,($@ @ @4040,7 00!7 008P0,($@@ @0406 00!6 008P0,($@@ @0 400!6 0x608P00,($@ @ @040<6 00!,6 008P0,($@@ @ܧ5 00!5 008P40,($@@ @ǧ0 400!505 008P0,($@ @ @ᮧ'040D5 00!45 008P0,($@@ @ᘧ0404 00!4 008P0,($@@ @Ⴇ0 400!40K00 8P0,($@ @@ @i0 (00!,40K0 4 $00,P @ @Q0 (00!30K$03 00,P @ @`:0 (00!3@@030 K0,P0$@ @ @&040P3 00!@3 008P0,($@@ @0403 00!2 008P0,($@@ @0402 00!2 008P0,($@@ @040`2 00!P2 008P0,($@@ @Φ iPC!0@C!00@ T!A0^w  Ld1AKJ~%E1bLc|pp1(KOAA\$cAX$cAT$c=AH$cAL$cA$cA4%cA$cA@$c A<$cA8$clA4$c&AP$c5ABAQA0$c^A,$cmA$$cvA#c)A#cA#c+A#c6A#c}A*AD%cA$cA*A8%cAD$cA<*bBH%cA($cAvA0*AX*A*A $cA$cA$cA$cA,A;@.Ltd`$cHtd+cpd c R RR CAQ ,0w -0L@0SP S S `(0 PH`(00S 0  "pHtd -LM<0 P<0p0D 8 )S0(040K (GrP 4 0Q0%0 *WS B `p`.0 0⃑(0R`%(`" *00K (!rP 00 Q``V `@ 0@0 I R :R R> Y *  Brp(KY A}!`paoY R +0 0C D04 K 3 K[$!$("( IY@<0@  80PYpW   A( 0 (C*0 0K=0 0b"!b! 0 R '( 0((,0\0Q H8 ؈ 0(,00C8 AHtd -L$Mp(0P@ ` @00`SMh0  @K@K>J2. 00 )0@K⹑P@h0 0,K/ 0 )0㬑P@h0  0,K4 8 <0!c#!$c4"#:0 = )0㓑P@h0$ 0 R (`P |A `p`(K00Q n)01 mP@nh0 (0+Z Z `P 3Z0H0 S 3Z <Z+Z Z n3Z <Zh0)02  H0nh0 )03 (P@Htd -RL$Mp 0DK(@(0 DKHP)0, DK `P P0 ȍPan K1M  ᡌ -(QLM`P 'Qtt 0(@pTDK 0K j,W [3W@ p[>@5A p-L,M`P@PDDy 0 (0S+R8 R5 )R 3R <R- ,R@S:D0K kj4[<SUD0[0 Q'SD0K( [j(U>0[0Kp S:D0K OjUC[D0[0(0S S:D0K =jUC[D0[0,>@VA p-PS0`@L MPK0%0PT @@Kp 0-LPn@P  j@P j 0n -LP 0-L@nP0K0hj (0-LM0 0 0 @ 央0  R 5 @`p`@.' `p` RE @: #<>0F `p`"T 1 `p` `p`0& =(   mP #!`paT 1 @P@(K2S# # 0'S(Cm00`S )`piTe 1 @P@^0SK  04 8 < $ ( ,! $" (# ,%$ $& (' ,+  $ ( , ČȌ̜ČȌ̌| SČȌ̜B! Č"Ȍ#̌|o*`pjsT 1"@PBlrP 0'S(lP W 0 P\K J `p`K0( KplP0PpGP 1*@PJ5~G PG PG0P0  :00 0S-T 1)`piP9`Vp@ `O+ 0+$ 0$T` 1#@PCP9K0 00 0 0 K0Kk0`Si ΀  0 V 400SH080SL0 0;00R 00 p0S# KP  zP 'P 0 FP * 0*0 ̧$4"48#80 XĀ 0K KKKP~ T 1#@PC8k,f2̀ L 0 L 04 8 < 04 8 < 04 8 < 04 8 <  ZK6 TK5K> \KH  0Swh60S  .\@KK5 .1@0K0&0V j660Spp $ 0$ T@ `J`000jP0 4#0S XU( 0(T 1# 0#1 @P@0 %^0)S(0\0K (>mP \ 0Q0%0 *N  D  0 >S 00 0s \40Sp0(( AR*T  0 Tu 1#@PCn(0Q Q0(0 Cbg0Sa30S P dC:jrf$`pd3WG 0 S0  $ ( ,  $(, $(,r  $(,0 $(,(! $"#0(<s'* 0*)T 1"@PBWi06% 0 % 0S 1$ 0$V i`pᄡ儑0S  S  `p` 0( 0R `p`Tg 1#@PC`0+SW T 1 `p`(`ph0,SV`p, 0K0咑#  0K3/L0 PS CHtdXeJec$c%c8>@dA\$cA<$c;@R" $ ( , $ ( , $ ( ,$S 04 8 <! 04" 8# <% $04& 8' <40 ;0\KR0 K\P ? @@P@@BKR -LM@pJ]PPJK0KI`P\i100 0KH0KHKec -0`L@1@$KkHtd -L M    0Y^ KPud -L M@ :J0 0S@ T0 Q00A:00(KofJ`娀aPU pW x0S 0CSx0040 hq@40pS 0#00C000c@`TudKeCcH+zdTvd`zd -@PPL `0 )P M ;h\ `P/0 !`8 0 0 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -L$MP0S4@s0S/ `08K< @0 0( @ KM@ 0C(@DS0 K P0R HB00@ R0C8#8$cp}dD:@2izd -LtM7P 0 P73 R ǟQ"`p0b'`p0Pg@(K`70S 7S @@@0( 1jPPI 0'S 0 3SH0L0S( hPP7 00dS lS3 g@0`p000* \ ( Q# FK0 QX&0$K 0dR lR 0H KP%7@<`p000@Kp겠`@K( "KR6`pbhK`p0&0&K0 hK& L XKHx K hK1B@Pt K XK+B@P; T/*`pj3M`pbhK`p: 1<02 8P#8sQ ##&3#p KhKAP t*@8#(Ql KXKAPx p0Rt l0R"`pb#hK`p0 #3^ H(p# 0#.cP #0 00(00jP f01 3S4H0L R0P0AaW gP (p(pph2Dp @KH0 0,0p 0LrH ᲀ 2H K P%IipP n0'S 0 3SH0L0S(fpP 0<02SX24K0@!F0K0E0KH0K00*0D H0 @`K 0 P 0' 1$\ Q\:\ Q\:(  \ R! 0 0H0KH00S 0\>f$cp}dPudHtdJe`zdH}d($c 0-@p`\DML!0 000,p(`$@ @@ @P 0g!0 0040,p(`$@ @@ @ ޛ 0!h0 0`00080400,p(`$@ @ @PǛ80(KOAA+bBPud8 0 R kR  /-/$c@}d p1-PLPC 3C7CPQ 0@!@0#0#0#$0#(0#,0#00#01Q.pBaB$V V( &#&$'$ P $P0S `P0 0S @03#"ku(Pud$cp}d -L$MLQ@p 8#8R$@(* ׽WG@ᣲAQU.@ T+Ƚ 0R ?00@@@(K8 #8`V  0@KD H0 x00 H KhaJ@`V`<Pe< `$cPudp}dTvdzdD:@2i -LM0plSP 8h R @8d0CS++++++4-+X-+|1+2+2+Kᅀ@P'1S 00:S0S*@7 R WA+S,OWGp7p'W0Q0A(KQ@ KC@P[?Xs0S [P@CPP 0[" 6RP  ͍303;[20D0[ 30P""##;[ R00Ƒ3SuH6K0 <6@ p@  K(I 0S @ K@P[\ K@P| 0u0#x Q0#t 0#d 0#` 0#\ 0#X 0#01 A@P@APZ |0PP%x0 @P%t0P%d0P%`0P%\0P%X0P%P0a\ K9P dK$3@P0S  K(PD dK$"P>0S;  T* K.@KKd K.00$@05[$00KKlK5[P RQ@T $cp}dTud -L|MP @R 0(K0S000CS B 0 4 8 @0!,21 ,/ cP@-. QH!D R pWR`: R pWR`: `Q  Q33,3 :R&*Ep`` d S QA  D! R pWR`: R QR:  -0L@0t0Pt00`0x0x0|0|00S M7PO 000S >7P@  垸80S ppq/7P81  8司<0S ppq 7P<"  <倸p0S ppq7Pp  pq@Pppq7P@  @bP 7P 78P 7<P 7pP 7@P 77-  0/ -`LpPz[@P U[0\7VP  @ -0L@(S`pt[PPA_7+\(?\( 0(0C00(00@ @@ -L`@VP 3cpP _100 _2p3 0 `$Kk 0-LM0@)S&0S#PP P KzP 0sS :R0SK0 00:S000 y* 0-@LF00t0x0|00 q-``q.QL@PP 7600/U00S00=U00S0t00U00S @^P 6001U00S 8P 6080#U00S <P 60<03U00S @P 50H@0^2UPPUpP 50p0 -L MP 0@p #0H S"SH+I+I+I+I+I+I+I+I+I+I+F+ G+G+dH+H+hI+I+I+I+I+I+I+LG+I+I+dG+I+I+T @/0S 0S 0S 0S0S @T. R  R 0S0S0S 0S0S -@R=PC@ K>0S  V5P7@PT0 Q0@T0t0@T0  R0 00PT0p T0T R/@S0S 0S0S0S~ 0S{ 17@P05P g0 00`P@T16 TY 00TU1408S  0 00PT T: 00T6#X<` 2Xp``40T%3ST0@ST@@x0ITR0 R000_T0 R|0W*@2H%c -LM@0PS`p4P7 N0ES* 0 00000000K -LP`i4@P 1 P ~4@ 0-@PL0-K0hp4 -LdMPK p`jx@P 0S)0S&|0Sx0S h1$ @@0P @tP <P@8(KsV |0[S @( TK&0S%0S"| r!.p x h0 d0 l pKTKD\P@TK\P  H0 <TK \TK&\V  xK0hKl p0 X  c -LlMpH S@  )S *P `FVP P PWP(K WP, P P 00F;SN+8M+8M+8M+8M+xQ+xQ+xQ+xQ+xQ+U+8M+8M+(V+8M+8M+8M+8M+8M+8M+8M+8M+8M+N+8M+N+8M+8M+8M+8M+8M+Q+N+N+N+N+N+N+P+N+8M+8M+Q+N+Q+Q+Q+Q+8M+8M+8M+8M+8M+N+P+8M+8M+P+P+P+0 00PPKwPP&V] &V` V> V6Sx0S|0S0S0S h0R99% 1$V* %V h0R88')V- 'V$ (V| h0R77/VK 9V0 +VpYc h0R1 1h0f0  Rl0VO h0R88h0N h0R77 h0R66 h0R66 h0R33 h0R55 LKwPP* :0LKI!KwPP0 K 2P vPP 2l0 &P`P` U 2PPm 9P`0`0000 0CSQ+R+S+0S+T+ LKvP W`LP|  y:P| i0)3Sb10"|0S20Z0S@8 0R;0S8PU52P1LKvP L0  R00 s800 K{vP 0S0ŕL8!,21,20|0 0L K0|Kx0KP  Pzx0St0S p0s ~U |LK9l|Q 3S100 xKk5P`|pV0 KxKM P 00S0  000S xK⯹P `hK vP oh0S d0S`0s4U aXP|  9P| J |Q $5PI`|VE Yp 0Y vP| `X\36D`KH L0 5LK4 n4P --0EKuPP0S S Sh04h044h044KuPPî0F;S񟗶LW+8M+8M+8M+8M+Z+Z+Z+Z+Z+LW+8M+8M+L[+8M+8M+8M+8M+8M+8M+8M+8M+8M+LW+8M+LW+8M+8M+8M+8M+8M+Y+LW+LW+LW+LW+LW+LW+Y+LW+lX+8M+Y+8M+Y+Y+Y+Y+8M+8M+8M+8M+8M+LW+Y+8M+8M+Y+Y+Y+%V+ V4 V" V2 tzV& $V60(V &V 'Vh0C9 +V 9V! )Vh0:h09l00 h08h0C:h0?h0=h07h000h0C;P1xP 9P; 2dP `K8`h0 @L0K hKPP dY0x K@4P YU"2x RLK x0  x000 LK300 0#`Fx0 h0 VLZ+8M+8M+8M+8M+8M+8M+Z+8M+8M+8M+Y+8M+lZ+Z+\Z+ 0z4 P8 <& 04 8 < 04 8 < 04 8 <T1 *@PJ-PL @E0S *`pj0-PL1 %HQ0K( EH H1V\1 @0tSH0H1 P)0s0S0S8000D1K p80 0 0S. 0R/K0=KKcPP@1KH06@.048L8     R *88b 4b4#0#$0 #(#< 0V 0SK0S K6P@ @X' T1P00T`1 0S 1%@Q $LP Z .PPLQ K 90L1 KHUPP L L  FKM/K FK0PE褆KK⼀ o0P: 41R6 BKخM/K BK0P+KK⠀ V0P! 41R3dUb1S1S1S 1SV  ZKc5TK5KF?KX \Kl2PD ԀA  TKB?K\K\2oᨂXX2 <50S F/K.\K5%141x00\0Kp&`p 0&rZ 1%`peX1PDUL i0Z@1S 4  Q00H10D!X1 0d1 0Q<0=<T0 1) 0)3ST+)`pi/T 1%`pe3PPl 0S 0Sf X!D0Sl 3i0S00Sb 0\!S@H1S@ 2TKX \0 J?KK?K \K\D UN?KO/KXP @1S \TUy<1 ST1M <<1 %0#00S ( ,0K0 #KKQ/KKP$00 QKHPD1S= R `p`1`!0S R D!.P DT@HgTH0KPtTK 4L1S K 4tr (KV x0S 0SV x0S VT! ( ,0`! <  8!R+S  R8 1`a R 0SR :\ 0S\  0WV,<1$ \K,1 K?K@0 \1\ KM(P c@ALud$ct#c#cJeHtdY 8!R>00apdc 0-PTBLT0 ⭯P @ -L0M`@P 0S   1HpK8PK ,+P0 #+P$0S  }P 00S p p00K4p 80  X p 50@P(0@Baᩝp'`K:@ ;@2ic 0-@L 00CS 00K0h 0-P$@L`K0hac -LTMP@@KL0`P  0Rp%p *P0K >RP P0 Qp%p *hNW\C @K#/(K0 R 00S `K⤨ `K*P0S S O3`0S\0SX0ST0S `0[St2PK  i*P@04@D#DI`HTr$HW 0 x0 嶮P, 00S($0S% `0S\0SX0ST0S  `K❮PT 00 0 0$0 00CS 0xp(0s ^(10 !#30(0tK,'KЃX SRl8PXQ Z=  X QT:0@j0Sgh_`K@P 00 0 0$0CS 0`PO4Ard:@cCcMb -0P`L M0Pp_fP @ 00 0 _$Kh]&@P700 0 00@(0 `  ៜT20ST28K@0TB00< ( @0 @ Kx4P 0S   H&@X(0$0%c{+1i 0-@PL(L_P oK0h_c -P`0@L8_P_c 0-@LD'_TP @T00 K0hr_c_ck_c P-L P $4` ``c -Lp` P%@P700  00PP%@ 0-@L4^00P ,_%0c 0-@p`\DML!0 000,(p$@ @@ @`P0  0!0 000400,(p$@ @ @`0Ӄ 0!P0400D0,(p0$@ @ @`0 0心(KOAtu+Alt+]A01,!,"/ c0!,21 ,/ c P-0L P R  (R ᇦ00 d -`L.0 0 ך0p@T,Ko.ꌀ匐ODT 1PZ 0>CS0 0*00?0)#3 0@BT ODKeCc+dXe%cMbP/1' p-LM` PL2@S7 P$D0CSU0 8K'] @J^T8K-  E@'  R@ !R R r ЀHQkrP ЀHQPH0S D0C KpccnA -L,M2bRB0 "08%.]ЂXT@ P  pR @0R0 ] |P t2@0S dBCZP8z]0rP| 8 `r ЀE0XR 0g Q@K UB_E{& r0 KL0CR)*@T @@ - 9Oo B . p -$P@K ' շ -T@K@  |@$ KL0C\*T :Z R Oo B3 - @ -T@K uT  Z(R]T0-(KCc%cdKe+ccrdD%c 0-L@gP+P}0(0` R T`@)&q0d -L M@8@0D Q #Q0`p0x WV``h \0S,P   @0 0RKhR S`lKШ@A#c -LM400S S 0  K0 9 K $c+ -pPLM00 ,00 p u\2p X\0(KWq 0H0ZlH tK;tK tK &P l K.K KX0X0 d0T0K80P0 <0L0 023K8 r 0 E 1 R0P0 1 0@$Kh0`PS@K80 \0H<0 8U#8H tK3KEȠ 0`V0 K0 K %P  . K6 KL]  K#P@`0HS 0c%cA -L4MP@ppp[0XPU1\(KX+ (0W(:` ᥣ00t%P  .\K\ Kh0011\ D0D  \ 022T((@PcdAc@c p-LM@![P XP\ 00000x0x 0 b d PP  TT*L`0D 04 0Kphdc@7A+>@AACc++ 0-LP8m=@100%0?0: !#3 0?000t00S 80S3 #00H00S 380S000W00uMb#cL$c1M 00-P@P LU @@@D@H @P0 -@0L@Sc `Qq@ DR HQ0PP ϢDX:XQ C @`p`@P ᾢ01 0S@00@H00S R   P! R  Q!L 0`S\@A `p` 0S $ 4H0S %c>@rd6@AcAA -PL@`pŗP 2Px00Cx00Ѐ|0 ? 0%x0V0x000 0apg0 $Kk 0'0 cCc+ -L M@0@`10PS:6S7 vWppW! eT!T1ЀX0Ѐ`V p ß" 0 x00Cx0Z$K   ? ZvxZ{=qZZ 0 p0\8K@0 0  0@KH` %P@Kᬯ %@T7 1 SB?C@ !R~@Kp QU `U@KኯtlTx1|`V 0pS 0S0S00S X@TBOD n0`1"U(K@pK0 `P SP 6(06 06$0%$K0  $Kll RЀ , D0`00``liHUiNi0AOi XemiHcJi(dc@c%cMbrd -L(M@P08Kp@0 0x0嬀P`0PPTPx0@0A%cCcMb80#S S S S /S SS S/ -LMHP`@἖Vp ,PU x3@K` 0P 0L#0H(K 000` 004 P V V 3S0@K02 0 40 0 0K~Pp2p90` 80"K LP0("$RK@0`V0!40 30S  0 0 K0S:8002040 1,0S|10H0 KİpP L1,0S @10H0(0L0S >K"H0Sf 1`a40 3S0`K00 0 40 0p 0KP0 K#Pd0 0S PK .0P 080(:@>@aAAAA%cXeA -SL MpP@*P+ P@% P*@"`U@ (K6/@P(W 0P!P(  6/@P 7@( K`갑+H+ -LDM0PQ0``0  0SPVU0#V 000@T Z0 Y1U pWpD0d0 0X (K `ƟP dh0 !ὟPh000 p` .W4pp\Kj\0K 000@dd A A R 0 00ddld 0-@L⤍XK0hP/ 0-p@LM,PKq0e`! |0[pSI0V 000  0 \K0<`P .K0K = N`0S"a00S80%S (S S`KP 8P1t 000 W <p!W  (KGS Sb!ldNAtA -LQM0` @ K H1 巘H1Kp% PP H1X! t70S @K .H1`K. 00P0,',$GC `p`k 0R|0K  AP |0 QZFK3b `p`e(K0` d0Kh0lX KAP01[S 60S .K.KR0K%x@0T1 00W00SL1  50S %e| KD|KP \50S P%dTK N?t@T" p@9q 00S 40Sr .K.KpGp90$00K1d Ka"P KdLq@C/KKqP! 0 T  p"80K p@|I  CK .K.K K 4K}K0 K zP30S!  .K00#0K KpP 0\1 00P1 6SX1 Doo9 bR`Vd⒗606T1S* 06%0f @0#010 00P16L1 @FX? 2@ K0 0@ @0 K0L006t2 h20 ?T 6 9 ᛝP00 `  R Z9 X1S 061 10 ?t`OL1S N" WOVTN Z \1&?oR20S PN@0+ P1 Y (;OP16T2 9 X1 &T1 S&X1 06%0 1 0 00,  060 x00 ?l00S@0H1 T1S %c>@ArdAAA$ADAyAACc%cc\$c805S S #S S ,10/S GSS S/ -LM0pS` ( KG9@9PP 44 @@ @@@T@W90RB;(K000 `````` `!`"`#0 0 $ %##<&'0 NP[ K5==`3`KⰀK0 00K  K 0PL # R  .\K0 E0"0\0Ki K밀K50V 0 0S0W<002;K0;K@00(00 V@@000`00:0 00 0  YZX` \P m x0`(000 )`,`-`.`/`1YO"P 9`(0  ``0(00 00@ℕ0a@0A`9 BǕ`($$ "$ 0( :*`+`0K* +00Y0`` KW 1(@PH1.@PN@E `p`Kk<(0 0(0000B0; @  A  〕 Je%c>@Ard -L M0 `@003pA0ASu0A"DP0P0`  K -PL8M@T` 0` ` .LKM 0pL KSh10p`LV K ` .LK4 0L KS01 R 00S 0 0K` Q 0 1 00G|0 d00IP00S `LpK` `.p0 ,ldA AA%c>@9ACc+eA -@LM` ( KⰀKp倔9@*8PP 3 @@ @@@T@{380vy9(Kw0(000) 媔0S YY0SX p 9(0  0(00 00@A0ɑ@0A9 B℔*4 40#40'4,p-0'8'|.0( 0:/p*+ᳱ0K* + 00FV 1(@PH1.@PNAIF @`p`@LK";0S90 R00 00[S0V<002;K0;K@00(00 @@000`00:00000S0S0S  R 00 40 P*@p 0嘠K 0 KK : P0 0  0KKyP; T00S .\K\0K0 0K:;&Jerd%c>@A -LQM`@ QKM_KǓ ÓL8AK0L1 0`P @KAKy :# 0R0|0K  =P |0 Q@*@TG AKR(K IKp冓 IKo0PH1 Z <70S @K .PK} .y000 0&@D1S@1S<1S81S 6R01S,1S(1[S& x60S l&tyd6tKQ_K|0 x |Kd P60S  .K700%0K[$1[S50S %| KH|KP50SR %@M 0xP4 U8P Q@AAAA$AAAAA5AjAld:@  dd -L@ACc+ld 0-L@LO IPP,K0hK0h4ld 0`( "4`#/0!,21 ,/ c -LM#S Q pp s@P P`@PrD 0$K0`@PD%c6A?@cP/ p-PLM KQ KM fKI0`K@6K8K:K0Kh KK:`PL $`00C0Kp .LKⅻ 0 00L0K4%cuA -LM\0P 20S  .Kid0"00Kp@l2p`V3\2!,21,2 Kr@P9LBT@ D@DT 00Sw H@T T%10S  .Kp1pd0!00KT=V`\0 d0d RP $ K⹏<1K,`=K(0Pll``0K E:P 000\00\0K (K00S  .K d0PK\K .0 ۺ K. ׺0p0` Pp0K 8K%c?@A %c cA4%cA - L0P 6SGG 0S- L S 4S SpA 0-@0LQ 0S  ƕP4 !00 0-@LT  0#@<0S P 0\ `P/0 !`8 0 0 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -LM\0@10S  .\Kd0!0\0KAp$`PK x (0pKx0K K | t ` E9pP9\08!$0\000C0 1PU(KU& \0#d0d R P a0P R .\K0 ѹ0  000000d00\0KPD00S  .\K⹹d0p0\0K $%c)?@A4%c %cAA -LM`p @ K ㎎KPPo 1pPj\20Sf Y D20S @K .pK~ .z00 0"AZC !]B1S0S0S0S6  0R|0K 7P |0 QPP0S  .oKo?K.C"0 R200K r3P 0 Q@8@TN `p`K<(K KEKP =0S - K'1 0P( T 0X 0K⤀K\2pt0U0K0 $4"48-8#89K00 10   =PP10S 1%UL10?0!!#3 0<00 0 00  10S ! S!0… 2. oK⁴0o/K@0100101  @PC W R85Z4 T0S00S \0`0SL2SD0C 0S H RD BQ@ Z2 ?2ۙT(1Kp 0 >K0p `  0#00#0 d 00#00#0 h 00#00#0 l 00#00#0 X1\K`p d0 >K1Lp 40 100 H0@0H0 +K/P K.WKҰW/K, 68"KᅛP D20S K.WK⼰2"0W?KW/KK)pP h00h0,0A\00\020S  0P " R #WK|~1P1U$ QU:PU:1!0@SE |Ct30S? 2ooK. nP`0#1@000K00&=I~=v0`00PP000-/-1 01019D:@/-/-/ -L M    0}! Ktd 0-@L@,>,-0 -LM`0P 0 h 0@0S(01   0 K(( 0 }KP(J, P ,D@й"`pbԹK1M  JJtd -L嫧 -L帧G 0-@0L@0SyP 㝲00K0h\$c 0-@LJ0 -LJ -@@xdh*:@ -LM0 (0 0 00 |6@!,21 ,20`SP B 0 0K00qP0K0  T!P qp/500Sor=Pq 00:S00 P#0S5)@P70S K>(K7 \5 ,210#,2(Kp0P00   #RH L0S0P  ((@0H  0C'S00S 0(0C00(00T 0 (0(0(0000 允800 0 00K00K0x00 80P(QpW kd00#$ #( #,`0 0v00K00 00:S p :P ~(vpw! 0SM0CSJ:00 0,K:i(p 0 (@P] 0( o K 0 (@PP 0, K0" `   00:S0S `pUhf UN U4 UB PbP1@"U@ FU10 `pkUW ʄU1L D0 `pmUX PU10`po  `pRi10 `pj10 `pk10 `pj10 `pl10 `pl10`po0<`p`0>C`p`C10 `pm10`pn}10`pnv0`jC 0#wT! cH%crdtd p-L$M`1@P R8@ 0 0K08 4 08 K3@KpR 8K70[S/@80[S@ U j'9@ 0-LMQ^@0 QP K ! AK0P KBP0S)^   i^e^^-kN^\\?  -@MLpJ 0000 %`P%`QUʀ 0! `0     !0 0yH`Plᙧ`P $K0@vp0 㒭 S cd dd#c#cxd -LM@P` 0R0%0 *(0K (P ( 0Q0%0 *S @j `p`np R  ! $K8`T(X0 ᣋAHtd@ ~ꠎd 0-@L@" " 0 -1LpS` PU @1S !S T"S TP11@T-1S \  0-0L@S00S S0S000C0S@ 0 0/P0S000@@@;@P0"  /᠎d-$䠎d -0LS0S0S R 0蠎d -@LPTQ @P 0S 00S S 000CS`P04H$L@ p-L-uKe1d-/\ `P/0 !`8 0 0 (  , !/ cd dd-/ 0-(0@(L1M  B(0M0 \K0hB -L M@0p(0 `b'PP) h 00S(01  0 (K` (0 CP$(P $PPԱ#`pcرB K1M  KBd 0!< 0`4 0 (   !/ cd dd 0-L@hPB]0 0-LPZ@QK0h 0-LPN@B0 -@LP0S0S0S0S 5`h x&|101㤣9 -L`p@ P@@ -@LP0pS0S0S0S `᫥@nTA8@ -PLKFL0 D@P 0`@RT 0 L%c1d 0-@Pp`DML!2 000p,`(P$@ @@ @Y 0!82 004p0,`(P$@ @@ @X1 0 00!140'>0 08p0,`(P$@@ @X 0!140'> 0 08p0,`(P$@@ @X040<1 00!,1 0'>08p00,`(P$@@ @X0400 00!0 0008p00,`(P$@ @X 0!0 0008p04P0,`(P$@ @ @|XPㇰ<0(KoSpOAPAL%cAAt#cZA1dX)A+,bBd -LM0@SpP0S P 0@S=PB P 10S(KU7 0 S`* ( 0R*Tш40K 4 0 T 3[#[00p PỈ3[#[00@00`  `B>@l-,h*1d:@ -L M 0p0P@X` X /@0S  @ K0S  W @0dS*@(KP=@P(0S Sh0<h0K 5K y 8KⰄKQy 0\K`43K@ K`0KP`0@L 5#`pc/"`pb30 `~`@ dAHtd -LEM`$1 (0R@(1 a a ! 0S00S /01 a B K8K0SoobXP PK 01 `P$1S 0Sy000 K2$^P 0KU1 0S 1 1000S0S0S0S 801 0SD 0SA0s>h0  0x0S|0S0S.0Sx0pS|0S0S`V!.0 ` 0 D7` !,2Q1,2(0ЀK8!>K00K0P1 91Sps6p!,21 ,20K0E?K0Kx00 80 PPPQ`V IP  KCKUA?Ka a `0,K B01  K>x3C_K6S0(0K 00LKKP  K٦P  X5x@xP0S 0S0S0S90@ p6xP∠ 1 W0(01  QHL R P sh0 p . H  B1`V" A      Y  (1( 1`(`&`X 1"$ #$0 :  (",$ "$ W Wnd0p0#$ #( #,`000 08 w w03h(("4 h#0R] R 0      0SL00S 0"P0(8ഀ<00|00000# 0QAA!,0000A$`p 0$C008 0 0 $1S !0KR᣿$c(KR  RS00SX(0#S*p v 8 #8,1 #$$0"$(1 00 0  1 w(1 0 10( Q v1 8,1 (     `! 8#< *t`|p0Pӫ$ 0$ԫ`08 0 070H%cx@@UA cD:@lAd1d -L M`p@r0P0 0@ K -0`L@嗫1@$Kk蘫d -@`LP~@@@@T 0-@LpPK0hldPhipP -@P8eL4u4S% |$St4 0CS0!1t0 |$,0h [vl0d 0l00d0h004t4,0004080<0@0D0H0L0P0 ^0SX:00X:0P&I,xI,I,I,I,##0S 0,B,\ :\  04(B(0 $0(0< -0 ARgJ,J,K,tK,|K, Q0x4\ `0x$ h0R40|40h0v 0 4R0x4n t4S0t t4 R00h ,0 u0d0ldhx4t4",0l 004080<0@0D0H0L0P0c T0X0\ 0X0h u0,0004080<0@0D0H0L0P0t4L 0\0X0h 0CX0 u0 Q7K,K,L,L,L,L, L,(L,0L,@L,HL,hL,8 0; 9 7 5 3 01$0/d0-(00l0)h0'hYh guppX lh ]ulhJP Q-L,M,$M,8M,@M,HM,hM,PM,XM,`M,H,P 0t$,0R!tt0 Px$ 000P 04080<0@0D0H0L0AAAAA -0LhMpp0 z P`KP@IB$Kp0S<0S,@400UP@) -0LlMp @ x0 Q`KoPPYTPD0S@ t0 Sx0 ST 0<84X =P(K0@- R 0Ad ^R300PA40 0-@LT  0DP010# T0S@00 -LlMp @PP `KPP<0SD Rl`VSp0SP KS // 0-$@L00C00d \0- LHyP@@U00000,cd 0-L@ᖈ0 Q 01 00 S0  -L0v`Y, -0LQ =A p-L M@Pk`P0 K{`iKp -@LPU`P `T 0-,00@p`L00hP,P00S0 D00S(PU000C00 0 3/PCcA -LdM`P@p|2xڼP00 80$ 0( 80 0,30400 3HP y0 tPo0Sh0 0a0Ka K@"TP0a0K e0Ph0 @hX@ kl@ t l0t S(Klhl@Ps \ KTUP\ ` KDUPh T K0{UP 0%K`` LKX` r0D0 \0dKL @0 T04@ 00 d0Pp0 O h@p_h0`V P0 `  `* RQ00!Tx T`@D|0 |0 ` s00x0`018 < p\0` SQ  R:ݻ8P V l00l0 |p`A 0S0t0X Kp0L0Kv a0[Sm h DhA A,AhR,AA6AJAwdB_B\AcAnAA Y,2A 0-@L  0d -L0M P@wPPd 1UP`0 S`* P]0 SZ`  P RS?o 2R0SL0 0 PB Vp q `2PP"DKP0 0 0 00P  U P0  PP VV AU Q 0 DKP$KP,cI - QL0 $QY T AAA -L,Mpဆ@倆cPP=zcPPTa0 QL0 0D0 0@0 <0 80 40 r R08#8P጑4K4[S(S| xxQR 1 0SL KasP PA 0L KḤ[v 4[04KM^0 P 00嶺(K5j`^PP ZPP ^U ZPZP|`xZPl``YH0 Tዺ LK6/P A'AR,Q,yara AFAXAQ,6BTP,kA 0-@PL T @H0S <圣00P@T @T%cV,d -L@`PP` P$00S$0$@0S    -L`ᮅ@Z p PPW,0S 0,0B4$0S (0S(VsP @#$Q  (Q AA -L@`PP` P(00S(0(@ 0-P$@LT00000TB00 3/@ -0L ;vPZPZ -@ L`PP ToPd00 0S P P/@-@, Ġ ,,8^#ȠQ# R0A^0 4 <#0#\ 8 0 0S0/c0 0S0/c -LDMP@X P@ ` $7 ZA 0T0K0VPpKS0K# :V  dp TK,0K0$C` TK`PK00 0X  @`p:/0(K0 `TKR`KO`KPK`Z  @`0S! 0 X3/0P0  X0 2/X0 0 3/0P Yp@Fy0V@@0 X3/0PYX@Z0V Y@0 3/0PIp0 X3/0P  SR 0 3/0 X3/0P c -LM0K0 K K 00 00 0K6 K -L M0K#40K0 K 0000K0000K K -LM K n   0  K -LM K l   0  0 K -LM 000  K -LM 0000 K l 0 K 0-LM 0 00 K 0-LM 0 00 K -LM00 K l 0 0     K -LM00 K l 0 0     K Q-L EAP/ 0-@PL03/03/  03/0 -`P@L03/0 T @T -@PL03/ 03/ڪ03/`P`Ϊ03/ -@L0P`3/p0 3/㶪 03/pPp  03/ 0p`V0 3/ `03/03/㌪03/}P〪03/0 3/0S Tp -@L0Pp3/က` `03/[03/LP `L03/pW⨀03/? 03//P03/ 0``+0 3/03/03/   Q-LpP`x0xS#  0@ $Kk Q*@J$J@ HDH P0 !~P0  -L@P`%P  $00Kh/ -L4MP  p   @ Hs0P  $ <0 < Q(K$`V,0Kac4 9/P$[80B8#8S  0U00S P<00<0 0`SP480K <8` 9/60K <4~J0 5/,0@ 3 \P (0\8p90 7/PU,0 0,0P0P 00;)0,00 <0A_CcA s, -L M(0@`  ^Q 4P~&0K 5/2[  ,0  O K ,QpK  ^^{ (P ,]@[  [K8~0 8/,0@ (08P~0 5/P0 S] PXP%XPE_oRU(08`~2[ 6/T@A 0-LM( @0K00 Q'0&4P~ 0K5/(04Py~0K 5/[P4 0R40 8 S$003/p 00S0S 4 -LM,0@9!;1K(0`K8PF~0v 5/}_(04p=~0 7/1[SPU 0S , P(08`(~1[ ;6/K,0/0,0<d^$00/ -(@P0 dL,0PAoh RQ` ;0U<03/00d0,0h0 -,0L@0(P  "L,p3|; S  10>8#8800#wP已$KknSb 0 #""夲b3  0 "啲pb3  0 &p"L兲Xb3  T0 <"vpb3S 0 ("fa3 V   0 80,0 0,0+0!xPa3S 080,0 0,00 d!(<p0a3  080,0 @0,00<0 00!$`3  080,0 @0,00p<0 0 h t`3   0{| ,W: ,0 05<03AeA3?Ar,A:AA2A#AA&AAA+A"A0,AA ()Q-/ 0-L },0@ (08`u 06/(04`u &0K6/(08`u0 6/[00?, R R 0 0000,0 R  R00000660000 0000 0000 -L M0B@`S꬟,t,,, 0"S4_d 00R0H?oh, 2Q0S h3R0S S SE 0"S (04PTu .0K5/(08PLu2[ ;5/03 $003/0  R= 080#8S\ S SP (KS S P S@P0(0\||8u 0:/(08u 0:/(08u0 :/0  R= 080#8S$(08t 09/(08t< 9/ \1Ri0Sf0 (0{8Pt0 5/ZZ S 0S0SR0 #R   R  0(04Pt .0K5/(04Pt.0K 5/2[4 0R40+ 8 S(j%00S0S 040vO00S// -LP X@ -LMp 0P(@,p00(0`4tt .0K8/(04lt .0K8/2[,00,0(04p_t,0K 7/2[  000000,0 K 0 #0  0- 2[ 003 (04`Bt*0K 6/2[(04`' 7t (0K6/(04`/t&0K 6/2["[ 00 6 60 6000@6  600t&0K 6/2[@000000006 -LM,0@9!;1K(0`K8Ps0v 5/㺛_(04ps0 7/1[S}㬛PU 0S , P(08`s1[ ;6/K -LP`s@p  ⧨`(0 00(pp00$00,0080(004s0 8/3 L03ᕨ3 04,$Kk耨X@[AnAX@eA AA p-L MP B@0R ,4,,4,S  0"SUUS  0"S (04Pbs 0K5/(08PZs1[ ;5/Kp03 (04`Js0K 6/1[V>01K(08`>s1[ 6/(S  0"Sp -LRP X@ -LM,0@9!;1K(0`K8Ps0v 5/}ךdP(04ps0 7/1[SɚPU 0S , P(08`r1[ ;6/K -LP`s@p   ħ`(0 00(pp00$00,0080(004r0 8/3 L03Ყ3 0Q,$Kk蝧X@[AnAY@eA AA -L Mp 0P(@,p00(0`4r *0K8/(04r *0K8/(04pr &0K7/2[,00,0(04pxr(0K 7/2[  000000,0 K 0 #0   "[00 0 "[0000006 0060000 0-LMP B@0Rꐪ,,,, 0"S 0"S (04P+r 0K5/(08P#r1[ ;5/K003  0"Svp -L3P  Y@ -L Mp 0P(@,p00(0`4q *0K8/(04q *0K8/2[,00,0(04pq(0K 7/2[  000000,0 K 0 #0  0+ 2[ 00 (04`q &0K6/(04`q&0K 6/"[00 R60 R R6 0R R6060006 0-@L<(08Pq0 K0h/ -LP`q@p彥  b`(0 00(pp00$00,0080(004`q0 8/3 L03P3 0,$Kk;W Y@[AnA8Y@eA AA 0-LMP B@0R긮,@,,خ, 0"S 0"S (04P!q 0K5/(08Pq1[ ;5/K003  0"Slp -L)P DY@ -LP`q@p,  ѥ`(0 000 0C2?000(pp000$00,0080r(004p0 8/3 L03ᴥ3 0S,$Kk蟥DY@[AnAY@eA AA -L Mp 0P(@,p00(0`4p *0K8/(04p *0K8/2[,00,0(04pp(0K 7/2[  000000,0 K 0 #0  ' 2[ 000# (04`ep&0K 6/"[000[Q000000660000 000000 0-LMP B@0R괲,<,,Բ, 0"S 0"S (04P"p 0K5/(08Pp1[ ;5/K003  0"Smp -L*P Y@ -L Mp 0P(@,p00(0`4o *0K8/2[,00,0(04po(0K 7/2[  000000,0 K 0 #0  0 2[ 000 (04`o&0K 6/"[00 [ 0  0006600000 -LP`o@pۣ  ․`(0 00(pp00$00,0080,(004~o0 8/3 L03n3 0 ,$KkYuY@[AnAY@eA AA 0-LMP B@0R@,ȵ,,`, 0"S00 0"S (04P?o 0K5/(08P7o1[ ;5/K003  0"Sp 0-@L(08Po1< K0h/ -L`P.o@pI P(0 00(p00$008 ,0( Rp0,0(004n0 8/3 0 3@$Kk腣0ң $Kk[AAY@AAeAA 0-0P0 L@#R U U U  Rl 00S p003 00xA 0-LP@pP 0? 0nP 0A -LP Y@ -LM0(@P,0 000(0`4pfn 0K7/1[ ,00,0(04pYn"0K 7/2[  000000,0K 0 #0  0 (04`@n  0K6/(04`8n 0K 6/2[ 000 ![ 000000 6600 -LPpCn<@`F(Z  p(0 0000S00(`$008,0$003/(004m 0 :/3 03,0  0 'LlТ d0 CPǢ3 @r<,Ko辢Y@[AnAY@Z@eAA -LM@ 0P`0 b00p 0 7/P0P PQ,,0`S  R 2/0`0$K dTc'c -LM@ 0P`0 200p 0 7/P0P PQ,,0`S  R 2/0`0$K dTc'c0 , / dTc p-L MP``40 0@04/Kp -LTMPP`p@| 0 @ 04/p@qh2Vq /17V\ 70VX 7C0CVV 0@ 04/2Vy ?0CV00Sm Pl t`K0 R@PT` A000 0T K03/@P60 R2  2/0 $ R) 2/ 0 ]? 0 ]?  E20V 70V@ 0@@ @0000 @(K0S R 00 0 BPR  0 00@ @04/S@T 8Z@LW`WXW (0Q40S0000//TW@ -p02L(MQ`P@$ 2Qx 0Q 0CQ= P81Q< Y177Q o37QPP)  0 ` 06/$pW 0 <KPP*Q U R 0(03/Kp0 R ` K6/PU0PE( 0  2/ -PLp]u@ UG01SE  nc40S 00Sy`u0` p`00Pj4P00 0000S  | R l R  $Kkt@0< 4/#P  `` d`, 0-L@s]4Q0T T0K0h0 R0 K0h/|/ -0L@SP` 0P`4 R   03/P  0R  4Q000//?o2\Q00//Q1S ///40S0/ q-Lp@P`?o4 2R0S0 J@QPU 40`S@ 0@ 0 0040@S@   @ A 0-L@\40S0T   0@K0h< 01- 6@L$P}M`\0S8 S 0AT 0S 0S Fp]`003/0S 03/0 Q   2/8000S 0  2/ 00 0c d 0-; S 0 0//@d -LMP@ `$ 000' 0 0,00$(00400p0 $7/P 00 004`$00 00`(0, 6/P400K0$0 0(000,00 0S 4 3/<Q %Q 0Q0 .0 /AQ BQ >Q0 .00 .0!0 . 10 .0/5Q0 .0!// -LM3A@Q  - - - - - -d0SP`$K` p0 7/P0 U:D0C` 6/0` 0d0d`VPPpEPwPE0V:0` 0d00 00CR00 09/pGD0 P0 5/`@ 0  E08/`0SP 0Spp`Pp \Q-L 6Q-L CQ-L& 6Q 4Q0 %Q/ =Q' AQ 7Q QQ HQ KQ EQYQ ZQ RQw0 .0!   0-0@00L0\P 0\0`P 0`0P 00P 00P 00P 00P 000T0K0hdd0S 0S Ҡ /0Qh0:9Q ;Q0h0 0 S 0$Qh0  / S l00A!l /tQl0S0000 / 9Q-L0Q*$Q !0AS h00 S 0h0(&Q;Q :>0ASh0 S l00A!lh00h0TX 0 AQ  R 5` R  R  d    BQ / d / -LMp<0@@`P  d03 8/DD000 00S<0@  d03 (Ko/PZ]PEU|-------D-P------------X-0 S0008C0S0C 0<00<00d\ 0P2!B Q0 B S:0Q0  bAR00000W ‰0 S0 0T W?o20SJ <0!0!SF00<00<00 P0.01SXEXQ<0 d 1`Q A02 ":/0 Wd0#0@000:/0 d2!cR 00S 0.01.0 1<00z B13/2(Kt(c[@/Q-Q*#Q  Qb 0(AQ0=Qx !7QW 8Q<0  00000@00D00H00L00P01010 10100010DQY EQU >Q<00N_Q]Q*OQPY MQX NQ00PQm [QhP( lBY0oQA cQe nQ00}Q5 ~Q1 |Q00<0<<00000@00D00H00L00P0001010 1010001|<00<0x00*s\ 0n00000T  CR` 0C0R 0S 0d00 00CR0Pd0<JhP( l7B 0m0,A0 00 -L MT@0 080\0`0d000000Kdd -LMPP`p@ E 0 0000@080 \ 0`d0     Kdd Q0-L@ :Q00 00 <@K0h/K0hK0hb 0-@0L 000tK0h -QL@<0 QQ Q <0Q Q *Q!R0 ,R0 !R0 ,R0!R0 ,R0!R 0 ,R 0 !R@P ,R @PU@ 0 `06/0@ Q Q Q /0!R0 ,R000// -XP@Q`1`!PEU0LT p07/`0S T ?0Tp D07/`P T0 PA`0S  0S 0d00 00CR00d0 -XP@Q`1`!PEU0LT p 07/`0S T ?0 PTD05/`0S T @`0S  0S 0d00 00CR00d0 -QLM@`' QQ Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P>  00@ D0R P5/`P  @D0d 0P2 5/`0S  0S 0d00 00CR0K0 PD05/`P 0d0 -QL M Q Q Dd 032a@2"4/KD0d @02 D 0 @0 -L M0 @480gS hJS 0BSO @S  AS- $KDS_ RHS<l0d S0T X BS000`0S  0S00pd0 Qd023S0!0C00CPSL KS MSl T`XPR 00CS10N!0EL\X0T4T`XPcSQ fS XSld 0QD32`S0!2P"5/(S 1nS lS^ ChSl`P, PPl`R hHPLPpAQ@08 K 0`` 09/P; `` 0``   0` 00 ``0<K09/P <0@08011l0S6 S1 S, :SP SP SP SP'S$ SP :0CSP/SP(pC1S pPP40@0D0HPLPpPPPl0S0 0 08K⼄8K cl0S S S< 0T 0C 0 S S pJ  dF \C T@w$p$K?c>J?u&{Al?h?dApAeA2dBAvAAAAAAAA 0-PL@U0U! \=0  RS\ 0  C000  /R :9R0 B##S\ 0PC0IA -@pPL 0!0P3/U P807(n 0!0P3/ U$\@ -@PL 0!0P3/UPh` 0 0P3/ UP<` 0 0P3/ UKhr]@r^@; S 430/ <8#8SA3=8#8SA@A210/>08#8S2AAP00/<0D   P2A0A`0pQ. @Q& Q% !@Q @2<Q# :Q! Q2 Qv =@Qr $@QD @Q0 Qk /111111Q3 Q111QG 0CQG 0Qh17d1Q`13 0QP1.LQ @Q @Q. Q11Q& Q00v0Q 0CQ 0Q0] 0Q 0Q00/0P000000Rxdt_@+A-AAAAAAA?ACA2AA-A7A;AOASAAA AAA#A(AGAKA-P0 Q  Q ,,," B( @0(S!<#" 0-L@M(00 00P`p$@K $ 00,P$ a D0PL ,(P @ $0a   p 0 0  0$KA(cA 0-80LPS0 @h,K0hc S-LpP S!  刂T@ `V "j gV $0 3/D @jNT@@0$KkN_@Ac\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd 0-@PPL0S00  R  K0h0 0-<0L@SP0L00S0@0000 fi<⪳,P 00(c1- 0-<0L@S0⚳<Oi00<0K0hC -L M@`0@VSP(03@:rp40 S4  ScI@BY pp<0  0 R  HXppW0S Rpp 0<p0< P#0(K 4  0P 00 A00*A -@LPpA@` 0 RU@) -@L`TP (0H0P00P`@ 0-@LL40S 040 80S00K0h -LM0 @R <"p0CS3 :4PK p(&\ K0< 0000000P Q@ R@// 0p P/P // 0- 0LP @@ @ @  0@S0l R0d h 2/ 0l@0 0-@LNT000 -LN00. -L MPK %`@h PpP 0 4 R0 W80  (PxK8RWRW SW p- L\`PM?0@S  L00CS0𨝨W c H0- L4@P,?LP  K0h0c @0- L,@?LP K0h0c0 000/ -L`PN`0r@p00p0000M0S 0X΂0S1`0 $7`000`딐 - d }.`0  @0d0 0h000000l0`0SP `0t0000(00,000000S 0$@劂OPP M偂Ձ}X P l.0` )PP ]P<$Kk(c7A|dN-?A(cRAAAeA8-AvA -LM`pPMH4@V D84V ,4V $4V 4V d0t P0h5/`$K3V 3V d0 0h8/3V 3V P< S0< S< 0S`PH3V +0CV 0V $3V X 0  [ pq`P c 8` c2V. 0CV 0Lx   |   0 0 000d0h`06/2V/ 2V 0 R00Eoa t@000000000 0 0 000t@0000 0 000`PTA000 征`P,A C4 @000000000@00000@000 囁`P@ 0`0 0,K0(P ,0 `P9L ` ` `W W @W@W @W WW@W @W@WW WWW W(c(c -LM@`pUL1 P T  0CT 00 0@#0T >0TL0S# ,02@0L R 00080@ L R , 0qx@ @T@00CS0 K@}f~f -@P4L  <0 pKhc-<0(Q$P Q0/|d-4( \0^/|d0Q000/\ `P/0 !`8 00 (  , !/ cd dd -LMQPp  0q<0 0X `VY `$K0 6/P 0 S 0 0@ T`@ 0 Kl0K5TT 0CTI 0T`*G W X5T: 0T 0CTWW `0 0j: SPP 4T,$T=*0CT5 7=D Q q`0 @DoQ: Q7 > Q4 Q1I @GW 00# @ ,W 0<#X W 0;# 0PP @Kl0T@@S d00h3/l@ 0 @@a0D8#8S @DH$H 0D!Q00T0S; S< S S S 0T0+ 0@0S0+ 0A T 0S c0C S@0@ 0; 0; S' 0 @0D8#8 T:S00@2T@ 30D8#8S@DH$H8T@ /T@ 0@H$H0A1`A`|1%#(*$' p-L M0( @R1 $0S 0S+ P`40 CS4 ,0 0, !; S Kp0$K K03/$Q Q 0 0 %04,0 |d(c -LPIp0UPPS@+UPp W&0 `U`RP0 0)d00h3/`PPPPp U@ I 8}W`uI `AA 0!< 0`4 0 (   !/ cd dd -LM`wIT0@S P)q)p0S 0$ LPU% ,0S" 0p0CS00 4K40 00 ;P !< p0d P IH}<J@ I0 9K|dCcAA$`@ -@LT0`SKh0Sp Q` 0B0%31B %! %)P0SP 0S`0P0PCcMb 0-P0L@SP  R 0)d0h0K0h/0  0-@LL@ 0 - L`9PP@ @T@`V T0S LpW@0`4L`p@P Lpc H0- L49L@T  L 0c RL RL // Q-L G}A -<@`P LF  `P0(0|dC-C-+:R0P0S/ 00S/T`@ 0-L@Q pU-U-U-U-U-<000000 0 00000000000000G-!0S@ p0P`ᴀQ+:S0C\ E F\@0TP`ᴀ000P@,(`Vp`W  03#\0C?0 )c <-00000LDQDa \0@T ^? 0@DoX: X7@T4 AoP P U >  P = P Q  P P@PhUlNoV  ^Qڰ <x$Kk- pW A -0L`S@P S 0`ڰ < R؜ 0  0  0  0 0 -L,M0`T@K ^@CqTPK|䁟t%(KPU Sj PUc 0  0^LAoY YPT0KQ p 00W@D"*  Q= Q R !Q   d\ p* BoZ  RQڰ  "n S&x NA$A 0-Pd@LLT0003/X@ -L 0-Pd@LT0003/LPX@ 0-@LL@0 -L MpEPd@TU(K0`V 0 6/PPX@ -T0T@L0 F@ QCL`V@@TL@L.c@ (  !LP  /L.cH 0  !LP  //L.c<0 6(001LP /L.c/ -L Mppは@P ^|PP`ᕯ@ K0d`h00 0pdw08@0p 0l`0vAP.c -0PL `R p y@P@pDv0AT$@Pv0AL.csAAA -LMPP@ 0TPX0h0\0h0X0h0P0SLQ 003/P 0X T0\0R\0h0\0X K00S 3/`l0S 0`l p07/W 0-TPL@P0S 00S 3/X \0R\0h0\0X 0T00L0S 003/ -L$M`@D3PV ,>C0CVL G0CV 0V L0SP0S o dpWXh 03V0l0b3V 0VPl 000802Vp >:C?CV 2V0SI S_ SUn?2V o3C7CVdPp`Ud`^LP. \R\\b`qXWʀ 0! `! 0   , !0 D0 0DK@0  0!!`q0   , !(KP T0SL0S0 QT0SdPU 0 0RC0P!XP Vp 0`00CXPP P , 0q xPL0S ,020S 0 0 :/PXp.~fW|fbWaWdW cd dd$ 0L.c -@LP F@``P@ @ @@PU T0S L0S@0P4t -QPL@P P2C :wpPd`VWPX#C@ C <w00S 3/PPpX`AA 0-@L/CTP0 PQ SK0hS 00 Q-L wA 0-L@P\3P0BP 3P T0SL0SK0h0A -`T0L@Pp 13/ULpP`T0 0T01Kh/0T0 -Pp@LM`V$K 09/@ -LM`@pW$K 09/Pp0S@PRQ-\ Q <:#:^:\:0a@ -PpL0@C0`p0@@A `@!`pW8 ,0`@ -鄀LlL L`pPA@!0B"@p`V8 k,0p@ -LM@TP0L    lA0A`Pp # PR VpW*(K pA0A0000Q00 0Pe0 `Fh !$ Fa8 X  Y !P4 0 pW:X4  ! QY 8!  R 0 - 0 PA a@ S-LP@p t"~ `Y@`X8 +0S R-00@` R-L` \@p 0JhY P@Z8h --0S h &-P@ 0-LP@P 0S 0@S 0000R-`0 B"1\1L -@PlLPT U pP#80&0Z8 0S  ,0P0ppU`h pP -@PL`0P"0U#80&0P`V8 0S  ,0P0 R($0 0// -Pp`L0S lZ@+p 0000@ Q000 KhRZl.c -L M`l @RpP":pQ:AQ  A8/ 0x%\ 0 BP #p Q BB<"0 9P* K0 -LMl @RpP:p Q: BR  B 8/ 0l 0 BBl"%\0PQ 9Q*$K0 -QLMpP`@@C@0HS`0 p0S@0IV$K`0 `p0VH@D -LMR`p@@DT00 0 00 0 PU$KP -QLMpP`@@C@0HS`0 p0S@0IV$K`0 v`p0VH@D -LMR`p@@DT00 0 Z00 0 RPU$KP 0!< 0`4 0 (   !/ cd dd -LM0 H)@`QUʀ0!`)0) )   !00ZSP0@00 P 400$0X0@04 00$00 , 0 4 00CSpps(KT0 X40, @R0 4  40 <0 080 0b|` 8`p `4pX 8``ApR <`p`FQ0S`T0V`40 000000 S Z `0 dS` Qd`iJ240  de l B2pqhpp!PpLpx  ! 000| 040 \P 0TT 000 pZhpqgp }2Gd 00C0' 0R0p0pC 0 0RS0C27X5A0L50D50@50<50850451000Z%0 J0 Z }-(~-(~-(~-~-(~-(~-(~-(~-(~-(~-~-~-`p\p/ ` `.5;S? S S `L>`l̠ \" `Apppp0pppppSGQpHYpppppp)0C2.c<>x'x(W<8L"(#8`@4  㾀Q \4 4  X:꾀ᾀᶀᶀa 0N6aPn0 A0 >3p aQa X:    R  Lt5( (s@`p 0l R0T0: @($ ,0S X`YpZ0F<0 0f80 0GD0 0g@0 0HL0 D0h@H0 0PP0 V ^80<0[R33W ^@D1\R))XH ^L]0R))\3 \\4 0P0S\ \T c(#"$c4"T $ 8#<8#88T (4(#<0<a@HAaAyAAUUUUa@ ̠ S / 0-LQT0   R: ,0 30,#1 #2 R0 R,# 'a@ -L MPP `0p@!L,`1 V ` Q @0" 1!pW*(K00#0Q00`0@x b 0C  2 1pW:x  !Ry ! R 00 =' 00` @d@t@\u@ -SL4M`* 儠P@ A 040 0 P8 00 c1!0  40Z P0z c028Aq8 (K ^! D H!@ 4@A$$DL \@ @$$D1!DH!@@  0@1!! @$@Q@ Ph 01\ D0 0@0 1H0 0c0<0 D0S<0 HD0 R"@T< 40q0ZpL0 @0  p p@PA@TH0pGB @BS 1T0 1X0 0 P 800Cs80 p H0SD "<<"$0, 4#,,#4 <0@  R d R   ̠Ġ  1!,,!  0##4<!<<!00@\ 0#00#0X0 dE^fP0D0ST L0AS@,< $ <(,Ġ <  40#"̠4̌8"$,00L  R4  b ^   ̠$̌(   2. $ (.  00 <Ġ #,,#4 <00 N^<  48  0?00<0#ş0 "  0S T %00pPD<T!,4,8!0,04#$(#4 <  !48!0 038##4   mD 0004 1 00 0c S0à 4,  80,Ġ  00 10 H0AZ@ @ S 1T0 1L0 < 00@P0 0CP0 800Cs80 X D0S4 S 0#,,#4 < 40<#"<<"$,004  R4 a ^  ̠̌  1.| t.p0#  #4<00Pp03W#̠Ġ #4< m0<00#€ 0!R B L0p 0bX0 ^vL0H0SE L0,<  <,Ġ<  ̠4̌8  00@ P b R   ̠̌  1"" "$, 0# #4<0# #4<0@l 0#0 " 0S T $00@PA 0pq 00P0100 a Q ́  P |R 48 002#  #4< 48 0X 030##4 \d@t@\u@ -LMp`P@A #` !&V` QP0 "41X*(K 0"00#0 R00`0PZ1 @b@L00 00BB00Z00140 ?1X:Z  "  "  R0 R 0 "  "  R 4 80 # 80` P Bd@t@\u@ -@L4MP@PpWpCW{*P a`b. @  `P"( &  V`", &  S Z | $8 0,@ 08  Ql%S> 2 4 00 X9:808 80 $"448 8 #848  4   8 @ Q10""Ġ0$0 0 0S0`0P 0"00#0 R00`0PX*0 0'0c PR'`R (K裯,pK 0:,0 B0c 0!00#0Qa0@ $ !L  D #!P  H D Hr  b@P "< D    <S0 !X qt0p0 cR2 00 <0 T 14 \0 Xh:808 80 $"448 8 #848  4   8 D r @,K00!QD" "$,  <Pi\ H r0S X "0`0PD0s0L0 #  "0 < RGH rP !  " 0S X "0`0PX*0H 0'w0c <0PR`W; 0PED0s0L0 #  "0 < REH rP !  " 0S 0X `Fl"pG B ,pK0>, \"Ġ "$ @}Ϡ,K 0< T PH"<< 0"$0, l  Bd@\u@t@0000000100/ᴐ-<--x- -LM@P`@PpW3C\/*P`!'P*( V& `Pq*, & S!80pK/ K#8( |0$p|"p8#8Y%* 0'0c wPR`)W=(KpR R  80 ! 80` PY: !$$("($$pQ  R  80 ! 80` P,Kό\ 0/[PE0 S 0S 0 `F!pG -@L,MPP@PpWEC ZA*`!. V"& !P`0  Sx", & P4 'x7 |0$ '2 *<  8 @  0D  L0 H Y_*0 0'0c wPR`)WQ(K0R0S  %!0`0PY: 0\40$ \00! 8l<0#CX0D0cQ[0P0 @0>.Y0N0c^3\>P>HL!AZaP]10 X0pS   0`0P 0PE0 S 0S 0 `F pG4a@T0 (0X0050 0R 0 00/؛-x- -@LMPP@PpWJC\F*`!. `P"( !y V㊘", & !` S0PsK"K)80 X:80 0pS0S  x 0`0P$p|0|"pX*0 0'w0c PR`W((K0 $"44 8#84 4   p8  R 0S  A 0`0P,KQ00[PE0 S 0S 0 `F% pG -@L4MP@PpWpC W*`P!, ` P"!)V `8   S", p< Ƞ,Ƞ4 * |0$ ,,20  D  @ H  0L  T0 P YV:000X0 0>8S0S 4 0`0PY?: 0^<0$ ^80! @ nD0##C$X0Lp0cR#[0\0 H07'Y0G\p0cZ3\:7P T "BZ  bP] 20AX0\00000 0S 4 0`0P0 0'w0c PR`W(K0PE0 R 0S 04 `FbpG<a@X0S 0 Z0X0R  Y  5[ 0 0R000/x--,00S/  R 0ꬑd -`PLǝV0@P0# (㾝(  `  Ოp $0$p⧝P` n0`000   @@謑d"/ 0-P(0L@T05/@ꬑd-X0P H \  , "  䬑dp.c -pL@^@P P@@@ @S PUR  ^V WQ P@^@<0 N R C C@ B R@D @D@ N!N' -`L MpPd0@T U000(K 0 0 0VP`@ꬑd -P`$0L@T 5/@ꬑd p-0MPL`0PP@P  , 0< 0 00 20Kp謑d -LM@(ÜP`ᴜp  Xnp0``a࢜p0F<0 0 S$p`0000P ᭜᫜P(K0$  #80 0S"140 0 ",B,08噡*S: <00垓#4 0C0 0S00 A -L M@(NP`?p   @p0``a-pက0 S$p`0000.P 97P(K0$  #40 0S100 0X3 L1`0L00 /)Sr80xq 8e `H ! $P0  Q?K80T1 418<$4;Q?K 0 Q?K $8 T1R 0TQRQ*T180  0MK GKK q W0R0KKH  P 0QK < 80$+4 4P M?K00T!0?gP "4P 0L00 X10S >K @`?P 01L!0kPq 0 S/ 0 B 0-0 ML $ 00  " P 000000 R0P Z0S(K 3/p 0-LM@0 P0!$ 00PP0000(0$0S S K0.00(0P(0"0 B- (0 #A -LMP $p0@0( 堡0 `40 40Y :(0$p`000@0S0005T"R/ ` p@T @ T8 6:T @ e\뼂 )T T" T@pG `"`V 0( 00$00C$0(K pG`@8 D8D D@@ P p #AzAdd -0L`SP U U@ PP  < 0|P0 <0AAA 0-L8MD ( DK @0 Kh}@ -LDM,0 x0H0 0@( 0K !$ N0K 0 O4[S0 LK H0 0H0 LKtK}@}@ -L8M   +!K (0 0 DK @0 ^ KX~@ 0p-L$@0a@ @0 0K(K@P t@cWAdp@c^A -L M0&0K0@%0K2[P,C R pC`0P" (,~P{b T` 0RX00 K0 0` -LsM`0p1  (1 p 000"pP@0@q/K KFP!4"6 0)01, K201 @P>K000;!0  !?pP1 0p1 P 1R R 0S01 U h7@h Mr/K0hpp (0!0(01@00000(0:(0,0<,0;40 0001`010pPPP 1  0P 0C#>K000?_pPs10\p0P00ãp001 p /000LI Xp 00p0 0SEXH 0p0AX   P ~P_o l RPvP) U+ pP$pP-@0s/K EPq DUQ P`XЁ \P d01 @dT6Z0X0PX T ep(Kp@P FU AX <T ᑐ00edAXAWAjAnArAc -LM`RP} sRz(  X@ @@ p t $K@  Pb 1( Kq1 @P(t0S _5@p0z'P(V5@4(p:00(0& 00Z@P(0((  D@P(F0 (w@(P:T (D(F('5(F0 000 H@0 S p p0!QP@ F( 5@ c@ 0-LxM0Q0f%P@ K||@Pt 4K00K @ (@P   8  cevAWA\d '- LP `P@t0S dD9 C`4᭏00(0:(0 0-L MP @R@$K0( K $!K1/@P00(|08S4@F@K0 0-LM@K a0 *6PP9PP x400K0 0-LMP@,P 0K0@-0 R; r8Ap`UT2bWV.0 r+HUT' r$x r!| r r rcP@WVDUT r "SR 0t0 CSR-- -LLM@0S ؀X00,0P|`L X0 0 00t0S(! p pP0L \ 0P0X H0 C20 0000P (K $K L0H  l3<0 \D0 R1QD0 UH0$pS<@0 L0 GQ1L0 KR%K0P R$K 0 L l2#KVe -L8Mp@`|P8!!""8:#:0900 000X0Hh0Xx0)(L0(00,0LX#t0S  㟍\0KD0 0 @0 00 DK\ #KX 4 !0TKL P0 0H0 9P40, ;c(00|x0(0000L00t00$K -L C -L C -LMt0|0CSJU#iSR8=DPP Pi K80s $ 0XP80sYP(0 Ki@DA -LnTA -L Mp@|` t R02& -XPtP2 I20P 0!0Y0 &X K00C S!----------- 0| ( X R%   / 0+ 0, 0 0 / -p0@`   x0L00H& R*0X6\6S `&R \&``60C`6H&8!PeN` -B^ L@R -4=S B` `0S!>00CSʺ0 V0  =# C!  R/P 0S = C!P0S c> Pc> -LLMP0<0 00P tL0 Qp2|(`$0P0 D?P<0P,TR PH60@S\680 H0  <00#280 .80H \`60PX6<0 P@&D6 0KLpP 7(KL0X0 P00KX}ЀX0 X0Sp.B.0WP'0P 0 0P 00K000 L\PP0 00pW ԆK   ? TP TP WP R Wt H0P <e> 0X& 0T0 0Q 0B0 0S0  . X0B^ pS0`2 K 20[S0 *<84;@0 4D0 $K ?  0C  ?o  20  20K ! -4S S 20[0X0SPP .0-400,0*0`680A00H  h#A@-H0H \0?0A@P" 1TAc@0@-@Q0ST L0R PPU00A@DS Q U 3=?000SࠓࠃQ^U ?6?0000- A^ ^\CS0Q Ӂ0ѳ 0ҁQ/0 -LM@`1@TP5p4 Ka#KS#KR)< ,[+0[{.B B2$U 1_V l!<RX!9U5$K0V00U0;ų p-LMPP`@ 0 Kp02K1K(0 20Ġ$0K50 !0K{Ό2 ?0#K,K, 0KK_ P? d0 ꀖp@-0S00R0100 ^# P @`DS!?0 Q  P. 0Cl@ T @R@A@^00p0S*0Rꈃ@ -L M Pp0A S0 00.SR0 .QR 0@0S Z@00W@@(K \.\ B0@ T .T.Q ^ZS= QCB@ ԑA R\ \@C 㬑L\00R0S`)\@R_000S00T? WQ0 `X T@^ B@ 0\ L S.S @0X S0200`V T@S B@  )0f VqW|.`KT4KW 0Br Q c HR~ 0F0 PVm*00ꈃ@ -LM@p`0 Q s.R R 0G 0S/KN/KKY0` 00pp 0?KP `a         X@PPĥ(K -L"MPp@@ `ZSX `$K/KK$ X0@ H X K i   e  a T?KP p@P T@o P YpW 0SR@BOoB$SR 0!1RQ@ 0?PPET /Kꈃ@ -LLMp?00CS@`(K@0 `0RpPK   fK  ZK 00 R/R SYT@K 0 G 0 '?Q QPR0S @PB 0  ("(R !  BK  Q PR!?PR !?.0S AP R/030 -L`0Sq.\ \ R  0  /000S/| 00/0M000Ѝ/ 0P @/0P0 p-@|P|`|0ML 00 @`@x`AP0 00 @`@VA( Kph聑dcAA@/ 0- @LbE`EK0hsd -LM Q|L  K{. K -@L$M`0K  00PS raL S^,xB@x  !008P 0,0$0$00040XE 0L00s0X0"P0L0X0 !0\M $55%5L00t0 0t0X0S  40KPgd 402\0,XL0|@0L00x0t10 @pd0`S< 000@ <0K0$ 80K Y pP C K0>00C00$ \ 030 KiA -L4M0@8P 40 `L0H  0s $ <Mp(Kp 0L0\0S* ~pp0FD0 d0V80H@0 \X0X`40 080 h # Zp[ 80Kld0 @T0CP A)A 0b03"$pP00p 0 B AH00 9 Z0 000@  0\` .pV8 r 0040KPd0D 23h080l04Q 00#0 p 80KHSpP ~` L H0C200 0pB -@L|P<P *00`Q冏|`ŏsBd p-@LM( `$ r(KmPP⭏@Pe(0 0$00 001 0!00喏Kpdd -LM X  F KHA@P4偏K y'B갔ddd -0L`|@@ RP 4 R`0(PP\0S  0P0$ @0 8l@0 0C?o20P -LM L@   K8P$3FK0 0,갔dd 0-LM`0 x,0 (0 ێ0Kh@\PpET 0S < K A@갔dd -`|@xLpD2 @ Q ! H0P0,U xwx 0 踔d-   1 `00C`0`0  0`0 1 / -LM K# K0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0 -L,M`?oPV20R0<4 S8@p (KX R@ &L00 d0\PV l 0CP 230Wl0CL 30V00Q \0d Cp0X0VQp0D K00D0 @0KD 0HS<0 0000h00 00D @0R:0#0j 4P W@0 ld C@T  D V0& PQS\ R*4P  ) 80K000K< K<0 S 4P 04Kl 00 B<$"PPi<800 @4S:P \00sp0@ Q@ ""@ @00@0 D00D0 4V P D0l0Ch0c긔d0 `\!'0S/ -L M` @RP/ `0S 003\0.0Kpl0 0C#0$Pp0p`0$K00! z0$K 0!{0 (0809=p0\o0C00D0l $`0 B00"$ $ 0 0000 0P   Jp.0Sp(( P oJ$K謆@BB^B -L(MR@pPv\0Ss:07 40K08 K00K 0,K0l 08 B$"f`P= ,00400s7/0@!S  R 00# ,0R( r. AR040!,0 040 "  "Ġ #K8 ,0,0 0t0,P $K0 40%SKP040,0" 04$K ! ` -LMP`@0 0 0KjpP KT 00@-0@ l ol0LS1! cQ\51: P0#03Q0#S\ 0l o AQ1 -@PL4M`H0 QU(Kpi\ 0H0Sp`đW 0t00SP0S0N <0K0@ K80K#4 K   8 l0$ @  0C#0|PH0pW1`P4< % p+ P0H4  0  0 20<#4K0<0R00<0 < 80R*W@ 480*ĠᲤK<00 0*,K04 0#<00! 3<00 -L,MQ@Pp 8R 0p00D<K#40C\0 9D0 = 0@0 `0H D  R*0H Z5:V( 0Yp0 0@  " B r  /oJ L0 UL0 0 0 0p(KV`1@ 5  " B r  /oJ D0 UD0V`1@ 5 mNA 0-@P`qԁL,M80 U\0S *8Q 4  K0I 00K0,0K4 K40S 8Q  i8 K   , l0$ 4  0C#0nP4`20S s& S80000<0 P8 0:00 3K0#400P80000&P80K0 0080000 P80$K 020!00. 0-@L M00 \ S:0`0q`0\00PS *U@ r; 00 x3 UQ 0000s(0S `U IP(0K, K Pz0 K ( l0P ,  0C$#0P $K -L$M@8PX`PpL00!h0!s00P0hSh  h0p0l0t0V0 l00l0 40K P0 (KX0 Sl0040 00K0440K^0P00X`F400X RX0 0l 00P 480 n80h  00C h 4 00Cl00 L0 00 CS0 4 dT040 l0$ BL,p 0C#0$ 0WQp긔dM!Ѝ/ -LtM0 Pd0 0H0 |@l d 80 3pP )0t ` (   CRp(Kd     pP d00SpL0  / 0.S,R R(0.S%`0BP` VrL `l Rt R3 tX0   l3pPX X0`BooSb`V $d008KBP P5 P0p0 ` p  $0`p0 0t@l0`0 C/oQ" R000X0 0 x@ |@ `0 \0@ SEL0K0D KP0Kx P P: px  0`lD A)A@ 0bHK@L"<3$sPh 0h H@L0Sx00x0 00h  \ h X0QQ S0X0 |@ Qy0SO 40SL  3pP3X0pS0X0 X0|@S0FB0F,@00%S0X0 \0 0S0 00\ `0 ` h0 0h0 F\`  P p0S=  \8KdP7\0 0K]P0l0 `,@SR00\0F00\0RK\ 00 QK[`q \RK\QK[`LQV R V@BP` HX0 =X00`0 P hR@l t B/oQ" R ` X0 ( t  2pPX X0`BooSb`Vpd0 P X S`Boob`V #d00d00 d0 P rP S`` P` B -LTM8@0X \ (0pP0 ,0PS:p0d0A1000 H P 0 \| (Kd \0H2\0,d@0K00H0K4 KTPlH04 A)A0Sh0DK,@  0b"<3$9Ph`D @0 0` `/H00I0 0J0 0L0 0M0 0L0,K  0\0 0! 800sP0@0T0 00S0P0 \ 0\ `0 0,d0 000h0 0P0 P0h S#:T0DS X0S} L0 X0rH0 L S0H0 H0S<0K HP0<0X |00ah0pT0DS5 d@0K `H04 K06P,l4 A)A0 0bDK@"<3$Ph0`D000`80 0d` 00\0 H0P0P P00P d,`@0K4pK00 6|Pl4 A)A0 0bDK@"<3$fPhD0 000 0X0 P0X S T0DS? e `FPfh01T0DS) Ud@0K F0 08;Pl4 A)A0 0bDK@"<3$%Ph0D000P0 `F0P0 iP Hc -L$M`8<0K04 K0 @P @DOoB(Kl4@ A)A0 0b8K<"<3$P8$PW h000PPP K -LM 0$ 8 K -L$P (, 00 RJPQDKQ Q:@@ 0/-/0M000Ѝ/ -LM K K 0-@`p Lpp X@`@`b $@#0 4@cdd^ -LMPt0S 0SB@p4K0 0 K4Jo`P⩒4$[$0  $}/P@$0(KJ$P '0   g/P@(B 8. -LM@0`S@P`0p@|P *K $ 0KBK( $ PP ,K2K -PLwH0 0$qPP/(0010D000t010@娠000 000(0:(0l040d000 L(Kx/|j00P@<P T P ww00PBB@B -LM0q0v P@ K@PP 0 ,0 0( 00 $0  0K8@ 4@ `@P KKd@P 8S cevAB\d -LMPR`@$K R(   R@ @@ptx| 2刁|000x000S0ӈ0(0x p R(0g -@   H@P p0 P(y@(0(@@ (0@& 00@@(-T (a(0(-ppw  (1*@(,T0 (W@P@P@00 0 0g@u(T  (%*(,-$ (0Reea0S,0 $( 9 00(0& 00N@@(,TI0100SB 80( Kd@P<(t0Sz @5 c@ 0-@LP0S WK0h -L M@0S0s0 QP"SR0qQP(SRx0s` 0|Ps8p  S0s  St0S(K0 QP `0(   0P0 QP$SR4 `0(0  B 0 @}@P #SR 0R 8c$SR 00V T0 HVL0 0L00000s `0( 0 tA 0 F@P L000L0000|0s# `0( 0 tA 0 (@Px| L0 0 0L0000$(Ko {\a` -LM0@|p0S   R`0 070` S 80P\pH@X1!8 U 804 K00P 0PEP80l @<)@0 l2>, (K8 d0l 0C 3ß#KYXP -L4MP0S (KP00@|`\ P0t0S8p. pp R  \ \0P$K0KD0S H0D C20 000P 000 0 = ShZD $KDd0hp@1à@ c SΌQŒQ@ 4 R300 D0\  0 @DT@!0KKP0$KR 0R<0K@04 K0 ~Pl4< A)A0 0b8K"03$D hPx8 p00 0CS@1 D8Z0ST -L,MPt0S S ; 0|p@ 80 8` \000 0P00S(KX0\X0`0(0@0D0 \0<0 < ʟP 0`,pd 0R ``8`<0 PYQC 1N`0 /PV 0 \ h\ >0>00S HA00`, #K0@0 H0@ C2000800PD0SI 0S\ 0 X80  }ԃK@ 00t!0 0\!K 0+0000ZVj80X -3 0< J`Rp`\GPd V40 #00 (CL8QP |  0` #K 0*P R1(Ko+)BM!Ѝ/ -0 L|pt0@S|`P IP W -PL|`|@ V@ P  p!@P 00 -!0@  B@ -LlM0` `p ` d0 ` Rp S `R @p(d0S dP  (`@S `0@P`|PL00 0S 00.S |0S 0 p00 0 )@000l0 n|0h0 d0`S|00 h0,0t0 h000|0 p0 ^&@`(|| l0XX Q00Sx0 0 TS dL0d0 _h@P `Q0p dK@P |0h0 d0S! |0S L ; 0 EP l0S0 hX@Pd0 dLdd@ \ Kp|@PU040 00(`0 `K@P ((Kl R @`0Sl0S 9~(`|0U l0Sx0S X0Sj|@,00  PK \K h0t h, |0h 000 p0Z@P PK `L(s400400 ,0@P0 `l0S 0$ tD0 @ ( 80 $08K< 40 (0 00 d 0@0h@P @t0`40 80Sh0t @040 D K080D K` 040$000(0 00@0D8KlTd  Bp0C2 A)A b"30$~@P80h 00:!40sh08@P `6`'@dP 3#000B@@BB -LM@0|P0t00CS8c)WV`808 dl0A 0Q a6WQ004`P؃YX$ 000#SR $Kk'8l A0)A `18< #$KIB -L M0P|@"X7@8 808!$!60?77K`BBA0|0\ <H -LM`|t0 S #& ` ( !L 8 x@@S p @t;PtP2 I02pP!y<0 o;$Km00C S[.[.[.[.[.[.[.[.[.[.[. 0` / 0+ 0 0 / -LM0|0d0 L0` p00 0S0  $K0 0d08P0!0p0@S0 T0  0#20 o0T 22`0 d0X0S rL S$K@R0L0Ж壂0P0 X@00s 00L RKldh0l A A1< a20X0 1\0 T0`K,<, 0 0X 00000 ,, y000Sf: +$K`Pf 0$KT0S KT 0P  P P RTT0 dp Q a2SQ\ L00 0Ch 0IY0 010!0 d0\ \00L CY@0K04 K<0Kd`P9l4` A)A0 0b8K@"<3$`PK8 @00C S 00S00 000c00 8000 0Y :$K K` R0VQ*&K 0 \0 0C0d0\$K R? Q0R0 0 0S VP   0+o0 0 0$o(KQ 0S0  00 D0K :p4[0$K 0 $Ke 0B0K0A0K$[Kq0L (KBKAK[. 0dl(K@T0 )K(K0/0L NRK0  n><20p0 >t0 K)K` <, 0 0 0 nP1   @04K00S'*8dl d0KP0C C c3̎|0 T00"x KH0K/0 "2- 0 00  P 8+`6$K 0&KT0S KT 0P  P P R8`T0 Y0P0 \0 $K&K\ ?*K0P0 a$K&K@0\0 $K&K@0\0 `*(K0 0~#A#A -LMP@p0@`0 R@,K,@K0V 0T0,L0 0L0800"0 VT,K,@K`0R 00 W@T,K,@KM00P N0000K -LM0`|@X0S, \0RP#+* px KT KPP 00 CQP\H (K %K#$00$0!$K808 $KQPā#%K0L#0 0pLpqp' XppW:#:S%KP0pp 0KP '2W" H0C2000 0 P$ 0 W !KSR 0!q#<@P  00  Y B P 0H0 K! 0 4|a ?0) qԅK40|0 lK|!  ?R$K0,&lK000A@P\ R $000C\@ %lK40040 @%<00<0@%&KH 5lK1"N@VP0800`5lK1"K@T&K%8->0C6Sy`K0 LKP @ 0 `000 00x0 00 兟 0@`(K0S[x0`$S``V o@0Sx0p@&K(K0@$X0 $`(0lK0(0y0K0x K0C@P xp?)KW800 o)K (K4#"(KK3`#R 0V03`1`0(Kj@P(K`"(K`+#o傟y0[Sp `b"m00+ 0U&KK0 QPo1300x0 13 @o(K*0`(Kz0@x0 !3B=3@z&K(K$0T0 z 800 do$ ? (KZ"P@$ ? (Kg"P' ?)K11000(K3j@PV! ""8oT%\@ 9o0 RuoL0KY 0 "(KK#R K`)K (KE"0#B-#1T`!@@@8080T0y0KY@Wo0 S=o !303n)K (K-"-on0 R90#B-#@@@808. d cBld1u -LTMP0 0p`0 0S\ b t0S R0P(K|000 `0040 x81D0 400  401D0P 4%t\ @P40AUT\0 $K0`@X0 @0 L0t Q  P (Ko>0D PPP Q QN Qt'000\0PU&  00! QPP0<0 080 #KSRKH0<  C20<00 0PP 00!QP*V0@0  PtQ Q` QX 8Um0SV@&00000D0 0;00@PPXl 060LPP K0`P@0 kfV`!PD c@P 060 %*PP 0!U%(0P 0D0u$0L0 0T0 T L0S 008S ؀00!YX0\T L00$0C P 0< <  R  X #RLX *^YK00 CSRD 0D0P +#800800040070 `P 400 ` `008So00!QPi0@#000P< P< YX 0H@0 L <0T0B@ <0 0I S103X0 5@000L0 `00T0 L0X*0L 0Rn*0n@0 $00CY00 C$K)!<00 $K400 0 0  0K0K% 400 %KSR0 0  0K`@0P0``t1`E0S400S008S ZDPIP 0 1 %0600~P '0PT0S 00 C<a4000 0P < 0P < i%$K@**P\$K X0S`g *dP c dAcB -LDM$@`@@T  |0T0 0P`000<X0 00U RL KP d0 0PP0 d0 + X pR Z !P ' PX?T08#10#W00S TKlXTlP L0KR  (K1 Cr#ӑ #ÑlP -ljl0!P!0BqґB‘X0S &KT0T8l&KȟH&KT0T T808k0ST6lX0S T080l4dH@o/ -@LM`pK 9 K0 0`K@P S)KP0@ K4/@P9[W@009K K0\4/@P H5)媤W 000 0(0 Bci'BiEBCccB. -p 0LPMP0hK`嵣@P  )$K. RK dK!!>W3K0p V5K!>4K`0@` P @d K0Lh4/@P 8(h^(0( 0 0ളjBci@BCcB. 0-@@LP*.jP%(010eB -PLM@ `K K0 K0@QP h(K\P\0p K7/PD @` P0 K5/P (Bc~iBiB 0-` MLpP0K@P t(K KC K!> KKP0 @ @ ` m<0 K0@04/@P T(ɣBic1B  0-LM!K000K00  8 K   -LM 0K # 0  0 % K !>-LM1K00 !4KKⷡ K -@p`PLLMd ` P@ @TaV`|(`0S ~P0T 7  `03/P PP B (K PP 0 d8/P 'T PP *PP TP %TP 8<0 X0K04XP PT0KL KPK:/#PX PTK03/P0TS 0SP0 00P0  000 C/&h0K00KL K4Ah 4/P#P00p  0@P< R l0R  C N 6l0 <0 h0K0p0K04Ah 0KL K4/@pP #0D?oU20S 0 )#T T0Sp0Sh0H$T0S @l0< 0Cl0 ,Y @9 15倀Kl0 <0 h0K04Ah 0KL K 4/#P@  P#P@ l0< T0Cl0 0S @T z @xP 0 |0 0x S0x0  t K xK |KPt  凅N40Q$(10(1@f4Xw 0S0Y 0 0|00x00l40S8 8\, (4#\ @  1 D T\ B!  !  80 h 0 l  D  T $ ( Z 0003 000 s 00bR0lh0Y 0  P:ll0 00 0h0 04#Q@P @P` &00 0`( "4`#/ -LLMp`0 `0P00Y0 H D%$`(,,56D0T H<0 4 L0 P$KH  :|`#:80 ?%Kt R Xtv40d0T0p0<0t040x0 L 0 P QPX@ 0P S 0L S 08 S%KSR`0H S 0-80X0%K(T0H0<0L040P0$K%H0 `00&0p0`0 ?!> X X<: Y`0De03T#XL3 [4X0T 8<0 p<040  O?4 <J0 Xq$K0H0 {X8zc0HS20d0%K-{;00-L0Y 0P0 0G "00 40 #K  4 4 8 4 <408<0@40@|0 0)"`ASRSR 3#,( h1Z &<(K8,( (,<80p@ ?@ 0|0@x!0S`0ʌV%b0 00 !T%  8   (088 H`@td@ @xd@c 0-LM@ P`0 0  K0CT D P0 oK0 0-LM|P@8  :8$b0 00 !~K0h$K0 -SL,MP`t X@1\p #K$SRGP Zt0Z㔡 S  QP;`0 S00SX1`0Y3 ]b1 4 10B !S0` 00N 0P00H0 00000`00X0181401zb (KP0R000 4 10BX Sb1 `8N 181Tb@cbBhBQnBB -L@MP` pX @XL K000 0`0$(0 1 !  :1P`V& ZV1 -;;:10 0E4 `P 1:10 044 `0 000 000;;1ǨCcBB -L$M@`LK pP  ?ༀX (K{ xZ (20 ?R0 R00 000帀UD@0;0000@<@KzK"RQP(40 S L0 0D00@c -L,M@0 0P`<KH D  0 T00Cz S 0D0  @ K DK HKX @P@ ~s< ?@4#K14 @P`KPDʤ!0 SA008@pT1 , ,0K 0040050000@@?0S0 ?0 ?@?/Q P@@0S   0R00   RD DKHK @PH0 0D0 0(K@clAc -QL@PP @Q@ 090 0^#D R0p`b0@@^D# R0p`0b@@ 0-@LP^0S 6K0h^ -LM1Q刡`n^0S 00"^(Kq崁@T0SZ@^)LKPA 00 0^0#K-K "KU *K KSR) 0K"KQP(0l R  t0K00 R 000^ 040 0!@!KQP0| R 00 !/ ! c] R100 1J`P q] K0܀`V%@0P0@ `|0K l0K0400 0P0 ]0`0pP@G]P 0C]0S`000 c|@BXdHBHd.PB8dYB 0- @LRPK0hB-Xd -LP`  @@V0T0T0px00tp|@0 d0T 0h-h d`dX\P[1 1 0&T 0 Xd|dHd c@ 0-LMP0K/@P @P0|00 yK0 -LM`pt0|@SP PPPU 00|0 18 6008o<08t0S(0S ( U 0 -K cXd 0-PL|@t0S (0S  0 (i@QTU\XP P t0S8[|0شdHdXd 0`( "4`#/ 0-@PL[0S0K0h[ -,PL@U0,0Ȕ1  t[`p1S[Khgz p-LM`\P40Sx1U 0@ +z@Kp ,`V@0 080@0 0z 000! 1S00 00A4/@P@U% 7T 1S 0 0 0N> 0 T 0@(T @0 0 DR23200   (T7T1S   cgBB -L$MPp` u4P@0S1v  \P7`$IV   Q- @$Q  ! 0$P #  B X @ @0@0P2 #101(K#0 00# $  #  P@    <KkiZ  M^@ [@ R @ R  P " # <  0 3SH L0SP0\ 0 Lu  P <  0C S00S 4    D @ H D@ PHFQ<l.t...d.)  #RHL RP \  u0P0 , BR  R P  $ $ XD00PGV.   #RHL RP \ t0P0 , BR  R V  ` P r ( PX00P Jeddd dJeddd 0-8@LlP0"0K0h@dd 0-@ML HY d+ \P\00P0 D00(0 ,00p0K0@dH.jB;ABB 0-<@LyHeYP(pK0h@d0/@d 0-$PLH@UY00K0hY@d -QLM 0 00 3 KK 0 KA -L8M0@< ,0p,0#O`P0,P 0080 R 0S) y0A<0 ᕐ`PX@ {0  $0K0 # 0 0 ~`P!> #PKL` P0 `P c{0   $0K0 # 0 0) b`P >K52"@K4K`P80' >9`1Q 0`4Q  ẚ1 $00R0S 4 [`P 101q 0A  10100S+x` |V`1eeo∀` `P1@010@00@1m:d`TPLH``\`X`l0h`p`$KS x` |V`1`eKn∀ `0 R  00 $0K0 # 0 0| ϓ 0 R0$K00!“|x`ሀ`m`Cc@scdB -LM@`1 (KQq尡 #K P4Q`aVʀ 0! `!l!0 d!\!   !@qW0S7(4X 0!!`a0    !xX( 00  ЀK0X8 帶@嵶P 08 0`ሠ R (@- 0c@scCc cd dd@dԗddB -`@0PDP@0L1P0젟&c0`PW1  zp 0S %pW4 +P p1|<1 V   V#P P0P`#P0VCc 0-@LSW1  <1K0hWB -@LBԗddd@Cc 0-0 ML $ 00   K萃cMBdd -L0 d 0-@LP K0hd 0`( "4`#/t00@-S|0`/o"\ R @P< BACB < 0S0#*#0 0P/(00CS(0/0G@@0s/!R000! 0S  ! 00 -`LPnfV@n0000 -LM80 p0`@`4 < `FWV0 0Ј0s 3SH L0SP0\ 0jQn00@h0 W 00 Z pG0 00 0 0C00$ 3SH L0SP0\ 0*n<0PSWn00P0- 3SH0L RP@\0@$0<  0CSP Z @@ 0 0}0J0000000 0@C@@L0 00D<  0CS 00 S ``8 040@(K -L MpP`@0 U   Yw  # #RHL RP \   R HP(K`W0`00``P@, BR,  '  0 00 l000 00 { #R H LPPP\ P  PETUUWPam  6n0@H0P0H0 0000`P0 0  B @mfUnm   U PEU`@H0 00V  W0 P @ UP!U  0 0      PBP@PPPFR0 / B\0H/ -LMP`< @0@ @@DY@0   B<0R`WT0 R0 <(Ko0SD0SA  0Y80 0040 00 00S0 R) 00 B 40I`V* @T 008 Spp0DP00@D0C00 80080 0pCp 4 00C0(KH -L M`P0p 3SH0L RP@\0@ @U$@0 00(KL0 0@DTp{p@DT000 0PE@@p3lU@al0H0\0000W@00p  00 O00 0 B  0 `VpppU`E! 00PEpp`pM b00SЍ/ 0- |@Ld0@PP\0P(0S (PPH0,0\00 ,QU0 0 K0hشd 0-|PL r@\0PP0SP@@\0QT0K0ha T0-QL`@\0P(PPE(P\0PU0KhI@@ -`pL0$A |P(@T Y "?X@Z7 @HDA@\0PY @T@\0Pu0Z\0{P@T SR @ 0S , 0$0,(00(0@\0]P@@شd -L$M#K`0p000 #K0|PDB (0SD0 P0S^@0K#K`\03PV ,0 SR$0 Sf uh`00V( 1VT \0WP00(00@0 PQP0  0 ܃K Ԁ$Q, HQH,@0 < 7< @0Q@0000000@000(00(0\0 PV (K@`0@`@@I -`0|@`8L888(0S\0PO0#90#00 ,0S ,  , 0,`VUH` PP $P`\0KhO 0-@LP ]lP 0 S % 000$ 0800 $<00,  $ ( 4 0}IP0@@0H @0< GO0@ +lP0شdИdCcؗdԗdܴd 0-`@LP lP 00CS0((O2 @ lP0شdԗdܴd 00-P@L \0"R B C@ U00' 3SH L0SP0\ 0i0P00 P U0 @@AT 0 Sm00<  0CS 00  -L`@P P0  21< 0,( $0#00(,00$4 88<@@HDPHXL`PT 1R01(00S00 04 $ (8},@p Dv0Hs4Pp :l8Xi<`p 0b@@@@ -@L`P0Qp D' P 3SHL0SP0\0  i0 0@ <0CS00S000800@P 3SHL0SP0\0 h0 0@ <0CWS00S0XX00400شd -L M`0 p@QP40 ✑. \ PHLQP\ h00@  AQQ8  0 04@p(Ko_\ PHLQP\ {h00@  AQQ4  ,(H PX`شd P-L P 0 R00@o0S0 ;o p-L MP@`|$K KP"8$6$)M191fM|Kp.@-|0< b a < <  < AV añBT ñ@-|`<pAR0A 0P0@-|`<pBR0A 0P0C-p|0`<  a< BT ñV añC-|< PAX TX" Ѝ@TP`p@@XPTC-p|0`<  b< BV bñCT ñC-|< PBX TX# Ѝ@TP`p@@XPTP0 H R! D01x0 R R /`Q @@ 0-4@LD0SD@pP K0hLشdd -LMp`008 < 40 &g40(0fS00 4g0 0P #RHL RP \ f00P 00S g, BR  R @ <0D  ,   04V V 0 3SHL0SP0\0f0@00 3SHL0SP0\00<0CS fW 0@008`0000040 \ 8^ GqpG 40@T@8p @* P HL\P\\ `FffZ`tf0`0@ QH LQPP\ P P  P `\  PEZ P1  0@ 0 0JZ40pCWV0T0ppM<0CS00SN0000S000 3 0` pPW 0 000CSU0000 000(00 00(K0) Q HLPP\ P @ efW@e@0`P 3SH0L RP\0 00Q @ 0 0J W1 C0 P pG 000 00شd@@YB -@L MJ 0K#0 R Ai00K 0`( "4`#/-// -LM`p0PK` 0@0 0KT0 0P@ 0 0 000 0ᶗ?oP20S$K`Ac p-L M|P`80Q03 :@ K2KAK(TKp -wL@ J181[J(P `PW0S%` 5`P W I1819J1p圀 01J`P5[<h`yIQ O qM zK n0 ᙒCcfB -0L`(@S JPP@ & -LM0K@ヽ`px 0尽PP0命(K)P  I/o``" FP@,/ l0-SL  $0R x@ p-LM0PS  C  0C?S@ R`0K`;@P 0\@@CK @P `Kp -L0 040謻dld -L Kh -PL(KU 400004 H0 4 H0000H0 ~ 0EQ QE!(T喾0 3SH L0SP0\ 0 a400004 H0 <  0CS00S4 H0 00 0H0 TEP 0D K00K@PU <0S 0S 1<e8 D0 04 0CR|zW0400D0 00'R 0<W0t 0@ 0PoDB%K?` p 0p4;0` %Ko&K?` p0p4;T0 4P0 %K!\ \0p&K/ @0P+4eK`VpR 0b"`0 # P$@ 0$0`|0 <eP@KDK:PP@ m ?! ?! 0$##$UK8 D0 00C UW c dYBB -p#@`LPP|||ßʀ`0!``a `0```) ! 00cS0000`V700 `0#g<`oက0 !`!0    !0 ,Yڌ22古 ⊤Z@<0 P@@0 00SdSd0D0  : 0S8: R/ R,|| | R`| R|0| R(|   $ R/ R,xx x R`x Rx0x R(x I ( RF/  R,  R*@ʀ R00  40S$00  80 S00  @0 CRt000 S0400S00  `4 , R``V00ShP`` P0 8֍ x cd dddCcBB -L4M`3p0PS ]( c`(K z0崠00@ḡ10Qt D0@0<q?8z?H0 3 P0 0 S`>C2 |2圣 0D0:|0x000$00@0t 00 000`Pk< 0 00040'S0 c0?o0c00400SP :D000 @0KU`PK@0\P:"p0  t0Sv C  B  A @ ? > 0 B {:(Pt0S0t0L00L0Y0 <KPp0p t< KUG `P sDqz b-`AcBBBBdCcpAcB -L$M@Rp 0GS( `1 V Q <0 iYPP00 (K0P000 040PP000|0 0x0$00(0@0,0D000$0400" 0S&  -`L@t0 CSR 0|P P  0 P  w0 0! P 0& c -L4Mp`0|`0@8 ;8PPh "\D00D0 D D0KU@4  z 8PPP# #RRHL R \P   BUL0SC\0P  00 BRC8]U7z, BUT DK4KPP00<0K0 0@K8K01 1 PP Q 0,Kp 0 0JPPN <`(KU 400004 D0 4 D0000D0  0EQ QE!(T坹 #RH L0SP0\ 0 \400004 D0 <  0CS00S4 D0 00 0D0 T00t0S00  R,0 dYB c 0-@LPA0S K0hA -LtMp`0x *0|`P@|00|0D  0t0 | t h0KTP Y@X 8  " Q1HLP\PPP PEZL0SP\0PPP00PE U!R\Z\PEZT hKXKPP -`@`ZX0000X h0 Xh0 00 0h0 W0J! !B(Tٸ|X 8PPP QHLQP\AUzHL0SP0\0   CR [UX0000X h0 X h0000h0 |0EQ QE 0!|(T呸Q0 3SH L0SP0\ 0 [X0000X h0 <  0CS00SX h0 00T 0 h0 dX 0F 3SHL0SP0\0=[X0000X h0 ;   AUT hKXKPPCW7@n_`?P| T808|0|0V|00E?oT 2R0SP(KU d<  0CS00SX h0 00 0h0 |0 Tqt0X0 k #RwHL R P\   BZaL R0P \ 000B S %[ZX0000X h0 X h0 00 0h0 @ J0 J !x ·T0K0`0K00dK\pK0 p0 PP QY |0\d <0 000CS0d0  l K  `Pl  `^P,000BZ0x hKXKXPP Z@P 0 0<K`P<0|0 \d |`000CSl K  0Pt0 l  `^`tP#0d0 42 0Rx  ;\ d0 0 0CS0d0  l K  0Pt0 l0< 80 4 0 $K'K'KD QPt \<QP8@00C?o2x0 \d P 000CS0d0  l K  u0Pt0 l n`P# 0 0PKz0Pt0 PY|p0Sx0SX08pX0 0x0 ?o< K2LKP `^X0%( @ ` dYB d -LdM``0Z 0`` P\ z`(KU$Ht&t00t0 |h0K    `U@T  8   $ Q2HLP\P`` `FRL0S`\0P``00`FV"p Yp Rl`FRT hKTK:`P! ]P$RT0000T h0 Thp 0000h0 0p B! !B(TD0SMt]P?`| U808|0 0 3 0F?o` 2R0S`g QH L0SP0\ 0 VYT0000T h0 <  0CS00ST h0 00 0h0 TT ? PHLPP\ 6 hKTK`Pu`0K0d0K 0X0K0\0K00 031`P daU Xd |@000CS0d0 & l K dK XK(Pl  \\`G  @Q0h`000h0  A0 A! ᓵ2 0R@p@ 6X dP0 00CS0d0  l K dK XKPlP< 8 4 K( SR00p0 t0D S8# SR4@@AoᩒXd Pp 000CS0d0  l K dK XKPl PP 0d K0XKPKPPpT| p0SYX08X0 @?o< K2LKP \K\X0%( dYB c d -LMt0S00 K p-L MP@t0S |`P t  0 gKp 0-@D0L a.=00CS0K0he=\He 0-@0L|8(<60 001K0h/@We 0-@0L|8<70 001K0h/@We 0-@0L|8(<60 001K0h/@Ve 0-@0L|8<7ؗ0 001K0h/@Ve -LMP` @KpP sK0  e`010000 pP0 R c -LMPt0S03@{{Xk `0 0`0000 00PS R  )"40 0 20 40 Q,    R  (KQ. \Q z븀X    `Q V: I  B  `  pp ؀H0 d>dB 0-@@ L0 0@K0h@P0B -Lt R02 3QP #SR0|s0s# 0"`p#(TL""a!"0(1 1yP  0? (KX""0 10 QP Z X0 ba0!QP#SR0s tQ(0 1:P c -LDM`0T $0|`P T00T0 D H0KYP4  8@@@# #R`HL R \P   BTL0SQ\0P  00 BRQGJTE, BTT HK4K@P00<0K0T0DpK8K083 p1 @P YA 8D 0 000CS0D0 X @ K  :PP@ O <M@(KT 400004 H0 4 H0000H0  0DA AD!(T垦 #RH L0SP0\ 0 I400004 H0 <  0CS00S4 H0 00 0H0 TP 0 00KPPT <M8D 000CS0D0  @ K  @P@  P<{M?@P@ 0P@PT8D 000CS0D0  @ K  @P@  P<RMH@[Y@ dYB c -LTM`0`P  @_AUT0|pZP0,0`0 0PX0 T0 VK&X00X0x0` V0\0 H0KZ@4 x 8 PPP$ #R7HL R P \  BUH0L R'P \0 00 BR'IUE, BUT HK4KPP& L X'(KU 400004 H0 4 H0000H0  0EQ QE!(T儥4 0@ 3SHL0SP0\07H400004 H0 50 3SH L0SP0\ 0 H400004 H0 <  0CS00S4 H0 00 0H0 T<  0C S00S4 HP\0 00 0H0 ZP05 P000D0K 080K0<0K00 021PP dQZe 80 D 000CS0D0  @ K DK 8Km@P <)LPHd@ _P 0D K08K00Kj@P0U<18D 000CS0D0  @ K DK 8K?@P@ 9T 8D 000CS0D0  @ K DK 8K'@P@ !x0@P<KHP0,K D K08K 0%@P0P D0K P8K0P <P0 KP0P<KX0Z`F0X0 OoT0BS@T0`T0 \0S`|P dYB c -LM0 `0 (P @P   00 `0AWV0 <0 |0@K0 ,,<K000 0SX040P 0 00 0K00 0SPW+\00\00 |0R!01S   0K 㠐 0`Sp 0 8PPP$ #ROHL R P \  BUH0L R?P \0 00 BR?5GU3 w, BUڐ KpKT PP@ K0 W0S @K',000C00 00S@Ka,@K,<K0U00(KU p0000p 0 p 00000 0EQ QE 0! (T団p 0Z 3SHL0SP0\0QFp0000p 0 O0 3SH L0SP0\ 0 Fp0000p 0 <  0CS00Sp 0 00 00 0 TUp 0 3SHL0SP0\0Fp0000p 0 <  0CS00Sp 000 00  0P P0S~ P\F0HL00X'@PKP000\T 40A30p0XP0 0C00 00 0 0C0 H+00000 +  Bp00|0K 0t0K0x0K00 00|61PP Q0Sz t| |`000CS0|0 / l K |K tK00P0 % xIP<  0CS00Sbp 00000   }0K pKePP l `5 0RKt |p0 00CS0|0  l K |K tK0P0 lp0 %K )KL 0 &K+K+K\ QPt \QP@ppGor' KSR0x0 0C?o20 00 ppp p p t| h 000CS0|0  l K |K tK0P0 ml P" 0| K0tK0hK0P0 ^0hS|` 0SWX08`X0 ?oT K2dKP00  U 0S㜐a pUX0%(t |0 00CS0|0  l K |K tKT`P xIPlJPxIPY0I 000 0C0 0 00 `R`00 -Zp ZP pp*0a夠B  ᧡0`a;*0S] |X0pH000 xHU0 Y0C0 000 R 0 00 0S0Z0SG 0 C0 0000C0 000 `Rp0`0 * 岧P  ZY0ia0| K0tK0TKT `PkTJ@K<KuPxtHBB dYBtN/ c d -LlMx0 `00&|p@p0PL0p0$ H 0p0 t p h0K TP T`X p 8  " Q0HLP\PPP PEZL0SP\0PPP00PE U 5DZw\PEZT hKXKPP H@!ZX0000X h0 Xh0 00 0h0 ;0J! !B(T彠XCG@?P| T808|00E?oT 2R0SP(K0 3SH L0SP0\ 0 CX0000X h0 <  0CS00SX h0 00 0h0 Tp0X 0j 3SvHL0S0P\00 0CZ`L0SgP0\0  0C S CZbX0000X h0 X h0 00 0h0 J0 J !t 5T0K0d0K 0`0K0x0\K0 0PP GQT \d |@000CS0d0  l K dK Pl  `=G P*<  0CZ0t hKXKPP Z02 0Rp`pp 6\ d0 0 0CS0d0  l K dK NPlH< 8 C4 @p`dK;(SR00p0 t0D S8#SR4@`p`Foob\d P 000CS0d0  l K dK Pl @P 0d K0PKPPW| p0SVX08X0 p`?o< K2LKBP `FX0%( dYB d -0ML00 - K -LtM`0p0\-|`@x0P0x0H  00|0 00t0 |0 t p  h0KTP Y@X 8   % Q4HLPPP\PPERH0LQPPP\0P00PEU# YB R4 \PERT hKXKPP" 3F@`$RX0000X h0 Xh 0000h0 \0 B! !B(TݞWO@ F`?Pp0V| 808| 808p0|0T|00E?oT 2R0SP(K0 3SH L0SP0\ 0 AX0000X h0 <  0CS00SX h0 00 0h0 T|0X P0 3SHL0S0P0\00CU~HL0SP0\0  0CS AURX0000X h0 X h0000h0 EQ0 QE! HX Y |P8PPPR QHLQP\AUHHL0SP0\0   CR bAU X0000X h0 X h0000h0 |0EQ QEz 0!|(T<  0CU0 hKXKPP U0   AUT hKXKPPZt0X P0 3SHL0S0\P00 0CUL0SP0\0  0CS @UX0000X h0 X h 0000h0  EQ0 QE! ᘝT0K0d0K 0`0K0 0\pKp0 0wPP QY~ p0\d |`000CS0d0 O l K dK @Pl F `DPiU CP QHL0SP0\0 @X0000X h0 <  0CS00SX h0 00 0h0 |0 T9<  0CUw 0 hKXKPP (U0k4 0R | 9\ d0 00CS0d0  l K dK @Plz< 8 u4 r0 $K'Kl'KD QP | ptQQP@ Iop0\d P0 000CS0d0  l K dK D@Pl _>`P 0d K0PKJ@PSP0Zp0 |@ |0S%YX08@X0?o< K2LKrP \d |@000CSl K dK Pl  `C P@X0%(0d0 $2 0R| t :\ d0 0 0CS0d0  l K dK Pl< 8 4 0 $K'K'KD QP tt \:QP6@00C?o2|0 \P d 000CS0d0  l K dK Pl @P! 0d K0PKPPY|p t0S|0SX08pX0 | ?o< K2LKP `>C1X0%( @ ` dYB d -LM40 1 0000 0 0  K c -LdM`00@X0 X0 `0|p\ <ST0 X0(0d0 0Pp `0 P0 V ``V$P0S lc0 v! H0 0C0000 0`C`Z- !8888&`0S X0 0?R:*000H0Kd QT0`S4 r 8 PPP$ #R1HL R P \  BUH0L R!P \0 00 BR!>U , BUT HK4K*PP BU 400004 H0 4 H0000H0 EQ0 QE!(T54 0Y 3SHL0SP0\0Pk>400004 H0 N0 3SH L0SP0\ 0 S>400004 H0 <  0CS00S4 H0 00T 0 H0 4 0o 3SHL0SP0\0f&>400004 H0 d<  0CS00S4 H0000H0 X01 000 0 000 00 000$0 0X0$00D0K 080K0<0K0p0 061፹PP QT0S\ 8D 00\0CS0 0D0 $ @ K DK 8K`P <AP(K<  0CS00S4 HP0000H0 @ P 0D K08K0K`P00\0 U<8D 000CS0D0  @ K DK 8K`P@ 0 00$08D 000CS0D0  @ K DK 8K`P@ P 00S`P8D 000CS0D0   @ K DK 8KP <;A P8 D0 0T 0CR! S 0D0  @ K DK 8Kd`Pj@^`[ 0 &KU0@S<AHPYS0D0  @ K DK 8KB`PH@<0 &KP0``` 0 00C S 00  K K KpP  0@S>Hpzpppp00 G J 嵖0 0C00 000p G 00 00 0 0 0C S 00  K K KUpP!0S 0  A? P0 00C SST00  K KT K,pPT Kⱖ 000CS00  K K KpP PU  000CS00  K K KpP 0@?S' p0 0 0C R  KKKpPp8 S^ T尜PX D ` 0K Kl0S 0 "X001C60 00S K P Yg 00  000CS00  K K KpPh  0 00C R0 0 !KK_pPRp 0 0 /K 0 300 0K`3P0\00 S00  K K KapP-[ 0 00C R ՘KK&pP ꥹp꡹ dYB c@ -LDMT0 `0p0` L0|0L0<$ H P0 H0K  mP0PS4 b 8 @@@# #R0HL R P\   BTL0S!\0P  00 BR!8T , BTT HK4KG@P <"T 400004 H0 4 H0000H0 0DA AD!(TRV3<?@0S0 3SH L0SP0\ 0 8400004 H0 <  0CS00S4 H0 00 0H0 T4 0q 3S}HL0S0P\00 0CXgL0SnP0\0  0CS >8Xr400004 H0 4 H0000H0 Y H0 H! ۔`<0K0T0DK8pK0` p0  ẳ@P {A?o 2R0S P0SB 8D 000CS0D0  @ K   @P@  <;<  0CX0 HK4Kk@P "X00@?SP<;H@00S=TL0 08 Z6 L3 P8 D`0 0 0C R D  @K@P@`00SR  \L0 HL0 TT TP` 0T  `忺@P T9<{;(KL0@QT.L0 T L0 T5L0 XPT0T 0` 0ۺ TP0SA 80 D 000CS0D0 $ @ K  @P@  <B;8S  TUP L 00`L0K -@PL0\ eP 0 00Kq@P0<;P0,K  0d@P0P@ 00S@<; ᝷@ dYB -LtM``0p 0 p<t0 0 CRI)p/l00l0|0p |0 t0 |S00T0 <    d0K [t0PST q |0 8@@@. #R<HL R P\   BT$L0S-\0P  00 BT-6T!0CSt>ppu-@(K, BT| dKTKT (@P# :'T T0000T d0 T d0000d0 |0DA AD 0!|| T(0p00S1_:?@p0 3SH L0SP0\ 0 ^6T0000T d0 <  0CS00ST d0 00 0d0 |0 TT - PHLPP\$p dKTK @PT0t P Q1 #RHL RP \ (6T0000T d0 &  @Q0d@000d0 p0) A0 A!p p 婒,000BS00ST d0T0000T h0 <  0CS00ST h@0000h0 勨剨00d0K 0X0K0\0K00 0:1ḫ@P Q t0S Xd 000CS0d0 o ` K dK XK%@P` f \x0sT0 F  #RHL RP \ /T0000T h0 ,000BS00ST h0000h0 800T 0@ 3SHL0SP0\07/T0000T h0 5 #RHL RP \ /T0000T h0 ,000BS00STh 0000h0 700<  0CS00STh 0000h0 D700T 0 3SHL0SP0\0 R/T0000T h0 <  0CS00STh 0000h0 600T 0 3SHL0SP0\0 %/T0000T h0 <  0CS00ST0h 000h0 500#SRT SR@T T ^H L0SP0\ 0 .T0000T h0 <  0C S00ST h0 00 0h0 408@$TSR@ SR Tj ^H L0SP0\ 0a.T0000T h0 _T ^H L0SP0\ 0 .T0000T h0 <  0CS00STh 0000h0 400 3SH L0SP0\ 0 k.T0000T h0 <  0CS00STh 0000h0 0<  0C S00ST h0 00 0h0 40HhPeT ^H L0SP0\ 0 '.T0000T h0 <  0CS00STh 0000h0 40T ^H L0SP0\ 0 -T0000T h0 <  0CS00STh 0000h0 0Q #RHL RP \ -T0000T h0 ,000BS00ST h@0 00 0h0 0R01|00000 08@p qHPp qs dYBd@c@d d cXd PP0p00CA S0d0  ` K dK XK⤿@P` ~0@?Sp`P\W1H@sP `pX d0 0 0C R d  `KXKdK@P`Y00 L0K`6@PQL0\0p0 t0S+ Xd 000CS0d0  ` K dK XK\@P` 6VWPP Xd 000CSST d T dKXK@PPPWPUy p0d KXK<0 0<K0G@P<0Pp0  t0S Xd |`000CS0d0  ` K dK XK@P` 2 0RaX d@0 00CS0d0  ` K dK XK@P`@0 #K (K4 0 $K)K)KD QPt \,QP(@00C?o20 |0SX 'KSR0p0 xp00G?o20 pWl0K04 100 uPPl0\0p0 0pp p p Xd P 000CS0d0  ` K dK XK☾@P` r0P0 ! 0d K0XKPK❮@PePW|` 0S0SX08`X0 |0?o< K2LKîP@  | 0Q0|0 \&0U @@X0%(x0t 0C?oR20S09*  q)<@K/l#SR8$SRH6 1p"@P p0ST0  q  p h0p @0 | 808|0S|004a -LtMP 0.`p0 `0TP t 0@<0 |0|0 0Ph00h0c p 0 S (0L0  <  l0Kp |%0@SX |08   Q*HLP\PPP PEYL0S\0PPPP00PE\PE U | lKXKT PP, e/@`0YY m+Y< X0000X l0 Xl0 00 0l0 |00I! !B| |(Tp00Sq@3/`?P0E?oT 2R0SPoUUrp p0  pTpW @,0K@#0@

<0 C 0 @00L3 0  P0D 80aS0P0T 0!`V 9!P 8 $00C$08A>C P?A AL3 0  B  0!000 AAL3 000K\00S  s00nRP #K ?@ $K@ $31@cTU @BB -L4M`p P@?t^up0!$K\%0 R 0?!! ?#KT80< L2)L<0K b<"1>ZP 0` 00\ Ó\ CW(KZ 0  `$Kz0WTU p-L M`@XPU Kp8T L\UP!P TU0PCP -LM`@Pp 0T  B bȟ"30ၤ0 0C0?oR20S ]$Kk -LMp`0HPS`8@ 0 0K 0t0 QPb 0p(`80 00(`` Zf k  0 00C0 A`Rp`A L32  B \%X1R/=S,T @U0PuS X0 b```Wڨ 4 U04  UY]00C00ST0T00 ! B !0 0 0@P800c#K`p;t` Z"P0 0S@P(KU T -L B6 B -L M@0"K\:Ѐ`  8PEΟTQ`şU @"K  @L؀AbKV  a` & $K] B B B -L,M`$K 08 @<0 ?lrP14 \!Q-R ( 1R0\ ?ᵟ Pr#K400 1>4 `0pS7 00#K ? $K4۹=S$$儺 K0w0p0 QP405005 00 080T < `p 0 L30   <0: S 0?0C0 `Rp 0 L#00C0TQ X  0x0cR1 (KoL@cTU B@ B -LM0 8@ 00PS  A0 T1!``0 C cA>2 C`p< D4@Ĕ#c 0q 0R0= CP0 00 0S ?q000 YP ?q 0 0 00000 nP00Ȅ0Sh0h !`a 00 00(K0 B BxJ0 -LTM|l0 h 08d T0H0 n; 0 d0: SL0 8@,0[ D0 `0Jq0E Eq0PL0040 T ,`${0 00 V-Q80` ,QS`p?qH# L0 PS0@3@@ 0d0 0 00 l0(KLr P0XpU Lb ^pX`U ? 0p0 00 00Q0C2S0!XP0 00C1HS0UT0 00C1ES04`0 0Rc4eK@0 @4K 00`Vp?p#KR0KeK0< 8 V" o#K0p@0PSiUP0 ?p0D R0P"0D R240P64`00`WLP"\T Q  `RH# R0`B0LP"\ T Q `RH# U0L#" X0L34 20X040 cS/ 0C0,HH h X<[1@ PR@03YPP190F BT B -L` Pp8@  h`0 C c6'`p\ {QQ 0!JPRt V0  ?o8 ?,`pZ 1JP ?o ?o,pNQ` A?o0"WU`pEyL Q8 `p0L320S80P80` -L` Pp8@  h`0 C c6'`p\ PQ 0!B0Vt V0  ?uo8 ?,`pY 0剑 I0 ?ao ?do,pP`? AZo2 W U`p ?CoL#  0R80`pL320S80P80` -LC< D4@Ĕ`p#c 0l 0R0000 哷P T() 0xy\%0R1'#K#K0"K08 4 1KT0L0 0SBK ?l@ | L@0 8`2\0 0\0CP0 L3T 0 0PQS:= CP0 0 ˡ0S S< RD4@Ĕ# 0xlAn FP0 80S [00`40K000 0 0 0R0PD0 D(K08S <0Lʟ0 x0 ?x(K#K 0R ? R00T0T0 \5TS@00@  00@  0 L)Lß0K2 pb<87"Q0PD0 00将0p0S 3S6&\Q-R (K ?k&K 0Y`?T0X0 0S̠ &K ?'KZ[ ԆKx08@(K 0&KQo A 40Z A0C4040T040 0TAS&K ?$KZvTQ @0@S  |0 0s0cR1‘T0~NP000S h00h0 00 00S T8`4 A\<`)A lQ6^#LSR| @ֳ'K&K܆K 0'Kh0/0 X0!.&K 1R R P"M &K$K܄K 0&KH0/0 X0!.$K 1R R ^"r nH0܄K/0 X0$K1 R0R  0( $00C$0 ARA\ L30  B $K 0$KY0P :MT.!`am #O40P 0 0zl4040 , V40 00S0D0 #K < D4@Ĕ B#d 0jA~ GR00` 10S ̳001` 00@0 P0`pR009S 0t0S# 00#K,P000Sh00h0 ! 00 00S! T04 C)C2 b16<"# N40 00 C 0k4040 , 40 00S`@ 0\4徲L0S 4L B BT B@Ac BU @cT B BxJ0H B -L@@ #K0K|O`P 0h 00Q Q K(K 0 P #K%0tLT @y BU ` -L,MPpḠ@ ?i|0\Ŕ0p0!#K`0!\  ? `0 c0# S.Q,QQ3, V@@#K岱0KO`P 0h 00Q Q qK(K 0  P p#K0LT@y BU -L M`pḐ@ ?,i\ !tQ\ ^  ? `0 c0# S.Q,QQ3, U@$K^  ? KT004  A0)A1 `2< (KNP(Pp 00P Pᵏ K\ ?h@ TB@JTU -LM|P 8@8u Pp2 a Q̎SQS10 \0-0 UQ 00 sS 0S0 0+KR0 P l0 L1<1̀ 0 ,K R00lK00 +KV0000SI `p<96>Q,P850%00 0@50L5 0 SY60T0p00,K0K0000000 0,K[P P B2 b061b `0`0*M0*K' 00 00S  NK+K R0 KЊP `L<6 l0>,`B SR0SH85@uL0ppX 0S 000+KM0T0p0000+KP0K0000 p0+KP*Ka 00 0 SR0@u0ppL0p0T0p0000+K&0K000 p+KPr0S 00 0pT0  C)C0 `012< +K0K0|0K0+K#(0P0 Q0t 0C0 01-0m0`T00H+K0K00 ` 000K00 +KP0K0K00 000p`0T0` p C)C2 b160" &KPvJPt0 0ap 0 0 00K0 pЀ |K0K00000b0 MP00W0 00 1 .K 01 .K0 VI0p0 0p q0 0 0 0K0 0/KP >IS0T/0 R 0 00000+K^K/K000+KTK0K00 0000/K +KP0`0 0 00 0  0K00 0000T0 C)C0 b201<"  P H00 0S㨠`K0V`:0Sk !`Ra 00 0a IP0`S0 p0!00 IimIg 0C.K0OfPm0T0, K002H00+K0K00 0000+KpP H0`堐@0S 00 0000T0 C)C2 b160" +KP000 00, K2H0 a!V SI aH0S K 000+KKPg0 0  00 T A0)A `12< +KL "|K K 000 00 0<PX00 0 T` ?.K 0F0 000  c 0SQQ ?Qe01,).K0 00 \5S 00`0 2",0KK.K  ?l A a2H0K00 00 00  0P0- HJ0 S00Z0S 0S&0  00 0`p0|K0YʰK 2  0`PGG ,0Kb0K000000%F/KP 幭 H00 1sH0K0 # 000  0000 ܀000X0S 0P 0aG(KT B BS0S0 0+KR0) P l0 0L11<̐ 0 ,K R00lK00 +KV0000SR 00`p0 <>68Q,P85L05܀%0@5 00X00X0S9 0T0(00,K0K0000000 0,KPP B2 b061b 0`` 00 ӎ0 0 00 00S P + G+K R0kK P`p L< l86>, `\< SR@uL08E @@p@pT0Sz 00@0D00000000T0(0000+KZ0K0000 p@0+KsP"0 !SR0@u0ppL0p0T|0(0000+K40K000 p+KdP0S 00 0pT0  C)C0 `012< +Km0K0|0K0+K$P(00C0 t0 0aVg0pT;+K`0K00 p 000 K00 +K#P0K00 000`0T0` C)C0 b2160" &K,PGPt0 0a 0 0 00K0 pЀ |K0K00000b0 IPy000 00 10 0W 00 0S E0p0 0p p0 0K0 0 -K㌅P EO0T0 R 0 00000+Kt K-K000+Kj K0K00 0000-K +KP0`00 0 0K00 0000T0 C)C0 b201<"  P E00 0S0`pK0WE:V h0dCh` ]FP0` S0p0 NFwFu0SJ P}0TF0, K002H00+K0K00 0000+K+`P 5E p0p R   0  T A2)A b170" +K,P000 @0, K2H0 qE E0S 0 K  0000+KHPx 0000T0 C)0C b0+K |K" K 000 00 0 PU0 ἠT` ?-K 0F0  c 0S0 QQ ?Qb01,*-K0 00 \5S 00`0 2",0 K K-K  ?l A a 2E0K00 00 00  0 P0/ nE00C0 0S00R0S 0S%0  00 0`p0|K0YʰK 2  0`h PRDND ,0Kb0K000000%FGP0H 00%E0K0  000?00` -LdM$K0 0P98h0 0#K0 S) R04#KaK00K0`00 00p $K` P=00 55!t20t20$ ;60 0Rt< <80!! K8 8 %K #000A@P0~@P 0C(K000p00S0H0 0Hp p0?@l0 h0S@T 08000 0DcT01\0 0t@ TU0D0@0SH0 0 pH0 d t?'K$K `N0$K 8?&K <0` "<!K0PH0K1L0 %KKR09l0 R00S 00SapH0a`0 0000C0#K9a T0 C) C1 a260a0`%K!j  R\ ! 0H! 0 R!L BKK % 09S0. S.0t0S # 00 0$Kk00S01 0L AK0 0  K#K 0%K&K R0&KL0`F0CL0 S0 00D0C00 T0 C)C@0 b21<0" %KP ?oX20SZ 0 ]@o0娂?h0S 0CT@@Zh0S 0C c B -LM`Px! 0@pW 4Kj 0 Wp0 P  $0 Q D  0! 0V`0 P ( ,0 Q @ $ 0  UP0 P 0 40 Q$ H  0< 0 0 00 0 0:0 0 K    -L,M``0p(0|Pp<` ?Kp`T0 C)C210K0 b60" hEP 00 0\%`0PRx 000@? _ UaX0 B(K_,\Bp TT -LIM.K0 0 0t-K A0ASR|@:.KR0*Q Q^^P hQ KQP% 0TQ(p` 0*Q  00 00  (K!)KQP08P =*K .K000 .KR0rP \>, l QP!Q RQ<Q` l \6 `Q^ Q^SRD K= C0H`KWV 05 "K0 V 0000 0!P 00.KUZ .K 0 AK #0H00,0,0  A?K  ?Ԗ.K0 0000 .K R0s!P.KRt0S .K*00SK0.Kᘈ.K0P ?`Rp `60> P0 W" 00P0 1E?K R08# 00 0000S0 GK-K 0-KZ* 0EK A?KEK R0q/0 AKQP `0S1{ 0!C?KC?K 0 A?K R0 Pp 0n1 >p N:.7:QPb:0.K*0S.Kb A?K R0 P pL< `l7:6,QPQ:0 RUl08%1 "6nK60K0P00Sg 0qP  \2, 0l3 Q0 R9Q0 U0S<0 /K R0 Kj< l90>,WVb:01 L lj0&jn<0 0`j>0 0300 0<0 /K ?WVp1`1.KWV`pH0C20000F0.K@0d$ 0`p0H$KnK4p0`KV0Z%0'00/K  0ᴔP a0 0000 .K R0SP R8@eL`0K0'?1ptx1 ` 01E?K R00#SY 00 .KZ.K.K.KK* 0 R K00Sh  Bh  ! R0`paᾨ 00 00 RN !G?KG?K 0? *IK PE?K  0 L `l2< 1 CKI?K SR$158e50`%`0@55`0L05`009S t0S00 # `G?K t 0 R  p!pq-Kd KE?K  R0q1GK' 1CK' 8@L!8% @ L `NVd009S t0S00  TC?KR `0 )-Kd KFYnl B00S1/P11/ -LM|@i8PpV``P (K B2>0`` b` "<1`P (00 0-]9(Sx>` KS; -L8p` <@00 $` B2 b>51RT H B1) B a25>Q@P8PD0<00p0!"000uA;P< -LM|0P8`:pl@Tu 0 ?p P g $KbT 80 B< a31< QR0QR!` a31 QU4 0S 0020V 000S I 0 P)K0, KP2 K 0 &C}?PP 0,K"X 0 0 0 K;0 Su I `(K PP 9Sڠ09S jPU0 S0 1 P cdTKe 0-L@/0@P @0  @@@0 00-@L0ywK0h-/ -|PL姮0@j `VV ~_Ѓ08E. `0 WVE/ !SCE?000V `S000$Kk}\ 0 -LLM@ <0 e0L @P`00< S cQQQ< R0T0 P4 X100H0 D0 p0%K0 @P0 T`c 0 X80 0H 0 R !01'u0`0V4 X0 0 R@ @<0 00d0Sh0`h` !Ɵ 00 09S`L0iV 8`00ooTb(KP  B200K 0 b81"8`P 00TW t K?X000D 0&KP0Q&K 0:sSR.H0S 尠 X0 0 R !1 00 0 @\ 0 00D 090SR;W0P S C ; X00T:@00<0D 000090S4;W:U X00<:rW0n80 H |`PH0 wp 08q`P 9SL09S 8` Vc0P S0H0 c B -L 000=C ?cVP0 C c00 4 K ጃP l 0#K4Y  0 p 0S2 0000`8 ``L00L0_408 1H0 @0B20I> 000=C ?VP0 C c0H08 HP d妝V 00D D00p00w000c#@ c> Bb B B B`0 B -`0Lp@ PU 0002V t$Kkw LR000 0p Rp=9S000<{`0 -LdM``0|@0h 8P00p0  " *$K0, K0"d l0 h0 R Kh0`PP0K0<P D0 7D0pD0 D0(KT0<ĕ8$ Cà c23@ D0 P00@ c6 SWQWK8D\` 1eK!lV C dK\  c0P T KQP::8"3H L0 $K ?WV*L0@E@DD0@L0@d0@ 0l0 0 0:P0< 0\@D`00S`00DS\0 0`0h \j0P<\0 67\0<0 ud ,0K @# l 040K  0 @ 0 : 0-@x L0P?T00S V0 ) ) d l p t000,V0 ) ) X P  0 -LM` @9P P 0 WVc0S 0$ 0$V 0 #R0P{vPP 600KC-8P`@@8 ^ T q   Y | pሀ8Y(@p@L@ -`0LS00t0`0@o10 0000000B!000!啜 B -0`LQT0@0 00o0! 2B1   P"p' B -0`LQ0000BBJP B -0`LQ0d0H0<0BB$v B$ŐG-\LRPPl@p@`rpnRSNh$Up`Y!Vࠡ΁pppΡ~ ^'pBW  ‘ @$@N`GoHV#pG  UP!W !! B!^!0B1$5S P#1Ѝ Xppppp  H @D!R0C -L MP@Tu00040000 0= !`0 Cs cpcA>2qC 0#KT0PĔT$ 0C cp<` ?Kp`T0 C)C210K0 b60" v8pP, ȕ`  T8@ "$K# Q$K 0 040Px040|`00d0L0 0L0ž(KTdd@ -LM4K8  7T#KP8hpP8`|@帩Z᫞|0P S姕 壕p(Kl l80K  &w\%H0R,5S0մ Ѱ ն0Ѵ0*8?|00@@ꀶdddT -L\MH   0 D3p Q0 `PD0K0PL0 $KH0PL0  $KP tL(KH0|@9 S Pl P PԄK` @h 0A@ 0hh=AP^ 0ah0S^0s0#0%0%*|000ə0 Qt  0 XQp  00 %XQd0X00YPЈYX Q0(l!lH0K  w%Pw0 00 R l0P0\%$1R<K[#K#4 0L *H{00@@y!0!0 $KP%K0X0 l0P0P h@0 0%Kdt 00SH\嵙  0!Q t !r@@ BddT B*B.0@-0 :B S60B034AQ\*=@C0$0S# 0S 0S 0S ,0S \0S \Ő0\x0à"ĠR S00 \0P S0 00\T S8@^`\H|L|R3ST0RS 0T -PL/ P @(K`(A@P P 1P -Ac@Bd\5DBRBaBAcoB0}BB Q0-L 00|0@,T0 p-LM@``PE 0` @`PY`P   0PK0%0 HKpvd -`p\%1L@RP=S𫝸0S,Q0 ?" C΄" " ? ? A ? A? A 0?\ $ ̈́? L( ? E΄? L`@ 5 10 5L5s0`pP50h0\%0S΄R,5S 0 H   ? @L  ? ၏ᇟ X⡐0`SR 14S9Ӭ4հ4S@0Ӱ4T -LM0S00 @|0BK c,K(  2KbK@QKШ -LMKoP,KOo KB | -RL t0S \0 0 R l0S  40Ry  x@ -L4M pR<KP4`VF(K@,0V*\%0R.X 0T0K C)CH0L b2<@KL"1>4P@X 00\ Ó\ $1x 10哊%V<K TU 0-LM p0Sp+@0 00@@ @@@㠐P0 00@@ @@@㒐T0@0@ @@@0  ㅐK0hK0AcBdBB 0-< Lp00CSp00$@少宑K0h誑Acd -LLM(0PP T Y 080 3yT0P 8aT8帅Z ϖ@?>L0 0h/`?p?A 0$40K04+8)40PD L0 ~4 0P %L04! %y05\%`0 RR  }0(hpVW0#03 W0S P  }0Y 0R$%$5R, ,0R?>`CL3 L3P3 P3H3H3=0T3T3O  }08000P<0 ,(5 0S,0 @0@0,00T`S> ) %< 1S (030(0EE 0X4S 0 0X468p40pA6LEX$5SP0F0KKp 0KPP sP\xP8 9s00J`800X40`H` ?$KT0HL C)C4KL 0b03"`8U30Pp4 0 L0 NOL04/80p$%!0, ST0P PSP |`?mM%K̟)# ᜀKH00H0 ` \5S 00ß0 2",0KKKx ?IM`0 C c0"3@ D0 $K ?KT0p C)C4K0 0b83"82P r< 0)K<0(K# 4 48/rM@BTTBBeAB -LLM0pR`@00 p0Pb08 X 8l`0 w0 @@8Rp8W>(0|`T0 \0 T0P<0 圐0P .000 @t 00K00T/  0:$08?}2pP~00K0 l\5S(hQp($KSRp 8&VJQ Q|@0 0]N %h!VQ % # 3 Q RAP <|Shp?.B$KSR@ 5  (07<0 O $K`S> ) %< 1SE 0X4S 0 0X4ph00 Sx.0800 0P<0 0L0 !=C P0T0L C)C0K4 0b83"81pP040$ R:N.L000 L00 5  0L0S000004pA5$%,0P Rq0T0 {0H0 E>D Ld0 H0P Si$5SD0P30ÜD0, H3kM4tS9Ӭ4հ4S@0Ӱ40T3X0`0K0,000(5 0S,0@0@0,0P000 040(0:(0,0<,0X0P0`0 0800t0D0t 0b0?o0cH0T0 0CL080P0040808 L0SV (pu 8p(K(0<<820Œ(020<0 pV00H 800P S0H C40œ d0CH0ßT00K C)C 0b"83871pP000 0D1MD  00D0 -H 800p 0H0 ]D$%0 D , R^\4S  5  0 00(00 n(0pTLzT hz8㎠0P <V-V P z\?z00zp:<0 Cp0a`p(0K00$p` 0h0+`04`P2Tp(0h 04L(p0 51 50P0\%R=S04, 030304040 50L0" " 20XZ-` K5*T -L <Z @S c@@cBB(BeAJBB -@`P1LPpሁP 00 PB=TpSLP 0 <=t0S ϝs= S|n$%0,RL1xhxP xp x00(0:(0 c -L$M@pP=S =S 劐4K'FW00W`0p 80 0 Kx4NFP:4/FW 0<0T RltX Wr }P`8T=S* 000C^ RP`(K8r P nmW0P`qm 0   }-@BL0@c 0-@` L( # T0|  Q  `000P05/-/ -LM|@p #K0 P80 0` ` ( 0 00YS*9  0 00 P9 ;909  0 00 P9 ;900X 80S@@0S ƩZ `0 }00p#K1/ H@RP@ (K0X } W`0 0 00(Ko/ -LlM00| P0 *  $K04& K*QPi$KR0K0H0 )QPvH0SHX dK =T0 00L0 `08(0H@0`0 *#K= C#K ?%K#KR K0 0K`p< 00pH0`K#KP0fKK#K 0'K#KR0OP4p \7,0p `l&`QV.Q0 R^<A l0l \nQ|QjQSR8 K#K%K0 KSR#K, pKL0 0P00#K R0 0k pPL0S #K#pHc0 %K#K 0%K ?~0S)T0Sp H p`$K 0#K#00 H0 0#0  #K0 s~p  )ڌ #K= C%K\ <00`0`F0V`!V #KKR0p#KKpR0ppWL0K0D"0 K 00\ >0P`p#K 0%KK#R0 0BpWT L PpP; H0C2000 0 )#pKR0 0oW#`0S`<0 #80 (CL8QPT 00  0 #K 0}pP? H0p 0#K P0 (K, |'KP0 0L000 'K1/p&W ! 0-L @P P000K0hd -LM@|Pp|9S ʸ;S ` ( 0 0`PQ 0 SL0L0嬈ᥑw0|P|0 0 垈K脶ddd-/-/-/-/-/ -L|M|0@ p0 0p)UT`)P& p0*UT#*p0, K8P00"t 0 ^ p0*%K %KK%K R0R'K0 <P 1' =(KP\X 0Q0 a" QP3QD D0 UX0S1@0 $K 0&K`d#K A" 0a<3H0 1L0 $K R08ŕ%K܄K SR4:0@\00 0@Y0 1܇K !0X ܄K\ %K SR't0@000$K*P<0 @D\ RT \@ 00 \YP <&< T0 @@5@L0@&K R0$K 0 A a21l0 h %K܆K SR*T0@ 0L t ,0K # 040K  0 @$Kb* -L$MP`t |@R0 p0 (Ko")QPB0SB 0 6S (Ko*QP:  (Ko~꼠080 0S Y  NJ*$K 0#K$K R0#KQPP H0 C20 0080' P (K -L\M`PX0 0T 0|@H0 0)YX R 0QPH0SH} T08P =\0 *&K0P0 Yd P Q2 aS8 8̎SQL < 0< ULpA W p!Q`0KӜ Xp  1/P@ ?*QP 0* 0 R=* m0P0 #K R0#K P 0 l Lh hPP"0LHa0D|@y 000 0?080 n0S ``F `V$PԎ(p(K8S$PpPU !DP 1,PKp%40P >  , z40S 1PhP꠶d c -LM$1 K  qM@PPa fK(p 0@ |d  x PP  0 q0 0$O PP  >$QP B>(puB Y 0 P0z 8[ l> cB8uB\ddddB0@-0S  0S@@0S  0 -0Lt0S B -0L|  Qx2B 0-0L@|P$OP $O$ψ 0 01K0h/=B,@We -PL`h|@0|0 PPPE PU$O(p 0 01Kh/ᠶdH@We 0-@80L04$  0S0K0h" 0-t LR Rz|P 0S80$ 40A00"t !4!S0P00S 0 8备0$aOfUiB ceBd -L M`p|@렀$MOPP?0PP1 EPP$@OP T#-~$000  K蠶d cB 0- 0LP t*\Œ`\00Q0VQ08LP<<80=40$0 @0BcBTpc8uBdc0@-@P0 P 0SR00G- MD!A`0Q000o0@$@TP%P`A @TP@ @Hp0 @C c@>T @@@T PP@ ЍЁX@PP`@ P@ `` AaUT# H`@D0C4c@ c pSjTgQI AAB_ CC `cJ9F @C@``VAp@TPPA Q -LMP'K|`0U ` p0 @P  000D}H0@0 ܇KY X 0ZW00 0R|  1L `L l<,60> \HP pP`P 0 00 (K07P| x0 0L @ `20 0000`pY X 0 S0 !1| 001/P|Vl`KWppK'K0P0 0 Qp0 0> 1p `p00CSp0 6W  0X &000R00S 0P X0L! A a1<80 00 6SP|0cx0s#L A a1!<60 0z1Ѝ!F)K K'KSR 02 W>000000D00)KK#pP -2L0 C c38008600<0u2t20t2&P  1 뀀 ;`#)K H_0SW 00Pp .RQU 0KK0D P00 S 0|0 !C1!01/P`H'K 0'K000RЀ   U R 0KK0D P00 S00| ! A1/P 'K 0'K000 00 U 0S `pY X 0 S0ሁ1' '1/P 000 cTKe -LM0S |   0S ,   0   C K1 -`0@00L|P`06/ `000`06/P b00 -LHMp@%K`0K00s #R 0|4K1/%K0Hg#K0K0K" 0 R &GP :D0 I6@0 $KP0KD0$KQ0)lT0 G`K P?KKXp100 0@$KtpP Sl$K |0K0   $K1/p>K|0, K0 $K 00[=0[S< [.RS#SR QP00; [.R00S P -L\MP2p0\0 `0` 0@\0Z1d0 j1P X0 j |0T 0 4 K #1/` d 0T1ZQP0 DC 0d5H L d"83 @0 4D0 ?&K\0\#KDKK@RPP &KR DKT !K@PVDK 80K0 0L 0T000P000T000P0 @P0 0 08 S `0`F`00`0`0 dPhjTXej(KBc -LM `p0|@l0 0l t0 00d0 `0,0P0 0h0t 0h0!oPP90  `0(0 0JSPl00H0K0000 "PH0 S080l00SP~S0 8000 0000 R00S00 00000 0\0 `0ZD00C0 \PU ?SU .:P0`P0 @0|0 `0 0 d00C x0 ?)K܉Kd ? *K,:d00 0h0 p0 `0 `0 S0S0`0\0` 0 00 `PPJ%0PKP Pp640 a`0PP 0` PK00?PP (K\0Sx00Sh00h0 P0000ഐYb % R  0 P0W \ R Rg | R      IRڐ`P[\P]xh h R  Ap R R= | R  R6 0 AP0/| R@  R=d0`p 800`0 0\0 PP 0S| Z08S0S u@$`0 d00) I I )` ` P  ` 0S ` 8  p \   dRK`0 ~$`0| `R* SR *\#L00S0s 00 0PP0S Zyd0`0c\0Z00S t mPP)%KK#K#QPP! L0K <K`8`PPL0l 00S5 9S2 t mPP \0S iK*K`p8d0`0 `0\0T0Z`x000HT x0` dP!d0X0p0T0`0S0`0 ZZ 0l00 !QL0K DK`_PPL0K 4K`_PP9ZK`x000T0HT%K$K#QPF^Lp t L`&mPP9  |0t 幅0 t P{ P^ZZ%KK#K#QP^Lp l0L0P00 !{\0 cBcqB|B -L,M@0 `0|P,p0 `<0 0@*QP  0 R8 00 00 040K000K0?Po0@080 pW Spppppⴠ0J Z<  R R) <0 +@P<0!pZpđ$,,^0p p W0p 8  Rppppp0C D0 9D0Z0đpɑ80S0   0 94k 0P0 0 R ?SR *`@ 1/ (Ka@BB -L4M @Rp0T`0 |`,0刐H0 0L0 0I ,,@K0 R P?5/PP5  ?*\/ 00 0*aH0崐@0 0 0 @ D00C00L    :9@vkP<KA`0< K00@04/UP(K!0 Pp@B -LMP@|` (K,0K. 0?pP% ,0,0 T 9 0C8C890 00 0(5k 0Tp0 0 0 9S`00003/ K0 B?pP ,0R     -LMp,K(KP@ `P%(0`0,0@ (0 9 0C8C890 0,0 0j 0 `0 00 9S`00003/ K -L@M K  40Kv K|@ -LM|0#|1 K -LM|0|| \ |0 00 K -L$M|@P)|@`|@\yᰀ @|@@H@@ p0 K|| 0  -LM||)@0 K 0-@LPu0S ⷘK0h p-L M`@0K0! 2PP PP nm|T0 00 Kp 0-@L,`|0*0Tm00 -@0 LLMp$KPP [l|0`#SR[0`(K0 00` ` 0D KP `P`0,0@2`[1`[V `w[P3[ S0|8 QP$Km0P@P0K LK\X \[X0SPg`@P PD[PP@t0S J[P|0*0P.. -LDMP| @ <0 9 @`Sp0t9|08 )0 | 00 0 `000p07/pP080CoᩒZ VX2 | 9S@09|0)0 | 00 0 `000p07/pP | 90C9|0)0 | 00 0| 90C9|0)0 | 00 0P4 ]x |  0sp4 zxWnXZVP0 p 0 G 0R0RQW W R: `00 00D0 0,0K #000K 0 ?P& 0p@0 0080 00 G 紐R`< , @RH0 <0 <PH0 @  R BR400<0| 0 tpP V|009 ?o200 ~(KXg | 90C9|0)0 | 00 0 `000`06/Q80S0 kX 0|p |09#60p?|}pP4Z Y; | 90C9|0)0 | 00 0|9S !0| 9| 0`0@ 00 -  01/X 0p00p0|0# |0 0|0@0  80Sp8 I0 pD00C80080 8 0 ZpdB p-L MP @ 0| `P |09SKp|?1/ -LM0 K @ $01/P00K 0-LM@K a0 "[PP^PP pY00K0-/ 0-LMP0@ K $ 1/P PF00 0| Q  Q YY0F0K0 -LMP 0S 08 00 000  Bqu0 KBcBd/ 00CS0/0vBcd 0-@PL T 00 -LMp00K00P08 ` 0`@[P0^P 0X (K000|@ 0 0 009 R0  09  <101 00+t 0  ~P9 ;900 0 00Qd0X0 0`000`06/P Av` 0 0 8Y avZ000 0 90 000 0X@d 0-@LP0S [K0hQ p-L MP 0@| 00T ]`P0jKp p-L M 0"| 0@0T E`P00 0| 00 0iKp0| 0 0 @o/ 0-L0S`0|00@0 4/0 -L M`@|P t R02& `0(00Q t  }ptP2 I20@p!+~0 } K -`@L`0|P00p0 7/"!#"9:#:0900 000#"00St00C=S70(00000 ?#00@00 ?$00P00 ?%0 $0`00&0p00h0+40 0x00|0t0S; S8`0D000t00$) 0(S 00'Ñ(0"#0D0@00"$0@0P00#%0H0`00#&0L0p00!4;$( -LM@0S30s0!p`SR*bWV&00s#(SR0sx0s|0P s|`0T$: ` (   (K 0# #88Spp 0t~0 }PW0|0#880'00 Rd0X0 0x#0 0|0 y0s+ `0(|p0y s000 0 0>~ 0 |P00 0 0R0 t   尐0 Rp 00 00 QP t00CS񟗙0V1(V1hV1hV1tX1tX1hV1`0(00w 0Pw#SR|`1QP-&SR)pw! `0(0_0 T|@p+t}0 |P 9z:'zp 0y0 00p>`0(090v00 }0 @]|P*#SR `0(0 00 0$SR 0 ` ( 0 0&SR Q#0p L `0H 800p07/P -@ p-L M@`t0S | |0|l0 0 0T0'PwtTUKpPV -LMp` |000 [PP /gSP(K|@(!9SgP}g  gP0 8C890 00 0`000P05/PP As 0P 0 TWP _sU 9 0C8C890 00 0d -LMp @P|TT T, T4`000S-@$K贐 s`@00@ 1  bP1 00 P0 @s 070 g@x븶dB -LD0 B2@0 H0X Z^ |x!pX0 CX(Ko0@0AT 0KL0 RPKPPPUKSRPKSR 40Y 0S0S   ]L@1T0 P P IT0P  00C0P#KR0CKƟ`FX0< 0PH(K(dd@c -LM0@sR PN<冪H000aSL (qL $ 循zxPU嵪 0 O宪#AR*D @ F.XKhO3 03ᔪ0 00IG(0,#654<OK@c4d\B -aLp ,@ATilHPU \#AR0CD R@00S B@ ZW\ Q00P 2YX U S<0!Z00W0S #X0wP ˩@U@c@c -LLMt$KDK` a0?P@DKLTL0A0A80 0S0婩D0#v&t804 0AT<0@T 0PأPDE3,PXP 0 0 0勩3 0 <0 `<(0S, , " 80S< < # $K 43`8 4 !( R8 4 !(,8 4 A8  4pq,p(080S(08 < 0(@<00"S040Q<400400 080000000000$0w 0X K0 >0#600 1<0 00M0 "K! 0 D  0 01 D < i !0     0 K %K1/pP800X0 00WDS 00 00V KQP; (@A1 0B!5D; Р80(K#R Ϩ#R OY 0D"0O3t5X0 6L0 /0 LOp0PPDE3,PPQꄼc`d>CcdB -L4M\ 3,P 0@Pbs3@ C3RK !#KK0"X 0K 0K$KP 0l%K#K$K R0" 1 00M%K0  D0T  00 0SQ0! D SS:勨1rD  2X唑90 !0000CS03\000F D0 (X!0 -LLMܓ `@P@sEVQ 00M0<0  T  @` ,0B10s C ^8 K80C#6D 40  ! 0k 0"$K X0"&*4 崒 <v  $8 4K<K 0 T0 K0h -L4MpH 0P$`@PL0  H ##K2P 0HP(K0H p0B 0 #K 0K#20#D0H B40L0W00 H 0 W00S$1s! K00#K5pP  0P 40& P 0P0 H$1#K*0p#KPB -LM@`p2P@$K 0!SS ,0T 40#00S Y Y@T|喤@I0h P@W(PI- 0!5p JP#SR) 8@0,0s/000l(,0 ),00,0`#SR 8QP80,c8P<0<,0 0,0D0H 00$@"(@I6dd@B 0-PPL D@000   0R000 00謻d,0 141D0S/ 8$Q 5/ c 0-@PLP0U  K0hK0h R0-LP@ T K0h -LM0pQ`0 H@r@@ T 0PU0 0DPP 000T## 0 P m+0P00P0K. 3P0  (K | 0T *40 8 402-00D L|PꬻdB -LM`00 0Pp0@Hg* 0R   000 0 JpP g2P p t^0p(K`\V ,3038OV 0= h G,B4d -L M@0PH0`p *3 00P  P  ۢ,3 3 C03g2P  0 (K`V ,3303 `Y,`V (0,#6`3 3C030 4dB -LMHs`0P0043 1R0 l"h"  l"h"P3040 @TT 3S =@PM 3  03000 X7 0 0"000f0k SXl 3 RYM P@0 0 pu>3,|Z iu (Ka0!000 0040U 00 `*@P  0W0001P= DL/ 0Jx0 0x0 @3  Z.2+03ZC03X% '"U 0DAV 0000S lZ dYꬻd cB4dB#B -@P0L` 000U U   pP   00CS0500 U$p q p 00 -PpLAM `@K 0h] K K K1 H-0 p Q0Q (=0S P 0@ "  Y:N@@ L` 0 KP 408 P0  Kf4  Kl@ PKKK[P000K00K00    K+ 0[S$0S000 "K= [KWP 00 0  .000K 2=..000$pH`_oVRPU0[ SK L0;PL%V0(0UP!>L0 0P 0C3>0CS0000 00KȀVH ʠ0 KD묠K0UL 0B?o20S V 1S 0S # P 1 嫠1#RJ*,  UW 0 0 P UlK 0 OP0Y !R01P010U X Q rE*ᰠ  0 1 '0 Q[0à Q 0z08 0/ 0 `3S 0[S000  0S0Hp P` K vlq-0[S* 0S'0 0K,0K KP# K rp P0p)Q3A0300C00p KKj0000 S0 0Ã0 0$X Pl0K1 UX B 0 K  P!05/ PDw/P 0v`6 1 0U0,a10Js60U3 32Y/ 6Q?᳟ )0Y003030000[1 Q 0  & 1  P1H̠l20l20b0C00`00 L0p K1   1  00K00K 0PP  01/P #Z4 0/ z0S   B  (KKLY``VP 70 3d1(To03 V 0DABP K_3 3 03 000)LU U P 3 R-?P0KHp0 0KKGp PU0u`000 0000 3 3030W 0"Ȟ  01/V 060 0PC0P 0 P0TrH01 1Uf0 , K!@ rQHK PK #Z@ zB F꒞00000 0"`0p0@ppL V0 K1/ R0,K1@ 0, K1@P0[ S00#10U0K 1!h20h20[ SX00000I 000 3S 0[S000  0H`PP3 :3K 03q0d00i+0 KK$0P0K c8dd.B,@4dCc:BDBOBx@YBcB -L M, K@`6 pPP(8\ 0 QR,0 S U 7M,:,P( KP ,0@0S(%P 'JT,05 3:U ,+ KnB4d -@P`L  Kh Q-LPp`0@ST`# * 0 `P T  JT 0 CcT0 +Cc -@DPDpL`t  0  @l Cc -L.  M   K0.    R0-LP@ 0D0 K0hDGD -L M@0 1K -@0ML040  0  ; T0 KBcBd 0 V꨻d 0 V꨻d 0 AV꨻d// -L0LpD@QD0L`S2RD0D0Kh cpvc0@-EP@0 C@@0t CCP@0B@@0 B1@*@*<0@?&!: SR 0%0 ycycd -p0LAP὜0UP0LP000ct00h00@a0 t c@CcB -L" Kha0 -LM0SZ@ O+l0KK #>#s' $-9x3 K謻dBd? -L$MP< U `0E0p#R*PVpMSZEQE(PEN$1@@@TH#p  `8 @0 U7 80 040K00<pP 0G?o T20S% @0 p@ TJ30DU014 D0 &D0pPE04000K 0`P  W (KCc4 0S/(0$00 S;S80/ Ccd -RL@Mp`A f`1 0 1Y0DpK0 1 00p0!U P |Y 0 0P@0< 01@1 00p0  9 P  0 ! B\1pPuL000p p0:pp0!0ip00Pj0 00V)30x0(#0:00 T Pi$K Cc@d?8d>'BHdBHd Bdd{7x7r_Bd@ -LM >0R('N<'0 0 0@  0 `p PP ||nY0@@U@P0  00 0P SY KP@%BPB -LMT1p`L10PP0<<@@0AK 1 p#KT0 8W5 X0pCXp(Ko,*0#K 0~$P 3 030 00eԚCKCK$Pp$~X Ú$ (K8d Cc4dzB>(dd -L@M`ሐV:$Kd0K!dPpZW@@U@#TEd`KW`Pp!$@ꄂ> -L. .M   K . -N@L`P@ U4 Kh  -L,M@P000 0h1^0 < <N  P 0K P)0`008P Pp5ApF@0 80S00`(K0  " P@0S 0 0 ` )P LL'3z036!@0< 80j:C80 8d Cc>B -NL$M@00Kpg`P*080 A33p0P<0 W0;000<0 00 ! P80S l'0`0 `   0 g(K3zG03 @0 RZꄂ>B Cc -P`.<0 N@L  0 Khg Cc> 0-<@LP0AiP=i!P3#0 Cc -Lp`v؀ؐV$Kk谙@ 0SP!PU# 0BQ30S 3 B0#33SQ0SE#U ጙ`FP֙P0 4dB -`pP㰀LU@A/3S l@#T 0 0pa3S303"MP4d 0-PH@L000   0R 00000謻d 0-L 0@)0P(0S " "4d R0-L@P U  K0h -@LlMp h `0 \0 T(Kp0@@ 0@ H0 h0D0 p0<0 <4 KD<PHK<@\0` S 0\0CAD04`<l0 l  00C0 S00 500$ 0d X0  yd0<0 080 00t0 D0x0 H0S u\pX0t\p &l0QH0S 婘HK<Y;S` 40xJ|PPY 0 P 3 Q 3S 40$ HHKm@000PX0p0X0 40 HHKP y #Y44 0/$ X0Sh 6@D0h0 bP3S X 403S303!HP 0S Bd 40R $PH0Q @40P L "JLK PK 01/  P[ HK40L  J" LKPK 01/P #Ps`2  ` 0/ HKXY 姗P0 P壗P03 Y 4D0DAP HKP3 P03  P{!ė—XZ Z 01PK7P岗P00.lP!,媗P 3030 = HP1[X0 0 0=P 3C003G 兗0>3x03{p0x\0s HKUDl$HK P U #d HCcB4dYBdB -PL4Mp#K0U`sA0,`K0CS00&&0@ Kp 0  00 $K, 2 2BCc 1B -@LMpKP` `  K\ 0p 0 `  0  [0P@?o20S0S 0000(K R 00 UP Cc0A /R0C 0a000/ P-L MP0T0d -L@PD! 0P 0#6\ R 0C \0C0060@*00T 0P3#\0Q 謻d -LPp`@T " 0H@0P 0 D B"&0$P 00S 3/000D00D   @0@ -@ppL`0S !S PC0S W{000 c 0-PL@JP00S 00000 0- PL@00aXK0hN010/ c -L ,d 0-@tPt0 ML 00@@@ @@@XK<0@@0@ @@@0  JK0dBB-00\H0^\ ^0^ 0S00Q : Q*000000\ ^\00 -L$M@0 P0`S8 @@`80  (K80<0 < L0S:)=0#Z00S  8KX$P VL008 R0V00 & 00P 00CQ8 5:< 0CS80 8 00` 0 08Kp P 70 K8yP UV00000 00 080 U00 08 @Q0#03R0#S 080@ 00` 0 8Khp P V000 0S00 PU 0S:p80 V  P%W \ Qp!*Q Qp! Q:W Q * Qp!*Q Qp!P S*Q\ \Y:P QT*V SR*V  BS8  S:P` 0 8Kp1 P0P 0S8:0P0 V 0 0<00CS0!80  ` 0 8Kp Pm V00 S 000 V0 0 00C80 P` 08Kp P0S00 SW V0 0 00C80 08Kp P0p 8 0S*VPPV00S  R* 0S*V00P -@PLTHP 0 D B00"&00 $00S 3/`@ -@PLMPL0( KT@1UP!T@!MP(00(0 (Q: K00 $H 00R0S "Q`pA 0 L`p\* E `Vp`) -P@L M`UH`0p 000P @0S `V000HP00pW !D #Q P K4 R @ R 0 0CV <$6SW H110}H`W P40S @0S00 80$0S 0 00@00@0P@0S `080 PP Q04 R@  B@ 0WHpV 40S @00CS@0 pꬻd c -@LDM@0 00S D D H H 0  0 -S0H0QV S 0S004ST0 "$0S4 40R{8 80Rw< <0RsL L0Ro@ @0RkWJ 80"YXa00SBW% 0 00U000U0000C00  0  00S D0D0H0H0000009S00S 3/00S H R;  R 2/e00S  8DP 00SV  8:PN (K -@L ppP`*00DH0PPPLp`PP坾R  $Kkx@B -pP`@L j0 SA00T P0@0y@ -LMP`p $G@p0 Kd 0-@ PLގ000K0h -` H0L@SP`B   DD800 $Kh"$0S0SKh/ -L`Pp@T M 00000   @0@Kh -L`Pp@T - 000P00@0@Kh -L,MP0%4@8 ` E.Pr8) 0 KP 08 0S000  * 0R*00000S-0 p<0圠95   R r 0P0 80K 0 Sa (K<0 0 Q<00 R@p84PX8 0 QP0P00L00P ! 0 #CcCcd -LMp( K@`P P$K( 0S0W ;(0S 0S$0SH0SU % 0QP0  0(0 I00P000U X 0`F( `0` 0` P0Q00Q0000C00  0  -SL M`Pp307/ PL0( KUP1X!XP1(@P@ 0S* 0S 0P 0S (K@08 $00 0%K"H000T<0@P @08 $00 0%K"H000D0S T00T0pX0@p40\080`0<0d0L0<08D0H0m <08%h0PDpHcz -L00`0(P$@@ @z0*,00!p1 000`(P$@ @@ @Pf0,00,!! 1 00`0(P$@ @@ @PR0,00 00000`(P0$@0@ @P<0,000`(P 00$@00@ @0P0 ($Kk ;2BdBdx:2B62B$CcBB0CcB%B0BDcBBDc;Bp -LMKK_K@/$/K 4`S`B```` `a`a cbcb`c`c$`d(`d,`e<`e@`fD`gH`gL`hT`hX`i\`i` j    2/KoKxg/Kc/KB_/KB[/KBW/KBS/KBO/KBK/KBI/KG/KE/KC/KA/K KKKK K K K K K  K Kh `  KX 8! KK K$K(K0l 4d 8\ KK?#KK88K` ?TR 2  0S?#2 0` 0 0 00 0000(K謻d c -LxM@|0KP`p` T0 <Q< < 00 0 0000000}K -LMⰁ@P`` K0 0 K\ ^ph1h![;[+[̀ P.YKW+K^;K0+K! 0T  0C0 00 0 0 0 0K00  0 0 00  0000-(K4`(\ ̠ $A( \ 2(1p3B(108C8c@c$Ccd 0-@Ld0/0S // -LMpPK` 0`0@0 "0K\0 0P@ 0 0 000 0?oP20SP dQP PPdE(K 0-@L d70 00-L8M 000( ,0 0@P'. , $0A 0 K00=2 -LM` 0p00 0PP >0>000C< SJ3 SF:LSj*Q 0C0=P 4D@ YXR * Q'(Q 0  ! 00 @P 00S 0003/:#:S  @(KQ'Z 0 @@ ] 0D &6S0S 0 <46R*0  @000 @P 0 ꄂ> cd0ʠ,ʠ 0C00S>0 0>00 0 0#L\03P Q03S/ -L$M@:#:S0>0>0 T< *4!P#6DpH0 D 0H 0P@0 <0 KtP' 0@0 5D0H D@(K <R*P R:<$`R !L 0  T!QL0T :00000 000Q  <R: JPH0S80  V L0T :V =80S 880SV00!S 0 00D 0}  JP0DDP 0@0 @ -LTM\  04Qa H0 @T@ 0(KßN@  @N V@T ^K 0W 0C H0 D PS:L 0#3R03:QT0`p0P0 0<0 @0 ^T8L0PX0 0 0(0Sr D0K 080K0<0K0@0K0 P04KKp 0-LM41 DP  K" K@P@0S #  0K @RP K0 0-LM 41@  K"PDKP 0 CK0 0-LM04A K0 0PD0"KP 0 DK0 0-LM04A K0 0PD0"KP!UJ2J2J2 K2$K2LK2@K2 0 DK0 D 0 D 0 -LM04a K$0 0D$K0"k0P K` D"QPDP K 0 DP Q 041@ D` / -41LDS,0,0,$0>00C0C0/ycDc -L M`0PS@D$0L@09/@` P T 0\ 0 0@0 `00000a 0D2$K -L M0PS`@x0D$0Lp@07/X0T @ `  0 0  0 DK -L4M8 @ 0p 4P `   R@  R H<  X X80L0S (KY 0H0<0SPY ,0K  #0(0 F P*YD$! 0L @0 LJP4d -LMP(KK R fjAv{(K'K00 0{@(KV 00lK@  p0      0 p K 'K1/@PUe{ p QL^{l0Kp R.0{p Kp0`V6K Q Q 0 1   0P0 q{n+{ 0  0S0 ! !  !  @'K (KP4dMB"PR0// PR0//0$ R/  !0ꬻdG- `TP HApP& (0!00C0000 0S   0 0S  0 00C03 $00C$0^000000@P (0!00C0000P ( 1  B P ( 1  B U謻dd -0` L@RPp0S 0SP|V0  R 0 0P`30300040R,`  P 0x@ddЩ@ܻd -0 LPR@`0S0SbPd`00C0 0R0 00 3030 00Rx@ddЩ@ܻd -\L0S:0 0B000 $=8R0\謻dXB -`@pL PP PPT@0S T8  P   PdB -L M a@0QS M0!>00000000 N@81N@$681HV 0CS*7뤀p0W2W0@@N@N@W\0 K(KP< 0 (%J(CcddBdB>B -,2,",BL M0 00 _y [y* p7* PMPOQ0 S00`0F 0!ࣥ vpbhN  I `! D 偑 00 000000 00 (00 ,  (K1`!F P &4 400C 40  b40 c& d cd4d0d2BdB}dd(Cc -LMK  p # K8/ -L,MB0SR0S bRpdx0S<0 LxH(K2@0 08p D0 0H 020H0 1L0 804K40 0@01000 0K<0SVڀ1P0 M R   R 8 4"& Z  !   8*&!08 4"&  0 Z  !  8*&!08 )&0!  0P 00S\  40H X000180L 080 80,@`ixT Dqꬻdd0d cd0 N0 : d -LM`8 <0 @ pxt2tP8  00"600 l1S $t  l?RPQp R _R@ ,Rg (R! R`@TW WJ60pKp 0 Pp 0 PA H!0T p  p pQ  ҵ ŵI 80 `#(0<0,00S0!  #wT #W # 8 (K00K0 0PW 8wV   #0d cdd^B(Ccܻd -`@ PL Pp""5 Kh - `L@VP U P~ $Kk -LM2P0S 2 Q00(KwP 080 00 040 `00唂q8P |(KoEw`40S,0P40  0P P@3@$w8>0P<0 (v11 P @P@          $@wPv<040  \ @P@$$@TzVt Q00 p000 0 80S[00` cd0dd -LM K aZ K3S/ 3-0C8L#8S3 00C0謻d 0-@LpK0h 30-SL@ 0003030謻d3S/U3038厦30388< - L  -8L  Khc -#L@R/ PU 3033 3:#033S 0S$Kk0S 3 B# 03B0 00 PUR zP }30qS0300C0 08P`%Vu0300 1! Q @ X  $  $  ,( \PP@0L0Q@00ӵ0µ$Kku0S Pܻdd0dd c(Cc -p` PᔀLUY $KkA0Ds3 0 033 R3 03 03:P괼d - 0LS u0S -LM@P0 S 0Sdp&0 0K # `  Q &0(KddCc 0-LM@0@@@0 KK@ \P  t@@ @P0@010S 3/@TK04CcCcdd@ -L4M11P80 t1tAl18 p00D0 6@0 L1 QH!  v< `<0,K`! 00 p0@ ^P 80 S0H0 t H0R 00 ,  t0v0p 0@U000(K l0H0 t H0 0P 00D PEJ cdddDdBB -`LMvᎫ0P微0 @ 06S  Tt00V tKPP 0K  At0S PA,{t P ꄂ>ddd0 0 0 eEu2d -LMP0@  R00  Q C@ 0p` tX t8 Y8Tq $?t=t(KU~ P ( ,"&p@` p 1T<@ 00 R0``ss00320<0 U" @00S3 032 U  30380080 303e T 00 P0  (,,Ơ03@ @030qT 00<  0S R s00;0K&|sslsh@ U\X00X0sU U $10C$1Up@`i4d(dd -LM0 K' K脂> - Pp@EVv1 00M `LV0 0 #W0 As@s,K` -P儐p儀`L*s0Sh6bss@@@D[ssTs x+d8Cc0ddTKed -|@L  P  P \00,0LS D0Q< c_GR`P< 0@?AD0謻dcdVUUU 0-3L@ P P 30 030300(0, #6 P  0-LMPr|0!x00Rl00S`20\0@AT T000娻$0 000*K0@0d cddBCcddd -T L00<S8 Kh膻@ SPPꬻdd 0/ 0-P(@Ljr0K0hr0dd -`L@V(UQCU 4  10 10 000謻d 0-@LP9rL0 0C0,0R05 K0hmr/ 0 0dddd - `L@V0PPrPP V3#03 B# -EML qn5 5@ 5`I_PP #05E!5ep q px"rP lUJ q0S 0SYڈ0SV`<%8[000q 0S0 0 R 00 qq+q 000 @00 0S3pq1xp pp 0110 yp p  00p 0@ !QRTP 0 0 jpP800S0 q0 I|qp qP ,0R0Sq00qq0 0#R00SZq p38 4qpr# q101Y!!  !!#q"   1/1q ٩#, P# ### (,0  0 1010S 0  0PqYm@ qX040X0Gqe0!   @R xY  ,KP P2 | x p t #  #  q xp P   (,! p p ,0K p @qxK`p$10$1# #p0 00 WpxKJp @0R  <0Rkp&T P0Rq0 SP @0@Bdd@v2B cd4dd0dBdBd8Cc(d -CLP@ @L`P 3 p@ -L MP H0K8@4@@@K0@ P PK謻dz -\PL`P@  PV@ 0,0@V @_T d,d8d -L MD!0,`PP00\ @04000 8pCd800DC440 00C00YCT00C00XWCY@Y XX 40P WW ` PP `P0qrPs`p0(Kdd 0-3L@   x0Q    #,#  B 3\0የ00 P  @ #,#   0d -`0pLP @PETVUV ڶ3 P`FU dP (1 0(1PEo@dd3   x0Q    #,#  B / /  00Q    #,#  B /d 0-L@0 0,0   #,#   0d -aLpp0S0@p0t@TD 3 @T> 0HQt0 10 1P @0 101WoUo PU 0 R"0P s0S  @P@Y 0R q0S p$@PD@0S Pr0S "@PBddx@@CcЩ@|/3 /P000Q000/d -@P0`LP d! 0P@]  Y ( U 4Q @PM L2I XKhCdH2/00P/d0 0hC40@S/dd 0-x@L p, d(( X4$ L@ @L 4X (dK0hdBBBBBBB 0-@LP8z 3RC40   R h A $A$( 1  B 0303 00 0000@ @@0謻d -L MXnT1TqP@T 0 0R410ӵ0ŵ(KoFn 0R00 0 3<00 03`! 0(P 0,0! 1 Y @!  ! ! R! !A!0     0 R$  $    0d cd0Ccd -L,M@   \#2\T S`!j3pAFp^P %Vp Q": S00S $6'00 m, (00 R 080 00D0 O@t0P@0 80S 080 um$(0, 0R$640 0&f'v#60c<0 0F80 /`T0PD0 80S Pm(K080P40S0PU NW*s@P@!@1w40@D @S0!00 0@@0 0 Y@0P0TW!@@Ot00 @P0100 D0@@0 0 R < I$@@D @@L0  D0H0 CL00X 0@H0S#IN0L P0 3L  HP00 (0  )80P`' P`! `1pF 4 004 S`PUG *H Y*00H 4P Sp10<0 W'<0P0 `GF40`EY`1 `!< <0Pp1F@0 <0  DH 40H 0S40 `P HlX 0S 0>H 0E@*ꬻd0d-B -D0, 08LR (y*,\0Cc|d6B/0@/Cc/-,0,0 QԞ" 0P1Cc|d -@,p|QL`T#$ R R&R$*&    0R 1`V+*딈 `F`PV,PXE,E@,p#R@o#^ A  BA  0RP0`V w%`F`PV,PXE,E@|dCc[B -LP`_,@E# P!*   0R `0`VT)!`F`@V,@XD,DP|dCc[B -LM01p0PS)@` V(0 @((U00 ,0 V,0 $"0 pp0 `U t0@`(Kp04# 0SX06#,C T,IX,J@ꬻd|BCcBBB|dp@-,`\0\P0S  / R$ P :P*Q @p0C?0Cc|dp D00P 800S , (01 ///Ccd|d 0-L@P0 0-L@PD0 0-LPP,  05$ 0|d 0-LPP,  05$0|d 0-LPP,  05$0|d 0-LPP,  05$0|d,0 ,P 02 /|d,0 !$/|d,0 !(/|d -L`PP, 06$(P|d -,0p`РL0 I W6P@@P  80 #6< @ D H L  S : S *0 0 00 0VjJjp|dd4d p-P0 ML` L0LP0S00? 00=0   ,0V$ Kpd|d*B9B -,`LM0h@(0 P@' 0S2@# 0 0,0㓕$(0K0@0P00 ($K|d p-L M`00PS@ xx0(t00Sl T`\X%* K AhP@(, 402!P`$@KpdĪ@FBd|BrBBB|d -LM< ,K!8 PPK'(K8<0pW>'P10` @0 R00S WH*dp',Pd18@< 4$0! {P W,1pW ',`pGp80c#``80,`W80XF,F080 #*@08@ R< 00C 0,0R$ pp P0<`P&` , L08@<4$H  0`C ` ,&P֪@BBd'B|dCc[BdlB -L,MpP0AK6i#K R0 0`niV*  0@P㤀#KT0(Kh``F,K&f`*i00 00 00 1/0f 0@P#K@P 0-8 ML  000 000   KB@d -L!P00@d "@d QP-LMP @`pM Q 0 =S 0!  V0 0!ı60!R0 0!ı! RAZ:#Kh#KR 0N 0#Kh#K!0 ` pZ#` S 8` pa`0(K VP SR -fpLM@V@@Kl0 R0 0S  4\Q P<< 8H  BH /80@ddT0 R0/0S  (Q, Q80@d 0-`@LPU ` S  R   00 `800p <00@8@@H00H0 R 0 P0S  0  @dd 0-D0LP00 @ST000 j @d -@0|Q00P0L0C`P0hP'TP""R,40 qt0S)4 140P "gL00CL0$ T00CT04>P% `g000P00P0g`x0``FV`U8`8g, (50HP `ꬻd(d@d\d@BCc 0 8@d -L(0M 0 0  h KN42 -00ML06 0 0h KN42 -LM600 p1!Pa4 P80 X@P  0  P(K? 6%:V T[4<0 6 S  *!<0 !<06$0 000H S| 08P0f0T  T -gX$ 0 040!800R000.XPϼP h00S0f0 g d cXdpvc!Cer2 -@LL D0RH`P000L00L00PfT00T0f -CMLMT4 1HPPP$  QP1P!0mK `Fp0X4 W0(K@ 0T0C pPH R 0B.1\4  \4D$  <4 X@$ 084 P4S 3/T$ {PT48@ꬻd@d\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -`@L$0  C00C0 00C 00S0F0S   R0 L00CL0000($Kk0S0<Pd@d -L4M<08P@4;TP%VZep4fW00$00(K4(`tPEaY! Y # ?# "0 eeeT00T0e먀00 h0P0 000$H0 ;@0 4D0 X00K@ ,`K 0&?^40K0<0K0` 040PL0 #KSR#L00000 0S`x?`᭽ @K ?080㓪& `FV4`yᮻ0 00ɔ00$` `0L00H0000)#K 0 0<00 t Rp0!"P0S Y | 0 0 0HN000A $K ?$KH0H0H0 v(d@B@d@BPdԥ2 p-8Q@01LMAH@Z da1 cP #YP @P000@ @@@@!=4Pt `0 0 0 `@@h\0 `@0@0 ^Kp@dd(dXd@@BBB4B<BSB[B0d_0dS Q N / -LCMP0 @S`Q P7H00(K8 ,ޓ00CS 2x2@2x2d2x2L2603/P% 60`B>  y000 $PP0 S 0X T ᎤP#<6pP P0SE?K% }P00CSk괴2222P222KX`P0S|% t } 0T 0 1 0 1 " CK`P Pp t0SPp0]P4 p  4/=u`V @c`PP  cU D P> @9 04p0t0PS 0p0! $ Hmc5`P cHP  P Zc 0! }P !IK \34 1 XtY Y$ P0P 10X 1" 1" PP Ec]cHPI?KNp ?4; fjt0SFPPYP7 0~10X!820` @0H 4A#"#04>0C6Y 01 1SI  ~ >K!0PPt0S( T!0S"   h 0h!h3P XX !1K"] PPp`0`00 @x0S0D01,`(0b0000x0L L P PbxbOP\bP0@bPPꬻd0dCcxc`d\dBcB(dBBDVeBBBB@d B2"B@*B -LprbPUb,Ko@@T P 0&$ 4`P ` NbZ `8 <0R0<0# @ H00CH0XV 8@FB0d(d@d*gBYBd -L MHpH0PSK0 SQ? 00b `V0S00S4 @T ` 0)  0 0S#0Dp 8<00 Q<00<08t0800<00@800 00 0T00T0#b(0 (K8@ bꬻd(d@d -PPLL@adX<0a 0P@T@@a(ddCc -`@@LPau( X00CX0$0$Kha(dd p-L`PLa]@( F0 0 0C 00TATKha(dd00 D 0-LM`@q \0P0\0 @0 6K2PP(faX00CX0aK0謻d(d -LM@4q`DPQa@ !N@@( @0 DЂ QPpp\p#p2W |a p$K0Όƌ R( na*p0 0p0 D(KpP(00D@#F@Xap B,(00C@#FD@-D0S h06CSa@0!Ơ0P8 @`p&&'6*U\/R/>0 0 @ -LM#Kt0`@SP  @ )060p#K  #Kp` P(Ko? -`pLMP  0;@P0 (K# 00 0 0~@P ` `# 0 #   3030@0P0#10#0 S#BB -LM#KX Pp, J APXpJ04S Q 0p(KP#K 8 P8 P#K*R0H#K0 @R X#K*0#Kp WH#K kP P -p`LM@0 p``$V    W  R 0 00  0_ Kk(` -@L`p_dKh`H/H  /H   @o/ 0-P00L@T0凥P @Cc0/Cc -L& 0 4dCc -L M`Pp20P@00 pP0"  PPP% K|00S0@@PɷP000P8PU4@ KP@4dCcBCc 0-LMPP@! َP 0xS    K☷P P 0S0C0@0T,婽K0@4dBCcCc-/ -@Ld`pP᥎\P@ @T@ U@  4/@`4d@0S`04/0PQ/Q   / P/P0S / 0-@L,00$00 000 000042l2d22l?oQP0@-2 R 0R 000D$T000 -LP@T@000`` PpW#  P P@p @pW  P  P0@S0S0PPP@P P /'Cc 0    /0PQ/Q   / P/P0S / D00-0<0@040L0(0 00002222P P / Dc -Pp`娀L 0 HZ @1@!0 Z0 :@j D 00 0 0pG000 0`T* -ML MP`0S E 0C0@ BKI J@HT  Tp1{#H0 P00C@D0 S : 0CR& P@D*CKA 0   C>K0C`0 ` p` *4 @ (K -LM@p`P0 0K ,P ( d0 ` \ K p-LkM@P1 `0@0nK^KQzPPD0n/K0!^?KF? K1"MKYzPP1n/K%0M?KKpBB -LAMP  04a  x!  |! !1 1 0  @DqHL@T\  y K 0 p 弐 Dt} Kx0|0 ]0x0x0 2 t 0$0p0 L]l h d ` \ X 0 PKT0 Ѣ0#00KGK1@KQ KK4p@P20T#0GK0DsGK[@P# \pW@ȡ ̡ pС ԡ ᰡ ᴡ ḡ ἡ8A 0U8qGK9@P \ 1T w4qB` KT2T"K0 L2 H"0 D2V@"ż0 09K0 4040Ӭ0 \0ð0 0 ŰjKѾIKѼIKѬ@ @K@ @ 9Kv40 KW"@PF1V7ugb1 1 尐0    p40AK C/Kx  劶@P0S @ 1  1@ @@  0 $"@PQ% W  ( K(0 K` "@P P01 (K0 S1 0!PPU U0SP  !P @cBELF4 ((20000/8d000/-AM 8R#8 'R R, R 08P#80$Q  44 0C8#8SAߍ 8d0A- '@pP` $ '\  \ \#Q Q@0 Q Q@0 pRS*  QQ0Q08d  -LM`0s00pQ 0Aa 0@\:#: (K0@ΠQP@_P@@A0 040 0 S2:00N@@- R 00 pP0 B 40.  0 0R @p B pP@@X 400T 000 pP00 p222P Q /07s78Dc -LxM`KPx Rd@TpC 00 0$p0 00 00 00 00 00 :0 0|0 0x0 0t0 0l0 0h0 }>d0 0  0`0 ` 1\0 0X T0 0 0P0 P 0$@KL0  0D0 41H H24pK@0 00$:0p00TpG 41p000- @pP @@ pP0@@@$K p-L M@P`5P KphrKp  0-LL@dP 0S 1(S3 S2S#00B -LIM0 @3S `PP1S S P2S CPP22$1 $1 0 0P0,0(04000 0"R01 rQ50'0CSPQx7 0 0 0PP?宸00CPh0PU ,0K⠠#0 15/PP)̠X0Pp q 0q B0!"R!" UP10Q U!3L0Q*C3PEP10 P1Sm9$X@ P " 0UH001 00 0Sv S001  2 S0S,1 ` 00s0~p~p0p401TSG pp1 W4!kPP+pp0$p0tQ1"PP1K"PP`0(0 $ 0;0fPPv40 0 00. 0. DB0 (0141D0 >0#60KШ c -L@X 00 X00 `p``0Xp  pDc -b 0`pb 0L@RP:U@ P 00 0000Dc -tL@$`pd0SP`0 S0000% P PDc -LM@`T0  0/ @+ P4"p@PL0L00L0 0 q 0 0D@P 003/ K@ -L M04a2@00 0000 pPP  i0S  , .  DpK 0-LMP@P 04*"*0C000C0 X0  00. 0. D0PK0hK0 -L(M0K0200 0 0 P0S K -LMT0p $#00<0<041@0CUT@@@41<@H<`@p0FPB 80`F` R 0C 0Es 0 0000 00P0F0P 000PP0 KDc2 -LM0@`0 0 `/P 0 K`P p0m/KdpP NfU00p0K !0apddxddedA -LM4QDC@c 8⭚Tp0S U 3 KhP'2,K 0!2 00 0*D[`P Q0  &#D0 倂 0xB  pAT \XK`PP<KPEP\KP 0[/S],0KP00E@K-0`0K`Q s00K0 K0KiPU`P0 T | 0  00PiP;0 0C /P 0 0  P0@P  KP ` iP# KK L600   P_oTRPU `uAT00h:(Kc8d B@B WBcB/B@~BBYBBBBBBBBB -X`P𝤀0 !`!800 (  , ! cd dd 0!< 0`4 0 (   !/ cd dd 0-,0L @R 0K0h@dd -L\0P0 `!d 0xUF ?,d 0nT@!d 0-L`M00@ 0 Q00hKP00hKhK@`T#ʸ@Q hK 4/0 0hK&#:phK4/0hK0&#: dhK\4/K0@D8dx97(AvBbAFAmA,ADc-AF7XA A3?AdBdB 0-'@`PTML,0?0? 000P(`$@ @@@ @pʧ0',0t?0h? 000P(`$@ @@@ @ᵧ0',0(? 0? 000P(`$@@@@ @ᠧ'0!>0 <,0 00P(`$@ @@ @ዧ 0,0> 0>0|>0P(`0$@0 @@@ @v 0 ,,0<> 00> 00P0(`$@ @@@ @`,,=͟ 00 0P(`$@ @@@ @`K0,00.!= 0 <0P0(`0$@ @@ @60,0\=0 <0 00P(`$@ @@ @!0,0 = 0 <00P0(`$@ @`@@ @ 0,0< 0 <00P0(`$@ @@@@ @x<, 0l<$0< 000P(`@@@ @S0,00$0< 0< 000P(`@@@ @̦0,0;0 <0 00P(`$@ @@ @ᷦ0T˟,0t;00 0P(`$@ @@@ @ᡦ0',0(; 0; 0;00P0(`$@@@ @ዦ0,0:0: 000P(`$@ @@@ @u 0,0: 0 <00P0(`$@ @`@@ @aR D:, 0 00P(`$@ @@@@ @`MR ʟ90, $ 00 4P(`@@@ @6R hʟ0, 0 09$00 4P(`@@@ @R ʟ0$0 0(9, 00 4P(`@@@ @%0,08 0 <00P0(`$@ @`@@ @&0+,00!8 0 <00P0(`$@ @@ @ܥ(0,0H8 0 <00P0(`$@ @`@@ @ȥ)0,07 0 <00P0(`$@ @`@@ @ᴥ*0,07 0 <00P0(`$@ @`@@ @ᠥ+0,0d7 0 <00P0(`$@ @`@@ @ጥ,0 ,00! 7 0 <00P0(`$@ @@ @w-0,0;'$06 06 0600P0(`@@ @_.0',0p6 0d6 000P(`$@@@@ @J10+,00!6 0 <00P0(`$@ @@ @520,05 05 000P(`$@@@@ @ 30,050x5 000P(`$@ @@@ @ 60,005$0$5 000P(` @@@ @70,0404 000P(`$@ @@@ @ޤ90(,00!4 0 <00P0(`$@ @@ @ɤ<0,008  p$!,4 00P0(`$@ @@ @᳤>0,03 08000P0(`$@ @`@@ @៤?0,03 08000P0(`$@ @@@@ @<@ @@ 剤0,0X3 08000P0(`$@ @`@@ @u@0,0 3 030<0P0(`0$@ @@@ @``A0,02 020800P(`0'>$@0 @0@@ @JB0,00"!\2 0800P(`0$@0 @@ @5C0,00,"! 2 0800P(`0$@0 @@ @ D0,00!!1 0800P(`0$@0 @@ @ E0,00!!l1 0800P(`0$@0 @@ @F0,000!!1 080`3B3BCcBB(3Bp;:fBB\5BBB$B$@0@0@@ @TJ0,0D1 0L10800P(`0<$@0 @0@@ @>K0,0101 0<00P0(`$@ @@@ @(O0,01 010<0P0(`0$@ @@@ @0,0<0 0@00H20P(`0<$@0 @00K@ @`0(0<00@0,P$@02 @@0<000K @`0(00$02ܢ0 K 0<00@0,P03 @0800'>00͢0(0;$0 0 0<00 K0@0,P @0`30l30'>00ᵢ0(0; 0 0<00 K0@0,P$@03 @0800'>00ᝢ0(0<0A 0@00 K04,P$@080 @0'>00ᆢ0(0<00 K0@00X4,P$@080 0'> @00o0,04 0800>0P0(`0$@ @`@@ @Z0,04 0<00@00P(`05$@@0< @00C0,085 0<00@00P(`0\5$@@0< @00,0,0<00P(`0@0$@ @05 @ 050800'>00(K 0-L8M! 1@P`000 00`,P(P$@ @ @p 0,00 $00!0 0000000`(P0 @0 @ݡ0 ,00!T00`(P00$@0 @ @0 ȡ$K#!B33+!Bp3!B -LM$Q (R`p@0 R0 0R0 R00 0K` 0 KT 0 0@00 0 0??oP20S R 08RL3`3P3h3p370$K8870,0$@ @a@ @PI 0(00 00,$@ @a@ @P8 0(0l0,$@0 @a@ @P0 '$K!BB!BfAAyPA"B{B!B 2B!B-A!BT, #60@P R  P 0 / 0C -LQ0@`P a"WV:`Vp0S S0 0#d 0QP*0x0 0`pL0 0#d 0QP:00dd C%K<`>C'K R00t'KAQt  R0'K=9 =t0 t|s(KK K 0'Ktt Q 0'K=9A =Ct0 P1| @1t夡K ($00,K@0<FKyL |`H Bl0+ 200S& .#KB?0 40K0000000 00 @0l KPP  LV K@0 K0Kr(K 0dd?BCcCccX"Bpd 0-P00L@T0|P @Hqc -@LMp` PUTV@(K 0 00 000 00000d 0-404@LQ0S00 ]>0P00 cd00CS0/0>d -L>d0/d -LM0p0 `0 0P0@K0 |00  0 R  ` ͵0KT0 0@ 0 0000000| KCcdCcCc -L; <;0 @4q  &*?SRp#8 P#!,*0`00  30Ss S@p001 ;UPp0S1P00S;Up/pP 8 (! ` R(PWPP ?;81<;UWc #GQEPY V 41 (K%S. n BR)X3X38X3X3X3X3lX3DX3"?0J pPZPx0d"2\"J0000<0J> C $"0?Pp. 0P J/K01 JPP(` RP(PWPU010ܦpP P 0q 0 0 1 s- lCKPP ᯦0(1 媦(t0S P( (tUPy KP0S P8UKȸ0 *K`0  00S 000 000 000 K(/0EK$ 00(1 1 0 ,1 IK 03/PVec`d0Ec,AAo#BFB@0Ic4Ic8Ic -L,M@P!"K0pQ 00  0"Kp 0 -!`P 0W4!D0x</`0  ${ KnA{Bt#B/\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd 0-@L40040K0h -pL40Q040U 40`蠟90@T9,KoS 9 9 Y Y," 9(AP U 4  994  4 ,KonP * cc@@c 0-<@L 0G9K0hCcc -@QL8 @2 0!1 !0 Nh 0S0 0Ag%`P0T100Kzὤ (B0 !1000000c#BCc c/0 0S/c c 0-LMPQ@ 4K040 4 $ $0Rl0Sd0 @}  U D 00080 "40  00C\3 c\3c@c p-PL M@`8|1U3 37US `1 03/AH1U@ 3C7CU( P10S&P" 4000040000(00,000 0L1$0P000 0PP00P:P\8KpeP iP@0S PU00 000cc,qccCc cc --LM0  0 Kd/d-//01, / c0 600/ -PL@n@@T Kh8 0- L] o#B -@L/O  7011>101?1?11` P@ V@@ 0-@PPL7@0<0C@00S  0 8K0h7c@-!2 !@!$!!!r!E0!311S -A`LP. 0-L%T0p@-!2 A!R!!r`!U "!P "!00\p!AA 2S^ 20\00C0CSQ Q 1p0 0-@P@ LᠮA7 @0 S:|7pp600@00@TPS0 P7001Eb70cCc#BBc cQ- 2  a>Q 0 "Rq0 o`0 -pp0L@T`0S4Pm60 P P$p0P7@c -QLM 0 |  (KQ0pS000W0 00 0?S0IS0 0 0I?oR20S0I?or20S^Y6xW01x0#0 363P00 U `0S6t0S3 0Sx0 R, m60 ` 6V00 zfP 264@=0 Q610 00V :62E6fP010S @T Yt"$ Qx W  Q Rd 0 00 $6x00 $2!47Jx KvX   @ X ( 0 0 0 4     | Xx 0t  p KX d  ` ( R Xp\ X KtXL x| H D  @  8` < 4 00 660 K5X000 00C0 Y0 0$000Cs `gdPY \@00S00005 5g0S 0*0dccqc c -LlMP314IXP03@03?0 (K@THU2 0pKp0 0pP P 20Dx0 h52pd52PU `0SPt0SM X5000 0 ` 5V=00 deP6 $254@=0 ;51|0 |00S|010S @T  )500S 1$ 0R a5`x0?S0G 0X5 U5d15dZ>P4114I @ lK^0KS  d `  \  X  T  P S<0L $ H ( D , @ 0 < 4 8 8 00 4 5@0 lK!Px0@p@0Cx0 h00$0T@00S0000$0pG54pL ccdccqc -@Q8ML 4x1@ta0p1pq` 0@@@0 @HHQH1 0<1@@ 001@0:81@0 1@@ 01 00)0 ,00`pl!P0 000($@ @ @p`M0 ,00!t00(0h0$@ @0 @0 $Kcd3B(f3Cccb38c3#Bb3pc3#BXdm3h3#B -@4`L]441 Rp4@@ATg4@T `400000[4 0-@L MP4000CS00 K4PK0F4 0  (0S  0"K"K 0 0,0K  PU 03/P0 c -L4M1 1 41]H0 H0A3`V 9 4 (K0001SppGp pW p3 0S  0$03/3 01!%`0 (0S 0@$K#K0@ 3@00 D0K 73 3gP P  c p-L M0`1 2!1 SA0S0C0KphzꬑPQ E:PU PPKp c 0-LMx0P1 2!  Q@AT 1S000 ℤ낑@TK0 c 0-L@PP (0S 00t0S 00 -L`P@P (0S &00 -LM K K -L$MP4@ D 2140 @0p,10Wp!40`V010!80 100 1<0 8002@0 00@ < S 2H0 pP' H0 UpP 80RS40a R`01 SD0Q`P2(KV `#`32Ccc -L$M04@<0 80 140 40P1U2Ӆ 1L0 0002@0 0Ò02`bYpD0 < K8K=H0 g2넡0U H2Y8^(K0 L  B B੩Uڜ1S Y << !hD08 ۩@08!hVڌ+<018010p o00H1_2 -@pLM`P200000O240P1 0 01@K -LM4@p1 P 0 0m1 1g02U 0KhKc 0-`!L4q PP 0 @P  PU,1bP ` 0 `1 510 ,00 @ cc 0-@L6@ 10 0-@L1@K0h% 0-@PL 40 @010 }c01 240g⿢ c g⻢ -LMH2 1414p42`0@1=00 X1똁1XPńaՈ0PcU/  `P n I  ♨ɒ0âZʂ?1?1 P11111040 080 U0!c1(KSPb/cr !o !k40Z pW (Q1SQP< 00 < 0 61U!l0 80p0 02"!!!r!E031 cc -1L1 B41`g"`P넑 pV/^ U &8 Q020?SڌP !O011QP?QQ  ?10,KoPU P  RX (Q   bV80  `   cc p-L M0Q4a4@1S@4@ B1S P1Q 0 ``1SKp0S  R R    WP c -@LpT 0QT@dPT``%0(;PPP`0UP@T 0d144;Pvtc c 2MR  !Ѝ/ -l0p@`!L4Q P    ZK c -LMP@`p P @! 0t1 21 0 01 t  PPR @0 @@0 @PK c -e`LMV@8 `DhQ1 r100 000S>H1 D0  /"1 <0 2@0 < 10@ +11 R /80#+ b80 48<00 01 4EX D0 (K14 /0P g J/  x cc#B0Q`/wt@ -LxMPPp`@ x K⊦t@ d@p ` '/U (:P  Kh^/Ke(:P 0 Khc -@XX`L "+ Pp0(00 p 0140R cQ-//-//-/-/-/-/-/D / 0"/// 00- @L' 0@ * 0 -@p8PLQפP@qc -PH0Lp@W``Q ὤP P@\d -`@(PL.$@$@.dd 0-@LDz.@ 0S00  R  K0h.0ddqc 0-@4PL`. 0 0 00 @ .0ddqc 0-P(@LL."0PP.0dd -@LPT D0`00pH05.00Pr.Ь@ -D0QL`P@  .@ ?R"0``U W. -@D0LP` .0S00  R  Kh>.0 0-@PLP- 00 0/.P@.(~K0hLXrc - @0 Sa 0'C!a0 '1XLPS   P:x1 (XpP 㸙``- 0 0 0Pp-0 ᾙCcMbXrcP3 -@PL`-80p080080p04 00@@0@@0@0$Kh- -@Lt|-" 0L @D Q0b 0'! !31SP儙Kh-ddCcMb -RL@P`H0 03/H 0 R!!0#4#01! 01 R&p<-80$ @00C@0 0R 00 80080l- j-H00S L⋋XKh 0S  R- -LM@`0q- 0  7PP>-`Kt0S ,3-000 `P (- `7PP 0DP    @ : 0(  ,`$ 0010 0A-c c -L MpP,K(K`P( ,0   ( D K@ ,l4`,0(@@D%+ 1 2 01( ,4x K@1B c -APL @`,@pW0P, c  "@ "AP 08!/,0Q 00P03 0#@2qc\d -L Mp4 `XP[P 0S\X(K0Sr Y \X 0P00  %,1 1 R!Y @ @ 04 S 0R @T0 T00 D000400 0LH0 0<00@00! @H00SJ1S> @=0!#4# 11  P 003/P; u000 0[T Xc00S K +렑Y 0#$# ! AT0@   S 4R Q @ @0  11 0R!ź@P0 H0 03/P 0 40+80080+! px+8008080 R08004 00@@0@@0@0$ + + 0<00@0000T   @u hd  -@L`0PT 0T @ZP ,7sZ0D@lZ@0,D@P<ZHPZP@ 00Zk hd Q-L`@ 0PU`  0-80L@0DP *01T001  T  K0h+0 -L M<0 PPY@p` D R d0("C;004(00,0*80$080 0P$P90 0*$K*Y< 0@0 08 :0<0 0( 0 40 00D ,0 *DK(p}*W$00$0$P$P* -` @PL}P0U ^* -@0(@P@1L b}O*1S1S@*@*4"D1 Q @@10S c 0-0@L Y * K0h\dl3"B -L MPp` 0QS xQ Y@P@QP HY(K0 s  YQ' SPS0PPPs E 20S  00 v00 cPP0  5) 0T 0IC00J  WV00Y\dhd 0-@PL 0S YP |nY0@P\fY0PU @_Y0 PP  PQY0hd0S 0H0/@ -LmM  ! P pP (0S  3 0S 0 0mK 3/P&m?K 0 01 U#Y10S1 5P1 21 0S{ iOKeKpD1  (KU`1`#0`@K/K04/PKOK21 0:0P0@ 0S 9 0000  0:/P00C01 @SPE0P0X aK1 60pL1 (01 @0S21s@ )01 Z 0 @ 1KK4/!00C!0 0!4@P  0S eKiKS0P1 t@ #T0|1 0a/KKoKx1 0 _?K001 (1((0@a/K T 8!" S4@ ( Q   a/KT40!Sv(8  8 " 8 @  B@  (H0 03/ F(80! 0R!080@00C@00 01  80F 080@00C@0g( ((Z@a04gV(T(0 @ 1KK4/@((1KoK01 0! R!   T Rn |!x1R 00x1|! 4;*(((  $!080@00C@0 !00 0080 0 00@@@ c -LM,0 00000 00R K @ -`@LTH0 0P3/P @ -`T0L`1 RM'1a PKh' 0' c0 ; 0-@LDT0 0T0` 01 " @d\ lP pP D劓 0HK0h cxdVe 0-PL@G'0S0' 0'忌xd0 ӌxd -LMp`@圠8 4 K8P9/PDPWe 4\ 00K  @P ?P(K0S 0A03/00`@0@`\d -LlMP+@x0T D0 @ l0 hP < lK▘PPjX` `tQ"XPP}"$iPPw`0(0r$ 0;0"PPhp0K02 0000P P 0 P pp B *L D!DP @1 R l(-" P  h ! 2/PPD0P S%*L S":,0S!044 @SR(KlP  l pP  p t T Wp p p PP\rcxdN/ -L,MxqP `IX@00K+8p ?PPC0/S Vu(K?00 0 S0 ?P#/* b4 P40, KC"/C418< @ pU00<00< UXP 4{pG ,0VPC00pGp80 $Ve -L4MH0 0p@4a嘄T @ D0 `0 0L0 \U80K0 0T~PPX@4 D8 D1H00Z0 00PdPxP P0 0$0`0 C5<0T0lPpPhPtP$U PPT0@4 XQ \PTPQhX\&T00T0@0S T00K@0@000 2 040KBPPsX10 \Q0X1H0S 2 0H40K 0P /P\10 0\140h @000C\0X1T1 $  BP! 0@ 0LR}:@0(K00@0 p00  0PP A@0'QPF#P4@ @j 2mZ0S |g40 040 X1P0X1z PPPX\T00T0PT0 0T0` " P h@ lP PpP LTDv `0 HLT E/oT0D"0S RD0 P PPxdVetd\dL5L5vc00S P 3/Cc -LM@0 `p,0 0h (K(0  0010 P40 :P K4K:P00K'4P>P0 40P040 (0@ 0CS(0 ,K9P@`Vp Z,K9Pp4K9P00K'4)>P0 40@0P40 -PLM& @Q4@ aS  B$ 0 @@90 K4K1 010;0 @00`!P`pD(@T W,V/AU1@P 000 S&(K 00S S S ``pp@PPtt' 01p@ 01`@ 00P!0 R xdCcCc`rcV$B_$B\rcp@,A -PQLp" JS0@(Q!`ȀVcSP `V `V ^hSP R(0 5( r# 0(0`0S(0(td\rcrc -@QLp+ SP`U P(`U!SS@t#( r,0S#P0S `P, P#X8S@u"(P 0QS   Ptdc\rcЮ@ -@`PpLU 0S   Kh 0SP 0-L@ yP0[^#`P dP 0bK0h -LMP4Ap? 0 Rʜc#`$K   `P00@0p00 0 P @0ȟ'YXcCc -L0h0pp000K03 `00f000q00pW 0p00r00r0000P !000p 200;"'0D Lr001!20 0S l0l00l000S0  0@00\0h0>S |0|0S|0|  0|@01 R @@0n$1uD03/ !<J|0e0000t0(0 P00! !! [ |A!xvQtQ@08 T h0  !h0>S !(K}D@%00^00p\W`q w!8  [8IQ8GQ @ !Bq$Bd&Bx$B 3cctd -L4M08 p10K4AH`P`|PU @0〠p2 @5PP0S U @` X !S @`P10[SR804V 0TD @00 P0 f5PPTl1 <0 `@ 0V*:<0 & `V 00 ` H5PP0P001 K0K 00800 PPQ  0KK6PP(K@0 0S 00K+p:PP0V0 c`X <0 jv@CccVe43 0-x0L@S0d3/0x0d00 -L0#6000040>0#60@0>0#6000800<004q P Ż  0 1p0X # 3W R , "  帻W3/h Ehp' H0p̀@0 H4X1@h 41\1<1,0K#p 7/pP L!<T0A   01 l0 w000l  l 0 4h0  0 -0  0P*pW9pW`0<`0/L0      2/ p L0Dl0P 0- I-pP0  e0  eQpPW pGRrGR00P 6 _20p 00 9 h0 0,03/h00S  3/h0 (0S $  QL Xo.(0Xg L@r0p03/4,K P00!4p 00 0 pP> h003/DJNP0S8ND噋- 4 H($HI@ lP SpP OT0S  opW^kL  <wL <l{X<D0 +(0$D 0Lp@07/,pK'003/3 0000 0 DTpP 003/<01@01S  +h04q 00S l0SV8 N80l  8 VN0pl0P $1S 8 R h S 2/ g00P1 h0 000S 3/h0 0$1h ,!D03/\10S `&NP0SL!N0Ch T0% " p : X4d03 ,pK000 帐(' 8p T0(0t000C0Z XV{g<0 S oSD壊7H0 H2p(K=\dcxdCc$BtdVexdpvcc 0-LZM]OK@PP0 @K0 -LM00 K43 -LY hL33333 3303@3x0S o'P@ t0S 0 S 0`0(K `0 t0S? U 0000d0 ? R00(2   00x000<000<00 0W PX <ᔓ0 Py=X <XP0h m= 20S `20$00P0` -P4aL@T 0S 09P T %$0&$ ( R 86$0f8A B 0S/t B\R R  B 000X00S0\0x0T10S  ( 00S0  00/Dd -LMv4AP0S d0:d00Sڑ0K0)d0吐 Hf) <9QP ? =0 0000 t t0 0C0( k id !0 1111 Q0 t0V0S sPP1S 00 J4.8|080HRO?(尀$180S 3/N=}p0  A"l0 00l 0 l  0"20S3 Y  40Z00 0 S  dTM YX X B%"Y  &ŰG)01S h0Z(1S,!,!(!,1 0S   2 R @@00ㄠt00000S 0S  ( 00S0   0@0`0 \0S K  K S0<0 ;X D 2,2 Px0P &p H1(p5H1a0 tp0C000000VbIO[^Td0F TBb 1o0P ! iPm 0S Q h 刐  h #+h  Q Q ? p U J 5 1-0SlDd$BccFecc$B -4QL@ `d0  < 6 -LM0 0pS @ ` V 780S r 6X14Q WW w2 p0 0 00 0S 0`@0 0Kp Pu Z$0  \00C?o2S Ph00 0S Ywh0 W6$P \ kh \00S000t R R  0 Rd  !d  00C0V000B 0t R Rh       B V /  h0 000@oᴐYP㨐 000 ut0S 0U ` @0KP 㨠Z4Y 0S00SPM 30 0 0 (K3,K0x0*"P 3,K0x0*P a t0S000 t0S000 0U`0 =P 0U`0 0P h0` " 0V nh0 P3;h0@ T2@\0PS K KQ02 @< 0P00CP0< T00T0<:<X:<<X:0S X <؏X <0ҏ00(20t00S   00C00S  ( x# #$ R 0@@F;<f=1/ P gp e$clG #1 B/o0"S R0 400 x0_0t Rd0 C;00("4 0S 0  c cccDd 0-LM@0s ScT0P0K` ,0 TP X KHK0 0-L`MP0 @p0 0pKtKSl0Kp0S0 Q  tK, 00P0S X lK,K0 0-LRM@0PS 0K0 0RQ/K 0S/KR?KL1000P0S  RK,00P0S K,00P0S QK,K0 -h0PL;U@`h0P 0P *P n * (h05h0 0PKh[ -4ALPh0  t`h0  K5P00S KhbY l00x lQc\d -L0h0  000K0 08  000@00?0 00""$140S  3/420 0S l0l00l000S0  @匀<0#\0h0   R#0 00S s|0|0S|0|  0|@0@3 R @@0b$1uD03/ 3   R      20S WP12101S b01S xw up0  p<Jnp 0`? 080 a80 SNd0M 0 0t 0000( 0Sx0 000 !h0   R!0 00S 5h \100X O01'$An%  @ 4cv8 8@0l01N000t0(0cC00Ds1Sh 00Z 0 gO<0,cCcrcd$B 2B$B$Bd&Bx$BDd3ccd\d 0-LM 000 K 0-LM 000 K 0-LM 000 K -LM0  , R      ?R0 0000 K 0-PL@0S0 -pAp1LQ/P@n`1<<S81ʀ !` ``&!4  4 !`!`00, !  !0(0,22,2C_CP ]40SCP0OCPh1S ccdd d 0-LM@0 0h0 00K0P0\PP @5u0$  $ 90 @0K0%Bp3%B 0-P@LT00 3/@ -L@`P P` P00S0@0S   (  sc 0-4@L0S0 R 2/sc sc 0-,@LP00S   sc$00S/ R0/0sc  sc sc -P`0@LB PLCtdsc 0-P$@LBK0h:Ctdlsc tsc -P`$0L@T03/@sc ^scq 0- 0L@T00 3/@sc -LPp `k @P  p `2[40 , R @@0@0sc)%Bsc R 00 i sc P0-qpPPLP`00@T 0 0S$KkqS 0 j0 3/00@@HT 0 S 0 V0 3/@|@ AscY%Bs%B 0-PL@0S0 0-(@L 000d%B -p0SL,M`@P }uP p 00040K00|p 00  00 @0Ti@pP mu(KX 4 T40 T00 vZ``?` d44Ut` 0S 440," P!,"4,2<,2,2@0,2,2 0,20(0@40U  x0S40 0tcpvc -0LA0P TpP!Qd,2  TLP0S 0<0b,Q$A} c%B%Bdd%B -h@LP\`0S HPD8@0S (/]Ydd-0 0/ c%B\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -0L`@TP눠p QPZ |00Sp0呵d0P@%X0P@RL0P@P T0 (($@e cccRuBfA$&B@7&B,&B0 0 0/cd -L MpXA{0%XS "N0ᬀPP(Ko`0F㬀"N 0 o0 p@|0S [ 0F"NPᬀpvo(KoroS cc -PL@ሑp"nⲀXWP@ t@4 8R#8 @L @@ 0B0D(2S R[@B @0B08 cc0@o/c 0- L  Kh/L5 -LMpP`K` 0@0 t0K\0 0`@ 0 0 000 0$^?oP20S  R (K茼c 0-PL@0S0 -L$20CS$2("R Z -@0DML@0 00@ @0@0@ (+0'x0K@ 0000,00 (00!H0$@ @0<0 @ 00 0eK@c3T&BDcc3Z&B 0-x0x@L p@RJ,,1(!A|H LPL|DD@@0 002K0h輹@c@sc$tcpvc,A5a&Btci&BPtc$ 0 t$(Q6[ 0-@L4Qh(0S K0h_0t0d01d00S 00C00SK0h[?0S $00(0000 -`PL@P 1012n00$20$241D0S I0 !!0`1\0X0P000, !  !Kh cd ddP/P1S8(00S/ -@PL` P@PP VP PU 014A c c -@4QLb v0I002H1

 0#K#`p #0##K!#K0n ..`pn0 <`00/0 $ CP00P0 T00T081S88AS : d0 < w (1S,!,!,1(! ,2 Px0P f " H1`3$05bh0T(0PE_0$0C0Z0S   E LWREUP!oE ` L10L1GP@@!0b0?o SD!0b0?o S `&$04$08aV o~ cco&B - 0L@04QS La$p$0F7S EP1 $0  00C00(0 S$0 $$0  0 000$00$0WG -L M`p4A40 P00 $00Dd0  PPU P;@00  P P!RD1SM U' H140"W R@!R@( R D!@! 00 B SP! }  & (K@!R 8Q40S  #W  $ B D!]d0  *0 0C S  :P 8!R PQ@Q@ -0pL14a PQ@T0S 0(D? m0P1 0*1Xa@ cCc01 / c7K -p PL@2P3: p@#@P5o0 c00/]ȣZ -0ML< <0 4 000  0 KE4Cc.BHc -@0pLP` /0 @00Hcqp 0-L@wpP0 D00HcC-@P ؀ 0@ p`V 0pp`X0t }opV 0}ϠpT`X0H0  @X_@ `d@Bx 0/`d 0 pd 0-LM000(0( (0$10c00 K萯@|H4.Bpd -Pb0LT@pG@H0 D0 DaV < 80$+4!P r  0000000`pFp00C$0Y$KkU -L4M%K\4\ X1p41 `@H0 0S000  ,'0 00S060L0 0P!00 p 0F$0<0 Ki0P000DW@ D0 =0 Xp pv0D0 L0S00X0 080 8 0S0@e80僑040 0S800 @T4 D0R@0TOW@=U0@0%K"H0TPH00000L070|2 0 8@<Q0 L0 SRx0S8#$000003/$0H 0:0 40 DX0Z`0P  t?0PB 00 H0 D0]`0000 0SS@0SR0S 0 R  TT T00S000 <05W 0`5000700 00(K<p00000\03/0 0C00 00 0 CH0@<0 00 cPvcH4&.BTKeH4$0S8$0/ -LM4K-}P@x`xpT 4K.}U \úKYzP UḺᳺP4K|@+A-.BA -LM`phhPB<@0S 0S  0 \( 卺U$Kxd^.BW.B{S4 0-@p`DML!82,PK@%(`0`0 0,p$@ @@ @Q 0!1`a0 0,(p$@ @@ @ Q 0 0 0!1'000 0,(p$@ @ mQ0 0 0!H1'000 0,(p$@ @ XQ 0!1'00 `00 ,(p$@ @ DQ 0 0 0!0'000 0,(p$@ @ /Q 0!d0'00`0,(p$ `@ @0  Q(K.BAxdCnAo1B.BRuB.B 0-P\0L@THK0h= 0R0P 0S 03/@\vcd p-L M@P0@`Q Q10S@  0 R    ᢹ3T Q\` Q0@0S" 0 Rx    RKpH00S ԇ00 S$00 0n@xd.BW.B/B.B 1S/ 00gxdCc -X`P𝤀0 !`!800 (  , ! cd dd p-L M@`@P0S S 0SQTP00S { @0 ,R(   00Kpxd0/BW.B 0-PLK/0L@P 0 4P 0 K0h0c/B@B`jA 0!< 0`4 0 (   !/ cd dd 0-Ly@tP03/0 0-Ly@d3P @0303/P 03/0i/B 0-Liy@G D0Q  !1PS :g K0h蠠xdd -LM`呺<KzP@p圀T<Kz儺 K xP ކPP px@PiP<K-z@x/B+A/BA -0LP0SVhz@`pTᚆJwP\ xPD>,@z@xP e/Bd/B/B/B/B -<@LP0`ScP KhT\vc -LM00P K KTP \vc 0-LPw@P w@Pw0 0-@LxxK0hw -@40LP0`/ 0 ሸ0`0@/B -PL`0K/@P5 0 P. 0 P' P0S姷jxP 0Sd嚷6wP 0S4卷Khxc/B@B`jAxd/B/B0B -0L@ `RP ΅lq wP`wP `w0S ᵅ Xxd0B+0B -LM`vPPP K2%P00S 00S:KOP3><Ky@p刀T<Kyx2ᒅP x(P!<Kx@ee=0B@scA+gBT0B+A/B 3B -L Mp0$PK,p (0 0`A<@0%0S V KmP 0-LMP,K?yP@,KCyT 0S :S /wK00S ,KxvP  KP  P   -@L`K/P p P pPP0S厶wP 0Sބ\偶7vP 0Sф,tKhKwc/B@B`jAxdh0Bx0B0B -0L@ `RP lZuP`nvP `v0S ង Axd0B0B -LM`_PPP K<<Kx@p崀T<Kx0U  $ጄPᎄP pP j@PPsP<Kw@0B+A/B 3B p-L$M`0P4K<0 8 JxP@@ CU 4Kw<K@P4KAxT UKp0000/ 0-LM@P6P 0 0 PQK0KP p-LM`P4KxP@@ V 4Ktw@P4KwKp p-LM`P4KwP@@ ߃V 4KSwP@4KwKpP 0-PLM@X0K0 00 K0 0-LM@PPK0P 0K0 00 0-LM 0 01v KV4\V4 -PL@`P PTp ~ \ `@ X0S T$ k  xd0B0B1B -(0L 0S  Khxd1B -PpL`@00(0p ` P@  \vcp0@-@P0^PUPU  PU0^00 0@՜\vc 0-LM4Pu@P $000 uK0S4`O4 -LM` 㳜PDx@p1S d00.c10S1 QQP400,000 xuKxdCcdV4 0p-@`PML 00 0 0@@妦J|e0@`Ph hh0P`0`T TT@P H@b 80KphWc:1BdQ4@1BdI1B]4l1Bdw1BdXe4@-`0@ 0 @0 00000@00C@0cc0H S/P ((\\81갮@ -%.Lm C -@LMPpK` ` n K\ 0 0   0p  0 ` C0P?o20S 00 P0S0 0(K 0-PL@20S0o 0-@LT0t0Sl02l0v/s/|@ 0-LM 0@T6P 㟛0   Q@@   Pt! 垹t0@ 0h0@@00@ %㌭ <<K0hq Ю@cc0ud`i41B84"B 0-L8M,0\1@ 0T1P0L1p000'>0a0 00p(P$@ @cJ0,00 000p(P$@ @ @POJ/0 ,00!0 000p(P$@ @ @P;J00 ,00!\00p(P0P0$@ @0 @P0 &J$Khvci41Bd4 2B1B441B000/ -0L@0CS0DP $`(KhKhc - `0 L #@T 0SpW 0KhlPl'0S RpLa0$ R@ e@TKh訚ccFe 4 0 0 0 0 R0/c -LPt00C < 0 ,#0S  R0 R0/c Q-@L`@ \PTdP@P 2@0@T@c -pbL,MP`@ 0R * 0@ 0 0rp@ 04 0 T 4& D 40H @ 8 L 0 P0 < H00 L0 0 \ 0< 0 0 @0# P @<0 0 000000000W 0C00 pGD04 @ p0@D T@ @ @ t8@0@@0T@@x0s@0x@0@0_(Kcc0u0@-x0 0  ^ @ 0@0000@00C@0 0@bRccc 0 d 0-@L`|0RPS  0| 020SK0h0K0hFec -0L@2PQp` 0SR 0 0 0l02l0@T2U  R t BRQW l "l  @0CS 0l  BR d -L MS40 @p4 (LLS}   0" R``l   #P00 U  Rx R `P P,xQ TZ" RU R`  @ P40S " W DP"QZ|PRPi`oYppWpZPjVQaU Qa R] U ZQ x @ P$  P "    " jl  l 00 0P` 0`  | R |"QppR R| |@P w PZ ( ZV U(K0 00P`PPccFe -LM@1pP`2 @㝏K00T0S K` 0R@St2 0p 5/@t2Sp" p"0c 0-P0L@1P41S d0 D0SaD0000 c -\0\LQ4A@00S  Ob0P002Kht czc -0@PLq4Q0@0` SHH81SbT BY`0 <`0cXMV$KkG c 0 ֵd0d0Td p-TRL M  n! b ,_0"BSN<811 <!!01!Q0X !QX2 uB,1 D03/۱ 8@! 0 0SL1 0 S00#0,1` ?Q( 0(1!0C0QP 0{g0` Q?, 0,000000Tx0`*|abP  k$%Kphahvcd&Bx$B@scdpvccccxcxcCcCcdczcd>Pd 0-80L R0t0@A0x00d0T^d 0 Td0 T喵d p-L M@`PU PUPU0PK0% P oKp Q-L@P0 Q Q) Q0PS0  `0庮VᶮP0差U D00S S`0  0 00CR@hvcCc -`0LP` x@ pW OgҲW$Kk 3 0 $Kk{$03/@ Sc -L\M@x  | 0 (l  $x0p D0t0 `\KxP0T T 0}\0Xh0 Yp`P=0sT0Ph0 l0d0 :`0 d0KL0 0 JLK$JJdH0 @ 8 D <@ z LKtSP0V0l  0R]@|0 0RS@3@C 0 l 20$01l0& 200S! T! R  VX!0\12^0 000t1"  R0t12 ]50N0000T1 -LM PS   40$ 080, (0<04 00@0< 80D0D @0H0L H020T P0 0%U<0@`00h@d0\0'l00p0`CGp0&~pd0<0 OD080 H0 ;PH0 0< KjP@ mT<WI 0 Y 019P0Y@x D0  |??orP% i0T00 00P@ WI0070t0 CSR`@@ @0H0 ]P@ |Tx0I0<Kj@P Y8000 D0 DK0n90@0HhD0K0 $0 D` @p z@@ ci4 -LM4K`pAPP,0S ,!@T (PPQ 0wPP@  ᅑ$KP -L M@̪0 000㓬oK -LDMP0 0PX0 8@14 `4U 0s X04 `0P0(Ko?40SP0400H0 0ST0 PU 0S00 Up U0p 80 e>-P%(1`07`<0 4 <0 YD  @A\0 < 01 0!L `0 T<0Ss \0ATo 0<0 `0St0S h0X00 0P @U0媯00 080 00S~꼖4L4h4t4444 44xPP220$l0w0GS 20 R 0S<0Sd 00S0`0`@@0 H0Yh80T 00R0S` p T0SRX' 000000 0 000000000 0 0$0$0(0(0,0,0000040408080<0<0@0@0D0D0H0H0L0L0P0XP0T0T0X0X0\0X\0`0`0d0d0h0h0l0l0p0p0t0t0u0u0x0x0 |0|0000000000000000X0000000000000000000000X000000000000////<< @ A 1X1 1NυN1 1 1$1$1(1(1,1,101014141P1P1T1XT1X1X1\1\1`1`1d1d1h1h1l1l1 p1 p1^^a2 2aX2/2 2 2$2X#΅$2(2#(2? H2X@ H2L2%L20= h\0e`0D Xg7\0ZuD0 0D0 H0 0CH0 L0 0L0 @0S_ Z00 00S1B40ST 4 D00CP 0L S 3,:ዏ%ሏ< (KS 200Sw?QP |0尧W0媧0寧0媧  ^%[<<P<00@ >800C80 L0P N=00@0S Rq cc41x00/41xT10/41T10/ -P(@4aLz200c -hP@Lp`iT4120$00aP2@0@$00c -`P@Lp`JT41200CP2@0@0c 0-L@0 0-LP@0 0-L@0 0-L@0 0-LP@0 0-L@٦0 -L@P`0S P 0Kh  0-P4AL0x Dx000 R04QxR 6/ -LMP4pͨ`Yu0@x7yIu[x ᄦPYy a0  tP @ pP p 0ppF0P  00 B00(KUP  NP  JPAP    : P   6 P- P(P ᓨu P VYSYppGgWYTYy x   Px -L M`p4P)x0@v5wGxYv PWwk   ֥P @ ҥP P PP0ᢨP   (KṥP  ᲥP  ᮥPᥥP    ឥP   ᚥPᑥPጥP x  Ꭵw  ፥v  ᆥ  vP -LM 0  K" 0-LM00  K -LM0tpbE@uBP=$0P 000K7 -LM 0  / K" 0-LM00 " K -LM0tpb@uP $0P 000K741`0#400/ p-L MP`'00 0@PPKphҧ5Kp -LM@PT@#@`4q2 ,K^0 ,KaKc -L(M04a00P 唧@P 8K0 @P ?T@$Kp2P0 x $0R  />P 00/x0 0㍥0 00 ,c1B -h0L1410SP00SD0DpP@0Q@``0 S/0V ccCc1Bd 0-l0L1$" $" R @$@P$(2S 00@T*P c 0-P@LT0 000000@ -`0L14Q0S `>@T 00P ΋@Ur c -@L`TP5 TK TLUJ ||!:FPUS00V0S> 㨋H1`P1p4(1 0SpZ=& P% V* U&00P14Ap0@T$@  V U 0@$Kk@@ e@ " Z@ cyc -@LM `0B<~0 00,(`$@ @@ @|80 000!|>P0t> 0<040,(`$@ @ @Pd8; $00!$>0>00/> 004,(` @ @L8 0!=0 040P,(`$@ @@ @78 0!=400 80P,(`$@ @@ @!8 0h!/> 840 0<0P,(`$@ @ @8 0!/>̟ 40 0<8P0P,(`$@ @ @7 0̠!h<0 084P0P,(`$@ @@ @7 0!/>8 80 0<4P0P,(`$@ @ @7 0!/>˟ 0 0<8P4P0P,(`$@ @ @7 0̠!H;400 80P,(`$@ @@ @7 0!/>4 80 0<0P,(`$@ @ @v7 0!/>4ʟ 0 0<8P0P,(`$@ @ @\7 0̠! :400 80P,(`$@ @@ @E7 0!/> 8@40 0<0P,(`$@ @ @-7 0!/>ɟ 40 0<8P0P,(`$@ @ @7 04 ̠!90 080P,(`$@ @@ @6 04 !/>80 0<0P,(`$@ @ @6 04 !/>\ȟ\0 0<8P0P,(`$@ @ @60 400̠!70 080P,(`$@ @@ @60 400!/>h80 0<0P,(`$@ @ @60 400!/>0ǟ00 0<8P0P,(`$@ @ @60 400̠!60 080P,(`$@ @@ @h60 400!/>Ɵ0 0<8P0P,(`$@ @ @460 400̠!50 080P,(`$@ @@ @60 400!/>@80 0<0P,(`$@ @ @60 400!/>ğ0 0<8P0P,(`$@ @ @5 0 400̠!d40 080P,(`$@ @@ @5 0 400!/>80 0<0P,(`$@ @ @5 0 400!/>ß0 0<8P0P,(`$@ @ @5 0̠!D30 084`0P,(`$@ @@ @5 0!/>80 0<4`0P,(`$@ @ @o5 0!/>Ÿ0 0<8P4`0P,(`$@ @ @V5 0 400̠! 20 080P,(`$@ @@ @?5 0 400!/>80 0<0P,(`$@ @ @%5 0 400!/>``0 0<8P0P,(`$@ @ @ 5 0 400̠!00 080P,(`$@ @@ @4 0840/ 0l!0 <0P,(`$@1Bc1BP4"B2BhdL42BP4B2B2BuB&2B/2B82BB2Bp2BO2BB\2Bh2Bo2BZ&BuB4z2B42B2B @ @4 0 400DD!0 <8P0P,(`$@ @ @4 0!00/>㤠00 04,(`$@ @ @P4 0!00/>00 04,(`$@ @ @Pt4 0!@10/>004,(`$@ @ @P0 ^4(K -8Q4ALp`0S S# S;V @TB )@ V P )@0S)T@D@"|0T@VB`)@\0PU `0S _05P2T@ Pcc -pa4QL@D0S S2 SPT =PUN 3 @ n`kV@=T 1P8 `PU@  @ RT`|PTߜ`0PU `0S 0Ӝ0P@ @` 1TP+@@`cc p-LM`P V 4A @ ,KyV  ,KAKp -LMP@`0VM#`p## 0`  `p`,22 48<0@S, 4K8<K$P`p`3p30K #KRK$KP 0K#K 0`p`#p# 0  K$K -LLMh0 0D0 _/o%K, $KD0 L0 VPL0h xp, '}`p W1# QPx0 W xp ) P p00wP@PEP`p R)0 ,00S(  r^ P,50S(%` 00prNO00h h0 00h L0v00h 00 00h K@scCcB4BP4B^4Bl4B -@pL `WP0 T7 X000CX0?U0;0Eƒ1Q  > @@000,2S$00$0 0S PJEW0S𨝨D0 RQKhmQ00T0dyc 0-@Lw  00R    B ,"R$  B$ ?P ; @‚!^ R0A!4.! R0!R 0b /o" 0Q A 0 //(X` 0L\S000$0Q7Ó$0$0`0X09D \Q\   R\\  \  7$0 0-T0L@T@0 Q 0?S0;0Cƒ1@D00T00 cd 0-L00 R @000@@@| c0  /~4B0/ -L$20CS$2("R  -LM,0 0S000lw Ke-B^@yc  -LG -/ -LMH1Q@Q80 0000 40 0040 00 $2p0 `p`$200   ?Z .80(Ko0S00S>< > 40  Z < >< 40 <>X 00S ceyc -0L@q00SPppc. EY UP= `PWV0$V `XH. 0$KkV>>.0 X5.0  ce -X0Q`Q ppP0LP@ P. c -PL.@ T@m= pX  `u=T@$0" S T`0 $Kk=]= -`P0@LQP0S   bT-@ c<00SP/ 0///e<00S P/( 0 0@o//e c,00SP/00//e00/]Ӆ -0ML< <0 4 000  ن0 KL5Cc4Bc 0-00PL @000c`@ 0-L@f@P0 300c -LM@41Pp$[[.@N u0`S00 4@4/0042(K P4B0 3/4 0  -LM@41Pp$[[.@N u0`S00 4@4/0042(K P4B0 3/4 0 /00/ -0LMp0 0@PU(K 0S P `K` F0K\0 0`@ 0 0 000 0?oP20SH00S 0 00,,Ӌ03/P zdyc@4B4B -Lp4B -L4M0`0S@' pP+@T"0,00 (00!0@$@000'> @ @0 0` "@P0W`S`@I K'DPp@@ycd0 5ycd -L8M 0 000<P`p@000,(P$ a "0P R h $00   '. 0  0,(P @ax"$Kk$Kd5Byc5B p-PL M` 0@T T0@T  S  0D 00 #P (($o`Kpdyc@%5Bdd04!@1<h  ςP d R00@"l !03// c0@- 0S"@PB"00 0-PD@L O01S001  R  K0h0 0-P<0L14A 0D@ 0 0 2010 0Qo0 cj 0-PL@!0S0^ -P`@LT(0S$0(`00C08A - LZD 0-4QL@t0S d0S00C00(0 &K0hI \/>\d 0-LP00C"0!300 @ 0 !A\  Q` bD000@TR0000PPP#0 Q0-L@ 00 P 0S(0141"2 0R00 c 0b0?o 0s0 c /o b0!0/ -0LP \d -LALPTp` 49$0 8$0.@$04$00F"l !03  (0SX@X t0>S0?03/(00CS*5558585552@T $@G  0 S 0(0000S $@@ %@@ 0-@0ML 00 00@@@@塃0P 0x00@0@ @@x㒃PPLT7 4r8 ,,K0hlH5f5Bcn5Bch5&55"B -HP QLK =T0廄`  0@8+TCPc 0-[L@<P0  0K0hńc -HPL`8SP0 ㇄@  x+%C08H@KhcG-HP0@!q@0D0H0L000000000111 1a  A @@ A⮒ Qဠ@ A⮒ Q& Aba䑖@Q$0(0,0004 d  d 111281B0c0 0S/0 c -PLPp@U#P0Z00 `U00 t  `\B` @T 0S P x A0p0 0-@4PLQ0 R00  㻃c0S/ p-LM@P`P" RS,K. 0 0,0 (00(0  $00$0  00 0 PP  E2 1"  P0E"0A 30Kp0Q0@-" P0S0Q@ L >̠ TP00000 00 0 0 00 00 0 00 -@LNP`@T  8A p-L M`P@K`$ @   -`Kp -PLMMH`@0p$4@ 0@ ,@ (@  @ "   䑘䑈$K   @@P$@(@,@0@4p 0$pK@' 8p  4K`0AA 8AB`02 SB0!!!!!!!!  $K̯@ p-LM`P4A',Kr?D1(H 1@U$00L1 1 ,0000,0 11( 0$0 10 0  PKp0E"K! 03P 0-4a001L0>P@00104!H" 4!D & 0p0(0 r k Kh(10101 -0LP@4q  Y (` V  0`P 0010 10010A4" l 1//$04$0 -LMt0@0C P(K080 01S 8038 q<<0 h0p  Z' `P NPP  800C"0!a1`! 2 0S  2S02ą`$ 0,PK0% 0P   NC  N=@P41S t Rd Rp Q+ @ 幸0P Q @  B^ "yV S`P~ Z  ី@Ph  uPP&0  B "^U1St0hPS[ d RU {&PUu 0 <0SP58Q?o22cN<PP^8 U R% PP8 QPU S0S00C00ht0d01d0R /1d0XP1` 80 ? 80!!bR!X̯@@cc -LMPxq4@`U$ PP1@T) `0Sx ZR000  00 000 bPVP  @T P @TU(Kx0S` 0  6P VP t0 CSR |@cc p-L|M@?x `KP>0U0 000 x00t0 +<0p lP P h 0d0 Gd0K] =Kp 0-d0 @1d00t0000L00K0hw -pL`0@T% `0S d0S0SP`P GU CUV($Kk3 8@Pccc -1Lpa4At0Sd0S 1d0+%0SP'd0SXP ]P 0Sd0S$Kk 0 A8QU 2 ccc 0-LxM@t PK=0 0 |P K K0 0-LMd0@60#R00SP 40$10 0\ Q Q Q $ l K0h -P`p@LTW l0  |@ p-L|M@`Pt K=0 0 K0` Kp41$1 0/ -LMPP1`儒p04A& $d0  a_ᲺHOSWH000 rh0 + 0Rl0$/0 S @1<`܁p ^!` 00 =00 rP` $1 `^0# (Ko/F280 1 4 40Q 202  (KopGoPrpW @0 00D < {p40< D@0 101101800 11 00 0(Ko(Kcw5B -LM1q Q4A?0 d0  x1Y `塃h   @1(K  R @alSYR Ppt K<P1 儐 40 H K^⠐ 夀 p p1` ܁吠 < CZ l`~-1SiP $1. `@T0K 4/ፈ7 cc5B -`L$MP4A x0S:ڠ01 hl   0 P, (0 ?Ⰰd0 1d0!) us c̯@ -P@4` HpLk^`^;"101101 1011010  E2 1!U ( !02$Kk̯@ 0-@PL0x (㨂x  K0h5B5B -LM4APd0p  $08$0 ށ  9!% :d0$`V0S 0 00߇  00C0\V$08$0S8a7$0ሴ/000 X :1Xxq|10 i` X !j |X( $03/ `j00S P ?Vx 0 `p <Vd02d0d0 :d0Ƨ`$ 5B5B̯@c zc̰@@ -LxM<1`At!4Q嘁R H0t!v2~X0201S" x1Sx K^:` ^K:1܁,0 ~P 7$1 ` X0K 8/ Y& K P KN 0KP K$K c -0`!L4!PH @"Q|85|858585x@ pW aīW$03/8 $KkUi$Kk! cc5B 0-Ppt0d0L1d0?`0S 00C0@TT(0S$0 J R 8AV   `(p000 -L|M` 1Q4At $1K0p900 P1X@ 40 00 00 0tK␀ |0 0 x0 90S : 4d0  pö` K!0 R @! ](Kh   S `H0` 㠀40`K1^9  P $1.`@T0K 4/ c5B$ t0 l?S  Q Rp 0S/ -LP@p `V p0 R 00@PX0`00@@@`p  @000/0S0S/ S  , 0 0!< 0`4 0 (   !/ cd dd 0-\L@PA0 @T000/ -,R00, 0$ @00 $ 00 (LQ Kh,RR0(t `0 0\ 0C`0 5( `@40(0PKhsLzcd 0-LLA  0( >00\0K0h4 cd -t1taLQ0Sp lW> $0 G$ 2 @40$0TppW $@冇@D 4q X@P 01 @P 41H0B0@@ 0S 4 8PX ,* X@,P #@ c\d̯@ -P@`pLQ 0ȀS0@T$Kk 0-P@L U0K0h 0-@LP0U0SK0hK0hw - L@`Q`Uʀ0!`` 0X P   !TV  cd dd0t0| xR  0-PL@10S0n\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -P`L@T h.`pn!X@0SP00:#003/0:#0 c -pP0LAbP 000(p# c -AL M0p00 `㩿0 R %}@(K,\`@zO 40 {aP40\ɿ` R 0&%x00`q&&`a嶿Sd c5BTJ5c -@`0L0P 0>00T0S; 9X`Po_ 0P/{S  pPI SXD0S6\P E$P\0S  pP \P0K*RP ?Y \ Z8ER*"0P SPSXD0S  D0S X00P0 p\Q! '0X0 D0S 0 0S0R0S \0SW 80SG7P WR0 ZP P0p0 084s$3   0` Z 00Z-0wPWk ᑦh꒓!Q00 00 `08 0 '0 r'000 0`0 QF:8n8`04 RK40 040K  0W0 0440@P4 0p;b0  RY 0SS S\0[00 S\000D0H0080P0SL 0(  SI0 00008 P@R `08  P00R:`B 0 %0 ' 0P@4P8Q`  8 P 0Q:%K#\ ;0 0@( P0\0PE0PU,9BS9B`zcb -LMP04S ` 4l@Q0s0S 0P R0p@(K0 00o@P0p@020p V 0K0 0K[@P` K&84p 0[d`T@ RS K1 A%P 1Z Z @``` 0 0  R4 RB@ P 0P ]0000 XP T0X0`p  K&4 BT*0B08` B %04`8 `FT :`0&*`  .&P4@@DT4@8,0@8@P0S$(00X"0 K00@`  R @` 8 P 8 4Q:P(0P9B`zc p-@PL MP0  8<0`0S 0 KpKph\d -L|M0 00 00@p$R k@70S@3Q0s 㜤`P @( 0T8P000 l 0K0 0Ko@P40S` W`0 40S@ @@0 nP@ ᐤ(KT P@`0T%d0S ( S@2  00 W X0S OPv 0K0 ;4j@Pf b0PQ0p p@00 XP L40X00'0000 40S6r  0RV00 "4H+)%XPM00 0Z0(00000C0 00  S @P 00B0 00C0 000s% @@@Y@T0k ^ڣ@P @a 7%070 4@ 000 )nP`P0K?. P +$9B`zc P0-L+@0@@@P hT: (K0hS03/d`zcBBd 0<0/`zc P-L Kh?0!,20,2d c01, cd d -LMp0S1004 S0 0X @04S8P`` @j(KU 00S0@S`Y!400 /#'000 %40 00S*0 0S   R0  0000 00000 0  0 00 zmP 00`@00S8PPV`zc9B -L$M`PQp 04S 3j,00K0 0t H@TP) P00Q1S0S 055|55l55x@00 F0 Pp 0 4/(KW<@W0@(@$@-@9Bt5H|5|5x5(55 -LPM0 `V@X0  0B S P XKPP $KTpK!XPP00S 000 p000X0KkPV  XKUPU0S X0S P\d -LMp04SP`@ iT 0`0S0V0S`0 KPU -(K0 0 K0Kp P0HpW  0 0 @`0`0 0 07/(:B -L|M`0 0@$R p BiP70SP3Q0s0K00 0K0 PP"d0S"W@ 41$1H R@ ,0Kd # D@B!@ `P0@ 4@800 `40 S0(K( ` S  PQ( S  800S  P @D RT0`00 0S X_Y `0 P``Y I`IXP9B -LWMh1 0R@p`1  `Vh@`h1S0h!0T0 Z4040d1 <d1 ,0\1 0X1 XQ YX  \1 \! P,0K 1u Q 0s Kl1 Pl1?@uPP PE, K !  1(0W 0 d10 @ @ @  d1 ( W" W W`10000K@`0@ @ 0 SK,0KV/K(a#  P @P  KXKh`1开 0 $00 T1X @00KE0p>K KPPKK P D0R0 sR j Kh@eP0Ph1PZPSPU ,0KV/K(a#SK SP 0`TX 4 RSX! g8``'`q p W0S`1X ZT1 p|PU8㞠PP @㙠P%ᴠh1S T1h!00S TQX`Vd1w p~Pt  !0X@70(K@ !0p0 0P`1Q1P R+0p`1GKS  4 0X!0`l! LP l!a! !!aZ 0`  0XGK00P RQ `1P0S`!jg`1  P0!p!!W P 0R0C 0`1p 00C 0 01P`!A(   f0@X0h1SafM:Bi:B:B:B:B --L0M0 00 P Uq 0 0$ K!0s  $0KPE #pK K  X@P RT@ KᄀKX |K`开 40 $0K0   ` $0K@# @ ` pBP@  8040 @ P0Q 0 ` `PV0Q S0 XP TPP {PP 0 X 0 XP' ?@ -`L 1V`04S8@Pp& f$Kk  0P n0p`0 P fp`@48`0D"S*` Q0Q 8P@PT 00S`@`8P IP04p0pSV8pd`zc;B -P0 LYf0 `娀娐q Rʘ,KoMf s@ S shBfT@ a0 @(0K, K $K=Bcdc 0S-Lp@`@T`rE P @P `jEH0W P@ǟ@0T@SP P0PT T`P%@U )`HE@@H W P@dc 0-@L`垟%R0@P0ST T % $џT0`K0h Ec -0SLpPR`a`yPUL嶟 E@P PC0W Pp+LP# P3 L  LLX0PU,PS 0 0@ 0@!凟T PPtY PD hPP P DKD W Pdcd c 0-@LT!R0@0S   KT0K0hc 0-L@KPK0 0-@PLKK@K0 0--L M$P@0`p $0 \0p00Fb `K -P@Lʞ`V `5b 0 $ 0Kh,bꔾ5G=B 0-@@PLF 1 T!1b000 c 00-SLP@0:ᒞ00S ,0 0,0@0,0bK0hž0 0R40 00 000 @ 00-SLP@  S00e 0R 0,0 0 坞.00 0-L@PP00S0a -LxMP><`@Txv$K 0R00 0 p耄0S ( R,00CP0000 x Kp,00 00 00t0 0ؐ0J Kscd 00-@0000L0CSh4 0S 0RD 000 ,#00CS  K0hPdd( R/0S/00 d -@L,MX弝$HQ%X((K0<KS\w%$KK#KQPXU4PUPPHKdKKa\1ÌeȌ6̌USRB4` VB|和)40L0KlH0 s#?PD$K,@P`>.$K 0p$KPJԅKU$K+  00  ;0  5X OKRPPR`X0S0PS b0D D 0Pbʚ;dɚ;ʚ;L5 0!< 0`4 0 (   !/ cd dd p-L,Md!@`aPVʀ0!`8!00!(!   !4K#KP0, K0CS<0 P K < U [00D0K0 0t]P  KpKh0< @ T R 4  cd ddʚ;Hdɚ;6e p-@`P```0ML 00 @`@UL40 @`0@0 BKLKpdcO=BX=B 0-8@P0LP 0m 0d@5 SR[/ -LM@$K@bP $ḴKQQP@/ 0-LM@P $K地P0$ K4K0 P-L@ PTp`0 QP00 0ʚ; -LM@$KPQ  $K{K -PLLM\0Kh l 0 `0Klh|bP <PX 0 (K`0嘡S0`0 X,0K@C@0` p#P?oX20SM LKhaPdKl0D P0 0 C\P  R00 00 ıY)`P` %K`Vp 0T LQ V0  P`p`AQ V0  yʚ;b=B p-L,MP` ,Kϯ@P0S<0K0 ,0Kc@Q 0 <K԰P@Kp -L(M@p`,K 嫯PP 0S<0K0,0K@ PQ 00 <K⮰PPPK -LM R R S41x01 K0 唰 KSP12 -LM0@S 0Q  ,K,0 (0 |  $K]$K $KqP K 0-RL M@P 41tx YT U  4K>P 4@K/0QP K $KK0j=B -LM0 K -pQL` Ѐ 崚 0 0 @P 0R @TP=)@ - `ޚVP嘚H!0#0@_0( 1@01$Kkǚhdd@Bd p-0,ML00`@ [PPP4!P<KQ,KQ  ,Kد <K⻮P PKp -41pL` G?o2!R0SH0!R儚00CS 0S 0SS0+EXPX@@TX@ @X@0dɚ;6e -0L@0CSDOP%0XP0PSD_0" _0S'%0XPm 0R 00P eЅ WV.XX ^-R< 00S0@@ XP:000@@S  Se XPX  RX  X 0X`V peX X BRX `Vpe X R @@0%e`VpX0X 0CSX0`Vpe0X0dL5ʚ;ɚ;6e -XL^ E0A  T0%XX%0NQ^XЄ 0HP P`@0XQXUZ@X,0PE0X0 -Xʚ; -LMP@@0 CR5  R S4K$!cKSR,QQ 0 00!$KR R0,AQ R0!000 R Sd ``\\ %XQ 0!ʚ;ɚ;6e -L\M0 0p0 @`0 ?o2!R0SlK\K>^PPLlK:^PPH岘 0ATP=LK@@lK%0X0S 0BQ0*SR|K#'K 0%X0t 0!X0S  X `p 峘WLK(K5S |Ke'KP 0%X0t 0CSX0P5k9 RP&JZ@. 0 $RQ0 eJ# ^Q0 W  T(   T  , 0p, xptpp x 0 T0 @@D 0 T`pp pXpp,@K 4( ( Ydd -LM0q KԔ -L$MD p`/\P  (K'\P @D00@0 !00S@0S @ 01S 婖@01PU-T G@@0SD@  ( D 0pP  GRppPPH0 H0Wl5 55l5 , @P@Ϡ0X $ H00  ^00S W W' Hp 囖T GI  <KP#K 0 X4%D0XQ1 e06%X<Kddɚ; -L(MPpU`@4T0S T DKtP $K LKLP H0 qP D K4 -@LPT`<V`M `p"\ 0 Sd0\0 %X^X 0%10X000S0@ 0S QJS X` p De RX (X R 0 0 `qp0S ផ`$V0S( 0S%0S"0S0Ε$KkzHX0`p^`pXe R 0$Kk譕dɚ;6ed 0-41L@0PS0\41@T U PU /d00Pt@T /000PgK0hzdCc0@-4P@ T0 R000 -PL`@0SY -1LQ 0@ PP```Q00$KkC0  0  CR+R RC400 0C?ʃ10R00 RC400 0C?ʃ1RC80# R0%KV&K/X0@ TP!@#j? R0@@T` !0 0KVO|N `0 <KĺT;00#K$K/40@A@`qD 4QW0ʀ 0! `! 0    !LKC 0!!`q0    !M(KM`X0SxxM%K#K040 ``&P @f .>Blch>BQ>B cd dd ?BB>B>B>B>B -LMP@U 4K0<0#K`RcK 5/$K0S `< H00 <0VR 4 K\04K3/Cc -LMH@0S $K"K0 P $KP jMKlc0?B -p@ L0 0aPUTe5@ ᧬VP `0SPT Q5he -LDM 1Q0@S @0*pl0!(0 0 40K0,p$@ @@ @`D\\104 K00K,(p$@ @ @@1104 K00K,(p$@ @ @@ 004 K00K,(p$@ @ @@004 K00K,(p$@ @ @@\00,(p$@ @ @@00K4 K(KCcheK?B6S?B[?Bb?Bj?Bh2B -@LM`0p  ?0PQ "@K` 0 0 K\ L)P\ 000 0 0@ 00 0000\(K@T|@ 0-@LK0hj 0-@L K0h` 0-@LK0hV -@pL@BP`K QP00T00S d[`4!M!40Ѝ/0M0000# Ѝ/ p-LM`0F S#*@\Pb,K"2[ 092K$0[@0<<,K$0KP@TKp -PL`LPEU@!0T090D0T@0<<0D -L(M0$00 0 00 00 00 00 0 00000000 L Kq?B -L(M &4K4K K K,A -L M @K ! 0  "$  "$   @RK 0-P@LM K0 P 000K00K1[0E00K00K1[0E00E0 @ E S K0 0-LM@P `0b"!4b4#K0! +(00 0 0 0@ S K0 0-@PLM Kk X0b" @!4b4# 0D D00D0 P D S K0h R/4!"?aAt R/00/ 0-PL@ᑍ0S0΍ -@0`pL!DM,PK@%(0 000,$@ @a@ @ '00S) 0 V0 0 00,(00$@0a0@ @ \0,(0P0$@ @00a0 @0 (KzRBCccBwdBx6?B -LMp0` 0PR@ ?|0K ` 0 KL 0 0 000000xK?q  cCc 1`S-L@PkLp T  [ PE\U  0t h l  Q R/h R/R44 4  4  4 /c c 0-(0L@ CSR0S0P0^ D0+\ K0h0 d/ 0- L@R0(0 B K0hd 0-@LT0Œ8A 0-h0L@S00; S :#0K0h譌000000/c -`0LP @Zp0@ 0 BJp`0S @0@ P #僌 Khdc//00/ 0-00PAL0 00K0hh c/// -L M 0Q㌐p`P0P@(K4 00 :/@P`004  809/,IQU 58/Px974<7?BA -LM!PP0 `pEV @80 4 :/`P4 80 0` < 00&CB -L$M@ `RPp#T@@0(K |  0 S R 0` 0 < &bG6 ᐆ# I4  Z R B0  T1rp;!Y8  10 @DpR05 00040 00JCBCB0- b B30 RB  -LMR`pP U0(KR<6 S#B"0 R H P㐤# 0  I8 0 R R00C0 ~ Y  @@ 0 B4  W1r`r;0 Y  00P pG 000 40080 00CBCB Q-@LpT, TP"!bIX:V T0 pG PW T0 pT0A0U! -pP `LV:w"0@ p`Ph"0PbR 0-@LX"K0hS" 0-LM@PP 0 S  p  B K0  - 0-LM@PP 0 S{  K0 -LM Rp@00 Py (KoY@`(K4  @T00U0SY RR00"B`#180 0J40 00Y00U0S 0s U :@40 PE80p `P40 P -L M@P 0 S 00C 0K -L Mp@!P`T@!@ wX R BW Ki+ 0-L@PPT0@@0 R: TP 0 -0LMP,@K0$0`Рp̐W 00S" 0 00000(K H 0 P = 0 Pp 0 00P ̂ceAFAA -@P`pDML { ,0K@# 0,(P$@ @a@ @P p.00S 400 ,0L0(P$@0@0 @a00 @00(KeCBeS6DB -@P,`LN{ 0 P@ {êc 0-@L\={ PU Hz{P08 0S  Q k{0êc -ML M0P0 ` SlL9`dqd{X1@TU  R*BK+, @BK+ @<{BK @xz RXU P X  Q@@XU@@$T  T{(K < {\ 04`03/DBvcêc-DB3DB0/0/0/0/ 0-@PL0P0$ P  0-@MzP UP0 3/0PP0` -QL`PP@ y 0U" ,z -@PPL`y(0S0(0  R  Khz0 -QLp`PP yP@T'0@"V y -LMD00S 80  KK 00!ce@B -LMp@P`W P0 S0P0=$A(h0 0 0KT P ,7S06K~DBTDB -P`p@Lgy0 Khy -L -L,M S 0@0T %Kh0141D0S Չ<0K40 000 08 $ , < 4KD , (0   0 ꄂ> cpvc -L,M S 0@0T Kh0141D0S Ὂ<0K40 0< 8 $ , , 4KD 0 (0   ꄂ> cpvc -pP젟LW6 P`@T0``0C0 0W@1R 040 V0S0 P0pG0000C000C0  ]脂> c-@T0 pUTT#*A/ -LMP K`pV@P0  5@ K -LMP K`p@@P0  P@ K -L MP@`ptPPt@ K t(K tt0 (@(~cP  !ڈP   -Pp0LA40 D`P$20$2`P0 S`$@P$(2S 41 D c/Ȑ/А/ؐߐ/// /////,/Q :Q   4@o/49@o/4/4!@o/<0/P8/@/ -0LoP@- |0x0 0^@ T000Q@0<0 0 S Q000cĠc,c0c se -LM<0 ?oP2``VpP8 @\sX4X 0 40 RWl 0S $4 44Q:0 SD1 @Q 8@ @P@  `W 0S000S000 S RSR@d!RW@# q0 <1SRʾ ꞣ$@Q 0B S  P b!<02 0Qq0S @2 2t20040R 0 SPP0 @,1SS  &`R 0A S  P a!<01 0AT@<004 0@ 0 0S*`0@`sP <I0P 00 `FԐ  i P T0@ 8P 00@40040\0@0000r@(Ko30Q0 @re,c(c@cĠc<@EB0c@,cJ@EB0c -P`$@L{rre0 QP (0 $00S00//cĠc0 QP (0 $00S00//,c0c40 000R0/\ 0cĠc40 000R0/\ 0,c0c 0-@L#rT00Sڤ001S 000P0\ 0S@DGr@0 < R0 AT@7recĠc(c,c,c0c 0-@PL@Pq H0D00Q@0\@r0 e(c,c 0-@PL@Pq H0D00Q@0\@q0 e(c,c -L MpP@$ Pq0 R `V. 00 # P00# R 0 B RPUlqPh00S\001S T  Q0@0Dq(KPe,c(ccĠc -L MpP@$ PWq0 R `V. 00  P00# R 0 B RPUlwqPh00S\001S T  0@0Daq(KPe,c(c,c0c -,QL@ T  q10S101S 000Q0\ Q `p(2q`p 00Sڐ001S 0|x $@ ZFp_`!@80 p ` qe,c0c(c,ccĠc -,QL@ T p10S101S 000Q0\ Q `p(p`p 00Sڐ001S 0|x $@ ZFp_`!@80 p `pecĠc(c,c,c0c -@PL\pYp`8pV 0 $Kk/e -L@P`pP 0 Kh/ 0-@LP000$00 00K0h/؂c -L@P`pP 0 Kh/ -L@P`pP  0Kh/ -L}P -LuP 0-L@PlP 0S K0h/0 -L@P`pYP  0Kh/ -@PL\poT`8oV 0 $Kk/e -L@P`p:P 0 Kh/ -L@P`p&P 0 Kh/ -L@P`pP 0 Kh/ -L@P`pP 0 Kh/ 0-L@PP00K0h/ 0-L@PP 0S K0h/0 -L@P`pP 0 Kh/ -L@P`pP  0Kh/ -L@P`P $0 Kh/ -L@P`pP ( 0Kh/ -LP, -LyP,/0S/!   -L$MA(0qp#F0@9q@A`a0Q |8 40 tQ-408 d \ P 5/##K$0 S,#K05/V? Y$ (0R9ԃKB08 0 u 5/8  0j, 0e 0(Ko/Y#K ?x#K5/$00CσS 0Ġ ? 0<5/(Kx97X@ 77EBmBEBFBEB FBEBEB -LOP0S -@L`P `*nl &n0t0p0P0 0T0`\PX 0-@Lf  3X0 -@l`LPpnH@T @ U@ 5/@7n 0-@LX7 P z0 0f~ K0hy 0-L@lm`K0hmXRXXXO -؃XP0L`p@00$A ? ? 0SR T 0 P0$@ -L$M@c( 1PV"6 001 ‚dK00(K8Q 2 P帀 pN `n'3&8 ><0 0'3&>@ D0 '0p08!$0a ?#K00/`?p#K 0p;40 400 dK#K 0p`#KWVdK R0#K0 #KR040$K$K QP #K 0 SR06 00 ( dK`p$08 0 -P(L@ P:8 R `Ġˌ$8< (  $& , 8b5/Kh 0-@LMS    $0  0C?o2QP R\4 R1 P$K@K008@Q| AP"0K80 S  a"0K08SFBJFB -LfMp2PQ` 0Q 37Q00 RV K!0# 0 WV $2Q) 2Q| 46C!0CQ& 1Q v QF1Q`  6C0CQ( 1Q_ 3C 5CQa  VCQf/Q m?Kf/(0RE/ 0 S0;301&6`0)0!R!  0S 2      *! R{\x P  sz  Dq Dm Da gd@edAd@d@{dЀ|d -0`S<00@$b /o bP c0?o0cPT00L$H\ R 0S,1#!0.!p  G R ("( R ("($ R 0 V  U `   hV$Kk \ 0S ^  0^$yFBFBFBFBFBpFB$oBFB -80L`SP@(pW {{W0sf/ S R8SuPT Hmf/0d0?o0c QCP Q 0202 0P 0R*WEV -LMP Rp`D p@Ɵ$ 4&<p`PA@Kğ` 6$:&@#K ?`p( KhP  )|([  (@P( T L040 $0C((4$KXSBY@FB@ FB 0p-LM@0P0 K`P\KVP 

h@ ;h0xp&w0K 0?00x0 ?04 ' khih @ ciAGB@c)GB - 0L@` h(PU 0S   0 Y 00,p0(`$ @8< 0!0 0'>00,p(`$ @8( 0!`0,p(`0T0$ 0'> @00 8(KA|6Bc6`Bd66IHB 0-LIM@!8 K0妥MKL1壥P-@ 808PPR R#@ `Kp*% v@cc0e c6eAHB -@LPX`^P0!QQ0`,@^@ T9^|@0ecHB -XL0S4`@00P0d0?o0cs!C13/ cc -@LpTP` XPb`a圀PVpʀ 0! `! 0    ! 0!!`a0    ! cd dd 0 c -0@L0pͻ|0|PS@<`EQ Y` џ`VT@ FzP,Ko cc -`D0L@`P@囻U0Kh/ c 0-P00L@00C0剻U00K0h/c -`@L0SP㍟PUT@ -PpT`T0LM@K 0$$P P ]40QFɧL]K0eL5c 0-H@PL 0U00  O00$c\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd 0-P8ML00@00@0@ @@@0  NpP`Vʫ@xp V 0000$KkD0K@D0K1 )!@$cHBCc4c4e -\PL@pW0S8 aq @`X4c4eHB 0-P@L0 K0h$c 0-@ PLD@ qT0$c@ 0-L@@PP0UK0h00@000S:p/$c00S:q/$c00 R !$c0 g$c0 b$c0 $c"1/"1/@-20pa @A t a00~Ѐ0-@00\!R S0$c,0 0R/Q0 /$c -0L o$c-00 0R 0 $c <0Q/1S co `/ $c -@0^1 0 co ` $c-$00\! !0$c-$00\! !0$c-$00\! !0$c -@pP(0L`V@P$c 2ᦹ 2Ἱ -`p@(PL0S𨝘Q ୹@$c -`p@(PL0S𨝘Q @$c -`p@,PL0S𨝘Q @$c -ps`PL$M0 @T(K?@ 0?T0; T T 4 UP1@   |T`2:0 0H39Dc -LM 0@ ^t0  5RX 1  K<4  ,0KP`c@cd 0-LP@P  0- l0B ^\0 15Q@ 12 . 0 . `c@cd -<`Y R 0uY$Kk/ite -LMp`P]Px@ 1l 00`000L3/D1` 00 003$Kte cJBH97AaJB 0-TL@PXH0 0Q@  C B ?"@UY0xe 0-@HPLX0S00  R  K0hY0xe 0-P$@LX,P0P4PX0xe -X@L`X0PUP 000041x0,0 0R8PPXxea0 -LM$0,P 00 M) Kxe -APL` 8@|X 0QGPXxe -LM q`PdX 0R) p@T2 00S 0E0C@S@1T) T@# K00S0 S00X K @8XT X 0sX#@ Kf@P hXxee -@LPT 4`40H0X0P@0PSXxeD@ 0-@0LR/ 1R >0R >C 0CR  0,K0h(0R :>0R 0`PW0P$PBU 0PXP00$ 0040 K0h'|fxe~fe -LM@1p8 R` Px1 R0S 5S -@0@80(K茀K` N ,0K d #\0 0` 0 0 00 00@V@W 00@ WW0` P@圐U`1WV@?PEUP!U @ l0@S 0 əT0p`FP@xea0\d Q0-0L 0x@PAtP Q UӡUӡ  P 080H00xea0 -@8ML WG< f0L ,00@`\!p0 000($@ @p @`Pừ50 ,00!P00(0$@ @p @`0 ᨫ$KxeJB606JBJB 0-`0LPU0P@00S0V$F40S L厘 K0h Wcxee 0-@LP0SV 80S 0P080 Q P Q   Q  0S0@K0hV  R  ^ Pcxea0 -L50e 0 @e0le0ze0ze0  0z ce 0 ze0 0z ce0 ze 0-$@L ;VK0heJB -L@P5V`0S 0 S 0h0jV5/T$V0L0q 0-$1L@S0 1S 0 0$10u>$ $1  S// 1S/0u> -LMP`AV pQ03/h(KQ 0<0 000 08KD` 80 D0K40 @@ V8K26p& 1Q  $013/ @ Q$1$ cl6-$1R00$1H 1S C0H01S/ < 0-L, @$0Q  K0h cu>$13/ w -P@L M呃0 S6` 1p`00 ܠX0ʀ !` , !! 40   ! !40`1000  !01000(Ko譃c c ddd -LMp` $PN@@S뀀N@@PSU  Kp $0K( #R (P ,>0@$K PP&%c cc6 -`@ML@ S 00   0#Kc$6JB 0-@ 0LP0 0c 0 !c 0-@L⏜0 0 c҂c*c 1/ -L`P@ R 4/Kh c 0-LMP,0K( ] @ K0c 6T0 0E! c -LM  T$0K*> P K c -LM`p0p+T@@\ @ Q z@p0h s KX@ @PT RT00S P  ZP0h  SAJBKB -LM  T$0K*¸P KdT0 0d 0-L@M0K #0,(@@8P$  A JK06KB -P@$`LT0!5/@KKB -LM\ h PP! Sh 54585: @R  h  K脳@lKBKBKB -LPMB0R01  CK0`p@1 1!T 10000P(K101 !0R hCK<T0l 0 0 p000 0 0 <0 0 D00 H0 0 L00 80 0 00 0 40 0 0 0 0 0 0 0 0x 0 00 0cK0 0cK|0  ^5 !h ?'K<1` X l0 @1d0 81\0 %K A$K> $K1 1 1\ 0 CKP1@1 0S1 #KK1#KKgKfKfKeKeKdKdKS(@1 Pee -LMP@p`  LP\ )#KK΄ 0 ! #KQP K(KX  R 8! 8! !.`p` -L M4 !P0 刁 0 @iT@h!+RU@ QP T )T   !  KP  J΅ 0 QP 3KT@T>C`p`C &K0O4(K8A8\Q@^ 0 KQ<<@ ce@ -@`tpLJ 0S l4/ 60S P4/.0SD44/X (4/U6 ͅ ^8 0~4/ G  4/ Ѐ#K G  0KR 04/00 1 111 1 0100SW0 pRH`QU1P0@01Yx0Shh喾PP0P00@000S0H뮦@$K萃ccL5eec cche@P0   H @_   H @@HDH 0H  \g  \  b  @\  X, H H      0H0 @H  @@  @P @\4H Pl0 `0px ᬷL @p,`|H @, H   p00H  H   P@0o@p @P#   H @    H @@ P 0P@00B0B0S00S000IB-0K 0CL@L0  0㰹h00  C 0㨹@Ph h0U TC0@@C-0Kh0 T0SZ d0P Z0#03R0S 00PEUP T d0P Z0#03R0SpP T T0SZ P0d ?o2Z ! 3R 0  dQ0SP T0P T T0S Z d0P Z0#03R0SpPEP T0T0S Z d0P Z0#03R0SP@D~P T0T0SZ d0P Z0#03R0S00kP TmP T hzp0SP0 003/\(KmOB @@c --LM0@ @@ 000S@ @ Ke --LML0141l  2 0S 000  0 K c --LML0141l  2 0S 000  0 K c --LM00 0 0 K p-L MP@`]0` Kph\ --L M  K --LM  K --LM  K --LM  K  -L00S Khwe --L M00 6 KA p-@PLM` K`"007TU 0P0F%07Kp -LPpᓄ\1 0S PA1S Z 8_PT !T,21,240040@0S10 0SA000 R 0 0Q000S`0 Pu`r0S X0X 0Q012Hcj@sc ceece|ea0OBe,AAtOB --LM -- LM0 0 j K -LlMpP <1l!lKm@KP >(K 00 W00S/ Q0S+ j)@T`@ T @@|KLt0Z#Z  0 d0 ͘Q 00lK 0@'K@ l @T00 W D0   C0 `AcOB 0-LD D@18 00" ~K0he @ t 0-@LK0h --@LM0@ @@ 000S@ @ Ke0Q  OBOB p-`LM@P 0P 000S   Kpe -0-LM@P@P0 0 00K0 0S q=P P@ 0-`LMp@  P80 NK 0--LM00 00 K p-L Md0@0P` 9T 0@ 00` kKph0KpX9?<@>01 0101016 -4QL`<@p1S𨝈!0A! 880R𨝘P? $1 q0$1,20,2 0d!Kh> -LMpRP 4a@>p0  <0Q!PE!( R>$KQP> &KRP >2[ p&KrKTP 0-d@P0ML@PD00P00 P 0Pm> 0 00 K0cOB,&B 0-L@ 000 0-@L K0h - 1LP`V00S @P@0@100 ,  ->`D00D0P0DP01d>V0 t0l g> FP` ( `p`@@I>00ecc ccc PBL5\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -TAL0S` =81PpU @`V 0S7$Kk= P  0R00 `000PPP P y 0R0D0 P000```Q   b00C0c cc// -X`P𝤀0 !`!800 (  , ! cd dd 0!< 0`4 0 (   !/ cd dd -L@P`P@0S@ 0-@LP000/ -LP`@ <iP 0-@L^<~K0hz00/ -@LPpm`p00(0@p!0 pKhz c -LP@`SpV0S00 R  T`0SKh0 -@LPp1`400@00 0!0 3Kh= c 0-P@`pLM00(@ $P Q 0K ( K 0[S0Kg< <(KGcO7*/ 0 1\S/ / 0-L @<<000 -LqPB -@RLpp1< 0SPP!R PP Q `a  0 00 0qO<PQ7 -P`L<0S@ Kh=<0V* @T 0A 0-@L@ ;0 -PL`;@T00;P0S   0S <Kh\ dP -`PL@;P 0S @@;P/0S / -L M`P00 ;@pT 0 S00A0(Ko;;;@Y:;0140 @p;@T R 00A0;; 4(Ko R !00q0 R    ;;T(K;PB -@T0L"T0!`|0T t0p0A`c PP0pP,0Ax#cCc@BCc -L$M,@K<K#KKP`p$04 bK0CS$0 P=9K =$0 KШ -LM !K͙ K K -L$M,@K<KӕK"K R0`p$4bKAQ$  R0"K00$0 KШʚ; -L$M,@K<K}K"K R0`p$4bKAQ$  R0"K00$0 KШʚ;0@-\0 R@T0000R0S $00R000<0?BCc0@-d0 R@T0000R0S (00 R00<0ɚ;Cc 0-LP@P@!0 p-@PLM4`K 0 0 0St   #KP0, 0CS0P,   7 Kpɚ;6eʚ; -LMqP4 aB:T x114AT H:@ KE@ 940K00 [ 5:3:1 0000@P#K /,0B! 0㬀#K"K1B4a 9T *P :p@4KZ :#KH( !0P P @Y3c cʚ; p-@PLM4`K 0 0| 0Sl   #KP0, 0CS0P$    Kpɚ;6eʚ; -LM`@VPX 4`KLpP#X P 0K0CS,0 PT K , 4@KpP  00S`P @ !0Es 0 W0  ῵P @ A@ TP}Hu0PL0 0P0 P L00H H0 1L P00H 0FR0 80080 1"T0 吁T0 000T0 H0 J !L0P P   H0@ CP L •P L  !L 底L   <K aT0@ H`P PEPQ000 -PLeP!ec -P1(a@6c0L-V0SP4 51$KkSpW P0g0QPQa0P : -@ `L5X0S5|5 tQl\0SRP5LIX0S 5 z5 p 5r5W$X0S.5 X^ AR   \  R\  \0 X00X0  0  \00S\0  0\p 0X00X0~5(P(00(P!ecH"eCc 0 fP!e (0(R8 4@2@1@S@/0S   0 / 0-@ 0P04 4# " Lϴ0! R! Q 000 1010 -Lp4l1,@T`AB5 ,Ko ``5P Pp 5UXUPUWqTP 0  ARB5P ( p젔WPP4 10C100C00S   0 QP U40W X"ecP!e - `LPpw4뤀夐X0SG \@0S   0 X00CX044P W44 0  }M40dTPB 0-@1L0 0h 1 Rh  h 00 -LPp`@P `P 0p00 0p400h00h0@h@0S0`h``@! !A4 0-@L43 1(S$!$!$1 ! 04K0hX"e/ -LDM@H0 0RD0 `0D0 PWP RpP 0``:@0 00T0 2X0 6 @ 0@ R Q001P0 0L0 3@0P S L0 S@T 0S*@@T 80K 0 0D 00000H0#P L0 S 3@0 Se:@0 80K 0 0D 00000H0 P`80 R       C 0 00C0000 R phpp0p0Sv 0CSr000`00000`C`000@ R h0' s3W 000S0 0C0D 0S7H0 03P@4` T L0`X 4 400K# 04 K04/P 04 000PH T04 0`3/T0S 2c|23 2 ` +33 4/ (K00 30d -LM@(1S:0 1<à 1TP K000 @00 -LM  T$0KA*(P Kc -LM  T0K*P K 0-pPL M `00 y2x2 04 4# ' C0ATv 10C100C00S   0 0p0W 0S;0 0000S 0 ,0Kp# 000pW 0S"0 000000S 0 ,0Kp# 000pT0S3 0S00Y,00,K@(S 0  000p S 0  1 0C1P?2T0 `3/0Q@(K0W @7&20S   0 -(0^ : 0!3201 BT0 0(cT 0  -LM K -L4M⬓@0`X@ 40 P)s B1 1 14000 #0#K8#L.#\x00s#K ?X NŸ#0400T01 @P[   b10 L00X0\0C?00 qy0EU0 3`P@e Vp `!0K$ P0 0T00Qp`0qq(a ᡨ 2 ,12017S3410p6U EB&VoU, 0d0h l RR0 エ 40 SI 04 @]PB @@(KQL 0C(p ypE@PP00!: 0 0< @WF0 Q << QPr`F PpPЂ00 0L0(0@, ,@80R !$$11cP!e(e\PBx7T|7aPBX"e$c -@`z0 ML00P 00 0`0@pN0 00  0x0`@0p0d\0 (X00L0 `0@000GK {7P!ex7hPB1|1pPBczPB -L M 0  K -L Mƌ 0  K Q-L Q Q1CjPB 0-0ML000@ 0|A00c00,PP  XXQ @孜<0 0 !K0h+ꐯ@P!eo7PB<@PBn7Cc(0(0 C#' 00/Ccc00 Q,0$  B'##  / cCc -@PLMp `/A0  0 0! 0?PV 0  \ PX0  PP /" K$ 0  P 0 46B7,A 0-P@L/ P/d -L M0p1 @/4K4 0 `PU 00!/03/PZl/! c -@L`Z/0 P1R p0S0a 0 !WV /SP0 c 0-@L:K0hQ0 c p-0L MQP0 & 0@S / 0K # `00[ 0S G/.u Kpl c܄7 -L Pp0 `0@ `F`@ P t0P0 0 PP PU@PCc c 0-LP@.000PPK0h. -L.|Pt@0S a00.6/.""QPc ccc -P@LP0XT3/@z.&`pWVfD Kh.c@c -@LMp`P^."SR"KU`p 0(P 4 "K 0"0x 0BP.$K<  0,"K 0"0x0c cc 0@-LS7 777  K PB -LMe -pLM`KP` @尤0K\0 0`@0 0 0 0000 0^z?oP20S RR %!*(Kxc -pLM`KP` @~0K\0 0`@0 0 0 0000 0,z?oP20S RR (Kxc P0-L CyP0P,0@T `0S L0S ,T Ly0@<@0S ki0P@cc>e?e p-L|MP`U@ 0S x Kʣ00 0,@P l0 e, Ke,Kpc -LM4p40180 80 R@ 1S< 0S9 L@`T0' ?, ,0K$P`#00 UV000S  Y H0 S00i,@㌑I4PU=T0S00 Z H0 S,0Y O, (K0Y!LP0D PP0(0P0L@ 00L P0PL000 a 0@D 0C 0TP 00CS0T Z`LPWL P0RP000 L P0 @ HKA$P@QT`V K  x?e?e -LDM@4!0L RK@ TK @P$0S 00 0-L@M41@L0PSK0@ TK?P 0$S $0S0 $ 00@ TK0 @ -LlMs140\0 X0 T0 P0 LP t+l0K\ Kw +00 i+$@TX @L P0RP0(0P0L Ɖ 00C 0+0`i 0S014P0x   t t KL  p < DH 4 G 0 0<00@ H80 @(+00TY```F`o^+$V phFP H+? 8  0L K :/ ~ <0 BS @  8   + xK0Px0   c0 0  x0 0 0 M0   b0 0   cx?e?e>eQB -L,M@0BP *LD`0$`(0xPX#p K1 i?0>0h0 ``0(0K00`00pP d: t*L0S */((`LP,`Pc*0U 0((0?0t0X(0* **4QB@PL0?SXP0SU d0SP `0SMX X@T T> T@(KL@TZ *$0S2P*W6 0<0 $080 0@ lKL`40 x?@P =P@ lK⠡0HTp)/0P 0R:Q%*H RL0*@L0SP L@(0WP0(0P 0LP(P0 0000A)W>exc cx?e b ^ -LMPU"0U2 00S#p(K4L0S L`0Y@0 Y ptP  Ԡ 0 P) =pP0?S0SQ 0 =pP Z)00CS0@)T >0 00 4  80 <0 804 pPR2)ZpY0SWp _pWppxc>e?e -L $  0  0 0,p(`P|}P 0!0 $0'> 0 0 0,p(` Pe}P (KHuP (Ko>ecDQBRQBh7 _QBxcȏ7iQBxQB7P@ RR  :/ -LLMt 4!LPU# SB 0p0 ?cpz'_ ?`1R@00/S@Tp0 S00Y0S#`'#`p/0:@F(pt0W  +`P |((K0@!R 0S H0R $0Sh(@ lK<`P<0S (pHR L0@BCc -LMPU%ژ00U!Pq `W<@P0 S40Kj@ 4KF<@P $K#@xc p-L MP`P @ 0 K@U 00Kp -LP@`ppP P" '00000';l0141@00ST*L00T *UP  P0@ P cCc -LM  K -LM 0 K -LM`)P @ ( R @$K!pR @ 0 Z!4A, Z Z1! BR-@ 0 PP!R R R   @ `  @'`  ` }'0 P@@P @0@ c -LM`P0Fp S,`7`7`77T7X P(KP "P P10 KX;PP KqVPP Kc<P@P V@ 0 P 0s0 FxWKm W(  );PP Y  ^I  >   P 5/PP  >   !<P 00V񟗦77777(7L7t7t7t7t7t7X77̩704@S\*@20\: Pp0 K yP001 0 0100  [P#000 S ȄPP߄ 00C p1,`K 00& 0 03/PP0  "  0, K0" 0 03/pP 0 03/Pi 0@ @0, K0" 0 03/pP 0  000 0 3/ x00 0 0G 0 K\ 03/0P0, K<0" 0 03/P4P2Cc~f}f3{f@|f 0-@LP p0 0 0-L@P0P @ 003/@W0 -LM@KP K7;K -PL@`eP @ (00CS7Ĭ7Ĭ7ܬ7-@.0S<@0 @ 0@ -L M?@P @ (0S -@K0 `1K0#K"K0S S S 2K݃ 000 040Kp rK 0 040K @0@ -LM@0 ` T0i P 0R0b 0 #KP @ (0S 0CS@3-@# 10FS 0t00S @(KV77787`707@@4 %4,`L%@CK@T P@ 0噼@p0|`| @` PpVCK@P 000V 00S@ $0@0 0@ -LM0@0! wK -L M@ KjP0000K 0-LM@P KjP K":PK0 -L0MpD D K<  P8 0U`141@P ,P D0( @$0 ! 0 @< K04/@P,  R tT00#T0S@D0PE0S @0 f 0PK c\d p-LM@P` P 0 0` Kp -L|MR @8 PP 0 @.Y (0St0S 00 @P0qlX X@0` 0 p8@P0 V  (Kl0K`0 \0 刀 x | 4Dt X141 0 R8|0 0 0 @ K04/@P|0 R tT  #T R@ X0B 0  R @  ,f^|| PQ 0fP H U@@ c\d -0ML0 0O K -L0MPH0 L0KD0 0a@0 00 1U41pD0L 4P ,0 @2 0 @D K04/@P 40S tT00#T0S@  T  0lpb#1 4\#40PED00S @0 e 0P$K cc\d p-LM@P`P 0 0` Kp -L|MR @8 PP 0 @.Y (0St0S 00 @P0qlX X@0` 0 Q7@P0 V p(Kl0K 0` x 0 !刀  4!D t | X>h10SF 0  @ K0|4/@P |0Z tT00#T0S@ T  0 P"0 14\"|0 X0J0 R @ d0|| PQ 0dP  '@@ c\dc -0ML0 0? K -LM41P0 P `- @@ @fT l0 $ P 0 0@@00 0$00B$@p `V i~7V LK$03/< PNUPgbPNP cucvcQBc -P@`Lp P00P0000 0n?@r?vO`  -P@LpA` ,XH00`P , $0R`0T c 0-P<0L@T ,wP0A@c Q-L k00P P0-L l@P pP@@PU Hk@0<@0S v. g0@Wꬴ@@cx@ecc -LDM@P T `I2@0@ @@@0  R2 @;0@"R,`K@&@!2p0 < 000,(p$@ @@ @s 0!H20,0<(p0$@ @@ @p0 s0P`(K 0!1q 0'> p00,($@@ @s0 0 0!1 0'>0,0($@@ @s0 0 0!@1 0'>0,0($@@ @s 0 0 0!0 0'>0,0($@@ @ss 0!0p 0'>0,0($@ p@ @_spk`P  TT4 `QBCc@cc x@eQBQBQBcQBQB RBRB@7}B Q 0 c -@PLBoPPVP 0KTI]zKh R00  -`0PL1p4aH00CS@ @0$N@T P| c -L M@` 0p 7PP  Kh@P` PP0 `P M `J0P1S!!1! PU 02 0B@0  T  'c -L@P`P (0S \ U 0 @@ -LMp`P4 K@P K 0K2@P00S,00C>S@04PS@ 0S@ 0KxD410 0-LM@( KP (P $K- $K2K0 -LM@ ,K1`P0 K,p`P00PS  ,K  000 0Q  ,K2`K -L$M41@ 80 p0` 6PP 4K0KMPP80P@k3 P{@P4 080 (  ,< b R 4!W8 @  RR R0R Pz@ Hd@a0j/ 0R0 T 0W`0% $℔1 0 0@0!1 0001@@0 @0pP< @  P ,@1 0$0?(0L00 0000P0 0004 8pv04  T' (K  Pb< R@P[vo~wrτn0pSk/1@!@<`@PCV,ꀅc@&RB/RBo @cc p-LMP@ ` P  ,K0P,KAKp -LM4 Kp@R`PO4n4w4P(0 Sr,0SH 4@T! 0b0?o0c 0A P00 R4 01S1 B"!,00C,04 T4 4A V 0  k100P0S`   `1`^(K !T 00K `P `@0@ 040 2 0 0P"  #P<#(` -LM0K000@jP00K 0-L M@PP  $K/P$K(0K RP(00K0 -LM3P `R`0U S: Y @ /`P (K2 gP K {`Pr]vU(`? p(0U, $0RJXj  0hh! @ 1@1ᨁ, 娀RfPU 02`x RP x K0 冒| 0  | 0,00,0 A0I V VU (A  KvTG 0S 0K P `P00  P 0 #P<# 0S0000@@ P0P(`(`\ 0  @@ꀅccc -0ML0( K -LM@P  $K /P$KK 0-PL@0S0 -p0La4A$1X03/X0hPPUHph00 Kh {P!KhT ccX@e -L(M`Pp4AC}P ` 1 ` 000h00(0K000000@0 `P 5}$K(0P10 C(( $0pt0S d0S0(000C0 0(0H( e0H@7 -LMp4Q`㫿$1@T k.PP#0P (7PP 00 , 0>0 K 0 40K( PP 4Kb/P K~ -LvP10/20/ -4QLp  `P @W0S $0   @ @P$  P P $0$@@G( R H @@ 0-P4AL  PP 0T 0 0-@4QL s @P @0$0$$ ( R @ @X @ p-L M@P4a H0 K@ TQ  K.@Kp -LxM@p?T`@#4Qx Kₐ00 x0@ t0 0``p $0  $^ P@ T K'P@ JHKc -@4aLP P1S@T (0S HQU000H15H1(0S   P1S 8ATP$& P -0P1L4A0!!`ppQ  PP  41SP1S  T0R $02$0 W c@ec -PL,M`RpH PP U0<0K0 @0KH@P (K@` 0젟刁4!p''D@@ e$ 4L0  $$  %@  L0x d0p0W@3Wp@ #PU  Lᛏ<@@U < KH c@e;RBc p-LM@P  ,K,`P,PK KpP P0 `Q 0 -9`P 4 -LMp@W;0 P0E Sp#*QU4`Kᆽ` G,pP 0KV {(K @1@$$D@  0 @ 00 0 S 000S   0P 0 0t Q  4!RP!R 0$ "$ %V@ec -p@WPqL!0P 01@P ?T014a xpP  @TATQ T @ c p-LM0`P1VPa4A K`P KpTQ,K  ,KK_ w 0R #,K0 c -L M0@0KP K,K -p@WL`@" 4DP $@F0SD 000 @T z@P0S P@/ Q 0CSr// 0-PL@0S0 0-@p`@ML! $PK@%(00p,`$@ @@ @ lk(0S) 0 00!0 00000'>,p0(`0$@ @Sk 0!T0,p(`0H0$@ @00 @00 ?k$KBRBFed7GRB`7B -LM@pEi 0 `mP㬀嬐0 U:TP U 1+@Pi$K0P1S 04K+4KG^QRBcFeVRB -pLMPK8a` @׍0K\0 0 0 0P@ 0 0000 0c?oP20SP@-0SP)hPUP# ᡻p`U*0!R0W ៍D 5ኻP$. ჻Ph(KFec40 P0@1S //Fe -@Lt01@TP 0S $ R$PDp0| 000l0`0V@04 a00C0 1 R0(ac cFec@c 0-@0@@L P 3  K0hCcFe7}B -0ML00` PP@.@ 0R pZ0 S   @ ^ \P0p80KP  *@P cKFec -0 ML000@ PKhKK -LM0@0000 0 PPa0 $R8P 8 80S<P(K0ST `P0t00 " t!@S T $ 0 P` PapW@@耟T$Q  0K5*P R P 80彸P TP(q 08 S ,2|CO(Ac cc@c@ -LM0 P00`p0(P@"z0S U@P080  !1E !000 Q4! Q @.@`(KuP11Ps@ x@sx@P @t aADP}@ 7w`@@` p@80S (0QE0!000Y P! R ; P0 B8aV MX Q  0Kz)@cFe cc21P 01/ R // -`D0LAh1P\ATKhp%r`@ c 00-L8M000T ,00 H (0@  0 P'.$0 A0 0 phK0c\RB -LDM`0Td SH T A,0S W0h@0 d0S0H0l1pal10\0 \ H00`0 0X0 P0\Q`QX1 0h0 d0S pH0`T0S{ 0PB<KpPS\ `ˊs``H0LP P0 %P0 D P0 D0PcP_oPeu T  0R;X 20S0 21h1PH0` T P0 RT"pR 0L  00SM PEX1S 0`!00 00S  uP #UP(K UD  D l0 Pe 1l0d1  2/PL l0 L pFP0P 8!F!dV 003/tY FP`f 0S <K0PX0 p`@ 0h S @AX1S@ S 0X10Pl00X @g0 QXQPP | Pw cT@c`@ccRB -LM@Q p0(K31 "! ,R 41@0( 0 QTP>PB`RbU2`Fa0 @DVaYXW0AR KY  &0P?X` &0P6W` &0P-1  0 00000  P R0  '0  S R  '0  S R 0 c '0 KZ|  0 嫷0vYXW`FLD K _&0PfKP 0_ K R&0PYKP K F&0PMKP  K :&0PATKPb K ,&0P3TKPV K &0P%TKPJP@ G  V [` c p-L4M@P`  <K%PSp`H0  ,0K #V4A@0  UHEVS MD0S DKjD(K0S0S`0  T3 0S88(8(8l 3 0S 2 l0@P\0U4 UD UF 101 101 101 10 10R 101 ,DP $04$0 101 101 101 101 0c -L M`4Q@P 0R< KS,0Kp W Q  ,K"p <K!pP K -P@4aL h r@ DH  L!0 0 Kh -@LM$K $K"K -4a@L P@ 0΄t1vx0 !! !! ! 101CP "$04$0^ KhZ c 0-@4QL  t1S zCP $04$0C K0h? t΄vO Q0-L @0 UP 0^SB 0-LMP@PQ$KK0 $K1!P -`4qL@ P V 0! ! ! U` 0` 1 ` 0 S `3:0 ! !01  0-LMP@P Q,KR KP Q K" ,K P K0 -LMp `WP4 F K03/@PK@PKpP-K0p0SppK*g^ 9/@Px2x!K夐K x!|! |!! ! 101` 㜃 = 0 NAP v Qs0 0lK⇃ 0  APW ` #@[ꔑ41b1S41g/!04a1 1S PW Y011S!!1! < W4 yWY1Kf,K KP`p0 kK0CS0 P  K +K KP`p0 mK0CS0 Pp  K -KR0 K 03/Y @ (K` K03/P@ cʚ; -0LM( KԔ 8  0-PL@ 0S0 p-@`L MP K a@P 00  GKp Q0-LP@ Q Q00P00P h0T @DTt0 R0 -LMPrx0 0 0Sk0@ShP AE HPP 0(K 9 y `0 t 0@114Q + @T0 00S P10 S;xy php00W0S j0 00 O Z000x` h0Wt` S` t`W`F0`p 0P 00 I00t0hpV 003/<8A0c c -L M@ K 2P0KrK -LMp@P` 0004! v`P 41 $K tPh41 0ISPEXWP -L M@0K KP  K PQ  K K -LM0 ,K (0 PP'Ay ,僮Pg $0S(40%pT` 0S" Af i`P Pd ,P (K(P $K O `0 P4a C 000 PP@ w Y P1 S(0S 8AT e XPP (K,P ڭ,00fp(K,ͭ0,0 ccc -LMp P K `@PK`P@ @@04! P 41@ &  妭K7 Q ҭ.41    宭@꼭 -`LP@v0S@ @S0C@|``0 V|0s0C0@?Vt0`S ʄ0h@0T0 |0V|`ŀ`@@ -LS 0-@p` L!DML!@1,PK 000p,`($@ @@ @@%)^ 0!00p,`0<(0$@0 @@ @ ^00S! 0!0 00,p(`$@ @@ @d^? 0!\0,p(`0$@ @@ @0  ] $$(K tRBFezRBRBRB\8"B -L M0004A4/K -LM(0100000A4/K c 0-@PL 0S0K0hJE 0-P@LP AP0@ 0-P@L @90 00,03/P 0 0-<2LPQ@x )>C 0CQs 0CQZ 0Q0 !40iS 01 0(011K0h/1Q\ 0QT 2=C 0CQ0051Q( 0CQ 0Q0!S0 0 0!!01Q 1[?CQ2 1CQ TK0h;g0S1::1P0Z0S: R*0RS0C BS00 TK0h 1#30<RPwt@c cs@~fvt -dLPP@`20  B?" 1R@0@P1B @@V^Fe 0-@PPL@$1S0$1  R  K0hF0Fe 0-@PPL@1S01  R  K0h.0FeQ0 !88S0 00C0C0CQ0C 0C3+C? R0/ -pLM`KP` @f0K\0 0`@0 0 0 0000 0U?oP20S(KcQ0= S// --LM0 0 00 K-A\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -L1LP@ `p0`00T1x_PTPRP U T1 c```f x `F Ɵ0000``U@ `p0`00T11 !c0 ? R18(8 (8(8((8@(8 (8L(8 U PT `p0`0x P  U  c?0SxPS0C°0L!B00000FeFA@ 0-0L@ T15T1T!"20# P00 0@P U 0@SK0hNU^IU@? 0-P@L@T08; 85 0-L@;P 0S S 0@0\H0P4p0(0@0I_00萶@Fe@  - LV~谶@ -|1LS 3/ 0-@,PLH0<0K0hFe 0- 1L@Rʘ$Ib0 p-L M@^P c @` KPP` KPP0 :0c?N Kp E K = K -L MP1T@0S 5T1coR \ KB/E BRC00C08!P ? RnR K@  \ 5p*T1 >0(K0PPT15T10:0PpPGUPPUJM(( Kg [ 0 :0\:@RB0s/S/ -pQL@ _d`[dA!P"R ?0~0B!?0 S?0~0B?0S0? ~0B0Q?01 -PLM Kw Ks Ko>`V {KKK` KxKp@@\Kx@KKK@pKx@HxKP\KN@KLFe -@`pLX0n@P@00 ]I|P$+ 00S Fec -LM00@Tp @T @TPS& 0 S* Q` 0S`  ,_P``  0S @|PUY H03zd2 `kec [ 0" K KLT ] `x0" 0?0K KL xTPUZ0 KK`P& 2N- R +K1 K00 N=0S0 *K1 K00  t0 R^ 0CS[D00846#5d0*cl &c0T0 cH!d0Kj K,L(Ka# ^ Q|Qz Px [  Y(0S S! 0d K L0 DK L80P K0`78Q|0d dL0K,0S 0RBdSB%SBaB?BH';SBRBRB3SBFAOBM0A -jLP@`0P1B @ U qnc@VFe 0-gOQLP <0 8rLP00S0\ 9Fe[SB -`L@PV 0P @R00PU(` 0 P1B 0 0000PP0C00 PFe -a L0R@PLpŘ PU 0 PP0SCc -P`(@L=PyFe 0-LP@P0 0cO00-A -LMA̡@ @TT0Q(K p1PcP_o Pu0a0?o0cP$ !P E12 1"!10CS1!1R!101! U؏ #W( :W* pW 0Ta0`0  0 KpKX  g<X  Y P <ccFe 0- L#P -`L|M@p1XS 0 0P!B @  (K0< #" (6204"Ql0 R T! e9P2 0Sl00`0`H20 J ;0A2|Z 0 S2V dQp1dp# KP`pK$VML1c( ?0!I0V"0PQ대0H0 T1p`F0 SB0 S58d0  x 0 W0C0p`F00  0 0P00T10 Sy0VQr T1 0>0<A DFe ccCc@ 0-H@PL00,0   PP000K0hFec 0-@DPL000C0 0R 00 K0hFec 0-L@Pxm n0 (4 @`l x2 0. 0I.01111111111110*8cdSBkSBsSBzSBSBSB 0-Q@L1/01111111111111S !1R 101! VPSSmma T@RxP(v4t`rlpnl IK0h艦cFec -bLML  (A s 0@Pp;!\2,K@(,0 00p(P$@ @@ @PyU0 0 0,!1 004p0P(P$@@ @dU;0,00 0 0!10 004p(P$@@ @NU000;0,0 0 0 0!P1 004p(P$@@ @8U;0 ,00! 1(` `0 04p0(P$@@ @#U 0`!0 0<0K0p,`(P$@ @@ @P0K0@ U0 00!p00h0,p0'>(`0$@ @80K< K0KT(KFe68$8"BSBSBSBSBSBBc($8SB B 1,/011 S!10 !u0AcFe 0-@PLX 0U00 00P1B  >0:PFe 0-@L$ 0  (K0h3 0-L@P TQ @Q  c? > 0>;000<0lQ x $IK0h 0-@Lpl0 R  g/0@000P000U 03 0Fecc -PL`p 0R@ @P1B  |AT 4/0 #P@P Fe 0-D0LP#PP@ Rl 0CcFe 0-L@ $A[~0Fe -L MTa@ P<00 & " 0 "\00\0! 0!Hq4 00$0S P % (K" 0 "$00$0 R P @   Z <0SP  P14 0 TS 0000?Y$0!T1  T0SH1  eP xP000MP1 1S 3/P0000  〠  90 7 f1 C/oS" R   ^-*090 g1 C/oS" R T15  0T s .T15T1(Ko3 `1 S  S Ra1 S  S R V\ }`1 PC_oSRPU  Wb1 S  S R V@ a  - e1 S  S R 0<0Ỏd!0B?o2 RPPU  d!e1Rd1 C/oS" R T15T10<0 Z   < S[1 S  S R 0S 0  Z@ ]1 C/oS" R# c 0 R P    Q 000S0>;) K \1 C/oS" RP ^1 CoSQ1 ` P P p p0 P P "l@wp0 P P V  @ X j1 C/oS" R !T 00 S   1Rpl^h  aPb<S? sY Zc X1 S Y1 S Z1 S+ ) Z' 0 0@^$0  :0/ OX1 PC_oSRPU. , P PEUP#U& PE0 S > Fe@ -PAL`KP @ Fe -L$MT10K2T10@9000 000K& P090K 0-T1L@ T1T 00h1S0i1S0 -`LPA@ @p 1R@ 0P1B @ T Q W@ IPFe -TL@P`8kU"R0Fe -LDM0@ST d `(K0 `#K4t4 1` 4@T1P0  ^2 Q-l * S' L413Pl02 0Sb`T] 5U3f`LV P0<X0 yiQ0\0 Uh!01RF0P -h \l0 U PPl00A Z0S;H1  dP x P000P1) 1S& 3/P000RP5 SRZ<KV0U`0 P  Z0`,P!B )@' @V` R LKVK 2d$K R D 40@ZZ0EPSZT0S@0\0 ڈ0*X0S d0  #`%0 (`h1S#V V#V% icQQP h  R P0 $P0Sa 0`P[XX 0Q0R0Q00SM~Tq`6VCT00S? X0S U: X1S Y1S Z1SP0  U,0`# cFecCc -LMp.@QP4! ( BQ*(B BQ F"B(BQ  B%- R#-Q  B-QJ  =!4"\w p " l-Q gl BQ: Q U <-U 0-U $-U =U" 0CU 0U %40WS!VS*KS  |볼< `V  XY!üV $`  06/p,`JvOT [뒼L< `V  X8!ᢼV $`  06/+`)/+Q ++ Rrl R " R} l z`1PukD S 3 KP+`PZ (K(;U# 0U}`+U   BU :Uo *0T! p %l8Ue 0U`T(V0p TS 0H0HS`* $ePP `% 0D 0 0 P N K k`Pu e'U 7U0CU6*0CU01787U 1U 7U]_< 1wP  p y60Sl 70S `P7U`6LY0 1Ss 3/`Pn HM00H0 0C0;<PUPP3"Z`ZeV@T`&0 >00S00c0 SiT1S0 00+@Y00T1  0 1W 0CW15':P0@0P00W d0CW H1< e1Sd100C?o2 @ S> P0@ 0 0P0 4X00SS-P0@ 00P0Lc`tx8it_t f@u t tptFeut\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -P@`L`V` UBV00 0P 0-@LP DP 0SB;0000 0-@L0SP  \P 00BSs 00lRQ3\000 0S00000CS0000 -LP`bpV0SS 00sGT @@DV@ f0`Fp0C00@ 0@T00 -PL`8\ @ V@@DT @@DH0L0A0 @ l@^ 0LS0SࠡpspphR^  @R  LR  0-@PL0S0000K0h 0  S 0C 0AU0 BPE0S00 0U RR   -@L`0 PSS 0SK P0000`\ 0BSs00aR! 3 C<  !0 0000S000:TB -L M`Qp@Jڄ0 0 SA S0S4 000 0R5P 0PPC PE0UP f R  C0ࡁH P ⬑:50C0`Fp000P 0PU00Vpѫ uP 0X(KN 10c00Z 00RTB-0S000SQ0CS0 0S^ 00ASs00nRP3̌Fe-0h S0 0 ^  0CSs00nR\3, Fe 0-@L RP @Q  BA0 \P 0CSs 00lRQ3\R  0 0-@PLp040141l 20 P / c0-P4@l  P00ޘ -`h0P1L41l  20 @T 80 JPፚP c -`h0P1L41l  20 @T 80 PlP c 0-L0P41l  20 @T 0ƍ ဗPN0P 0-L (4l!  P | Q  Qh@4!200R0l@l@L0K0h@@at c -P. 0-@LH,$0S 400 S   0 w0Fe -L M`p唐@T bP$]^TPPPDK$` DK~4DK@0S$K@FeXcqTBvc0S/%Xcd8 -xPL@h`pW V0`D 0 P@&lbPpXcFe 0-LM`0!@0P,EKcHAEK_Q AK_,EK%K0 -1L@/ H1S,P1:1(1<`S 1(Q,Q:11 01l)PHaPU 0S 3/P ㈑ ㅑ0$H1SJ -PLM@sU 0SPK,GK5&PP GK QKPK)pPP S0`S 1[S HGKT_1 H1S0Sp1Ha:1CK3/PV P ) &$IP 0-L@L(P|WyW0$ W0 K0hWFe(88 0-h LP00P0X0@TL0LK0h|WP0SX@$0S 3/,PFedcCcGe 0-l LT00T0\0@TP0,J4K0hYWP0SX@ 0S 3/,PFedcCc -LM" Q"  "  R P㴒@P 0" 2 =k`P= P(Kp2@22 T 00S, (0S)PU& 1"R" 0"00R000 0ګPd2Y00X0Sz  " 00"S @000 0S00  0`0114 - Kb 2S 嬢  R " @ " " " !t " l p" h" Q cKd"K K 8b R Q0 WK .b2KS H L @ D 8 < 00 40 -KPSjZ000 U 2 I =2 0Hs } \!K"[!KP$᷸2S22|p =;cc c@-Qp@P `| @i>Q`0 @ 00-X00L@ X  $R|01X0S 3/P0ST0 R D 0 08 04 0c000S 3/,PdcFeJeJeJeJe -LLM0 0@Ppl!2 000,P(p$@ @@ @P`p> 0!`2 0040P,P(p$@ @@ @P` > 0!2 0040,P(p$@ @@ @P`k>0 000!1 004,P(p$@ @@ @P`xV> 0!pp1 00840P,P(p$@ @ @@ @> 0 !1 00840,P(p$@ @ @@+> 0!000 084,P(p$@ @ @@t>l;00S pPp`ppU:T "(KoP 0"S@ (KrAGewTB~TBTBAL8BЈBGe$P801X0S(00S/ P X0Fedc -L0P  0B?oR20S,\ 0P0-L@ P00^0 R\ T\RP\,00 0-L@P @0S K0h/0 0-L@P <0S K0h/0 -LPL -LP Kh@P0ӗ/@ Q0-@!@3PLPP@0 -L0 S ɦ Kh8` @TB 0-LP@OP  H0S K0h/K0h -p0LP @6P D0S $Kk/`PV 1 !P @TQfPF舀X B BR !DfPUP!Vee 0- L@0P0 K0h -`PL@P Kh800S% S S  KhVS S"00PES@# S S 7S S Kh20\  Kh= Kh KhWmOBTBTBTBTBTBTBTB,A -`pD0L@TP0SX@0S 3/,Pdc -`Qd0Lp@T0 R X@P0S0S  3/,Pdc808 0S0C1 S1 P #/ Ccd0@S/  -L M$0 K@:PK脂> -LMP`Kp` @_ 0K\0  BR--00 00 0@` 0 000Oo0 04PB@TQ!0S S S lP0QQT<0P 1(K80(0'$00CcXHe.@CcCc -opLMOK k^p 0_Kd$02 库` ^0P 0 00000|B lb 0 0Z4(KXHe 8 0-1L@SHPL0S0L0 L7XP U0H@0 100K0hUH  L00L0H0P D0` T^ X0\ K0h/UBXHe\ `P/0 !`8 00 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -LMP0@TP0,"a!,"p @T!,210#,2 00 0K`0SX@(0S 3/,`ODT 0K0S 3/0KR@BTdc cXeXHe 0-LDM!3@`p'00>P< ` U0`C` 00 F00000p@fꇸ@VA -0L@p  PP: (  0 0  000HL"OH0H0@夀TqU`P `  0 0 000HLOH0H0@TUP꒸@*VB 0`( "4`#/ 0QS /P cP0 (/0 R/ -` L@ZT  R@AQVT PPEUP!  U`F0@ -L M@P`@V`V 5/||p`-0K  P@-[ 5/V 0D85/ 5/5/5/(KAVB3AFAA -L$MpP@~ @R 04/0 (K40K PHL4/3[@d#dhFh!4/V V* 4/0 4/3[#!4//[4/0[4/2[d#dhFh`F!4/V 88`8h8p8@8@8@8x88|x4/0[Z/`[V \XTPLHD0K +P(D K4/L0K PL K4/<0K  P< K4/H0K PH Kphp4/0 `꠸@OVBsVBVBVBVBVBVBWB"WBVB:WBgWBGWB7WBDWBOWB\WBvWBJeWBJeWBWBWB -L MPp`@ @R 04/0 K80K P4/8[4/80[P S888888888888D4/7[<840,(ꮸ@OVBsVBWBWB(0K wPx|4/2[([lT#4X4/([%XQ@ Q QH84/04/,1U6 $1U5  U4/4/1U% WU( 60CU !U4/0 q K0U <U 0U 4/ ([4/|4/0 D4/@OVBsVB]B]B?]B5݆1]BWw]B#Z]B`]B!T]BVBg]B]Bn]B]B]B|]B -LMP`p@@X 0 4/0  $K,0K P4/PY,[h(4/\4/X+[4/+0[ SH$ S< S4 000K P#[ P"448C8S "[4"48#8PeS S4/4/2[#!4/2[#!4/+0[ S St4/eS SSX0 @]BsVB]B^B^B(^BvA-^BdB2^B7^BoB<^BU^Bq^B^B -LMPp`@G @ R 0tt4/0 {;,0K OP484/, K( 4/& K 4/2[P#!4/"[4"4 8#8S  S 4/ S S4/0 K4/0 ll4/0 ;P4/0 @OVBsVBJe^B^B^BVB݆d^B^B^B|]B -LoP \`P@Q Q Q l4/0 KhQ $Q Kh] Kh" Kh Kh^B/-/-/-//-/-/-/ 0-@L -0 -L S-P1P!L` Up@F\ U l l  UPU: -L M0p 0`PP)@ T01 0!00000P T D@@ Z 0 0 00P Z J0P@H(K-/-/-/-/-/-/-/-// -L@P` Pą p@00  MX  ;N`Wp  1NP -LMQpP` 2Q 1CQP0S P$K09Y@I   80"@KP 0  9 0SRLBT=@ hWq $2WA 1CWZTK@P P K K70(QPUP#W 4PK4US@P PU 5/PH@D@DT KPKK0p LB T (1S90001S0:0 H@P00S H@T D@DT@1PT (1T 01T kKePii -LM`@@@p PP 00 P0 @P g (K -@PLPPU`@ .M`P -Pd0d L0 0AT 0S`o0S@$00$0c@c -@PLpY L0 <0R) 4 R) *`00@00D0 0(0t`|`p00S0x0$00P0:0/`P@@p -@Lp`$4P0@bUT  Kh_ 0-@LP0 z000 0-@L@(Fpk3 0S `y0PS   0P 4z\HK0h}zcc -$0LP0CS`$0@80000?o2@T vKhK 0-@LP 0S 80 141R00 0 c 0-P80L@T 0JP0@@c 0-0SLPp` x@d^TP,P (0S @r$00$0@Pc -L M0 KK@P 00S@vT p ٠Ki@ -LM@ KKP (00 Z KK 0-LMP KK@P 00 R, R@   R t !4!Q @ Ġ0T 400S 呠K0@@ c -L M0 KK`@P(0sT@ 0(0,0S 9K Q-L`P <@寑@0PᮑD0P P0-L tX 0Pd0@0S P) 00DP<@q80 To( +0@@cJec -LDM@P Tc `^Q  @@@@Ah1  nX`P  8800Q@0 0p@!!(00K0 ,p$@ @@ @( 0!00'>P0K 00,(p$@ P@ @E(x0 00!h0,(p0$@@ @00 KE'(Kj`@cc@8}BJe@_BF_Bcj?B -@QLp`< F PP:*P00 /R0S /HPPx Hx@ pi4PP00<(0$PrŐ@ȐD@ D$3D@P?M_Bc 0-PL@8jx0 yPP ax0 -LM0` KPP   @ KTPKPP 0LPPp h P0XS    @00C@0$`V80080Vz@c@c -L Mp4a ,K3/@P(K4K⌠@P 04( (00 0d1R 0\@$K@Q@1@!0R *08 K*@P ( 4F@ ,(0Q$ 8@!Ԑ4! 0 e P N0 0! R!@Al80 000  0K03/@P 8 480( 0t@@cJeDRSP ccc -LM00 0z K8 Ԕ -L$MP0@K`4<0 @P0K8K@P @K(K080 (00 01R 0͟@,K  03/@P)q@P@KUZ>d@X1@!0R<*0< K@0 0P @+p @@KT 0 8ᑟ<P 0 4`P `$00$0V@80 P_l0@!0R:T@0\He -LLM\ 00 K` R 00 00Z(8 XP  D ! ""2D0  0 |20|20Sp0p30`0 \0`<0 @P!0DT 4< d.0P 0S (K 00 ?oX20S 9@\0Sa <4 084 0 Qh0 0 XUWS0S80SP00Q0S  E0 B<  F<P @PQ0@40 Z00KT0 00 000 Z0PH01`Q0 d:pP06d0 l0SXH0P 0HP\`:X#: 0L00P  44$040T 00 0C0000 00C00 R0000C0L0S400C40  T0`P0p(0`(`k` rTNXTP O00001D 0R! !X;h 1 0R0 D0 3/D0@S101X1;ö10P00 40XSpXpP X`k40S``@0V`400C40 80S @00 S00R0Sv r804 R00S [%0@TJ0P(@ @@0 1 R804H0 0S3#RQ- ! X  X R% S0!S`hL0 H0p!0@>0pppG 0PP0   H0`0  0@P'6l0 p P4 fX00R0S 0 80S| 00Sy0 0kbV`00400C40 WT@% @@\ 04/H'@x(@v#@t @r0p@p@n<9c>Je I0-L8M ,00@`'~!T1TQ 0L1$@ @ @000(`p$:0 ,00!1 01$@ @ @000(`p$0 ,00!0 00$@ @ @000(`p$ h@(d⇌\ℌ P <@88$Kk螈9JeW_BD9`_B9f_Bcp_Bv_B_B9"B -<0ML0000 $0BP  K_BKe@9_B P/P/ -@PL` 0 Q //P00 3/P# -@LP1 P40T aS 01?S0!t4 0003/PPatꌇc1 0 1 000/5/ 000/!  000/9/%/ -1L@P`1 0 Q / 00 8P  0 0Kh/- 0-@Lg1<1ᕌⓌ⑌K0h p-LlM@` P1@01 ( d K?, ?0 00S 0403/3KjKp 0-LM@Q1K0hf$0S P 0S 1 < "90S 1 < 9\<H1US ?UK0hK0 -PL M 0@ 廈`PX  P`P/` PPXX )`(K+`0S 0UH0Q `010@410 01f7<h@41Yx0D1 PP[~003/`P 101aӇL@X99Je -L$Map0K8K@ሁwPP!$.2 8@0 D@00  C3400 00(004K 0P 0"jPP 18 041(K400!*!0(08 14 W408 00 c`@ 0-@5L05 00$03/5PP0C8#85?o20S 0g -@L1 ,PU4PU  PU 1P 0003/ 1P0SL0L1101DPP!8004` 1 1PP  Cc Q-LP@ 0 `j@DT0 0Kh/ -@PLp` = p`Kha 0-@0LP l K0h= -0LPS`@  T 1 > <P -LM 0K#  K -`LMPk 2R 0S 0S  3/@_@ Tp 7 T T 0DS18T T T @T TY !r X f$l 4Xo  $03/!@lT*@' T  T1TC $0CTC 0CT= 0TL1T7 0T4S44040@4@$K0T0CT0CT   T  T 13040 100 4KCz0(0 X0 ?#K<00,  @*@c CcCc0 -QL5= -L$M3@XpL0P@0  U "U U U U"@K`Vw@0XS1EXPPQn@U  UU~  U<U# U U  UZ Lc X #k _X $0 3/"`kvNVAL*`> U 7:E 0CSB <K`P0#KR0M4T2ZIL2 #08"@H0 L # 0P07H0L 8(XZ0@ @0 !@0U01 U `*VV 0S 0S  3/P` *P`>(K <K;`V8PU!` 1#U< 1QR0011`@K,`V@Q`Ӿڸ0U U 0CU  \P0;07`P1;10S@0 5@000S@0 5@01`Oc?BCcCc  -@LM,K 0,K,K@,KK -@LP@`(@0 0@S0S  0T 1 & P -0LP S@"@P 0SN0` ;00 -L M@0 Tؔ$Kh? 0-@D0LP#0S S c01@0@0H00  X @,X S00H0\0긻@Ȼ@ػ@ -L@P`P `P H0101 $0\000' c -LMP,K0 j빅@p `V !aj̅V 0K$03/d `VjV0@   @0 ,K000S00 0@K`c 80080@0<@0 H \ 0@0/ 800C80@01ᒆK0h101 0-@L䂆 K0h|  P-L2:@̀P`apVʀ 0! `! 0  , !|0 ,07d0 0!!`a0    ! cd ddc Ke 0-LMPQ@K0h00S:\0<141@0)  <3P 00PH 0UDPD0<0RH0 Ke cc -RpLP 0(0h00S `V<08 SD @R 0C BS0Q `0@P P̷PP 0L00H@40B300\00T0X000 9V`0ST0S@L@T@P``_B -PRLp/ 0`}P@P1  8P( V` ( @XPUPT0SPLPT@0SP@@@@@T@~`V7_B -`RL@ 60 0S 0 S<8p\D@PPL0@\ 0RP0UP0SNT0S`L`T`PP_B -`@PpLTXU] 00 0RX 0SUJ 01QT0S0T0@U; 0#! RQ&  3SHL0SP0\00<0CR1Q 0$8 00080 080@P@0P000p@L@$Kk}_B 0-@LP L0T00 0-@QLP0T0S@0L@T@0Q 000000 K0hhQ/T RT 0 0SX -@QLPL`L0S  Q Q`0 R000S0T@@0Q 000000 Kh( -L@PTp``LWT V80 ~0@`0S0C00008 pB8pT 0S L@`L0SP0  RT0pGE-0`=%@L``B 0-@L@0S08 0-LM@P1 < < 00D0K0 -0\`LP@ U[<S!p P  P 1S010SP0 R07蔇c -4$LP 4`0?RH1S,@P (!<0R 0(1,11:11 011 `@P 1110111101 0 044T0T001014141<1<1@1@1D1D100 P 001111001.1010.000 0003/P V 101GB 0-LPL@U 0L0hPPPL0SP0T00 -L Mp0pP UY`0   M|@(K40 @P U U40 PP 0L00H@40B30\PTX0000  000P000 5 G5@`B p-PLM K`@P    6Kp 0-P@L0S0ᬾ@g 0-X(PL X @@,\  0`S : -LȾ -0LP 0-0LS00@@K0h(Ke -`LX0@0X0X(p@P @0S T C@#@X0( 0X0N -P@QL 0`S x舁 00S/I\d# 0-@PLڽ0S0K0h] -LM@0p0P 0 (K`P ( 1:1Ջ`P ( K$. ៍=DC 0D@@ @ 0( 0 0(  `@ 0BS-@LP``P  $0S0$S0ĕP0`B p-L,M 0@S`  <KPP Kp<0 <0 SP@ KDKPPP<04KV@ D 1;;14KPP< R (0 $R !8 PP  8KP< R $ PP 4K巉 -LM0K0@ P00K -PLMp K`@P  4@ᒉK 0-LMP@EKePE/KK0 p-L M@` KPP  *PlKp -LM`P8 p冉P (0S W&@(K0K4K@P L000 W q 00 ~ 1} !* 4Sy DT 0S 4 P!z1 504,c @P!4DST 04  T10 414x3 40 ( C-     !8 **!@L|L xT 4W40000哼4610 4EψWv ,s00#. 010 44-@@#@@ @]0{B c`@ -PLMp K`%@P$ : 1%@ @P% 0!00$@  0@1P pPt@ ဈK 1$ R 0@4 101 @ 0-LMP@EKAPE/KK0 -L4M`1P1R4a0pH0 0 0H0P08 K0@KL P2@08 K<K@80 @40 H0PL00P+<08000 PUY 4KP 0 <l4 @h (K0 <yz4 @st c -`PpLXXPU 0 R  R@ @D@ @Y@P i -L M0 pRXP``(K@0T     R R @ 40 `40l 4VPU@@HXU 00I` P9`B -L|M   0X  a` RM R(PX}`p REp  K4 x D | t \I!P 1V@@T \` @i2|0 0 0$ 00 K4Q05/ |0P0BPS 0+ pP  #P R7T9$lpK PP l0KW )`(K lpK || ^P TU @0R0X@ @PTP P0 R P _C`B\d -@LM`(KpOPP 0( 00009P† K 0-LM@K5PP JvPB嫆K0 p-L$MP@U  U00R0S`"8 K<K`P04KkU 4K<z<0`18   $ Q`P 4KgtKp Reb -50L MSP`@S|!0K!4q 0@PH 00,K00@PH, (K8K1:10 1:1ч@P9(0 쀟080(K4K 0 (  @P%40, ` `( (0000,10 S;305<0-@,T 4g 8c$Kw 8s,t0r c`@ p-L M` KPn@P  19@ 00003/@ t݅Kp p-L M` KPP@P  e  00403/@ ZÅKp -LM`PpP C0 0   KP KU P  0 S 0 5 @/ PT 00   K0`B 0-LM@K1d0000P0p `P 0#`P @ᛅP K -LIM @Pp  MK6`PMK0$PK1e000 0`P 0#`P @mP Մ K -LMpP`P C0 0   KP K RU P  0LR 0  PT 00   K0`B 0-L@0M8K( 0$ 00 0 8  04 <0K0 K PP <0#P<P K0 -L0MP`p8K @P&08 K43 0 (0S<0K@0K@P(0S@0 4K8@@P T 8K<B 8K@K< 8K@PC`B -LlM PPp  lKmP\\K&KK 0&Kd T00X"d0 SH"K d `xKP@x0徤Z90 @ S;# 0 t 0St 2 LK7Pt:40 P ?t <0x Sp0Kt0K0L0KP #0@?oT20StP &ZTx0@徤7 (K<0St0 HKLP LK0 LK00 P40@0S   p LK;P \K&KKP 0%KT0d 0CST0 P5k9K pp}NDp0S `V`` 0S t0S 0SLHv<KhW6%P KhZ(KecH & Xp 弱    = A 0Q 0Q  4Q 8Q (QpW 1P Q @00ı± P S! Z}qY000 000 ,X 4䐟X  4<  .<0S00  0@000000凱ᅱMG!}8pW000 6`Bc(KeCc \:`nP0PS00   4 4K0 KP`i@l@x3 0 S0#0380 00T3@@0 @0@b0p0(3@@0 @@0 b `tp26#p0P X(5"0"2i8 弒@ X  R2 0 00 @ZJ``d`VXbTH0$000<0!>@ ` @8@0 FL0,00p(00aBCcFaBdcBfaBXCelaBsaBccXKe9BaBzaBĩ9aBaBaB - L x0P_h됤9PKeaB000T@-@T P(@401SiWV R   t0PKe 0-@LP0  ;0jm -P`pL@ Ȕ@P$T UPbg00R hT`PVQ  00S0t#:0#0@ PKeTKe 9BCcaB -`L`BB,ʠ ʠ,ʠ,V P\ 0$00 0 0T00叩T00T0Khʩ9 0-@LT`lLl 0"00000 00 l00  | 0aBaBKe!Ce -L Mp`DRX)l0X S* ᘩ pSb@P9  000F(KT S 8@T^V  UPh cdTKePKe -LP`p) 0@P' 0 P p 8&@5P0 ? P9 Ѥt0Sx x x0t )  Y@P  0P |0E' t\txA'8dicx堤#!ݤP00TKePKe -pMLpp`P@P 0  0&U00000Qx0!t20t2t0S`oP U (`phKU h)`pi c -LM pPP @ @@P0 ;`P D0@0K` -`L M`p 0P@ P P帀PE0VX PP"0 ;pP 0P 0(K P ;10 ^`pTKe0/PKeD0S @ R D00D0@ 0D0 R 0S  0 0 0T R P0ST T0P 0T0L R/H0SL L0H 0L0/cXⲣ X- L㧣0@-H1H!1,, N @0PD N @PD40 N @PE84 N @PE<8 N @PF@< N @PF@DD N @PG HH N @PG$LL N @PH(PP N @PH0 cc -0L@S04`00P $@0 `@ @00K4 K(KTebBbBcbBbBbB -@PL0SPp`0S  ! PQPW\PQ 0L 0000 0C00S  ! PUec -@LPTL`z∝ 04R00 0 nP00TeUeTe -@L`T N@0 SxPza0S0  Q    8   Q 0 @劝@TeTeUe 0-P$@L;00C0K0hvUe -L Mp0@S`0L 000 QDQ SREP00!4 O,1 P R!z4 4     PR+73N`       0 0S0    00PA@(K0 S SR   Q 4 4 UecTeUe -@`pPLUddM0`PP000S0  000$ 000 00PUec -@L p`A00P1SZ R؀YXQ   000@ 0C0 00C 00 0C0 0P$Kk0bBc -@0`SLP00Q0S0S0SP/0S5:/ P/ -LGM 0p41`QP8 0241 01 1 `V\4`77H<X01 V0$1 AT 0D1 /00D@W 10P p7U l7\7(K0 4!$]F@P0$1 吓L 0E/KFK@P t M7 V `0 @E7T X7 O<P@P +7PAHB<!71S C! /  C0Q1 00CUS0@@ӶW@ 0X K&F@P 7 T <1 D20 0A/KFK0 1  E@6 T 1!0! <@PX *KPOK  U0< 1 @ 0KK 1K 1 C?K0 00 K?K .K 1 ,! 0 %,!,0KK #0 GTP0  0KK @1S 0(P&K K/K   AR@ڸ^^Q Q OOK@UT A@DX"0#* ,1 ,1A  ,1 @,1@v B0P@t0S^ @DVe#A -LM0 ,0  o K80 41P80o/Q / -L,M@ T8 < T"p,Ja@pP, KE"pE4`8 @ D :00T300@ p W0<0 E 80p:@(K -LMP40E40 0`p0E;@P 04 K0K<@GT t@(K40 C4 /  C07s4 K00p0A05 $1$!S pW   4P44 4PE 00 BVe 0-@L0C,0$ R @@0{0Vec 0-L@T/P00S@ S @R 00`00Vec 0-LP<80@T$K0hL0S 3/@Vec -PL`TpH0@T44 0S  3/PP@Vec Q- L S &S KDP-/ -@@PL0S0 0S!0S00Q!I?`  00`00Q \R HH  W@W C0\S@XcBcBcB 004,@($@@ @`|0 0@0@ @@@ PGDB 44X(KoSK7BVe,::cBccBcBؼ@9}B 0-P$@Ld00Cd0K0h1(Ve -PL@x`V`803/0@Sh h0l 0lPd0@,Ph`@c(Ve -`Lt˜dPUh0@ P Th0 Sl l l0h @03/`'@TP(Vec p0-L➘d0\P@TLK0hט<0S d00d0Ϙ<03/ቘd00Cd0h@(Vec -L`iWTV@P TV @0V001S*0 eQ<@Cc Ve -LM<0 0P8 * ACKA80 S$ ^$؁cK X0``Va0 UT T08zLo \ aT0(K ^<0((0P#KSRYXH#KR0 0 UT) |00X 0S0 UT T 0࠳^ #KR00 00 |T 0\hV#KV0#K|X0\ #KV00 UTcB p-LM$0PK@ `K0%`0 VPKp0 S 0S ([ - L[c 0-@PL,P04 80R8000804 (P[ 0-L@<  0K0hP Ve -aAUTL`pa(AUT(0V(0(P@PZ@ @Z!0,P00!R(0(0(@c -LM$0@`PV$pK0',K" K,0( (0 ,,!aWV!@PA ( ,0( ,0( (0 ,(`0 `P ,kFP999P9|9!R0 ,!(0(0 (`,!@PA -L$M`!PR@ RR' P p0` 0PR0V0&0 D0 R R R <P8  P^ 0V`p 8 P P P`0 0r  0 P@O D啖@0P R  !A 0!@0$0!`  (`,`0   R Rt RP 8K(P0#P@D奖T 8P (K@ 0@ P0P0  PU00P0(`4000D8000@4000uZ(0PS 48 Q8 0 804 0(0U7 ꔐ " ZРZ R Y VS Q(0 @ # P0!4!Uu P S 0S 70X(`PP@0p40 00K0 40K0P 00C(pS $9X99d99Ul 4 @0 ( Pf0S0S& 00 4 0R a!WV 40@0!(@PA0 8 K,0S"0S40U0 @00( ( 0 ( 040 P48P808 4(@4`0 8 0 040000 ,0S(p(@!R(040 U40@000(0!@PAP a!a`p؁`YX`p a X0`p`P@P   x  P P Vec c 0-@X0ML0L0 0D00@0@@@L$PK099cB Ve 0- L:D0@ N0PP00 :@0Ve -LM<0 3`p刑00 @8 ,K) >PPp UaL0 `0(  Pt0[0(i580@P4 0S #P P0 `000< 0(KS& A PF5Ux`R낯0 tS&0 0 :0080@0/5008 0< 0L0 0 `0 P%0 0580@Pu0 7SP PU<0PP R 000C00  C 00 0P 00S09000S<00t RppW   P 0/ P0  hA040p  4W 0/PqT TA0/ xZ T \4T 0t0S/80 @7A404 cDVecB 0-0L@00 P r/0P0K0hk/ X0-PL  P  P 0P $$R@P@dB H0R  R/R20R/20 0-@$0L L K0hZ9Ve 0-@L P9 @  0 0-LP@P 0+BP 0#0 -LP`w@P P 0+@PP@  Q0-L@K0hP 00 0- L@R(0nL0000Ve 0-@LP@DT@00 L@0Ve -LM0 0P0 0 0 00 0 0000p0 0x0 p0p0p 0P0 $0 R t/ R  00.0 .0000@T t0S |.0p 00>a0 P l.0P g.000418 r`V 0 |>`0A0 /RG @ T0@ 0 T ` 0 d.0 P _.0P Z.0000S =a P 0S" 041 `$1`;X 0  0 \P 0  !"@@Xx t 3x0h@ 00 00x00S00x0x 0< 0p00 0x0 0 /R) Rd@ h k h`@T*-p0@@00S 0 0 00000000000 7x 0 0p0p 00C00 ` @A /TT@@TpH^G @/P@ /P B @ R R )  Q .P.Q* * hd0Kh KP hP f-0p 00000[-p0?@@000td0S0  t0SJ0$*0 p0 00p 0 0 0Cp  0h00 0S 0S  00 00 9a0$0 S$ 0`0(05I J` ` Kp;L  KLK\0 8 <0 H 0LK />P' JSx00 p0x h 0 00S,d0h0 0d0 0 ;P hP ,d,T< ;rt0  J0SD80S 41 0 NJ0/`| 0  @@R0 {R@}` /Vt  0R t  0R0S P0 Si*0 |0/V  @ @0/`0 0E00/V0  t0S (P0 SG*0 |0/V   @0/`0 0"S00S /Vt0 S \P 0 S!*/V  @|0t00 /` t R R  |t0 r6 |I0 t00 Sj:5 I?Kt0 S 0S /Vt0 S P0$1 .0 S */V0 t0 S 0S /V t0 S 0P$5 0 S*|0/V  #4 @00t0 S 0S /Vt0Z PNO9N0$ XKN0 S 0 */V XKkt0Rt 00Ǘ0 0 t0 0 3 lI0 0 0O=000/S +00S0 00 .R  .R0/S0 0 00 +800 0 /RR 0dh0 w+0d0 x0 00Sh h0 d x0x 090d0S p  ShP SYZ+0h0 dd+p0 d w+tdn0x00SJ hP d `` QB x  >P J+dH+0p d0 00000x00Sn :SYM 0 00 00C0>ECAx00# hP +d+0p 000005P ++ d Q 0CShP P +0h0 d*0p 00000*x00<x00hP d0P*0h0 h0p 0d000S 0 (K*`X$ (DVe c\d/dB@Vec!B4dB!B9dBY!Bdd-Ab!BddNdBWdBD!BbA@dB(A=!BmAMdBASdBRdBt0 S p 0S9 /V jt0 S lPgx0 S T*/V 0 |0 @TX t0 S h 0SQ /V bt0 S hP_}0 S ,*(/V 0 |0 @L P t0 Sb 0SI /V\t0 S @PYU0 S 0 *0/V|0 @cEI* 0SH /Vt0 S, PM{L04" XKL0 S */V0 XKt0 St0 S 0S /Vt0 S  PnM_L 0S /Vt0Y P ZMILt0 St0 S 0S @ |}V0 {  0:@ 0|  -LM(0(0 0 [, $0   K 0 0   ,K@,K)K -(0LM(0 0$0 0 0 0[, 00K00 00,K @,K K p-L$M0@PP?P^/PPPX`(000 0[P0 0K04P,P (P 4@ $P ,0 ,0 ( < 4 PX0L C`d0$0d0`P P(Vec0NVe 0 NVe0 NVe 0-LMt0@S@UPP@p0K!t8U@P@UP@%K0 0-LM@P 0 TP $t0S# Sp0a@P 30 QP 0K P ,`%V UPKp0P ` @  @0S/# -L`/000@

T C AQP*WV$@WV -LMCpPt @P P6 P-T3 0QP<G(3 SR$ " "|GB P 3@P F$KF@@2PNP tPP[ D0SO@ 3/@d00Cd0Tq P(R n3x$ b PU D0S< d0 0d0>D03/@ d0T0Cd0-I/U0S#&X fFt݈|Q@T\h\FXWFP0@ OF,MFO@hPh0CFh@,`G$,5@`, 080 080;$080@"l(K(@((0 P9(0d00d0,@P dFedBc4eBdB\d_eBeBeBpcAc(VeeBeB'fB+AA?fBUfBxcDdVecfB -LP.p@P4P p `cp000@@Kh蛈Ve -L\M0@0x p`0 HP D (Kt0S <0  51PP, E @3n`0(0 0 O(0PM8(0tK nPT t0@ D h0 l F< lKt2ZXP u#7P )Fp R h#0"P X[# 0,00,0c(0ASpPXH#0SP pKp Pq110SZ ` R8X TM 0|0 +0Tp5#p000Tp,#p00 rZ "Y "勇ʇZp,0T"p#p0,0p"ẇ$8P " x0 #T0 w p 嘇fBcfBcVe -lPL` F@T  R00 < }Kh, 0S0S @Ve$Ve -L MpP3 ,`(0N @, 00 (P @ (   ( &  J`P)H, W ,  i @T ' p 4 R. $E 5`P (K" ,`P ,  , ( A X( @PP(PW 600 ( P$$( T %"fB 0-LMd0P@P  {P 0N.0,0 $FK0VefBfB -`LMQp0P"Ḡ#KK@P > C#K N P 0N.0 0 lRF`8 U8 p @CpU ,C C(KVeeAfBfB gB1gB 0-L@C K0h_gB 0-,0LA00S0K0h ced0P0S R / R 0S 0S/00Ve 0-LM  $K$0 U K 0-LM  $K$0  I K 0-LM  $K$0  = K 0-LM  $K$0  1 K 0-LM  $K$0  % K 0-LM  $K$0  K 0-LM  $K$0  K 0-LM  $K$0  K 0-LM  $K$0   K -L M0 0  $K0 0$  0  K 0-LM  $K$0   K 0-LM  $K$0  K 0-LM  $K$0   K 0-LM  $K$0  K 0-H0  9L@PH0 0S010L0AR A00000@@@0HVec -@LbM K|Kxq0Z `[K0$ P0` ? K[/Kg.K(Bx0tp$S K! !QKt `B\0 0X0BT00$ #B0| B R`0 1 000tB`P`0FS\lB 4PhBKcB@@3ARhBgB/bAAgBgBgBhB+hB{gBABhB "0-DML00 (00!1@00p`0< 040K0p,`$@ @@ @e 0'Q!14K P000K,p(`$@@ @O0 0 0!014K 000K,p(`$@@ @<0 0 0!04K 000K,p(`$@@ @) 0!0P4 K000K,p(`$@ P@ @)0 T @H(K0@0HVeBcAhBhBhBPVe -LMphaP`@1` 0,2`P&W  %l@Th@T#^ /P `0 |0P s 00 F00`(K^ @0 |0P03 0<300+-B @ TKe  -LM#K`0`000p C4 c00(!@P0! 0 00  01PP峃܀l@Th@T)KR0|0 aP z tڃ P(K @)KR0| 0 GP @TKe  0-P@LPt00CS 0p0!Ñ"h0|0Sh0|  0h@0000 -LM 0 0No K -@4 <P$p?L`McKv$zfT(Kp0 ß#K 000K0 0 MP j@p0.0 -P`$@LKhKPVe 0-@XPLH0  9H00 S0 1 0 K0h/HVePVe 0-0| L@RP R| |00S H0  l R;H00000K0hd!CeKe -1| LPR@ R| |000h`S H0  l R;H00|0S0|  P`H0l` t0TpS S MP  `0S (0@g!Cec 0-0@ L R  R / R     , +, )R Q0HVec,0;,0/ -L,M0@Sp`0Q`-` 81PU W@@hP 0 LKP0 P0VL0K LK KK0LK-0K`V`pS@(KdP dH LKy` d V Bd P0p@H(Vec -QLMp`-P 0SP R  P010W>00$K@KPP@D@K P ꌐY $@D Pv@ KU KPP KPP  ^ @c 0-@L0 0 0000p0`0P0@0x0|00 -LM`Kp@0$@0 K0cK KШVe -LM`Kp@0$@0 K0cKKШVeP 0/@{gB 0-@PL ,>|0S0>K0h.AA -LM00FPI@` 0@ /pl@TLY 0|  2?30090 R0 P $K@@,T0Sl@T JDTKehBhB -`L MpP"BVB I@B@ 0 P'C0 (KoB 0-LPH婀D0@T00Ph@d00d0(Vec 80P0-L@P0 p20x000800)%*&(%)& +NK+ 0|00 -`L4M@8 P @0 jVZ 41U!81 0< Sj q H9?, K00"0 3P H D0 庯D00<0H 0 X W9(K008H P1!D H B9 D0S)40K H<pd0Y 0SV, (  ( ( M8(0,0A ,;*S fzYT`0d:V 0 P 7(04(00S MR\0SF XCS 00@ 0X PK PP3\ PpP-PP` V 0 P ,Z7(00@L@B}jBTrcjB -LM 0 0 0000 s K -LTMphK @P 080 h0<@ d@ `0 84 dKL@P h KP`h`P&@@0 4:@P (0 L0@ E@T0S QTrc -LMp K; r@P SK^PRy(` @0(0"@(0@0(0y -L -L\M3Pt K@P t0``0 S^:$_:h_:_:_:0`:X`:`:`:`:a:`a:a:a:, dKPudK@P,  t| K 0dKed K@P dKu@$ 0dKTd K@P$ ( 0dKG pKD@Pd KpK@P(  pKp5@P( dK/@Pd KpK dK$@PdK@ dKPdK@P@ @ dK@PdKp@ dKP@P dK@P@ 0000rp@ dKP@Pvp KdK@Pp pKP@ dK׌@PddKxp @m1+PŌ@P 1M @W@A@Ve -LM@ ,K姌P,KK -L$MP4!Sp88! w@P00Sp!8@TQ \ 1?,@K00$0 3`8 <0 吧<00<0 0@8ݧT  ,1(K0080 P 80崐 `P00/S S 0S@ +T + @ 1(0o80 VeDVe2dB -LMPT0`p K@P 0 0 0`m@ K@ -`PLH9 0@`P  `+ -PLM Kp`XD@P  04 00!0`5@CK c -`PLH 0@`P Ԍ` -LM41Pl@80 `@p0K0TPY8080P 00 0`0P0U'@T00U0S 0 p@0!UT*0 0 0P0 3/0P0`P,P@0 3/0P 080 80(K2dB -LM0 000 K8 -L M40K CPP.00@aXt0Sp"V*  ' S)0  S00 00 Ā $K0TS )S S0K KK K9 @P K$ 0K KK@P -LM@# Kh\@SK -LM c K -LM!  K0 c8 c;9 p-LLM`0  1 1 d0K@P+`Ks@P$0P00 `0\@ 4P X0 0\K, @PH0DS@dt0S ` `0R@4 K@D D\ `dX Kp@4KDH0PM HPV @@ -;ML 000c0  K -LM 0;0 00 K0 c 0c0 0-LHM0XK@P$P0T@ ,P (0 X0P0 0$ TKE@P X@0<S(0,KD<@0P  @P X@K0  ,K@@P ,K<+< 0 c/0,0 c' -LMP >pP 7 (0S>`t0S: 0S S S, @P @@PR 0  P0  0 KP 9= (K@*K/ -LM`p=PP 0= @(0St0S !"K  @P ,0K0 ?L@ K@g= 0-LM0KA@c LK0 -LM`pw=PP 0H= @(0St0S !"K  @P ,0K0 M@ K@(= 0-LM0KA@c gMK0 -pLHM0P@' hKT``@Ph08` <@ `0 d@ e/4 0 ` G.R.H.S.dK 4` ]@P h0$KhPW@ PPP @P @ -0ML0 c K -LM 00 K p-LLM``KP@P`0P4@ \@ X0 0P /\K, @P `DKpH8@H -LM0 c K 0-LM@K@ P@0cP cK0 0-LM@K@ P0cP PK0 0-LM 0PKP @00@P ;K0 p-LLMP`K`@P T000 `04@ \@ X0 ., \KX@P `Kp H9@H -LM 00 c K -LM 00 K p-L MP@0` KK@P  @  Kp@ -LM@p K:<PP  0 `Pu;K p-L MP@0` K@P  @  Kp@ p-L MP0` D0D0 0K@P  @  Kp@@ -0ML0 c K p-L M@` K;PP 0 P;Kp -LM 00 K p-L MP@0` K@P  |@ N Kp@ p-LMP0` L0L0 0Kv@P@0  w@ 0 Kp@@ -0ML000 c K p-LM@H0` KvPP0 00OP  Kp@ p-LM@` Kc;PP P07P ;Kp -LM00 00 K p-LM@` K@;PP 0 00P:Kp p-LMPD0` K!@P@0 @  Kp@ p-LM@H0` KPP0 00P  Kp@ -LM@S11\Pp `@KK0s(0sK0Sp"0K Pp (K 0S  QPK0sKj"KiP`  K&KQP%`\0V``K80 sK0 s KVKdKY40"K040 ZW  P0``@@ p-LMP` Kp:@P 0 @0@0 ce@:Kp -LM 0  0@0 Q K -LM0 cC K -LHM@PP`p 0S <K⹁P<K 1ST %K? T  1SD !$K? D \K0 0K - ML00 @0 K p-LMP` K9@P 0 @0 0@9Kp -0ML0  K p-LM R0`P@"0 K@Px} t0S@ @P"]@PKN K)K"@SKp@ p-LM R0`@#K9@P0 @ PhG t0S@ s @P K )K0K P@-9Kp p-LM` Kn9PP 0L@ 0 0 ?P 9Kp -L$MP(KM9@P0( 0 @) 00  0 a@@@L0 0R`p@ 0H#K #K` (0 @b8 K p-LM` K9PP 0L@ 0 0 PA8Kp -0MLc 0003 K -0ML00( K -0MLc 0 K -LM c 0 K0c00 c0+c -LMPp$K`8@P$ 0 @ 0K @@0 0p0@0@0S 0  00;8K\d -p`41L8@ P%100:#:1x p-P`LMp  K@T`)0 S0,@PKp 0-LM0<P K:@P@K0@ -LM`Ё 0PJ 1 R0R 000(K0K 8P00  ` @D t0S`  0`H 7` -LM`Ё 0&J@Q T0R 00K 7@P00  @ PP t0S@  0@ 7(K@0S , !P CoQ// c -PXaL1BTJDqj@T $0SE101201B kT,]@j, 100@S$ $0( (@j1201Bj0P0   PU 0STjU  000 @0S @$@ clVepVetVe@012SQ  R R0/0 c -LPxnjp@ 0S0\@ 0,`0S Q R$0- -lVexVeVe 0-P`@LFj00CS0 K0hj(00C(0zjK0hlVe -LP0@S00 `#,p$P 0 P05,1,X H j@pP 0 P0Djs-lVexVe 00-$@L0+ @.K0h-jlVe 0-\@L ,i i i( I- F-i+000lVekBkB -`PBLTB0S opPP PPP@ -LpEP0@4`0PP P PpPi@itVe -H@LP`pi0000(00(0iKh6lVe00S/ LVe00S D/Ve00S/ :Ve -81L0S0PS0C01p(0SV+0S4 o+Mi00,$Kki`1?@T  R   R  R R R  0S  B  o1?00$Kk7+VelVeVe c -L001@o c -L Mpv@XP5 `ܐhp* P!UX10WPP0T 0S 0S 0 0P0  $PD00  -PP00 X0 00- i(KlVe cxVe -L00 0-h0LP0S-@ "U@@ 6iP#@hu@P h0VeVe -Le KhhVe -@Lp`ph@\000hPp ` 0 0S 0P0 P0ntVe -PL`p @T ^T0S0 R @S    -0L` P;0@t0S`d3P (10S00PS00* 0S( 5*h@ 0S00Mh pW@0;00S0C0* 0S *pg0h0x+X4hPc+00 *0  3/@Pp0)VelVeVexVe -@`LPg0S@00@0  Q  ) U0P00@0` 000C@0@0@@@08PE_oRSPU @+KhgcCc@c 0-@L,P0SS0 + --L M U% 0-P@LT  DbT0@00P t R2`// 0-@Lgnt00CS2ږ,*  0K0h Ve 0-0L G @ ⻖0 LG,D*000 t00$#00Q0Vex@fBc 0-P`0L0T0@1AT0 0R 0RP @Vec P0-L@ P gT BpP P @0 <0Q4 R/000 -LTM2@a00H0`p Ā apmH0wfL0\P0L07*f(K0 cdd@cx@kBcVeVeVe 0-LM2d @0PR0S u|P Ff;0S X0S !d1!1 S00 ,f|1xoPeUQPP 0S,P0\ S5R3XK000fKPa0[Se0,0*0[S!PH0  xaJlGH0@<b&pP6e80@0400000\b8KP*D1@!00A$b0< K (p@  07/pP b0@!0`1S01 R (KT 0z,0 L00L0@db<00`b0,0&,&bbc@cVec -`0LM P0pP P   0` ,` @ 0 6/pP .b(K0S 0`bР P&00 `@0! APb,0 L00L0W`ba0X0K&,I&88b6b0@a /b. a@cVecc -LM@< <K8 40 0,0 00K0@ (0 P00p@0,00(00 a0K`P : KL00<KP@1! A<00800400 acVe -LM@< <K8 40 0p,0 00K0@ (0 P a<Kg@0Kc`aa00W0,00(000 @!pQ ^A @P1 S! Q  K0cVe p-L M@[P a Ha1@!1S01 R P00000taP 0K   Pt x0a\00d0L0 00L0Qa`tKpcVeVe@c@xkBkBWe -0LST  BRT  Z, Kh;%ꩾ@kB 0-L@?0S S00 -@AL M88Q` pE `X QpE 0V %6$%0$P``@0S#*0P  00K `@q0`000@0 X*l` ?(K00010QPU`VeccVeCc@c -LMP`@ p_0  K -0LSt0S  c\Q 04@SR 4@Q`4姙`` cc H / 0-Lt@0 0\0:0\0<\00 \ P00 K0h 00O00 0-H0L@ 0 `H0  ,a⫾ 娾H0:P:X:`:h:p:x:90000000 0#K")K'0K@t0KPd0K`T0K00 0@0000404;$x0| Kp9:: :9: P 0-L@Pk 0@?o280K0ha -LM@ptPL\UPP0 \-K R00(K-K 0 KR0T0p0\2 QP 0 P0000P\PPPP\ 0` 0`  1ሡ"K % 0S!P0` 0 `0(0t0S2 011" 0PyZp H;(#L0妀10#00 _L0X0L0 ^H0;H0 _ 0p0`0Pp0Y K!-K K  3JZ00P0SpP[  0 @ c& 0-P@L$#P 0 -LMPpt R`d02@@^ 1Q|cK  @ T 00C#  K410S@$1Q  R>@ @0Q  R20K@0@?| @0000S@ @)0 S 0@PVp`-^`014120 @ Pf^T @@f@zfzfat c c -Ppt,0`0QL@ 0@L`0S% (0" MKJ{   }P 0 0  Z   L0J  -Pp ,@0@L`0 MKJL`?   0 h0@ 0H   -p2LM0@P = P2|1b,048<0,05  L0 0,0 ,0( 4/ P #  PW, PQ Y{(AK00 0W 0 40040 0KsP  (K (p0D0,04[ t0S? 0t0S=  "  )  }pP  .]X00X0k] 0P0W0\  pP Kx 0K*K  pPp-pOp c -PLP@`| \X00CX0*] DP[  -L,M`pP@PTT0KL0 0H0 $K 0T P@ S<@ 8 LK LKJ@PX0 LKi<0Y@000P0S@W (K041D040 i -LK0 0G/Kp0$0@$000c-TV0K0@ -LFMPp`0 GKq@P 0I/K@PGK0 0>K0 0G/Kp0$0@$v000c-TV0K0@ -LFM@p`0 GKqPP IK$PP$1GKPq0 0>K0 0G/K0p0hP_$000c-UV0K0 -LFMP`p0 GKnq@P\0.K@PGK@ 00G/K0 @ -TV@K@ -LFMP`p0 GKFq@P\0.Ka@PGK 00G/K0 e@ -TV@K@ -LFMP`p0 GKq@PK@$@P 1GK@ 00G/K0=@#-TV@K -L$M`0p0 K@P(`,0K00 0@PU,0PV,0 `F(0K000zP P@( ,0( 000-TV@ K@ -L$M`0p0 K@P(`,0K00 0Q@PU,0PV,0 `F(0K000?P P@( ,0( 000R-TV@ K@ -L$Mp8K#@P*`80 40K00 @PU40PV40 `F00K0 0P P@0 400 002#-TV@(K p-LCMP`0 GKHp@PP0.Kc@P GK0G/K @ -TV@Kp@ p-LCMP`0 GK$p@PP0.K?@P GK0G/K @ -TV@Kp@ p-LCMP`0 GKp@PK"#@P  1GK@0G/Ki@"-TV@Kp -`L0L@#2000FSP`VP`0P V`00 0-T0LM% K 0  0$KP @Pd0 K03/@$K0@ -H0LM$0   0) K(K@ Pd0$K03/K@ -LH$M   0 - K0,K@( $ Pd0(K 03/K@ -LH$M   0 - K0,K@( $ Pd0(K03/K8@ -H0LM$0   0) K(K@ lPd0$K03/KT@ -H0LM$0   0) K(K@ UPd0$K03/Kp@ -H0LM$0   0) K(K@ >Pd0$K03/K茿@ -H0LM$0   0) K(K@ 'Pd0$K 03/K訿@ -H0LM$0   0) K(K@ Pd0$K$03/KĿ@ -LH$M   0 - K0,K@( $ Pd0(K(03/K@ -LH$M   0 - K0,K@( $ Pd0(K,03/K@ -LL$M, "K 0K!K01 K@( Pd0,K003/K@ -LL$M, "K 0K!K01 K@( Pd0,K403/K4@ -L$M0 0D$ 0 1 K00K@, ( Pd0,K803/KP@ -L$M0 0D$ 0 1 K00K@, ( |Pd0,K<03/Kl@ 0-T0LM% K 0  0$KP f@Pd0 K@03/@$/K0@ 0-T0LM% K 0  0$KP L@Pd0 KD03/@$K0@ -D0LM% K 0  0$K@ 2Pd0 KH03/K@ 0-X0LM$0   0) K(KP @Pd0$KL03/@(K0@ -X0L,M40 , ( 8K "K !K09 K@0 Pd04KP03/K@ 0-L(M\"K "K 04 9 K0 8K0P0 @Pd04KT03/@8K0@ -H0LM$0   0) K(K@ Pd0$KX03/K0@ -H0LM$0   0) K(K@ Pd0$K\03/KL@ 0-L(M 0 0\( 0 0$ 4K0 5 K0P0 , @Pd00K`03/@4]K0h@ -LH$M   0 - K0,K@( $ xPd0(Kd03/K@ -H0LM$0   0) K(K@ aPd0$Kh03/K@ -L$M0 0D$ 0 1 K00K@, ( GPd0,Kl03/K@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , +Pd00Kp03/K@ -H0LM$0   0) K(K@ Pd0$Kt03/K@ 0-T0LM% K 0  0$KP @Pd0 Kx03/@$K0@ -D0LM% K 0  0$K@ Pd0 K|03/K,@ -@0LM! K0 K0@ Pd0K03/KH@ 0-`0LM% K 0  00$KP @Pd0 K03/@P $K0d@ 0-P0LM! K0 K0P @Pd0K03/@ fK0@ 0-L(M"K0\9 K$0 04 8K 0 0P0 00 }@Pd04K03/@8FK0@ -D0LM% K 0  0$K@ cPd0 K03/K@ 0-P0LM! K0 K0P N@Pd0K03/@ K0@ -@0LM! K0 K0@ 5Pd0K03/K@ -H0LM$0   0) K(K@ Pd0$K03/K @ -L$M0 0D$ 0 1 K00K@, ( Pd0,K03/K(@ -H0LM$0   0) K(K@ Pd0$K03/KD@ -L4M#K0dA K,0 0< @K(0 0@$0 08 0 00 00 0Pd0<K03/K`@ -L,ML"K "K 04 9 K0 8K0@0 Pd04K03/K|@ -H0LM$0   0) K(K@ Pd0$K03/K@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , ~Pd00K03/K@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , bPd00K03/K@ -D0LM% K 0  0$K@ LPd0 K03/K@ -LH$M   0 - K0,K@( $ 4Pd0(K03/K@ -L$M0 0D$ 0 1 K00K@, ( Pd0,K03/K$@ -L~!nB -P@`xP0Lt0@00d0L00L0 0( 0P0PWe 0 //0L0// //0/ -L -L 0-@LkiP 0P nP \0 0-@0L$ @ H0 -Ld=nB -0LQ -$0L@0 Q/ // 0 //0@-0S  0S@@0S  000C S;;;;;;;;;; 0( / 0, 0 / 0-@PLP0S0K0h P -0LP R R  p @` `H 0P@0  00X0T`;T5 300. R(Q$ BAR P  $Rpp00W0S 0\<000V pp=W AP tPP1 PU(0<101TP P c 0-P@LTDM50K0hM!0Bs3@ 03@4d 0-| L@000H0 0nH0+ R;H00c 0-0L@0 tMsMK0h -LtM(K P 000 0S|00 < K $1/cKKt0 S `0 @0@4V0pR``0S>MT00T0{Ml0H $` 00` 00000S0H000H  03!30R0 0 7R0#00S00H 0(K%K0L0 Y  TP T1 0d3Q\0 Q2Q\0 UP0S4X0 D0K040K0@0K0%K$ P9 L0 0L0 LHk0S- HݢB 夒`aR堂Vʀ 0! `! 0    !H03/ 0!!`a0    !(KD%K 0` D4h0 0h  d3h0 0h 63h0 4l0 0Kp%KP 0Y0K 0&Kd0p#KSR0S 0 CT0 L 0L0 d%KI 0%Kk%KKSR00d Y00SH ᜣT  Bd0H娢 0X\) D" 0d03p0 4t0 K%K R02ʠ j Z| SQS:| Ux0 K#K 0@# cdd dd -LEM0 $`00 @0  000 `0Y  000 /@0PP0 :90 00 00P 0 Q #'K 0؀0p|00 d K 'K1/ '  ?KR'K|\K1/006%KP00SLP_0SL(K |00 \ K 'K t `0R(03 RS|00 0S 3/0SI 0Q 0 ,0KD #  0 0 >PP  `P-0p0 p0Sʄ0 01SP000U0S 0S 1S 0 8 03/10Cs` Kt0S 0`0p 00à%K)K R 0K0#&0:0 0C60 *KW0 Kl 0L1 p0 ?(K  0)K0 ?  0K 0 0, K K0,0 (K K0p,0 KP 0 KR vz1 S 1 P P!LKWLK0S`00 nJ ,K0S0  0Q/8 03/P01 0S0S - J#KR0 0S- L0KZ  W 0?o20 )K X0":0 10 0 000p0K0 0I1P+<1 0pQ7B0S p0 0p0 PX J1 `p0SW8 J0S J0P} 0! P 0S JPL0KZ  !#@P 01S 0S p0  Sʮ)KYX00!pp WppW  ! p ,0K( #  )Kp0P 0S p \JfKp0 0 t0S `0 0400 P812 1 0S  (0P1  060 )K V0pR0``p0 R`#0 01P00000w$`S6007 0007`` 00000C0 0S{)K'K01 0 0S 'K K R0"f:0 013@x |x Y1 0i3Q0 Q2Q0 Ux0S90 l0K0T0K0h0K0*K0P0 w 0 00 0S 0S ኟ #1 R00S 0S00  |0  1 000? )K1/0P0 oI0 R0Iἠ0S 0 P \I0S p IP%61`jf3@ 1 0P0C0 o10K1 0  S:#  K0R0 l00 l*K 0` I90 0  i30 0 GK630 90 0  'K KPG?K R0`G?K ñ` 0GK 'K 0KK 'K 00 KKR00P0?'K 0GK %KSR_G?K0p#0d#0 `p'KH0 V &:1 1C|0 000 H0a1 S$H01 00C0 G?K 'K0  P!#@Ơ'K \0G?K R0G?KñP R # # R # #  )KKSR00 R00S  ᢟ|  0 Bᮞ 0) I 0i"030 90 K'K R02̠ a P SQ US10 K%K 0h#!0R00 qW !3/o"## @030U0V0S 3 3@ 3  P~3C030S00 PPnB4d cr2 -L_MUK 0P01 t<1D1 hK0K?K *R0$  !R $A! !$10CR  0 ,0K 1@E?KlЀ 0$  K?K  X0 R0SK L1H#*PH6 $! 00,0K LI?K0K?K *0N 1 $10$1 0L1 @1 01  `E0?p1S \1L!` t1|!0S3Sx1\1 V2~\ Q0p A $1 q l!C?K1M/KO/KЀP  R@ԀP  UKЀP  R@!I #RFl10l1 l!$1Sʄ1S 0EM?KOKW V R0  ,0K #R0 00 K 0 }E|0$!CK0@18/ 0EM?KOK R0N@0hq T0 00X@w h0d S  d 0x!R 1 }1#  #XD!R1 d! D1X!S 101R0d1S@dAdq BT0S,@ T0S S DXhq !$10C6K/K0 6 cd@scnBnB4dd -0ML 000!  K 0  / -LM@0Pb ,0F00 0 0' Kr2 -LM@0Pb ,0F00 0 0 Kr2 -LTM0$@P0  @ph K` S0 0 0`0 01S@@Th00S (K0K6#P0D@@{D1 12l0 ,0K, #&KkD XIX0S@X DDXQ1T RDTh00S s13@ K6 T T K@L  KLKH 8@ P < & l0LK@P< R TCT 3@ 03|~p c4d -L,MP01 r0,`(@VT0KT LKL0 @` PP H D@ 8 0Pd0PPEl000 L10|0 @1 <1!&JY3:|}1p0h0 000P0:#:00$K+y||0  Pl%YK00000C0 0 00C0d04 K/z0x 4yꄂ>nBcCcdX ; 0-@LPVB0S K0hB SS-L`Pp@ ZXT W PKhJ -LMpYPp`40K0@ 0 4/@P 0T00S4 +h40Ww Sw 4P$03/@P!p0Sg00K0 0 8/PP 0U00S0@ @ t0SXp40p0S@ 4P t0S4P A00V1 W5 4P t0S R0P 40P J0t0S p0S P4P t0S P04  $00  (K40P P0P PP@ @@{ -LM `@ 0 WT  W 0 000 0"? 0" -QL@PP @Q@ 090 0>#D R0p`b0@@>D# R0p`0b@@ Q0-L@ @Q<  0@9 0$0@0$00PP>$@>0$0$$@E/!R0//0S-/ -LnB// -PL0S 00s  r @pl 0 r 0 `V S S V  @ Tp- // -L* 0-0L@ @ DnP@@0m -Lm 0-0L@ *nP@@0m -Lm 0-@L@nPzn00//// -0L > 0-P|@LPmP0|Om@-`0@_`Tap ? 0-@LP0S :S 080H0PP=00@=0 00T@d@t@|m|m|m|mm|*n -LMpP`@]P @00<00 K KaPMP0 @ Q S00R 0T0R0T0 -L MpP`@'PW  O   ( K0P(0S K -L M@p`PTP@@  KUP $ K@" P(o -LPp`@P   Khy -L`P@PPDP -L`P@P P -L`P@0 ᇂP  Kh@nA// 0-LMP  0K K@P "00K0P/ 0-L@M0K #0,(<@P$  A JK0nB/ 0-0LP@T@0@0弼 -L`P@峼pP000000 0 0!!!!""""####$$$$|0|0嵻/ -LMp@ K  P` =b 0x0t0t0 0CSd p0!p|` 0@Pp0`K p-LM` K@$1/PP 00Kp  4PP ~PP [ p-L M`@ K⭼PP 00Kp  PP N[PP 8|0哼-/0T0/0X0/ -LLMP@ 00 0L `pd00  \\/`LKlK 01s  V! > R dP9 01`VɐL0 0`d0lK13/L0K  r P   p0 p0` VɐP00X0S  P 0 0 (K!|  p p@U B - L@0` `0(0 00CS P0 |00 d013/ 0pPp Z `0(0 00SPX0`W  `KPP - |q qq cP@WVDUTq `(bP@WV tQ01  `0(0 `000// 0-@LP`0003/P0`0 ?!00` tQ01& (000// -0LP| @` t00CS(0`003/`P 0 :X00X0: -0LP` |0@~:X00CX0:`000Kh/ 0- 0L@0t00CS0`000K0h/P 000 |0000/ 0-P@L`0003/PP| 0000 -@LPT` ` `0R@`0003/TP P| 000 0-P@L`0003/PP| 000t0 -P`L|0@`0003/Pa -@LP`0|p`0S009X X00CX0:P|r|PA 0|  d01/ -L|0 InB -$0LP@@@|0``009*9`0S 04 d0 13/@59@`@ -0L|    $d0 1 Kh/9|@AQ/ 0 / 0 /0@-0S  0S@@0S  000C S^;^;^;<^;<^;$^;0^;<^;^;0^; 04 / 0 0, 0 / -LY -LMP@59IPp0S al90 WV t |0R R1 000 0K`p1 000 0 ; coB -LDMP`0S (0@!Q QX3p`1pT0 0P0 t0Sx S@  @P80S 9 @(K 0࢟0 00009PPL00L02(4X0 0 \0 T0P0:P@`8PI` H8`0S XP h60\ S!8 Ro T @8PPT``Vt 1AR@p0!11000L0K4/@P@<D!@0#S @P8b80S 0S0S 8@00 0P80䠟(4X0 0 \0 T0P0:P@=8P` y8`0SXc0P`0 G`05X0\ ST 00C 000C0t0S  cevc66hd -LTM@P0S^ `t0S SZp 0 hP~ (K R0p0 !11000L0KP[8P40cKK%K p ῭E$+4pPKh K 0fPP h00 0ES1 Q1 ~P嵏Z0SY hd coB -LLM@t0PS Srp 0 p(K0S] R0pp0t!p11000L0KSPK8@40c ?K&K%Kdkt 0`p&KJ0DZ! T0@00 0LP P0 `0`D V `! pP PFP0K00@0 0ڒpP YP P0pW0SVpڏ Rhd c)oB -LMp`7$Pp0S AG70 UT t0S S K@P 9oB -@LP6Pp0S a70 WV t0S 40 1Kh`pKh/ c0t Rp0 -/ -0Lp0P 0-@LPt0Sp0 00S K0hh0\03/-P00 -PL@6Pp0S a60 WV b 9P`p!PP $0P0忎P p-LM@Pp0!"KL6p^PP6t0ST Sa;60 SH11412` Q@-6  P. \ d6@@6040C0 H t0S00Q6X2#K0t 1R 0 0/X8600S16.6000d0 1ᢱP $KpHt0S K ,c cFeeVoBtoB -L M@04 4p0,0!$!60?<KoB0 p00⶞D D0 4S 40 60CpS//x@ -t0LSp0 P];"B -L `p  n5"-?  0Sa00 000a00pd5Y  ,KopAUTt@t0T 000eVe -`pLP05"-0?ATh5t0S p0!SR5.P U5p0@U p000S I5p00@5B5AP0@eVe -@L`P40?ST T|)5AT0tp P@T pP @45P@eVep00/p00/ -p@LP\`4 R 0@0C0 00004 4Kh4e -@p0LP4pbm ?`Q|Q010p`p0@L0D04T  KhpQ00eVeoB P 040////0  00-L@P d 000 .0)0000 -LM P0@"U`TPpZ W0040 000 U}Tk} 0 .0$KKd 0#K .0(2(吃"K0"d 0Ÿ,1#<0#80# <##K 0܃K#K T 0YX#* < #K<P   ?#K 0#K < n#K<P   ?#KYX 0耟̠#K@#K ?#K#K 0YXCK 0<0C@_!5 0 @P㔌 圕) 0 .0 @PT0@P(K:m;,n -PLM0`"0W"K0 QK#K 0JK0 "R0e0"@P&> 9p\!8#@TPL"0-@ 0@!0 @TP"0 Ÿ@,1#Π@TPCKLX%dq 0L^.!1 ?@P#KP R0@ ,#K R0@#KP#K R0#K #KP R0 p#K R0YX#K   n#KR0K40.@ @0庨. 0Kᵨ@P< 0ᮨ< 0ᨨ (K:Q:,:mnP/ -($PLp@ rQ#R000$00U (0P`#V0P9PQU" !$+4P Y8

.^R0a  7P`oBU BoBTpB pB -LM@\Q"V Pl0)|`P Q00 p- RU0$X 00R 0$U+0 WUT0PTP  WP0PPP%0X00 $Q 0p 001/0P 00 -00(K 50 000U 8Sb0S -LDMpQ@P" P@000 140 #KR0#K R0R0J4 0(Ko(K -LPP 0SUo,`,P͢P@ 0!QP@A`,,@6B -L M`p@P`F 0S`BU_,帐`}, ᠢP  ᛢP  ᖢP`&;;S+VĠ QP  0xx` *"K-#K"K 0K8/``,,$K6BpBpBT@pB -LMp@3`Pg 0Sf0h0Sb p 0⇿pP:d1W 7C 0CW 70W1 P,01W 1C37CW0X h020 0$KkPڷ tP ♣P0 s**+* s$K0X h02\0 0PP p0 ὡ0SppC Gp PP}d(@zd@d@ -goLP+똁p@P, 0S p1 CS!1 01+00$00++0hǂ@+T 0]᧗$Kk+p̰pP+ς⣽+0000000 0H0H0$#0h0p0!"$0Tp$00p0Y+T00T0+4;Cc -LPI@P0 0S0h R00$00,Ko蚃$ R P`0 F69 f&18p嬠WP#`7pdgo+101=pZP+,KoJI -TP`L@0S00go0N*1 CS!1 01<0 $&A$+DKh p-L MP K`a@P Z@P 7Kp   @P : 0* 0X  X *  00 -LMp@PP. 0SP*Uo*`*01S0d0S 0K PP0 h d00d0P W,1(100(1,1,1(!001`**K -@bLl-"0\0S 0S 3/b- 00-@L /P0K0hA -RLM@` 4K, pP, 4Kɝ0 ` 0 B ^\ 1p0% X`ß v#zf08 0 $K谸## p-LM@P`P 0S 0`0 0 y+Kp茙; ; p-LM@`P 0S (0` 0600]+Kp茙; ; -@`@LpIYP0T*0QU@坵P0ڟP0Y0US $KkvWeWe -QLM`plP)t@T) KW 01S@ dKqe Kq)K 0- L@d0S P`)U)U l00CSd0 hPh0 -L`X@P 0SU_O)`L) V,1(100(1,1,1(!0S01Kh`z)x) -@UoLp()0QUe)_)P`)Kh -P@aL MX0 4` Sp ATb Q_ pP00XWR.t墶l尶0 ]go%(1SD)0  ᇥ0 0傥䮴  0 萄l( p00Cp00S  . l(p Ὰ кl-X 40\0!`00X((KP101 WeWe\@|@pB 0-LlMP0<P  4K1P*R0n#K@-ᜀ堐***+0 <0 0ᛀ P0 ]o ׀2P g? T0 B(>X0 l080 A(Ht/ F*$K+dK&K R0`p*$K+&K R0gKdK`p$KVgKdKR \gK'KR0$KV000 SQp0P 0p0t0  0t@0 &KfKSR<P83(X XaT'pKJ(K3 0 000ZWbp  RW' @bWX6 8'p080Cp00S  . (PWp<L D0 ֝PD0L p0W !D FD0W0 ⋣P"  W 0_W8'p08 0Cp00S  . 'XTn'pҬM` yoFP #0 Ṟ <P `21 01@0/10p `0p%* ! d 00*klP@^ @ @ `<0DC$KdKWV' 0B0;pBcWeWeqBA'qBCr -LM0P1 0GK p1  1 04!CKlD 01 &t@T`p004' K1S0S"`Dz Kn K⇞0e0K0 dKn*%K+DK$K nE/KK⚱`P 00 0@ -@L&PKh7PuBB4cA -a fp0LM`@`PP@ 0S9`aV@ 1X 1X @0 00p0 0۳p@ (K0@    @TX tp 0` Q V @ @T 0 ɅiᘀLcr @Cc p-Pp0L `0M@T`P 0S 40`0 0 !KpLcN4Ȼ; p-Pt0L d0M@X`P 0S <0` 060$0|!KpLcN4Ȼ; 0-8@L ,(2P0K0h^LcWe`cWuB04!`0<`0/hR \0R T0RP0/DR :80R -/P-//|fwt@t,@{f@~fvt X0- LP0@ 0 CP$ 0 -@H2HL 6M040 /o"Q Rm X   B 40 Sr;;;T;T;T;T;T;T;T;T;; ; SR 0^PS CP` X `fQ010!80 @1pI 0U$1000 Y 8 dV0Yu0`WV  PZeUP!0S  ᕁP  0S00(K R  R00~ 00 X 1#ucc> -p`L d0 剄@H0*P0V,PAY(0 @xCcc>c -P`LP @0@  c -@LP` \y$ 4 < 08! }: 0@00StI/კ -0LM 60P S@ `p`` K$K@P `0 w@`H0 $]@K"`pb`c c@ p-LTM@`T |Kp0\K1 4 ) d x0@0S  \KP| ;@P@ |U k csuB 0-@LK0hE A0-LP@ 0SE@ S@0 -P0ML00  @P 0@@ 0S ` pP?o2 T0S 0 00 00@(K U\# ᩨ0PY@T  0 H@ c -L,MPUp- `A PU0 S#S` R 0 R,#S 0 0 P pPP P0R S+ P (K.`V30 0LK LK]P `P0V`00P0 P0S ᧤ 0#PP c c~uB 0-@0(ML 00@@ @@@ P0 0@0@ @@@ $Kw$  0 "00#0#$0  0$KgGK0uB cuB0S  0 00/ @-@`p` @`p`!A`pa -`@L PU 00P@H0P00P`C?@ -dLPP@ Ÿ6Q  ?""R0PPV 0-PP@LP0S0P0  R  K0h0 0-@L0 0R 00(0,000K0h 0-40L@SP 4 s40S,0S S 00 000Xe p-LM@P` H耟0P 6!:(0 6,0 "K  0K 4 <(0 4,0 "K 0K0 0@0`0*-: 0 Kp@ -`@L=0Ap!P4!x  200S60S50S 0S EpcaH_P1 Q 50S0 t050Xe c|; 0-@L SD0S ]$PK0h) 0-@L50S0500S K0h% -LM(K,KpPPEo9@00@P<41`x00vt⽇P  \PPPPPPwspPp 000`S 0 y8`@,0 (,P K|;XeuBXe8@ 0-(@L,0S0S00  <P0 0S K0h/] -`@Lplv 0RPZb50St⡇0550U R  00 0S#P> 0 0 0   P:0 0000( H/o6"Q R  R   0 0  pPP #P 0SPU  P P K 0-p`PLUV,.@U@1 ᚒPE`0uB -@lPLp` 0S$0C(@D R (0S $0CS p`KhXeuBXe -p@LMPK CoK` _p le 0` 0   0  P p h0P?o20S(KXe; -pLM`KP` @00K\0 0`@0 0 0 0000 0g?oP20S  BP (KЉc -pLM0@x0 l0K | t0 pp W,@ T@DX&l(K <0R!S (⑋  0 Q 0S K3/P`@T @DTS K`WKt000pppG`! 0Z ``!PV`0F?0  0PPQ 0S 1,< `p`pP 0P P60S5Ioᩒ 00 x0  q 03/PYP Xe -LMD0S 00 Ho K 0-@LP @T $@DT`T0 PP0S(@0 0 0,YP XeXeh@uBd;uB -LCM@p `P 2SJ@ @0 (@ 0@S K⻐0B/K00I/K(0000$Q  a K<; -LDM@P T-(KQ 4Б +1 @@묡 ww ,0K@# p` 0,p(`$@ @@ @ m00SD 40p0,010 1000'> 0 0(`$@ @m0040p0 ,00000(`0$@ @ @m0040p0 ,0\00T0(`$@0 @ @0mXeuBcЉcXe; vB4;bBl;vB -LdMQ@p0 ~t l`(KQd000 `P`Xp0ZPp_UO@A@TPA @Z 01@0#t0 @DT: Z  W R, 0 P0 l 4 h K5 g K6 f K8 d < ` \ ( H0 T , L 0 @0 D Y R< K <K b`t lK-P  I@ GrpT P p0P``XeXe -X`P𝤀0 !`!800 (  , ! cd dd 0!< 0`4 0 (   !/ cd dd -Pd`L@T 00000S 00 0 3/6KhXe -L4M<; 00-LM@1  1 1 0KP 1 0/K KK 1 A  EK5K0 -P@ L` #RH L0S0P   50H  0CS00S 00C0 0000S  (  ( 0Spp 㩍 |Kh}1 -LBM  !  K .K   ! CK d K -L@P`)t(0,0S  Kh/Љc000/Љc 0-@L^P K0hU -`LT@T@41tP141x0050S0500S paB00000P P  P P 0000|PNUEC Xe cXe -L,M@p1`41x00O50St⎁P5P9W R9W: !0CW) 2C7CW 3C7CW 37W]+dD9W 0W 0CWO0009W ;C?>CW >0W >C 0CW; HK8Wp 60W 26W+x ]! ˔80 ip8Wf  ;C0CW 0CW 0W' 0CW 060T 8W =C?0CW0@0J PH7W 7C0CWb 70W 7W HP37W6 70W 5C7C 0CW|0 0QS 0 F0 0A0CS…Q07 pW $pGWP0PS0PPP(K00|z0S0S&0 R 501:S 00P0PWU PP`p(vPPQO䀔`rX u UmU Ϲ p(P ǹ\+P trPp 0S]J4 R!PP0400S 00P0S 0!H0 ,21L ,24 pW9 Pᠤ$pGW  H4L!,210#,2|0H R0S 0S Pn00 @KP0   ?)PP0 @K(pW $pGP0S RPp!h `V0 PS R (`V $`FV0S  1P0A Q0X: ⡉PP50(S10SP PPP 7P]0W S 00,0p0,0`0,0S  q0,`p(pЀX0mp1Wi1P#r@P 01l1r# 0 PU0S0 0(0(,0 P000P0(00,008000080<00S<03@00D04PH00,0`0,0p0,0S  :q0,p`"U8 PP0402  L`+ ckB@|B@tB@oB@kB @CcCc~f|flB vtfBXeXeЉcc?B'vB/P/ -LM Ka0`( "4`# K0M0000# Ѝ/:9/Q21 //0@-00S CQ00 @APP^0Q@  Q0 8<00 00  0-L00S 0CS00 APP0 0000S000/AP/ -QLMpP`A @@S S 0@ S) S S0=S SS S S S S @S S S 0@D(S &$S S S 0S: CRS( KG(0@S%S 'S 0 S* 1 3/00S{ ,S -S T5S <S 4S dS 0LS ES @Sl DS 0@GS HS  *0SK0CS @TS MS PS  A:`Sm aSo \S @qS |S lS tSz 04CdS2 Ss^S S Sj S S1 Sb 0@$L @J @$K 0S: CRSP( Km 0SSF( Kc@-  =*0SV0CS7p@ 0S S,( K(0S&<  @ 0A 0 0A 0 0僁 0S* 01 0S 0 0S 0 T: T  @ @DY EHY ᱐@ @ @$I4I 0 0@ 0C@d0 S0 1 -LXMX0 L0KT0 0` \ ` KP0 K -`PLPp@ Y@ @0G S*10S0S,  1 0@@DT<<K mvB3A01,!,"/ c0!,21 ,/ c//////0 00/ /H@o/  -L, -`L$Mp@KP9=0K@D\V\0P(KP& D R 0 B R@ ᚄP 0DSWP0S P  00C ^ R0 T R XX PU@0[S @K H CH0S@PKvvB 4cXe 0-@3L08@h9$0PU0(0S 3/XPdc -L M8 ! K脺c -L M8 ! K脺c -L M8 ! Kйc -L M8 ! Kйc -LM8 j! K脺c -LM8 U! Kйc -Lv, 0-@PLP00S00P00C0c, 0-@L(?0 -0pLMPK` @0 \0`K X0P@ 0 0 000 0\` Z?oP20S(K< 0-@L+(۲K0h 0-@L7 +K0hs 0/Q0SS// -PLTMp P P0P 08  0 0 <4P0,p(`$@ @ @Oa<000<8`04P0,p(`$@ @ @`0 8a(KH H0*P< @ 00 )8 404 g 0,p(`40K0 K _Pv0 0 0!0,p(`0$ 40K0 K^Pce`@2S ?S =<2@2_S@2 M@}h@RL,<wBvBdc@< <@c`P(Q0x0,1K0 -@`P9 L(1 901U(00Khx0 L c0P/ L c -LMP@`p0(x(Q0,1;EPLBT D@DTYs K8KN @),8KPH@ -LM3@03aNp`LRU DPEU-I PP" 0S00P00C0%0K0K`HP,0S 3/XPUK"n20Pdc -LWM@._K.~`!-^   P3"0 3Q  @" R<<"@7 0Q$P 0?S@ Kh΀a L0 0WVp `\` 0@\ 0@` 0\ '\0` `0\ \0` `0\ \0``0\ \0` `00\\0\1<\13# 4P"3 1P1 3P!3. (:0(03PK31@0`@1^N D! ! ?$8 |2M8 z|h X*|_0 0 0PP0@S?P SRp @L? p `P @CP$P @<$rSPPiui ii#cii c0L4c -0Lp0SoCP @0SLB @2S oCV0 R H@T D@DTP 3 P 0S PXet< -L@`TP@P h -0L`PU_Ep @0S@RU _EU3LB T D@DT 0 0R H@Q PXet< -L@`P@P & -LX0S !S* 1S  Q(a 0PU` `Đp_EU0 SLB @RU _E ,  H@T D@DT 0 RP  0 Q:V` 'P`4ct^⡦ V KK$03/x'▦0h'S:`gS!B!'BS K 0`P @"X `V@` Kw @6pW GW @X0`C`(K?0 6K  KxE0[S?L2S DS KvX` Vڐ K@P,`F@L2S DCZ w5@ K@rX` K wVڐ K@P`F[@H0?@D5K A@A@%A:A`wW K0000 0)X@ KET %0SK@P4 KyP K0@DU03/@m@P 0S-@ K_PP@ 3` 08K 03/@P ` +@ c@80|#S 7p#S d#S X#S' W6 0 0 彿@P, Ko#S# S!"S "S""S "S$ &6 "S }$'- S q" R3 1 0 3/P@) 0S-@% DB0 Z  \/1Zg p$@ 0 4/!@ NT 0 0 (@04/@#10#  p0[T00S OdA pW \bW3 $03/$!@0S  u 0u kd S*.hR SO  S, _I SF *.SB 'BO BTn@@k@@&i@c@c@ccyiziXec<iiiii{ii8iui niiiϖocciiii -LpP0`@TOD@BT ODT 0 S 90S,1 0{P0 Xet9QC<aPAU A7AA00 \0S?p-0C0 S3 pp -@LPT` T% TB io  0@H  ^o Zo0@0^0@00 0000000S 0S 0S @T P9o D300000000000/@ @@@ p-LM`P @o$ K,K`P&,0[- $0[* X"$K,KP 00 0 ,Kn $Kn0 0X24`0SX2  0XB0@\20\2T ՜Kp` p-LM@P.$ K,KY`PX"$K,K@P 00CS 004`S  0 \20C\2R᧜Kp`I|// 2-QL@`P -l2Qy `2Ql X2QX  Kh$82Qn M0Q`2 Ÿ2 0\00-\0Sv4P3, 0Kh/1Q 2?5Q1`20d201Q* &0Vt"RA 0KhU00S00So.3A AR 0303/P PKhP2!4<010`" !d"S d2KhKh:x"R0Sz 0 0 8YtPoi1iii2i(#iX8i(i@ 0-`2L@ d20d20 APd20d2000 0-h2L@S 0d2 0d2 APd20d200 0-L@M (00@pl!0$PK@%0 00,$@ @@ @p`J 0!@0,(040$@ @0 @0 J$KwB`^l0XeΧXe 0-6L@ @& @0@03/PaP `Px00Cx0x0PS L0S 3/H03/00Cx0$ -`pLP,%$0 3/@,x$T3@ @,$0 8/@,d$T x00x0]$ -@L#@Tt$KkM$0S @ 0QU`0Sp#\7$P`XeYe -d@LP`p#@T8$Kk$0S$0 9/@XeYe 0-PLLs@Pn0  R 80<000@0,0$0(080$0H00 0l<m<u0@PS0@L f0DO0@Shl!R R 0AP  f@00C@0@bMTcc -L$MP!,2`1H ,2@p|`@KD @@0T : @K*!H,210#,2(K1 3/@ cc -Liű 0cexBc 0-@x2lPLS|"|"|2x" D4D08D,D( K0hCc000S/p"Rt"R x2c -L`PP@ &@pbtRNu$0 @0Rx"||2cc 0-L@P0 K0h -L@Pp`     -@L`pP 0 PP@ 0 PP@TT 0  0-@PLz 0 -L,MPQ00 D0 h`P0' 0L0 ,"1!H0 ,"@p`@KD @@0S0 @KP0 'L0UH0,"! ","D P0 (K 0 DK"0000 ( $#0 0  -@LP`p# 0 0  \:00 Y0 0A P L `0S: 0  000 @ ``A@ -L M4bpP0Wp@R W p(p(KT DJ` GE`PY*0U ES 1 PEU WPPW B\aP 0 P p  gPpWX0+P p  0 0=a  ` 00 K U00pSP@ 㭨 /@T* R l  RPEEo@D10Q0 00 00 W@É{Ye`cxB@ -`QLP 0 ]P @@XPT0SP -L$MP0`Q< @80  ;P ` @(K00 K<00@S@0 4 0p R V R  QD0 H PD0 H PD0p0ST7@p 0 000P RPP<0 0000@ 0V `0 0 000 0@0pS/PUP0S$0S# RP0S00000P0pSP0S 0SQePPUVy 0 Sԡu 80 SWPPUIcp0S0 0 P㡧Q V 00 0PK P PpxB -PLpQ`P @ @  BfPW6  XP 0@  R' R3 Q0 0' T! 0S 0 P!P࠳ࠣS^I RHF 0 @T@`9R- H3 00PSF T0:`P R00#0 P0 QPP(0P,0P 00 0#00#0 00CS 0 0Qd1  0 0R@ R   R00 S0Q00 R Q࠳ RSR ˦0Q `U P0P0 RPPQ AQ  0 7yBxBYe`yByB0 -`p@L0S MPT 0@ @ 0 @6/P -p@L0S +`TP 0@ @ 0@7/P  0-<0LP0@S0 0P@  0Ye`c -@p`Lp ^( P0pX 0 0p0d0(0P 000000 0YeH<\<<М< 0-0L@SP pp0P 0K0h00 0-$AL0S  ! R SP K0h$X P0CPP0  S^ 000P:lPdPd @T0PD 0 00pYe}yBdcyByBYe`cyByB -`LpP@()*'P` 000q100S0@@P -@P0`LS   000@7 0R 0qKhKe1/1M/ # -`pPL0@TUH 0 $P=M,Ko#!0R"1S RP TdP P LdP 0SU P 3/P @HP 0 w$P ,Ko,Ko  #/0 ]0  ] -PSL`p 0S @1W0 S 0 0 03/@P 03/W@ ^8@S9@ -0LS yBQ00S//0@-P\ @0  S:S0( B0@] -LM40 0 P @ \ \S R KK coK 0-@LP V0P RP N000000 帶Ze -00L@SpPU 0S l`aP 0|0}0 -0`LPU, p0S   0R0 0 8V03/+0S0C0`帢@T " ̟X0P0$$ $$Kk-QZecZezBCcd<[e 0-@L(㧊0 -@L8P,p`80SKh>nc -`L @T@Kh+p0ddP 0%8MC(1LLp0C(1HpG>ccZe\ `P/0 !`8 0 0 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -L8MPp`PP @P 40 8U$KL!W 4 XK[0XK TP @(\e 0-@LLPQ0Q ,0 P L ,00,0P,00,0=LL@<0S0P0K0h6 0-L@LPT 80S 3/@P 0 p-@QML  @@`0 0@`00c00@P  = @Dr0 0 `0@@p库l0 (d0 `0@@尓 @@Kph}c(zBc|<0zB@@AA8zBBzB8[eJzBZe<"B? 0-@L8:B4048<0S0K0hc -Lp`P2YP@PG`P$@0S @P 0 0R 3`P +!@ᤥj40 |H0LPD@ ᑥTL@T H@T DDP@@ -,0LPS`(V @P0Q  (P@! 80S 3/@P 00,@S 000VY ``WWY0 V 0@ \ 0-@LP0}P 400 C 40X\e 0-PD@L 0 PR0500 K0h2cc -40L@ 640|t`tPPU`d0P`@10L`@ID<@cc cc 0-<@40L@P6400DP0T0K0hc -PL@a0P 000P i40P %p`0f0 &WV&ā 0-@PL8M4 HKY04 HKD0 00@0 0<0 H0S(1040 L0000 0 K0 -LMp`PU@PPN000P 00c00S0P  x  NN00{@P  Y0` 000 @D0R 0KhccZe@ P/0@-4 030 A30  $@TA@00c -LM`pP0  @P .(K8'N (00K040000 P00H0PH 0 㗛zBY ( -LXT@0/ 0-0L@SPp7K0h40 0-L 2/P 0 00- @ L4/P0 00-L @ 4/P0 00 00-L@ 4/P0 00哚@,A -LM$0P    K KX\e< -LM$0P    K KX\e<%P0/X\e 0-404PL@T00S 3/X@dcX\e - 0LN{BW0!,21 ,/ cL0P0  0  !P P  /$ $/, ,/lc 0 /\eC-DGDG EH@EHFICFCF؆ 0` p 0`0X@`pi@cc-/-/-//-/-/ 0-@L-0 0-LM1K"0`P2KpL8@T 0S80<000@00C@0LT 04 K1K,000KKelc|c\e -L 0S V9 -L 0S O90"S  0S  R  3/*///-0"SP P P0 \0 ^.0SV**T @ P"<<< <$<$<,<,<<<4<4<4</X0 0S/D0 0ST/00 0S//x/ /cc@c -`0LM00p8 40 8p@Y WPP1HS  ! RL BU0  A<0 R<0Y0P -R P00@ X00U0S 40S" 00S 00S QP LH@0p40 W7@(KU0080@00S@U000  0 -LHM0@SP4 0$K4 XKQ0T0 00P0 0L0 fH04 S (10D0 ,0@0 H03080 \0K0 0XKXP0S P 0S400@00'$'$(%(%)&&#&#%")&K0 &Kp`l R0Ѐ` pfH0@2@@0X0@\  0P0\ @00fKc@c -LJ{B -LD{B -L>*{B-/\ `P/0 !`8 0 0 (  , !/ cd dd-/ 0!< 0`4 0 (   !/ cd dd -L M@`p80P00 00@ K< 0-LP@o0 -L@`PR  -L@`PKh -LP`$$00@upt `PbX0 0P0 0V $~001@01\elc< -LMQ 0 @t  Ps- (K\^pDh 00 l d hP ~h0d l0 0h0 00 0|0 00x0 0ct0 0p0 ` 0FS(<(< < < < <V$|0S   0S K7ZdJPHh0S t0xR0D p  BR 3 PE0S 0S  K"PKPP&UV0 V004 `K0 P4!,21 ,2弚d4@PU00 9К 0SK2 0380@BP`0 0 p Psp0@p@ 吚0LBT D@DTkᤚ0@0 T0 H0 傚K@@RU _EU |0S "SL2S DS Kᅚ(1 0`KL0 0K00KVPp0L S dZ t0SV V VK2 @T 6~ ^TxB:h2 @T 6T~ MT 8B$` KK0:/ ~Z NZrp R  QbK0 0+0VH0 0T0 0@0 70K0 0K`KP#p0S d0S t R " ,  4  `   R㸠 RԠ pdRPp0 0p0 ؙK rZ0 "͙ 0Z 6u~0ߙZ ` K$0K3/T h~H@!P lC} 60ac< cXe@cPcccc 0-L,KM B0" X AK !1 0 0 ,2p1  ,2P7P e(K0S~pP 0<<墕(0wS `V `P@` ܀XP P V M11@700ST $@P@ `7P 0 z0S`+P`  14 41x0K0N x0 Y``\`VQ^ 0 \ IoXQ Q  a  0\00 0S 0$S0S 0$S  0P0S 0/PPPK N I 4NԀ 00CS.t<\P =Px00Cx0x0$ 0x000Kh=0=Cc R 0 0 0 0=\e]e0  ă 4,48C8S    / 0-@P`pLML!|3(`00 0p,P$@ @@ @,& 0!03(`000K 4p0,P$@ @@ @&008p40 000'В!2(` 00,P$@ @ @P%008p40 000 00!l2(` 00,P$@@ @P%008p40 000!202(`0< 00,P$@ @ @%008p40 000 00!1(` 00,P$@@ @P%008p40 00 0 00!T1(` 00,P$@@ @P%008p40 000 00!0(` 00,P$@@ @P%008p40 000 00!0 (`0,P0$@@ @Pl%w}``r0,@  0(KiA~BPc{BsA0- @L07H00 00 p-@LMP6@x0S L0S 3/H03/ Kp0Cx0H@0`C,6@'  4K0 4K{x00Cx0u@| 0#K܃K*||܃K)|,x0SL0S 3/H03/0Cx0\e-  0/ -LM`PPH 8 90R 000(@ [G80 S00000 09p0  p0  @0 G@0  G? G`0,@K\p1d0<0s| !s|0 (K\e p-SLMj`@RP,K,@K,1l1 03/@,Kp 0-l@LP@TPK0h0U@( ;HtK0h~\e]e 0-@L0S0000\e -LM0  <00S K0K @ KAPc@{B 0,  -LM,K,( 0 P0@PU 04 K0 IPK PLK{&`pf{0?P 3 KFu KF00  [{#`pc{`V`VpKph;尐d+0 0 N0 QU PEU*UpW/ pY ` P 90R* s{$`p0 $u{ KpK9 0 p K⠍U K]Q Q PUU KGU-00 婐`YP K8ἐYL2`SDCᲐYI,{%`pe0{00S` HY DIY9 4 pLPXI{&`pf{ KpKp0K ,B P0i0 0Sbxz% 0%z0S xz$ 0$z00USڴ0 S S0R00  0 80" pKm@ K PPTp  0 \K0p0PI  p0K ^ 0000  SXwz' 0'z00Sʴ KpK0 0\K⮾p K0 㷌00 0 #448#8S ShFhz"`pblz^ 0Ɵ R0P0 ,Z tp0K㍌I00 Sp0KLŝH0S= R SPK\K0\ KKPP\K`, l1\ K0P5/P,[V U f00 ` 9  jKP 0 0\K;6(e 0u z 0z 0S KpKp0K ,&0 KP@  R y 0y0S p@K Kb@0 d000@0y 0y0S KpKF0p K`9 D6 &33  ?%,0V6 \K[0 \KP 0R6 T \K 0 LP00 0P0T00Rwy `?pj,Kwyky,Ki`p0 )lyp0S 0 Pp\0KP oob@RKy"`pbOy0 S40;P  AD,1 0:DK / 0D K*D0 0 080S00  ,   /K \K,l1\ K03/`,6V 6p  0S  C  C#   ,@K( 03dx `p` `p`x0 K=(KK \ed{B |BPcNAC|Bcv|B|B|B|B"}BU}B -LM0P 4K6 0!S10040K֊ ꤑ0 R00$K 03 HqXq@`VT8 4K 0!S10040K0U/ ` 7P00`` 0 0``0 0`@0 @S `4pK `p0T l《^`0uK0P 78,T Hq@x}B APc\e]e}BACcH= -@LM}PU`4 0 ,K 0"S200,0KG`! R  ,K 00"8S,200,0KQ20S 0!0&`V L7Hp1K R$ 03A0AS 0 0 ,0 ,!0 0,K 0LaRn^`J0$! 7 R%0000S `,pK `0p0 ԉ000 0S0 0 00RT00S `,pK ` p0 0㯉]e@}B Ax}BPc9ACcH=eA}B -PL$Mp,P ^(K4 P0 P H@PP"4 0b,"!,"4   K$KᏌH D?P @KH墌X   @K R \!hO!,21),H  9X:8  " 4 $(, R  H 8P4 '4 4   H > P PPX H 4 '4 ( L R  @#~B c;~BcXe -`0L$Mp PF@P 6 4%P0 9 A (K3 T V1T2 ,_l1 @ 04/@,Y T1Ckv+ 0+lvC0P 0!#㖈꬐ P ,)l1 03/@,{T(C &ᬠ0* S2%P009 5A밖 2 %R 00@6ı UY ,!0L 0 RwS D0 8"0<?6S  2%SR  T0S!PP @ )T0P0CT0u  0 uu  0 u@ P0SP0QT0R0T0 @ W@ 6S#W@ 40@AR3 ,1 00@0 0 %066<K06f#Y 0 <K W L0 @0<K@P. L0 @0 c\enB@R~BnBy~BPc -LMHHr8 ,@T 0 "S00002 00C 01,Tb 0aIu! 0 !Ku0S@P@ 囊0 0PH0届.u% 0%0ucR 0Kpu# 0#P PP0K`0St@P  0 $4"48C8 S  St$@PDt@80(K $!$8(QB( R P PPPKePc~B\e-/ 00-(0,0L@<,00S 0S 3/0000000<008000 ( 0 R0K0hH=$==Pc -L M0@S@P;  04!48C8S* 00S@P% P0 $4"48C8 S  S`0,K4d#dԉ)hpPFh 0  l(K380S VVV`40S 80S<0SP Z,1 X0 EP 07? 1?0<0 Pc]e ]e 0-aLM<00pl@ 840X2 yPP$ 90(G@ > 0 090  0 ,!D0  >nPD00 ?0#P @<04@S3,! >` ,0K!c ,   4 > @>(KPcCc~B ]e]e -8L@`ps1@`p`$Kks\e 0-PL@U0 x0T0 R08 #804 0110 K0h PL  P   4@~B~B0 0 R/0Q -LdM<`p 2@   hKP=!Wh`K$K&K` @\K?> @K;>딈1 `V P(K\K-> 0hK3/PPXA 0P d啉LpTp@T0@D -先p80S!<0  S S Rd|`K tX0S lX`0 :/GZ  z4@T 0@DT WU  dk 剉P p]e cc -80L@S0P S0PPX 00R0Sx` 0pp0彇0  D@8/P0000`0PS404@@B$P]ec c\ `P/0 !`8 0 0 (  , !/ cd dd 0!< 0`4 0 (   !/ cd dd -T`LPUF@@8堈 @ D0PP0 ccB B -40L R   Kh c]e]e -LdM"`X2P pPK @<!> JK3K4KP`K= :K=n2 `V /0PK3/PPA` 0P  dxKsL`T`@T0@Dt@cU \0d@TaSJ XG `08/ xKm(K80S"<0 Y S Rd0dK 0 @X0S 8`0 X@c -(qL@T 0@DTP+T+80S0` S0``X0PPSPU 0㼀0彄0 D@3/0PPP040S0  004 0U00 4@墄deX0S@hD|hlyhc]e c L-L<`="B]e>=}B?="B\@="BA="BA="BXB=#B 0-@@Lmki gecK0h_]e -PL M :P@@K0h 0d `` _@P P }HM@@ `@P  |0>=B4]ebBB8]e]eB 0-L@0P2P 00T@@@00B<]e -LM@PpK  ` `6 K\ 0p  0 ` 0  0P ?o20S 0S$4P0(K<]eDd A-LQ:G=G=G=G=G=G=G=G=G=G=G=PG=G=G=G=G=G=G=G=G=G=S S!00S)P S SP00S(0 80R,00S 0CS00S<]eQ Q QH00S  BR , R00S//<]eDdA QH=H=H=H=H=H=H=H=H=H=H=H=000S/00S//<]e$0000S//@<]e A0-L@ Q\I=I=I=I=I=I=I=I=I=xI=P@D T00S0T4P X0P0 SS00$00S000S<]eQ Q /0CS(00S/00S/<]e 0-LDM (00@Pp!$2,p040K 0P$@ @@ @`40,K 0(0!1(p00 ,P$@ @@ @ 0'㌑!1(p00 ,P$@ @ @ 0!40K(p ,P$@ @@ @1 00!04K 00(p00,P$@@ @ 0'(pp4K!0 ,P$@ @p @s 0 ,0'0!0P($@ @p @0 _(K[BҁBKBE=BwdB 0 /<]e 0-xLt+}p@ hh%} \\ } PP} DD} 88}0F=}B<]eG="B J="BdH="BI="BH=#B 0-8@L$}"} }}}K0h}<]e -PL M :P@@K0ll l0 0` ]@P PzH(@ ]@P z<]eE=7BBWB\]eB SQ-L M@ h00S \ LQ }{P0Kc 00]P0[SK`]eSBB -L MQ@ Q \ , | R 0Q{P0Kc TT]P0[SK$  R 0;{P@`]eSBB -LMQP@  RS S S``8] K7gpiW@yzT%#PK@nzT PhzU#P`]e -LM 0K N]P [ KB7B -LMpP`K` 000@0 40K\0 0`@ 0 0 000 0 ?oP20S 0 Q R 00  (KP -LMpP`K` 000@0 30K\0 0`@ 0 0 000 0 ?oP20S 0 Q R00  (KP -PLLM  :P0080 8(K0D$00<<H\0P80  (oy@ T @@y{ t{ o{ 0 (00`p!34K00 0`,p$@ @@ @u40,K 0)0!|30 0,`(p$@ @@ @a' 08ß8!0 ,`(p$@ P @L 0!20<4K0 0,`(p$@ @@ @7l2 00!20<4K0 0,`(p$@@ @! 0PP !04 K,`(p$@ @ 0!04 K,`(p$@ P @0 0 0!14 K00,`(p$@ @ 0!|10<0 00`,@($@ @@ @ 0 !0 4`0,@($@ @ 0 (00!0`,p$@ P @0 P@Pzzz [0P80 XixˀBBl]e B`]eDP=}BpO="BN="B[BҁBAB|Q=sBwdBdR=IBSBK7BiB 0-L@M (00@p`\!0 0(0K0p,`$@ @@ @Pg 0!00(0K ,p(`$@ @@ @ VX0 00!H0,p(`00$@0@ @P0( KB$K[BҁBBwdB -0PL M S @ 00\ \\Z@P LwHK,@[@P wꣁBB]e؁B]eB///0  R R0/t@R@- 0@A @R A@BT R LP^-@ A0@S0 AC^ 0S BPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@0 P//8@-@P-3-8 -@Pp'LM l@  `08 00CS )v<:0<: /P0010#21Z 0 ?Vpas'd"0&1/` 0@` p0SR"0/!0/)]  0 v<:0<:` P)=00 SZ0R70)v <:0<:1PC P!:h0:`1 p`$p`YX R00uv <:0<:1PC !:P0: pW *R R `:S 0)Tv<:0<:VpPUt 0< (K S 0 0)<2f'CVB?B…B@@B DBR*0S A/ -Q*  @p@-Q @ \@0 SQ00@p0S @`CPUT C @PUT0\00p^ PL_UQ @A,à0@ 0@ 0@ \\Q PAQ Q 00000 00@#1 2 /UUUU3333 @-+/ 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00u+ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/QC-Lß0 B0#01 #R" b 3R @@ ^0&'" 0NS 'Qr#S Ÿ 00#01R #  Ƞ ̌ q ̌ , , ', q , ,Ġ  ̌   Ƞ ̌ q ̌ , , ', q , ,Ġ  ̌   Ƞ ̌ q ̌ , , ', q , ,Ġ  ̌   Ƞ ̌ q ̌  , , ', q, ,Ġ ̌    Q00## A#\#4 0Q<1   G@ -L M0@R(@K `*RP3 R$ P* P?R% [R ^RPpp P\5 ]\E R -\= Q`[R9 ]V7 RP PP0 KP 00 R 0Q p P P P p`0SWp @/o"RA-p"@(@0!!p"0NS(1ឃ!Q Q Q '&' `0@D4`P8<""p"TPN0x'0t'[ -L M@ 0Kc [-K 0-@PL $Q-@ (- 0"0A -L,M@@p(0<0 0P80 0H D0 0@0 H0 0K/-00(c(#"$ c$"<0 5e3# <#0@  p  "06f1#f+#808@W0) 00#08D 0D  @W<H qh.ɠ,D <L .P PD', Šb,p,p'pL< @c & !c 8@ 8 pH@P 000 ` 0` 0 00p0p 0 P0P 00(K@ 8 P`tP` 0A -L M`P@) $(pQ ?PU5  08R(!)8 b8, `,5P(qᜀ!(Kb8"P#4b4# (0 p,Wh , K@R )@ b,8 8  ,0(0 -RLP`- ? @p`Z(: ?,"(J` p ((?WH? *3ᒣ$T  ($,A!,A"" @pG@ , " @pG?WH ` 0-@PL $+@ (+ 0"0A J 0-@PL @ (+ P+ 0$$00A -LM@ `#K v%K!&K!'K"$K"&K#'K#(KPP 4K+K3 0D@ ! D @܈K D K)@(D @ K !K K 0܄K&KK$KK 0K  ! 0K<08 `#>20 ">< 20 80ԊK?"10 ?8 "10 *K)80(< <30 <8 30 +K " 0#$K܆K%K " 0#܃K K&K܅K %K " 0#܄K 0ԇK 0V%K&KK'K'K(K  1!0 " # #,kK3  1!0 K`& p'   "# -#3p0  0 KhKlK0`& p'1hK`t `piKhK)K`& p'0ԇKhK() L0H #790 "7L  90 "9H mK70 "9L 70 .Kp'H0`&L ;40 ;H 40 .K "0#dK$K 0`p&KgKdK` p0gK`&p' 0`p` 0 0KT0P K#>20 ">T 20 P0oK?"10 ?P "10 /Kp'P0`&T <K31

 0 K  0K ! 0K!! 0K!"`p"#K 0K## 0b#(K&K'K$K&K$K$K%K&K#K%K%K#K]$K&K$KK$K#K%K%KeK#KpA -@@LDQ  PUP`%  0pRPQp b)H )@ )KhR Q b)p p )0P0 -L MR@: @ ` ZP : ) 0#K$`p #0##K!#K0d $P J  ` PpG p#)Q0`p## 0d $(K$ 0 QP$pGWF0#ᓢ%U  Pr)Q m)$ 00 QP$တIY F -`PLP =@ @@T ( 0-@PL @ (:) P( 0$$0AYT -`PLP @ @0T ( -LM@ p lK)p0o00 p000 p000 p0 00 p000 l0c$c\0 0 ?   "  "h b`$`  "  *    db`$`   ! `  )`D` n!@, @ @$@\ꝉjaa  " X (M iaa *  .T 䍈dAbb,  P P)Pbb, L  P%h a$a$ P]  n( @H !bDb,  DeQ .lDl  `@% "@@@$ nDn - a P< *͌b!nTn! )8lA쭊`T` "t (4ꝉjaTa $x  .0 鍈bTbl |  @ i *P"  P%t  ,P%/  h) " "x@  "/  ͌n "@(  "|@P! "/ @ @@l .@$P @$P `@$O@ P@,@00 @$ "@0 -#0ap .0p'M.;b!P pP`!`&,tP}dA,P,ϠP`Pm xP P P"P%P唀gq$!|*]!!  fa' ")孊 " "/@@eQꝉ@$@$@$O@ &@p (@pj鍈@$p@$@$O@ p%@` p'@pt`i}@$`@$@$O@ ` @*@$`P@x`PhMP%`P%P%_P `P)P%` |`tPgq䭊P%` P%P%_tP t`P(P%` `xPdAꝉP%`P%P%_xP x`P' P%``|Pj鍈P%`P%P%_|P `$Pp `&P`pimP%tpP%P%_P p*P@p'Pp@h}@$P@$xP@$O@ P)@ P%@ P@$fa @$|]. @$O@ 删@(@$ @嘠gq ) )M, )韠ጐ &*eQ .䭊. 堀'.`t`dA,`,Ϡ `% ,`px`jp `͇  ` $ `PP Pn!|P!P! P* !0@0l@ "0P "0 "? 0   0 @06`p@ @ -@$P@$P@$O@ @pp@aP@}@@.@$@$ PPt@b! ` @.͌@$@$ ``gqmxP P%P%P P Pl 捁|tP!P%P%t   tfa  .! 蝉!/x x h p  " " "/|    |i  ͌" !t !/   n` -@!@$x@$   l p⍈! | ௠ pp b!`! p}   ``hP`!m   PPgq  P]@!t@$ @$䟠@@@ @ faM"x ! !/   eQ   "| " "/    dAp - . . a` ,,   b!PP͌ P   PPn P@tP@ @$P@$P@$O@ @@@l p.00x0p'0#``,0#`&0#?0 `0 p|t }h " "P  "/t  x `yZnܼbm" P%gq!!/x   | @(@$ " P] "fa "/|  @ " M!t !/   '! "eQ "x "/  & "pdA%* | - ௠`. a  $P,Pb! P͌ P  P! P@@tPn@)@$ @$O@ "@ )@ l!x@ .(!@`!@ @ p, p' "|@鍈i "@ ` `& "/@p@}h.@P)P%.@.@ `@mgq,@,,Ϡ@P@]  @( @$t @faM ) ) .')xeQ䝉 ( (,Ϡ&p(|tpdA鍈 p'ଠ p'p'`p% p'x`pim !!P $!P|h]! " "0/0)0#@@p0M@0Pp0P0fap0`0p0 0 p0(K000,00(00$0 0 00000/#EgܺvT2 -@P1L00>! "0%?0 0%0?S`p @p` #?0S: EKh#@p -LMP@0$`KS  !1" 0S xpp0~? S U 0 # !1" 0SK ꋆB0 A0A0C,ĠCCCC R/ G-p0HM008 4Q 0Q <0 @R 8ȟ0 p 0%00#0 <8 $! a@  $ , ǁ  #  " 4b% 0!00#p0<, ! pa " ,$pǁ #  "(p b% 0!00#,p0<, !0a4p)NON " ,Pǁ #  " 4b% .!4 ğ ". xğn  #, \ğ$ 0!0# 0@ğc> .!$ $ğ ",0ğn  #,<#Ď  0! 0#0#c>  . " *,! a #,,|ā0" 0#0dc> !. H*,!0a #,ā0 .$0c=  *  b+) ) Ł (00c=  "0 \b+ (@  ,(Ł0 (p0c=p p'  pb+ ppp'0P3 : L?0V FKh >@P 0-@PLMK " !? 7R8 bx b8K  X K0h: 2 A0@-@$0`( "$`T"a! 4a# 0 -P`8 `#T0.p@L`T%0 (0D PD 0Dd0P00DD0D`V@@p@%T]e-M Ѝp@-@ P` !LNp( !@Ap RC/A 0\R#R! R/ -`LpP@# *ⴞPP @  ȼ@P ɞ0@P0W H0W V@`ḞV`T@yaratcid -LM0p14a@[ 0P 0P V`:P@ ` 0*K.P0! *`PP ᗽ`P 0(~K$ cyaratcid p-LM@@@P@`T:Kp0 0` 0  WB(Bc0 vyara0 Pc0 mtcid0 PcQd/yara00PcQY/tcid00Pc / z/ 0-L@PP0 0PP0tcid 0-L@P 0Pt00loob -PL`X@PP  P  0-LP@ X0P 0 P P/ 06 QPrbmn 0-LP@ X0P 0 P  P 0 P0rbmn -PL` @PP  P  -PL` @PP  P  0-LP\@: `0P 0 P P 0 0 QPrbmn 0-LP9@ X0P 0v P u P 0 P0rbmn -PL`4 @PP  ;Pa  -PL`, @PP  'PM  0-LP@ `0P 0. P- P\ 0c 0!QPrbmn 0-LP@ X0P 0 P  PF 05 P0rbmn -PL` @PP  P  -PL` @PP  P  0-LP@e X0P 0 P @P 0 P0rbmn 0-LPg@E X0P 0 P  @P 0 P0rbmn -PL`b @PP  iP  -PL`Z @PP  UP{  0-L@P $0P00gnts -PL` @PP  /PU  0-L@P $0P00gnts -PL`@PP   P/  0-PRL@ @# 0!P0/t AeA0@-PäP P P P0tt@L\PDT\\ \ \00P0\:$$ P000\0SNP0T0NUT:xx0S0 -`LDM @PU0<0 00<0 0 S S S|=x=@0 0SJ  @ RcPP@= Y0J"@ @0 pU0pSpW8U &K080 <0 ` P40 Hp Dp <00SL0 j <0000 <0 L0=S *S :S| 0 0S0  <`L̠   S3"P% R0@0CPE08`p S>03P05@2 U *00J  @ b@PP U< 3 @ 5@2W0  4P<PQ0<0 8  U8 4505@2 X,p4 <` <\40<S P U>0305@20 0RP0(K Q* DQ'R0@0CPE08`pp S>03P05@2 U * 0 @ J40 b40@WP @ P U50@2`P U50@2` P< 04 < 4 0A P0p 8p  D L0bSR fS FS@<0000 <01 A a>0 3P 5@2 U *0`0J  @  b@PP U< 3 @ 5@2W` b 0B0"!0# 0 00V 3 "R' X @pH0`FD0PE00 0 S>03P05@2 U *0`0J  @ a@PP U<03 @05@2W` y4 P<R00SH00< H0 D00 UD0 405`05@2 00 0C40 00000 0Sp,040 X R+ 4 R(XH @`FD PEp0  p R> 3P 5@2 U *<0 0`0@ J @ a<0WP @P U05`@20 P U05`@2408 P<S  RH00< H0 D00 UD0 405`05@2L0FS 00 B< 8,0p40 0 0S0 80 00<0 ( 0S: <0S7XH0@`FD0PEp00 0p S>03P05@2 U *0`0J  @ 03P05@2 U *0`0J  @ `@WP @P U=0305`@2&KJ @ `P80 P U`@0V00S3 0BV):XH0@`FD0PEp00 0p S>03P05@2 U *0`0J  @ `@WP @P U`8p %#038p 505@2,040 P U#03050`@280 d0RL0=S. 0S8 0CS5X @pH0`FD0PE00 0 S>03P05@2 U *0`0J  @ ~`@W<0P @ `40 P U=03`05@2 00 B< 0 0 S0 80 0P U=03`05p@2 0S+ <0S(X @pH0`FD0PE00 0 S>03P05@2 U *0`0J  @ :`@WP @*P U805`05@2p00P U805`05@2<0000 80S&KJ 0 `P0P U`@080 0 `80 <0Z8p ` PIL0FS080 $BFBB 00-LM@0@zK0/ -P`L@ ሾP -p-PL`@ zPKp 0-PL@ DlP0 -p-PL`@ ^PKp -`pL@P NP -p-PL`@ ?PKp00/Tc0-P@  P 0S RP0/P*0    PP0/0/R  0\/S/ --LM 00S ^ Ke@-@ / ?!BCo  @ 0-,LAR@P 00 000]e A 0-@L0P LS0]e P-L 0R ,0QPoeA 0- 0PSL@HK0h P -P K0h0B -Lp@P 2P`P-@>` P 0-LP@P P0 000 -PPL@ l0Rp@P 0000⭖`P0Q` AeA -PPL@ T0RH@P  ⋖`P0Q` AeAP/ 0R / AP/ 0R/ A 0-@PLP0 40R YPP 0Q AeAP/ 0R0P// AeA -L M@P` K?o 2Q0S0S P 0Pp"P  D0R S0 ( ^ PP / AeA3?A -L M@P K x0R`B PPp`P 08 S0( ] P`P  AeA3?A0P- ?o, 2^0S0S A P-L ,0R 0Po AeA -LM$0pSP ``V`$0K P $♕@P 00$  0KP 0$ S ᨕK` (P 3P$0@ 0B 0S/-S0-S0>S/00// 0-P0L@Q zP00< 0 P0 0-PL@AQ0P0 -@`PL 0S<P P >Kh PP 0-LP<@P /P P >P K0h0 -@`PL 0S<P P /P >}P Khv sPP -@l`lpLPAQ<Q >Q &Q 8pPOBBB D0-L@^P ,hP K0h90( A B (0-L@wP0K0h(.B 0-L—@P  {PP0ᔔ@0,0 0ꋔ -pQL@P b0 @ R6" <P0 R !R -R E/o"-Q R00P/R>PEU0S0(0 ` P 0B0S<300>R/R)0FW0 S P0/S0P$0(0S0$00>S0 >S0 000 0P(PR`0S  0@0S<3 P   0@0S>300=P00S A 0"Ss0 S 0m "P  C  >Rd00P ]P0Y0@- PP0<P8 &P @aT@mT!@pT2@;T/Q ^**lT'tP";P<tP;P>pToPsP ;P'SU00gT qTuPoPtP;P" Q-L o p-LIM@IKB`P R PK?KPJ/KMKIKZP Kp0 P  PP,1 MKIK(Q5/04a  MKIK3/P4101  `K?KJ/KKIK6P0 41 0K,1IK(Q5/P 0141 A -L@,PP7 `p@@ 0B0S 23 P&@<R P  P0>SSS D{P@@HP @@B%B4BӒ -LM0 IK0a00S 3/@0P P U 5/0K0 IKPK0KIK03/U` 5/V  V Vp01(1 (Q00S 3/`0@ P T 4/003/0JK03/P T 4/h p -LPY@PP PPj$0SP 0` P P PP  `PxP.BBP0/ -PLJM8 IK< U0`0~K8100 00RP P xP %P PP 0  03/P P PVA\ A6A 0-@P@L 0 0 0K0h` -@PL 0R@ p`PPH@ 0兑ᅡ   0兡 0P 00U:000\ A 0P-L $0R00P   \ A 0-@PL000K0h 0-@PL ,0R@P@0\ A -@PL` H0R@ P0S@#*W@\ A 0-@PLyT $0R@@0\ A -PPL x0R|@Z`0S pW`@ 0VpP `\ A -@PL` <0R@ P4 @\ A P /o00"\ R00\~/\ A -LM@Pp 2R0 0 K)PP @ p P-(0S 3@ni`P 娖0Q>PP9嚖 `,V <V VP !(KGPP h `<742`P q1v`hV P U` 0080 < P80S0C00 ! 8 0` 0p0000000  E@"B!# 00 0a 00 1 pP\ A`c=`e`e`eaebe A -L@TP`p 8Tb00 1P V0 $Kk)M0P- ?o42 ^0S00 S\ A -LM@P`) 0R%P0 K9P 0 p`  C! 00C0000 PK\ A0P/?o( 2\0S/00 S/\ A0P- ?o, 2^0S0S\ AP/ 0R/ A0P- ?o, 2^0S0S A P-L`Pp@ @T P*  0 S @  S@ 000 0  00 0 0P @ 0-LP@PP PGP00 03/P P P -0LpS@P =`P $Q`0PH `KhVA 0-,LE@P 00 000pce A P-L 0RR o 0-@L0P ݊jG0pce - 0@SLPp,KosPS  `LVV)0,Ko 0"!0 @Yq#1BP/?o4 2\0S0SP//L A 0-@PL 0R@0L AP/ 0R/L A0P- ?o, 2^0S0SL A 0-0L@S $0S 0 09B00C0/  0P0S 00// -`PL &PP@PPC@P DppM0 P`000U *xdel A 0-L@K0h P-L`Pp@ @T P* & #0 SS@ 000 0!0 0!@0   @a_ 0-P@L@{PP0 p-L M@P0 S R ȇ`SDKp1CaP` 00 P 00C0`xde -p PL`ႇ@P U  !U @p ᔇ -LM@Pp` P00K0H  P (0S @$ @0TP h2A> 0-LP=@P ,00$000P00 00L=> -P`L@`0SKh!PP  U 0RpP 00 0 PP , 00C 0 0SPP0 03/PP P Ph2Al A 0-0L@P 00Q 0 Q00000P 0-@P@L 0 0 0K0h?vu -@PL x0R@ pӿe`PP '@ 0 0P0U:000l A -LP000 0-@PL ,0R@P㣿@0l A 0-@PL ,0R@P㏿@0l A -@PL` H0R@ Pz0S@#*@˿l A 0-@PLeT $0R@@ᴿ0l A 0-@PLN000K0h衿 0-@PL>@@@┿0 -@PL` <0R@ P(0S 0@A|l A -@PLP` 0R@p0@0S@\ 0 0a000@l A -@PL` 80R@ P@7l A -LP`U@p P00 Kh -@PLP 0R`ᮾ0 Kh 0!qP0S 0C0000Kh 0P l A0P- ?o, 2^0S0Spl A 0-LP@PP PPP00 03/P P P -0L`SP@ jP $0S Khh2A -`L@P ᖫP 0-PL@ ቫP0 -`L@PD |P0-!00!0!Q00 000000 0#0, 0#0000!R0Q000! 00000 -@`L1S 0P&T1   R   R  S !  1T#   S Q Q        0T@``@!R  z1!000Khp000 0/ -`PLpU@@ @E 7/P Q -`pPLUV@@@F@ @E 8/P `Q -`pPLUV@@@F@ @E 8/P `Q - Pp`@LW0PR0 0Q1  G  9/P  q\0R@@ppTP     0000W @0@0  0!RDo 000-Q0\ A" 1S  !R  C000S A R0 - LP`@T0 \ R ^  0 TT 0^00KhR"/o"!T0#00#000!0000000!000000P0T   pP`pp pT p^ ^3 09 T&p00 00000, ,0 0 0000000 T0W00p00R0000 0000T  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/ 0BR"S-LM@0J0`P pE UWpp-U`Pp +UP`00Ue00XSH00 C R A BR@P@` ?#K K?0K0 E ^Pa ERWPEA ER'7PET$#KKQP00\00S4(0, 400,".0KP0T@0K "K r0Y"KK$KY S FT @ AB 0BR"S-LM@0I0`P pE UWpp-U`Pp +UP`00U00XS900 C R A BR1P@` W?#KWK RB 0#Kl0K0 E ^Pa ERWPEA ER7PET X SFK$KT@W#KK P0:#KQP00\00S04(0, 400,".0RKP0R0!#KQP00\00S4(0, 400,".0T @ 1X"K 1 AB -0BR"SL@0||H0`P pE UWpp-U`Pp +UP`00UE00XS/00 C R A BR'P@` S 00E \Pa0ESWPEA0ES7PET P 00Q00SP  PT@  Y`FYRT @ AB  0S S/P/$(0#   @// / ////H-M 0ЍH-M 0Ѝ -Lp`6. 0@XP0@ -LOÏM` p!" PbK#0KP`$p$ 0! R0$K 0RR! R/P/0@ 0A0Su*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/ R.0 \ B BѴ Bôr- B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@@t@P B@@P B@@P R@/ R/ R Ѥ ä/-\{F ,DP`pL%T\&dl't |@P`p B RR,DP`pL%T\&dl't |@P`p R/ RAn,D R L@Af,HP`pH%XX&hh'x x@P`p B RR,HP`pH%XX&hh'x x@P`p R/ RA:,H R H@A2,LP`pD%\T&ld'| t@P`p B RR,LP`pD%\T&ld'| t@P`p R/ RA,L R D@A /R Ѥ ä// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/ -pL@Q`P wP `P10r 0 P 0-L@\& ^ QRS  T00w0LQ R S "  T  00 0 -LMQ@P`pW Z ' 0yZP@ R[WPZ @0G Z 0 @g@Oo@d8D o?oL\Z 0  l>4L4 00 5 N04P? ᮏ0<0 080 奟PK /#K R 0\@4P 0 #K 0 Z@P(KW30B Z00 V f`oo`f56 f0F00 140 #K@Po?oA! \4p  \ @l4>4p 00 5 D@l0@>40 000 5Do?oL\ 0 \#K0@ @ l14L00 5 AQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /~-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ -L=뢇B 04 8 < S $S $S /T S $SQ 0/Q 00///PP 04 8 < S $S $S /h S $S $S//Q 00/Q 0// 0-PPL P 0S 8⪝@P W8K0h蠝@0M/ \P1M/ J 0<P   /  $#cD#c~) 0-@L0  0:00 0-@L0:0K0h -LMp @R (  RQ8 .     0   PUW   RL00 0000h 0R010 0! R!100Q0;SPU  $1R00$1`V 0`R00 0R010 00C 0801 Q cʣ8U(K HR40 ` R Q00000 00 0  0pQ010 P ` P40 0@0 0 P$D0 00< 000 D0< p Q00  0Q010 V` 00C 0 oP< J C^D eC^@)PS*΀ L 0 L 0 * eߜV D`y^Q< ќ< PCP 0AcD <0 l<04 I0BD 40 0SK000< 000 y< 0Q00  0Q010 V` 00C 0  2 0R 2200 O*؀@ 0 @00Q*ᄜ<D 'D <0CD <0p<0I400C40 P0CSP@ R5 PP40 `V<0 崢`P<0 " "* N<  04 N  0Z <0΃ L 0 L  0 0)00Up0 00S0``0`0 0P0 00S0```P80Ҽ d c -PQpL`{PW@A0d 0U00 p` P P #RH LQP\ AV|  R UX RQE ` .\PRp P@Y.YQE>XPP PAPEU PAPEU0L \ P 0A0CS00L-\ Sᒛ@ALX0 0PEPR.\p QR0 B  d -`p@LM |PK.K= .L`K8 .4`0K :KFA -LMPOK( pwK{`PV T60S H60S 0I2 0Y0K?K"lP ,1" Qp|:pWE( (wK0(K K{K  Ku P uP 2[S 2[0S 850S  .kK%k?K:0S 40S  .kK0$0k?K:DwK(C "`pb(4]Kx |1 _Kd PP1 0 R 0S 840S ?K{/KKK:$0 :  P 30S .kKm?K{/KKKk?K#:30S ?K KKh#0xɗ1[S @30S ?K{/KKK #041[{K_KS1[000C?o 2  2 xP 20S 20S{ 0 KK"0]2_/K((CO_KOP`20S 0 KK@"0\4:wKLCt!R 0 ⃡ 90 00 S 10SG  .kK0 KK9p0J0pk?K! :3200000 0IVwK2SB 0tat2 {1d1b 0SSDO{roKkK a ]JK @X0KKiK000KIK!>K00 2P 2 x{H0IK( ,1 {?KKK \$c#cArd%c:@A#AdAAAGAAAA#c@c$cP#* -L4M%,22,2ElKib$UA4P4'N{b<7؝.59E#kUtwA'1vi=녮늖냈4jypd 6AE3E#t4(J< &4 R4!:&SR 4$Q% 54$Q% 5SRaEx Pi{Wy S 84D^n뜼>w<{w뒼0  08S7=j% fU&[< 3S .&40040H&U 3AO?IU&`n뇇np*&K6Y(b0# 00 0 bP;byԄ z 'w~t@"j@2p"00c0 0JP匒,fNP: F7000X2 SRL"    H$7 y$K<D A<0唐Y y0 y y0Z 0y8es1LK<K#KKPD04 0CS0X?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_le>f> m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    o p 8q q q L5|r 6r L5lsllsrasrror AAAeAAeAAeA@AAPAA`AeA_MAAP  AAAiA@ AAP AA#A(A ,A(A0A(A 5A(A9A>AAA>AEAJAMAJAQAJAVAJApPZA_AdAhAplApApPuA_A6ATA6ATAp zAAp 0AAp `AAp pAAP BAP AAP @AAP PAA- Y4BAAA AAAAAAAA @A@A A@AAAAAAA0 AnA00AnA00AnA00AnAAnAAnAAnAAnAAnAAnA AeA AeA  AeA AeA AeA AA ABA AA $A(A $A,A/0AAo3AA0/AAp 7ASA<AAA@DAAAIAMA@QAMAVAObA\AObAcAObAjAObAqAwA{AwAAwAAwA YAA AA @AA `AA BA AA AA AA AA 0AA PZAA pAA AA AA _AA AA.AA AAAAAAAAAAAAAA AA0AA@AAPAA`AApAA AAAAAAAAAA AA&A*A/A*A 3A*A07A*A@;A*APJB*A`?A*ApB*ACA*AGA*AKA*AOA*ASA*AWA*A[A*A aAeA iAeAAmArAvA {AA0nBA@AAPAAAAQAAAAAAAAAA AA0AAAAAA AA0AAAAAAAAAAAAAAAAeqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0edeafdfafafdeaeddaiadbibpmzsdepeAeAAAeAeAAAeAeAAAeAeAAx`A| | x97_bus_dma_busaddr_to_paddr!A "A "A"A""A0"AC"AX"Am"A{"A"A"A "A"A"A"AdB"A"A"A"A#A#A#A #A#A#A##A#A0#A,#A5#A>#AF#AP#AF#AY#A`#Aj#A`#Ar#Aw#A#A#A#A#A#A#A#A#A#A#AVA"AT>2PVA"AT>2VA#AT>2AVA#AT>3VA#AT>3 VA#AT>3pA#AT>3qA#AT>3qA#AT>3qA$AT>3qA$AT>3A$AT>4D $AԀ>4D &$A>4i .$AT>4`Rf6$AT>4 i <$A>4qAD$AT>4TrAL$AT>4TtAT$AT>4TtAi$AT>4TA~$AT>4T A$AT>4TA$AT>4TPT$AT>4T`A $AT>5TE`A $AT>5TE`A $AT>5TE%V $AT>5TEWV $AT>5TE i$A>5TE $i$A>5TE0$i$A>5TE ,i$A>5TE0,i$A>5TE .i$AT>5TE0.i%AT>5TEAi%A~>5TE!i%A>5TE !i#%A>5TE)i%A>5TE )i#%A>5TE-i*%A~>5TE -i#%A>5TEAi5%AT~>5TEAiC%AT~>5TEAiQ%AT~>5TEA _%AT>5TE A h%AT>5TE`A s%AT>5TEJ`A %AT>5TEJ`A%A>6J`A%A>6J`A%A>6ZK A%AT>6KPA%A>7ApA%A>7AA%A>7A/A%A>7A?A%A>7AA&A>7A/A&A>7A?A&A>7AOA*&A>7A/A7&A>7A?AE&A>7AOAS&A>7AAa&A>7A@Ao&A>8A0A}&A>8ApA&A>8ApA&A>8AA&A>8AXV&AT>`A&AT>XV&AT>?A&AT>@XV&AT> A&AT>@X/V&AT>&A&A&A&A&A&A&A'A'A 'A'A'A 'A''A.'A5'A<'AE'AN'AW'A`'A&A&A'A'A 'A'A'A 'A''A.'A5'Ai'A&A&A<'A&AN'A<'A'A'A 'A'A'A 'A''A.'A5'A<'AE'AN'AW'Ao'A`'A&A'A'A 'A'A'A 'A''A.'A5'A<'A&A&A&A&A&A&A'A'A 'A'A'A 'A''A.'A5'A<'AN'A&A&A&A&A&A'A'A 'A'A'A 'A''A.'A5'A<'AE'AN'A`'Ax'A&A&A'A'A 'A'A'A 'A''A.'A5'A'A'A&A'A'A'A'A'A'A 'A'A'A 'A''A.'A5'A<'A&A&A&AN'AW'Ao'A'A(A(A'A'A 'A''A.'A5'Ai'A(A(A&A&A&A&A'A&(A-(A4(A 'A''A.'A5'Ai'AA(AH(AO(AV(A&A&A'A'A 'A'A'A 'A''A.'A5'A](Aa(Ae(Ai(Am(Aq(Au(Ay(A}(A(A(A(A(A(A(A(Ai'A&A&A&A&A&A&A'A'A 'A'A'A 'A''A.'A5'A +AH +A +AH +A, +A+A, ,A$,A, :,A[,A, l,A,A, ,A,A, ,A,Adata_abort_handlerbadaddr_read@````` ```pmap_map_chunk c  6A*6A46AA6A\6Al6A{6A6A6A6A8A6Az8A6A6AES-6600 q  T!\!!؏!ԙ!L!L!!h!?A?AeA@?A?AeA?A?AeA?A?AeA?A?AeA?A@AeA@A"@AHA3@A<@AeAM@AV@AeAg@Ap@A@A@A@A@A@A@AeA@A@A@A@A@AeA@A@AeA@AAAeA@AAAeA@A*AAeA;AADAAUAAZAAcAAtAAyAAAAtAAAAAAeAAAAAeAAAAAeAAAAAeAAAAAeAAAAAeABA BABABABA0BA5BA BABA5BA>BAOBA5BA>BATBAYBAbBAeAsBA|BABABABABABABAeABABAeA@ABAeABABAeABABAeA CACA$CA)CA2CA=CA@)CABCAeAa?AKCAeA\CAeCAvCA!zCACACAM@ACAeACACAeAsBACAeACACAeAsBACAeAsBACAeAsBACAeAsBACAeAeACAeACAeAeACACAeADA DAeADA&DAeADA7DAeADAHDAeADAYDAeADAjDAeADAsDAeADADAeADADAeADADAeA@zCADAeADADAeA@ADADADADAeADA EAeADAEAeADA,EAeADA=EAeADANEA]EA bEAkEAeA|EAEAeA|EAEAeA|EAEAeA|EAEAeA|EAEAeA|EAEAeA|EAEAeA|EAEAeA|EA FAeA|EAFAeA|EA/FAeA@|EA7FAeA|EA@FAeA@|EAQFAeAYBA[FAlFABAqFAeAvFAFAeAvFAFAeA|EAFAeA|EAFAeAFAFAFAFAFAeAFAFAFA\CAFAeAFAFAeA GAGAeAAA$GAeAAA5GAFGAAAKGA\GAAA_GA\GApGAyGAeAGAGAeAGAGAGAGAGAeAGAGAeAGAGAeAGAGAeAGAGAHAGAHA$HAGA)HA:HABA?HAeAPHAYHAjHAoHAxHAHAoHAHAeAoHAHAHAoHAHAHAHAHAeAHAHAeAHAeAeAIA IAeAAAIAeA -IA6IAeAl!d_!!!l!d_!!!!l!d_!!!!l!d_!!!\!h!!L5L5̭!L5763L5IAeAIAIAeAIA@IAeAIA@IAeAIA@IAeAIAIAeAIA@JAeAJAJAeABAJAeA+JA@0JAeAUJAZJAeAJAiJAeAJAxJAeAJAJAeAJAJAeAJA@!Թ!@!!! !L5@!Թ!!H!!L5763L5P!!!eAeAeAeAeAeAKAeAeA!0!!"""L5!0! """L5763L5eAeAeAeAeAeAeAeAeAeAeAeAeAeAeAeAeAeA!!$!ERROR TIMEOU DF@8"7"@7"<"@"/"D/"@8"7"2"2"<"L5763D/"ORAqRAQAQARARA#RARAQAQAQAQARARA#RAx>5>>=>x>=>>V>>V(>>RtAWtA>>rtAivAV"A@>4>P̛>>vtAvAAX>L>>ؗ>%  8  @!!@! ! #/ ''w0 g'' c0c `uAivAV"AHTguAsuAz|uAuAzuAuA uAuA `uAuAuAuAuAuAuAuA@uAuA@ vAvA vAvAivA?yARtAWtAl.vAivA@vAHTvAivAV"A]vAbvA`uArvAvA@IeIIvAvAI0I0EuAvAvAvA@&II  IvAvAuAvA@"I0vAvA%vA-/vAvAvAwAvAwAvA'wAvA;wAvAPwAvAfwA~wAwAvAwAvAwAvAwAwA")wAwAuE o@o @o @`uAxA xAxAX|ArtAivAV"A@& 3BI@ xA)xA @(#0VxA`xATB xA-xAFAxA2'EyA yAyAyA.yAGyAOyA`uAxAZyAbyAoyAbyA`uA yA`uAxyAwAyAyAyAyAyAzA zAVVwhvA'zAvA;zAPzA\zA~wAqzA~wA|zAzAyAzAzAP8soo P q q sMkltyAyAtt3zAzA hCzAzA h&FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~dBT|AX|A\|AHA`|Ad|A#####L5l#L5H#6#L5}AAAAAAAAAAAAA AA"A*A5A=AA@@d@d@d@q @c@c@2@3@ @ @?@ "@D@Q2@e@XBBp@LT@LU@q@m@m@m f(pt""(4I4b '  <         )3      @@@@@@@@@@`1l703% cU cU c  2 @@50$cA   )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u    :uu ; u%5E u%5E ) uu&5F )u&5F 2 5u&6F  0 1  3 4 :uu ;uu&5F uu&5F    u ;u )%u&5Fu 3 4u&6F  0 1  2 5dm$n$o$q$r$L5Hq$6l$L5i$(j$i$3@@t$$w$w$@w$5dd512 ] YZ[b^U\ ]*L(I$_%`&a'T-g3V7c8W:;<=>?@ABCDEOMPJQNRK iAsAwAGASAYA]AaA$$$$,$$D$؞$ܞ$0$$$$l$uisdata_bio1W 1 Q  Ч$ $  % L \$Lm L    o4! o! o ! qj! A! A A A @ 0U 3t Q % Q B Q $ Q , 0 De 3 @ L!L!!!F  @@@ @ @AA@:F:FP 43 !      @ @ @ @ A n n@n @nn@0f @  * Q k k"k"k"k"k @ ^zF |5$&AcA2VZP~" `"'`{%15|$AcA58$!AcA@ h'W W@ @EEE }WQ  k"BFFeeeZZ Z 0dϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^d5H$)AcA P@9WPurl_int_mii_write_regurl_int_mii_read_reg5|$AcA B  w *w +w +~ W UP  << 1b0 0rk {&"79n= wF@W wa-  Vn 5<$8AcA$u$u$x$x$Pxmue_rx_loopmue_tx_preparemue_csr_writemue_csr_readmue_eeprom_getbytemue_read_otp_rawmue_mii_write_regmue_mii_read_regmue_dataport_writemue_chip_init5X$ڏAcAF hF 5H%AcAx'% '%&%%%X%%$%|$%x'% '%H(%(%%%L5763|$%5t$%,bAAsysctl_wiwi_push_packetwi_write_txratewi_startwi_rx_intrwi_rssadapt_inputwi_tx_intrwi_tx_ex_intrAϕAAAA=AfAAAږA ږA A A A A(A(A(AKAKAKApApA!A"ATHIS is A memory TEST pattern !)H%%4%%\%%t%<%6H)8L5 ##$ &L&D%&%$&T&@ $&T&@&&   @ @ @  0        @*  ) 2 & &P&\&X&T&J&(&*&p&>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IXkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث XXXXEEEE,,,,????kkkk::::AAAAOOOOggggꗗ𴴴sssstttt""""筭55557777uuuunnnnGGGGqqqq))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q@@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽH@@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTH@@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@@@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_r/_@[ ,Κ;qLr!oADSgEmV1JBچ8{ Bieee80211_setmode@P ,    $ 0H`l     $ 0H`lieee80211_media_status , $0H`lieee80211_media_change   $0H`l  $0H`l_ieee80211_crypto_delkeyieee80211_crypto_registerieee80211_crypto_unregisterieee80211_crypto_newkey4A=AGATA^Aieee80211_crypto_setkeyieee80211_crypto_encapieee80211_hdrsizeieee80211_crypto_decapieee80211_hdrsizeccmp_setkeyA&&&X&ع&H&X&hA`&d&h&&&p&&Ƅ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decap6A&&&&8&&&0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsizeA&&<& &&P&X&ieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_lateattachieee80211_node_table_initPieee80211_encapieee80211_compute_durationPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_updateAAAAAAAieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setupHA(ct(((،((cCU(4M(0M(7@ Q((cp),M((M(x9@)(c($M( M(\8@R) h)Lg)(c (4M(0M(7@(cC<-=4M(0M(7@,=(c)C<-=4M(0M(7@,=(csC<-=4M(0M(7@,=(cC '4M(0M(7@'''(cC (4M(0M(7@(}E#(D(@AAA==A*ip_output(x((4(T(p((((((t(\(((d(l((t( (syn_cache_respondtcp_output @@@@@@@lw)lz){)D})tcp_ctloutput԰))ܬ)))))L))))))ܫ)))0))d)\)\)()̽)P))\)0))P))d)0)))vtw_control_init""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwww)|))d)) )) )))x))))))\*P))$B *A *'A *oBx*3A<*>A*icmp6_reflecticmp6_redirect_input_icmp6_inputicmp6_errorin6_get_llsol_addrin6_update_ifa1in6_join_mcastgroupsin6_if_link_upin6_if_link_down^generate_tmp_ifidin6_ifattachin6_ifattach_loopbackget_ifidin6_ifattach_linklocal`$c)*"*0!*@"*`$c:CtX*,*(*?@J*`$c:,$* *@@1,`$c))**\8@* h)Lg)`$c,,**?@`$c<*`$c+#,`$c,*`$cC/=**?@,=`$c)C/=**?@,=`$csC/=,**?@,=`$cgC:+*?@&+`$cC,*?@,ip6_get_prevhdrip6_nexthdrip6_input(@AAA==(A*ip6_outputnd6_initnd6_optionsnd6_resolvend6_rtrequestnd6_na_inputnd6_ns_outputnd6_dad_timernd6_na_outputnd6_ns_inputnd6_dad_startin6_init_prefix_ltimesnd6_prefix_onlinknd6_prefix_offlinknd6_rs_inputnd6_defrouter_selectnd6_invalidate_prefixnd6_pfxlist_onlink_checkin6_tmpifaddnd6_ra_inputprelist_updatend6_prelist_addin6_ifadd#,, ,,,,, ,,h,,D ,,,L ,T ,\ , ,,sa6_recoverscopein6_setscopeA1mBdBdB7AdBdBR@*O@O2Q@*O@4O@7Q@*O@ON@ xN@Z^L@*O@AK@vF@F@FM@M@uD@D@JHK@PJ@*O@ M@ M@ "VM@LM@ "M@ M@ N J@H|I@XH@ H@ H@ H@[E@E@UD@o@C@ G@mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0), --_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d qQ@1!|2"@ 3##6&$7/%8(&9)'0=-'?\.'(/ 0+*~1}]2}]3~4{[5|6,;7.:8-_d<> 4^eEmMqQ@1!2" 3#!4$"5%#6&$7/{%8([&9)]'0=}-\.-_'(/ 0'?~1+*`2+*`3^ 456,;7.:8d<>| /1,;`2,;`3' IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| #6/'`4~^cCeEmMqQ//rRwW??1!2@ 3#!4$"5%#6.=+(/`0[{1]}2]}3 4~^5'"8;:d\|/? bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* /[34{-'?.^`~0!]1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> &1|2@!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`4%58=+~d<>\q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> .\`0^~.\02,*345|d<>5^~sSa`zZ~}/ 02'*4^ 5 .'`|0^~-+?\02'*345d<>| .'`|0^~2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ .'`0+*~5^mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>| 9aAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm 5[,2AAP,dP,L5L5W,L5763L55^,A5e,A     !A  !@@@@"AEAhAAAA A A BA eA;A.AAAA7AZA4AAA5A6A 4A WA zA <A ?A ,A -A A ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!AAAAAAAAAAAAAAA AAAAAAAAAWA[A_AcAgAkAoAsAwA{Awsevent_copyout_events3-L0-P-P-9-L5@C-L5$:-6:-L5ABCDEFGHIJKLMNOPQRSTUVWXYZ@e-\-D]-L5e-L5]-6]-L5rasops_reconfigrasops_init@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?.c&/c&8/c&Xw@Pw@oXy@y@                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~z@{@a{@) |@25|@g|@h|@ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~PX--TFT-H-PN-RR-CEP-ST-NM-P-CL-0PL-0RE̾-@RR-CEP-ST-SL-RR-CEP-ST-ER-CEP-ST-L;(@@`@5$-WAdh@@9@\:@\:8@\:T@\:p@\:@-@$-Ŀ@|-@\:@\:@\:4@\:l@XI;P@\:@\:@\:@\:@\:@\:@\:0@\:L@\:h@\:@\:@\:@\:@\:@\:@\:,@-H@ȹ-d@K;@HK;@\:@\:@-@hK; @\:(@\:@9|@\:dȀ@@9@d];@lI;8@lI;T@T_;p@i;@-@$-Ŀ@|-@$c;@d;@I;4@f;l@XI;P@d^;@g;@xh;@pJ;@h;@h;@I;0@lI;L@lI;h@lI;@lI;@lI;@lI;@lI;@lI;@lI;,@-H@ȹ-d@K;@HK;@];@?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ蘜-l-L;-0;-0;updatefatsU@5@5.B. .. ,d$@@9@$.@d.8@I;T@I;p@ f.@pZ.@|f.Ŀ@xE.@J.@L.@I;4@I;l@XI;P@hJ;@,I;@TL;@pJ;@K;@j.@8I;0@P.L@I;h@R.@k.@8Q.@I;@[.@I;@PI;,@.H@.d@K;@HK;@H.@X.@Y.@hK; @\[.(@XZ.@9`@;|@P0;AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z....nfs_sillyworker..\.0; @@@r@^@R@@@,@@@ڙ@@@@l@D@"@@@@@ؘ@̘@ ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  $@@\@5/jBtdd@@9@\:@\:8@\:T@\:p@_/@X/@ 9/Ŀ@D/@O/@O/@\:4@\:l@XI;P@\:@\:@\:@\:@\:@X60@\:0@\:L@\:h@\:@\:@\:@\:@\:@\:@\:,@0.H@.d@K;@X/@\:@lI;@X/@hK; @\:(@\:@lI;|@\:xdĜ@@9@d];@lI;8@lI;T@T_;p@8_/@X/@ 9/Ŀ@D/@N/@(O/@I;4@f;l@XI;P@d^;@g;@xh;@pJ;@h;@h;@I;0@lI;L@lI;h@lI;@lI;@lI;@lI;@lI;@lI;@lI;,@0.H@.d@K;@X/@];@*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?1j10;8l10;ffs_newvnodeffs_reload0d00w001 1 ffs_syncH@@ @5P0@BBd(@@9@\:@\:8@\:T@\:p@i1@tP1@\Q1Ŀ@|S1@h1@h1@\:4@\:P@\:l@XI;@\:@\:@\:@\:@1@\:0@\:L@\:h@\:@\:@\:@\:@\:@\:@\:,@t)1H@1d@K;@HK;@\:@\:@f1@hK; @\:(@\:@9|@\:@00@1@1$@1@1@1d@@9@d];@lI;8@lI;T@T_;p@0h1@tP1@\Q1Ŀ@|S1@g1@g1@I;4@f;P@d^;l@XI;@g;@xh;@pJ;@h;@1@I;0@lI;L@lI;h@lI;@lI;@lI;@lI;@lI;@lI;@lI;,@t)1H@1d@K;@HK;@];@;B2IчH6B|nQn- q+6BZIчH@B|nQn- q+@BSFU0eC@BIчH؆BIчHpB-чH+uB-чHpBSFH0eCsBS'@ )Ѹ/uB*1@ )Ѹ7uB1x )Ѹ* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jrt_initrt_timer_initmZV%[Ag%=C+ˮ{0w-0 jB;rt_deladdrroute_outputrt_msg1route_enqueuert_addrmsg0c<<8@x<8<<$<<<8<0<<<< <@AR?AR?A$BӄBA`A˃A}AA}AA~AfA܄BiAUVA\VA~AByAyAZjABAABABAӄBA2A2A&A/A(A"AAAcAcA,c cc̵ccclcLc,c cc̴ccclcLc,c cc̳ccclcLc,c cc̲ccclcLc,c cc̱ccclcLc,c cc̰ccclcLc,c cc̯ccclcLc,c cc̮ccclcLc,c c @ @ @ @ @@@@T@x@L@@P@@@T@@@@ @p@@8@@@4@@\@@H@@@@d@ @@~A4B`ABK'AUVABK'A2A_BK'A}A%AK'ABK'AAK'A!BK'ABK'AF!BK'A~ABK'AR?AbBK'A BK'A$B}A%AK'ABK'AAK'A!BK'ABK'AF!BK'AyAqAK'A$BBK'AE>A(AB BK'A,B`BʄB6AAK'AIABK'A܄BBZjA3BK'ARBK'AcA_BK'ASAyAAK'A>BK'AAaA&AAQBK'ASAyADBK'AIBK'AMBK'ABK'AӄB BK'A/B`B   Zgg} j(sFK#(%0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGB6BBBsBBB@BB؆BBBWABBsBBIuBDuBpB+uBBBBƆBʆB҆BֆBpB܆B/uB7uB h2A>9B=>B=~A=VA=DB=B===rbmn=<==h==^e(QBtcid=====l=`=== yekd=`=x=_e ZBbecBae<lB`e,tBatadD===ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/pce|BloobD== =yara=X==p=H=xde BstrtoullstrtollstrtoulCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALLsrc:20251019110716-xsrc:20241108121326 NetBSD 9.4_STABLE (INSTALL) #0: Sun Oct 19 11:07:16 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL @(#)NetBSD 9.4_STABLE (INSTALL) #0: Sun Oct 19 11:07:16 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL 9.4_STABLENetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partitionbad sector table I/O errorbad sector table corrupted: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerpxapcic_scoop: GPIO controller unable to acquire bus. error=%d output write failed. error=%d ioexp%s: not configured. can't map bus space couldn't establish power handler zssp%s: not configured zssp: zssp_ic_send: invalid IC %d Sharp Zaurus frame bufferSharp Zaurus LCDzlcdstdw100lcd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctlcouldn't register event handler zkbd: pseudo power management module apmdevifzapm: USB Mode detection couldn't map memory space zusbunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbuslr, rrx, %s r%d, %s #%dthumb insn , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]und%s %08x oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-aquiet-q-v-x%s: curaddr %#lx not in range_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: _BUS_DMA_BUFTYPE_INVALID_bus_dmamap_sync: map %p: unknown buffer type %d _bus_dmamem_map: size botch%dKB/%dB %d-way %s L%u %cI%cT Unified cache %dKB/%dB %d-way L%u %cI%cT Instruction cache %dKB/%dB %d-way %s L%u %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-SARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %ppmap_pv_protect: page not pv-tracked: 0x%lxfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)scsiverboseperiphtapeprinterprocessorwormcdromopticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storagescsipi_dtype: impossible device typescxsplWARNING: not enough memory for scsipi_xfer_pool unable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer %02x DEFERRED ERROR, key = 0x%x , requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal), data =Sense Error Code 0x%x at block no. %d (decimal)request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedsearch returned equalverify miscompareunknown error keyscsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter %s(%s:%d:%d:%d): killed probe(%s:%d:%d:%d): sync (%d.%02dns offset %d), 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueingtagged queueing ATA illegal length indicationATA volume overflowATA command abortedunknown error code %d %s(%s:%d:%d): wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x unbusypiomodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: PIO mode %d rejected, falling back to PIO mode 3 wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out %s:%d:%d: %s error (0x%x) wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: no xfer wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d unable to allocate periph for drive %d wdc_atapi_scsipi_request %s:%d:%d atapiscsibusdetscsinitq: SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d removablefixed timeout-info target %d lun %d: <%s, %s, %s> %s %s%sscsibus at %s channel %dscsibuswaiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X GENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio JMicron Generic MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST336753LC ST336753LW ST336754LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA drive %d: <%s, %s, %s> %s %s: %d targets atapibus at %satapibusALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.02Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25read_cd_capacity: extra large block size %u found - limiting to 2kByte optical mediaMMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d cd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct NEC CD-ROM DRIVE:260cache synchronization failed no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectorsdrive offlineunformatted mediastandby immediate standby immediate not supported wd_standby: status=%s %s: (error not notifieddevice faultdevice timeoutrequeuechannel reset, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramswd_setcache: status=%s wddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xIDENTIFY failed SPLIT_MOD15_WRITEFORCE_LBA48quirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d wd_trim: status=%s wdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed wd_flushcache: status=%s address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015AS%s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq recalsetmultiatacmd_to48: illegal 32-bit command: %d%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: not ready, st=0x%02x, err=0x%02x drive fault error (%x) atabus at %swd at %s drive %d%s: unknown child %patasplatainitqcan't alloc drive array %s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't create task thread "%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %dcouldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE setsdmmc_select_card: SMC_CAPS_SPI_MODE setsdmmc_select_card: error %dcouldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short MAX_BLK_SIZE%d = %d bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d unknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x %s: %s failed with error %d SD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) SD card status: unknown bus width %d-bit, C%d, U%d, V%d, A%dcan't execute SD tuning can't get SD status: %d write-protected Default/SDR12High-Speed/SDR25SDR50SDR104DDR50: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_hook: malloc failedconfig_connect: malloc failedconfig_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxaippxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented stray interrupt %d : Interrupt Controller intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostNot supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d lcd_free on active screen Stray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacunable to establish interrupt init failed, error=%d pxaohcipxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL pcmciabusunable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout couldn't start dma xfer. (error=%d) unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledreal mode interface already connectedinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentunknown error codeAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! Cannot allocate cfe entry CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for pcmcia_check_cis_quirks: malloc pfpcmcia_check_cis_quirks: malloc cfeSVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-EthernetDYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciausbevt: USB revision %s, not supported %s: can't register softintr usbreausbtskusbtask-hcusbtask-drunable to create task thread: %s usb_create_event_thread taskusb_doattach%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s usb at %spre 1.01.13.03.1usbd_transfer: not doneusbxferWARNING: pipe closed with active xfers on addr %d usb_desc_iter_next: bad descriptor usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usbdetusb_detach_waitold: didn't detach usbverbosevendor %4.4xproduct %4.4x port %d configuration %d interface %dusbdevifserialnumberusbifif%x.%02x%s (%#04x) %s (%#04x), class %d/%d, rev , addr %dusbdlyout of data0 lengthiface descusbd_fill_iface_data: bad descriptor(s): %s usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDusb error on tx: %s usb errors on rx: %s rxeof: too large transfer (%u > %u) close pipe %zu: %s watchdog timeout pipe abort failed: %s usb error on intr: %s open rx/tx pipes failed: %s rx list init failed tx list init failed if_initialize failed: %d Ethernet address %s usbnetillegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d hub not fully initialised, but child deleted?multiple%s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint cannot open interrupt pipe port %d power on failed, %s uroothubuhubuhid at %s reportid %duhidev%s, iclass %d/%d could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidbusuhidev_intr: bad repid %d : input=%d, output=%d, feature=%d uhidreauhiddetuhid%s: was console keyboard multiple key code arrayskey codes not on byte boundarykey code size != 8too many Variable keysbad modifier sizeattach failed, %s This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). ukbd%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %s %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Unknown state %d%s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umassdetusing %s over %s quirk init failed endpoint not found %u/%u/%u unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) failed to create xfers isdata not configured command protocol=0x%x not supported bus attach failed ATAPIUFIRBCISD-ATABulk-OnlyCBICBI with CCIumassuisdata_exec_command: large datalen %d uisdata_exec_command: bad command 0x%02x uisdataex%s: ATA_POLL not supported uisdatablumass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cbcan't allocate link for drive %d %s: reset failed failed to set configuration, err=%s getting interface handle failed couldn't get endpoint descriptor %d missing endpoint auedet%s: EEPROM read timed out if_aueno union descriptor no data interface setting alternate interface failed unexpected endpoint could not find data bulk in could not find data bulk out faking address cdcedetif_cdcecouldn't get ep %d cuedet%s: read MAC address failed if_cue%s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s loading firmware failed kuedetcould not read Ethernet descriptor if_kue%s: %s: bad register %04x failed to get interface, err=%s couldn't get endpoint %d urldetif_urlmedia change failed read PHY failed can't read rxmodeaxedetfailed to read phyaddrs failed to read eeprom failed to read ethernet address failed to read ipg if_axe%s: packet length %u too short %s: rx_cmd_a: 0x%x %s: invalid packet length %d %s: packet length %d too long%s: reg = 0x%x: %s %s: not ready %s: timed out LAN7500LAN7800failed to set configuration: %s failed to get interface handle: %s failed to get ep %hhd failed to find endpoints muedet%s: PHY not ready failed to initialize chip %s id 0x%x rev 0x%x mac-addressfailed to read MAC address if_mueudavdetif_udavunable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors %s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x detect auto increment bug, try again wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: cleaning outstanding rssadapt descriptor for %s %s: tx rate %d -> %d (%d) %s write fid %x failed %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u failed to allocate %d bytes on NIC tx buffer allocation failed timeout in alloc %s: interface not running %s: device timeout LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list if_initialize failed(%d) Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d device enable failed ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s timeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550a, working fifost16650, broken fifost16650a, working fifons16550, broken fifons8250 or ns16450, no fifotl16c750, working fifons16750, working fifoAu1X00 UART, working fifons16650, no ERS, working fifoOMAP UART, working fifoIngenic UART, working fifoTegra UART, working fifoBCM AUX UART, working fifois_consoleforce_consolecan't re-init serial console @%lx txfifo disabled unable to allocate ring buffer 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s channel %d: reset failed for drive 0 drive 1__wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xferlost interrupt%s:%d: %s %s:%d:%d: %s type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardlRoot hubOHCI root hubohci_setintr: 0 interval ohciabt2WARNING: addr 0x%08lx not found ohci_device_isoc_abort: early return %s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted , legacy supportohciabtohcixferOHCI version %d.%d%s unsupported OHCI revision SMM does not respond, resetting reset timeout %s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilcrypto_core_constant32[0] == le32dec(&sigma[0])crypto self-test failed: %scrypto_core_constant32[1] == le32dec(&sigma[4])crypto_core_constant32[2] == le32dec(&sigma[8])crypto_core_constant32[3] == le32dec(&sigma[12])block[i] == le32dec(&out[i*4])expand 32-byte kinvalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher not enough data in following buffer, m_len %u need %u [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: too short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table 0x%p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %s: free all nodes in %s table %s %s table %s: %s[%u] still active ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s: scan set:%s%u start chan %u passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country infokey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! %s %s table, inact %u Cannot allocate key index map with %u entries scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %zu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %d (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlinpcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechoICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailableselectedreserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblist(unknown)TCP: invalid wscale %d from %s, assuming %d tcpipqepltcp_pulloutofbandsynpl%s: impossible (1)%s: impossible (2)m_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachablerfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttdropiss_hashabcaggressivemsltremoteremote_thresholdvtw%s: af %dtcp6inet6newrenocubic%s: could not allocate %zu bytes for hash anchors%s: could not allocate %zu bytes for fatp_t array%s: could not allocate %zu bytes for vtw_t arrayudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_umaxtriesnd6_mmaxtriesnd6_useloopbacknodeinfond6_maxnudhintmtudisc_hiwatmtudisc_lowatnd6_debugnd6_drlistnd6_prlistmaxqueuelen%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: the prefix length of an existing (%s) autoconf address should not be changed %s: addmulti failed for %s on %s (errno=%d) in6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctlprefix ioctls are now invalidated. please use ifconfig. %s: %s marked tentative %s: %s marked detached in6_if2idlen: unknown link type (%d) in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: never found a good ID %s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address in6pcbpl::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6accept_rtadvrtadv_maxroutesrtadv_numrouteskeepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedrr_prunev6onlyauto_linklocaladdctlpolicyuse_tempaddrprefer_tempaddrtemppltimetempvltimemaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxifprefixesmaxifdefroutersmaxdynroutesip6_init%s: off < sizeof(struct ip6_hdr)%s: m == NULL%s: packet to an unready address %s->%s pim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludgeregen_tmpaddr: failed to create a new tmp addr, errno=%d nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 which needs %lu scope error in prefix list (%s) scope error in router list (%s) nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: Cannot enable an interface with a link-local address marked duplicate. %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s %s: preferred lifetime(%d) is greater than valid lifetime(%d) defrouter_delreq: error %d deleting default router %s on %s %s: %s/%d is already on-link %s: failed to find any ifaddr to add route for a prefix(%s/%d) on %s %s: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d rtpref: impossible RA flag %x %s: %s/%d is already off-link %s: failed to recover a prefix %s/%d from %s to %s (errno = %d) %s: failed to delete route: %s/%d on %s (errno = %d) %s: lladdrlen mismatch for %s (if %d, RS packet %d) %s: called unexpectedly (forwarding=%d, accept_rtadv=%d) nd6_defrouter_select: more than one router is installed defrouter_addreq: error %d adding default router %s on %s %s: failed to make %s/%d offlink on %s, errno=%d %s: failed to make %s/%d offlink, errno=%d %s: failed to make %s/%d onlink, errno=%d nd6_prelist_remove: negative count on %s %s: failed to find a good random IFID %s: failed to find a unique random IFID %s: ifa update succeeded, but we got no ifaddr nd6_defrtrlist_del: negative count on %s %s: src %s is not link-local nd_ra_input: lower CurHopLimit sent from %s on %s (current=%d, received=%d), ignored %s: invalid option len %d for prefix information option, ignored %s: invalid prefix len %d for prefix information option, ignored %s: invalid prefix %s, ignored %s: failed to make the prefix %s/%d on-link on %s (errno=%d) %s: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p %s: IFID undefined (%s) %s: invalid prefixlen %d for %s, ignored %s: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: %s is already configured %s: failed to make ifaddr %s on %s (errno=%d) %s: failed to create a temporary address, errno=%d %s: bogus mtu option mtu=%lu sent from %s, ignoring %s: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring %s: lladdrlen mismatch for %s (if %d, RA packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d addr 0x%xiicintr: I2C bus unable to create intr thread i2c-indirect-configi2c-child-devicescookiecompatibleWARNING: ignoring bad child device entry for address 0x%02x WARNING: ignoring bad device address @ 0x%02x %s at %s addr 0x%02xi2c-indirect-device-whitelistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' WARNING: intr handler list not empty WARNING: proc handler list not empty i2cexec,i2c_bitbangi2cexeciic at %smii_attach: phyloc and offloc specifiedmiimii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverbosemiiautmii_phy_setmedia: MASTER on wrong mediaHomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXcouldn't establish power handler: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX, BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyno media presentDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance no media present exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX, LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_common_attach: no memory kbdmux %d: console (%s, %s emulation), using %swsswscreen %d deleted wsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %dOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux_getmux: no memory for mux %d wsmuxwsmux: attach out of memory %s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660utf8_joliet%/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfsRRaArrAamsdosmsdosfs_write(): bad file typerename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad v_usecount%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%s%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inodefile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on listffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %d%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsdoclusterreaddoclusterwritedoreallocblkslog_changeoptorg.netbsd.kauth.systemffs_modcmd: can't listen on system scope. appleufsffsinoffsdino1ffsdino2, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: lost blocks %lld files %d %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_ioctl not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s missing NUL in namenot roundednull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageanonpllivelockuao_getpageuao_getuao_create: hashinit swhash faileduao_create: swslots allocation faileduaoeltpluao_put: strange, got an out of range flush 0x%jx > 0x%jx (fixed) uao_put%s: impossibleuao_detubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_object%s: error=%d udv_detachudv_faultudv_attachflt_noram5flt_pmfail1flt_pmfail2anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpgloanagainloanzeroloanuopguser_va0_disablevmmpeplvmspplvm_map%s: kernel object %p %p vmmeterloadavguvmexpuvmexp2maxslpuspaceidlezerominaddressmaxaddressthread_guard_sizeuobjwirepguvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: Tried to unplug unknown range ractx%s: swapdev not in list%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning of swap...stopping swap on %s failed with error %d uvn_fp1uvn_fp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initfork aiodonedcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_ticksclockinterruptCondition variable%.*spid %d (%s): %s write of %zu@%p at %lld failed: %d cpu%dfdcloseincrease kern.maxfiles or MAXFILESfdfilefiledescfile2dup2EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSexecargsshould not happenpspawnlwpwaitkernel mapping failed %d netbsdinit died (signal %d, exit %d)orphaned traced processincrease kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx softintpserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)swapperWARNING: module error: built-in module %s can't find builtin dependency `%s'built-in module %s prerequisite %s failed, error %dbuilt-in module %s failed its MODULE_CMD_INIT, error %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEunload requested for '%s' (%s)module `%s' not foundmodule `%s' busy (%d refs)cannot unload built-in secmodel module `%s'cannot unload module `%s' error=%dunloaded module `%s'module `%s' declined to be auto-unloaded error=%d%s: builtin module "%s" init failed: %dmod_unld/stand/%s/%d.%d/modulesbuiltin %s failed: %d moduleautotimemodunload%s: %dmodule `%s' pushed by boot loader already existsduplicate bootlist entry for module `%s'unable to load `%s' pushed by boot loader, error %dunable to fetch_info for `%s' pushed by boot loader, error %ddependentuse -f to reinstate builtin module `%s'%s module `%s' already loadedout of memory for `%s'cannot fetch info for `%s', error %dmodule `%s' has invalid class %dmodule `%s' built for `%d', system `%d'forced load, system may be unstableincompatible module class for `%s' (%d != %d)dependency name mismatch (`%s' != `%s')module with name `%s' already loadedcircular dependency detected for `%s'required module name `%s' longer than %dself-dependency detected for `%s'recursive load failed for `%s' (`%s' required), error %dunable to affix module `%s', error %dmodule properties failed for %smodcmd(CMD_INIT) failed for `%s', error %drecursive load causes duplicate module `%s'module `%s' loaded successfullyLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for %skern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfmutex_init: impossible typeMutexmutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) %s: %s suspension %s (delegator %s) removed by %s classresume failed Powering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: class suspend %s: driver suspend %s: bus suspend %s: suspend enter %s: suspend exit Flushing disk caches: Suspending devices:%s: bus resume %s: driver resume %s: class resume %s: resume enter %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueueprocplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s rasplimitplpstatsplcurprocpaxflagsrlimitcputimefilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitrnd: source "%s" failed continuous-output test. rnd: source "%s" failed statistical test.rnd: disabling source "%s". rndsrcrndsamplernd: seeded with %d bits printfautoconfrnd: bad seed length %d rnd: bad seed checksum requesting entropy from dead rndsink: %prndsink %p in unknown state: %drndsinkdestroying dead rndsink: %pcacheht_timebalance_periodaverage_weightmin_catchtimesoftintskpreempt_priupreempt_prirunqueue pullrunqueue pushrunqueue stayrunqueue localizeowner/count : %#018lx flags : %#018x Reader / writer lockrwlock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old paniccrashmecrashme_enable%s: unable to remove %s from sysctl null_derefnull dereferencesigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes softdissoft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=parsedisk%s%lluswap dumps on %suse one of: %s[a-%c] none halt reboot md0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesetrunnable: lwp %p state was %dWARNING: negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLkernel %sassertion "%s" failed: file "%s", line %d %s: rnode %p wrong version sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_mspooloverpooloverseer/%d@%dthreadpool job %p ran after destructionpoolthrdpoolthread/%d@%dthrdplcrthplthrddeadjobptimerplptimersplnanoslppid %d attempted to set the (obsolete) kernel time zone callout_init_cpu (2)late/%ucalloutwait/%utstilepltstileturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time uidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrttsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s.%d, %s dvl_nlock %d dvl_nwait %d dv_flags %x %s with registered handlersdevice-attachdevice-detachcfgmiscdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_attach: allocation of device softc failedFound %s (root)%s at %sWARNING: power management not supported root device %s not configured done. WARNING: %d error%s while detecting hardware; check system log. detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbackcprng %s: reseeding with partial entropy cprng %s: NIST Hash_DRBG reseed failedNIST Hash_DRBG failed self-testurandomarandomcprng %s: NIST Hash_DRBG instantiation failedcprng %s: creating with partial entropy sysctlcprng %s: NIST Hash_DRBG failedureadc: non-positive residureadc: non-positive iovcnt%s: block majors exhausted%s: character majors exhaustedwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and partition table is fullno raw partition and disk reports bad geometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitdisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table type KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpusetkcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-2048kmem-4096kmem-8192kmem-16384kmem-8kmem-16kmem-24kmem-32kmem-40kmem-48kmem-56kmem-64kmem-80kmem-96kmem-112kmem-128kmem-160kmem-192kmem-224kmem-256kmem-320kmem-384kmem-448kmem-512kmem-768kmem-1024not modular%s error: %s,%zu: %s lock address : %#018lx current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) page %p, nmissing %d, time %u %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u%s: [%s] ph %p poolid %u != %u%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOL CACHEPOOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer entry uncontended %llu contended %llu cache layer empty groups %u full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p empty cache groups: pool item size %zu too large, use a custom allocator(null)Skipping crash dump on recursive panic panic: [% 4jd.%.*ld] %s: table is full - %s %s: table is full autoconfiguration error: exclusive accesspsrlzspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclocvxchicvcrosscallunicastxcallxcall/%uaio_process: invalid operation code aioworkaiodoneaio_jobs_poolaio_lio_poolposix_aioaio_listio_maxaio_maxsys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s compat_80mqmsgplposix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsocketttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutftkstatninnoutcanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_streamseqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)offset %04d: %s: too short mbuf chain (%u < %u) %s: cannot read header ARP: AddressType = %u(ETHER) IEEE802) unknown) ARP: Protocol Address Format = %u ARP: Protocol Address Length = %u ARP: H/W Address Length = %u ARP: Operation = %u(REVREQUEST) REVREPLY) INVREQUEST) INVREPLY) Cannot parse. Cannot read payload ARP: Ether Src = %s ARP: IP Src = %s ARP: Ether Tgt = %s ARP: IP Tgt = %s ICMP: Type = %u(Echo Reply) Destination Unreachable) Source Quench) Redirect) Time Exceeded) ICMP: Code = %d ICMP6: Type = %u(Packet Too Big) Parameter Problem) Echo Request) MLD Listener Query) MLD Listener Report) MLD Listener Done) Router Solicitation) Router Advertizement) Neighbor Solicitation) Neighbor Advertizement) ICMP6: Code = %u TCP: Src = %u TCP: Dst = %u TCP: Seq. = %u TCP: Ack. = %u TCP: Header Length = %u TCP: Flags 0x%02x : FIN SYN RST PUSH URG ECE CWR TCP: Windows Size = %u TCP: checksum = 0x%04x TCP: Urgent Pointer = %u %s: cannot read TCP option TCP: OPTION: NOP TCP: OPTION: MSS = %d TCP: OPTION: wscale = %d TCP: OPTION: SACK OK TCP: OPTION: TIMESTAMP = %u, ECR = %u TCP: OPTION: unknown (%d, len = %d) UDP: Src = %u UDP: Dst = %u UDP: Length = %u IP: Version = %u IP: Header Length = %u IP: ToS = 0x%02x IP: Packet Length = %u IP: ID = %u IP: Offset = %u IP: Flag 0x%04x (reserved) IP: Flag 0x%04x (evil flag) IP: Flag 0x%04x (don't fragment) IP: Flag 0x%04x (more fragment) IP: TTL = %u IP: protocol = %u(%s) IP: checksum = 0x%04x IP: Src = %s IP: Dst = %s IPv6: Version = %u IPv6: Flow INFO = 0x%07x IPv6: Payload Length = %u IPv6: Next Header = %u(%s) IPv6: Hop Limit = %u IPv6: Src = %s IPv6: Dst = %s Cannot read option IPv6: Stripped Hop-by-Hop SPPP: Address = %d(ALLSTATIONS) SPPP: Protocol = %d(LCP) PAP) CHAP) IPCP) IPV6CP) IP) IPv6) MULTICAST) UNICAST) Keepalive) No parser for address %d, protocol %d %s: too short mbuf chain (%u, %u) PPPoE: Version = %u PPPoE: Type = %u PPPoE: Code = %u(PADIPADOPADSPADTPPPoE: Session = 0x%04x PPPoE: Payload Length = %u No parser for PPPoE control frame. Unknown PPPoE code. ETHER: DST = %s ETHER: SRC = %s ETHER: TYPE = 0x%04x(PPPoE) ARP) IPv4) No parser for AF %d IPv6 Hop-by-HopICMPIGMPTCPUDPESPAHICMP6unixposixsemmaxpsemksemsomaxkvasbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadunpgcuipc_init %duipc_usrrequipc 4inflightdeferredbuf mem pool index %dforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbflushbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestedcachegcncachenchinit %dnamecacheentries scannedentries collectedover scan targetunder scan targetforced reclaimsnamecache_statscwdidirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.fstypesmagiclinkspnbufpllf_findoverlap: defaultlockfchrooted pid %d uid %d (%s) detected outside of its chroot namei_simple_convert_flags: bogus sflags /../earmzauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dot%s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system failedunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... ILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFELOCKSWORK TEXT EXECMAP WRMAP WRMAPDIRTYONWORKLSTDIROPfiledelaydirdelaymetadelayvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dfdesckernfsafsfstchgfstcnt%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvcachevdrainvdrainwt%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-namexattr-valxattr-listsystem.user.security.trusted.vop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad oplayerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_ioctlspec_read typespec_write typespec_fdiscard: not a device spec_close: spurious pgrp refspec_close: not specialdev %llu, %llu spec_node_destroy: corrupt hashfictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > sc->sc_size (%llu) %s at %s (%s) deleted dkdrn%s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fsmdidle%s: cfattach_attach failed %d %llu %uurandom%urndtemprndctxrndpseudoopen hardopen softbpfbpf_mcpybpf_change_type%s: softint_establish() failed%s: no bpf_if found for %smaxbufsizepeersbpfattach%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#%slink#%huif_ifqmaxlendropsifnetifasdl%s: could not attach sysctl nodes sndqrcvqif_detach: WARNING: AF %d not purged UPDOWN%s: lost link state change %s too many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %s%s: can't handle af%d ether%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_loopifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedpfilpktqsyncpktqrenqMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find our annotation rn_delete: couldn't find us radix already initializedrn_init: radix functions require max_keylen be set rn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d rtfree 2route_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %drtableroutekeeplog_movementslog_permanent_modifylog_wrong_iface%s: %s not ready arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s %s: ouch, empty static llinfo for %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: Extensionsorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d curtainusermountuser_set_cpu_affinityextensions_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionscryptofssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadzfstprofisvvideohdaudiouhsorumpblknpfdtvfilemoniscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmicttyphysconptcqmsofconsfdtunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseulptraidugenucomuriouscanneropenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomsysmondmoveriosscomksymsepcomtslcdtwensmbwdcpxapcicpxamcisdmmcbuswskbddevusbuswsemuldisplaydevreportiddriveconfigurationproductchannellungpiobuskbdmuxcontrollerindexdackirqintrbaseKernel RNG "%s" monobit test FAILURE: %d ones Kernel RNG "%s" poker test failure: parameter X = %lld.%lld Kernel RNG "%s" long run test FAILURE: Run of %d %ds found Kernel RNG "%s" runs test FAILURE: too few runs of %d %ds (%d <= %d) Kernel RNG "%s" runs test FAILURE: too many runs of %d %ds (%d >= %d) unusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs30%llostringpropstng<>&plist version="1.0"?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl %s %s SIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... kern.driversinvalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1scosolarissunossvr3svr4ultrixffs@mmmmD%=mF@MYammm mm kmmnn*n?nRn an@mn~nnn@n.inn n.nnn%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedforcemount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousautomountedextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdupbnorripbgensbextattbnojolietbnocasetransbrrcaseins-q7qu0m9cBqk mm kmk@IqPqUq^qhqlqqqxq usage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.-q7qu0m9cBqk mm km0@1mO@ksD%k@mo:mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %ssoftdepbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror-q7qu0m9cBqk mm km0@1k@usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac-q7qu0m9cBqk mm kmkk@M||PH}  }@}}!}'},}H0} h@LL{R{6}[{e{o{ z{@recvrpcrpc_getportrpc_callsendrecv[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s%s: can't read disk label; disk type must be specified%s partition type is not `%s'ʄ0h߅ ?\!HpCcWTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask%s (%s)0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdownSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()۷߷usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%llunot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY)R|0b*UPBROADCASTDEBUGLOOPBACKPOINTOPOINTRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%d%-*.*s %-*.*s %-6.6s FlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspechw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpaS***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. loginmachineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamNetBSD gzip 20170803malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gz4HS- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndadbticmsovb|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: filename expected%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: extra characters after \ at the end of %c commandw commandread commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberrabetbhfprdldvcupndipausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i.1<H$CLڻ$YS$aS$mv$*$$$ټ$'$S$S$S"$!)ܹ$6N$=D0$NS$X.$a.ۺ$k|$p$pؽ$x$$$$'$S$ S$x$$##$4S"$?M$$_'!$kS?$wS>$PLNAME= n &09@OV\chp u~,         !"#$%&'  IÒ_ 0Jђaq  &09@OV\chp u~, efvy{K]7) &09@OV\chp u~, dIwim----------------------------------- - --------------------  @//tmp/usr/var$$$$   0 Details for index GPT part -  *=@EJ.MSinXn n#\annn jsxpi5c cjjuk-jj` ddgego`b`d?`o`'r1s r}qtk3b[a]aaa_a. R0R0  s SFH0eC쬞 SFU0eCLHah!IdontNeedEFIV(s*K>;`|nQn- q+kw|nQn- q+|nQn- q+|nQn- q+|nQn- q+=rGy=iG};Mt?mWC 3KOOyD<#*=(&3Dh&R00\ M}-CT-чHe-чH zZIчH.IчHIчH2IчH S'@ )Ѹ*1@ )Ѹs1x )Ѹdmm%I}~~_݃u IU ٙ}m'  . AR ! 4B/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages.tgz/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6) [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeNoneOnOffunchangedDelete?reinstall sets forupgradeNetBSD/zaurus 9.4_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksmount point (or 'none')secMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-9.4_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-9.4_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-9.4_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-9.4_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsSwitch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Bootable flagSafe eraseUndo changesUnconfigureEditForce umountRemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionInstalling boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] [-p] where: -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -r release override release name -C bg:fg use different color scheme -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog9.4_STABLEzaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-9/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/9.4/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filesysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %stmpfs%s (%s@%s)%s (%s, %s)%s (%s, %s %s)-t -o disk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2 %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %d %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%sprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*%-30s %s/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'raidctlvndconfigcgdconfigdkctlrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700gamesrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %sNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD9/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10schpass -s %s rootsource for 3rd-party packagespasswd -l rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%cfictiousdisklabel -r %s%s (%u)/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%s (%llu)%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %spartmanlvol%.2dvg%.2dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%lliPartman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %s%s_%lli@%lliNAME=%sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tableSec GPT headergpt %s %s -b %llu %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1138: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1100: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sv7sysvv71kv8otherhpfshfsjfs2appleufsminixfs3vmfsvmwresvefibioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockio%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxapple-ufsBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapVMware VMkernel core dumpVMware reserved/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2100: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1743: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1773: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2067: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2193: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2198: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI BootS***************************************************************************************************************************************************************************************************************************************usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputn1^f-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu ping6: wrote %s %d chars, ret=%d --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000getaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmaprefusedunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s SuccessRefusedIPv6 addresscontrol_handle1control_handle_datacontrol_writeonedhcpcd_reportssiddhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_getxsocketif_discoversplitvadd_environparse_optiondefault_configread_config#bi\cdv4e.fz4g/h/i-j.k4lA9m4no4pHq^r4s4\t$0uH0v4wR,x4ziy4A4B4C-D4Eu>F4G4H0IOJ5K5LoWM5N5O5P,5QST45U>5VH5WR5X\5Zt#1k54t56o4|z~}5}5555555555AAA559F255o9~256 66"63616]86@6M66S6Y6a6f6v6'46  a a rt_new0  rt_buildrt_deleteM M \.9Z+59?9H9O/{S9!36 55Z]&9make_envscript_runreason0123456789abcdefdhcp_envoption::;M;};;;;<.<\<<<<< =Q=o====>?>e>z>>>>>>???i?{??????@@+@@I@_@~@@I@@@@@ A A0A@AOA_AA@AOAAA??OAAAB6BTBsBBBBCC>9C^Cif_opensockets_osYRVDZD^Dif_initrtif_ifa )( PT@P HEPT$ @DCread_leasedhcp_openbpflog_dhcpyMMMyMdhcp_bindMKMMCDKMcF Mdhcp_start1dhcp_initdhcp_handledhcpdhcp_readbpfdhcp_readudpdhcp_recvmsgdhcp_dumpipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1ipv6nd_rtprefipv6nd_applyraipv6nd_expireraipv6nd_handledataipv6nd_recvmsgipv6nd_handleraQ^Z^e^n^XXu^ X] ~^^]^^#^/^=^dhcp6_checkstatusokdhcp6_openudpdhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrequestdhcp6_startrebinddhcp6_writeleasedhcp6_recvifdhcp6_recvdhcp6_recvmsgdhcp6_start1 '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_dump/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: connected to Access Point `%s'%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version8.1.9--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 8.1.9 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-8.1.9 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: SO_RERROR%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption `%s' does not take an IPv4 addressinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argumentunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbuf(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %saddingchangingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleteddeleting - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinTESTSTATIC6ROUTERADVERTUNKNOWNPATH=%sinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=%sif_down=falseif_up=trueif_down=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid=%s%s: executing `%s' %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed index uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%snd6_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rt%s: SO_USELOOPBACK%s: SIOCGIFALIAS%s: if_addrflags6net.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6fwetapxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: %s: truncated lease%s not foundNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: timed out contacting a DHCP server, using last lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: dhcp_open%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: %s: short frame header%s: checksum failure from %s%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired, extending lease%s: DHCP lease expiredDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired address %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %snd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_addr%zu=%s%s: delaying IPv6 router solicitation for %0.1f secondsreachable againunreachable%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: ignoring unicast option as not masterdelayingunicastingbroadcasting%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f seconds%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: DHCPv6 DAD completed%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to request information%s: DHCPv6 lease expired%s: failed to request address%s: failed to confirm prior address%05d %s%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6DUMP6Unspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\Bo = o!= o9= oU= m= o= o= = o= q= o> o> BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~oohdplohhxlooooooo q@oousq/etc/group/etc/master.passwdJPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidfull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresv0%llo%lld0x%llx%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME/usr/share/misc/terminfo%s/.terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist