'V7jOY0ŧNetBSD/earmv7hf ramdisk 08YOj<  YOjEzt tYOj@@<@T 08YOj<  YOjEzt tYOj@@<@TU YOjtpp`AYOjYOjYOj$h YOjYOjYOjAYOjYOjYOj.A.YOjYOjYOj AYOjYOjYOj/AYOjYOjYOj'AYOjYOjYOj/AYOjYOjYOj`AYOjYOjYOjaAYOjYOjYOjbmDdYOjYOjYOj (08@HPX`hpx $YOjYOjYOj (N$OYOjYOjYOj08@HPX`hpxK$tYOjYOjYOj{M$qYOjYOjYOjFAYOjYOjYOjdCYOjYOjYOjeAYOjYOjYOjfAYOjYOjYOjl!YOjYOjYOj aYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOjaYOjYOjYOj aYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOj!YOjYOjYOj4!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj B!YOjYOjYOj B!YOjYOjYOj!YOjYOjYOj"!YOjYOjYOj"!YOjYOjYOj"aYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOjaYOjYOjYOj aYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj!YOjYOjYOj !YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj!YOjYOjYOj !YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj !YOjYOjYOj!YOjYOjYOj !YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj?\!YOjYOjYOj>\!YOjYOjYOj=\!YOjYOjYOj<\!YOjYOjYOj;\!YOjYOjYOj:\!YOjYOjYOj9\!YOjYOjYOj8\!YOjYOjYOj?\!YOjYOjYOj>\!YOjYOjYOj=\!YOjYOjYOj<\!YOjYOjYOj;\!YOjYOjYOj:\!YOjYOjYOj9\!YOjYOjYOj8\!YOjYOjYOj:\!YOjYOjYOj7\!YOjYOjYOj6\!YOjYOjYOj5\!YOjYOjYOj4\!YOjYOjYOj3\!YOjYOjYOj2\!YOjYOjYOj1\!YOjYOjYOj0\!YOjYOjYOj7\!YOjYOjYOj6\!YOjYOjYOj5\!YOjYOjYOj4\!YOjYOjYOj3\!YOjYOjYOj2\!YOjYOjYOj1\!YOjYOjYOj0\!YOjYOjYOj2\!YOjYOjYOj/\!YOjYOjYOj.\!YOjYOjYOj-\!YOjYOjYOj,\!YOjYOjYOj+\!YOjYOjYOj*\!YOjYOjYOj)\!YOjYOjYOj(\!YOjYOjYOj/\!YOjYOjYOj.\!YOjYOjYOj-\!YOjYOjYOj,\!YOjYOjYOj+\!YOjYOjYOj*\!YOjYOjYOj)\!YOjYOjYOj(\!YOjYOjYOj*\!YOjYOjYOj'\!YOjYOjYOj&\!YOjYOjYOj%\!YOjYOjYOj$\!YOjYOjYOj#\!YOjYOjYOj"\!YOjYOjYOj!\!YOjYOjYOj \!YOjYOjYOj'\!YOjYOjYOj&\!YOjYOjYOj%\!YOjYOjYOj$\!YOjYOjYOj#\!YOjYOjYOj"\!YOjYOjYOj!\!YOjYOjYOj \!YOjYOjYOj"\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj \!YOjYOjYOj \!YOjYOjYOj \!YOjYOjYOj \!YOjYOjYOj \!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj \!YOjYOjYOj \!YOjYOjYOj \!YOjYOjYOj \!YOjYOjYOj \!YOjYOjYOj\!YOjYOjYOj \!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj\!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj!YOjYOjYOj !YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj !YOjYOjYOj!YOjYOjYOj !YOjYOjYOj!YOjYOjYOj!YOjYOjYOj$!YOjYOjYOj4!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj !YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOjaYOjYOjYOjaYOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOjaYOjYOjYOj aYOjYOjYOjaYOjYOjYOj aYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOj?\aYOjYOjYOj>\aYOjYOjYOj=\aYOjYOjYOj<\aYOjYOjYOj;\aYOjYOjYOj:\aYOjYOjYOj9\aYOjYOjYOj8\aYOjYOjYOj?\aYOjYOjYOj>\aYOjYOjYOj=\aYOjYOjYOj<\aYOjYOjYOj;\aYOjYOjYOj:\aYOjYOjYOj9\aYOjYOjYOj8\aYOjYOjYOj:\aYOjYOjYOj7\aYOjYOjYOj6\aYOjYOjYOj5\aYOjYOjYOj4\aYOjYOjYOj3\aYOjYOjYOj2\aYOjYOjYOj1\aYOjYOjYOj0\aYOjYOjYOj7\aYOjYOjYOj6\aYOjYOjYOj5\aYOjYOjYOj4\aYOjYOjYOj3\aYOjYOjYOj2\aYOjYOjYOj1\aYOjYOjYOj0\aYOjYOjYOj2\aYOjYOjYOj/\aYOjYOjYOj.\aYOjYOjYOj-\aYOjYOjYOj,\aYOjYOjYOj+\aYOjYOjYOj*\aYOjYOjYOj)\aYOjYOjYOj(\aYOjYOjYOj/\aYOjYOjYOj.\aYOjYOjYOj-\aYOjYOjYOj,\aYOjYOjYOj+\aYOjYOjYOj*\aYOjYOjYOj)\aYOjYOjYOj(\aYOjYOjYOj*\aYOjYOjYOj'\aYOjYOjYOj&\aYOjYOjYOj%\aYOjYOjYOj$\aYOjYOjYOj#\aYOjYOjYOj"\aYOjYOjYOj!\aYOjYOjYOj \aYOjYOjYOj'\aYOjYOjYOj&\aYOjYOjYOj%\aYOjYOjYOj$\aYOjYOjYOj#\aYOjYOjYOj"\aYOjYOjYOj!\aYOjYOjYOj \aYOjYOjYOj"\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj \aYOjYOjYOj \aYOjYOjYOj \aYOjYOjYOj \aYOjYOjYOj \aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj \aYOjYOjYOj \aYOjYOjYOj \aYOjYOjYOj \aYOjYOjYOj \aYOjYOjYOj\aYOjYOjYOj \aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\aYOjYOjYOj\ !YOjYOjYOji!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj aYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOj aYOjYOjYOjaYOjYOjYOj aYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOj!YOjYOjYOj!YOjYOjYOjaYOjYOjYOjaYOjYOjYOj!YOjYOjYOj!YOjYOjYOj!YOjYOjYOj B!YOjYOjYOj B!YOjYOjYOj!YOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOjaYOjYOjYOj!YOjYOjYOj!YOjYOjYOjaYOjYOjYOj aYOjYOjYOjaYOjYOjYOj aYOjYOjYOjaYOjYOjYOjaYOjYOjYOjYOjYOjYOjbpf!YOjYOjYOj $YOjYOjYOj($YOjYOjYOj$>YOjYOjYOj+$YOjYOjYOj0$sYOjYOjYOj2$YOjYOjYOj8AYOjYOjYOj:m YOjYOjYOj@H7$YOjYOjYOjP; $YOjYOjYOjXAYOjYOjYOjgAYOjYOjYOjhAYOjYOjYOjiAYOjYOjYOjjAYOjYOjYOjkAYOjYOjYOjmAYOjYOjYOjnAYOjYOjYOjoAYOjYOjYOjpAYOjYOjYOjqQ;_ I5+ r)U2;[:!Mp?.x}O6}>!ƒdBqqt cfgXA?ya"dƱ,OY#l /<g^'Z"::LcnlbWYMR,069rBy<am7cGt# -91^9(i%y{ -=HsCa/lnT^)hfi{5nH&L)fM8WN5uX_wQ7G͹u)> x2xw9rQ&~+S& Et . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4a4 (000hLL000NetBSDAPaX NetBSDearmv7hf3D0D 0p@-F+`fpywh+iK8FV "oȿ+aoXF:`P;HYFh#Oc+a8K` FU M)hHFR0ZЛB) FU%jhR"!XFUvVZ0 FU1hHF0 pCO FU1hH>F3h+)FXFUL, I I#hZF8FDU( DљPd Kn:f*oB² *IV{mQeppG&IFFH 0fhJh3`pG-pCF-FK"F)F0F` A @FIF( e KA1 I H! {z"hpY@<dh0p FFmF@)F0F, H1F\ ph-ApG#sFF `.=0FU*FX;h+J$h#@c`.2Щh0FU(C+I+H, O$)KEp;9F.20FU0*;h-+.IH $,HUF(ѩhHU(ѷ OH)F($ I$H O FHU00+.<K-OhFHVI UzF(~ЎIH$x!Fj"FUAF KXph+KJhhCЅK+@Kh+0yH V0nvI|H0FU+nvKh+FuMmJ tI(F~0;0+ PF*Fđ(F (0OUТ *R*xBxKp p: F F*2 1L3 L L L L  L L  L L L L L L LL LB ў-CmL2C "kI T2CgI" T!UOzw aH! sT\LAqSeUls Euad!V#&%#######EJ 9 F T #RQ#C F T'x Mb F?0 F F> U,-G*L!jc RkCk3&%3D jjG?? bj I`xO dOE;h+;;`k2F!hj[jG(#j6Ѧi= I .0[պO ajHF瀣 @j 𵅰4L%j #KC3k!j DjG??bj 'ID#0kji!IG(ki!h[jjG( 5F #Bv#0kI'jiG0 O #BvҢi8F!h5FBBв.FТ m+ L!!($h  C HLHأ  -OFXMF0+FА8+BJ!@ A0+>Уh!Hch#H####oH## #o"hH#H## Ma!@ B7 0 / '+ 0@0M0bܳгo$0+\ЄK0#0#3OKIK0 #0 {K|H*F9kh!F۰O6;k`B=)E(0+Ikh9FlJmH2lJ2 2:FiK6,0;+hgJgHFgJ*fHr)eK0 #dI;k`Bj`)]I j`Bj`)аoаUHShr h !c [ C 0+$03EK@J!DJEHBK@K!>Jh/Or_Esz9FXF9UAFFF0F8~RFFF 8vFFXF9F9@ F(F8jFF 2Cr# @! #4!JF3FWH DuH~L2R'n^Xu tأ YF8F9 f 8FYF9 WwFFF>FH00+A,0+#H $ph#  340+#HYBw 1F9;F F(F8F FF0F9 #3 ^7:F9FtH!$hqNc#qh  h qh 1  hqh %1 S 2C# @! #FVHUHj+ x2<@jh(u12F+F i0 3#`Wk5CuCICHrfsh/NOrWE{h-9FPF9[FAFFF0F8 JF[FF 8FFPF9F9 [FF(F8 FQ3F&H6QF8F96 f QF8F9 QFF>F It22F+FH #@!2F+FxFIlHأ pF!rF I n&`9F96DB pF Mkk0T2k.#c(F0 I" HN( K"3<3+2 0 pD L3he`;3`[Kh p p0 p -GF'L#hx . .$HoF(#h||xBN3#`0h%6hF0B FhF(0#!i #"#QFF(F[ B$h6 F(ں(  Kn:f*oB (КmQeppGIT-OFܑ&nLء0F+V8FFh]ѻ`+Z"h E򔀶F`hOz  D0QF30_(o9 hZUIFUHUH"0;0S@ 0;0+JKhGԛchUFK"`6{h;{`+8F(;hZ:`x - B@E0FD30AF (9h+IF+HP*H0;0+8&Kh K0;0+KhԚ -chUFch" Kh˱h8້[9h IF H Ho@F.ch "U#`猥 h ' 0 -OFZMFYNh|3hVK#`3`0 \$PO#F'EK,g+]+REIFH3h+XЪhh:hhh2:`#;h;;`3 P FxF!+#I0F9hI*FFH H I,1Fo+x F!+(9`h I*FF H H( Kh# I:FH Khhbyt  OF FB ;h)F x(9"h\IFHH$o04瘨 h-OFF F0F hx'xx$ 20Fa'8F#*iB T20F( 4-hDB(FF(o -AFxF FF!+&I0F8h!I2FF!H& H :!FJ:F)Fo(F3x F!+(8xh I2FF H H( Kh# IBFH-}ht -O$TMFtkh;k`+%OH($FF#ѫ@86hpHIFHHHH8"#`EK`ol&FF4F+hZ*`xf BC۴FOy  D0IF3088h4.IF*H-H0;0+)Kh z 0;0+Khԛ U#K"`$ /Jh3`0"UK `0FE#`K hUh&FK`縅h(  8 0 -OFDFF; +--=`9 (|LO3;`B9yNxAF3h33`8RhpIFpHpHT3h;3` lKh  &3h;3`+cKhԞ#i*FF6 "F+D,MFlL0CD< +QH=B00q30)8h$ i#U>`挥 0 h ( 8 -OFFFF(H%&DB { x405BI%H x ^+\(\  HYF4( 5O500 x00 x00\X8I"@ h#jF ` IS( ۽0+;J`0+;JS`] ht@T KZh B)iBHo 4-GF&MFliPO +iBkic!Ho Fki+Ж+i+$4tki+.,<ki+,i FFMF(Ыi+ #"#AFF8F(kiBѾ砥 -CFF0HfoL0B̿H F FFB (F()i;F"F@ (-hLF4 KJh30 H-oa9 Ki" 2 #Da h B Kh30a8Ki@[Hoh -CqMԁli p;xY2I +"(7p )(((iiiiiiiiii^.30-.^. LD"0x?.. .@ 300xA2@ (I8#EI "`CF;38~h"+=Ho Fs۲20Z-.^.#O3DO3 1H8\#,I "`\CF;38Lh"+*..0/li*/YBYA0xB30z*К Xxpb;.0jikh`3k`,i`B,+iBڥO4砥 ( 34h#Lc`ci3( ch+F"+b`h!Ѣ`!hch 3 c`x,) ;) +F"+b`F Ѡ` S0x;+`aBу ! L FF R .F3V˄E5F+/`:5F! 8F Fp8hIFHH F8##+iahB <\+9@  N0 ~3h8"#3`3iSIH($H4F7(F 0F9Fc I F,/*/"bU"Zp>3iI" Fw GNJ1h8#@ C` F H  %;"@hO1#@; '8L`a1da, *1I @B"``3x S0x *ћ+2x.*rx *0300FF0;0S#h E" biF#`B#10;0+#hԛ8FF,F(o -CFHL#hB07U%B0ЂB"(FF8FhFca1(hAF$#10;0+_ hKMѽ*F9F H0;0+6o#i1F B̿r"((FhBF,8FF0FF;hh+`B]`00Կ#hȿpȿ33D#h  0FtF8FpF 砥 -GF3Lhc'eaBF"ܯB ݪSOO +J]00F30)F0;0+4#h N'* 0;0##hԛ=6h`i0;F'Fbi@FF+F(o -C F*LF FF 0300;0+:#h 2 L#i9B̿h FHF1Fh9F#i5p[9#10;0S hѽo -OF^LF'#iB̿H F0FF]ETh {B۷=F0Ou5D30)F5(Y0hP;0##hdԚgDJAF10FSe(w0>3fa0(Abi Fo(:#10;0+\ h68ѽ(FF(K+ih;DB:ݳ y IF2 7hIFH"H0;0#h  q0h;0##hԘQF*i8D5N+i-hDVo 砥 hF-Ljp/1QXibB?+D",(Fw09F30rF72hmIFHH50;0+#h  0jp;0+#hԛ2x\*rx6/*6 h-G#Ll2CЬH!YF on B;@B0 F5D30)F7hIFHHH0;0+#h C 0nP;0##hԙ1%@!"p x +8"B@B0.F6D301F(0b;0##hԚ*Fo5@1Q"ZU8x!XBXAt!+@%+n nB"۵F0Oz  D30QFq(?o0n;03#h?z?|0!xSU0Yx\)љ[xU5F~B.n BEE.F0FF6D301F5(?30n`;03#h?>?@0nZ x1ZU1 [x 'H1n`+DBݳv 1F2 (?0n`;03#h??13Np DBvp{0++1H栥 Shkh HF'F6aCB!ݳv 1F2 (?0n`;03#h??1>F+D++Q*>DJ1h8#@ C`' KF1x!+ I6 /! F3 H+  \S7KL0x +9IKh0xP1E *DH 30 *!i 0x!+0(0/HP-6u0)F307h%IF%HF$H0;0+#h B 0P;0##hԛ# x )"TV(QYxT hhK-AhL0F E2Pi (x /9!ȲY(AY)><<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<Z<hHqX<Owb<}%E0 F+n*p*l*0 x + JHEE1 3h(o(FaiF(% F+n*p*l*0 x +1  %(`iE0EEaiF(% F+n*#p*l*0 x +1 (#B3caE0EE!)iah)Hv[x320[ Hnh *F(?r% F+n*=p*3l*60 x +L!i (Y(R(3x 1KN!0Fw(@lJ#1O3`J`5E0EE!+СH"1F43x+Hah)[x320_F(? x!+іH%E0F+n*p*l*0x +ݮ xH"4pHVlEEQ H!i (Ӯg/ G/(F(ɮV/ (  ( F+n*p*l*0 x + 1)F31zE0EEch+?% F+n*p*l*0 x +hQJx+?yPIPHsE0EEch+?׮% F+n*p*l*0 x +=22+?JE0EEh 3H$%E0 F+n*p*l* 0 x + 1 Jh8EE`iA( % F+n*3p*l*0 x +1 #B?E0Eh d`k h4Eh _x(%`3F+n*p* l*03x +9FKE0EEaiF("Fn)p)l)0x +vB(%B0BBaiFf(mu7(fch HNh.$#iB? BuۮB% F+n*p*l*0 x +.1 k0F6H#E0EEaiF(%"Fn)p) l) 0x +BB0BBaiF("Fn)p) l) 0x +جB`B0BBch+?N% F+n*p*l*0 x +2^Kh ]Kh2E0EE#ch+?   F;l; ۲+  x +1+2q/iO5[x320]ch #i`3F(?{% F+n*:p*0l*30 x +U1 !3x2!+ ,H"1F43x+1+?4&Nh0F(J?J#iB?F#1AE0EEO%.F0xg*M- *=0: *,6 "9F`@80C6h"+>Hb 0&Th ( 3p*"r*#-0x *-[x +*ѥHٻE0x +2H̻E30EE2E#2D#20b30 i`F0;0+#h  ZB (P#b20;0##hԞ-ArIm(~!2C2 xn+Rp+Al+IaiF^(e% F+n*Lp*Bl*E0 x +?1 |!D#!2rCH2Ճ# #2C22 2C2CE0EEaiF(u(ch+?h.#iB?u% F+n*p*l*0 x +˪1 0FӺE0EEch+?:% F+n*p* l*0 x +E0EE D Q)300 O5%x320Z:F(?!ich C73 F+n*=p*3l*60 x +W!3x2!+ ВH"1F43x+1+?;NHI#W/F0Fb(K#iB# 9(?E0EE1+?12+,q(o$ch+?  F;l; ۲+  x +gHai `D(0x1;+"Fn)6p),l)/0x +ҩVKhh#iDBFV6&QI "OM`(`@806h"+IH.`B0BB%E0 F+n*p*l* 0 x +ch[h4HEE!ich+?](% F+n*$p*l*0 x +` 002+fHyE0EEai `DF(Mh"F» H2oCh ]T( 3pr@'HS+z]pG x^+0x]+0x]+ +[+Dx.۲+ JBF/F])ѢB F ) F o-GFP,F#xB +.eJ BS@B4O.F6D;h1F3;`(76h,IF,H+H;h;;`)Kh [+\+ 4F( Ht&0Fcx +HF H;hJ`;;`+Khԛ,a*F0F4$K"rU@h+)F0F #G0 h GS ( ,Jphx (*H# ( (L01'H0 Y`[x +ЃBMF pL0Kh۹K&0)F`Kh(J@'0070a %0(6h IF HV H(   h-O_N`L3hZ2`Yx%)"h5\O%|3hxKEX EF۵F;hOxD3;`AFP6hKIFKH KH;h;;`HKh xIE33`CHt h  N;h;;`+0ԙ3hZ2`x"h +SU*3hx*P;3`B@B'O.F6D;h1F3;`l(;h;;`+!Khԛ#h"`ZU\+'3h5Z2`x"h + 0oKh+jXX(Н0D< +?Y 0#` 0]FO( ة 0 h D4 8 # MF `F`*hx /J`##` (+hx *кB3+`+hx1)6$I "`(h0`@806h"+H4`og*3+`#( ة 3-OMFNF/h*hh0B"ۜB@BO&F6D:h1F2:`(;h`;;`+yKhKԛN+i"U=:x&*^  Bܤ KFSE*iH۪ Eȿ#FD  {2hYF22`n60hj]IF]H]H23h;3`+o FSKh  3h;3`+JKhԙD\3PT\*Yzx 1)S0:BOX E ܤ KFE*i5ܫ Eȿ#D/O q:h2:`6h&IF&HH&H;h;;`;h;;`+KhԟՒD\3PTFB@B2h'F7D22`9F(?Z3hp;3`; Kh?j?l +iU44ة 0 h-O} FF#/(Kh#!i #"#i"# F(@2FMF`h7Bf  E?`IDq(i 2 \ 6hWIFHH : Kh ( : *xKhԙ0+ # " F>(i!F0D3 JF F[hK>o HF }  E!IDq(i 2 ( : *TKhԛ0+# " F(i!F0DNF3| 2D!x)7DAK? h  EO QFOq1 Di2 3KH6ph0IF0H/Hs0;0+?RC#" !F(? 0;0;Kh?4?6/ 2CH:Q Kh+# "9F Fx(i:F!F0D3 J+i# K hKE &`S`9Ho h0 `T:FFb >!hFH(+Ji +hO 3+`0FF+h;+`+"Kh A "hFB+h;+`+Khԛ&h  XFF$F(:F1F0F( 紥 0 ة -O[O[N;h3h3sh3VH^oSL#hRK"`T R $0(F30(<+ # # | FOl E ^AKh .3h0sh;`s`0;0+a7KhV  R2 ܾ' `FSXSP ;Dhh0 KhXhhh`X`KhhXh`X` hY` ; =?a [簥 `" < 4 0 -A &M2; Y J#+`Kh`JhZ`\ Y/ D+`hThhB F FDF#F ` -CF LFFh"hB#hO bh8F P#50Fh`0Z"`d1  "`3(Нj IF H H2`h{  h XIFFH 2h-O]NF FF3h˹IrhK* FG()FHl ;pCO5#`o `Ob)F3oB5?# FPD(pCOгhS FP (pCO3hkh[+x/+2(FPH)F( FP(@B3h+@ހ!F(F5(8H"F)F `Z(#FyJtOa4otOb!F `34 `F(OakJ ` `P(fH)F/!(F騳/! F逳G9F@F4FX3i+@׀si+XOX8F1VIX"F0;0+@F$F88F (0F'F o3i+@si+shoc)FF[ #FP2-dL"#kG#cchC3B+ ;hS"##\0.+ѻi3k B8F +ˀmsEsBs 8i B8FBs h0B_Ѫj BF7H0ҲCBF#  A h+ii)Vi&J ! X i(j)P+j J ! d XF4 BFPF 4BFF8jpIF4nBF3DFF  RvF(ѢF(Ѩ 0YF(` QF 0(Dh`:jJ!F0(D` FajQOsEq3J!$4 j(+?KBsD( !J 3j-+? KBsD-;B//3zVUUU-OFNNFNJF!Fk+"*FF .!F 7h/(FOO+k'(FFx5h(FT5`5h+[1IP0;+R#llIllIlIll%H\ !j`jFXF #sal[\0.+ѳi+"!F(F03l+sk!jPF,9F(F<F Fk+)њ!jHF#sc gYR-GFhFI L 1(IjF O 0 J`#3O#ah'%O JFAF0FCfюKbml C"mCЊH1 K`m3 id#eBaoCC  Co C@M#hE+c)@c(@G#*j+[+Z oKc`l+@rcm+@ph+@n"miKiI* F*F#c.e0F`i#d1G+HO|WdotO #ã`#d#3`ce3m3Oe`#3ced&#`#3cedO3e#"2#Od>`O ## 0#cf%E#c#cE #"cdff#cdf###`# ht@heYzAx#`#Oa' 1#'cbb#cb#b#a##d##b##g#cg#cd#f#g#g##a#0##0#cdE@4+IF+Ht  E$I8Fj+[b#hA*ѢEEK#n Km KK+++KK#n Km KKKKKI hH gfgfeYg]ffeuyul8FKh<jFHD\ D8 R8FKh<jFH D\ D8 Rl\m!J@A DOb!FOC4,hfIFH mBh@AiJ##THKJhhC F Kh F!FHrh  d K\hjHOHFO hplKJhhCKAh˱K "!!JCS!bt0I H$pKNhK*FKhU(OsAq3F F0Fp@Oi( 0 D *:L H Kn:f*oB (КmQeppGIOpC O س_гO I * @O г`O% /  | @ = 9K-AFhmF,#4HF3Kh۱3Kh+5 #"2/K!#0,I $+H9FD)K)JhhC40F&KDhC%KhKhpCOѨhD FKJhK) FFKh<OsAq3F F@F9FPK0Fhv, L0 D *T L DH d hF8"K(FF  BKh[5B I2`IYBBAI[bBA5B 5BY 8Fh82;CЪi Fij h-GF ~K}Kh F`&h@@@ 2;C0m+#ajoH0mKh+| "''KiJCS!B0dI ibHphBijPFid\Kh#:h!k[H\zh!jXHXXKh#hiVHPh0C_WѪj#RIв1Ck "NHak8LKh+g  IKJJhhCf0F=GKhh;FKh3pCO=hpC O0FV he;K*Oh:K*F9Kh<OsAq3F F8FiI# h ! I!(0?gjH"I"OHj8FKhK0FhZ ` LD *Tx {@  L DH | d , 0 rHK-OFhEiCj3DDKh+DKhñj3DBK FBJBOhhC55;hE FOi9N!i3hB ݉V"i2`#h&˹)F@F&FF@F&9F0FF5OEE1!: C@&06hi "2B  E KajR*h*jJDVEF FO , 0 D hx .K-GFhEiCj3D*Kh+*Khj3D(K F(JhhC5y%K5hE FG꽣i)F0F&i, 0 D h FFFhFCF L K!hF/ FP(AkD MKca #k`S0O0jpCObi BI_'@IhNTp##a0`+@:K:Jh`:J` #!#a*`*@1Kh1K.`O8#"#h1:??3xh+$##aY pD//EKh.A2FHFQF2C9K# !#a*`+c##|ت  W! N-`m8@ /%/^;NOFOA1`Q F CF"FHFQF2NqhC[ѻ4`O S3`/6h/o03/P$KOB`OF"K`*?W0GRYBJOS` GQPBOR GQPBIOR+ ` )OS)`Kh(ORO  KMi+ Lch+ݠhOBiFMD(`` Mت |#LcbKi #"#h14 F 3tJh O0h"(|ت  Ki* I UO0h(K JIhhGت W! FFF$*F1F8FMD-D F,FFFF$*F1F8FMD-D F,FpFM Flh,Nh1i)FMJ#s`hB`3` FpM#s`l`D3jJh Oj FI|ت "CFNLeh- FFhBFJN#cbs`(F7isc`?/f(f3h +P?I #c`%( +U#"#h0R LBhcs"(Dg`#s`cj+L%-I 3~h+ #c`3xhE+#c`3ph+3jhE+cj+3bjJh 3Zh+3Th+3Ph+(-K'gbw`hYi(FA I j I3 I8F|ت dTX!C4K𵅰 * 2MjhB1Jh:*0I  O0ZhZi**9"Z`kh+ 'Ii!`* *"i`Z` !I *@!Y`B(݊BOt'"#h0)"F3F2hf0)   I#hMf(#k`Otت |N}m(O-G FuFFO#;!Oxh(.9)0!h0B F)"I9$BqF F!h0*) 3l Jh O0x`a  0+|ت F8N Fph(%6Ki+<+-t]2I 6-qT#'"h0  3()Jh8FO0p`Bc+ڳj+!I"F!h0),3 Jh K-`t(F!F14CII#h0M(3 Jh M# s`|ت @m m-O]zOzK F:hX*FJtHV20[bS#"F20+:;h+ʀ!0F##eJBV|dK:FV<1`J;FLOq.]JL3FOQ$,@XJXI(Fh ]t0ӱQK!0F##GJMJOQ 錨1F MEKh;h+BK!VhAKBF8FV<1n6JCFLOqL9J;F0 4O yh&J1Kj!0F:J!@FI  1  L10 FJOqHFJOQf猨1rF MDg,khت W!R@ " A8 |JTX! -CXMYNYLh+#3`30 C#i+NKOOh8h MKMI8hh 8h.,hIIhMFhjpCO$2C`iM`@Kh+?Kh+(h(!MhM6(h("0 C #i+ ,O2H9h)K8h"`.O3`2C#3`)O#3;hj3b0 CML+h# h#+`;h۱KHh2v騹KOR%hPOI1<F F(FI . h.| ت W!W!W!{ W!ySc\X!,KFhC F0O0 -OL =OOu-Kh+,I -<,()I"FH+d$Kq"hBFB8 I O0*(>0+I HOq$&H!FiGL#(  W) !FH J`Y  ! TX!-OO 8M$8H+hFFh9FYFE$кXO;XF -I (L)Kh+(I(I FO $@F+hAF#H[jGF0+hiRIJF$HF+ k!F@FG(HFKh+II j*hi!k HG("2"TX! Fl /!MFHF'p1FH鈹h/##p-K)FJ O0 MK0Fu")F1l/#X;9FK JE|#p 紱  hF;`+ MhZ` "ppG-OMO3F+h( (+hjG(+h kfKhFF+7рL4 F# FF( F((O3uKh F# F(.@΀nI" LkKh  (ڨ Fp(оbK4+`O"FL2(2r8ZJh P ;+! FyKHIH#y/+ 8KH1JIFH+/ F FEKh+ F(0K@J+hZFKF F(O +;hIB FlG(UC F(2? F(: FF('! F(!#y/+ 8H1rIFH+KBFHKFlKd0[2Jh ,;hjGI" L: aU#AW(TX! W!-O/( /[M+hlG(+hjG(( SKhF[QKhL2lOJh MKhùMNT+hjGII" L (ڷ ++hIB FlG(8KSA F(0KS# F(+Kh+*HL((O;h C#HL~:h0B`CXRhBAKBA FG(! F(+H+KBTX!W!HX! W!p DX! 8X!  0X!#y/+ W8tH0HtIFH+qO0:hClHL0+g;hKB`CXRhBAeKBA[aO;hKaJ+hTZF_H43h [Kh ZKh+ (;4+B +@;+9OHF+5<1YAکP;h+?ٮCO;h+?Ԯ(hK"`>J(F232;Kh+:z(90+?R̐0+?K.Kh#0B&HL0(00;"KBAKBA%KH4+> +<;+ P( H.PW!fHX! W!  W!W! @X! W!8X!0X!X!X!x"FL( 1D8Jh PJCFh y 8F  (+1S2J8h _O92BA BCX0)sAF8FD(O9HFYBCX0BB RICF(  L\( 1SJ8h BBBR ICF($X! NlpL-jMN)h hl( #haDa2Br2p 3h#b (ۄK"O0` TX!W!P-A  3N2BOtqF FDaaPеh*F#F0hDCFDjFPFD!F(Fv(O00mdD[B2-t2+OqqnF*FCЫB*Fq FFiFDdaFF -CFL FF. C, @ܭ-ؿ%F(FB8F4F6IF"F.'D  -OBC XpFFO>0FK8Oy$# -w'.BCX0)s0F-w6Kh /CY 1b2J#h @I#* .32C O0 /Bw0F*F(WJ0h 1cE D-gw*BCX0)sۘT4B IX!l -AFDL- #*s&%' h0B@!DAq#h!Fi*F.F+Da0B BA*I  (%K"O7`#Kh#hB+Da'8Fua(26DBr2#h2FF.lF3DaKhYi)0F\)(0"hBDa܈ CW!TX!8 Li#hB ٥i!*0Kah8@X8 -AFO FL- C,=iB1F,F&DF"F. -F#DaO0 -CFdFO-v C,8hOyBv 0O,FF"FF0\F#D,0f %FO0 -GBC̰FFQXVh 1F"hF.7W!𵯰FF6F4#g##9'N3h&Kh  FK뀻3h[## J!Kh[##J!iF FK`0ZhN+0VJ#Fh /0L J#Fh -iF FK0MbnRpF FFK p2F)F FKf(Kh,0J#Fh O0W! FKPhKh,0#FJ@h eW!-GFxFF/+O80O/ (FO /!,tF(EЀiF(FKN`@(Fl0/##piF(FK$됻p@@O0&Kh#:F1F(F!(FK(iF(FK `(FAqa#jF(F`O&O0X!-GFh#x/+ 2Mhh(1I"v#k`O09 "G@AK0UH0`#h#J3h N3h ;d'0`!h;FBF1$(0<0C@$8F<>( K$h,4 JQF 4`yDV!*W!KAX!-AF FFFFK|(@.Kh (BBBB#I2F O0pCOI F/>h FK(0J#Fh 6 FK (/ !F0FJ(0 F(/J3FAF DX!\>zS0F(4pCO)BCXSh(s RRBA## E `iF(FK0pCO  I*FdO0'0#"#iF(FNSF( P Q# 18pG-AFXUd>J(04>J3Fh eI*F O0 M @)FJ^I*F(FO \@$(F<(O P@$(F<0{(4(?y$* #@c#`c(4m$(4*+#@c(47K?Hh/(!(FJ(U(FK&(707JKFh Gq(F#R1h 2(F#`c(40*Kh+7$SV 3QJBJA"HF# $@0@*F(F@AqU0+(4 0CJhC J#W!l(X!X!X!KFl X!pG-OFFFF FѤ _0+#`00CEFEF[0hCf#FBF#` ' <*F!F8FBL0&Jx3*/A$*F8F-)80Jh EKthhDFFI O0IH hj!F0D-l `*D f4F|X!X!X!X!sF F p$O2O3-B) 0 J+Fh FO0I"F0FJ(0rJ+FV!0Fh F(JDO3+` KhSQT"4  3EE#0W!-G"]YFi4%/FF _(O SF(RF0FJ( (Hx#3B DBCXKhCEBT#I( O0 "]0FJ( T0J8h [B`CXRhBBTI(#"0F#-)T0J8% TN-C(M(h #3%Oh$N@Ish;s`+ 0FCѬO03hZ2`x0B#F4FhcKEUFh"Ui"8F(`( kiSlaki+ (hka+`V!V!HKJhLh+ ##aCaKhiC@ahc@@`0 I08`AF~F( J#h&F`FJ7F`!FKJO(FAѽKhKhZQJ)+@K`(P @=& hz(;S uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuAuuuuUYuuuuuuYuuuuuuuuuuu!)uGuMUY]ua %)-1u;`2K(` 0I $0@` 9+K*Khx-*)JYx#``#%K"$K%J`$K$K$KKh+"H(̀K"`"K` 0K"`J#`J`J`W!X!X!rW!h A& (X! WDX!X!]X!V! X!lK Kh(C xKK KKJ030Kh0)Kw E  0FOF Ip 9JhF; F Z` ~KJ[KKRKPuKh(?^uK|JI|K}JF{K|JCyK|J@xK{J=vK{J:uKzJ7zK1eKhhK1xK+xKxK`KhvK #0'sI`*+?oJ`oO#< h(RjK"ZakYL#h xCfH+N `x cK#`bKL"t7^K`(@@ h(@'WK"`VI  ;6%hPI(F.2(@ch+{a4;i3;aII.$(}i4DIHF.(BIHFb(@JF>Iv| EFO vF(Ѻ%(F.IHF.h+?bJF*IL(FFRI.(Oeh-?Ю47FQF(F.KI(F`FP*Fph(!{(ڣ>IHF.p=I"HF. ! !HF7N 0Fe(?![(0FYF(QF(F.0F0+*F7F4!(FF%Kgz;`"J!FO KF(FbAFL3I@J `K`K3@C‚:hIHLMO.@I0;0+򢂰1  W!nCh<Lz*πGEAKN{Z`{)/5;~  &)W"FFK(`? I _7K"F`K"F`KFhK`K"F `KJ`K"F@`K"F`K"Fv`KFvh(ԮNKHh<#/Ffa*Тe_  ) {J!`zJ`0`vJ`wJ`" sJ`sIFfdKhB(FVmK"FV`kK"FF`iK"FF`zF6wT"0aKL#J`K`F6d  \I\I\H#[IXH8L#XIUH2TIVHuAKUJUUK"F&`@PK(q LIKIOrF&%HK"F`)KFH0h-0O30FF$(;I V.Kh ((F5K"F`3K"Fv`1I ;ɻ/K"+KFfKh>(Ff APX!LX!& HX! WDX!@X!M.hv#y/+ cy.##q.9I #+`.h  5C!F*F(S4+;+ CA@F(Э CA '8F,aF8F&#h;#` <`h P F W!V!LK-AFhF"F%F;8FjFe(F,T(Fkx "x0;0=U F5`,F8 ([ P E :  #^0`v.+O0- FF"x !cx0:0;3D+N4sa"x cx40:0;3d"SClssa,090:"Dsa"Fcx 09F31;3a"Fcx 0;09F3`"Fcx 0;09F3`"x !cx0F0:0;3s`@0O0 d3hFEM/hS@=I:F =I# +x##a D;x{!F8F(%2I:F =/&a*c* C*M* &iFm*&iF$I;F { F#iC#a#И0@F(IBF#iC"aBA I;FBF P Fg#ca Kh` ``hTah   I    & XX!-CFK FFh@=,W! Fѹ hI  h(BBѽ@F#eG$hX!  Lch !@``( IO0hX! CK-OF_h/ZX4+K84+FB0CP@ShPF,6W!F\F LF#BEBB) i, F(Z `U##ca9G&@ ) FI zO0!h @@B*04+ ## 4i;a+i h0 F hX! "K-AF\hS8$*-4+);+&B0CX@0F, T!@U 5#EBiBB F+ѽ h0m FAhhX!K-A\h&T4OV_]/Fi8hQ8FN-ѦBѽhX!Lhs!LGP`0I O0JKh S BB L h hK`0-#h Jh ) hG hX! W! W!!  Lh !@ g`( IO0hX!E  L#h !@=M `( IxO0hX!y P" 09@ @B-O[NF3h+B C PO0B0C XPF0CEBCO#CFGFF(Eh+:0AP"F(@BBX"(SZN Y(IhxaB C`E`B0CP>BEB<i  BE""C("FBE/ X##h a` I *I  ##hX!   Li !@=ea( IO0hX! -CNiñ%O F@Gi\Yd### hj5BhX!-OF-F'K0@=HF,X! FSFYEHEBBЛj+0 F `v(H%@ FuI OhX!P -AFKFFFiԱ@=F,tT!@jBEBBB(FO0` h2 F/ hX! pGF!KMFFh{x/+ iF8I*F  MF( FI*F(Fl `XI*F  F M@3`## ##07Kiab`W!  hX!-AMNOilcha3h cjh h\;h C #3### h Kh!j h h FihX! X!@)s¿@9@@!F$%FB["B8F*D1F F,FpP%5 D-OFHM@,}ЀFLGRXk1F@FT @FL$O #hB-Фi, BF(q#"#*)_2FAFBLU&`##0S' aC'@;#*|#BB , Jh #O0 M2FkB,J2FAF,(B`CXShBA  , Jh  F,JI w    ; hX!-CF*KFh7)I8F] @"W F5 F(70FF `p(F``0G(@h,!h0F,(fh(F1F,(0F(F``( I O0LF0Fs FpIhX!]   F KFFh h@"T @T!h(F,`0ah:F(F*0`hhX!pF%)O0BB4.3O-..O -HTHTB DEt039TSBD6# F"D0!,%CO0 p T\TlFF0OpB DB0[(DDK@,-A]\FO. * F7J#hBD",x/+61JkF@   (EO0 ]+]** .& CDl+F]3D,?*D+FV7`\&JkF@   (JkF@   u(ڹ JkF@   fh    pFh FF*F3e-p@(e"GF*F hD#(F#`3`pF  FI  O`!KhOp!pGO`X!0#L#`\3щhY`ah3!`!`h(̿  0O0 X!8FxO08I"+Kȹh2"` I"FOqF(F O0"`j"-ANOtdFȱ%h1F(F+dh 9F F+xI#F*F P K J I JO00;+I#F*FK"`YgcX!-AFFOq0F(O0BB! FU,~S #840K;+dK@A@A ` @]K "dFBH]"F (lQ"F<tI" !@|??Dy`" !2B`BPBPBK`PBpBK`PR hK`B 8 &2)1)(4*1y/)CCC"(4#$84K+!ٖ(4/5)#4(4C C(43y/+3#3q `/"CC$"8$K) # #4T0}hYBBU`!BCC(4BCxhX!YBP`B!B X!X!-CXŰF4;+: 9("((Kh;%(FETI( TI(TI(TI(I(`mB#IFD5F6й/ѥ++JѢIBF;+Jh3`pGX!8IFHx h-AF>OFF|ẖ+ Jkxl<+=+/ Bkxl|+#F Kkxl&+#F Dkxl=+!#F = jx+*k' 5jx-*k( /) -% +# )$ '#F $#F !,FF  hY!Y!Y!Y!1FKHhY!bKs[hM.h+`:K.`0FH"xK*F*<"` F(F F*2hx*,h3IxJ\ HL3(F!FpY!e!pFFF#- _iXfm {6E'.2~ t=HR;HO(ѳ??6H ,)FFp)CC3DAa?  @ !CC@?   XA@XCABq BA !BABqBB  BB @@P@Y@CC-OFFt %*F F,U G9Fv &*FFH## ;FG1FF,CMFDFF F(F!FY!"K𵍰#FF#s,F F;F2FF F(F!F (Р +\9FF F/. TF F F FJ!T" `Y!z8 FMh)+8)!FY!-OFFFFO O ,v,~,7,:]H,##LFF$,|",9FHF0#+F F PH:'+عtLH  QD E'G+E)0h+F F'6JOO3#FG70h" ## kK #%#;F1FFHFbC $$##y;F1FFHFQCCn/', JO4$'F$G!E"zY!-OFFFF8##F1+FF F @+ FF m;FBF0FF F  <E - pFOu(F)FFH FKX` Fp@ F*2h"+mF**hdFHvpY!PpF Nrhr Kha H`&\F (Fp`p Fp@Y!$z-OF rMkhchKoL #h3#`kh`#k`#h;#`#hKh lh\h"eH JihdH" E aH!F F8F^N)^x0L9F(`(YK@h3`;x/+oh;F7x*KFMF+h3+`Dx( +h;+`#Kh O0 +h;+`F#Kh .$ H F K6 0#KHYh 7.Y!Y!lY!vK-GO sL F*qO ;hhtnH! F(AlHe(O S`dH!F0FF aH2F!F0F(FPF(0D0jF'J;h(Yh0D F(4F)0FfO#x.+'cx.+cxIK%FO7O "!FFPFx)FF@H#x-+cx+=Kh,\h#F/+9H! '(0FDz({*h+*'0F(0FpCO /0F'(O 0F !F0F)PJF0F!(/)h+)'0F(l0\F@F(b!NY! KYh)@"H @HgY!z8L$(M(FF0&Khh#%HܲL, g"MhhH /kh#H)L h 6"hhhS#S hCh;C`+ ?"hhY` "p h #hX )PhF HhZ`8"b!Y!2S-G FfN2hS#S5,FT_I@F)F(\I@F)F(@%F'O E\,@/Yx0)^С\ز({+yxxxxzjxlnxxxxxxxpxxxrxtxv F0hCh;C`+f 2hhY`pCFFK,+hk0hCh;C`+U 2hhY` "pU;+Ѻ 0hCh;C`+M 2hhY` "p0h w2h0A#$I S3AF$ xF10(B0јF$$ $ $ $ $ $F$hZ`hZ`%FO ^'F[hZ` _^bF)HF FhBhB< + #O;h+@"Kh"I"H {h#zhIH H2F)F ,IH FkIFH nF,L hCh;C`+ "hhY` " Hp@ ӻhZ`Y!Z!6nJFh5!`vY!FK aXi0XaO0 U FY!K\i"a"FiF aDDDH Kh3 K60 F! ( (Y!`!Kh "` Z!RK` Z!FS[))Fh FF FF)t2F)Fh FFO0R FFO0 FSK)L!Fh@pG8 FF)>*F!F8@hO0R]pG FFO0 JF0 H ! J HBѲBPh2 Y!qKhpGY!pFDF h( ")FCBF hC&``h( "!CCF`hCf`(FpO57MHV+hhK"6 N K\h\-h Kh#F2F(F`hBB e$h F0b!Y!g!sF$N Fh+' !<#XC`h(F1F(JF! Fg j` g++ .#x6+ cx0+I" F'.hp F("D=0+<.+(F"pN@Y!K"`"apGY!F #h;+h "iFO[h#a iH "iFE" FYhodhhhh a0L%jH*F!UZ00p bB H!UJ0 J#jhy`q j0 jFK#bY!(+0Fh+уhch@Kh"hh39g!h-GF!>O0FO5F;h3;`hFsh@F+gF4K\b;h;;`#2Kh h1`h#hhF( -(FCj)hF"Hrh@Fah:";h;;`#0 -!!(F +CD! `h!- PC6$h`h!(FC,+Y!Y!Y!-C FOF^0Pc! N!h)3_{lCP rJSb$qKh E+πlKXj(ʀ,ǀ E`hAF^0hh, `h!^0sjhC$&`h!^0+h+sj+SKh )F Fj)F F@EKh ~)F Fp0 t`h!Z^0+h+sj+h,Xtb4Kh \AF F/Kh RAF FN*Kh HAF F%Kh >"iK"Zb`h!JSj[ Sb`h!KZj*"Kh  Fv")F F H H s +Y!0e!(c!-GF!K!(Ft&hl` @EF K^bױ ^0k+hD(F& 0+!Fe!Y!(-GH(Mh7%L $K & hh0*x  0;Jp0+k +0+xF;F=FPM+{#hF K(FjlKXj6K"ZbY!`!-AF!LF&i3ahh!%^0hh+#i;#a+ #`+ "i:"a*#`ifb;a;+fj*hcj * +Ѩhhfj++Y!-GF4GLF^`fj  oh/[ `i3a/h)i0+/7K7Nh0 =5H :h 70hCh;C`+= 2hhY`="pxh N0hCh;C`+0 2hhY` "p0h "yhh :hAF^ fj"h;+#i;#a+`?h"QF8FhhhZ`hZ`+#i;#a+`ifb;aY!f!e!-AFFZh`h"0Mh,4h #'hdh3i0F0YhN#dh9F0kj|hj^ R"h *9F0kjkb[vh#FY!e!-GFhF2h J 0chSYKZMhZK0h ZWH W9TH O.SH J(hCh;C`+3 *hhY` "p(h JM.+h+`%! FNRF!FF/(=.HFANM#sb+h;+`+5нIF(h " mhZ` ((+h;+`#.Kh h! `hGl+h;+`{. .'!Kh+нGKh++h;+`pb#Kh 0+Уh+Kh K0h H KGh *f!e!,;Y!Y!Y!?OKpȰhh##IK0۱hñGK &GMhGK0h yDH vh BH p=Kh !FX5K `:Kh :$,5K"ZbHp!F(h2F dh G/H D'Kh "K!hv)L !#h3#`K`h 2#h;#` LXh#h 3#`K` #h;#`+ H Kh Kh+Kh+Y!f!e!PY!Y!WY!aY!#O23##KF F^0+=(;Nb3h33`x(H!(F")FFK0`h CD! !(F C:`#`3h;3`#Kh sh Y!iY!K-Ch$3 KM)hbKh,`iK`[`hhE(@N%#i F*F3`+dh,"N'`hm`h4#ih3`#(m# `+m 0v+h`qK60KlKi3 +¿S< hK0+T +'cN,@$h&x0+x0+1YKh+@3[h+NUJ!h3`[h Z@# ( JHdhi F:F)Fdh h2 Yhh`@Kh9K0h d='O eh9F(F$F`h Ch;C`+D - hY`5Fp{(F $h,N $,X#Nh0h-[Ch;C`+_ 2hhY` "pKh WCh;C`+ hY` "phZ`hZ`g!e!Y!f!e!(c!Y!if!GM(hCh;C`+ *hhY` "p`h P$hhZ`"F)F xmh( $hZ`#x04K eh:F1F(F'5$h -KB%C FF;VF˼-ѐ- рx8 Kp(%F (  m0 +YD#x0x0+?Ȯ;+ JB?JB? >Q$EKe*x03+ `(x)9) KB@3hF3Qx-(Hx(-(ъx*Fh# C + цK"Z`h`@"` C O3Kk K!h3 (@yK3`xKh3B@f h < +Y\#x0xkL9!`` 9iJh#c3`gK"`#fJ`fJ` bdKhS#S G`b YK` 2]K^J`^K^J` 0# [K`OK"Z`* c3@9 DKB@O+ BKhQ`hR`"`+@u)uEK&0+=ѽx0+9[hh+2O3!3#3!8K h"`%B)K"bBGF/(o$K%%*F jbB K` a.'K`@*F)F F  (@CK`Kh+lPi($ K"%h bBJh;`[ FQFHc$Y!Y!g!b!b!&f!Y!Y!z{Kh+F3bxvKh+uJ bC+ rKrKXjhqKBh 3` .jK% j^ Cm #F _L#cb +@ `b\K"`VKh+?TKj;Bv! QJ`KKh+h !IN FA .5F"+h `#`Os >L;3`3`#h3#`;Kh`:I h e#h;#`#-Kh s3!(-)Kh+.$ O Q'K!`(K`'K`#K` K`L. F+h#` >Kh 3` cz XJ`J`hK` LB ei3az HiY!Y!Y!Z!Y!Y!b!f!Y!e!f! . eJi ;ahcL3` `K F`_K`^K`^K`+h #`ZK`RJh;`WKh*""QKXj  NKh+ #l JJBJJB@K!h`#8 .CKhKh8K+?5K"++ѽx0+[@$K"`+Kh+?p j$Lj+ ! !h jS [KFj BB,`h)F $h + `B `o QkOBH Y!b!f!e!f!Y!Y!Y!Y!=HEKY!Z!KipGY!KhpGY!JFpGY!KȃpGY!K""pGY!( FHh" H ! KiBF)"hxc*""! Y!JF+PiSapGY!K/!0hF3#$  FBH!FpCOH!FOH!FB(PCO (F6"!FF(%F(F)0g!p%LN(Feb3hhñ'3hh!FY&c(Ffii3cafaO`jpY!b!(L HhFai)ipcj i9B̿""`F""a" Y! pG pG-CH{ (N9F 0 FGAFFBIFF=hWI"F Hh 8  FFFB'h/ m)F0FT 1K`K` F'`b!Z!-OFhFF/V* F%&:FF;+D@F &$\D0B+#!J F-hS`I*FF $ Z!R -AF F*tL$>Kh3"1FhFFmah5H 8F A2H 2H )0H1F z.Lk hCh;C`+C Y"hhY`*"p hCh;C`+9 K"hhY` "p4)MH 1FH +h`h3+` UFhF+h;+`;H  HKh+gH1FhZ`hZ`g!,5Y!>HNY!R8FL h0*xxB%+`h8)F'p(48FL h@x+xB)F'^`h84 K "0%h I:0Q;+г(,۝rhTZ!-CFL%dd#h3#`|-#h;#`Kh˱C῰0[ChB h;` 8h(5+0FY!Y!Z!T"K-AFhO6Bt%3xF+BQ:*(l<:+5:)lM+h+r.` F.`F*%*q H9F(.F,F,Fs$g!Tq-A&MX+h3+`|.+h;+`˹KhA\0+ #h`h;` J F2H(tCE?p?-'jh*?e'dh*?_'^Y!F8F7L#h3#`!0F6F *O   "h:"`*Jh*?\  O )  g!pTqY!zY! Z!-O$&F'FFFFO HF(1   !H ;C3CvK &O h7FFFFh+@oK|BUnL h #h[kH% (Fb=-R%MIEIWH)I/IWHWHWHWHWHWHWHWHWHWH5I;IAIWHEIII#O O O '&$OSк)Vл,!FPF5J/0KRFXFh3+4н 03C,? &Kh+/I h `?d!XF(а0+R#I!JII,н 03!XF!P %F,b!Z!Z!g!Tp FN!3h33`0F+ +@h +#kh`krhc`3h;3`3Khp@pY!Y!0LFF#h3#`#0 K>00 (F#h;#`;Kh#0@λ0Y!Y!!@0+@h -OOM FFFGF(FX!hM xc+7CWIЍHp(v(V('O&&/<ЅH+hh+97F+h*`h,l F Hc&H`H]!Fa.+h'*`haH' ~'b!'<Q_og!u|V|-OaLFaMF #hF(h#h` .؀.:.) .c/.*TI h: `*OkF *Q"OONOOOOO?NONBJ z>N(3h33` hxs8H F"O &/*ј0/+ sF"pAdJPF@Fj,/K :* Ҳ * 2h:2`**hQ)`2h:2`* *hQ)`ZF3B*`,B*`Z!`!N-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`3h;3`+;h+_"#caFh[aaNOcihHhBȿ`XhB"3h33`rci3h;3`+;h+3Z!Y!Y!Z!7Fx F!+$Kh0 0@+*+ Khh"E;S/ x* 0; +&# "` FF&h+x =+T Kh-+x+KhBۛhD9)A+. *FqBF*FO B1 5D;+J :* Ҳ * : "+ &: [b "FZ!Y!Y!Y!`!EK-OF[i FK G`kh`h`>KF&ZhVh0 0;DE #x+ D`F xɲ)K `(F~&)AO 0D`lh `h`aTF E#x+$Ё+@F  F"0H"蠹 F@F"p H"LEF(TFF &FZ!g!+Z! M L Nhhha#hh3#`L#ho`;#`+3h+Z!Y!Y!8F%v0f)FFB _KjD``b8Z!) FOF{;2F6h#9F`F0FFahhh%( 5`.F*h,`#FFF4`&F#h+%`F! ʿh1-OO FFF[غ*Tк?#xGк #x+4#xSE4T& غ\#x+4!xCx$ x۲+?b+ cx;@" 4#x+ #x+4Ax#xQЙB4+4;Cx+*+Ё+*xҲ*?+[+ѠFF8F?*И 4*4"xB)Ё*FbxBИ 4B{x+ѮAx!)^)5у[x.-?l]-!)^)&ц##x+ +cO x;xɲ)@+?J[+5FZ:)5F[;F>F#HI(F(ШBqx)ѱx)ШB)x?JQ\ BB # pF !K .F;]+[E?,7F4`5BЕ  85qE8+\+ F)x-)&ix])#Ё)\)5 k"# ( #6 (ؿO 5BO 5F0+?ٮOFDF-OFF F"#x*+6?+4[+=cx!+^+ѣxx./](@[($Xx:($Xx^](/(3x:+ѳc(ўx+/+3F:(ћx]+竱/+"(3x/( P3狱x(ف+4#x/+:4"TL+FfjxxҲ*ف(1 x+ 1B`j`j)A(EL $BICBx/+E#<F($0B/#<#x+5&kCFF xɲ)ف(F08F./#<x F1xҲ*ف( F+F+AEӯHH& 3(F/+*/#!F<8F:F(Z{.*Ѻ. "@F(.(F$3Z!>RY!FpFx3ɲ )F &x<p,XpxQ-ً,p+F F,F+pFF$M$N`hF;C+j`h`#F$h+b*+?+[+3h/j33`kjK%VoO` hbahhjhj#kb3h;3`# Kh +jB"`8h8`Fh(Z!Y!Y!8FM8+j`h`x,b$hZ!-CFxF0۲ +عB1"FO FxV*F !F&FU*ѽ>L .++*- F!xB`   =) ЁB MB*FF !&F+D%++2F5!F-Gvtv F FO#00F ! 6F0и/ N F-#<=O3h;3`+K`! *-OF#xF-+ F +@򉀣! *|L[?+v@+0; +m&# "`0FF&h+^x =+Y.@!Khj-gNMLx+E\ ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xpqK&qMԡhBK yc0fO;0+;hZ:`"yp6bK_Lh!h& `^K^K^KC;`#yp@-VKhOJ!bh,KMW;+x+1+hGN;+`+3hZ2`"p+h;+`+3hZ2`"p;h++h;N;+`+d3hZ2`"pC3`#pC3`#p.N=x+0 ;+ +h;+`+3hZ2`"p+h;+`+S3hY1`xp~C3`#pwZB2`xp+h;+`+ S3hY1`xpx+ћ\ZB2`xpRC3`#pmb!`!Z!`!Y!b!KZhVhK3xKhW+*?  ̀-ʀ|x:h*?.@A)-x*ДIP h: `* Qp :* : * Q!p : *J P xpB "pQAxp1ɲ )9)Ko~H p9)DAK0xp x):h*?.?}x :*RIL h: `*, Q!p ,: *$ Qp;_A!pWKC0 xp谶IB "pAB p:B p4+KhB/hF>S&0%C#`#pZB"`xpd3۲ +3h;3`++hZ*`p3h;3`+S+hY)`xpx+C+`#pZB*`xpN'Mg!b!`!Z!-OF; (CxJ\ O O =!@F!M 3G ОKJ.h[hh<Ѻ _$O &@F.hKFh@ @@ "" h@*"b@F ~K.hh}K@,'0@+!*+Ъ+rH9BFx+к#HHF R$$FO h49`)-)hH(` p ;ܹ 3O̿F"DO  D @ЀMK)hhD)`LI hD `xDJHKA`pEKF?JDFRF@FLDkO ;Lt$[FА'[FF$O @*-Jh*@B@"(--{++++ K  9) 9))ho~H(` p9) )hH(`~A)`!pwA)`Z!f!`!b! * "h:"`**hQ)`"h:"`* *hQ)`jEB*`>B*`\$#"~)hFU(`*["FiL8F!;x+@78F4*@",8FCB[x+@*B$7,tX0;0+70Z "pWkx+Ѯ0Fkx+ ѕ0+x@++y=+ O(YJh;`CE#hZ"`"pO C#`#p MJh;`+ #hZ"`"pGJh3`C#`#pBJh;`+#hZ"` "pmC#` #pj#h B ,*2I;#` h2 `O +Jh;`+#hZ"`"p?C#`#p!N#kx3۲ + 3h;3`+#hZ"`"p2h:2`*"hQ!` Jh3`4C#`#p B"`h 0F9@*Fg!Z!e!`!i :F@hiha0F I h: `*)"hQ!` QF 8J!hh"H`{jx~*⮺=+?ۮ#9F0FB"`B"`.F`!-CF;KFf0 "8L)FhO6Oa05J(#`4Kh;`ih`/;hfCr;h3;` `p#hp;;`++#hZ"` h0* F$AF#j"`+ i)F#j"`i*qh `s`6C#`ig #jG`` bZ!`!e!Z!"FsKhG@0ٽ-OOq5L&h02O;h;;`+FP#hZ"`"pP0F5D(F0 h"K(FhF F2 #h2D"`:hD;`+ `!J h!h F+F+*ѹ"3D0FYB#h@F=+D#`;h[;` C#`#pZ!`!e!z-O*(NF(O !!FiFF3t;h3;`0`KahUDи*HF")F3h 5`;h;`3h"p#x+H*FI  Ja H KFJF0Z!`!\R-OFrO+,FFi0n 9! 0308``K,ah5DNDM ,|,!,FO B ;h"pRF)F0F(fфй44tO BӔRF)F0Fx(K#FНB ,* *Fx)22B8FtBRF!F0FV(AbЕB <+ +Fx)33B8FRF!F0F9(#x+44BӉ,Fuc:h=C3D;`>00B t;?;h<`0;0+ c;`##p;h;;`030CC;`#pZ!`!-CFLFxUh!p'ha0ga#`Kh00;0B#hZ"`p0 h"1FFi FC#`pZ!`!-AF-LFA,H hCh;C`+&"hhY`&O"pB"HAF hCh;C`+"hhY`&O"pB hZ`W&6#DhZ`W&1 hCh;C`+ "hhY`6hZ`vH zHzKhpGhB`X Kh) Khj3c1 i@ pGh(h pG pGZ!XKh2`Zh:Z`pGZ!-AFMFlF+h3+`0j  0j`bKZhB`h`h$hB`g+h;+`KKh3A$Y!Z!Y!XK-AhN,j3h'i33`@F#`D< + +KhiCah#`K$5bhZ`h`h`#hEob#``O02;i+j#h;#`+chZb`x$h+3h$h#+JF!HF?S"!HF?(@F3h"`Za2hchQiWa Dc`F)F+: * Тh:`* H`"`h!`:`*;#`+#+p#.x+p K03`h Kh6.poXZ! L#h;#`+chZb`xB#h;#`+ڽ@7Z!8 L J#hh`hRhaabhZ`#h`O3 ``#3aXZ!FLFI#h3#`"!(F>N3hh(7hi`#O`ma K"``#s`#h;#`3Kh@Y!pXZ!Y!F-N!F3h33`>)H)F%?pxpCO)"# F"|C!" F>h(F I( F>H)F#" F#"`C F>H)F F\B>z H9Fp3h;3`# Kh +Y!Y!FLF#h3#` . O(F}`# K^`#h;#`8``3Kh@Y!Z!XY!pNM4h+hh3+`(Pi#j˹#h F3`3h Jh`i`i[hQ`s`+h;+`KKh3p@LpXY!Z!Y!KhpGXpFNM3hB ЫBѬBHVpXZ!78ML+hB8XZ!8FPM+hh(+h`8XKhB`pG`%Jh%LcC$LehB5F"E p B2eF b`) )$O30 bhU%b)Ldp/0"Fbhc` _!5rO`FSMhB%RKhRL(i hC{OH!>$ `0 h%KI `] h@(`GHFK"N '8F j7/8F> `0>hB! ! b! 5O]! Y>9hB >0$ hZ"F*H 9h h0;$hK"F$H\>\hB 0F>0$h7"Fh h0$h)"F h! O3#` ! ! ` _!`!`<vN`!|F0+gH3K3Hh3KaYC11N% !Ow3h33`B 0B(&K)Hh&KaYC103[h? ѻB5!^0$|h(ЌFH ;OpO5'Qh сBU`p;3h;3`3 Kh@| _!5rOY! Y!8FM+hB+`Ќ@! F[+h;+`3Kh8@J8Y!Y!-OFFF 0hI FOkؐ3QHBݪ IFPhShBE_  ++ +E 90+ і0+k0FЀ F0#00CEooKpHhpKr@hZCB_G_'B "-"fJ!#2Fh aJ !0XF XF#"D  Q=XIXFO #!FDch;c`+ FF#h7/"`!FH( o# X+" "=J!O#7J!XF5J!XF(OsB p "YFj0XF"D(H@[ch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#hFZ"` "p:FYF F7@ _!`5rO,6<ZDNSb0Fp@ճ DPh PU4mh-(FB! p$& F +; CC+OrB 0-OFFGKHH[h x%+c PFPFCAH+%@JQhB!h"D0ӱ Fkx+Ъx2-+%+++3K $i ,-HO)F'KZhSD(K!(Hh3000+ kxp?+YF8F6L4F69FPFs(((F&tKC;Ԕ Z) "R,B4HH$`h _!w-G/N0Hb3ic.M/O+h!hP0F#+H+H"!1h OA%H2O yC1-0CE!Ch;C`+# hY` "p F+hh"[h*`+ HF 1hZ` _!b!5rOb';MF(F03;D+7Hj(p(g(&'$0Khh[h .H!F`+Kh+KAYC1*H$ FF.)9$H0#N#O0B# cC0F4X8hCh;C`+9h0 hB̿ # #P`p;! KCX0hB̿ # #Q`4Fb!  _!5rO*MKi !T(@B _!JiH#;pG2 pG pG _!KF60 Kh Khy Kh KZC200hI FpG`! _!5rO0-GFKM+i+G?_#+a@F;@DO;h3;`(YOhpFkh",`!O O0D"F93k`;h;;`#3Kh 0O! F;h3;`/K0;#0#63Os0h0n. pC;h;;`#Kh W F0 F40O QFF!#F"EPFh2B03 *4t _!Y!Y!FKJFFh`IKJJ` F F" >`ĹDK`/S-BK60+N!F !F !F L@/B-6K60+3KN0+O0˹>F1F >魹,K1Fhr0#h@RF%H0h!F !F K60+в-K"a-!F !F &F>PH)F>"PIH-0+/`!Y!_! _!`: FF JN js0+ ""BO0>"F-OFFF #`iL AFHFFh #h+#h+(F-$0PF300"B.00OKh+OK60+@DE@"P"sGK!Fh0;0+BKh+0ñ !0##FB C )I*#00?#ЬE?O|dE,O4T`$@8`F? OsE!2 O~EtEѐ@D@T`#*#!0DEѲP"y0C0z0e!`!Y! _!Y!"-GF F F " F(0KN0O &@0B(ڽ'JN *3$N0hF>B4h>F F0 #h=@j"FHMO0C0C0 F64Д0ոД0#0*F!F8F` _!$!M(FB` M,+hhё xH l(p(Z($$$ K6 "0 D@N0h+h!7hh "FF8Fq+h*`[h+!F?Db!-O%NOF0FF`t-N0۱$en,p,H=hO Khh+-@0+M#KO &h>GջF'^F[Qhh+,O #1"9| *@@\F#"(FF (kH)F\#!(FgH)F0++ F  8h8A2B̦!@FVSKF( [, З *!8FF% F(F1h6GK60+8Fv ^B4 s O O z@$("0@#!0F0F5ѾB=Ж0+0F<\F;;i#("F3JAF(FS) 50b0+\FF'Ԁ 0+R0FԀ0+8Ffb!Hb!j _!0 ;!KCX!J  0+0F-??"AF(Fx CF+Ж0+0FpF=D5N3h33`F 01K)Fh0#h@RF*H%!F 0+ %K&JhSC JRhB! F! F%0+ Fh3h;3`#Kh (Fp-OsB 0 5OsB-(F"%Y!` _!5rOY!1Ki0H0F -H%+H&1+O0B#(M(hCh;C`+&0*hhY` "p!Kh0#@hzOrFH8F51hZ`M F+h3+`a F,+h;+`F# Kh > F _!b`Y!Y!H|Khh@}b! FHm h@p8L0C1"B ۓPUP-H(F#ca823 _! #-C!F Fo%0.@F+:F* ؀* =*{-آ"۲+N&#:*&S"QWe DK)">+w++ \*э \"zx#*ѮzxF5K /CFF@Fx0? /CCBЁ""Ȁ)K /CF&KOaO#}"{x +Ѹ!K$"""I JICF%:") }*Ix/ј K$"K""+FP.?M"#>;G&h _!-AOFF,ni+k%h-*7]sEO(( &&XUM"hBJ!)(F#h;+h+}HC`h!{HzHh.F`h!vHh%`h!rHrHqHdhhoO=޹ch˱mH hh!+h8F-hfH`h!udH dh5F`H`h!dSHz[Hwh!YhSLHmVHjh!LGHbQHQH]`h!?@HUMHRh!4;HJHHHHHHCh@FH=`h!DHDH4chCNCOh.=H+,h ?H!h0Fh!#h + @F8Fmhh3H}h!vh!rYhr.M"-M"-M" ,M" ,M"+M" J!0Yh!V%HR%HP _!4 =%F$*6<BMT0pF N F=! FnchKdh0F)F Fc0Fydh,ppFN5KFa6 N0+ 2$$!aDi+ <."+*UZpp"pp$i"p _!-AF)KFFFh+A*C%KN0+:P!F F=. Kd F0!F F=.FKd0 Y!KCPO3C`#r܀/9F܀ FAF=.Kd.Kd-O`!`-A FFFBF O333= bCF ر"AF =#F:F1F(FF"AF"h = FFHF:F1F(F F X-OF-l@ #0NN>MKXO ZhKIKhh 3H30KE"QFhFFp[0+-#x+:"FF2x),/*-0 F=z(""B#rڿ z%L F%LM hCh;C`+5"hhY` "p"##  65S] :+хL#hBK*Fh F #cU=FKh+FI FhZ`8_!`f!tf!j`!x0_! Z!-CF3L&0 6/O?U(FBA(K!h? %HA#HF^0B(1.ܔ^0+P60+Д.0+H6Qu(( _B-ѽ(Д^p/ J>FhKBKA9F` _!0e!px+P(L!#h3#`<(#h;#`+B"Kh+>нp@:KhS5!#h;#`+M@Ĺ&F X O R0;#0#0p@`&#0@,#$0pY!Y!8!LF#h3#`<( !#h;#`S 8@gH)FKh+Y!Y!8F F@-`hO 8HH8F!0)FF F8L&M#hBڶ+h7FOw83+`bhFpC+`+h;+`#Kh v+hh3+``#h#`+h;+`#Kh d8FY!Y!0I " <-<Jhh` D`KZh`hhB``Kh`ZhX`apG`!pFMN+h3+`ph#hBchh`h3` K`+h;+`[ KhCp@hs`EpY!`!Y! Li#h3#`KZ`#h;#`3Kh@Y!`!Y!-G*L+Oj;h3;`3OIEk%3B-3h)0Fc`ch `#h```D00%`hB ;h;;`KhӱGhh"DRi(FJFQFF T#h`+D#`Y!Y!`! J0 h3` KhD`h `h;`#Kh upGY!Y!8L%h}#hJh[;(D`8`!pMN,h3hh+hh3` Dp`!J hh`#D`J[``!-A$&FU{+@>`oCBHL!, D4C hp$r5UFF-8F ApG, 4S l)F@F8Dh(F!^F-OK"O&M` #8F/F0Kh+hHp,r,d,+hx.h#8&0F#!HKHN(F ^J#Fh2`O" # <(F5$N@2h22`F{N ;܁O 3hDE#pH"F1h"(hpNU(@ V F#\\+ӹ #F<(ѝ# >+]KEйIFxPHIFxB/LHh:`*F[FF;/?zDHh:`*[FFnF h?g72h_:2`* [FF OQ{F Ohh2h`:72`OiF 9!I(h! F:2`*XF0$J#5h2`Er@3h33`p"(h" " [!b!b!P+`!(?@F/? "1F-A%|L FF(@030<F<0;0#pKh IoKhh,|-u^r#,F0;4kDw" ,x4kDx" , O <^r#0+F3jDw!<3jDx!3xkDOHF,\r# 05kDw",5kDx",@H #<';L hv#h[8H&0F%d4H9F#x0; +#!FF x0:ղ--H!F/_(#*ћ&H!F0 F30Fx0;0!nh!FFHCF(F0;0# Kh {C<Kh+oTY!b!VflY!-O'؂f$=F@FF(1Ē0+:0B6ќKh2-8%/ODFW <+sђL h#h[ՏH&>0FS.a.H.EE'4F [hH)-I@F%!6((@FF !;0Բ ,ٛvHAF?z sHAFC 3Cz O0oAZF Bq ӫG w iF<0l!hF_HiF < W<,FW YHH) oCE?0MH !PF 7^oBE? BH !PFH) 7, FAF pFF FXFF7,# FAF bFF FXFFO4oGDFGF ЩHG G iF<(!hKF!HM 0+ xK`cGoCB?HeHG # F9F F FHSH!Fb!8   B & \ _!u J ,N<  :*# p;;+pG8?  pG+B pG7#Fx0; + "zB xZCO5ABAH!FH!F0D!/!x0; +?+ pG pG8F FFI(F츱I"F(F숱, I(F{P+x0; +(F 8 8 \!5Fb! KqUy]"FFgy24Bl*Dq8LM6N+xñv@<<<<",p<KI"F(FH8@8_!.Tf!-C FMMF(l)>KH,F'JNJIHH#h3y@F#y\FIF74/BL hCh;C`+"hhY`=N$=O " p)h9y@F* 2F:F#45,ѽhZ`1H+N0O؀yyB*h\@F45,$L hCh;C`+ g"hhY` "p*y8FhZ`)I hF F4y4,Ѽ $&U6A8F !F0FC 6.K:F H]r!!nn!b!!!!!!j!!! KF $yBѽ@0(KHY\r!!8Fych=U h8@fd8-AF T 0F0+р"( F H K( Yyh)!`aYqK;^"b!b!pF Lcj xIi h px-(Xx(aXx-(јx(К3FxBRxF:*[xiah Ha( HVxP:. 2Fb%ebb!""-C _M Fih+PhZHwx-*q4hbaih[h;SH+h+ x-+ 0mF,+hB,IH,h`$$BO@F*hBIh h3 `#FF8B#F#FB$o #D4 B8#DB#` h; `#.Kh 0FS@S@P-C-FF+hB H$OFh+`:hF2:`իh$t;V+C/*;h`;;`+s Kh+?nj+y  b!"""Y!Y!"p L M#hk+p+h&;+`+k"hk;c `!BhF"h,#FZh:Z`F$hD`8FEhkC`+݈ #CCh"bZځ"h`8F !"Jhij`$F;  pGxɲ)ف+тF3۲ + pGxFI\pG\?+ pGxFI\pG@ \=( pGFKHhk#pF FFa(F5h(FKhB`KhB`p+x-+kxO3`HKhkkt a_!_!#-OhMFF+heNdJ?F(9xbHh@2`@:x*3h;3`+O Fk`TK(hhah@2`h:x 8\U*2`J (FK2h:2`*B+h3+`?F2h:+*_2`4ۻ +h3+`?Fи,:xZE2RF)8ЈB; (%K)h1)`hh`FF2h:FuF л?:x?m *+h3+`Khh``rfC?[ ("PF \`!KF Fhi *ўi0F*3F (JJ"!hFhFhDmJ+F!hF K Jj,KJj##$$1$𵇰F F7Kh*F! FKhBFO'======e=====;=$9==========X=7V='F?'O MF0 +0  OEѫ (@H_'(#Р0/0+-@_}'(@6^0300h Q_,K] ;+#h;#`#;#hEF;#`Z0P0+0_ OF#hEF;#`#7?;+`(H\('*\(!'{`!Z!Z!$=%$\H?('U'V'TA+7Ya+WP/-٥XCo}H#h +F"ho2"` ?b? Eɲ )#h!;#`!hF9!`+?0"`* b Bɲ )#h!;#`!h9!`p?Eɲ )]!h1!`!Yp#h;#`H"` b 2Bɲ )#h!;#`!h9!`pA?Ҳ *Z"h 2"`Xp#h;#`Epɲ )U!h1!`!Qp"h:"`;5oK"`*b BBɲ )#h!;#`!h9!`1pAҲ *Z"h 2"`Xp#h;#`pA۲ +S#h 3#`Pp"h:"`pR %"%-j"`b bBɲ )#h!;#`!h9!`pBBɲ )Y!h 1!`Xp#h;#`3 pCҲ *J"h 2"`Hp!h9!`p ' '''\(B? (0300h ' ' ?'3D[#h;#`#;#hEF;#`{d^E #hEF;#`\#;V ( 0300k2cshZ:\(`(}(ۉ˱I²#h \; 9) #`#;#hEF;#`+%$("(ћ+#h";#`CF+"h:"`\" Fqh)EF#`#;#h;#` #M3DB*#h;#`#;0FChFF`"EFZ*ۉ+?t0FChFhqKB#hEF;#`#3D12#h;#`p[ #h0F;#`#0F0F]IChFF`"Z#h;#`# [0F#h;#`#F0@F((F@u((@fr#h;#`#F;sh[#h ";3DۉS0F'n#h;F#`(FpIFU#h;3D23Dc#hEF;#`{sh:<)(F.@F&rh;EFK0F5#h;#`#;pF #h;#`#AF0F3Dۉ+S?sh HhB0FHEFY%HB#0FH݉M0F0 Hc#h;#`+DۜK[hsh+C'<+=+:#x X#xF+D Fh0BF`ڊKhBȿ`>/D,$>(H#+`00F`]b0 a)F Ff(80@Fbbi00Fa0 0O2`+hKhB`>/O4<(>(3&(3#+`'|(#&(##+`#'+` `0 (j]`a0j-("`$t`##+` F#)F#h{(3=J\V{/#`OO ;3Kh#h3#`$i#(Fld}(F*K\ 'Hh00XM}(F/FO MK]hOh:`*E{5K*\Fh:`*O=eEF+@Ӏ%/Ā:/a#/mOf%%_!h`!_!@HIF0pFCpAO 2F0 (h:`* {sKFР0 *٧kF :`pgKFO V="cKF+F`H$]KO ]KZH9FWK(h:`*@{h:`*4O {OshZ  I JJ)OhJI@ C ST0F ChFډځO;IZ`FFOVB  }/ h#':`* O {FzO FC ST?'(rhhJB0F#`#pIChFF`"Z#`$#p7#h"";#`Bp0F J!ChF`"فb!`!-G0h $i4&F0h *h4D`h3 0 khhZBZA F Fkh`Fh+0"F!i-"QF0ij``-(OK0h!MKKP0 GK h  C BK h #F(P8K:M$!F`6K`+`"F3IY*hj; )3,I)Mi!   2#KF-$Kh K`K K`K`+Fa0K`K  K` K` Kh+!^# KKY!Y!Y!%-GM"+ha# (%*hSi3Sa(v"dd|+h[j;` O F F``` 0 Y`( +hi* M  +h F ;Fp` 3`" Zi2Za +hi+ # #F` `` ` : (+hji8XH^ #`F+hik`a+hi *j*NIil(+ #`IK`#`C`+hkai``:*Zi2Za+hk0` (!1`c`+hiZ* ;nF+ +h"a(( ! & `0F[& F*h #`Fkk` j+hk``/.h3i +IiIO0O +hi*" "ak #FJ;F+hi++hi * ! % kS+hFn( +hi*! vk 3a3+h"`aW(Р +! b ( #3`+hE &F` #```! +ha, (0*hSi3Sa#;`%#h+ #4F` K0F ( +*h8FSi3SaF F+h[j;`E-AF?MO$+h+h (k8`F+hi(Oi )\j4`&)G2B±Zi2ZaO (#`F+h`k`a%O F+hh:h0FZcH0Frh/! FH*h##`;hk#a+h``^c FYi1Ya*)O0\%%-A"%0aW(< Si3Sa~FK( "#F# F`F` &FFd``4`0(>F##` Si3SaM VF0FL5(є0+H;%8!M*hQaa` +h$`(*h Si3Sa+hh+hiH"H8 F&"FUpGChBhKFhpGCh hhBpGhc!F FFFch```v`FhF9(!H!K7ih8FBȿ`"F F9F F9^!"FF(9P! B! >!F:! 6!F 21i*F F9iKXh8 pGc!F FF)O9FBѰB0F9K FhB`)F0F9B, hW*F1FFHg F9H#F*F1F&'-AFDh FOt`{h;{`-- FDFHh(F9h+Fh(c!pF N L5h#h(F3#`+h(F3`$#h;#`3Khp@pc!Y!Y!8F Kh\- F!$heh$h,8h(9-hc!KpFh FB`hB`BF9n#"!F(FAB h(F9`0F!FFH Fp*'8$Mkh +ܿ3k`kh@ , !bF9.(+hB(`98K2Kb , $`8dgfffc!pFNh +JhBh !(F9 KhB`B(F9 Fph+ h +"!(F,F8 h+c!_!8F Fj(KEh``8c! KFS 0hhB`A F@9FFc!JFhpGhBhc!-CFOhFF;h -;`ܿ#KUh;+݀K@i!0F8d&tK$`!Fh|1FFpH0F8RmKhB`-iK0+𫀬B{"!8P!  F8JiOr@!0F8*YKV0+5i!0F8CFOr@!iF90Th F84N`FK"`H!h 1FFEHpCO F84#`&iOr@aiOr@ !h.=0FE0F`@ U*F1FF/He - .0s# 0;h;;`#(Kh ('O)F0F "F(hh&*F!FF(F8EFF)BO#)F F(h)FF H)! F8Y!Z!'D'Y!h'pF F FXO0p !FFH! F8fAF-h! F8XBF -h!FFHH@H@''p-OF"FFCFD#O"I2F8h J!K!N-FF3h8h[%I"F8hIO𠹲hB BFYFhC8hIF EFQF,h+$ 6-$" '''''8 !MFh8C Ѫh* b ! F8E KhB`8 !R F8A " ! F8B" ! F8CH&c!'8F KhhBVhFhBch)FGh8`8c!-OF F C 0 #C`FxKh``ؑ 0tKtJ`0sKqJ`pKhhBnKhB`3h F;+hB FF8 !FFbH! F8*(RhF@ FEB(` F8( Ffr+xh!FuF(x! F88(0300 +AK! Fh0BF28CF] h* * *0h+ѫh+Ъh FI+H!FH!F5h*ch;c`+ F#hZ"`-"p I F^ F))8F%Khh2$Jh,6h,hQh)/Qh xa!" D"K60˱,Khù,Jh,Jh*1+ K"``8 K`! Fx F(c!Z!Y!Y!F F@I F0 F.(O0^)FP.0J#FH !HH4e!d)FYCh;C`+5#hZ"` "pN%O(F1FF F -?- !FH@b!F8F^!%ch5;c`+ F #hZ"` "p-C$MFO+h3+`J#;``+h;+` KhC-X0;3hx#0hV4Y!(c!Z!Y! Jhp2FX h x3  (c!-CFdNF2hQ*@[h+Fq?'"YKhk$[h+x+$$-$-aJ-P-\$s)|jF(F0s+[,c,tOAF(F`0йsB,!(FP#33k>+[n#`"iF 8/EиB(FC8%+(KN0&K6 %Jh0+$$K60+ $$'F,FKN b-, ,T*ٓ60+)СBOY #@Q,CA<(c!`!b!(-OF F!ѤIhZehI(FT0I(FP(@Àkxp4p+F(@ŀHO !(GehI(F6`HK!hdO PFI(F$F(lэNLkh #h3#`hh!i`g#h;#` 'Kh+8F#h;#`#~Kh 7@/#3`(uO$&FZh[hxm,@qH$0FF@F6@.jHjN$kh{khxc0Fhh FF@F4@,ц&W(3$%FPYOX -V-%^hf,OSH$w(FF8F5@-,HHh4'9I hF8/P% ''/6.?.԰<ԐO T(?:j?(Fp5K"h5IhWO .%/?a,F %(F4kF8FP ,HF4F0F4\F@FA ,]H,F W/Kh hJ(%h+x-+kx+%.?ծ4n))j)d)(c!Y!Y!{))dq)*'/O D0+?z)HsD'H0C%H0FF#H (()-h030% OZhXhDP!0Fp0;0+9 Kh+?4]0030-(FF)Y!-AFK"`d%N-,ѽA{Yhx3h33`cYBYA#3h;3`#Kh 5(c!Y!Y!,c!pF LF#2 ,D2;+!(F#2p(c!KXmh+(x+ pG pG(c!-C' L N131#rQ3@+1;1qUh-hFX2(FAFFm(F+hF(c!Y!K@ 8 !*pG(c!8F M\2B ! ! }! y\B8(c!Ͱ#HK`"b!*8X"*42d"@K@Jd2`K ! ;K `i !7J !h3`F81K ` F*Kd8)Kh'K&N 'K5h`-th,#x+)F Fu`,%,   7! F"""b>*#`" 7H F$+P "@S  CC (c!Y!Y!Y!"K [(c!8F I'!F F* `]8 8BOrOA 8 M Lh#h3#` #`k`#h;#`3Kh8@8Y!Y!-AFF F*F1F@F7-D'7 /`Bh+O0%FhFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+`thc`` `+h;+`+Kh+!3 Mh+hq`F3+`bhc``0D `e!Y!Y!8E F?C K[iB F8@ch;c`+ F#h*xY!`p8KiܿKYiֿFH!F6*R]pGKRi]pG Osp FFR& ;+Ap0Bd#<p@pG-G F'!F8sx+[I0FH3\ch;c`+ F#h!F0FZ"`""pXch;c`+ F #hZ"`""p3x[HI0F*7\0FzF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0F F(ch;c`+ F{#hZ"`'"p'=Fa*KYi5L FG@AFxr+ HHf**h-Ah h2xh+xB,K=!0FhKh0=!F(F@B!'F=++x;/0;0 =*+O%p=F)F0FA7?F/F5F&Fp`!ChL!2hJh F F e!*FxB #` O^8\ 4F[=B|] *`-A("l DF: 0('YFF?0F'`T;+Yhh)0X[-jh++iC(FG `4-hhD;e!Fx#@HIF F(BNO#x3H!F@'+8Fe,F'! F F H!F"F0F)****-AFiFhFFKBh՘GF,մhF HAFH9FOF40=+sh-H F8hCh;C`+:hhY` "p8hCh;C`+ :hhY`,phZ`hZ`**-OF+LFF0; #0\% E"K)F@=* Xk.qhղB 4IA%`56h;FT ZFJe!e!C/ B=*Ѱ@ pG=* pG pG-AFFF F;;JU$ F=+@`'!O7` KDi,hB Ѡh*FAF.7`'F$he!e!IKFy F!XDiF0FF(nChZ `0F#t!;Hg`j0F@5O:h2:`iRsq Ch!F00DGkh`Ѩhg*ikh2R"*a L##k`D#k`khH$$TCKFBB0 q;h;;`ùKh@E $ T55Fh``*Y!e!Y!Kǰh!Kh&@ K` K`G]K`"K`@Y!Y!-AFF=!F BFHG(FcBF+$t="+*U"Zp&41F('`(FA 0FD;*Kǰh!@#K`G]K`Y!87L0`Fx KH-F0 I"#`0 KBF8@He!+ +.Tf!(O!0> h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp"( ] b!b!Z!_!+pF MF+h3+`T+h;+`sKh[p@`h 1F7$hpY!Y!sM,hLH0h `#;0p@;h 0Fx0Fh"``kh#0Cc`h#a`5pe!++%O-ѽ@ch"h2`Ԡhch F4h,5[ՠhch#@c``&Fe!"FF BhiC՘G(h3DhFKFh(F"F!FeFرCh2CiՐGph4D gh)F8F:0=!8FjD F$hhY!-C' h=F #xr+&&@F=p:Khh#*F1F FCn(p('% . F&'-*Khh,0 h(F! F c\=+   2FIF F(Ch7 3C߹F#C`Ch#C` H"F!%ChH"F% Fd(H!Fb!0+O+s" FFFChX)> I h2 `#c`Jh;`#Kh E pHh2`)! DRx I"0F|^ch#c`chCb`ћԠhP"h F`J Y!Y!-ANO|@ #heh0m:h@Fhh( F#h+Ѩh!"i:@hh0DGkhԨhhk`h`#i+ae!-AOMGFFF(FF`VK'h=U Fv, e, f,&x,O''OGFC/(hAF*Ce+b!(ܽ@(H" j+-CFX FT030;x-+F!|xHM(h*hGI0t`3`0`;0+w?Kh+sC>"8FF=!8FF8F%A"h##3a%8FBehBh`BB`"B0iC02aC`B*@*% #c`h\=+8FH% rKB 1\=+ 1#30!8Fpch+Cc`Y!f!Y!e!8F F8`h)FC$h8HN(x(I($(F( M+h*`hH8DDM$!F+b!+ hxxpG hFxxPxKxpGsFJ# "` FFF>h{:h"+ jfC2s3H!FBxr H!F Khx21 R3B(F1Fp,&,h̰ FiF6f L& F6^(6BB8BԿ  BA ̰ FiF6B L& F6:(6BB8B  BA ̰ FiF6 L& F6(&BB*BB  F F6n I#\Ch @iBѤ5j6B!F6ؿ%hFF(F6z8W 3jB8FFxCx-*xKK"I#`x K " I#+K" I# I(H ,t7,|0Fx F!+Cx+x8 '0(F(𔀰0+@P- - - F& x@ @ x8 -iF F6p(E 6R(=-` _#)/5_M_AEI___V[!hF<!!p@O  p@Op@_p@Op@_p@@Op@ O  @ +s 6fB6 +x(+ #x)+kxbxCO0 UO0RpFFFF(𙀰0+@𔀰0;+{ "+:IWep)F F@ @ )F F8 )F F)F F(Կ  FF(F FBB  FF(FFBB FF(F FBA FF(F FBA FF(F FBA FF(F FBA)F F)F F)F F'cx#x!+ )F0F(  p(++x)+kx 0xkO08 FF$I hX="IT% HD%-011 chx@ 8c`h(0\xx!+ (  (+x)+Sx+H :,<,>,H,FH(!Kh ,KhHI3Fh Z!,7 "FxJoECAoBAI"F 0/--OF F I+,khf/x-*@Zxl*bI*-*(FF(@vJ(F0h320[^F(@>7.mI8hJ.>7̑=ȡOU;x%+y8FF(@)h`HO>@FOs*њx*LНYI(FF((F`F(;hB(Fx.ќKJ#xh320Z FZ(Fȿu F+h(?sBK9Fh$(F0(F8F ;I*F 9H 6H2Phx+I$w F0nV# "`8FBxڹOBoBB?IH:FpF0h)I!FXF50 *h?IFQFHO,,O!XF5Ih-R-l--F-M-80,"K#J"h!KhF0g!h"0-CFFFL@- H9F%##a9F H2F&D,D|#Hu0g!F0Hg!-O#N(F F3aeKhS#S7`h%!عOO:F!F(FC ќKh-  L(X4#FS+`sa,FkfKhBh+щE4\. " FMKFhCh;C`+ |KhhY`$ phZ`%.kx%+ѬrKhCh;C`+ nKhhY`%FphZ`kI F#\'*+7F;x.+{x|*+z7F^H)FT8F\IO6DXI F'O4{xxOxp غW غ%9Aڲ*KKH)FX +R#))))+R#)Q)))2LF\XHF0EF\(ɁFO\ ps#;ppuaF1F"F(F0g!v^0f0M0(()Q ,(.&*Sb FXp'(\("(0 Y>o p Ff n r t v O\ OM ( ^#? F ;HpaF-#(@@^#a e a!F(F=F{pKihL h"h0@(#I SxL`dO `I"df PzFd(x!s#;ps `~H#F2F)F0tL"xI#n`:hvHsCF2F)FpHaCF"FBF)FkHKl"Fc!(FrcCF"F1FOsBF1FnZJhh(!3`eBF!F^AFF1FUF(Fj"FF(FQFZse"F1FAJFCF1F;aJFCF!F20h(6 x"+'+!FFX0+6L"QF(F#s)e!"F1F p# `0hb0  hYOO BFKF1FaBFKF!Fr c"F1F(FBFKF1F(FfBFKF!F(FN.ɭB,ƭ$Ki pH0g!bg!0h hh5һh"-CkBRBckBcBl"rBbBd"bpGjF@#80#l#SC@s#d#b I5"(I ~]tK2I 5(I lnt T2I 5(I \ot ^2h"phF F+x-+5 ##bKI # ȱhԢj* H)FN$3h2`[hccH)FCh FG pxg20FFFF)h9%x--41hF FdHh9h!9`kh C ;` 5 FT8:h--sh "C68 FhJh@(F b8J8(F$( JD(FT(J<(F<(t8FL#h# ##`e`8g!) F2Bh:*J!HBH JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJHg!g!0pFM.h6FihH(`pDH. H H!F0H!F+hDg!RL4d-CFFFF<F(F!FBF+H.F hHbԐH'ԏHaԍH#ԌHՊHbՉH+sHՃHcՂHՀH{Hv,}Hqg|Hl!zHgyHbwH]"uH,hsHQrHLbpHG'oHBmH=clH8 jH3iH.+eH$cHbH``H"^Hlh\H [HYHO@VHTHh!@@s+JK_G0F.򋂢BHAH ?Hb>HLpHqHFLoHpH@LnHoH:d!mH5mH2lH/lHhkHo3F"4,? h)HNHaHaH`HXHWHWHh.VHVHVH@THTHSHSH444444444444444455 5 55555%5$505/58575@5?5H5G5P5O5P4[5c5b5k5j5r5q5y5x55555555555555555Y4555555555b45j455a4i43333L:H;H</39H7!L8H8H1cL7H7H+L6H6H%L5H5H5K?F.h0H/L0O&h>0F5,Hch F 4\3F:Fd!.zh\:zBBF !{h8FO 4\BF !FHD ,$ 7&5555566 6 666x46`$65JIFH 26hK IK( FIHt g!666hsFF# "`#x#+4 FFh#I"F x+I3F"F (FpB78Fx;#+MI F`8(Ѓh`g!6 hh4XFFFF "!F(FN0`02hB" zh"++x#hx(иB K0h30@ O O h H Kh! "CFJh"+I L Fdg!t H KXh! "CF(h"+I * Fg!pFLh h#i{B H@F IB F FBFH$"#%a#pg!. s8FL!h!I*F (FL K"y`YaR`"(Z`bya ""`н8@ 48g!0Fh FxC H)F K #`0O3!H)F#`g!-O%}F/F& 0+2H)F j#@FOr 0)H)F0F } F"JU#B 0+H)F y *$((#( F  E,9/FB 0+ H*F\)D@FG(݆BF FF%;\g!h+ + + H]4)+HH]4HH^9apG7 FMjj*I I IkjB B I"F "FI 0g!m!8Fx 8 I#\%+5#I#T(FF(\+- L J N O8FT; T8F1+F1FBF07hw-CFhFx;H1FK +`/O7/!Hx/)\0`0\CFT0P DD+`H1Fg!Eg!"-GFcIdHbH*aKbIbIH#j_IZHj]IXH"k\IUHkZISHbkYIPH#akJCBUJUIKHTJH0aoRIFHvOJJ0+OIAHnKJL0#LI=HfGJN0#II9H^CJ#m#FI6HV?JcmDI2HPĀ'0B *I (HG4U<+BaAFHFU#1JH%Hm!g!3Z}WEVVEWi!*}F FFN%"h*o`0o0 !F(F#5+ { JsjqDB I"F I(F!F g!m!6g!8F IK(O2 F!8@FE"0K[i+ O2Or8 @g!{F HF  g!-O$N4M%FOS-3 @1(I 5#pI \F+:!@F(H)F4F#I ;PF чI@F(?FI@F(u888;x+B0wI@F(OFWFOsBFAFHF(+iHJF)FPeI"8FZ (IFH(ѧ j8FNAF8F9 CIF8F/CQF8F&CLH:F)F4II@FPXHOO:L ?20+?-E?*"F@F8P)FXF4@F7e3I@FH(iB.H)Fi0$0 &I@F("#H"I@F" H I@FF(GO3F8F 2H;FBF)F3eg!g-Cskg!h g!^+g! +,,I@FFhO3F8F(se}|I@FFhO3F8F(3fisI@FvFhO3F8Fq(eUjI@FbFpO3F8F](ye@aI@FN _I@FHx"O3F8FC(_sf&VI@F4"OsF8F.(Jp0LI@FFxOsF8F(4r0BI@FFxOsF8F(t08I@FFxOsF8F(v0.I@FFpO3F8F(g$I@FFpO3F8F(ݮg a+ؘ0+HBF)FbiBHBF)F/"H#BF)F .?EO]jny)FĂX CE ,?~)F~E?qIHF0 Fp## ;6@FJ 0h320[@#@FF5 H)F4!+򅀄K :H)F4HB  4M[;+F:F )FAF(oHkJ F0 O 0+C;ڲ*?Ĭ+?R#A8 1A8 1 18 1A8 1 18 1 1 1 1A8EIHFN *F"#EHBF)FXDHT#o)Fe  KE?(?v)FVKE?e)FF0ODB?(?W)F7B?t)F(B>b)FODB?W(?.)FB?K)FD KB-hg!g!8 :g!Ks&S[}>"1F HF8H(Fp6 I(Fj K"1F(FxS$45 I2F(Fs(h+ h+H #5sI(FX(HKH]`(F5 p J I(F@( H2Fg!WEVfdmdY;g!gdFHBOrl F@g!KJIXhm!mdF1 BpG3+P@FQ 0JOa F x (( ! F ( @pG#pO0 8 L M!hAT8@`H3h(F 4 $$mLKhFJ!h)FI(ݝ0c+ C+S+ Hs+##` m#簍!EE$$0MIFhFF( ݝ0Y+ F(H M0!F(FA(H$$ %KFHhLm!mI#F"hFM("iF F( m%8FMFJ(F>K!F(Fh8@i!m! hhmIFFjF0H mkB If (ݝ1Y+cFHrdA.%G%s%*Fgj zF JOazzgzGz z ]%7 FFRFF+x$+kx+_(FBUxT)GB))HQ ;Kh+IФk#"FHC##A8C++R#>>>> ?>>>>>?>>>>>1>?cڲ*H@H>O0F0zg ` Q0 zg    @!%%mLKhFJah)FI (ݝ0n+y+#c` m#H4!%3%& Kn:f*oB (КmQeppGI2{-GFF"F )F#F-I H9F+H V HBFE 4"K$")F8F!FH FhD$FhO FQFS)`D0FnME0FFB6 &/F EF+&+A=-OF MH FFJH!FqOAF+(#W# ZB𢁰IF (I"HbO [ }I";F7C("8F2F)F FtMtN)F  Ah1F(kH  2(eH砀0aM^Nj)FB=h1F(YHbWMQNj)FC$h1F(NHbLMEN"k)FG h1F(DH#cBM8N)FkAh1F(9Hxc7M,Nbk)FBـh1F('H^cc,MNk)FxCh1Fh(HFc MNJ )F^G(?1FL(5H*6&i!Y&&&|&n&&& '.'N's'''''(?(H&uJ04M4N)FL AYp1F(,HL0*M'NN )FB?p1F(!HN0MN"m)FC&h1F(H#eMNbm)F0( 1F( Hce M_(|((((();)-OMFHIAW(ЮM.h.Oѝ0+@G0`+@BP`0B:0|VaB  `03Fh3SsEbF”FO0 `I"+(# nGBxI `ȹI""HO0F81FF@kh+ FG 5}JO R `(=ѠDh  F  `QFC?hx4+\ѝ4`+Xىv4`0BQSa;RX[hDkB]H a  " aWHy0x|X  FIF  `A?"(CХjkO F [F a??@H ax a"# F)kB7H aO2B{ kAB{-H a"1F:0(K:F(H!Fh>&K[h+?ʮ"O%FO3& B Z B02F;h!F@F%#D65H MY)l) w)ut)*)]**l*m!!*)/*h F0:*F`ڍiBhQ`p0pG02 FNIF F*KKLILIS" KI" FGI" F!FEHmCH!FmAH!Fm[>H!F!F @j;I Fj9I F*k8I Fk6I Fjk5I Fk3I FH 1I FJ /I FL -I FN +I Fz*m*I Fvjm(I Fp!F'HFp#Q-;FX!O\5V/9F FXB!FH, F@2Թ+0+++++,,,!,4,I,_,n,,,,,,,--ݒ-OFOFX 0F+a)cбk)`,[FFYFFPFYFmdJ@! ` jhkFjFFFPFFOUJ@!XFSI:F F*{ F!*NKOIOIn+{;ڲ*j+hLgLggagLggVggggLjhCI:FBKhk{11?I Fk)_hh ;IF FhhkBA!F+ }kjhKX DD1IB FpX 0hhDkB2!F+ d*H!F)O2뉪hk{11$Ih Fk{11 IJhI FDJIk$!F* !F k)!F* !F )O2B)--8-@-*-}E---=X-i-|--F FF & I H!F0B F@2u2F;F)F F6--pG@pG8Fh`Ȉ؀R[B@[(R[B@[шj FlFbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXeTXEXTBElRuBD3l#J1C 1 f# 1 `# Q XC Q Rh"C B8Q 2BC Q WEVJFhB ѳ JhB!F@оBѳF!WEVg! KFhS# F0Or|i!(B(Br۠BA O0R I LMNFF H I HdT+ T <)F0F~-jh*.(7 F( I`hBꈱ# M I(h1x0#h jhI#0!vdl(F F(OhI8FFI8F(I8F I8F($.Ih(D4LI h100 +h bh I$$B.,G.J.!udl(0FUMI(h10jh F I^( H0,#H#.#90!zd@O.`.n.s*L+I h10bh (I2ah9%H$N%Mah2F#H*FahH 2F*Fah?H 2F*Fvah?H 2F*Flah/H 2F*FbpH\ah H!td@...}./?/c//..pF-P"L F"I h jF1V0bhI .. ahjFHpih " H I h 1,0bh IkhjFahH縍!}d(@/f.~d(//(0 FWIh"hF( I" T MjF I(h10#h jhIT50/!{dЀl-C&@J@OF$ FF#`;`JF)F FC;hB7O%,FE8hIF10zh 0Ie(q(O&B#B)F~6F(zh !IQyhHb 얹K" FMIKH* FyhLB (#!F(F6#*##44&! 0/0d0!N0}^~00|d(FLI h1<0bh(FII hOs1,0ahHg#0F9F2F;FHah !d@0d@00-O(-]GLhI F(DћMN2aOR (h1F10jhI=i 0 hw! DZ`h+ ]#PFih(4? #TBFKFXF~|I FlXvLzI h10bhwI FvIZF(mM (h10pI hpC_lJlImHf 2D0OS4(hYF1l0VF&0SD0 0+Oq ~yFر#FF7F2FSrcFih2FQHHI(h1B03jh( ( }F!( F>Ǽǜ@tF6L hhha@BFih3Hؐؠ,?2#.H̰##ihg#BA$h{"CSr(h2F;F??ihH6GHFOrAF(h0HXFPF!wd1K1xd <1{3DQ1g1h1111X12q(-A FIh"(4I" !i. "(/I""`hxxFFh'Ih"+ jfC2s3!I .I"`hxFFhIh"+ѷ??I*VMI,(h1,0#h jh I H62=2o22222!ydl2-CFFM$OY!IBF H@Fh48Fh1FG hC1h LMDOch`hBF `0bh I03!^JFRh I ︍!l(7 FMh I(Fp툱 I(Fj( K Ih10 h 0%3!wd(7 FMI(h10 hihHJ0!d@3IFFHJ 3h-OFF# HF F 3!E "V  (I(FJF180%I O }(IJF(F1$0SE K ,F$B$~IH  EHIFOG#2F(FQD4O D444-W_p FF $,KB7+KB@}SB Fr&IF $KBc#3B F FJK( FFp@1x Fp@F FH1ʸ FFFHb Fp@~C F2F H Fp)Ftcidyara4rbmn41^4J1HLhDD"!AF!F*LqO0,ѕq@p8D``?`. h `h%Ch-<` hh##DBO0 q@p8D``?`.2@ D8!K !*03(pG!-AFKFF銁FFAF@3BFh"+C;3 4`xFI"FH111I }h8-AF&OFhhB$I |h,!IU"DcBs??##h1FA0M`0{hB `<Or!D0FOpO0::!PF FOFO0H9F,O01JU"B Jd" +H*F#F9F :{O:!:8F LiB h}PD    #18!-OFF %J,FO ! "  KF +L#OKYhD OX BFA#xFqH IqjBF# IbBF# AT# pHoNd!oJ0FB퀹nI  #hHngI0F3\2 +$+Rx *`IZ h1 V-+! "VHF F0FXIF FUI0FNTIBF0FHRIBF0FBII0F33\ +VAHJ#>I8Dg2FHPDT6KOYh\"DCDSODF F\2TDUXDXR$X2[DFX2dFX2dFFD B t EA *FH #FUFLF(F!F ]FqA! ;(;(!z;Z;-h~;;K;;;sLQ Hch;c`+ FFN(F (0I #hZ"`xch;c`+0F#hZ"`x +% YXBXAp@pG;z;-OF0NFhB.I uhO DDkB tRF#Fj??O0rhh9FO0\`0BshBRFh#FD??`B=Or9F D\rhh!F/shBOp;!pFL2sN(Or#21F:11U#&2oU'2MIP#3@+B p!8!!-G FFD1THK2+ }PIh" F)FNH$*/+-2+1FJ?K?H)ؿF1J1Fh}"F+F8HD1*+2+ 0+b.J9F+H  F)F02XCF/F3FZFQF H1F6"F+F.2Cw#2r!=I\=}=>$>9>m>k->>==>>??@#;*"kJU#BR*T=K2+s #F;Nҝ>0)+6J1F6HTZ0)+_1J1F2HJXE#.I/K/H*ȿ F(J1F8,HIF4#K2+?"JU#B!KJ1F"H"!HK2+'*KJ1FH)! |FI KYF"#KJ1FHHF|!}U?x?==>>? ?#=g??H?-AFAMF4bN (B1-h F5NE 5Nm1F*F+3HA/1H1*F1F/H1*F1F+HG71*F1F'H1!1F$H@sD*F|1*F1FHt1*F1F?Hl1!1FH@sD*F^1*F1FHX1H*F?1FA/!s}???? @@-@?@P@a@s@-OF-4cE(~ F30B@0FO A+ x FI "jP жH #QFXF& " *q@ pd `CW@Xr*@ۀBuFJ%FT@lJ%FHFG/gi+:H)F8F(F&hOE*E&F F0F!42+@F(F&hVDF F!0F5!H"FHiBHG/(F$h}E$F F F!GܺFHH"#)F!xA~!AAABAA'B@BJBAC C}F!O"OF F0H9Fz }\" FI" F# R\"! FNK2+h+#9FeH#"iF#BBh#iBk=:YBrB!{B#0N0LB d2C-I/L(+H"+J !0(H#B d2CI/0(H2 FiB1o"hAE"0H)FROu-h@"0 H#h5;D!md!BB8!BFi,/iI FHI F I FNh4h<Khñohhv,F h9F( Kh+Fh0h9FtF( F$O778!F FFF8F< `0F8#`kh````4l`-AFhF FvF0Fr F5)FJ3F)FF@Dz<`FF7-G]Ki L h)F(dhI K# Kiѹ Oph +`JOa `0F<#h`+hc$h !F*h O@&4%h$` ;9FF(D%C$ ]`pKi QnKrJ hrHBFpN0FS%BE ..F`?,J  {{ Sh+ Sh` Bv(F F0+-+ =!HFE$4#4;E$4FGHv  {J{G 8Li 8.︹ aB88C 6HFi/k .|'Ki[0L 0M*F@A 4@#hj 4@h+T?+h+!H 4AF 3H 4AFH 4AH 4A S Fh(%H8!7'77d777887 h O ?* ](?#OrB?|FH\KRKpG,!KhpG,!KhpG,!LR F!F 2 h-GFFF5ILch!hHrhS!hHf 9F0F-PF|#FHXch{ chS$h!FFHF ,!6b:bp: R]pG R]pGHR]pG R} z-Gm(FiFAH$@.B>H5F(F mr@20F9F. %C00F F.rHF&JKhCFKDEF x;62`qՠ  0Kh.? FHF2F#` 0B ?3`#%Kir``Zia2Za 0 F(F 2i 0FhRFIFF |  0+6h)F H)F>!,;8;V;;dT;;hj!<h;zd@hz;0Fb  8FR0FHF0?􀮁EF6h7hJH{iB?h*hBH#!i$%+COqB?+=h9I:Hh"i(#*.S`O `##`hK c```h#{a+h;+`*1ji:ja.?~CE{jiBwh6h.Fh+si+0F;a2{Z`bh` i{h{ F{:a.8FF(?HEF?LF5Z?xO v-<;;hnIFH <<hpF7Mðkhsh3$ FCp@pG(0HHGOqhKh+5)N)M0Ff(Hkh;k`+)#HF ,kh;k`+'(F (y,&$ Y\B\AhJK)FH:hd J+hZ*`x竉դ+hZ*`x +Y,n,N,!<<5F7<𵣰#OFKNh;`3hFH9h" FI I-80:h:F F-0~H:#;`(FF#(F-H T 3h% L=`rH!F-&0F#3h+ >3h+ 63h3+eHfH(F"rC(F-+':F(FC;FC{n7B3hMHC~3hHH4C&(FC3h?H(F'CD9I X@(F7C&(D! ppC *H,4" ԣ 'I %H$ sD&&u{(F-~?AH\<HXHT#(FC&F&!!!<<<< ="=D=f====>U>=:>-G FI#F-OsҝH z FH)FHF-BF ЕH(F{'8F!U*Ѫ)ЌHl"!~O3o{d 0g`#`'8F((ЁH9F)|`` }H01F* #aa0jcb"bk}icab*jabezFlH zFgH#iclCcdgl kj( +e*(0* dR\HqjHFjcbc+"h#cZC;Fb#k"hSCBBQHup1FHFR-DCKI"0F IIp" Fع1ù11U+і1+ і3S3;3U+і3+<8H/8I IF(;5K'"hHF3`SS 310K13#kZC;F#k"hSCBB (H0Fz@Fz1FHFR-C'#k;1c1#d cckO "hHFZCSFck"hSCQEB$Hd@|>>>>>?0?L?Q?V?z?RRaAU~??AFHF-BѕA0  O"A0 @ﰱakO BH   0BIFPF  e0Fz@Fz(Fzm3H1F%h ik)F@23D f*H)F'HAFcjCbceBF"HjAFclF e opBBdeH2F@sB KR#@r[OsBOr[ HT1"#!e#ef$?@1@I@b@@@?F F hzF$H#k%"h8FZC+F"h#kSCBBH0Fzv R1F8F-#hCk8F!"l!"kZC+F"h#kSCBB HR1F8F-f#hC0FzH(F0?~?sFFlFh" B$c+`,h,n3f p o3g,mB  KJ Fl H@2F} I 0O3 +`K A@APA-GFXFh FF (Fz8`8H)F` h#@F UV*F3F2BB HI8hzm@F"h9hZC-m"hSCB YAxA-O$D FFp7m?8Fz FXsH9F(Fz$ F :F!Fsi*xlBkxhѨx@(dOpBx)?)j $;op@B7x)y ,y, ly,Ѭy,,Z( (y(hy(Ѩy()yOHyiy)yxxJIII $lOrB2opBB0O 3mKE+(Fz-@FOz&OpB op@BЩx3H0Ix0Hx+Iy$/lOpO :B   op@BW+QF@0F`JFCF0F7H JFQFC QF`0FJF3m[EDٺx0F73QFH ZFCD  |CAAAB BAFH KH FpGHpGHpG/B+B&B A-OFF FFO 'P0BHF )jE!2K P@F 3F8 2 6H9FZF5I ع#I 745  F9FZFF)H)I #j+b#%I2F(+j#bF F!H9FI2F (I 3F9FsBFFHI (I2F(#H FBF9Ft I (I2F6Bz?jBBBB C'C;CCCCpF$+mBpkhBыYl`Q`-AFF IFFRF0*F1F8F  IF *F;mB4X*O30`DPA-G"mFFBO %;mBHFHj j 3FO]hBZ`0V 0+ٜB؈b21QhB ёh,F" FX,$٣B b 2 F)FF-HCF*F1F8FI 5RhB)2F,$BH"F)F BF)FHH#F)FCF*F1F8FSIRFF  :mB!chSE =RF1F8FH"I e`tX, DZDDDD-OFm hF FF_C8FyF@eH9F]&0F:F!#lfFci!ipp+pOsBopCB m!O|opNB7&FFhCEz(Fz+p!pj`OsBopCB &&l!FPF"r((Fz&2F(FIFHFzOlX `bEO)rEn2f2 px3lf"Cl1n2fFkFn2f1  Bp3D`n2fI2 3,mPFh"#h+[FYEBH&g:F)FPF,4BYA E-GF` FFF&'#mB #k+kY5!lJq0F$0B' 0# 3+!,0( 9FPFV;F*F!FHFCF+ 6Id0:F)F FF7nB"F-H3-I M!lFhK#mB1n+ X+$J)nHc!FHFC!lJ"mB(+ X+'"mB + X+'#mBn'JH I "m#B/w'iX #d3_EeEz?r"EE*EhO? OBڼB`\&knx05!-OF7аFF_C1 ;D,3mBB  1Drh5nPFU3h#BF+FlB@E:FPF,VB#E#BFPF+FTB@E H Hi ;:FPF,BB$YEE!-OFFFVF+q/+/H+I EpBlJB@FJAIF1bRF+F`( AB-#B  HH ; E|FFMF!-A#NF/'e 3c~@F+FB5FAF|F$h,F ?",+F!K Opy8Bh %pG!-OhF F /Eл@ф m[E@̈́$O3%F'F C D07 *3 X0`3v 3F # X BBСHl cO3=FsBD00+ @[#  BByH(1Osp 63rx*E*gHF FlHlI (G(1" AF#(11 $(?sE1 "BDDD(1%DD#DspC(1D KK@!JJKHt +II((1C(1 D 3{+@rxQN 2- =F FOr!PF{ ;+K; # !  ( ! ( ! #KB"HOe ;F/FF[+?@HA-@;F /FF3{ BB%/ ' :F/FF'EEFFF=FPA!FF!Or!2{ g3F^ϘBOp0# ()D {Qh)!h'-?ӮHF#"AFO32 +FC%:;Op3-=F qz ). D3sqzDs 3 \ D O D (9Op/@opBL[B_r}CC}Cc_i`/ uOrQF`O00\-@ހO3 ^R`C@ހfFHLI f(K5wDDvDL opC@FBuuu_#_^5-@2P B6hB`+R`ñ+FHI +( DD#D 0wwsw`IF(@-_ 1BŁHFFHI F(\ 1_v_ 3wL opCB~1su1u 1F۲CR/DBڲ B?5- ;F/FF-'+0\-?PZF2#AF  +FVC?2 E/1B?*HDD$O1 ;F 1B皹MI00h+?9|FFHb#*P0B[X3 3+ChB?[X^F8HX_F5H=^"3I SF(#spDDDh 3 <_FX)FF&H/F$H$I 0 PDDwopCwDuw5wvL BOuuu`D+ڮ--D+ѮDG:GGB> H\RGGfG|FGGPAId(AP-;/h_ӱHFFHI DD_D7wvopCL Buwu%D !BmHFF{HyI F 0 1D/F}FqHOrP( y jH Ch55Sh03h0d BkF^HQ^I k(?Y_%d`DBY@FO3DQ_`5'%FJK +B$DO RP0[E?DZ =FHF#!O31AF +FC!D00ӹ  BBΫ ]#K*F+|B«$D$@n khd0]C`Bc`+FFHI (?DD`+ uwwD+ -w P>\:HBgHHHHI!HPA-C F#Fi?NOAEF@FyF08HAF HFxF(8Fy1HIFH8Fy@Fy+HbOr!clСk)#mB"H3 X( +!ShB khC`5 !縹H"I H5F(F mr@20F9F+%C F+(W(΀x-T`X.`+(h5FO`_ph!+*&phOr@!+F.#KERE a(Xp%t#3 F(ڧ-O ""`=J3F!"!+PIF+( &h+ F6+P+I F+hh F+&'I F+(xY$## F ]`h+HxDx>O4x9 -Xhx.-+(,ۻ-+ JJJF F@FpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h``lwhd   lm(d  lcd|`p`lSd mO(e`mKhemGemCeQ BC p`"54S+BE+8#FBT#!A#38 FF4.("8F F#T#E#34+g fXX\\|q|pccWFgfWFcbaXXSBBczgfp j $d$(^(,X,pcWhFbH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr  F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3C OsE0F)Fe %`O"j;h]kUC0Fh 2O [br 2PF MTKh*F"QKhFBiYQF[ӈ[Ӏ# 0 #Rcs #*sO 9DO F#cF #爈$oO`FFhF T0 Cѽ0[0ch F@ИGF8%J0hC Cѽ0[0*F2FiFF k0ND "#9hOR 0i Kih 0iFi# 0\ FF8KH! !P!p!t!P!x!|!MFFFFH(!F(FF 3F:F@AT v-tK#BAH!F(FF( z I Kp@OFH M*0!VKQKYJK7 FF0𵗰FFFX"!FhF#H0K7## Khk`h hiF F o`ol!(-OFq FFF𨀩K#Bq𠀸u𚀐EuX"!Fd#0Kx68Kh-~`h!h"KOyBFKFC:O{-lBFKF K PFYFk F9@$;F @2F@Ag 0F9F5pKFMF&FP0  @@!C! (x ں0F3U30RhC0 t o:!`o6"VBFKF K (FYF~kGFWF 3U#0+##C8 VF C300 Oi" Oz2H m  $ K F%JK H    J JF! Bq A 8 @@l D 60!l!H! !j bb Jnp DFk fjf! Bq  JFAFKCi+@ i% \ k6BiF*@ %i J oIc0D0 DBa# 0 P  @$C C^I h)REq 85L @5DAF CiF+AMI"iZMH AFKKh{KH# 0! 0kZ#!# (F "F*8J3IhFD5H(3K,K0hOxOj%i  a@a8 K"`7j 4F$ b an`@]f l!`K!tKH!K !!-OFFFFBB4(Fq Fb "##0 0 [kZ##F uKhuK)h 'O@gp :F?4p(F8))FOs#Or"6 B0eK@ Fh *F0F F[KhF0ZkBiFr F)F$%F F)FjQF"i*FK(hi iIk DE" :Kh+Os#{+Cx!F z"#F8F"HFQF*KhD0FAFdx+0FAF]x+"F+F8F)F FeAFhh0FI)FF FD0)Fp F=x+x)FF F2AFG0F-C3C0FAFF@l0hPwd|!H!p!l! !-OlMF F!X"F)F FI@@F>pCKHOF^ F)F0+U0[2C ##; lM2H3C1FC3CO2C@! !H0#X0K0F PhhFi##J2CqыHH(щK"`oPoH0cL0" !zO#?F FRH !ȱvJh3`0tHZP"#nH(ѮS  !F@}8yPXFQFT0 + XPO^p@OHSHtRH(`" !L0#P?f H ![C"#f#X0IFM^MwM !(q-OFFNK#BALH"F3F882pSx ИBv BBvb\5 F 1F# `PFFFF 3 D2KBiC,~OrZC " <bDBFZF# 6;n  @ @;iA CAqEM*hi#a:k01Fo#(` F f#0 F1Fo# Khi Kh# 0!MT!l!! !J F-OFM@BAET@EAҗHBFZYEs d(FjIF` \5 # @FFFF 3 tDKBiC,~OrZC " <bDBFo# 3n  @ @3iA CAqsnDgN  @ C qjPFC): s_H]IsS#FkhlYKhñYKkiU5O EQH#FkhkcKKFJhk+ #OsDc sF5 `  O  uUF>EU8k2]E (E+Kh{0(T5OsETF5T E `  O0UCEs  5O< 0SB` SB`!MT`!X!l!\!! !t!-CO +KFFKFp:F |C&H*F3F$L{F;B22k VV s8UH0`E@K%c(Fh+ OOxAF -F`cF8F`bbbY0`b)FOpvc(H V !M!l!NLkvN#c!-OFdFF0+dLKhkTF Aq  (V(VCF80vF(}AKHFAF&h >K(FhS"!`(C"@S f #3FF 2p(O zEغ $'O'N(M;h1h(hB7d1v+hk#H: F87A?62O`^&0X5X6B?BV`+h;h(`d3;`3h*hY1`B#@ !!!!!!+Nl!8F K Fh X KhS" H*F#F#BBh8!!JNpN3hKMh,hC;+hB 0hv[(hvX#+`3`pT vP!!!K"h pG!-OFH0$ FF+F ChGFXF $ K*jF(@.t0k{0k_oCFOzFB!pI1JFSF #BAK(FhKh+>ѻB"iR# B#33JC " Di  E# 0oK!Fh!jhmKBmKhRoBJܸEKۣiO #aO aHih Q;@hC!Oa(FYJXKTHihȱ ! Q+)  hIoYEIK!FhA+HI`FJF@Jih)BS8QhPAѕH0+bV _;K" @@A`##6H A4H(FGt(JhFa )H(J!`S((jo[(FGFТi"a2FKF(FTa Oi 6O T!l!\! !aN!NNN!-O\$] hF F`+# `v F(0CpL_ Op$(5BOpq ۸Hh<*qۣF2C *n+)F"  .)FOr  :kU(Aq% >FFF3B2FZ0@΀+ȀKh8u8@@uD%BrlIm@r ' G BC'bHp+P@/2+/zK"G@A`##uHGtH(@0F+0khCOiHXhK"`56 -_Khk#b0+ 4.k #O sCOzaw)t4PwєH0+-w{KK"G@A`##h&Hx&J1;A11H0+   #o!F(F!Kh˱IOr(F rD#p@H(;h+ I" K`QKYJ!O !l!!O!!0F FH#r B!F(Fx) )HK+0#p#O*OK-OhPF F x+$%F F)F $%؂&#Bu8#BB F)F0#ZF ,FJFO hR Bs>V! .8 &^E(^F0FuFH F)FxF+4EYh!S FBĀXhu|K F)Fh C `gFvI ,\5Bii(YCL|hġLsȱPFM08F fcK h*+_KzhB#B\HAFYK 2YHUK" zh F)FB5zm 0 # ~ACq#@ C 0;j;;b4$;4L3B2$ h:`ORb8Khf1Kh#Fa# 0pCOг O?гO#3pi3aO  #34+?|!K9Fhs#3pKh8OO8Fw F)F qKFXFwC"ц#3p!!AOT|!U kO!x! !l!0!X!P! OxD#e84J0  Xm   +HH AFXF-O[ @POh!#'J13A1y#Kh+?>3sp8{b(н Oxd80[m   +H HAF8a8baXFO[+KPf !p!-O\FKFPh# 80I#F\Bii&ACCshCsPF0 F qKh+0+mKbhB#BjH1F$X"! 2fK@F9F8UcKhF+@h`h\mX(F ##X0+UKh+SIOr(F z@F9FJ#pX0+ #  PDJ1;A11,Rbh@F9K9FB05um O- ACq#k\#kT#j3#b4$34L3B)L$hi2`ORt#Kihy0iFui%H P P0+?@ !F?7ohohnV I"h!TX!U O-l!! !P!x!!! !|!-OFoKFFnJhhmkypI~! OO` r!O|[B{B{  $XED XC=A ,uڎIP `EKhk 41FX$/ #h~H7k#h|H0`#hyH)#hwH"i3#hsHhqHt k"1 DB 2 ###hDT@OzsRF  E [Cs+FAl "# d!  #RF+F KF:FLHch+# 2ChcRC#R@ 0, br4Z0 J H DJzY80^Cf!8FD-JpF a` #RH#iSHN%i-@ "#l+<HN%l-@ 0!PPPPQ%QCQfQQQQQ R(RJRRRRRSJHjch+r%%d%aedl(Fh|ORfhnononFn#p00#0 %ShjBOt#0#z0+(H'K"`l+?i#h$H0"HP(?YHx #B"IH'(?E#hH' ;#0F-h:#0F-hA@ht5R S!U>NKh+TMH2FKFN kBBS;B2FKh;pO#DH( 0?OF+O+h^kOy0FIF"9hHH)F#o0 QOsIq |)FF^'Kh32F)HKF#'H\#Hpj(@gpKh+\IOr 5+h^kOy0FIF0!!!!TO!!!X! !!T!T|!TrVl!0Oв_U5A0 -w(F @߀K G1O h(q X@ F(?tJ13A1`TX(H t(@:K`HH(@7 $  O+EцJh*AqI2;)r:Ңn*7ЀJ jhI# hd xH wKhS #vHUi# 2FF(00ó U^Kh(5+:By5cJh<.y.+L02CDIEGu -w8 '%) 5G-fn+(IEu0+Bo9kC3WD۱0C##K:Kh+? QFT#WF5HJQ*0;#WF F,HQF6|2  jo   ñ40C## Kh+?d  T*OFHVQ*0;# 4FF FH2  ! !!UTt!`!|!U!*U!QUwUUU``Kh``O@V F ##p#_Jh3` Sp03KhOsBFBOrF g`g-zK 0 00+C`hLhPmAFkM F ##H0w0+K+hdKh+EmXCC5[H#YHXK"`#p| osL`onP`nJMK"hB#OpCeF @ +hCKhZkSVsC3eDe)uѠn9umF4(4KF3N`p O h#H0# kKD zF=2hi U +m85@$@5DAqlRm@q # C AC7 0PѺEњk0@FGՍ@!D!t!X!h!!UV!|! !BB#eH1Kh;H0FH0+?"#####ػ H (8fI"0V!dV\!K!-OO LMN"hjB3Qk0HHDDLTOO EpBu_X"! K% K K 0$jB_K`0>\Bii!xCNFWi NwIhNrKEr1 F F*FFB@Np 3BN  -#F*FE9hCBs 4EBT0!FkCFmJ\5B0{#3hlLCs F0i@F dKhdKh*k+kbKh.nx@&`O;h0,YFFd hC +FYIJFXH`#;`VKh+|UKx+xTO0BR3BF5sbF1BAr2DTb)X ?FKhC5@$@C!BBO "F3F>Hii%BC0@z+ AFi0@/H)F0B\0CDOF0"J"7Hq(6J"h*@8F $HFOr;h(I;#0#0 'J;hhCѽ0[0#Jpy7'3#7DB<#hHJHM(?BF F0JHt!0!p!>WWW!\|!"XWWkW]Wl!H(?䮠_!FWTF0F8FMBF F24F3B2nC;C#P tFFy3#DBE.#hkHH0 %~Hc23B2zKhyH8;b#{b0JF F&oH(c23B2iKhhH&6#h   !F8F|JF Ft h$h!FFHf t!6b:bp: R]pG R]pGHR]pG R} -Gm(FiFAH$@$B>H5F(F mr@20F9F#,%CKh *2H8F0*GJ `GJ`e(@JDKh#hC0CY-I|2F(F h0;H)F0;8H)FAOs5I*P3I$(2H)F.X-H)Fh*H)F4&H)F#H)Fp/H!H)Fd!\!!6``!I`T!!\`l`!H!!! !!`~`|!!!`7`` a.aZaaa!P!Ob$QFXFK#FFFϐ)O*VFɓK6X8SEA1BFHOsEqV뻐uHG(?sO%Bߛ #8SE%"ɚ@;`p(OлBNeKeJfIfKfHfKfK\]IF" O3F)/SBYF0XD[ZF@F4 YFJF#ߐ(F}:F@Aq[I 59hDHBMCJ+h\7FBѓ0+;.+h 5('18K"hh:76HO04H)h2NOR 5i#s 5-Kih+KhiFi')# 00++h"H!J+hh0*LJ/CKh+!hJKH) FF\!a!hbb4bbUbbab !T!bcP!x!|!6cX!0`x,BcT!#hLH!+h@b^oRHJO|jEIBCk `"J` "BC:Nr wwDAGwC w`DvG *@ܠ *l +h*@𣀓0+#h+N(H)h0F0"!Wp0L%P%Or0#X30@FdQF)hOR Kh#F5# 0Ngc8!0!c|!x!l!!P!0+#h+Hm)h"0P%ORc0#X30dKhhKh#Fc# 00+?W+h !1c#{H#H4(')hOR 5#c# 5(Kh+Kh#F&# 0+h0+(هHH( )h#(OR0yKhwKh#F# 0+hkc)'rHpH()h #́ORccKhaKh#FS# 0 +hRL%2@A+hL%2@+hlkB0UH*hk[Bd#h+@QH( HOR)hBKh@Kh#FBJ# 0 0+hl[kB0=H]*hSk[Bd#h+@6HX( ܀OR)hV'KhY%Kh#FT'J# 0 0+h%KZ\JKFZ)P AF)@R  +F#h+@\H(=POR)hKhcx!|!dO:d_dnddW! e!P!Kh#FxJ# 0 0Ă+hĢ ,%*@60%45BB1НH+h0e4u#h+@H( OR)hKhKh#F1J# 0 0+h(0+ځx)5ЂHx0++h <"x"(%#h+@ʁxHn( OR)hlrKhokKh#FjfJ# 0 0)h8%<5lCBB4bH6+hblCB1#h+@WH-( OR)h*QKh.JKh#F)EJ# 0 0)h@%D5lCBB4BH*hlC@5#hD+@X7H( OR)h1Kh*Kh#Fo%J# 0 0#00k+h *? +h*ǁK 0+@{.hOp@!FpeL(@#H!FK "`ܹH(ԹH(̹|!!QeWx!zeeewf!ccl!p!P!!)0BHT+h" #h[HQ( OR)hNKhRKh#FMJ# 0 00+?􂭆H#h+0B۱CvH+h #h;H (f OR)h|Kh zKh#FuJ# 0 0CsHn#h+oHh#h+KDkH`#h+yrZ! *\BY1R)jB`]HB#h+YH:#h+<)$TH0#h+4-PH(#h+mfLH #h+lC8%O|l"J`!h!H@Op!FoUK`ػH!F)fx!P!x!|!!Rf8!L!f`!X!\!fT!!f0!!!!!!!g!&g+hJ 5@pKhS1;ItzK"`KOh@Fh!F)@s!FOPNiOyFFHKFh>F(@]IiK h7B'ЌKh+MHH (AO3O29F F ?@Fpp# 0h (F"zH0+gxH(i#[ ܁rH0+ppH(r#[kkH0+xcH({#[B/":*/*@^H0+XH(@# F#qcqziFBRORH};h+@IH|(@iKH0+#O #rcrr@F 00I =H0+#"ct"t@F000# 0y1H0+?O2O3! F n#@F00 # 0gH0+?x7'i#8F;q{q# 0o7T!!`!!!`!LBALPgWog\gggg!&hdVgdFHb;h+?Ri# F#qcq# 0>K"`=Kh=K) OrOb`08H-h7L 5s6 #"''pY+ɲ.kp03B"!p",H@S)H#x%!@(Fo %K!`F(Fo#K`,  "HJ#p`J`JZ!)?HHJ+FHZ BH"8#J( "dV!H!Yh!!zh!!h-eKh IpCO س_гOг_ KhK PBOг@OHL |!!hF5Kh5H4I0F(F 1Jlx0Kh+/H1F&.K p -KxxC ,H1F (Kx+(O(M1F8F'HHkh;k`+"HpIJ ,kh;k`+(Ff (y, jY,+hZ*`x竉ջ+hZ*`x +Y,n,N,!hT!\!i!! i<pF KFFh .H2F+F!FVHg "p!iT3KOp-A$-`0K`0Khk9Fo -H-KOaaOp @ao(%K9F%NaO @ @af( F( n<9FFOpoF(,(Fo:3h4Ean`+`5`]`O 0aѽ,+ѠF!! !(i!!0!-OFBKFFh ;"D;BKF7H"FK!@F2H'=FB t"FKF@FF(8F AFFKs# B)K(FhXIsB) 3D@OsF~ FF H70DD#H!DiIiwiR|!-OFFF8PZ3ZFDZ(EK"`H2FCF$HhE O" b9FJs# B FHsHH0DDH!iiR!-CFMi Fu3K i3Oh2I#B9F0H#i%0F Pea#i*KBE)O,F.F:kL3B 0F#*FIFHF8hkH$L4aCCsAn  @"C CH@IFhK0#*FIFHF;h4kD;hPB!iiP! !\!|! 0}pG-AFIO hIn ;h 5C"3;`#CBBK!Fh H{h2F3{`+Fih\e`a ! !\!`!-A F MF I,hBdhBHd`  G C!BB$hiF F2 F`Z`+he`#`\`i,`Ca0! !ipF FF!X"hFhFe p FhF)#  H0+ 2 Kh[ HJ##`  HF H(##` H3!jjjpF N Mi3h)h BKh32hi(hp@p !!|!K"`pG@!8FL FTBA H Kh Kh #`T0BXhH80!2j! !-OFF FFFBB ѣ3C F@IO!HFAFx;+6I:F(FT"YF'pVEEOHp7$)KFhiFW8(Ff)F;FF/"G,B'F3C #0b9F(FO!ļK1F FFK6iF%?#?;p<#4C0R5\ !\%[K-CB}F F@𩀐0+)U h#O`n(`(hOHOb!FLKhLHKJL5h*8IN3OOx3h)hFOHhF Wq:F3hIFHF|iF"2 E[!;3h)hFm(h:FiFWp3h)hF`020204#k$ \3#j$ 4$bj04#8$j<@$ DH$OR#0L 5L53 #P50"0#"# }TVj!}jX!|!F F\#IB?ѓ); WpLE40b  WqPEPE@@@ @ Or]K!Or]KpGT-A0Kh+@CJ`L h(ڢKhA!񆼠IKx+<ПKh+8ОM+h+QНHtKhKhKh+Oі0+KFOP3MOR1FihKih0FkKh1F0FgiI h# 0RM& hO)FiMne h)Fin^}h B9iB!H~H((+h+Ф()F hi6n:(Fn7EFpJ#]M`oJ`+h+EaO;h0?\N3h+5hH+h+59hSM#OR0ci #X4SKih8FQKh9F8FiqCI h# 03hKPHROH((`MKh#MHDLK6M"`OR8Kih9Kih0F7Kh1F0Fi=)I h# 0k=!-kh!!Fk! !`k-O@*O>hkB$I1 Kax!SaEs#@ @܀ B@Ȁ FAF\5!FHBii)XCAqzKhPFvNAsI;h@F bpKh+3h+mK B#BiHIF;h FBO vs\H h CTZJ0B   `O@D]E  " MHO~2[Br28hL3 kB]0;02;B220n;0AO3AF39MOR9hi>6Kih8FB3h9F8F?i&/H ` F `O  I0%D3BD 3h+?T:hAFL$0 $[$04[4 0b $[ 0 F !8!L!T!|!X!U Z(!P!x!!KpFF @P%8 m8 H=CiB iT%0PFaD%@ ap!k KKi i@P"0B@"@FiBa!KFh 5p KBBB BB    !^F(-OFq X GFFFA(=XF1F(7KhNh[iSE"QFy`h1[A1C3i[iKE K"IFh^0a3i!RA!!A!! !!pG-OFFkKMpF$S"0[\OC kBܽ#DJ4K'F[$ S$0kBB 'DX$@@HDH$[R7`<Fn*#\(   [@²\@BZ @² @²IHkFn*%\@ Z\"B  [\"\ACIH{kFn*"TX"@ \# T[""IHPkFn*"TX" \C T[""IH& k-GF F $(In IF&n*F +Ow\O ʿCCwTIF o$uQF E(FH! @TFDEB< `F N~8\"@aFqE:ܬIF2B:FU"D.E"U&E&, U$IF{xE$4IFF!B1Ri"-G}FFFFJFF(dI2F (bI@F&(F(D]I*F@F 0h+XHIF~O0 }kk6j`j`+k#akkca#@0#bB0cbklb/{FI:F@F |0t@I*F@F v0:@IJF >IQF8"F F&"F:I0F8I0F 6I0F4I0F2I0Fh"F0I0FB,?.I00F"!8FHF 0' 0ByBOЪ# (5D*#*#0x "F a#( kd@edAkzd@^lkkClll'l:lOl-Am%OcFF)FFyCF*FF@FF F M0:`12(F mF-G] F  .%FFFP rB0`pC_x/!0FCxr+#`dJcOaT!`FUEB+,F.#. Ft`` F(U0pCODTsh|JOa(F^(FHu`F,%&. F @(.> F z(W(΀m-T`X.` (h5FO`_ph! "&phOr@! F.#KERE a(Xp%t#3 F(ڧ-O ""`=J3F!"! PIF ( h+ F6 P+I F hh F &'I F (mQ$## F ]`h @m<m6O4m1 -Xhm&- ,ۻ- JJJF F@FKh @pG|!KhpG|!-OF8KFFF@F9F5KhkOz"FSFEw ܀7$$ 48FFO`aq#0ZY(F]CHKhCH# # #'@#U h*۰mK@FBHi0[Y]CU He( K` ! !l!d!lW! !Kh pG|!-OFF FUBv 0kBOst8 0(F!Fk @Fi *FIF#FGB " -#FF#$BB*" [EF F *F#F0kB [i+H ^E " ^EBi"a Po^FF Fi#al !-OmP` F"C FFF(<F?FF7WEE#љBB*#2FHcKhH HP(K` l!dW!-AOB F !*NFF3h+Os#FC(F"#M+hkBSi3@F9F3hCKix)h" i"aOR Li Kih3hiFi# 0|! !!P!x!-GFiFFPF F;PKhwF8F FFHJHIK` GKhFKhk2+FiRF0F" i"aJPF F9Hؠ0kBOstC0(F!FkpiD#8F#`"HFe K (F#!F#"CE i"a*F8F#F0kB[i+ H$ l!+m!|! !Lm!~mKJ-OLFOKF#h I rOS5QhPnxS+0;O #h9FH#Kh+@̀~H(@ɀ#h9FzH#uKh+uHF#hO#hrH# h#hFpAO#heH##:F[Kh+\H#h/"HF#]!h kBZi*?O #hKD #hS50RhCGH9FO?Kh+gDH h1F #h"#F"#hkBZi*}6Hi4K5H4KFhByB Py0B҈3B)H9F#i#avH?EvH(>K "` H(dH(6P !^^m!OmOm nNnK`n|!^FF^0n!K!}Kh+6b2F&ltK`FtK B!rLO3 h 8F J(рE ?ā# BGi#a !h. (F k !O 0 lVK!"J&YE 6Z&`O 1 @ 0 8F(H 0 +O +F#k4FF:J2  B0Q" \AO2H 2Khñ1H0 kұZC8F0kB;(H'H(%K` 3h(Jq iD  0kSCAqBO  i#a`4J [i+ FQFl! !!cn!dnW! !LK(-OKMFJLKKKNF#h#A@GJFJh"#F_#hkB\iD;H)FZ *9Ji%p FE ؀ؐBi#aERF8F  (:S$4#1F@F### %0H#8F### ?PPF( K` 6P !^^!!`n!n!men!n8M+h %4JLBH#h 8H( ##CH +h# #C H #h+( !^F!nTo,o upG-GFvFFFIF(F:F3FF8FO`f#zTD&O` FB`۽#D# 6P I-G%@F4FFFF F!0_ H#J ## `:F!q F !F  @mH# :^F: F^p FFFr2Fk2Fd2F]2FVppFF F((*Fmep-AATB A ҅BAӃ Bt ҅BA E|   Akk@P!ABBh-OFiFFF%󅰃@B:K@J19J:HiiBvFF"jF bhB# ( XFG XCFCpPF ]DD#i  (XF@XC!FC)FPFbh7FYGBvF>FVBooi!@BK@}1JHn6cEvF5FdF=F|qE$ 5FF EF BuF5FBoopF%+K@,1JH6;ch BhZ`Bh`l#kYk(bk5B#K@21JpooojFKh[H2jl# Fb#`k3K@!JH k@l$!ooojF3K@AJH@ml F@loo-OF-FF# -Nе?9+$+F $<<_<O1F0Fl[P`hT@h3DP0 0O OshBihPFBB$H& FiA B43BFOL IAQPFI,qBB K@ 1 J$!pLBAW:p\pofppNBAWppAFPF6I  #k`40`@0  R#`H`B#803800O/FOs hBji&0FBB47BFOL Y AQpPFI80+K@1J|;80h BhZ`Bh`lr6I HO$PFF^PFPFXFO op-GO CiFF j3K@FQJHzO0$k-FF+kS(p_kkCE0Fl+ F#1F(F#JFQF(#IF0F#RFF(?ho(o-AFCi&F@jF3KOVaJH01F FrY K@aQJ:FCF(F (, F$o;o q-CFCi& F@jFF3K@qQJH1F(F@QK@sQJ4DI "FKF8F(#AF8F#kF2F(F(FoQo qK-sCFh F N3hBF HKFBF0hKF!F p$!\!"qK-sCFh F N3hBF HKFtBF0hKF!FD p$!`!SqKMxQHN$O+hmB(hPHH( (hN2hR[m8FS4Rh44!(!q$!qqTL h@j ( hS##`(!7FHh(j,)F0 F(!8F FKhñmJh K@"h`B #BB  8@n l!|! !pKsh;+oKԿO@bO`b`lM+h Et`) gHcgHt(W .a)7)5aHR^Hc(^HX)h]LOR 5i#s 5#d3#a3TUKihXSKhiFTi# 0#$F !$p#x3.h e3#F FCH!PAH:H)h9LOR 5i#s 5#d33Kih1KhiFi$*K" *hd3+7Y)7ؒayK+.HH(?j!HL)h#ORa3d3iKihKhiFi$] K" + FpHF!$! !rT@E48FC4#R>]pG3FS[hk)FF F'0@pGF04[ H^ |]pG6-O!FFFWF@qI(FO0'nI"&ih a F\B 4+gIJF;F(F Fj 2$XF) F (F#Fh0+4+#(FRIYF$m4B +#(FKI@Fjw+ 6AV "#DI(F#CJn#AJ(F>Ie#"B#"(F#JF;F4(?~VO##F(F# F(?f>C@ cVcmXFDp b6Bvb $*J![Fi(FI"(Fi#(?*{a7#mBؾ'F~vvvvvwvww-O!FFFQF0oI FO0!JU#B4+hI2F;F F(Fj #pFA\)#32*V6+)YI"# Fy#"S F###"#m((Fj ԫ4+II2F;F F{4+DI"# FpBI2F;F FD#"S F##2F;F9(xs0s+ P [ /I2F;F FEр$* ,! FQ$I,0*+rO FOG(?Aha3` JY FFHFQF F0$~vHwdwwwwww-GFF OaFjAF8yԉH1F$#Tet@E#!$4###F840FOcvF31FOb FqI FC FlI~ Fja0gIH4$$pCO(ВbI$B0^I$4#]I FHU2C=YIb0VIU2C.TIdF4Os$4U2$tCc:F#@FIFC EI:F F#`EFdU#$t@FIF:F(Fq FFF F F4Ir4CBF0IKF F2F+F F0?_"# F#'0?Q"# FBF?Gȱ! Fбj#R вBs F0?0 F2e#wxxxd@+xBxd@YxoxxxxF4BB* I0 I Fz4 I"F F@Kd@y%y!F1(I FG ! F$  I! F! F4I4jkyyy-AF jFjF&1YCh&ae FAF a(F0I(FO09F(F0I0Fyy$ʿ$ Ŀ9!+OտOs Fp!Ap!AOaOq!pGjXm j0pG$4jjPm0pG $4jjPm0pG-O FyF(C#MF!IF0F2FI&(H FFEF;h#h+FNEIO0 ZFW&06H#hSCFW%02FAFPF5#hME %zzh%za$$#Q@8a#*N FsF7hI;O08F(2h I(F,#*#s2hI &{-OF FF F)B G C -I FI FiE 6i2EB [  лz  #C %-I Fh/hx :F1F F CFv??FF2BB2 A:B; F 0 F0?x F# I#JFL t{d7-OgFW#F FO#JF1F(FC ѡKhBРI q( s("F Fa0O0O# F#"#??FFEA6U#I FW#$$GaHEq s*F|I3F F! FF [ uI Fj! F oI! FkI4! Fjj Sj !  F 4(_I F4hh BBѸUI F Zj2QI B fEzKI*F3FtF" EI8 Ez FF3 aEz;I} B A0-vCڸ;=F*F3F! FL0?! F jOf)(@#I F,-v BA ڸI F1I F, )II F-vګxky2IL n ̖+F>~ I">HJ!>m>Hvm#8$!HjHh #RH |]~9̗֗֙ Kn:f*oB (КmQeppGI߹𵽰 FFBg( :,468jKH=@t>CHH1kF  !AJ@H=>H:H=H8:H:H:H2C3H6H#jT!p RD EB10),H+J,I( F)H=@'Hh $!8m#jFAiF!HJ!#FJH1+є1+HoFH=@&u7-=L[iw8u-GFmJF HP~J |HJ|H(FzJ{KyOFFF$ F m#@F *# @F" i.1FgH#!#"ji &j`J!"3F!B3F:FB" XI"":WH"i+Nр!TKB:FRHBBHFOH$ O O@#3! (1$4! ?H qm#8$!D9H8H #R5H$idB-HB:F!#HbOaPF#1F#"jiN 3i+;+#j83":F!\"HFd#jc d 1bb12ʘјؘ9ޘ! a6|Z6-GāF FF%BF9F FNC`KhB"!0F\HV;)F0Fl( `(a8 (    %u(x( NI F FEE0F00FbEEE+s0Fx!xi+ sBB )0Fi+J +H*J (H(H0FK&J'KFFF/#@F  #@Fz 5 2iPFp * '#)F#:ji6 ?iHFX12ʘјZ-APF FnFFC 7F2K    h3ScE2FF(K(N2FAF(FHCFı!I"8F퐱!KhB J;F F"i*T* L*I a+, FE0l*ТsH O09F F0L 6CͿĂQ+B@+pG#𵉰3OF FF :F1F(FC(+s FK!`i+Ei+BvBB<ԱKhB# F#"#)a8 (!$I  F+0, F, F=H] i禚Ăh `Èˀz rF /0 //B/pG{ {S{{zzSzzӈhJN ]ޚ-CFhF F ڈ z Zz ۉ0sxs+sxl+O&F"iF8Fp#*F F"CjF)F FD'F"iF@Fh#*F FB7/67.-C FFx[PD FIF[  7"I"F 6 5  3 2 1  . ( ѝ0 00**+4'EF1FR0#S˄7/O0pFpL&"F@!hF6hF4G. pFL%O#51F8F(-GpFL#FD F5`ir)Fp@p-A FF(?4;;J044rABOA64N  #38NC0 C8dCS00hF)F#@c0 HOCFI FO0'F:FAF0FI F{0FIBI;F F_D0F0 CC0瀜S؀Vp-C FFF(0ICP,OȀC +K #    :F1F(FCF KhB#JkF FJkF FU*L* F0a+( I = K  IFhj0\ ̝ٝuI&  FFIhK8SB@!FFRKh JS BB KSB@Ih!-OKFN FOF2F)F FF3 ѠKhB ПI ?OǾo+;hF($$*ڔK!JHI(XHFAF8F F(M8FIp(ƁIF(@HFID(FgP2i;+.F4jOswI"FOF1+F8oIZFvP(FlIHF8F!(FhI(Д!(FeI(Д!(FbI(Д!(F_I(Д!(F\I(Д!(FYI(Д!(FVI(Д!(FSI(д!(FPI(д!(FMI(д!(FJI(д!(FGI|(иѡF()F@FP(  4r 9IRF8F (?|6i$5IBFPF(q5j1IhFH0,?f F a+J!8)I F(*m*%K!%J%I F(#I"F.&p 1 Gb<tnzL.Ǟ֞u   sAF(?F(f5jO h$3j3B >IRF@Fn(QHFI6rBD,(IBDHF"(rIBDHF(IBDHF(rIBDHF(|IBDHF(rxIBDHF(uIBDHF(rqIBDHF(rnIBDHF(1++ٿʱ O31ȿOs1Ur_IBDHF(?r[IBDHF(Bs$$AF$4BP F(?HFFHF$$3FUCR ??@BI"!05I0F(?7( F7Io6I0Fp(?$ (0I$0Fv(?-I&0Fn(?*I(0Ff(?'I0FJ *$"n I0F(?E<ISF F-utnzL.Ǟ֞1VZ}=ʠ$:"@DF$*FADBFT$4!L??PI$JFADE$1F@F\%FRFFJCF8 hQhO35 $0 600 40ˌ"## IF P0#T0B)FX@F<3F$$??%In$$AF$4B)F@F0`H0L0 $4 !?? I:$$AFh$4B v(HpF" FhF!Dah"hFphh3SB"FF B J I IjFbCI B $p z'i!!pF-PF!Ұ#.2### C## #@# 0"K,"'K(K)K*K+K,1F(F Rpi@i!iPFxhFM ]KKpFx +cHJhx Bxm5@C0@I @@B>H A i(DА *=#@;@B7УhW iF/Hlh`i# Bx3@Ct0$I @@B#H APiOa J#q2HB  pFH1F:h`i# Bx3@CB0 I @@BjH A6ѧO6?!!ġءѡsF J II "(FF$pah(Fph[x+ F*h`h L$h Ch/hB(F%-OFFC BFxJxI <(F9FsJtIFbh hQFhhoI(F`(9ПlI(FXF(HiI(FPFFfI(FHFFbI (F*F(1Ѣn# (F0%NJUISI (F (0+ѡn)|"l0Ft0onJInF#  ***ѻ YF[ kױ:I9IRF (AF4I ﯱ09F=C"l0Fn.阹"l0F!n(0bnl)lckB(FTph1+#o˱!F(FG0mI, "l0F!n0k0Fm0m} z|26>-HWw-AFdF$ F8FFȹ Fz1FF8FF0 F(FNAF F((F<F((F>I8] -AFFIjFF:F+ CFO0&8FF(А"!F0"9FpI0Fd0н #FI@F*簢iF0 F@ FFF0#`O0"BF?#8F."FF(Fb2(! FFFF0p#`O0BFd?#8F"FF(F<2(! FjFI0@L#`O0]pF.IjFF(,K!,J,H,I Fr8FŔ1)9XBaA;@!F8FI0F F(F`I Fĕ! IFF0FF F-O0pC¢ Ƣi0,MP IFC  0 7" Oa2J pbM#x7# OaM 2JpR#xc ,M0!F(F F60D!F(F F,0DiG\pIFF (KV!JH FlFFh3SB"FF IjF(Fx0I bpl ƢiF"!hFIjF FVC&iIFjF0KOaJHI F;C!0)PBaA:@ I F0$0O0 &C罣¢ ģiisF FIjFCF0F$0K@QJHv FFI x1F JI I(FJ I Fe p¢ ģ$6>7 F F0J II(FF0 K@A J H(0 F I KF80 HV`ģ627 F F0J In0 I X I(FF0 K@1J HI FN80 Hj>`ģpIFz@4O5#`(F$pE@-I .(FepFIF I+F0F0 I IjF0FT$FI Fe^iϤ𵉰IF28#`O0 vF0Fe/FI FI3F8FZ0 I I8F%V0I Fe(F2ܤi FPCHHH]~, 𵅰  mIF20I 0eFI`I(F0I2%OBȿB T Fe N J1F8F5xi $=csFFMF` 1F FQ0I*F > FC(  |pFIFFbXFĕ pIjF(FmF&ĕ !hFIFF0FF(F`Hvi p FIjFF0K@fAJHx!F(F0O0 p2*^BbB;B2@ @e !F(F I FF(F`C C猥¢ ģH8FMICF(F$0 K@1 J H(6) FWI e 8|` ģjF IFP8l#`O0" F0IH  H  IFjF$0 K@A J H I FM0H &ҥ¢ ģi٥ IFjF0 K@A J H I F#0H &¢ ģiI#jF3I %]iϤ FIF0K@1JHhI F8V` ģ6F08 (٣a*أWA*أ=#`O0P IC C #0I ]i رL ! !8 J H` "FIH~,j!F*F J IVm!HONL!(>FHKI"F(;FH3FKlƹm!HJKIDD(F"F H(F sh(FG6h$  1h٦A`pGA`pGA`pGA`pGJF `l `dpGJF `Qm `SepGJF `m `epGJF `Ql `SdpGJF aQn `3SfpG8FFHT0#`O080 +$ A;+#M(FB>( #,T CK \!JFnpG BЀi-OTOK @@ DPOx0GI n2(DIHD@E FTF0gkI&0F+@#*+fH!(F"9Fo&aI0F$O 0W dz(>YI .:!#pUJOapxp#x۹:##pOadp#JJp#x+!FPFt F0D!FPFj F0DchAF(FG$h7I0F 06I 6HNe14LH0s(F(0K1I0H8AF(FH0I0{@ƀ`@,ǀh"AF(FGi"9FJoI0IJ0FDD0@єIJK) FFi* zi~i9A.iiO":! Hivjթ9NV#9H`#Jd#R2I3HX#R/I.Hh#R+I)H}j#R'HZ#&Hob#Jf#RIH_\#RIHU^#RIHK P@,?;ch(FG$h0"AF(FG ]aXhj!r}-OF FF` )F F0?I:F dFF@9J 9I FF4I FȐ1KO0 Fz@Fv |'YF8F됻YFPFP IZF F K0hՙL0hԙM0hՙN0CO06[AF F F (-h. :Ihh|@ ! 𵋰FF8FI 2I(FhO PIjF(FM    .0h+I I"0FZ J I ;`;h I"F "!8i(. FFnI#FF @-CF!I FF0KOqJHZN4h N\F(FBF8F6FȱFHFnCFJ)FHF$p$(F$dD -GFF|I 0FC BFvJvI P"!FhFM    nnIjF(F0+ј"! BiI 0F0bJfIeH8P(^Q8(?^K "!T-5>\--7U#`0FO;d+-)UI@FV(OrYB?Q)?) A^ [X\0 X eO " F Fxr(00FdXպ0FL(OsX0| X Y*t##0FdO;!b"#`O;$ 8FF !YPO;+?2kDҲ^ x X0:,;+?w*lDx ?FF#'8.&a- W<+۲C# FA-7<0< ,`!?[x1F(FdQ$JI i"F( FJI F sh058$>-AFFFF@F^(#`O0@FF #ji!F8F0h Vc`-OPF%FFFC  GpW;F:F!FXF5g`9hYFhFKFG F5\0 F00K+- FBR#`O0(  +-@#` -GF FFF(#`O0:Dj #!ia00sIFPFz8 0hP($h0-+ PFf(( iIaiybh*=C$70h0( 0h((.H # FF)F0F0ck xk`i+aI Fh#FMFF$ !FFck8K`T7`DFF !FFcU(KeDa7L-AFFF`i0FFB hcaac cF0`ixO05i`ahcaac-AFF (!FFc F K"1F`FC/:Fa0 Fc$ F%wT-CF F ,!FFcFFK")F5FC$/2Fb  ;F0 FcWO HF\-OF!FFFFFE8hO  B "`O0tO  :hO  EJTC<`(hY+ "Fh(FF[FeFG(eh!F  4*h[F(F"FG(eh!F4-G%FFFFE(Fh_h'ig1F hS1FFGFPF\k  4|*h"t[hG pGh00O0 BjF*#cbdiL Fj0O0`h$h0jF+##bdj| F h2#Ah+0O0`k$h08F Fci`ciE``a#`a#t F8@O08pư&IFF%IF0FBF`"I`""H#`O0Fp(FF FxxFBI Or!hFB)F/*("!F/&*(" IjF0F0 Hh1`W>v4CK5dh4gK)F Fx0+Kh#FB"FH)F@8JCxh320x+H&OBb\20 V@# H]8F6hxd ,pP( FC C (7 #`%(Fp"#, ۴O,F!(Fl!A\"T`cCF(2F K"#F FFCF I 8FFI"(Fm*F1F F@G~"pF FF!"hF jF)F F$p-O<]FF ?J?I  {CF9J;I05J8IOr!")F@ؠ4 <]ah(FF 0+ћ0YF +"BOC 0IF8F 0IH$h 3CEњ0Mhx[c@C(ѝ41+ KM I HFzfi!pFHx FCF h++ &pI "!hFb"1FhFm"x!F*(" IjF(F0 h1+h/+HX iñKx;@FH?!ӱF FF Fgh(F9F$hhKxB8F( IHhP A F FFCF I I"( J+yh320[ I"F0F0O0 O0 h:i"F0J IZIjF F.8H#`O0 I F0z0I > .:9iB"F0J I$I F\8#`O0 "xKI F($0 I F50I zN:9iB"C0н0]#HBJ^VpGh JB ~BB I H JBFpG JB I H HpG HpG HpGPPPPhJB~BBrB I H JBFpG JB I H HpG HpG HpG HpG-O EDFFFF(FBBF)F8FDF' 9^). I2F8F.#P=$/DYFOD 0E  c  ءEK<h;Q8FO|F$瀱) IF0I I  F(0KOqJH0 F ICF Hb F$i¢ȲiPI FC   C #C J I I F0I pi0IFjFn0KOqJHI F0 I  I F0 I @¢Ȳii-ACI OsF0?J ?IF?H # #$C c #cd@0O3 1I(FA0Q.I *-H "8"@*JxhY2 R'Bx:*$0$'0;D#DAFP#`O0` 4 ,x+I $2F!(#F"3a+Ѧ 炸Obi8jhs'#I F:0JI FIhjF I F00I oiʳIHnhڳ-AF-PI°2"F0:69Ԛ9o &&PI .(F$ !( * , . 0 u0𦀝l * pI &&&&lHl m."hI(F#`0,0нb0+aH~_I(F#`00нb0+xZHlVI(F #`0 0нb@)BkQHZMI(FI#`00нb@)B`IHFP$GI(FF( * , . 0 0(+L ;I(F0@ƀ8I(F06I(F0 3I" F(@OsB-HB*Kx+?{(Hv&Kx+&H#Kx+$HKx+!H H#6I,2(F:.2>02$+*q0/H8i(iiʹi8iii.8!Ĵ״),.,C0C**+-H xh300[Kx:+* 'H" &H!Fx&$'i)@Fl.?<74/?7, imHZ;HT ,HLF H@OsB H6 /hbn!8B0 I$jF%DED D D0I(F F0i8P  IjFM C0I ]iʳ IF0 KOq J H I Fw0I ` v¢!ȲiL-AFFFHF FFEO< 2 -O=P I C # D0.OsH0(ڍI H0'+ @.F##"F(2D !<~(BF'-|K.|H|KFzKzKzKzKzK0(!0!!"FV 쩈kԣ2*O |3 SjJ$;2+Fo  O1 BnzqyOa F]IE#\KD pKDOIqDOc1DOCDOPDOSqDOB1DA&k&pCK)F@H|!0D"0 +v "+ D '+?o =/ #QJL 33~@B4@B'JأgvA6B$رO &f13?,!!@C;2%2^A$1B٣zcTc2 2PS;I"JoB1FKi%nEsw{Գ@!8!#x*+؀H+1ٛ *f;'+mLkmQSkkkkkkkkkUkkkkkkkkkkkkkkkWY[]_acegi+R#/A2+(+fx0+𣁛 +#HJ+F cxR!IFHcx 3D 0+ЙI0+ЗIgx&HĂI7B> ]PFW6"8JFI0+СxH0+#y'FIOHxxvcxN;``6vFEݸyyy(yDBPF`7FHFX0+СxpH.0nJB .r؛0+jH!F{hI^H80+?scH.FF`H$柳_IF8'>ZI_F>F  CD ۲+e7(PH^PF  9FJHJKF0h?KBsBPDJEK`EF@H6 9>I@J@J@JBѣys>I'H0+?"zy:H+v5IH0+?!z 1H0OܐĠ<,6*HOJFRFWFEf^'ƶӶܶPv n''tP %>,LPCIDH40+?oa ?H* FFHB=H"!O0T(" " 4Hp3N5`"O0H4h,+OrB+ + O333H!NWWWWq+WWX XMXX7%SKh#0@pG;>+"#`Y T! "D! 0"H!"bZFI aO MF(` IH!DbD([ k`0!( M IFF(Ff)FH<I"F(F^ h h(0TK ! CC !B K`!03 CBKK `h}(0TKH!0CC !B K`!03 CBKK `h}(0A#!@C%BF#CL`BK`!0K `h}(A#ȲC/F۲L`BK`!K `h}(ACS_FL`BK`!K `h}(ACCOFL`BK`!K `h}(A!CCcoF#CL`BK`!K `h}(pACS_FL`BK`!p(ьheI!CS C_FI` !B۲I`BKK `h}úK"#I@h]-AF!l'FBO@F`)FF()FD(77 FhF]I*Fl(Fa `0Fk~>Y-A F xn+Kxo+4'knL%FAF^80Far(F'x!Fn+ Cxo+0a5(=F a.(ч>IFFH| DYh-O]F S 4E3Fh S 3 S)FF3F HQFF#@.1FqI0F 8 ` h+@𩀟I(F (@𢀝Io(@G>՘IMՖIGyՔIAՒI;KB 8A(F0 Nd!@ k(` h+𽀇I" F(@𵀄I  `hO@ $4{I 4F(@`uNB$hhU`"`sh+@lH4ȑ  '0HFS'7B h+FWI `[IF.H `Q S3h+?`!pOER FI"HF4 #Z"(FF&QF FF F$88F F I"F ,#x/+ !FH>)FH8@ʼ8^tRIFH h-O%FF")F F`XzO.FFFFyJAFC2vKhB7ѻ.&X#4Whp58Fl4#`𻀹.@8F0@`I:F u(f(M(V)9(:G(+g8(S 333333333333w333U(oC oCgoCoCoC8hO gv8hO `go8hO gh8h&a#,I8hj *I JjS8h%Lo \.?[ gU8F0?p #g.0gECj0oCg#0+8Ff0?L #g cg&<&|M d(#!FH0I#F*F [$ dOa F2 Jk$'! H&"#, L9|',7" FFxB(I#F*F 06F^( FI@ݿh6F^( FI@ͿhP"FtBx (I"F \H8F F& I"F \#x/+ !FHn)FH8@8^tI 4hzKIKKKKFH Ծ9h7 " FFx (I+F"F 0i8KFF K%*F!FZ8F I !F (F8@`5!-OFFH"F F!`F2IH" F@8NRFIF8FbC уKh/  x28F(S ?8-87777777777777W878877778776777:7:7:9;77-;77777777_8q8}8877878778778:-8:::5;7 ;;5Kh 4K"`Q2Kh+/K"`i#saEiC#0ha!iCSc&JhC`2iCi#0hD!iCC diCcg!0hF2iecC 0hI!iC3biC@iC3 I0hBFiFI &FOR@##" #>#? F!(h` IF HDH#`O0B B@}o 砆m+R-GF FFFEIP#m`D3OqB BORD %J%Ih0`J<DOsPFD4.{"<#`O0 G K yO O AF!L @aPEq $'FVFF F B&4F_FVFFXGGCh(rFFFFagXFFIH:砆+vpG-AN} x FF!F@FOr(FD)F(OpF"F4$4MNxD#I:F0F #Ch N}( .0F N}A L!D ĕ0FH !-G["F FFGH@!0FEP#pAIC (Fh kF ꠱)FF8HZ :!0F5FF3HN RiĐĠO3GOGFO'k/0+i+O':FQFCFBF1F?iN0+FimDDcd/iib``ca ph6faa #ai#sa!!#-H@# I   gz f]IFH | h-OPF$NC FFC  'FFC#`D`yJ`yJ`yJIFC tKh[ +g8(S DCCCCCD%DEDCCCaDCE0hO#F0hh#F0h&02hTI ###OI0hiNI i"JIPFH(  PF3x!CIRF ?IRF z ##n7I"PF  PF#x0IRF -IRF-z ڀ' PF02h%I0hO F9ObY!6R7ph707Ir4a,b-&&ns+|!BT{8 d(#!FHh0I"F D[#H#H#H ]F H ]F H H 8 h Hh H|7" FFxB(I#F*F 06F]F( FI@ݿh6F]$( FI@ͿhP"FBx (I"F H8F Fl I"F #x/+ !FH)FH8@@8^tpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h`rlf`lwhd \  lm(d R lcdH`p`lSd mO(e`mKhemGemCeQ BC p`"54S+BE+8#FBT#!A#38 FF8F F#T#E#34+gfXX\\|q|pccWFgfWFcbaXXSBBczgfp j $d$(^(,X,<cW4F.H>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOrl F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"^!KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3y)^#JJp>s!tYh_I F>v1hXk2b&0F =GD0$pDLJFNI 2@UD[BL @r[ CSfd04 @#F#"_h # +u#}+ZJJOzr>vhSC   F*Isd3ddd#s11hXkPFh2@UL[DUBr[ CSR 2Nn   L Jk@L#FD0FpL!!kp2_B@Ѐ;۲#O &@;fFKh3A@񳀎O"F;F !xOzr OAh SCD0@0H0L0O30{C?Fh2@UDl[B @r[ CSR 2`h Xn  @C. A #F!!TT!-OF-!FND- Gc #s#Kh+PЬKh/LѫK4hh\C#0 .tO;A"E@B%D@8F)F\XEFA"O18FN?F@)F Fv1A"8F8AF@,OQOp^MF`(OR!VO1Op^a(zLO2!F#h+@O3,5sKhsKh4)qH< h)mH2 kOkJh9hhcZcK BhH" hYkK BcH h2hYkB_H  hk_ZHOR hk?UHO2 h BOH MK h;h0BSB@\3ؿFDK8F\sOEXhm++#$5kAkW8uSBdO|OKBip!h!(!+O,%x#<#(5#0Kh+?#0FV KXh+]9FHW3s3v7Ol {!P!BK yf#"XC C!hB <4XC)8$󖂲OsӽH hORK'1h`k\5###k'd gO3s84bgcb<#cdI#Xs0"7L5P5gh 7OsPBFAAqnj*FAqbAFP0`)FD0FcoO|p&k8D`(D a.x ADO >NvAYC 79DA4E0%D8$<4BsxHR vKhvK 08$<Fx 8Pkw(@DAF8&FT*FOsPF9F$&8aBA*FPF9Fa#O3sUHAF&F0$-BOCȿOؿ#1L 3KALq*O 3BCBsBL @`p  XK#KCXC3G/3GOCGsG0 PlAG#H(F1OpK3@,@pIDLs,B8F/('Bv8'F !FTz!!x:FOK<*F AqEC5jBXSBO!pT|!h!%ZkRhaH4PkR3bisb@bb@5lc@_OSfKhcKheKheKh0cXTcOs0HUP0h40PYF @ 0D8bij8d|h!t!!p!^F!L!T8!S`!P!X!L.O`v_Kh+]I# hX)hOPObhObxi~QKhyihh0+xiOr!Wp0+FH@0+yhCMj0:4D\Bi"iBCDFhInDr  @#"C@!CF2.J -K-IfC(?ѽJ0+P# 0*F+D;#G.hO`1F F)1FOPOb= "FvF(mObt)hOP[# P#!!T!kTht@+hjL#FhjB@MH 8<O{0GF  "KQEA\%FI +B%a`D%4<`DK B D p0C_CKBuۑH>( h!i iK$I{`ȿ`  h{a`Ŀ@;g)2@Ӏ"2x0t[SEgx#  eH;fpI h;3  #f`0fAH {fBdH% 1ihj Db-O FXDh[Ei@ʀJhnREvq nJFh$%* ݠi "@nG\:CBTi i2aAJh*Md zhRETzmR 1B zhREP%PCm@P%* @=0d F00 FPC@:Z2:R8  D * , :BYF N 9`#{eO3eK!TU p!YhJB5smxBpijYh:bJB5smxBpij;bhkX0@i3DOO Qk1Qc1FBi򭀚B"Dhdn&hikQi3DB@򳀎B2hi$5+O2fj $jNE3h#jzkF=h!jjPn1Rk!b!Whj!Zk`bBh`iik _OW8D3h+aihi9D#hqNkDci 0o+F(#h\%@7cNBii%rCAFhdAq   C #1C OK\%BNN3h+5 PhOBvrn 1@iBj2Bb5ShnKEvqnZFh$5+ ݡi #@n\CTi i3a.Kh+Gd7{hKET{mS 2C {hKEP5mXC@+4dxFQFt"2QFjFXC@;Z3;R80  DU T!TTP!p I Sk3SciZiBZhBvsn6B UiSj3SbnO nD#1FoE +?$B FP#1@#  +KFOL O +$eB3FP#`6@#`B < @I 82 z @J k08`Tx`0@YOFFEͮfiE>D(F6 @F `i#kDBhgK`f\B ii%YC FFkk  id Fv F   ,C1CDF k+GKh+@82D?n. 3h=I=K*FF 6I2"\Bii%HCBFhqFBrxn  @B #:C@'H2 DDB?)3h+hj;[KhsH+ zKhs Dz j#|:x* ȹ Kh I bU TX!L!RLghcgOKh+30304040JkhSC#oBIOb`i?Mfib!`+hh1F9Kh7K\5h0+WpOr!n1Kh:CF:Fp+h+hiZkFBhPnHtL  Rk'@Ci1CQjcjB+h#hFZk h!jj1Pn!bRk!:!k`i&hiYkI D-+*"!p-T!\!8 `!-G}FFFFJFF(dI2F (bI@F&F(F(D]I*F@F 0th+XHIFO0 }kk6j`j`+k#akkca#@0#bB0cbklb4/{FI:F@F0t@I*F@F0:@IJF B>IxQF8"F F"F:I0F 8I0Fr 6I0Fl4I0Ff2I0F`h"F0I0FB,?X.I00FR"!8FhHF\0' 0BgBOЪ# (5D*#*#0f@ "F a#( kd@edAkzd@^lkkClll'l:lOl-Am%OcFF)FFgCF*FF@FF FrM0:`12(F mF8F FD I"F z#x/+ !FH)FH8@8^t epG-GFvFFFIF(F:F3FtF8FO`f#jTD&O` FB`۽#D# 6P I-G%@F4FFFF F!|0_ H#J ## `:F!q F !F  @mH# :^F: F^p FFFr2Fk2Fd2F]2FVppFF F((*Fmep-AATB A ҅BAӃ Bt ҅BA E|   -OFFFXFd# " `0F xFPx(PI3F*F Lm,3a,M,%A,!JI+Fb< ,P$~}}}}-~}}}~}~BSFG700F9FFF$&F 0(0A  6    J J &+FHFQF$&0F9F"KlV㱴X AF0FR0pC O2&+FQFpfHF(FG[𴻀"((`:F3BEC FCh`!|17[-AF7N0 0FB F[tF"F+F@!*3j*FBF[ (F[g x2(*] #!3+BD +\C J I" C+T06&h+F@qF (F[.06pi D:zB2h;`!1-Oǰ F!FOKKh(@SC;J1#,0I (%"# #O0H0Nd00 @$LPA!aJPj #T0KX0Rp3I X*F+FH4Kh-=(F(3I!!!!2_ !!,!QSNXx!!pH")FL # V0423*<\`8O7 @F Bs 8F388FA#c!FBXB(8F&\`Kh8FZF0I[:F!" 0OFGF1d0 FF \0 0 0(0 ;; CEFyMvyN3h+#1 B2SrI h AqIoHgJ+jjhlHZC 6" O3HA FD(B]I+6 s@FP8C0 0CE$F  @ )4 DFO)0<D)2 D   PF@F7D?4BaH]Kl2[n Fг 0ObPDTIUZ@m O* %(F&0HDH6 PF 03CKh+F!HD!:H9MRF6;B0O [3 , cEO(DO1'KO O !  \ CT"F 2 *C  0.J#3Pf$&B06D&hSFID  !i"#. 78!\!!!!*jkiIH3#K/FD8DE?0+f>6𺀳Kh+𯀲Hh/ Kh.@3Ll;m#n!H\O@"! (( F z4Dx0 6kC 3"z #06x%s(( &GFB&~('KN@! 6{2Bu# "Z"!lK#nA#3'4/5Dx0 @!znH 3" V&#x0#@%((@PaIaH$1FO@?F '.O1F" z%Hx0  3"z 1FP 1ZC"1 DO1BAanDJDIcP(9%C x, 4. 60 2 56J7IGO v@F Z0F-J0I6@FZ'Fh 6*FB,Ӵ0 &DBO%#B@FZ53FRF@!0FZ#"%l+ǮJIF% 5B& JI !!\!1 1fJci"3 #F%BB"!CFRF !6"DD~`n F1#BHJII jO H#cD D2F%05d?K"q!E=I=H=I!F7I9H6Gp!HF7RFrIFXFvXKFRF@!2p'*K@&9F'"#ciDfOb"IZp[ %O)(F&00DH6fiHF 6@Kh9F+FBF0DHD G/ݾ11\!!!-G}FFFFJFF(dI2F (bI@F&B(F(D]I*F@F 0ph+XHIFO0 }kk6j`j`+k#akkca#@0#bB0cbklb0/{FI:F@F 0t@I*F@F 0:@IJF >>ItQF8"F F"F:I0F8I0Fn 6I0Fh4I0Fb2I0F\h"F0I0FB,?T.I00FN"!8FdHF X0' 0BfBOЪ# (5D*#*#0e< "F a#( kd@edAkzd@^lkkClll'l:lOl-Am%OcFF)FFeCF*FF@FF F nM0:`12(F mF-AFFp"`8FF Ffh3,x[x+&ICF:F TS-"F-G= -S%)33g= +dDTv0F!FDT$D46DICF:F4?R% I L ONF H I Hdch5"x9F0F4- X1h-AFFFFO)F F^BqۆBxI+F"F 4-G}FFFFJF*F(dI2F (bI@F&j(F(D]I*F@F D0h+XHIFO0 }kk6j`j`+k#akkca#@0#bB0cbklbX/{FI:F@F 0t@I*F@F 0:@IJF f>IQF8"F F"F:I0F08I0F 6I0F4I0F2I0Fh"F0I0FB,?|.I00Fv"!8FHF 0' 0BeBOЪ# (5D*#*#0dd "F a#( kd@edAkzd@^lkkClll'l:lOl-Am%OcFF)FFe(CF*FF@FF F M0:`12(F mF0# M xj,h214 F;*O"p $T3 +0`K"`pG\"1FHO0?FH -OF-h"!F}L<`0$#hchh #icii-#j$0j#k'ck80 ck@0B0D0F0G0l,L0)#m T0!+ iH4@#*KF(bH&C9 ^H2COr@c** F3 UH$ZcQI " H(NHT "#h!F(GHI vF3 f V ?H2hh+hpC_HCD7H7I"FXpF_]yrUBUA "AFjPF령AEHFP H$%QF8F(<FѰ2C.# # 2BB!FHjO0$[n2}f8PJ)F0?EG+bG_G+R 02HC+F@Cd DT%?&Ow+F@Bd DT#!GRI*OF=x$!#B H~@4 ,] #H<ػ#л 5HYF # Hh2C0B;;#OC;+yH"F?@%^+sHF6B'HJK +F/! hJOa(?E! F3[f F(hpCOvF"F8F1F6C ѧBvCBuLH? #?@Ga>Cp=g .FBs-FKD9F[FOs jxDD-:@phC DSE𜀻@0!F9F DND5Os]C .DBJOq*WBKBBHq O3#p!F@sXCP!F0{OsW}6Z *3Y >*9КB8 JBU۹OsB ѰH"BK KKOq>B*bЕBl٦H)FOqBКBѣHB(]O O >@Os@@a XT = "s !FOD O`OPD~F>:"O GI c@q#Oscf&F=- =  Dй?AzH!FO@(8 B,>>O 9F0F@r O @ "BB s#m &Or #\J 0"G+>JF*?0F8" # FBsOHU O f= bC& IA& E~ OD5AKOuFB3((F0 0I## CHf# RF(# IAR  .#QFE(FE)H@u# @sOrFB#(s c + # +#  @sOrFHZF#B 1 H91DӺq%\&hHhK) FF*FdHV"FB++##B ;Dvѳ?O OB :FnHڹGF"F!(F л @߀KOqBӀCEJBӀE@_K+`SS 31O3z3 r+s ks+ +tktt t+uku#!+ka+b Hkb#bIb(1+,1k$)#01b1d3ih3/0'78F# xMKF*F &BF  OEcrHqHBqK" pOaX`2+F@"D3`2 ! ;jhCWI`S .ձ@ +ih{:+Aqi`h hZBFOrEHq;F*FL2 @>N {2W (#谦f2ADIQE23YDB2*H1F ԣ@ &! { F BPEV ;j`pDcF:F&|`"D"``a0""Mb7ah "">a"p"ɚ;\"6eH H; jhP [B( ;D Hj`B03;KBj` D;$"ɚ;6e-GFFFF ` q jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B  0  /9FFH&0F Xa`"-CF#M -FF(F@ h+HCF:F1F^HZHIFVh?  ?H !!h S0+Dh< IC k@@`"kaaaah K Lh K*FI#FFH( D#|,hMIFF(F I"F(F I"F(F I"F(F I"F(F ^hpypF FF+ * *x *##pp\* Cx+IH(F;'*"*+;.F;B+I5FHh FKhhSIC h\B Kh ( !h(OOCOC`O0d##x#FFFP;F0O`#S`O? F`,HF+Jh`)Kh[#h(I; h\B#(FÈ #*##ty*%!%!-#h)9h21 RX^# #=#ctIH& ###%#0h!(/#@#hx#d##hhh FMNO FT+hh *3h[S9hO  A L#"`c`y b2 Fx#d### K : *B ( QppGI Ph F:IFF(8I" Fj젹6I(F(FF FDB 0I1Hn #x/+ (I)I!F(F+F)F xZ'O/)p,+Fxr1/*+FK/,FK\"FF/))2*Zx.*1FF6FF2*9F F`h\-O]H!/#3@#SaKbKSbKbK 3Ob`H@!+TѣJ#3J`J#3[h+3+JNFtFO*FAFHH:hOa F;hn3 + F8D"F9 + + L#SpFp)F!]cxs/ @ObQ##!3tLFu)Fx+F3/+ AOb(F# @"@!$fM C.eI(F,`4+aH)F`JOa/ P A PObYH)FB#8x+`+(?+'D+ԃQI PH)FPH)F"!#"# @'ObQ#r";"+#!Da;+R#yż-yżżżżż[żżż-[żżż %IF ( @PF F?֮ CK"`KhCK"F+F @ @Rq! $###h.7` K\s#D( IF ^(? @P?}g(єI BHq A/bk IF 8( @-ÈԆI BK# lIF F( F#zKhyK"`1, NuIF (ܮqKrJrIrKgHrK rK rK rK rK rKrKrKrKrKrKrKrKrKrK oIF F( @kF(?PKhcheI; h\Bխ`Kh+h+?έ @F(r)F @Y/E @@B  CX&#)FS"#FB 33>Ih7>I_F*3;D3Q+FQ FAF8^F#CCBQ#TY 5 F( F@ hCW2F(JI#HDS]F-lhd##( 1Mm"FfN#x#gfff @(I BH^FJ C @@A.,FF]F.SѦI (FWHy0[;hI; h\B՝Kh;h+ IHF(ИIHF( I# 0yBDoObJFIHFHF"F9FHF26FK"1F(F 1bEw8FQ 8bFB8F (  ( 7O  SE=3E6cKhr:FdI[Hd y D C 2 QIF(Cw 2 DKEFI 6e  +?\i281<@Rcld# IF >F(L I#h HHI Obqd#hw1 Kxi+ H3#p!H h##KFIF"Fp IF IHb IH#IHH($)$FIFK:F hh\=%A KhK J K I(FF I"FH3F(F#@x# -CF3KF3IFh h 3$OO \ A )Kh#F(I)HHF+C%Kxi+$Kh+#Kh{#Jd!e/2F+F0F)FFxF Fb00C0G F2F+F/FBC〸@#d#h#x#D.I:K hh\<$A PCyˆ+"B€X F#@-OFr*Q"={ՋHF۱hHFRF[F(FLFCJKh+0FjѴ0XCY F)F)F F&C&cy+ F8I*FF8H HRF(F[FÈFCÀ*Kh+0FHF F_*I+F2Fr!NHFHFHRF(F[FF8C3h+?W  B  B 2h*?B FHF+F"F2#od#h0Z+I F.by*(Ocy+9F F" F F.i,RF[F(FzF/ F{K(Fjb[FbbRFdFKh+?M I+FFHBI*FH0F I+FF H ($d#/Ihl7K-Gh6I6H6O$܀&#Bv1K2N2Oj F1F4FCy++Ic h\Bjx-е00;(FIFFPFx(F(Fi,j mjcy+Ѵ0I Fk3h; Ff9FFHX F Fmix##($d##K-AhIHM ,j&GF4.,jM#j$hlX8Ozr#F F:KS"8#BBhL$F H|h+KJIHKhz P#hFLyw3/#3Do?Oa8Fc?"K2( H#?o)Fo3D?L$D$N#F"#hPhchDs FFFBФI"FH$s ##(h.l`<(h Ob `phK2;"B(HWD$N! H CF@ @V F $ #`C`NLK-OFhðF.HMD4BC4lOr!hF*h v"!F0 0hF(42Kh+@+h+Hѵ iEy3#3E90#I#HF髈0IHM>8F& FFcF5I0쐹XF$0I2F0H/I2F-H,I2F*H*I(9FO F M yJDoObI:FHFFF@B8F"h8F#e 1FD$>(h\R-AmFjx/*p$O&AFxF8x+0F!8$ F m3iFH(FpFF(yB02F)F(&hD$R8iP F8`"iFF,F F8$Fh F@UK-OhIH0R+ ьKOaH##KJh.L4#+ шHIHO [I`"HbhVIF{H~IbxH烉'J3FI H 0F x#o#NP#Nh6HYv#h#D$l#p#-AFmFFFFF(@H:F#F=Or@a0F9I2F9H8HhVQ5IF3H m*i0NԀFq2hvmiF-0F F o/F0FOg:F0KIHm#hhVIFH^ 0:F F60KI Hm#HhV IFe6h D$#2<l#(   ;L4#+ `"#`#x#+ H"#@HNPF FFK#BqH"F+FqO F)Fzh;hES"qbC"` Khvj O#BB9F0Fvj#H$d#bBijB ћibpGiBтiapGF+IqPpF F K#Bq Nrh43hS"p#BB@j #$PpF FK#BqH*F#FN(F!Frh3hS"03*F#FHp@`ZjBB `p$F#$-A!mF 'FkF@FFkFk/..p h)F@i,$ F m.$j8/!F>F$ F8#p(F/##pF(Cy+H)FFL/'6*yB H!Fn F)h F !5B|Fh28h##Zt##T## F h=FhFG##` =pGOӹ}͸G KIHm j#hKh)Kh,Kh2IH FP[h9@# FhKjFIh(HhU IFHH#$hP m@pGpGaJFhS BDKBKm I H ]"S BD $I#hF L Fh"i DBHh*F`i9F0D.D`$< KiDao J3 Im HZ F]$#Vh#MF`+iBli FphiU0FTFha.aK(aImH##2FK $#hK FhCK$h FF`GKh I%"F(??KgmbhU I2F;F@ H(FF`#$l##h8ML4C0+"mIHJK$#e###c`* H!48$#*#:#$KsFh F;H F!F`nhGKhK*F!Fl0 KEmhU- I"F+F`Hv p`#$l##Ih8FL hF F8)FU(45pF KM`khB NTT0IH l`pX#P $h~.K-AF-NhC5,KhñȀ)O:!(FpFh#(F;u`B(4 j I(FHIH&hhUJIFIH`ThUJIF3h33`,F!F HAX#$T#<:$$#𵅰=L##:IF:H22CbF5I3H4M8#3K@3I*+F2H7"-M.I+H.h.A##v(IF0Fp2.h2C,fF!I0FbN8#KI*3F7"(hPI(hJ)hH +h[I JJ##hp#֗:-OF\ŰF FNF0# F~HIDLF\E#hEӫzKhCyJzKzIuHLEF0pI xE#y+:pJOq8Fy0S#ykJjI#hhaH.#..2Fy"h`y1A:KR#D@F:F!yp\J0/SKhZIOH#hDy"h`y1A:KR#D(F:F!yFOJy"h`y1A:KR#D(F:F!y8FJ#y+ EI8FPpBI8FJ(60+/I>H@.. .ѢyF(F2B2"Dj5J y@F1A1!D&0J0#y+yF(F2B2"D)J...ly!(F2B2"D:J y@F1A1!DJ0hy!(F2B2"DfJd#V,P bq-x#Kh(K[h wpGP $-O(L F#h +9M'h/7 "")$+РKh+'F>Fp`Kh35K(@Kh+)IHIHl#0HKxR+jЎK0+e9+7щK(FIJKKKlH)FBNh)F0F<(F `Oa0ԝ4 + `3)FxH')FvH `YFtNO )B  1F bKF(F(lI `  )F FF'80B )#@C9  2FYI(F)FVHVJVI(F(F `Oa0  LI `4 + aBHAH Dbh"h##F_8P"j!v$$P )##e~n#9N"@9C3h)3)3I3H+1K0+ 0HR4+?,H!#4:2ǹ.9- !K0+.0+Hr `=@+rY=BOqA3hKJKI-ȿFH*F= ` .- `=d####$~,h-OFL5)B<`#1FBL ih'ch8D+C1F#hF+Q 9B=(@0yIyHH !h/O#)b#Ob5!Z%ObHF9399393HQbKF2FhZ(Fݰ/O# Y(90/O*v/D.ܺF)'zMKhHILH#h+rJJ9h`0/_)BJhiAI*F:H->I?H>K ***8I:H:Kh9H 81I6Hm6I.H#3I+H !O*RFch!PF#("hT\&IFHI#RFOsh?? 3 9FHIOb8D0$P x##h-#D|#-[t($X#d#qKFhM+@iNl"BjKBBИB MeMhCdKhdIdH #` Fs(\Kh+ hg ``hc``h_`h[` iW a`iS`aiOaiKa D nf   k8 c`k4`ck0ck,cl(dl$d xx||vpjd!hMK+\#T$x#hFhF(? Nk#BaBMhCKhIH$#`Nk#}yqn f "`"$Z$&T& R N JFB>Ob! F#`22`20caa 0#$00&00  2 d22Or0 fKa4#ca0C@S #`K-a_Kh*Fд$ & +7 [x3\#=#caiNl#B#i2|3 2ch2h2#k2k2#dcccf?H#h+=J+#h+:J;I;HT#R8I7HJ5I 5Ko@!2N#A1C$9) 8:'I)H$I(H(I"H"9-;B#IHI "h*N*>*K=KI\od###HR2]pGhK7Fh FP( &hSa I+F"F H0 Kh+I+FH"F0@'l#hx#8FKh"#O`A$( hS, I"FF Hv(F8Kh %I"FHjl#"hx#JpF N F#Bu F)Fp F)F(Cy+È4E#8F F,u F)F8 F)F(Cy+È F# C5KhF( hR"F I@F H Kh3"FI@Hl#hx#-CFx2LF.+ FFCx/+!h-H 2F )I;F h-A!h%H9!h#H#J h"IJk hIJ/I hJI hJI hJiI h!h 2#h[I JJp#'LT'[bkt{:I -ANODFF8h "F(I 0 +;#0B#H+pwH!Fs4$pmFFlF! F#xE*Oa&H)FPF P(`O0#xF+K"Z` mpA+ F DB< +#<H!F*I d (R4$FF FF K!FFhF FBI @1F(F@4$𵅰OL`OI :NI hLILH`KI P aGI#ihF(Цh@!0F(a#p?Kqh?+C0`h*F:H#9K3FF `(FRJ.*4K%hpOOpCco h6%AOq h#"! h" h! hC ZҲ7 *_+-+H1F .FAOq(c4$ g:h4$]X#G0ðFFFJOq$K" FZ`*FC0f4$Lbh*IH#c`4$n𵉰 FJ!FhFH"iF F DB8hbqI .O%q>.4$p F JF FhF!hF NiFF0h"F)F0h!H^pv4$|FJP!"H])Fð JOqH"C]O0pGpF FKh*F ZhBZ`C!+I2FI "h!hOrl O2X` XBXAp F4$ Z 8 FEx- -K*F!FF H@hZ!FFH8@H񏹓!FFH   (7((RHpGHpGHpG    M FOa]I M]I n; f+X1 \mZe "ppG-CFF9,5x--# `PFhFM FJ.!HPFhFM C J.#(F0IF@F0$kF@F&4 ,у 54$4$dKFk+%x)ГH@cxK)H!Hx;+ C+++}HF}J}H|Ihah@i!iwH! * tKL*F`ih oI硈nHኡd++% hH"!B eH@cHcHcHcH"aHaH~"`Hx "^Ht h+f+ٝ501 040TH3020Vj;+ @=01 0 <0GH ;0:09080706050403020"j+#5H##硈#H))*H ,H+H#!i)H)Ih-(H'Ij&&H$I jhx4$ 56' ! 0 6D :6 6d v  s         = \ d n l7 8 -O$bMFF!FF(l,`20F*F9F&r""##!"FD D dRVBOI0FpQJFKIF!DR@(FI>DkCDH+hBHT[V\*5O `hF#"2K!F@վ?IFH ,phHTFBMMF.hs+`6(@xaHZh@Q- !F0FA6K"!F0FAI/2H$Q-+3+!+ "F1F|e&Ha /7$HAb_ H/H1F "F\ F_H"F1FL#%aH_HH AvA$8 mfakkkZ|rk{k_n J F)h]K3`pGL2]KhH\A$8 k-AFALm1+?HJ =!POC #Os3`Os   F8F0 9F#h+ mX"AFOc3`>OsK5R# (o@# `#*s3FP 0 hPFH,+ Hh#C-HA$kkkf.-GF:LFF11[/1Q--/1/ѽǹ,K,HZhQ- TAF0FGAF0F$K"G/!HQ-0#xutsCE/ѽGH 1ixHF)1+PF2FAF HG 8A$8 mfakZil-AFKNFF3h!F#,?DI FVȹO2oC##C@FP/0*Ѵ@ 8"` F@B /H"F)F3h+ x+h+#F1+#j!# CoBB?#)F8F,j2CoCB?#)F#8F)FJ #8F#J)F #8FA$ll-OFbNFF3h!FA'O,P L. PFP0RH)Ft%@F FF IH"F)F^3h+ @FFXF@Fh+.PFGPX0Ѵ@ a'F1+Ѵj2OC#)FHF,j2C$#)F#HFPF  !J SFd!t )FFHF,8F ! J ;Fd!X")F FHF`A$9lKlhlK-C8KMt}wBEO!/!!AF(F0H)F CF)FD2FL( 8F#$CF+F FY K]h !F*FF H)HHlA$8 m1mpF F&#fP0 p*I"F <Mj C3F F=1+K!FHZh1+OR#HlA$8 mn-OFFhhKh۱#gH# p (%^U(F O;FH HO6(%6OIF3 F(" D8F P"0 - FOO! !H(;B+HIBF BBO%F@F&j#C[#(")F Z E9K !8J(5CFF^F P( D    B()ܱS g0%E%%SgE%%SgE%%SgE%%SgE%1FPF#HF########A$ nlp Snnfa-CF`"*x FAF/#JH#P(FOTFP a#O3%F%9FHFUP?0 J F#CO>2B0I2F 0/#C#C  #"F1F%IhjC!F0F3FBF!ud# #5BܻO`1H1F+ OD#)F8F5B v@F nlA$p faZnSn`0FF%#UO0 0*I"F NKjC+F FO1H!F zH zgzg+z;g+;; ;S0+lA$fadn-OFjNMFF3h!FOZ ,o FF _J _I TRF4!pO FVHFXIO *FOS AC818F hO&0BѴ@ / M"@FCFh"*@IBF Ex*;IBFEx(Ѳ?S  T# CYFD# F#F1+Ѵ j2O CKFOR(F,j2C Q#1OR(Fs)F:F)FF @<0h8FO P0F")F"FF @<0h FOpA$<^tnn-OFMFF FLz@F PFIHOr8AFOrH+ *IHOr$AFOrH+{IHOrdAFOrH+{IHOr<oAFOryH+k}IvHOroAFOrpH+ktImHOr_AFOrfH+[lIcHOŕ_AFOr]H+[cIZHOrOAFOrSH+K[IPHOrOAFOrJH+KRIGHOrX?AFOr@H+;JI=HOrz4EJ[F !*dOrAF4Hh2H*OrbQF/J/-#h4;/F?t8 - ORIFTH Jh"QITsLp3FGAJ!DDDu M"l)F0F"O0 s2I2C@3+:H1{'+R#wFIJJJJ2C@3+)H 4+Yck O O *oF%0*N9F(FF*YF0FO00/#h`*O CDE[@FO(+A$}mn9nnnB$faYojo8E$oo@FOO h +# F%0ckKEE{h `;h C $QF0F$R:FH  `7ckk`#AF *B   hBЊh:B 2D(JhBъh*O;XF NF( ! 1$*)F0FwO0?#AI* F?*)F0FwOx0?# OcO BF)F0FOc0!h +NWF(?ήF)F0FOM0  XGE?8FOLGFGF#I:F FV*')F0FwOHO(0?CFNF0K JIhTvF')F0FwO 0?H;F!F FB$8 oA$-O$F=!F&`0FB<'?+|7F#;I(F숱xJ&809`*xB𒄨Fa'F.# &`"!@%PoA(,!0F C U, %P. 0 2  F[O O3FMFF8O /f+|H1FG=!8FF0xI8Fx/FCO rI8F~(%mI8Ft(CѹjJ1FhKiHF50+@% ,!(FF(%\H1FJF(FBTH*F1Fx+h+o II8F*0o GI8F(8-DI(F(BI(F #O >I(F #O :I(F(7I(F #O 3I(F(1H*F1F{0I8FFع-rRF(F2B &H*F1Fbx+^h+!I8FF(W-?gNRF(FBFF0H*F1F=o8 poop#p6p9tWp\poapzppA$x+ h+CoBJ BOs A1I8F^(]-? +FD3x*?a)DP!N!O!O!O!O!O!ONO!O!O!O!O!O OO!O'O!O!OO!O-OODDDdDdDtD$DTyH1F"p"vH:F1FOOO+7qA~"`8F*BgH*F1Fqx*jh*o@BABOA`XL TDdL # @ˀ@PJQH1FB@"`8FBKH*F1F3x*,h*+q %pa\LDd HL+# 8FL%0 0BDd1H*F1F48F"`8FfB(H*F1Fx+h+gGL#DdXL# +#H1F L}K H1F%ո?w-JrDd -@𖀸% H1FCpp)q rJqhqqqqoarи -d%3@cp#LH1F +\%3hМI0F(dxJ#0FP908CDtD @ "(PAB (B#+D0@(Fo E#`##`##FN0I,hNf1FFyH$и-- sH1F-и-p#.!1F ")F0FOr"`"pOs#aK&]J8 p01Fh#CYK1FYH"L#4qSI"0F(okz=+ HJ8 Bg $1,DJH $P44OC Ow # FOs+`;K8 : < > 0!FX"AFZXp4KXS,YoC,`#2F+`c+FN0thN!FF$Hlh#CXI H;+JJ"I"0F(aѫz=+ J8 BYO D=!@FF @FqOO ,ro8 |rHrB$9rrrrrnsdv 4+H##4K ( Or @F0Or # K.04/ )F H)FqO!jxBj=#<I"0F,F(+z=+?aJ8 B&1.D+WHɻ h#4$ CF{D@0! F1 yHHPFCF豆hN- NjIFoHh"FmILp0 G#0#T"@ F,F@B@Ӏ(ЀVH!Fh0 ! F0O T'&:JF F??*h"+ $hN_!FF>HBx;H!F-0+-++.##;3" #S1FNG0 Ϲ Q2 &C '##&0##XFh+@,<,+,#I@F##I@Fx B$so8 o$sFs8E$osf.]s$ '#F,I@F# &#FX#&I@F###MF(IHFAFFN0G (FqONbh+*FHF I## I"FHF3F #CF lB$oMIFF(FI"F(FI"F(FI"F(FI"F(FI"F(FI"F(FI"F(F I"F(F h*g+8FKhIPFpF CF H)F^` 8"F)F $*FFHBF$:ZmFFOahFXv I"F hF mpmFFFOa&XZ8H!F mp&iF(ZH!FH!FM2C&h dk`+h  &2F <(zF$mFFOahFX8 H!F mKh  hiF (F$F-H'MFF(/  ,iI F(I F(+*hOa FW H!F|I#(i4n f FvIh FsIhX 0FhoIF( kIH(,!(FpF " ," FU`I F+x3ZH(FN^WK@WJ @E\ @F *VIF(F(jKF"FO FIHB]GH!FXEJ @EK@2 *G(F(P"FO F;H4+ @H(6H!F'- F(E pC%FC K IFP ?%IF?.ѷF%FvI#F'FHlI#F'FH p &x ShF$-O'OchF9FFYDCF!pH+F@<O"ch27p<B7h7 pESѐB٢\+ZbE.F"p$+P2F!C K   xx(<#~H+p,FK@:zм[\aм$@>Zxh7py@50*@w@</*R+bbET2*$( \(*XxB)3x2x(3_x0/ٓdEЧ1T$|Dl,7D$|O Ep0hD@H,3B#A$J&`2COO#Ob1F(F((F M3x+;F"!Ff` "%Xv$("%JK( FFpGn!b!0O3J`HKJIh#"%Xv$6?J(pFFh[ #`5 h( NhI0FL>HI0FL9O0p##`- Kh K I*F `-KhKKh*b!n!Xv$ZJKK`v$b"%0KO2`Kh+KHh@𰺨"%v$Xv$lJKK` {$"%(p F!'Kh* ""`%Kh+$J"L$I(!M#h+"K#I(hh)h!H#hKJ!`(]O3J`pNhIL0FL(K" h`J I0FLh0F(jhI hK`K` h"%Xv$n!v$v$"%b!JKK`v$"%JK K`4{$ "%LK"FK`#hK"`v$""%"%JKK`v$/"%-A F(O3(J`(&L'N'O#h+ ###`3h8hx+8F HF##`#h(I@FL##`I@FL `8hJK1hh xK- FIHh K`@Orih@FjJ"%v${$Xv$Gb!n!v$@~M$JKgK`v$"%JKYK`v$"%p F(HO3#J`p"L4Nh"I0FL J# h`JhJAL!`IKh+Կ##I0FLuHK`K hhJ!#0F jhI h Kh[ J h`Jh+"%Xv$b!{$ {$n!@KO2`]((JiF(HYh(KhKh#KHhP HYh( K"`# Jp J`"%7 v$Xv$ 6 %%%8(MO3+`KhK`Hh F 60H!F0 F8@L(н8@} J Kx1h I&#+`hH8"%<{$> %Xv$O h @U KO2`](( JiF6(HYh(K""%s %𵅰8*/KO2`(,J()K )I$`!F'H"M%N%O"FFP  K`hz#x +`+h+h!F(!F0F+)h(K"`);h+K h`h+h3+` K`"%$eK$ xv$%v$@KO2`](+JiF(+HYh( Hh( K" JiFx("%   % -GF hFVI&xpHDD FPPKhPKPHhGm6UKKO2`GO%H@ݹ*й-)hF F(F:H#(Y6KO2` FGK4I F3K3O(F F%1H(F#BF3!F-K8F,ѱ(HF FOp.%HFx#K*F(FF FKh|#r)FF;#3KBF!F8FMUKBF8Fs(%Xv$ "%    n -A@MKO2`(X+HJ(C;R#!B#?I xx|+ (9Hf($6Ih5K6I` j!F3H/M$1N1O+h+;B3h۹ T'K"`BK&J+(ѓh#3KH,;FR$ `F)hKh{K"`h+h3+`K4"%h !$eK$|v$nxv$v$ pFm@O4;K` mp! FR$ F4,! /H2/K/!(FF F`AOb(Khk'N F1h61hh;`+ ^-#KJ FhH!F8K O2`!F hZ ` "p" F B1F {$1F uc H"%!ҝ{$Xv$lv$!/!0# 08I8KO2`0(5JiF-;+1HYhx((D.K/Hh+,HF!F)HaF F!F F--h+HF!FHDF F!F F-KO2`dh+Hh!F& F!F Fh"%V!`!Xv$h!x!!!!|v$p(LO3#`нp@ K NMh 3xK3x+)h Hp@JI(hV##`p"%%%Xv$!!p(LO3#`нp@ N M3xK3x+)h Hp@JI(h(##`p"%%Xv$h !@aKO2`]((JiFB(HYh( Kh Kh# K Hh HYh{(K""%!+"v$Xv$"*"%@KO2`]((JiF(HYhI( Kh Kh# K Hh HYh5(K""%!2"v$Xv$9"c"%-Am FFFObhFXo$B HiF ( V$ObhFBObAFhF4K"` m%@ KO2`](JiF~(!H"%l"@y KO2`](JiF\(!H"%""@WKO2`](+ JiF7(+ HJiF&("%s"S8 L%h0# KO2`8#B#`H\%`IhHVv$"%""8C L+%h KO2`8#B#`H8%`IhH2v$"%""8 L%h0 KO2`8#B#`H%`IhHv$"%""81KO2`Kh+H@Ӹ"%|v$"81 KO2` L#h!F #h!F "%|v$!F #0(rKO2` Lh!F H F$!F FH>F("%!"p8H=KO2`p(:J,(XhF33K4Hh/K1Hhz,K.Hh.H!(,I F =[z{'Khd K&Hh F/)F !N"I0F FP0F41D0FL " FhAOh8GKJ h;#`)F "%"Xv$##+#L$]g|v$D#$T#"%JKK`"%W#"%JKK`0{$d#"% FOF(O3;`(N#3`KHh3h3h"Ih H33`;`X, K"ph"@H"%"%Xv$~#"%"%(7&L %M#%H+`%Kh+h#`0 FO3(,+M !J##`(h`KhFK? + F !,`F#H#pOb)h? +Ob!F H JiF("%"%#Xv$lv$\v$%%#($Jh+ ##`!J`!Kh9!JF(O3J`LhI FK,pK"`KJ`KhKIKhI FK0 K` K` KhI FK (J#`J`KhJv$v$Xv$n!"%b!#`KJh+K#K"`K`v$v$#"%v$KJh+K#zK"`K`v$v$#"%v$8F F)F F8@ۿJKZK`"%#"%JKKK`"%#"%(-GF FFB(5O0(nhBI0FK|(F@I0FKv(B>I0FKp(&,;Шh,9h%! !F  F5%,K+K`+Kh.%)K)K`QF IF  &&%OOd%JKHhhIJh+ FIx.%KK`Kh+J KHhhIJh+ FI\R($v$v$v$v$v$Xv$b!n!$N$"HK`"%0KO2`H( Kh Kh# K Hh H( K"`# Jp J`"%$v$Xv$$$%%%s F(@KO2`pKNh31hHp@B(Lhh ")xjjhI0h#0hRF H Ip@J"%%Xv$"%$$$8L%h0KO2`8H##`0%`v$"%(%-A@O3NJ`LO;h+KKLHhZ(9+HKh#DKGHhL$8h "DNYh`;hSAJ`"@Lc hchEE3%;Mch;c`+L(F (Nch;c`+O(F (E1JiF{(ѨZabi2`+c` FCK%Hh#hZ"`x(p (;h"bhBZ:`"f#5a,Z=#+p5#hZ"`x +Ѱ0KHhu#hZ"`x +"%H|$Xv$-%v$g%T$T$\%%%T$08O3J`0((J(!Xh??F FIZhKh-t##"%s%Xv$08O3J`0((JiF(!Xh??Kh]h I*FF Fd+s##"%sXv$%0KO2`(ѽ@HԸ@IhHθ"%&&O2K F@H2I@hXv$ &-A@bO30(( JiFC(XhF(HF`xK*F(FF0FD4 F""F)FF"FI8F "F1F8F8F(8F#0J0FJMh "%-O@(KO2`(($J(!HF(7xK*F FOF0r|#N!FLF;#)F;`#` H#KRh~(FJ5L"%s "%"%v$(pF FO3J`phI0FJXI0FJI0FJ($hh1CJ KI`` Hhhh#$"%>&F&N&${$({$V&Xv$-AFFF F8K:FIAh@hJ#c`0FT JhF``B=H"hIAhnXv$&v$&-AO2M*`((AbhAF4*:F "0h#h+#+`LNO ""%8 Xv$&(NO3 F3`н@߾Hh OF0jh8h I@@hJO#c`"hI8hz#3`"%Xv$&&8 L%h0 KO2`8 Kh3 K Hh8@H##`%`v$"%%Xv$&&8CL+%hKO2`8Kh3 KHh8@#B#` H%`IhHv$"%%Xv$&)'.'8L* F%hVKO2`8Jh2KHh8@Z(OIh"` H%`hH}v$"%%Xv$6'c'k'-OMXaKO2` M(JiF(ВK$M/FEяKrhIh)Fph "5h4IOBO#w&h$;iB+FF+21 TzLF+x˹#p0hhlCFdoKqHhHhK`;iB5$+ \+Qkx5;+x+5jxP1@'#O "eF0jx P1@:B  FBS+bS+:Di*5B B FS&JS&$DO;H#c`hJ8#`K "`Kh Jd!Fx KhC,H!>v$xv$6)Xv$N$ y Kh Jd!FN KhCH!xv$P)Xv$N$-AFFF%hI*FFF2;x ;۲+A2FAF8F蹻]K ;۲+J" H FF2 x ;۲+@!`(F%FpFh F:!0FI2F(Fh##P+"(FI(FIp@0FF0%!0F#p I2F(F0FJj+"@Bj)~))s)8F@hJT#c`h=(F!F(FVhJD#`8FKF FFh(< :F)F0F{ ` #h+I#h+ ;\ :Ҳ*A  Hx *3 #`T{$)0x#OFx !p%).Cxc=hZ5`&Ղx" 5P 7!W![nO۲  7!W!D0RѲ0!0!0h-GF FFFoI TnI"(b P#`#0+/!PF(@PF/F@!(Fh'P+\K"`{:!F({up:!(FF(mF#;+x%` "8F0;x#BOsBn?H3FJF9F.=I"0Fp(# `#8I"0Fd # `獱(hF `hh``hh`+#`w*H2FIF@F FO0 G8Fy:FQFFhh+3`b+x%`h++Khgh;hH+8|` 8Fu`` K O)){$))))v$Sv$h;`+ڊiB ( hZ `ppG{-OL I"$O3FD D@D(@I (F0 x x{H)FL$ 6# F L (mO 4Л0+I,%x-/! F'BF@𛀹@}IJF|Kh.@Ѐ7FyJh0*!F0"ObF `8 c;# Ā gK!h`AcK``Kh+@Ӏ`JYF`HBFx+;!bF(YIIXI FIWI FIUHgTH*F!FaO ##pmO (F#o@!F 8IKK`b :!(?O#;UG4N F%F6h.>4F7Fg'p>FaF{(F%Kh.7FO Q6h%F.й%F'F&FE6h.йѠFO &x6!I F<&DFFO DFFF/x/?&I(F&'%F,F/F.F <) **Rv$|v$v$**'*/*7*d*{$*+XF(?#8PF,.}/#x+@OObYF `v c4# 00+#x+|KKhvIIJHp DF/! F& FF# F;-1+x+.9I `Ob2>C c5N5O A3LOb%h#`3h+70I ` c%`#Kh "!AB(HF(56M~I>T0*M FRNOS0FPD-UXT143x+;mH #x+lI FI(iH3A 3A"3A$3A&*+AI3HTC3x[-!-TKh0FN((OKhS%%%x-JH(/!H04%%0BK`(ANAK  ?K: hC%##-@7K8J(8I`7**(5H!*@#:#(K&L2C*##)($Hp`#Kh[#KhO7FF üL(I hfK h#RK hIVO2`N$ *,++v$A,"%"%v$"%,<,v$({$Xv$,,NOr!F0FRK`,3,SMH$,KJ`,+,x+𧀏H(Vx+SdO: /F FFI/F(&-уH3x+YFF0FEFӨ1F DF(8FI -?Ԯ +dqJ2C,oH".+ "0+.x+HEе& F,8%! F`H!F#O2X3(FWZWl1AYI0?sZ3 WSxCY#xcQI FV8PH)FWY FI>WMYM+h#`MPP&0*Ne1f e C Ih2KhTD1$#H5J8Ih7I(FOR(F3Kh3H*~F1K(F1J1Irh9F(F6h*,J ,K) FF)I(F*$+OA,mѺr-KNXv$h-v$H|$T$-$pv$tv${$v$-O..{$"%+*.?.---{$R.6?p.++_.#џI*,*0OќH. {2јKh+ЗKHh&-ГN%FNKhK2FI4hIRF8F-ІKhñK2FIhI*F8F%NIRF8F-,пI*F8F~M -*&$(h,*h7FF5f(H ! F(08 "5D8xF;kJ3h20X@5FO7%FF `J4!Fh8(@4+c[I6665 "WK)5x+#((ȁ<,?j FHNeJI6h(IHI6b(6x*+Cx6/*ZxX6**+36x+=J2C;H9 "v  9x-+09 "6hF B x99 "X F9&I6(IPu6FC } y { ~ (?bO3}x+[u2:T).v$Xv$.j!+....(h."%."%/./I6 6:F!I6(mИI6H\I6F(YѓHR#,@ۀ&0FH-@Ā+?+뀉J%hB%Iz(@䀅K+++@ZK#RN??JEs ??@wI??1Bs,qKh+@#!K"3"kI6JjI6EF(?$HF$aI62(ю!ܻ?.nZH1F FH0FH=r*د#@ +xKNHFI! C\KHKJ2+ HHL0FH(F~;K@1Eh$ѫMA)FSFp!.0FH#(FH55K*F5Ih# FH+M(F_!+K*F,Ih*H\, F FH %H%x|+!  I%0.+++:%H1#=/G/Z///v$"%"%v$///z0 0/N$50Xv$U0h000!K)KHh<??I`H` BB%H"%It+++%%IK)I I K2JhBЀK H~Kh(6а?O0oO`vLM uK sKh3Ox VO3O0d",PfM*8fHиO0V#"#` V# 2BF[HDh"+,>"##`OKUH "3##x *;*NI#PLH3##x* *,! 0;0K9J" D!F  #<#"<#Bq<###<#<#*s<#"B AO<#*4F(I*F8"+@Ѐ"+UKh+@ހ*F(H2#dXv$0"%0$N$({$v$v$ 1,1?1)Q1"%1v$J<1A1<#c# <#+pzF:FCVh(#(]E%H[?DD}Khs|Kh[|KwOhBr-F"+?Hd,?DsKhKrM'9FHbDH2[FbJ@;t bp+r ("# bKh^KHx"+?,?$-$+ZM*1VHVI LTH,?IKh+DK(sDJhFJhBOtA?K h[# W +j)?KB&:#??!F\:#b`#)+G+%\b0 (K:h>|-IF FK#*s (KQ) K BJ!L2BBAݮ Hھ Bؾ <־ 6Ծv$v1"%v$Xv$v$@Bv$N$1)1$1"%"%*})+1 K%hB3M2R/>A(#(Hn#($#$Hg#$&#&H`#&'#'HY#'! m++)+G%+%HE#%v$s" F"IFd( I" F^@#FF FpI FFXI" FH(I2#F MHRX Fp@[h++x+I" F(F())))1'𵅰#!2H鈱0Kh++!F3(I S'I 'ON'M'NB Kh+3!Fp:!R#(+hB #+`!R#[4hdI F8#x|+ FH#3`+¿33D{$|v$%N${$v$𵉰FFHI "F8F3h#3F D[F[F]#$3p$x$+h+7Kh+?G1O1K"`IF *QF &*h@BB &L#hk&KE йٹй? G 1kKE кٺк? G0+(-d$p,)-KBi[d,ڮ(-`$"%Xv$"%%;v$,{$P$/V$-A!N 4hdHKO2` FApGO I#;` AFF0h1hH"0hjKI@F"`@ ;hF;--k G)F L|$2"%P$),{$"-OPLdM"FF#FiC C C #K x22 (dhGFBFxH9FwKO2` dM 4OrYi F@tBFiH9F^fKO2`9F # %S!i@CiP\I@BYI*F0F0Ki3THTI3Fhh!`hPOH2Fi0i"ici[ (F((F#"ii9H#i$662F;I(F3`0 8HBF9FN/K(FO2`k3h(66+ #"!F#(F*I(Fr)L*I*N `(Fl#h0``'H h0h(!Kh3K Ih _($"Oq(FOrOq(F0V$v$2"%-Xv$h-z-@V$3P|$L|$83v$L3%-OMO#LMfj#юO;hO:7 hC9"!p( `zH~K"`"9!X( `wH MtKh#"Oq97+mKh+wlKlHhP hO3#`hKh[ܡ03dJԱh0O2 _H+0F(( 0YKh;+QKWHh#0TH0+(ѕ97+6GKNHhEKMJNIh(0+EKh;+ٸ#FI ' EH   (2K>Hh hVO3#`#;`'0Kh *+'K5Hhu 4I0H c(K-Hha,K1h Os87h0CcCC2yB"<7R:'&BWKHh7v$v$P$4{$^3 {$v$Xv$3v${$3"%333T|$40R$43#454XW$k4|v$v$v$0 Bh0Bc B^Kˆ(0[:78'#|I h(zK hI hO3#`97+ #"!# h ;hc"Oq0fH8'aI h(aHaKh#"Oq hPUI h#F 0UH! h87(PH:h97*+P 0+?PO  IEKh+=00+7і , <  # !1'@C`F5Kh5JhO2`[F'2H!?-K*`F3(+0C#097+ѕ;7'H:7?7>7='<0F+?(;h3#O;`KJIht0+?ڭч?$":` 0V$PW$v$44 {$45v$v${$;5K5Xv$T|$|v$v$SKFSLh h/1F@:F!pBF@! hf0#h9FDO#0BKh+ؿ<#Aq!!  t#9s Ozs"!"rCDXh+Th#+'H'K(6 h0AF @h+<h#+H# h*F!8F'`0Н90+ #"!#8F, h1F( H4 hO3 #`v$v$Mb{$5P$5b5-AFgO gI#;`eKhF&*𺀽*aMd``K`Nh1h"`*h`) Or+3`YN|s|ˆ6sˆpMKNIh$!$!`KKh(!(!`IKh,!,!`FKh0!0!`DKh4!4!`AKh8!8!`?Kha$Xv$5@j$0F7MM+h6H5K14KO2` M0@ռOB# AO iF"h(&H%I"(h(h"K "!FhHK1KO2` l մObiFC( ( Kh  M0L|$5P$"%676P|$0LO3#!FdHKhLKh+*ГKh+ $$KhB"ѐH(" KhKHhB KO2`KJhK)F$! Fr~KHh$ 0wKhB LHq( ! FV!"(VuI tK#R<qH(F9 F3hK#R/eH(F,^M kh3k`C r = H FhMH#k`WIhUHs( 2PHi(OH!F  "JI @K2I\`FKhX3EM+hS  ,+d"%!7\% JhB!|K@{KhB?Ӯ3!vK#RtH(x+!nH(lH jH!>(fbKO2`fK#*s vM+@ ^I (u]KM \K`\K` C ؉00 "pCOQJ#`QJ`QK8=PJhBMK< EKKh(pа?O0oO`CL8 *< O0T?Kh+Z9Kh.K[h+;Kh;Kh+ ;++x'K#Rr G ȉ!)e ,H x|+! 'I 0. + #H1QKM`K`Kq   HKO0F`%"%"%"%6,Q$v$v$v$a$({$"%v$\%,!d<$ JF ؉ L ىKh8=<-(fh +]љK  # G# h+@,K#+u)?qC@*Kh+?iKBd!???W!# ##$0FuK h=rI*FF F6oH( mH[kO2C&$ "#B&F B? (4F# Bv#"#x(QOl43 $ F0T09h# 8h#hAs##2Br3 B24 (F+ W0-= Z `h +D&K [ `m [DJ13A1` AF ,N ,2-L H#I@B hA K ha# ]Ha$v$v$v$$Xv$727v1"%v$LI h!hH I 4Kh+?3  '1 "0 +?: G5 5Xv$H7|7,{$pGKHhXv$781KO2` L" hF( HKO2 @`b "%P|$7F6IFF Fvj8F"BF_8FL hF F8)FE(48  L#hK H I 0 `#hOaHhK*FHPn$'4:Tn$.:L4S H I 04OaHhK*FHPn$'T:Xr$F H! FFhαF,FEмB20!FF"*Կ8FO0 -OFF9I@FFd, Ԑ<,3O ,,N,K-J ,M)F+IF(hH F! FO 8 z+F F5WPFCFISFBFSFBFYFhf "PFh0FGCh " F If)Pn$v:~: ::&:?I08x!*$*(*+FxF2 , ,,Q("*&F%x",5& ,)&3K%"((x%K!*F0"8("("8(\,\x3$K8(3x,",%K3K(88+ #8#8#8Pn$,8LK (8 K8#8`$8jFF  $838Pn$$$𵅰MLNN(8{IxixF#GIDH#OB1Fp(ڂ0)$8+ 8hhlCF 6H(8Kh;`+ l( hZ ` "p)H.'HCz3,8#H)h "#8F08l 8$hh`G48+zsh;`+ڊiB hZ `"phKB?tI mI i Pn$$*#:#D#%pGFI Z I"F R@h[== L#h3 `KhB"#hXBXA0Xv$KJ-OFhh-CC˰O!b2ah8t#as:< nvA0 8 򎁵@PF1FXA0 Q0 F F 33C@wKJOq h2J{IEFPFIFPFJK 0DFJ[FFqdDOaaPFOaaFPFF q0DJ[FLDXv$v$TF5F$%FK 3DT+# ~,TK#*sh KhS K" IhC 8`v$xv$Xv$0%lF!FF" 0#iF33@(O0 ]-OF-3LͰ ! F6## !HF&Kg2SG!U a iB=j K #BA$MgOF0+3@vI  y0+R(𥁞I Kh+hJ 1!@ J;+{I0F9F A FYF( JA1 qHD! {:#sd+d#FKhK*"-:Dh * |K|I HDqSxJ[ wJDvH#2F9FFB| +@#!qmJ[#0  1D bh8t#as:L jKKA0 (q8 Հ ݒA0 Q0 l$ z/CSO"q,@[$ 2 CJd!q  v4K (q(J 0  {2+r ۵ٰBq-JOsEs 'JOqF >$Kh0Y FF N! ]H!Y@.A"%v${$"%5J>"%"%L>"%Q<S>]>j>>>Xv$D{$"%v$<+ ! O 3BR +# F64FF3-z 8JYFHFD+ q3JD2K "FhCjMV2@aTA FFL"KA0 ! p {jB?0Oaa0FFJYFHFxOaa0Fx FXv$?~=>h `pILcn` p`nCh;C`+3\BР + (,("(=;Md&`nCh;C`+0FA "( \(`nCh;C`+8C#+p#x+,L+M h(I hZ`xhZ`x> #HZO0hZ`xMc& p`nCh;C`+!CР + (,(\( `nCh;C`+B> hZ`xhZ`x)Fb`hv4#%4>#% FOF9FD.!0FvF!FD Fp9F0F*FZ|]d F$$#%-OFLFF#x{I FrMhf`h+ВH!F. m@+.!#1&(+0.K(F8+p +VCS (}KhFF(&F;+N!RuG58jHQ ++3hn^ bI(иaIȱknD( YHXYHThnO0~A(0+IHknB(DH.EH}G(0+8H=Kh[hnVChZ`x ( (hnCh;C`+D1K2HhB (̰)*K,Hh"+OQCT xT(IhnCh;C`+A#IK"HhhZ`x h 3@ B""p (1)=J$pri2`5v$#%>%<>?E?\v$Xv$v?-%T$h?H|$hnBh:B`*HBѩhQ`x!J`"qhKBKHhshnCh;C`+,"C p (0~ B 30@hY`x Z< O#p4IH@FT$T$Xv$?#%?KhF;sI FD/xI" FhK"`320[K"Z`I FDK"`I FD  K"a I FD(K"Zah@)'%@6@h;`+ڊiBò +ۺ hZ `ppG@KANh5hO33`>H(6ѕ#p@H>(2>I"AgAX|$oAT|$sAAAA{$2!FJHI HA'%BF F !D IF D I2F(FLF` I2F(FDF(I2F(F>F9F C F~:/BIBcBOaL F< p% K"-A`KL Mh'h.hO3#`Ht('H !BxCx"+0AF#@<x cE" '`.`"*Ѿ"0+3+#0%{$v$"%zT|$%p @BFFhF*hFIF  p E F)F((H!F +x/+0F1FFF(F((]/(а@ >yB-O$hF&FB 0K4$hB#!F6Fp9F8Do .O FEB O +hS&6B8F'+hXhSE  DE /FPhQEF~FB3 #"%Xv$jF KIhhCf0 н0+P#J``P#Xv$ht@"%(FIH*I hKhD` hKhD `h+ JhBĿ` h+JhBݛv$v$Bv$v$Jxh320[ "nx RxJ3h20b; * +  O0]@phd7FL#h+#AOq#F<0!hHL#h+#AOq#F(F(0!hH0@,0${$B({$B-C&\5FO\] GBҞB#;p", , <)ծE5\,М@BDU85-O;FFF$  %*УE#F"TcF FP c-R1/---D%-zBc%!B٣ pM-|Kh+{K{Jh+FxZ#F)m-.)ИBT3m-n-mKh+ƀmKh:x#F)ИBT3cKhkfH.-hфF"_Kh#aH.-c-`Kh+XKh+\H/)2cF  )ј0  FO 1_0  2!FpEsF|/yx/)/F*ݼ{Bh.-1&ѡBCcPB<pB74T8y#F/*?5B*T3sF9BXBc/%BP *O< ݙB9"B*p#+$pB>"\TB02*p K J9{BcP#F)ж|v$%%%% pGFFFF1F8FFꐹ ,o#`J"` J"`O08FC\ *F"T,##`>BNsh;s`+ H6 ( K#`o#`3hZ2`x +0CC$C-CF OFF8FCsFBFH [IBFaB #H9D;U$BKI J K(hhhhB+`  2`$;CWC]CgCpv$tv$Xv$-GmFFFF & #cIF@C@FVP}I@B~zI2F(FzyKh+6И FqhBi.F2i Fi0%#! bh1@C1ii$0eI `@BL a`aHO0 m"! FNBFYI+FYH@! F>0TH*FRO#0;h+ !29h[Br2JFAF F(0iFh$+7O ;h+=! `xX4`$ t#9s Ozs""r!CDh+h#+hA+?|"H*FO20"OqA F0; #2F! F0I+F] L(<#`熬8{$xCòCC{$-nMb8F Fw)F F8@pFFch;c`+ FCFѣZh+ѣ#`h#+h3`(Fp#hZ"`xF FF!F8FCFѣZjh+ѣ#``h#+Zh3`(Fp FF I FFhI F#x 0FpH)F vzCFB I"F 6DdI *:D F0I"F cDI I DD𵛰#FFF03 FKhC=#HC3#Hm(F(KۊLNKh8FZF(FVD4 F~"F9FFnI"F0Ff"F)F0FbBzH(U(ԀwH#h*F0h+>sI#rHP"(5oKoI0h nKO2`%B#< F!F FB#< F!F FB(FYI h8~SHF F+ F!F FKHLF(F!F(F,,BHF F F!F Ft x+?n8H"F(F!F(Fb,^/K`/Kh{$ShFFF{O`B``0 #`#b.Oc`jKj;bhB5B=ah*F0FDt#sUh+D`p3" #FF`j#j3#i+&0F#ibhY!aTh%iB m`h5)FB(0 +}FFFF1F8FFjK,o#bK#` K#`O08FC\ *F"T,##`>B" +FF0 + K#`#obCC~EpG!!H'%K!Z0K<13H̻1hGpG'%`EKðh#Kh;Kh,@ C|L !F!F yHb! ! tHqJ1 qHqI !<hGlKlLh!h!eKkH(Fﰹ`MxA@+2dLxk#ZK1hG+l^H4xx,+x#Z"p1!h[hG(33MMMI(hFhKNCO"FOq(FH F)hEHDHo1Fx8x + F=H_3(FZ"p(6M)Fxk8x + F0H@3x;x,+x +x#Z"pMJ1h[hG F\3 FK!FFh 33%3%3%E'%%F`3%tE3%E3%+6EET#Ft1%K! `ĺt4% IK"`l4%w!KH`^p4%(% Kn:f*oB (КmQeppGI-CFM O"(hl1+`&O  "(h 0s FF H>I"(hut1%`9F)%l4%&H! !  CF3И\BH! ! F !F K/!LA F`A" F I H` I !FIHVIPFVF`h)\FhFK"sLXhIF1N[P+x;(Ff)FFph6I"ph2K "hf0n+H&pP3%`TX3%`3%sF HP"iF Khs K\A F(H!FHDlFF/%`FXFF K!h6 FjH!FH$B Rh3%FF K|Al#x[ FK!FFh `t1% K7FLA/! FHAJ# F+F 0!F`F pFx# + + `F+FKl , ,њB10kSFB10x*p-GFMFF|   *h,jh(Fh"!FH$FRY$ <)Z$ s##VFF-GmFHdL)FdMF hbK"bI`"bKXhaKaI"hD h " # 0" h 4*h 0* ""@ +SJ! RH QI $H$F FF0ӹ "0+ 0 !O1F0 +*/d"FB6H5K<1C B2Ha-1J! /K"&IXh1F mX(ѝ * * *pK<1#4H!FpJ[ERF`EHK"`}t1% /%p4%P3%`3%3%$3%(%F`F0%X3%F0Ű*HOr0> &HrE0v"H*"HOrFM ! F^xI jKk)F `(݄B!F\ >3 H. F^FFGG`5GK-OFL"FFXhI&I `"J!0F}K}I"h}=(RyKhyKl1+N" tMOFFFO ch;c`+@ F0+H .gK1 /?(@ F FF^ ZI<1+@XK"TIXh\VJ! d~ r#hZ"`x0+(ѵ1+F Cѳ(Ʋ (1 # & ; (>+ѵ,1+  - & +е1+?~<1+.HAF l1+?n#0!K"h. J!K0 b+h* "" @BяBY fHXdHHP3%$3%`3%3%t1%`X3%0%F /%CGFZGt4%l4%p°9HOr F(@6K"6IXh! ! 1J! F/K0I"h%,H&F+K<1C (Ha'K""IXh^%J! ! ! Bp FpFF(݅BK!hF )F )F }H.(FFP3%$3%`3%3%G`GX3%0%t1%nGp°;HOrxF(@8K"8IXh! ^! Z3J! F1K2I"h":%.H&F,-K<1C *Haa)K"$IXh'J! ! *! &Bp FFF|(݅BL)F h! h )F )F H(FFP3%$3%`3%3%G`GX3%0%t1%nG0MF(hPI F`JCchCc`!(h J! 0#ch#ct1%b!0%0 MF(h I F0HC3(h!^ 0#3t1%b!7HOriF(a4LhF:cy#cq0K"0IXh 1 #10D#00#01 1 #11KHi1#!1K`1# 12 #2 23Ht@HHG`P3%b!l3%n!"LI h hI"@t1%{t zt F,!@ 8F F 8)FG( 0MGI M0v(AHj?JOarF;KLA:K,F F 2J!F F pC -H: 'IObTFBѝ 03 +IH,HIHoIK`!Dx *#Cp H{B8GG`ҝ#)%hG>.GG(%IHP"-HDOr@!L( ` IH@@ HOriF H@KhF!hkh3%Gx4%GG`0P"MI HLHQC+H M0@q(55Or@!H M0@ JOa5hF J)FhF M03% H(%HG.H:H8'P"IHFй HIh(8@ I H} M"FlFl1+Kh8@84%G`a;+W\c WyO8E+0+їP+rKrIh(F(oI(F({(FmI F(kIfK@F4(gI ^K"cIh F(haI" F(c FYIF(?lZIQKHJh`dOKhWK`#]0 TIIK/!PFMNIRFNHG oB###"#"FfF8` (?/ @IX(?K"`$統=I-%'J#O1`9J`9Jp$$O4 O5 2IS"PFt ,J`+K,I *I (I &I ;h$J !$H#H(N!IQK3%2%nM 3%Mh!J&LLLLL3%LM3%Ml3%NM3%x1%1M-%M-%(I"(K2``p0&I&H!5-"H#Hb c\B\A#J1#<1K Blh#13h8hSh:h IdHK$[h[ rI 3h#8h9( 3%x1%MLL`l3%M-%MH!@-%6I s(2H#`1Khk -Kh+P 0h h&Kx+ !!#K`"L Z h(HpK"`Kh+!F h+O3#`,KxCC L! hj I h"n! O0+-% 3%x1%t1% t -AFaM+h+j@_HF^I ]H\J x/)7>YI"F>2VNDV)ySN3hCSI2F>0OS3`ONPI2FOO>0Oc3`LN3h+f#3`;h+@HI"F ZGKP``BO;h+):hCK`"CK`CK`"_w:"I>Z:h#3`*(8Kh`KhI"F/% N%N7N2%N3%3%3%N>N3%3% 3%{NJNZNN3%NuI:">`sK8 `0spKh)ր0h(8h @ iK:"iI`>gK" fI:">bK"l!bI:">]K"`_I:">YK"`[I:">TK"!WI:">OK",!SI:">JK"EK"@K"!GI:">;K"!CI:">6K"!/I:">1K"!:I:">}8K"p8I:">t(K" "4Kh 3J`3Kh 3J`3Kh2Hm2Kh1Hg1Kh0Ha0Kh/H[/L/I"F>G.I0##`,L"F>=+I0##`)L"F>30 ##` /Tl3%3%3%N`NuS.4$N7Nx1%N3%D3%O3%N3%|3%N3%¢x3%NeFt3%Op3% 3%MIFF(FI"F(F bhOCOJhI /%t HCh;C`+6C hZ`xK[h+ ##@/%L! %H` )F/%J>J! }0%J! u@0%0)MF (I#`! !H!Ft hLDch;c`+ FB"p  KhXBXA0#hZ"`x (pB3 /%19FJpGB pG pGKu^&\'+)"HpBIxF{YpF1 x,*F@2kZp FI*F^!?!+l0%jO( K @0^"ed""f"HpG(? "de"/%l1%FHLMNO < <Kh2ùlF0F  <T< "*"F8F 4wO`|OO/%0 MFlf!F}P!F}T#SC@rp"CCI 2C32""b"$ !b#sCcl!| 0#c/%`pMkh FB :(h+ HH#x+Dq2;p@Hκp/%O|K7nM0FKhIJ*xb Bl " FBjx ԝF H FhG 0) 5`/%pF,L-M1 x[@0F"A$I F#k`p!I F#k`FPI F@I F0I F8I"FHH#!FN$M+4,B+! F!#!`/%LOOLOh4y1%K1#KhV `4%K"LXh!FTK!F"@h`3%3%X3%p°#M "(h&Fx0 +M##p1빴B"#1y#0K "Xh"BpB*(h ";PKh( I0FPK`n#y#0#1X3%``3%4%J 0[ `pG`!m JVN! DTI TO@RI %:3h#0;h# 0O2!hF(ݽ0FL"0h!F( #xS+W+B+L08hOb O@< %Kh+(F *+Kh+!!FE"F r1+0+к b"F!x @+|)84E x ^+ xh:`* hZ `piB (Ѽ`P3%e6t1%3% /%`4%8F L hF F8)F(Рh )F (4` #KCBAF@  F F@y! H@'y;+&!0h&)F0F젱P0F@(F(`H#y#P#qcyCcqhB`+x !;#B`+x"{vPPFAL#h;!+@NX#h"+"`.h0F#hD+y `;+O4NGNNNX3n;3f+2oB۳mZe "p9F 0{'I0 ` n; f+ oB ۋmZe!"p)hHjX1! H1F`h#h3#`6F|#h)FD#`0h `1FHJ#h"+#H#`@C H1FpFF; B"BF*pp\+ ^+Bx@:Ӳ F;Cx0ֲ.Fx0:ֲ. ۲2x(ИBSxJx0:Բ,P-CF9I(=7O ! FF6=! FF(9#p FF(Oy5["(FFHFn4F`y! F4#h+L#h+H##`LAF F(FF)F?! Fpp F\F@y!nh(F#x!+ ` FJ!F!F8FnRP4%J>`wM$L%F h\1Oa!JhF IhFFXNO"F@1hF F.u0#u0 M#y`#y4BT<hD<3hiF8F !hFb#phF3`P2%PpF FFy[ FLF(F pI0F F|F!F ws$MNI"(h (h1F I"(hI(h"<H Fp(*I(h("0!HX HO!( HK!( t1%f@Qxt yt Q4%0!I$ K,3CLF0 0KjjK "h F`PPB +! ]4B>4%`t1%HH!H,0@Q4%"%L&I hh T#I" h`! h|?@ F! h|I" hH}0(3(HH ,I h8I h" h!|I" h& h`t1%xt yt RRR(Rf@cR0F(g=K<1{RR4%QRRRRRR"KIh0@t1%J>Q F Q <Kh "`]pG5%Q rKh "`]pG5%oDBF FF(F 0F"F)F8FC|D$-OFFO0?HO0?(P ' TFC O3F>FF2" ;$k . ;$ F& $.$ ?1 ) $; ?% ) $  $. $J 8#oh (?H !hF3+;846:@@*www x(x5%Bx\xwx}x*<и?ɮ2F O36HVO5F i'2H2H2H1H02F#nF B%HO3F]JzD+ $i+ظ?H hBH;2 $d+ hB H; 2 +q Hxxxxxyy.yQywy-OF O0 >FO0>FtHtJP &hQhC +F   "OsjI8#iK& o h   mFp`H4F8F?(F?|FO6FFFnF&FFFO2)FXF?PHO4Z8F?\(F?YF 0FQFH4PH ùO2 9F?H8HF9F n Jz rF !lF(5H68F?#(F? !l6()F XFR 5C BH+FO2 m H J3O1(FC#OcC#_6")FXF( H48FH?(F?tw=wxyyyy-CFHFF 0DH#&o` FO3??e" F ??4H$&F8C0H;F.HBFFH;CLG@@p@BgGG/9!KBv+&C4Oc!FXCzs!J kD I, ,."H,jH)FC4F@d@pDtv K#yzz-z4z-AFN( (H%(F*A?$pCO &,$ F>FHK[h;K2F8F#%oFBF(&FAF2F8F$A6DѣZ H+ HJ8F!*FD!5%:zBzSz-OFx]-+@x(,FOO  F(<01.h+, F FPD0>qFHhKh# ]Oav!F ]!F2Fh  LFH)FQGpCO~H!F[%P)F0F40Fh+(F|0H Fh0B_г_г@O ! F8 H!F|H!Fm{z{{FF+ * *pGF xx B0 \ܱ3\ %FA%F/ 3A/ a,٣A( 3(FO0KOh`Z` KhK Kh3 K"`   F5%r%LC%/H! A |>8F~!D)FF{H F8Jh3`pG 6%8Fh#x-+4`o8F " F (+hBO0O0KpFh+NuhŹ ! F Fh` F:!0I"F`shu`+`hh!Fhp-hFJ@!hF4hFr 6%Ao|F@Kh# F@O0 6%8F F@Kh+)F F8@8 6%FFF1F(` +`#` 1F8F `(H1F `KE?}Fs(x08 Kh+ F@ 6%𵙰)OF-J+x+G9F(F(!`0J1F(F_B}0FM FkhB F!`!l` 0KhB!pG 6%K!i Xii 6%-A F xFx9 KF!a F M' J)j/`_J F)j/`_+hCE4F 6%N-AFgNsjB$b/("#b #!wb kc<#c{ot=؆(h)K(b!(X2(YН0b03c0sc#s#xC#$0#0 0"0n(5K"8@ؖ(:(/K"-,K"'O;ذ_4ذo-аo$K "_!K "aO'а?'аOK"KK"K"K"K"K"K "K " K " K" K"K"<ĕI 6%J&%7 (IjF2'LH%'Hx(1ТD b0P+#b HhH6"(#jK b`#j+ܿ##bűfHS0 (nfn+ܿP#f0H( H;f H(ht@ 6%}}}}$}V"%K((8(  #&) 1((2 H]HHHHHHHH(#H(#Hl0p#Cp #6%,}/}2}5}8};}>}A}D}G} 6%𵇰HNL@ 0`H#`K(FF_(H#`z#` HpHkHfHa aH]HXH  p(ĿK"ȿ`KHxKpHM(F+FH<(F+FH< |H{K(FzH%5"H& }ޝ}}J}}[}r%5%}Zd#}ݒ}C% }1C%E?w C%K(C%}})F9J8Fy 6HF(aвh4K*F x+Y"j!:_F0F{Z0F00D(J1F(F%NO $H{"K(F!H =q(F5FHi8(F1F#(F2F,F+x$]K"`#<#HJ (?x+? MN}}l}} ]}N%}Kj n 6%Kj f 6%L(=KhKhKh Kh#!j L Kh#!j D#(= 6%r%6%Lr%r%r%Kh(K( 8 pG5% 6%K! 6%Kj$  6%K!  6%K!  6%8 7KLhKh#Kh!j <xC<x#8 #,=Kh#!j Kh cK%(]h;8@ 5 #jB8r% 6%6%r%r%Lr%r%pGFK! _@! 6%Kh;K xjpGr% 6%Kh+ ͹r%Kj 6%K!i} 6%F FF(5x(2+(3>x8F->L. (%{x-;۲L+JWVpQCFZx.+CF#X.`"`# o =FXI8HO1@yiF F(())H޿K[Mb)) H޿ K[M 1)HP)H%w}}=}}B8FFF((F!8@չx ++!(F#x++4 F8@8 L H! * !% ! !#` 6%%wBKhCCH@ `pG 8"MFF  "!F "!F KhKpo FPF`8 "!F 6%4r% KhCJ Kh4@ӹI F@`r% 6%FKhX@0x F@ 6%FF#XBXAKhH K! } 6%-CFFFFr B??(H!C dO0 2??0 H!( (FBH!H)FE<,eT$oIGCH!DBLE4B<d-"F"C}}~+~E~1fcKhB233BpGPC%8CMF+h3H! ,`8Y~-O#N3h+ "OAq:hB 2R-O`.3hBB zREB BikBDK "O`iBwthB#??ЛKh"BRi՘JRh*A jB B  =K(@`th^D#``#aiz5%F`a C giGGvGh??ІBw$D S#BBj AKi@"O 2F;FiH??PkHYF O0rREB*Fi,F2kBaKhhBJ``h#T````i```aCikBD(AhRBj3bi d `p````aeCKhSDCg?KihH>*DwO2`(%HYF (ZF Kh("$s%r%~PC%5%^dr% N%h>~Kh+{Kh(v*?siO 1)DhZFO dCg0+pKh+?? f5%% KhsBC kIAA@ApGO0FpGPC%L#hO0!C#hAqD"kB2"cC !2A !"PC%8L#h+Jha h O3#`L h=z##`8hC@3S Sh>Eli $ #S``=S0hB#+b6ki  (i8h,@O3a=9K!F<`h@»PC%6%Kh@@ipGPC%0F hDHh8#hBC!B 0ZR@hBQT20BS -OF1MȀ$Đw?[+K!F(FZB"Ob+B..+A0; + "##O O  AHF!  >B@F!  5K;+#c+$3x0;2 ($$\C%\D%~~pFFxM)h! FhlhM)hY6H1F r 5 F@hnkh "` p 5$~FFFFرK1A?+x2*+!kxcxSn!(,F ;^+#x*+ cx[s+d+УkKBKA4;`4`n!(F,FuSBSA##\C% I=HFH H H H ,MNO#x+KуKH!4!!8!!FKxb?BKxx?|cCCKxx|3Cx?C|`Kx@rx|C y?Cx|2CKxBy|SCJy?Cx|Cx|2C4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`p\C%KpFhh)ݔB ,`pB <)#FBF;)FF x&B F4FF \C%FI I F I Fh Kh+ I F8   D%D%$r%,FI I F I Fh Kh+ I F8   D%D%4r%,J пò\pG\C%(FIHyH( @F0ӲHJ !H#FT!p ! FpH#FX!(Os4$(FK!F"pD%\C%FIU8I FP8  D%<@DcB ѡ"c+ !@%cXBXApG pG pG*-A FF F|FF<`@0FrF(F ȹ(F2F0FO1 J)F((F( $$$D%FHFHI*FQFI"0FJFxHI*FAF*F0F I@8I*F4F8F<, FxJZboY8FHiFpI F I Fp F8@}(F8@ (8}f-O F F2F(( pCO5I FF F<(*FOad8.I("tF(J(F F+* * *# p(IFtX(YFnHI(j@0"+Ѹt#h+ ;#`(*FOa((( AF8FGm+(!F(lFF F,0,,((HpGHHuL%sFhF(FD!* F"h#R3FF(FpFN F'h "a#i#1F(F'a$h FFO1JFht+FF h:yD%7L (8B8#D80iF(F+2 8 8 D%pFFFɹ*6M+iCIJ`hah(hkjCI`hJahhip@hB Ahh K`hB&` J I-`h*F Ip@%3BJp,AK"8p ((((O2KbpGD%,K"( ((O2KbpGD%,-CFj|O N'#x:F!FB0# (FD ((D( (F#)FHF((Ft(#D%\D%7% L F"Dx(F0"F!5tD%FLXN8xJ8x8B&hF 82h;DB8 8;D 8hF+8 D%6%𵇰)L#38B=B+8 (+DBO&8#D;h[scڢBh(0F8 8[ 8+2 "\DD%6%%LN8#Dx3h[sczx8HI F>pD+D%6%sL8xhFK (h2DBF(F8 83D 8 8x[ p;B8[x+hF+ 8D%6%pLXB"8^]k. KO2b 8B x@ p 0FD%,K8x D%8 L#x%X8O2pKb 8 D%,pFM F(F@sBD p(+BB KO2bh@ xU;;;D%,7Fb% xX!*F F (0K$ `pGD%-CF xFF+7KhlhB)! F0Fkh%`c``l`h 1F@FPch@F0; F;LFh1F(#h`Pr%FF"FFpGL$XKjB"!F$8"aD%,K-OƲhFL8(h+Z($8+Z!](b*O(h088#h88+;#8H1FO +"+(F +08Y#DB0(h((7 #80&9(.ѠxJ!kBA(F(F(C+tz#=)pXde(#48&#48(؜#48f#488x8x +#488B< + 8Br< +?m:7#488Z#488x+?R#48J#48#48!#48 8#488B< +8B(< +#8B< +#48n#488x + 8x +8x#8$h#48V;\D%D% M%,Khj*(b(5 /FB RFHFAF(ѵ`N"HAFx"H8x+?48(@΀8 ;#88A28xF EyKEFEF-q8)/ sH#48F!8FFD8x+F )cIdN405!FE)oѺ*0xxFBшEFO x O Eث.F (ЈEFٺ ERF0Fn( 1D!6E F@(H(:d'0O h»0 5 J F IF HiFYJFIFhF`I F F1F(F(F;0F;'Rܿh  hq%Au5%,KhB KhBKhXBXApG pGL6%H6%P6%pM(h0 iF, Fpd.`;Okh+ +.+7+g$ $@M%p L#h;KhKh Kp@??h" !Kh{"hbI K hh``K`K`p I+ JO hh``#r%6%5% N%r%TC% e@ټ-CFe CFFDO3FM``2#00CԱ#Bw#020+Л, 2 8 F Ff"F @O%TC%%-AF FJ"LhFC`hh80FA@h#c`O*Fh9F h#" ۚO(H!0FнA׺@M%pWF@]Mkh%+>+; +p; +R#ՆE +R#7+E+Z/+ѫiFl#+b)ip@Rhq`p@ #x%F4++ ++L h;)+x #`(F `Ax"+ixp@x"+i@xKh+p@ ^x!+hj; FhbKh+ohjIHp@Kh+b I Kh.YF(<1FHp@̽@M%6%5%}pFKFFX`0F)F Fp@@M%NKMi@4@F/#s`c(Frj(Fm Hi, , K!F`@|HZH@M%fLN%CSap+LhH7#c`*h&H6hZ$H0h"H*h^ H$hHhHN%h A+F2F!5-ѣh HK"`pL##L H H@M%#/;EPV^N%+u!Kh@L,KXhi8 pG@M%COppGKiFH]a@a!F KhD```@M%Kph\#xK%;.FM%B p]&>#x5 B%!F VJ#`hD` `Fh@M%DF F-G#_Le&-]O`]Kh3s[;`O ch 0 C QKhO0*#hOGo ( hP @Kh0k}P6Khܠ0  1+^[ 8#@ch7+?OCOS#;+?Je(EjH")F @ (? hFP0I#" f0+?8e&2+rzJ`#*ssKh K"! i2+riJ`#*s"! i[#*s#"#YKh+ #*s "#*s"##"JK"FhyGK"Fh#*s#"#h=Kh+*#*s$ #*s"##M"!#*s=(Kh+"!j$Kh  5F 2+r;`Kh+ "8hFG2+r;` "8hFU e 5%…>`r%xr%Hr%#N*s#"##3`gci+#c 2e+rd;Ck+#d"##ck i*(q (q+ci+ yKh?SqHwnKh+ #}"l hK`blgK`lgK`(?mx bKhC`#*s#"##YKhCB`h`#*s"##g)!i {8hCsh&LCC`#*s"##F!i Z`h&s#CsFPBPA d+K.Hh`*K"dh`)Kbdh`d(Kh+@?&J &Ih#Kh+@5 ۭN0hpI FH.0hHIFJ#I h"ZKh! `0H! r%^6%HO%r%r%r%h|5%H,օfT,a5%<#*s"## i(?{H0r#H*sKK H!#*s"## i(?J#H*sKK#*s"## i FFH#*s"## i FFHv0F( ???Kh#*s"## iA(?H!L?|Kh0F0F90F#&abE-F(?1F"#a#hIF fKhKfJfHgIh.F0F޻dH!`IF F( -e& %P -??.O1(F!t#QIF> F(u - -?p(F0]#FIF F(^ - -?YB(FaR3Kh+9IF% F(B - -.%(FF(6&J% &I(Ph`.%#(IFx#*s%K`%JhBOvv6!i[`K"` h+߿Khs[2Ii}Xi|r%6%CS5%T,aqɆцtr%HO% N%6%#*sK`J#ih Dh+߿Khs[2K"`K`chi+?ϩ|0F I#"(F+¹Kh+?#ctr%HO%6%-r%Kh0pG\D%8FF ^$r!F(F8-OFFFFhD%FG E[եB< +5#+p-PF>2F!F3($B!+JhZBB8FZB,<++*)HF.FBFIF4(FzQHF:HF:FIFEK# \D%hZ`F`XxpG-GFIE6?h +43pF#xp+3pc!B" *+*F`xETDFhEEF=?0F+;M&F܆pF FFR ! 98+hD`4D(``` pO0-MFOO O $ò0 *;p&  `Sh 4O07F e 00;+ (ݝ0;+ A-@,A, Kh+B C Kh+C B 0m+KhB# K"`Lr%@6% N%-AFFFO d +2F5B$hxxBI)]Xx](g(B 5=`@(/+ '%@,A,,e  Kh+ C B Kh+C B K!h;B# 6K"`D( [d(f(Ѧ縱Zxg*F;+xF0*/*r32i Lr%@6% N%L h`hhh@M% FFH(ڽ@!HpM%ކ FFH(ڽ@!H\M%-GFVKh''8F9F(FqF(FO7!9F("#(F?? F9/2F!F(F|F(FOsKEE F9S  #xCcxM+ѣx++xG+ <<+1F FvpC HiFH9Kh+ O#HiF,OsB , FiF H??iFH^r%7-G FFFF F(`FDo`':FkhB@*@nB 2FAF F\ s"D4#x!F ##pkhFB!.KxF B +khFBkhFB '.Kxp4kh'Bӽ"P,Q,8F FahkhB F+*ЃB 8FX! hIAhF)*ЃB pGB98,*ЃBpGpFFh(F!F0Fp@{p0!LhFV#?? hiFJh hoFh h h3F(F h!T##`K  06%M%KhSL h8G h@r%6%L h! h6%O1pGCѽ@!M0FK, F(#Kh"H!Ma( D(O( A(!(Fd( o(Oq FK`Kh+0 ! FM#"(`#??(hO3+`H6%`-OF$0B"t0F0F " HF(HFKHFa 1@FVF@FwF`@FO3{F(@%F&I FXI F0 F Fع%FI F( &&Kh+f(cn(_ЃH (F K&iyI(F O3&sI(F O3&(FFxqHs9|CF9F F(F( Fg`Kh@F&Z(]H Y(FvLKHF9F@F'FIIFHK1F"`nEK`EKhBSCN"CKh3h 5I(Fh (F@3K 7Kh(kO@S3h#/KI F"`숱I F` Fw(K"FFh(F9$Kh  F9 KhHFQF ??FFd0s76%h|fr%;M%^5%6%s% r%5%6%6%HO%H,0r%%6% F@U6%F xpG%*Zx%*33s*0@0pGL#h#H ` hK#`M%-G!Fd Od O FFsh;s`+ 0Fj (F'#8F#p3hZ2`x - 2BOI !HF~9FFu8FGF8@F[CHHK(Fى]-AF!DUK"xxBFI4F#x##8F3p xBcxB4;;>FFF#x+5*FAF Ff,D;;P,Q,-OF8&F'FF,K,JFq%!8FFF/3'p-x7BxB&-nKJ(/D&O 6 Fd!(FKJ)FxC KxFj0F9FF FIFu,D0;FP,Q,FHF FF0I F@8F F(F!D4 F KJ!F;FF$(F8I0F|F0F8 F,(-AFFF %(Fx+F0F!D4 F8 F( K!F JCF/!(F((F8 +mFH!F"@x-AFЀF4F%?s!hFF?C(F#p#+ %+ѧBcx%+#KhB cx#+H~D<#+5<%+#+ѷBrx#*F Fu4 F^D%+ ѷB rx%*Jh,#*;,%*6%6%-CŰF E$"#(FN??Or(F1F6(p5lB,Կ  0K)b()F4*F!a0+F F8*F0F8F(4\D%r%-A08KhF+]6Kx*F,F(Q2H$FA0K(F@FF FDq6!(F)%K)F$Jx$KxCFF8F8_SE0F0D߹I"F0FVF0F8J_8FPF8Fj+x[(F8= F:FAF F,F805%fQ,P,FKh#V! F3F!FJF`(FcF^)FF F F4F88F8(F8 F$5%&F I`I F8I F@  fh|mF iF F80 F m@|hFy mHK-OFhFF3EKhO0BH=FбFxFF3|*-* F(Fx(F 9H!7I F($C FF(FFXFQFD4 F-*F[F!FFXF8lPFqFPF8e-й *е@ "c F((Fx(O3H;`F F4P H<`(F<F(FV#x+ F8(lr%5%3*f*K-AFh F.IO0%HF(?(!H1FA(FF FF8F2F(F.F0F*DD4!D F!F+F:FF20F8(F8@FF@F8, FAF5%YciF( p@CXBXA'] 0FL#hx(F!0S)FFuI FuF iF(F((FF F'0$hpCO(F!*0.)FFuI$r%P/`/F((#" F#pKFh FiFNKbBBKbBBѴ??BA &p  6%M%M%HpG(FR DB F,C/*FFO`4KhB Cн@ (r% KBBB Kh@չ@M%r%8Kh 8&??o??F FBB   TC%X i0A(q4 Kh"`,pGM%-OBO;h+$AKh+y$%F&F%HO%-OFFF@UKhB ݕKh+F۳BDڑKh;B?е??O>PF܀@󥀸DFEF F)FJ00hC׀??@ЀzKh+@ˀyKyJhhC@Ā#0 ?? 'qKh+PpK FpIh hC@sC)!O1)FE F)FYF F/|0XKh;BBB  F)FO EcoBBw F)F30N'O kHKhCF(^DKh+(AKh+@H@ F)F??F FQ!Fc(G!F\(@"K h9S(?7PF??%Kh+ !( " !OT# 08K hC K"O0`ON_4@6%r%5%q%r%q%q%N%TC%pr%/(r%M% KiS Kh( Kh+Kh8pG pGBppGM%r%r%@6%-GFF FB(4KhB#3Kh.Կ&&??.Kh+-KhCBOqu1 FO3"F+F&"KhCѹF  F)F:??F FѸOEAO0Ge F)F".F@6%(r%q%N%pr%-OFFFf'p  X FO`o??F F>!KhùOK h9"(#"F@F+F,FLO {F F (op??0$%FF FTC%@6%%-AF FFP??F F &AO0>C*F#F8Fh8 MFF+hB(hBԿ  8??4@6%K(FFhB pG/K(FFPhB pG/F @F޿8F(M+hB F(`#IS``#hB Jhh;`7h7 F8@7 Zi:Zah86%/N%KhpGN%-AF F"@FDE/8F78! F0F`0F #BEF#wa#a 3+h 5`\`ki,`3ca#hCE'J Fh3`Bh8F0FF@FB8F7 F@F70F^`$hZi2ZahN%/hpGhpG@ipG Ʉ 0 FȄ#wpGpGi DapGipGipGapGcpGkpG8F@k FB7`ec8@kpG-OF FgFF:й7`O #!2F1@F;FIF^F-Ѐ= !FO??# ZF0QF#F(FBF x#"(F2QF2F;F3FXF(> \F< * -O FF  ?? O4%F F)F Kh+sѮK FIh hCEs) O1!)F F)FF F F)F{(ѡNFF3h MB (M @FIF\W@FIFFF\OFBw>DF (f 8CBCA$O4%Fp .q@FF F +H{Kh.I&EN(wKhCѝ8i 0m2F;FF6G(iKh{ к  6G ( ( 6:gw ҉#(е  7F euE[RKhCVBO am 0F"+9F!,@FIF`( BKhk[E FF@FIFFJh? au . .)F F ( ( ( (F F'q%N%TC%%HO%pr%r%xr%r%r%?? au/ Kh[ . . +F FF# 0W^r%7F F/pKh*Կ""#(F!F#20"HO%-OFF.y#O3  $Kh+ѡKh@BOqy( FO32FKFKhCpi(ѓKh><Fwu , ,ьL0i#hf ( (0 L#hX (QCAm([ O8 FZ # CF?yjKh rcE (FUF!@t`KhC@_Kzh+~#j{o0B8Fao LF KI h)'KK"` :# F"l(+O;h;BTO0 khI "3k`#`"QF鈹:FOar(8Fh MqI"z,nI"p8!h!hg hI"b(@Fk=.-!.*<.Ц ^+)#` 0ZH>.Zx=*ј+&Zx=*ј-& "FFELIMHZx=*ј!JJ 3F<.T+.W-.[ki"=.kiYКB""*?x(?uFFF; +L#+ѓ+<\+# p3x+ *=!0F&F(SІBQ,+*M  Jx(f!hkiBԿ""kiB̿""kiB""JBJAH@ԵLJN%a@f,‹ȋы}/!B!F43x +=+ !h"0FCx=+:I;H!h !!F !!F3x + !h0FFxFFk . .#0#hhhFHIFHOd IHIF83(PF`x*!h_i!hx(?:!!FO}$TEK!B(¿Z`i`D`pG0N%K T@ wYc0N%JF XB0(O0pG2F JhBJhZBJhBKh>%>%>%>%-C!LOH8F6 !F8F6F6@0F6 (hBF0F O(FIFHF6xh6u ep0N%FO FF0BhU;iC$`(0N%8FJi]a FFF F8@P0N% JFhp`e  Z  O0pG4r%8Kh+Lm!VP M 80 L (8"!"!r%0N%}WHLK0HK0!O`!`O`Oc0 aHH H H H#0_0N%WpN%N%N%N%N%(  pGK8pG0N%8#Lca#F0biaB$H%`U8 :UU@UPQ H H~ H{ HxP8hT#iiC"Pi30N%N%N%N%N%N%-CF, F0+3FF>J0hC*0+8F1F5P[ #jFhFrF2N%3hBOnF%BQ! <,K `'>F(F!Ff%KOb!0+ L!M +hB! K0??ЍBt JBAJOq+ $! 5 @Q5,r%@r%0N%%>%>%>%-OLgF FF0??)1+@Ae#1ih+@O1uFiPF+ÿC!i3#ȿQ#0)F:F%)^r0F9FOG(HCD#??вBADg#1-%O kKh+oѸ| O  1B 8#??08g+xHFFFEr 1Bs SKh 1C1+#1F!O HD #C ZE  Ѣ1+\1+ј ! "g/  "S#h(F  Y/KhDE F0"!]60B#H & ")F-H_2BZF#aiBܣiN a0 1PBl1h" =}h\T!iQ"2A#30N%r%,r%6%N%Tr%-AFF FFKh+ 8")Fg( Kh0D(FKhDB r%0N%6%8FF*F#FOHq8 8-AF MF$x$1B  2F;F $4LO% O?h/ # F!O8 r%Ki(!h,!pG0N%K(!a,!`pG0N%(FKb8  0N%(F HK!FL8  0N% ( ! #3` Ch F) h\) \B\A` h+J\B[$)3`\+#C`O3` F( F(,ypF FF!*F FU#hBF0F(p-GFFLFF P*01;0#10#0(1F(FF((JF!0Fx 01[h PH JF!0F`F(05YHN0q}0 ` K)F0 1B qHF 1BFۣimNh0kN+D*FO1B ([^H3`05 #01.}\Kh*[Kh):BF;FIF Gi+*_i+I`iBhD @%i@8U 0BF;F N8 g*9)/)`hO1DcFhBO1aW!iFi2FQ (FS< #h(#`#*) " F*()$+05F-aIhi h\iB"iR#PF_.2ѫE(BF;FIF0FnO3060 CE0N%N%N%N%HN%N%r%r%\D%r%E .dCKh+BJh*)CBF;FIF 8_.hEF _(E0FPihD1FF(,I0"h01+0݂B4A!F|d"N2F)F (v<,~I;Q#B;8AKh+?c.`0+0F`0FBF;F ! Kh+JF)F0Fr%r%2-dO%\D%5FTLFFh - (#! -MJKh+IJhʹù0+ #g0 " F0$+%>%r%Xr%Tr% I0peCiB0T# poCD# 30N%KwYcpG0N%K zKh+~ # `8#B ` F@BDRk `ZiDihP"`\0N%|r%K" " pG0N%??-CFFO0FF(2AF`` -j0 0"U 0;`.4`0;B(8a 0U4F0N%%(-GFqFO0F8aH($O@h<U (F0Ah#D3`-0;+`ѹ? ,( 1h:D DhB@ h<F0N%%-GF hFhFO D/0h3`+h+`"F!F!F`"Fe@F5 O BFJFFPFF?FL#q1gn8FFiqO2O3K(130N%-C NoCL$L'F5h3`0BܬB5` ??07BF`6%@6%0N%8 FrO08 F0 (#xCH!F0r " FF(2OH 02KB hB Dh2[b2xQ%Kj+ KHh*J!`!`XpGxQ%r% N%L#j+3d+#b 1''b]A;BvH9FO3xQ%K!F9 K JcbB  ! Zc3 pG 3C i $xQ%%-CF;TF FFF??.0BEF#p JCc`Kx8HHhfXr%Tr%l08(H!K"`pG5%(Kh pGLr%0L#h++ `Hr%0 L#h+HiF#V##`@r%0 L#h+HiF#@##`!i h;#;#[1;#;#[+1H!l---!bi+#i`#`bi%H!Rbi* Gbi*- Gy-vh+ӱ#ih+H!#i!h3T# +#iih!+-tv#iihK"`l瀖Ɩ N%FhFF xF0; +#O F xF10:ײ / "+.`<##`,##`O0.HiF+ܿ3 PC3KhKh(   pGr%q% H: K"` L#x#i h`h!ciFG$41q%3FHx FpGBЁh ;B$03-O$,M#FF'FF*xb+A#`O XFnh~$5O 1hRF@Fv, A8(ټ- IEIE 0h7FTF#F@DBDAhպvhO # `+?h`3H(T(ĿK`{$@ pGYKhXH UK" "`"RKhBPKhoo ]WHJ#DIhB `G #13BKhBKh+AKh:K1+2!.0 :J&0h"oO293KxB ,JohC`&K"`+Jh**J#`!Kh{X 13 1+ J 1(h+?gh#+?aO0~ KhB?y(K"!qonr%r%%%Q%dr%$@TC%@r%H!fr%hFD]Fh3F(F8F0F4!D4 FJ+F!FF>8FlF3(I"FHHs%-CFGF"F;FD;F"F)DeEu&ICBA4 A#d"#]7 L2EE0@B! K22JKXChF]Mb@BK IhT "FXh`jBK"`(@ t% N%FK\`(@K$""$]pG t%8FM K*hB+h FZ*`p"K$8(@ x% t%KshK"`pND FFB-4Z4(F% N% t%D)-C FFF@BaAH Oy#02FKFF F FS `F--8F-#<!Fo˿-AFDppFF# 09F#F -(-0F-",!Fo-OFF FO O O :F;0 )٣a)أWBc#C#F`CK A)أ7 O0O1-OFFFO O %BF;0 )٣a)أWBszCFC5CA)أ7 O0-O%FFFFO BF;0 )٣a)أWBs#3C#FC5CA)أ7 O0-AF F$x F%(_^4;FXxn(+c(/d(%(Ns(x("Uk3FF ;CF "U iFhFzhFD #jFx FFF (CFFFFF fO`29F0F(FK FHEK"$ t% ( Ђ*KAս@8o!JpF 4 F3 4]@)F F]p@ ǽKh YO`K)F FhEDHKhR K44DhBp@޿"K`k t%`r%>%0@>%6% N%KJo]}7F F0)F F0@KxJ)FJF FN0@ũ8F F)F F5F Kh+޿K"`Q, F8 36% N%F'KQFFh+!Щ! "K!Fh!K:h"[ CBF4F0F2:H!)O4)n!wF ##F!FFB $(h (h2.` F(F2 r%8%5%ݩFh h2##`@ pG-OFFF(V_MFD"PKPDE pO3`+`&F"#FQF xѢA 2ҲEшBЙE!13B ,`3`#s`k`#KV#U# B 3+4+!F: "B"6  :  +!dp F9/ۘE3B#s!``) F#  /F"@ E"\E"@ F"23F*Fr%HpGB Kh8p@Kh8KhpGKh8@6%x% KpFh F K.2hOؿ"FCTp@6%x%Kp FhFKJ)hOOؿ#DD!Dؿ"ep@6%x%K!hK"rh@6%x% KphCBq Kh#BO0RoBThqXp3x%@6% KhB $32D*t0 x%K h9@6%K)phڋK$O6h9K&h<U1 [h??1` U1 [h??#pB1Dx%@6%NM2hkhB#,hhF! F2B!0h3hk`F(`^??S;D3B`p @6%x%K(h( BF8pG@6%F"YxX:)ء.)F?)\)љx)И2*pG:pGFpGpF* M+hFBF(1F(4"Fo*`"Up$x%Hu8F M??,+h;Bܽ8@4 Fy8@6% #jFhF] "iFhF]8Fx FP+ b;۲+DB"cxj+B+ b+#+`m+ t+ 4(` F8oO0oKhKr%8HKMhK;* F F p M(`ph`p`8yq%$x%lyD@-CFMx..`;'#xC+hBГHH :+8 %+'.+𪀍0 p?+ \+cx+𜀍0F# 0#VxF ظK ظBۀD FFtL,S(YYYYYYYYYYYYYYYYYYY)7EiQWWYYYYiYYYYYYY (hB  X@0 9Kh+4=6Kh5Id83Kh+?sC -Kh+?g??]0(Կ  2(KhZ???Ay(q9C?5m(q.LC(a(!Kh$x%(x%}HO%6%fr%6%#HBF6?tS(MMMMMM_MMMMMM MMMMMMMMMMMMM_yMM9MMOMMMMIMMM )h"B Fр+`"p??, #rCjKh(qfKfJhh E8a:0A??TP !n8aX(qNK8hLKhLKhKKhqHKhlEKheF@F1nq;KhXgP5BA*s(q8aH(wsFF??F F*sHFAF \-PFF?{BA*sqF F5 9 ()"" Hw HuKh*(tQHO%(r%@6%5%6%jKh8D@ Kh Khd -U K KXhXK"`r%q%$x%D@6%Kh D@FhhH %i-5`dBsh,vBs- FF FdBsDh,`%dBsۄh, (F`h h\hZPhB S``Y``` `!``#hZhB `S``L`` `!``F@h1# Fc`@pFDhcBv! p0!F0Fk#3kh&``[`l`ch0 hYa` p&,`-AFFF Fi&K`h%K``@h(< `F/B$#J`hXBXA@KBF1F`#F(F( `h1j#c`(FA )F``np:F!1(#1Oe`O0r%8%-AFh F^ iPBp 3PBrڰjBrh"jE|/ۚBj#EEW## MFŔfFBA۲hjBPBABPBEhCEEP8Fhp`Fa `a`#ka.`Ɣ)hѹia3iSQBB8F3i`F` a`5aKi+ hXhB hFBTi4 FHaPa"ZahBсB8Fmh+h"8FZa"h[hBJa ѽAJhBћhB8FhAxKhXhq@ h8 8%-CF FlT# GrE#hbhYBѱEZGs2CB#AiF@FEchZGs#  4P%-OؠFFFh+Y2h*VLO0i[/:!BO$a!*F9F*F9FI@000 y_9FO$b2h*Fl3hBB4 0"#2"F( F8%K""`ZapG8%FKh 1Mj>#bKh&b FM??5 FWd4;h;BO$N%8% C%@6%2K-Og??W-J h,KhQh #O޹&Kh %,F0;B(C2O F??FF@F[Es ۱??ІBw XFQF F%DF C%N%@6%pFh\ KDD  p`1 F14F8%HP%8F L 58@ $i!8@Hj[ b8%Hx%8F Fy 8H*F#Fd(#BA x%-OFF #K2h KhKh_YF FKhFKhBOrr 3OxFAF[FF??+: 2?? K3%F^F # Kh@ 2?? 8J՜BF{MںK4+Hȿ4 FYFĿ34B#SFF3H??K8+:_??FF33S??FF'6sV  B s 6 K ).SFF;hLFFO FHFQF'GFEKhk-mBoJFSFAF FYF(@6Kh39KhU 6Kh 55K5Jhh+l4I h)k+F*F1Kh+E)FFF 20FFKm-O(lH#"!2b(Zz KqV+JEE6%@6%r%r%(r%%r%$r%8%r%q%r%r%E*)+А)&hb"!HLEK{ iH00MFVFLFF??ЌB{ #B{p-i-l ; +TKh+ KqV 2F(X+H!*E% FBJ[YF`R#` Kv##FEv FYFS(PO Ku##F}Eu ڱE+K `"*K` 5E0h0e5 K# 7+!+! JFWCH7'FFR#` Kv8FAFEvکEO7F7x5FFO3x%q%HO% N%8F F H*F#F(#Bt(F!F8Tix%8F F H*F#F(2Bt(F!F8S]hB4FFx%FF#;`&Kh %K#??"LEt ۵??0ЖBu,F FHp F FHy(е??#BAڀj(/#;` Kh++Kj+Oppr%P%q%8%pFF +xKm,K"eK`p%i F F0j,F! #2F)F3F`a#( Fp@0RKm#a8% N%Km8  8%-OFKFF Fk[k(?`OEFv+F FCF&B3ѥK??䀸??ЀEx,(LKhC HxFFF??JIFBF5( #8FF6FO7 E|E|򿀌Buۀ}KhCBOpuӀeFFF??ЏBA9FBueډFFjOh&F&A&oF&F c# #JF F)F# CF( #?? Bs򢀲BAF#??ГEzڻzXFQFh#XFFQF??F Fe8KcZcO BsVzFFOs??Bu8'KhCBOru1eF KhC HxBuOpFڜBueFtFeFO F\F]FtFeF2O F\F]F,FF;O F\F]F5FFFFc#;h8%N%Xc(?\#F??FF?qE0!T??o^F F(FO1!FU 0"KbKh+ѽ@8%q%8!KFhbF M#"F(( Kh+ѫj  8O0L,8%q%L#iKh#`Hvh@8%r%<%-OFF  x+LGG8Lh{@ՒH!8FяHO9HF M+h+ЉKh l+h+ѣj#bW#bk(6и@O??F Ff#CF FnMF ##(<(lLmN#h2hC 1#b#h+3h+cKh+ ѸaKh>0F{+ F ѸYKh8@FkVKhF9`#FF F4??06B7O4%FE`@??FF(Ѻ?W8Kh+7Kh 8H!C&FF F??Ѹ&4F5F0FF F FO;#O2)FO3LFx#h+Kh+? { ?? ZF#h+ Kh+?B@E 8%q%pr%r%@6%r%1 IlJhC`Kh@ͻ15%r% ITJhC`Kh@a5%r% 6 I6 J!FhC`-Kh@5%r%FбI KI h+!I ! I@ 8F !F ! !F !F55%a5155-K-Ah,SСO`'! D}}(F)F )F !I  tK"`bNM/h3hCE+hB +hJ3s[`C K"` Kh#A %a5 N%6%@6% 6%hr%-CFKFFhHF0)FFFHFp3+] +@F9F! 琀%-A!F FFF0F!D|1F`m#wa F(F!Dh)Fam8 M,hB K""`8#hS``0i0 F0P@%-OFYMMhWIF0}.RLPF#` F2FOa8FFFx0Flh++hHF#`#c` M;x!+BF9FPFB(0 + +XFFx+F )!pqx+!FyFHFFkh`C``hh`3`ZZxx^*3FaEм ,$*O3!!pF\2])!pCx0a+[+\+TѐL[40 p!F3)K)J,Ihh[)ѣ.ɲ)GFcpFDF]cE 04FKJIhhFE0; F;n0 # p!F\BpF pB#0 pnpFؒ%В%RoS>SJ FpFhF F+""p0 JIHh hd4 F"F)Fp@޻ *26@hؒ%В%`S-GF>K I  %I CF FxJFAF0Fp1c(V1K1Fh0Kh/I"F+F |\,ZxU38Zpx[,[$[%x[,[,ؤ./ * [-<[+%F], Zp3--[-,B 8, e `O\)O: `,,2 `48H8 \ px0ҲH@hBjKhJjIhhB ,,8)P8 xp8)Q8\!p )YKXJ[Ihhm;+I+#0'p+"w+Mi+1h8)x+?o310\i28)DKBJGIhhWO #089389H 8 "8 ^Fh"+,/K-J3Ihh-89@;891h48I8)x S38)x T"4pBKJ"Ihh 310X28) )Q8x+ FKh [Or@ a F0?8IMxkjiSaԹ#xF%В%ؒ%BW1VTVVV&W%xjiSa1h;+?Z1 R;+ F&miMhQhaOp #haF@30 \+чKJIhh 8"HF)F\0KJIhh X8"AFK2hx0#320[ # FF.Fh ! {jKkJmIhhZ # FF.AЅB`KaJdIhhFcKh+1#T3 c hxѹ1hF;+?Z1 R;+}+?JKJJPIhh*h3`*` "!F%,"!(F.0+F#cU5 c ( x* !.nF"U! {&(h, !.`F x ( )h xT JD *hBD*`!TOH  +!Q JF @ )hBFPD(0@ x ]ؒ%В%pWWWXĊGX-G^$N!FO|`V[p4,Kh+ XCK`Kh0K`h;hHF:hi(FUF.%ؒ%h%%0%,%В%X8F F#`KTh``8AF "B`FJQh`CKS`AKphNmh (F(h1FF(Ch;C`+ ڶ2C !F F phZ`x F%-AFSLFF"j*8*\%(Fcj.3`bZh*,hFIcjb h CI{h%#c%bh!?J@H>M(>Ikhcj%c%hcej9F@F*Fj3b+ј #*ј n*a.j @3`cjjhcb4jcm:x#*Zxn*"a@F:F!*7 ce#pj3b#3`EFxB *+!:Fceej""b)hhBab?jpj3b.#p"ceBp%Yܒ%YLmchh Ch;C`+ڵRCСm hZ`x@ %-OFL Fm#hhkchI {BKJeX3eK"c#f#cfLMmCh;C`+ڵBСmImm\CF@"k I{&hZ`xmHE p` (;еnp0۱~H`}I k>耱zI k XyHxp4rHL #p0p4m@@EеFmH`!k(F#egHp##fbn#hڹ[h#`#h+hch c+8(!k ZK F ZIZK{#cfchxObOHdahMHOb\o"k NI{!kOb(P!kOb `H({FVF `{NBJSFOa(F(o(Fm@Eе8I(F e(?BB m Ch%fb(I ke( !kH#aK\#f瘱nD< + E ;F`n0F*Fj 3b @ %Y%%%YYYYYYF-> I"F zZ F @F. I"F zZ8F F.(I+F"F z8!ZF N F0h.)F# FnbF;F)FF0` FnX0h%])M)O&khB&Kh@>$Khh+5h.I"FF z| #*hsCX+6h!;h@hXI@h&F(OR#F!hF"F F;h!hF> 3 ]%%%RsFMF(h#I z4`+i" h libF2H( h^IF z p %2ZS-CFALAO2DF[ij2B AjbiDba"p&--\-Jx8h 0@0՘ \*&*Fij2B AjbiDba[i2aAF!"iOR Jh??R??i-j2*DB aj)DbiDba"iFR *F1Di*DF+D%hFBhFAiF*DFSBAAai a `/*F1F#c`D2D"e`ZU-OԲ#L0H!3#cKh-c#d. h¹h+@ހak!k@h(@k~.k~-hh*3h+@k~rhB++~=;>+R#!e Z Z Z Z Z Z\ Z Z ]'] Z Z Z Z Z_ Z_ Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z9\Ec\\ Z Z\]7] Z ZC] Ze_ Z_G`q``9c Z ZKccc ZEc"`+v_+ bk"!kph=8 +ph0PBPAk~xhh)UQh BO`"`"dD+ Ah k~B?<%hi~h*Zh0B0`*[h+#d h+ bk2F!k@hk~(?+@h0xBxA(lbhB! hYCZd# `fh #"h!sC(i6Px``f`%L%%В%#! 1h˹K(ihLKkhC ѐM!bk k+hk)h -xl+I(k+ek5&kj !0F#cA0Fbcc#yH%#xIvH"## tH#qIrH"#kK(ihd#kgOȑck:hiKB<#03 eHPxC80s# _I  (ѽ*0+0"!&C06B9hRH9h$ j9h f;h[KKh>h+8h.sFI"FF z, -?FP "!x O +8K6hB9h2Hv9h$ (9h &$CDF-FF-&Kh2FB9h&HPKBF!VDh+>F-BF8HjK9hhBHVF06HIK\8hL%%L%l%ht@\%RA{LZyZJOhB9h&H |K+{IhSEDx DvKkhC rN!bk k3hXk1h mH!  R#c4hIfH#"dH!(&k+![N!bk k3h*k+?1h Xk+ x !28F.F8kcc#c !bk8F0k# 2.?ccc>KkhC 9M!bk k+hk)h UlbhB! hYCZd `fh "#h!rCki'khjiRhB i %K $Ihzck9FHF#F(#aFkibk3к#i !@Ѐ#i!kHhz#ki8Fj#ihZ9D#A\%PZ%L%ؒ%VZ4%O KihVhBB ЮH#9Fhki8FjZ"i2BBPDO hF`ڝN H 00<Ϩ H<jaki[hcO!rk0k;hk9h 8oih(Z!}Jh C`BpyH9D#"#iO J1CDhF"9FHF#F(fR9FdHYBB2A!#Dh #"9FHF}( !k+;i3Or@ ah8a0kihKI zki iskBki"DIi(?~h+?f#`mi@k+]ki3 (iOr@ a6ha0*i hickB.I"hi(?>"m"*I#*H)N 0 <Ϯ 0<6Ɯk+ 4?J&kh*&f3xp(p71B*#"1F!%4%%l%L%Ċ3x0; 2DBҺ #"1Hp#"H"! R BE10FJ7BF!HRj(1O1S 0Dx0 h0<ǜΨ H<h x0h0vK Ih&m%%%Kh#"I#Hh`~{) Rih砂%l%pF FO6Bp#~w+{+s+ciiBD(cih I zbcia$h`iC4"ifa!h`i-CFFFF ,FBI z:#`@Kh`O>I8F \` Fj#i FG#k FGi+@F P1O ##X  2HFx*@&F&`3i*0B@3O F;FB2FF !0F#& _(0F$BFF #-omBBF 0 QI KhXFEݼݴDѠ %u@ DB"R!(>Z=I0 xIhQ8I8H#F"7KBF.&(^F,J  hE&>0(J)Ih2F'HSF iO  HhX5 BF  0E? ѣ Oc -Uh-um8DKF*FYFDXa> I;F QDB %t^h^ _J!7ZI@HO1i9iO1A#մ YFKF*F8DD bE4!jKhDv F!0D3BۚI i@S(F(2d(0<(EI *  u(PE аڰo|`D(/;K[h;OE`jO F@SB+x+0K[h;D>E60+?  [R#s"ri7x(c?a80Bi[??z(`(x(8 (8orD(?ɮS ]&hh&L_%d+?ɮR#uuu;uuuuuu]uuuu1ڰ?(?ͮ?<(->( ("C0hBo `p3D7D pB8FBֿ1ؿ OаBc@00ozwF.?@W&Ee#(FzhKp `ok[e FGB?^(вi7 j0iD" j@&biEDi@#aKiS'@>8FiXh *}i3D]`3@F?@FE@F@0h%KiS 0YpG%(KhBiS pG pG%-OFFF*$PB*F $ FD!Bm PPO U$()Ky.FFh.=320[ Ը 7I .F=E:>>.=320[bd-nT ѹRFIF8F<8FFBnb"D(VѸ*FO.ؿAFܿvv[Eȿ3FCF(;+Fi@IBF%F5F*b9F# F6!FPFC@PF? FDd(F? F?0D FCtF !KFhC 8"F F8@ F F@"F F6 FG sC@`F F8F0F8` F`@F0F@]`&%L   𵅰F F FS{9F*"F!c+F L-C 0FFFX F8F IF*"F!c+FLSK!F*F @pGI8MhBFhB" D8% d7hFLH =x%h}hFKIF(F h h##`L%h}hF8IF(F h h##` KhI H0<%N%@%h-O7IFF`5O*F!hFNȹ(FtA >jF!+IFF+H F)W 9FhF #H(`.0F~1FFF FDF( УD9FXF =*L9F F ID FJF!F&T@Ft  T#h {0Q# -O#M`F FF(?0FF 5 "AF(F(h #`9FhFfIFhFg~)FhFgzhFT( F(1BKPF`)00Fp Mh ``h)~(``hF  K*(F`K*RFKhKKh@| %,%HZ(H 5 Op(@@ NR-A -PM$O3+` F (A !F+h+8B*iF +݀Y!#]" F(@Ӏ F(@̀}Hg =3 F !F^ 0!F (,`6nMFf!F(h0(!F (h!0(!F cKh+ ! u B+h"$!(6F2*hX TI2 ~(j+h)A@(a#(\ (?rU!)F(LBp"6B(&B5/F.FB>$+OpB>ӷBS(F)_S)"BE$4U"B2Yk)"BE$4p3U"B2U& 0(F)4E6V h0G(kՃnczRnhR1 [h 4W g(%0=&%( FObF TIOb L Ob `HI `Ob> r (  ` iI#F"F DDDD!Fx a 2y: FObhF IObhFObiF Ob I  ` & `iF  ]2y0P$ C HK ` FJ CFP Fɲ(=L#h$*!P*kѓ)ѹOp0*`h0CG0#h$h0G#h$ 9(A(<$H+(7#H&F 'pK MhF*"F!F(hI`(h6(hFiF ñ#_"Z! ! `Hf HD HA)#0%&Q\&&0=P$C "K `   F F Fɲ$(#Kh*!$aFiF .S#`"!F F.m#0%&-OFOE 3x3FxF3 **O0F pO [E ZDD6  B5OL`D %)c Fx* * .Kh#F+*21 P#F)ЊB " F B $B5@5H`\(x+aF1 + Kh#F10IԑFBcc*ѻi :F)FG(?{3P,hC) UhPziS)Lh7hFL%hhFIF  h hZ##` 0IH `xI(FhFIF(F hh) J IF[ A%gw'pi KFh "FIF(Fp@ߺ KF %R<%7hF#L.%hhF IF(F h< h##` 0IH6F `XhFfIF(F h"Kh[hh)JIF[ \h) IF H D<%%'hsF5M F(h6!(hB(h=2F _!F ?@V U?4@ N!F ?@F1F!H54@~ H?a 5F(hA!"bC(hBF0IHX !4Grh(h7F F72(h?F F?" FFH~ FF@ Fp&h-OF-F F1 "1/01&#LI"F#`BKhFKh@RCFm(@f d*F!H41!(F<T ̬)yLCs)&)Fx2 h8sI h%`nL h@oI h##`lI8h@jIhxh 7 ;fH 6q" x ȱ :hF^H ##`FZKO0`}VK9F8h|9hSHRKPO`OOR#` 66C   C C T \Fė#YFOpF Z(m03.~'z $[" B "8FIFT$H"7$[, K h3SBF"Fh K `h uz%pt<%%:E-TB%X&4j,%>.Rh+WH@LFh)SIF F$#"(FB*OrB  yDKhBK$`> Kh J( I`0F&pPO6pJ<%}¾-OF'RK !F .@ZI"F u'-6)F !0F.F0F.5 FOAF(FI2FID3F@FI0FpB x%+@+*!:0+x'+5<*++/!PFF(@րPFF~F@FC XFL(@ȀT'0EPF(XFXI(F<7.5x-D'P@ >@.@E@@ƀ3hB@EH> >E?HCh;C`+򴀰<3hB(F>6 @0h50h<!0hAEf2 #pPF/#;F$B{.*?+ AFF(  FhE7(F(?ή DISFE+h4,.ht@&2 (0;(0(F@!8Hl_B@hE?f3hBѸ?LG@* (>@`Oh3`IE zC<>%F(6U H F(08FWФ('/ OpG0ð@Fx0c.!FF0H"hC0"[H^H"!FD%C%-GFhVO`FB# F#p_-и/-у k20#)F@F[#1) F+FJF4:hF!FFF"CFА"!(F I"(F/a*F1F FF F ,F FB%pM(FF@)FF 0˱) )D<.+(C`I@HI@pHpD%>A%C%𵱰/I "@0j"F*H*I "@0j"F%H!"F$CF*PI"FC   I FhF FMN1"OFHl1,F1)F"0F=F^"!F0FX!iB%%i`%B%8i(~%'-O6]DFX6 +WтJ© ( KhH~IH Z Bx'` F3x+PFDVE1,«hi(F(0F(/|сOrkH©`;F0o«# *shcIP v(bOpT(\#X6# IF0F1F|F(Fw#IFp0FSKh0DZi sOp")F04,ѧF F (F@ ( \23 R 6ROs82(F#"S,(10F(.,r! FO3! F(F(>-M rF B:%@u"FS1F#u S5O3U,FFOz t O3+`F )F+hX4 0F( 6]Kh `rX3C\T<%rhh B%4%D%b pOq"O 8FX I"8FF(𭀐I"8F(4ьKMF!A`@!J#A0hK@-JI[h E("A`"F0vyHA%1s+ ћ1l+tJ2h320YypH©|@()v "!NPfIC   aCs0@؀]LA]M"`ZI~ #"F)F F$IF FбTIQHRIOH퀱QILHXOIJH 0NIGH(@#:48KY% (? 0F(BI - 2U3H©|F(@9I쨿$(?5OrF$3J#x F1J#w F!F(\8# \8-@Ɓ@%J#y Fm,!J#z FdI쨿F(>/%fOFB}B%'hRi~%J VD%C%B%}%!HOA(? J# F\6+?J# F3IHF(?IF I FI FI FI FyJI F[7vJ F~I~I F}I F FzI yJzI (̮uKAvJOqDAsHOA%\X $%FnI Fb:4+fJ#FjI (hJA;F (AAAA'Op(VK XJ\IF(@R\8VJ C\8("QH'NH !#pKJ ("HH'}EH !#pAKx+\8C\8>J (":H'^0s7J ("1H'L.H !#p0+\8C\8(H!60 %h\8C\8%$^,FE%%<@=\gsB%~/%&C%(D%,MJ#} F\8ԛJ#| FKIx* F,YЛ:ĔJH< FsF F9żFF FW9  Fp  SF{IzH43( wI"wHvJ#{ F?+rI"8(pI":gJgHF< FFW  F7SF\I  JSOO;x+=XIXHFpWKh, !F< RIbQI(F`MJNIF0F0#KJ0FKI;x#5J0FHIHI  \0F 3+<,@Los@I ;2'4B%`%@<%h3C%P[}%jD%@ћ4c(L@F(I"H0C@F@n6W5CI 5JI 0 I )@ K@FIr0+HlFH03HbFHn X pX6`%% *B%D%(KiHpG}-C)}F F.HIFF(=є3+93pD# "q%K8FB[K![JpZIFH\8;VHRIUHxdTIF RI0F:4#PJ0FPI~ OIz\GEIF Fm:4+dCJ0FEI<:`@I \@IAH@F(5'>IF NKh0B\310[#F9JOq@FB$at(hkh0(`8sk` FWF'+~DjD3l*F:\ )FsO #O$& k|!F O3 ],Ӏ:Or`"ZJ`O2`"+H ` (# x # ` &1`FF `FO @ B s:OvP#K{K`oC"2:OvP#KqK`oC"2#!3&1 6:#O3CF DO6 D IF 8FQFO30U0X?iR#0rr#"O 2#~<*F3 3FTCF0FO30* P)0FS"`(8F,CqAOp9L\"F"5K`#""F7aα  OOU H  @%057F3q&: K T>F@"020FFKh*@"`oO6>!F0F<(x>Fq10F,1L# $p %& b&+K(hh0(@̀(? +?+h$!hR+hM!JCF48F,K"B`D B@ªOsM$#&F B5Kh+?hªOs$Kh/EK"!Fh#T }1(`0U (h""0"!FvHL/h 1Q$,"01(,48 1R8R#$)h1(1)\L $R ,10pF (LO,148 R $)? h\?EA !?O P O O  X!HFm>+h@F$1hJ[CS!m./KhP*h-I2Q H $1hh+h$1hFXhKF ! L PO : ;YF O30"0+@_d(?-$h0G$G%`%0%&%<%(( K@pGsXBXApG pGB-O L  O30##h*!*@𼁓)Q-@ЙJOa3 `I `"T`Op (𤁐I b !,H#hJOa3BlJHBFHK!\ B!F8F p"F}K h@h8hCE'p"Yh#Xahgk Ct/rj*o:h8F3OcxBkG(Y;hO "8FoBkFOcG;h"8Fx bkOcGcm!@++;+Fx+𸀳t+#m@̀*ȀAI c gF%w/nB*(tcn#5J!3I)I1Mcn#0J!mC!-Jb#nC!)Jbm+$J%I+ F$InlYI M Jm;"n*SCJ!tIMVIIPMI&|7RM>8vzGXTR9ZL9%(I'M(IE(I 'M'I>m&J'K'M)FF%I1!/&%#mAF##e9#m5-?24 F5B"F(FF(?%#F)B" ''b"l.% sV9-OM+h*aNHeIHFIF0FN7hG+hI3F8F|鄹 1hHL!F  FI(h)q/x0)F y|b4휩HFb0I FHFS`OH4>FER8F%xM+x!(FSvI FuI FtI F{+x#nJ FqIt#pH#Fj(@FjJBshJiI F[hHkgHhgHe+xeH`eH]dI F F  zYF(Fb8F%Opz!:FiF8F%.NI*F FF}Op  [ 0jhC j+km+k +m7hBa+hk x"#h#2OcxBFkG(CF# +~ km +X +\Q#9EEEEEmxl&~,;<%%5Wd4+f93+{O 8KFLIPF()mHIFlGH@FJGM2FH0FCH 0F?HFBF F:H0F5F FF 2I1F0I$%Kذ(F!IPFO KF5k `Ob K FIKkh[ +RBIcC FIHO pKFrO hKFl#j NJpR+B<aJQZu8RlTmR97L9-OF|M,@g,&̂UFU+AF64,ѪJI 6v!60F%]F0O4 F MԂLHB Hh`H6K(lcc H,,eTDO  ZIZF`IZFXKIZF;~Ka``H~Ia~K ;84vKDKA#2##Fh h$kh+Gkz+6 $8F ] A0,!$f X`(32h#F", `$)B@#3$!)hQ3B3 h0G4#BR$#jhBуj+kz $'R$jh0G4#B $0%hdFCz۹P4 @4`j[P3pB3BhF0G4Bؽ@$$&F$F'F%FshB F9F 3hjFS5IhhlG(FG50 cpG-CFFh F%F'OUxxOcG  #h bU1Fx FoOcG(I c @ hKXBXApGbJF PT!ڂpG%0 `pG hhg8F M0i(DXP0 10`a18%POFt peh/-!1-~ a0-`A %i41.nUuF`02140.55FeFC# `K0`# aKa𽨬%9Y0w}F F:OrFD ЉdETAD !LLAPAi#F IF(FA0)2BdF H"! "8 Fdp%`~p hNch1+E@pF0+ѣi4j1+ .8ch3D !B !4(FF%-OF }F!8FZ8nIc#:FlI :FO@JFE"F&CF bI# 0FB }eh 2F Ue(F8]a;+Sx+OI"0FF0F-"1Bݖ0 r +s0:F?Ia("F?F J[O(sE 4IObHF`,0HF56-I"-H^(,JhK h!*0 8'IO"@Fa^O0O# ; 9!HFTI:FhhICFht3`h3`+ \  -Ia#h:FhaMd@edA% %%8%z h LSh1+A@0+Fѓi201+#D2   F稬%-CF@BK*&& F>L >Ih9#+3'+"D %h9X]Hh9[]#D !B !5B #<1qL lP gD bT ]PaFH0FLFHFB8NFD8FHFB8NFT8FHFB8F8F8NF! K JB(7FF@@FC%K&i~%~c~ FiF88p@XBXA& OAJxI K"!H`KJKfK J!H K^H]ڿ ]%h%@%d%cA%%OApMdp9bhC#K"F#!30F$p KahA @0 p%~8H !F MvF(FC(FQI F F8@$=B?FR[)F" I*F p.I#F f$w0@pGVw O3( K J L` J!F HJ!FH @%a B%@%%MHiFx*萹 I*&%7FspEh$BI"F+FHH0h0 ŰF"F(F !(Fr#p1KhKx:DjQ I,E0I&%H }>H%=L"F Fp FJL7Khj#F6J!x | N"|!1HsZ/I j< q#H"+K !(FU)K #2 #"1#)F (Fq! H }O)FpbP0FO3p2(Fq! 0x:J!JH:"F  JN%&'W d1FH0iMxzX8F1Fȱ0FF@8F#lJ!xj| V1H|!"sOs Kp( i, F7 F@X %2Wd!F@< iF O3]iF O3]hFh#hXh"## 8FLch/+ !h)(F z84dJK( FFD%@%-O/IFЀ`,O-NȠO =Fİ(F"FQF HFH(82h[F I %O (KO F FKI"FS%@XF}(ѝ0Py+[D0a#0030 H8%Kh%B%i'%-OF-FF$L$!F0FF)#:F({$!0Fz@=FF,;3x+h1F(F`@0FlDEE_6K@G5J6H\   "a V+сE Z J ; $!6F "XF a F V*KEҤ1F(F"F,Db FZ#P)F`(F%$!XFF,p8F ~-AFFF!FF#FAF*8F{)F"F;FG(F# FA#𒺽-pC F-$!&oHO D " FaT V+хB p$! FFHS+]pGFHS+]pGٗ@o#@q F F' /puFIFF@r q}I}H_}I}L F`(& +;+=(x8 [OpSrInHAqI+) O3+DkO;x+jN3x+#x+gI `` `bxcI b#F(F c`I2F;F^Kh!\L@n ZSBwSA2F7O3dTH( =+ CJ9F0F7۹JHqQGJGK)FFIF vFF(F`@ =J8Kh2F!@m O3!3H' +3N3x+?X1O;x+?S#x+?O"I ``f `b(K bI(F%I c2F;F *(1F*FI !I b  `F(F`:&"J%l%n%dbU%D%M iFH!hF IjF M]M iFH!hF IjF M]sx%8% G+ #4 H $ N` z0F<IT ~ p >K|+H"|+K`HK`HK`HK`HK`H K`%& && && & F!F 9K@h%p#-P!}  V"3 ! # ZHعpCOVH"xRI"SH`RISH"\ }pOr! LM!"F2@A"L@AaC"&(ۄB?K@2!>J?H>I")i 8K"p O3B(?(@ )(I,H`|(*Kh+!n M%H@%N"$2`B\`t#!Cl 1@33O3 CF tm F Fq t!Qd%]@%A%%(%~=%h%8% -OFdðFF0qF0IH.h0FkF0FA#FDJ!`x!Ft20F۹,;Jh3` *F!!F F"0F"$(hGF( FC+JSh3S`XFkh+%I #ICF F0F0F"Jh3`I !F}I 0;Kh#I FjhKD !B !/Ji3aB%u&-U~(%%@%7FCh F+ + HJ#)F F#40JI2+ FR-Oװ@FHFpKhHdLPJ%N)FD  Sh/+S!`M#Ģ nh/.V8Fh+@ր!i"hB@р  zhL/@ـ1iI H 蹌H0 0BBІHH8I IH"hP3D 1+1%2+h+J  1+Dchh c9F(FI( 7=c``1kK!h;7j?)h#a ODaI"h`K 8 ** PK3D !B !ci3ca5U*$`iAFBF.FOi61+FZ<F,HV|,IFF F[\8F]<@FVf'IFF0F[P8F]02F#I F[H0F]( J)F FTFF F](F.IZtWPC ]LI" Fr8 IZ^(IZZ(VF], }D'p4bFL F8C I#O38J(FIF(X*I @JI8Fr8c J(FIhhO38#8dbtlvf@ L83#`F(K @dpmOc FF!-CF2F)F"0 Ѻvh FVp` mp FL PNF F'A "F1F(FXB yC ha`" ` h" |d FIzd@ M%OcF)FF-CF*FF;F0F iF F-ں` M FIedAh D#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕPlp" pO3 0pGo 0pGpLkP, ыk+#p+##,ыk+-N#" $#+Ѵ 2 #B+#V#1Bт灂 F3"+~p+P F !j +Ah#hhhkGb0#h hh[kGbjlhbbkZeke$* - pB) тB3 !B)!V!(F1")N!#!"Oq" ~Kk+ ыk+#pG+ ##+ + г ++#3###jF F h *!ac#hchhkGb0#h hh[kGbjlhbbkZeke  :*K"ac~# 00pGhp!-OFh!FF&Op hhBؠh"#h`hc`KhOƿh1FlG`ch$#BСhZEHEъl2 ѼJmE jBp"8F^c6p734%-OFNk FO YE ܵ0+ۙBݪiRgԽiO  hb *Z.BZ  Y.AY 'IB&IB&IBг0+#KB$jh+ѫi"h;DhCE hhaihnG(!p ih;D"kQZ"Z KB0F(Ѣlm#ehJEREIBѪ3e  A% s E y$ M' A h-OjFOFF;h 8`p#h_D;k.ջk3+єK6h#n\hniB8$FOpFJFCFI@8F-*hKBiDs C#s1.chBҹkO hhlG(*hxKPBѪi 0ѡhYD k@CS  iK h#:F#:F HFQF FCF :F  OA 9a r2 rhF[Dm +vsh+o(03OpZx00 qp0 @JBFx;Fh[DkOpIi-ll;Ii-ll_8Ii-ll5Ii-ll2Ii-ll/Ii-llZ,Ii-ll)IiCz&JBѫl30hP!+FS+hhdBFiiG+h "hhjSUFJB` %/ 9/ % v '/7<A% E -C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hY#hai*Fhho3FGh"İh F0GO1#Op"3# hh0G D𵋰Fl$"(F1B# S"#FO1{Kh#F)F+Zpl4'x'I F#+v+m#+e 20 R, F FF///#" "+v!F!FlmCeh0 F%Kl J !"O1 #Op3+F"`Ll`dXf(F 0v-C% F!!F(nOp8N8%` `@/a a@)#b b$-!+#Y#/+Q`7 5!Opj #QF3"+@O$-D `K@!JHP#"2 !JM 3"2#%"1#!FAF(F F! M EP ~Kk-C+F ыk+1Fi +++г +! !4F()O`FW !5(aE ˅Op} `@x a@s bOpnK"!F0#M 2J3"2# "#)1F(F F!pl9&  A -O F h%`h+Fp&(B-h!O O  #3!0Fh#h!h !8Fh-@P"F,#hhh0P"F,x#h8h#hhFXhF@@BFg,!+FA B EL ! @ P CM"hCJF #"(h"#"h0G?F/(h"QF"hlGO8 6dFė#$" % G ;B2G # F9F|g  SS D@ D8S(D D()hS D< D D2@O@F t X-OFӰFFF?ӲGӲ_G":" :_ :O<:): `!" N&O EJ$$#2F'(#@F DDG#)F0F+ FSF "F "*! 7[F6OK 8F^K!D|$D<8Fv= #F aORO3Oq~#-A F aklO@Zkeh9FBu9FOOzsCCBu#XCBuOS FA@MOCOC@Ci-AF FñhhmG+hihF@ *OD hB*?н*khp!h j`+h1`i h _wF (D1FN@q  E0#s K`ca3c# FA" 61D: ,c;4 -Oϰ FF"!(PFph/! WET0+ + ##3WEO3 Rj FHKh O#F@ =P `eFžžŞ @T0+ + 4žŞ pWEO# 0*F|HYj#B%FWE80HFlG(?@F `32 05HF0lGO2F hh 11  0"G(F #!###"#hFhkG"eOp "JF$ X @żŜO % #S%T8 T%t% 8TR-OFxFF+O0F "]nF#;p#xc+JM+@"M+1C+@G+++/#;pcx+(Fm+)"s+g+*BFKFO@!^acx+c+ M+O FS+ !*Ьm+ F"BFKFO*PFYF-OMhF! #m25(FJ ((#h FlG &h  Kh#BsF F F# *F0Gh+޲`Ҳ F@ FJ!`-@ a6J_+D!۲ [FNOpO E@KR h!{hF>S !qF=T !hFU !`F.L-A<SkI3F:F8F0F(F@F_K%h5 + s+FXK h#rYJ!-&+x+"RI*F#O1& "F#Bh)Fp(Bkx+@)x`)@ B#h0a9 FlG(062!F"###h F0GWk;CF"F3 DCv@F1FfEv jBAFVF2CCEFA8  JI\ a6J!_[FH( I\#F %GQ%WrLcI zaKh#F F]In16XKG0h#F F&SIZQKVh#F F8FMIL&7IK!h1ObF!UFF H7 I Fx I F@ @K` F0@, ؀4B%  @׿-A*L#h(a.K' h$*CF"AFiF  hx0Q##"#G(#h)$rRPBrR#h$h i@(( #h$h0G#h$a &h#p$B @ !@ Bh"Rm*3  pGsj$ Fp6hp#hFXhk+F2F!@(#h F0GF(Op!F pG wFб&M$&K!F&J/h$$H,`#H I"F H Kh,/`$ F<K!FJ0F,!KJ0FKJd!/`JF(I FOpz1F @%VR_n%% pGH@H| pG pG pG8F#Q۹ҹ@: F8@͹suy (3B## 8(Kh(  pG pG%KPhFh+M    O`\" #!" F#jFH OpJ"#% pG pG-CF\F F'Bcm+#~IFF$1h Kh+ O` #eOp#7p4%pPF F Z# N2 K(`" "0`p+C# @D,C $ ! %%F IFF8X1F("H:F(F!F@ſ%1H\ ]I p$"!F#jF!F@c0Op M K!F+`F ~*hkF^ I IjF @pId%]( 0-GFQ#0} Fh(F0T#08?NOra>HJ=IFB"F!쀻 F7L7H2F)F7 h4I3F*F h@90Na)H!F0hk+I*FF[ !F F9 }QFB&B (F)FFFHF^F(0=+BBJ!D|V F LZ h(IHIx h <%KDҧ'5RT#F0 FQ#0h0T#0NOraO8h0 I2F@8hd2F I Ht!F(F0 @9Nan<%xKpF F2#K#FhFPF,ж0@;U#0(Ѷ0OrU#0 a Op(Ѷ0 OrU#0ap K"`^ %-Cð$F F"!F FG)H!tF%H$O9iF y + Ѷ0OrU#0 aCIBFHpJI M(JIHI B;x#I:F ;!@M$HD0@;U#0d% & 1Nc%Opx8F Fe0J T#0ha8&R!0pFihiF0F#FIF(Fp@ٻo8F FH XI 0T#0 Ora 8Or{8 F0F Q#1c0I T#0i00OrT#0a 8  @@@I{-COr-F!,lmL%lO&F--9iK8hhsb(qeJ9F ;h(4cs(n`J  PU,HFZIJFF(F 4(F((F`b@=%dh02(Y@9#a5-6KJ ,KIPJHR@L&GFch+K+Dh65HKE<4(>K`@5!( F (?~a4|s2J9FF ]jFg-J +F POsOs(Ѿ#K$Lh;"F h=: h+ h;#@K2JF&!JF"!o2F}9FF[ Fl%&:c%d% &%&&T T <%-AF1HF/0I.NF(94h<@F!+IF F%HF&Hs(4 K#J Ht0h8*FI0h"I(FXF(F`@ /F HH`I*F F FTJF r<%6Fҧ,!!npG pG-O%,F FB ``.=-;1 DBt  C Ey Ew # C Ey t7BBt h.6`g Gg@@51Kh"0pG &-OFF Ey #MF FTFF*#gs#"#.w2F;F F)FtCsG2E;F F2F)FfeBu4F=F2IO Bu EHF 0FObsE5BA   E  K<K<3BE.FwsG2E;F F2F)F eBu4F=F\М *X *TS OC BBFBzAیBu2Bu 8Bs TJ.wsG2E;F F2F)FeBu=F4FBul4E eEBr   a0%##"#U#( (F)F 0rpGFBh I F@Tp FF/!(FzFH(F2FtFй5Djx`*ٴa:BaBp034O0"H0Zz * F("HF 0FM+h((`r#BA#-hhB##" F  gh B 4#+a\)3B 0 &#`FFFBܔK#`ppB,+$Op ` !tb!PBBt %`E%1h;` 532d8OrPF!0 #P`08-A$N'MV;! F, F)`F"*/`FFѽ%Kh H%`%-CFF FE0F*$+F"Fpp'B2B43Eܸ@a4 ؼkh J   Fih JkhJJF0K@QJH^@h F@8FMh WB# 2Bز8 J#3"+ K"h KhB (4Bx2F% & &-CFFF0'0'I F@ DM7hQ7I+:+ #;0a+I(F[#0#0#0C0 ++ ї(F0#KCI10(F7;B̿II$Xph,CT_w\8FM+h'$(`# IBs IBsڣh@"Ob#r#8" &@8-OOfq-FF$M PTF%Oc)Ft (,CF F $M_I0Z( F0FO1QEFu RF F\Fy!`  TX4%F'F+O+  e``` Fo0CE&0FX?IP (sд *)#XPBB+[37B܏0;h+` #0h3`5  +,1+01#1#0F# Fx"HF 0HFBFs C( 2Brڄ[b2 F:edA-OFVF Ofq F({OX"t 3+ #O0!FF 3+#O0!FPFcf#fSCfK#`jVcaV`` F IH"bZ #0 F9sh3`#0ЁFmFFF+Kg!JH mKh!JnKi!JCnKj!JnKk! J}CJh`haOȿOp Xph-OF Fh"F Ki i S ###X@BO9 7Y GYEw"- -r#UC0mG(F9F&g W g]bR B FFA2 WKErFFFF@ GKErڳ b 0'0O FCE ;JhBcӺ@{OX  h ٸI>*) O1[ jpjw D"kx[@ pD(0h3`2Br[b2HF*ѱZF B#1#F &-OF&KFF<h O3P+hQF(FlG8F  :SE؊O4O S8Ih0PFlG+h (F0FG(D (F)h"# b 2"0Gh# (F #"+h0GhC(CF+h (FlG" !#F3I2FKF FZF1FJf /#9WIq -C 'PŰk FhhoCj;D[h3;+ En*FkGOd*FkG#h"O1hj#hY hk*Fho3FGpFk0hKĕ#####0h" phlG(pFk0hK-lFĕ#0h0hho#G$bBBOq1 phjFlG(𵑰%F F.F hB-5џ#hhv#hFXhq*F!F@/ FwF(F#h1F FlG h* 5* ڛA####6-#h*?0#iF FGp#hh2#hFXh-*F!FOp#h09F FG%𵋰%F  F0FF8F K"O1g#S 3BFHc(F '-CD" FF! ! #@oF(}TLFŔ 4@Ŕ@F0lGHKPhTxO3FFC     h[kF FG7Kh Th#Bs *F#F#"0 G(J # 1F###Os""K"K6#2O3"#2AF0F~ # F0Fs0[ h0G0 !8Fh;3O0##$n&%Qo n  Fk#K hh0G@@0  Fǰ(0 h8hkGF@iYh"~&'#h"O1h3#h0s#hhlG0Fa G-GF FD"! #!00h[j HFHF(?:IP"X0P7HYj"F#B55Mĕ 0E0QF@FlG Os"(K1F&K6#2#JF#IAF 0F `32  F0Fp0s hB h@ G /q(8F O0h[ [$nax nQo n -OF-FhF0G#h FlGWKhTx/xO7FFF@!hkVF[ Fx F2"0 G(FwP C C ## ###hi[k* "!"G#h"0 FGCFR#h FlGF(J#hi*G F#G? ##(#hkG#h" F0G0)  #hE0 0# 8   # Fx#" VG(%(FO &K-OFh#(1+@ +h3K@AJHi.فJh\(FOJ#O~OxO FqJ>F"(O2)CF@IM$h 8 +hd @ O Xh 0hFph &J#! @FcO@B#!HFc|ȡ 1FOp  2s rHi0$1hh0$1hXhPO #C +h " $ & ( * 0+I"YHOq`!Y`@aUHYaUHh(Y22RI b@b#@u3133o O3UGF BCKb0F,0F+++@&7F,(FG(##z05K" O4 F-+h9F(FlGp2C !#h;+67hB~@ 38Kh)HZ(FF @+h0+!(FG\B\A&H%%Iq r 08n n  &o =n <%+?!(FUhO#hh0Kh@!Cb@!$ 0F|+OE&O$!(F((?(zaR hR4 Ch(FQ$m4 YhB0Fd 24B$$"&-O+հFOs K!O2h FF@! FF@@F}O HFU! F (@8FlK hS"+ 0BY+Nі(1+fO Pe,AR#d `E"qXO ".JKCS!B Fc FOpRFIO FG W @,=*5H@~J` C 0+0G( 3 rK hB-"O%FO6O 0LG O ,UFO6 6FOp(1D!O !SIHF ! Fc@od!GFXFFHF 0F #D 3D FYFFXXFO ! IFFXHF 1F  X0Fo F B+K@Q*J+H F#"AF23*F33#O3AFBR R#FEѺ F68F3@F0 -s?0F5TF[  & & o H-CMF FtH!/# 0\oIOb FX MxJx[FgJOaF F8!'/! Fw<@B"8BFx8/* F"Zp(ڳjh(FBOb1F FoӳZ?#&F0FFpC O(?ѳD>#`*@20F(*0/+ *OaBFF F*Ob FO0F(*Ob1FoOa Fmx(#x/+0 fx&v  FF*3;DDoFIOb Fo*Ob Fo}(F( ڳh(F`/(F F M>R'Op! F (  O F!Z "iFH ( Fx .t?@ B-OFFFtF(?иO&(Fvx0(Ft8FC+ I" FF(#FRFYF}0H73FIHFO7-GJmH"F@怜H(jH(e(@߀HObF((F($I( (@d(TF(чI(ObF `I( bIF I(ObF `{I( bvIF qI(tIF F(@qI(wnIF(FF(@kHObF `\bI(`_I bF(FF(@THzObF `DSI(G!F `VIF(@@%+@e(qң%CBCA #;08hhlGFF2YC^Cf3I2.D FKFBFPF1Ff#kD##c;0۱P [ chBAO Op E@΀#kC#cUEFNFPШBqFF#k [ chP!cC# mBfF 8FKPf`LO3 F2h)z#;%'%.'hDK ;PFhAKh,!<1YFFPF"(R#*s ##R @+>1I@F(8F E,IOp94Op E يk2S Jh0BE b C J`2J k4D#;0.B-v 00(h 3  k"c$%&R-CFFjShBgp&h~C#0!k(q ےYdhjJAh^hJ!hR\h[mM,?_JdD &!4h4Dj+H@g/WJ(!F P$h2DkY񓀓kZ=# # JI&"0(F)# AJ &!t7K@F!Fh#9J#k D5J(!X"~j$m@+JCF  УnOp\h&J#F`kh[o+h3Dh3Dm\@J(!CF F@$!XFkkJИG(+#q@#o%z) Feh#p&FFB9(E+O+ ^F, ZP!%J#F "H* L!H- BJF!hJF. 6KJ!H)hkԉk1#2 ++ P"F , %z(%Bh!-A2Fj(j5 ;NO FB=9HO@P"Z5"a3Ja@b2Jb1"c1Jc#hg2g hhCE$#OpE0 Fgj(ۡji oj /k2p50L"BlhjFAFlGHFGkX IhgFF3 ( -OF4FFFO p' E6ѹlp'qZ(a0IF:F30 Fxi1 x#"kih hb####ice+je8@ii D hjB6* Ѩi@x1HHk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  fK-Oh FF8F$i(th! XFeF(ZI #[E$5FOsO H0t@uO5"AF@GKA#2ZF##hF@FKEiqhj1 F(`qhOp b  h0v(Psh` DAFdrh!F  ZPZFIF FH # #cc_Ff8Ff3hcc0F[ 0sh3s`,O03PY8F8F &Wّ -CF FOp 0@W"O1+OkD/ #30 /+ "/#0eh'B?ij F(ahp'hq(bhP`!bsa:FE O5F"hFBcc"b "" Wch F3c`(Fh 0쀹Op!QFm(F|7%P-OFF#FFC &`   2Br ڵ iiI BB{ [b B p!```0KhOIO(roq'#Op B qj(Hm3oO3##K'!hO3E򐀳j+@,O WFh3hRE&l0FGp#E٢hZDk3tM1|(u0A 1mI#+:*@'3+#h Y˱E@p XC;k2:XYh2:PAY`!2A!-y'W 0ByE@PB<[a L#G Pp#SCFhC(DPP`p#hO3BDjVccPQmA3hmkGhhCDb!hhjCDBZm**kB cj+HhXhAPQCQ`hah , *B;F7#* IFPȱIFJH S)r T R"T "X *4%h&%R7jhBh 9FlG(h+++# 9Fj#Fa'l QF0FGh+ 2Br  [ BB{ #FQF0F9  e#E-yV2f#F"803W 0 3BU @G 0 2VfEW 0 E@p!ACxyX@hYB FOfE@.:E7!(q1p#hKD S 0 _C8h8FAF4hBzF}HjC p Z`chB8P;B7APQ#GFPC2 DBBq򡀫Brڧh W G BfF X 0yhzD A Ez 8k8RL Ez 1bhBhB@p a +FBDH0Q`q )s!#HS`;kH #;ckCc##ByG 0 G PEp pBBлk3 2S9kfF0p7F F_PB4 a D#Dp"H TC"FDDFhCDH``H -O%-FLhF(Fp& #B#-u(Dp!F(npFO p70E"ӤDPԧK$\CBTХK@]QJHP03nJk՛k35Sh0pBp" Fnc#k)գk3&ѧpO p4 p" Fhn.lhS8IhhlG0##W<[hEp4  p7`0!* @wKh;Ol&hlG BBO3 H$F0BpBG5p'e[e+X u T B2E # F)FJeJ 2+r JBrv[H0br` %Op 0By (`+ sO3 3.@ O 0E1 'Opp#sCk?0F6 XkJ[:FL(XFhlG0DkX2jFF-z ;B2]J #(FQFj -H ,F607?H0m۶4% pGD;kYkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504L3h0FlG FFA#0BJp"0k3t+kqjhY+rj 1h b0F2"0G(R##ihY#BqF F#3hjkGa"km!Fam#bmcb+nbknb3h0`a0FGCF#3hF"F0FlG+kcC +c#WG3J2GSFBF(F9F g 043t2[ BB sp#p k3@#k@𬀞@񭀣n+lZhEhS8Ihhl"G(S8 hh"G( h   bhX b2"0G(9,FĖ##)F"h0GFHH*FhlG#d D ;B2D #0F!F: d ' hRB   o" dhDXB2"0G(  05bhX+r h     b2"0G(9##ahX#BqF F#0jhkGacmam*bmjb"nbbnbha+?^j+?Z#mC"e"~*?RC#eMo h    [B3 fhDXC#"0G(xk3r#knщXbh)rh  +dhhBO5l)F.G5.BB0BB0ih'kjGacmam3bmsb#nbcnbpah0+u"1FGBF2F)FhlG0cccm[j+#mC"e"~C#e706B~#p O4BP$Op 0BP p$p2 [b2VF#CElp!0FiFp#F O1F BkO Op Ej' GE$p'0Be;P1FFG "3c0.!FXFlG(2!`.| Bk5Q)Qhq EwEicd4z300B@XQhCВk263cp3C(  kCKkB k  +hB Pp"  vk3h.9FlG0 72d0##3hb.##5ce6e7p4XFEcXJhC Ћk3Pp"4JpF$M(h% (h62j+`h!0bO6 Fb%KOqUKF#1 #c#FHP0jBbڠj(Fb p#!F00zjj0 V&ّ %-OFM-(h)1$a#.@X .@S(!3F1FF( 5(h#0Q##"#GF(+h$A+h"0FT#GF4F&FhB8)h@1<1@1V2HChR# V#V#(@5,O NO  ! `zJ#!`!vJ#8F`#h*hhO& O% 2 #hFXh ! [FPF+h #hh#hFXhZF! SF' YHt#hh#hXh" ##P" # #0IKO #$"`GJ!GHY`"aEJhYa"b(CJYb ٠j0"c?JYc # 3@u3@73o O3iCF V0Kb0F@0F.?+k+hTjV##0h0G.@vW!h@#EE@0 FG:F3F !F:F3F F)a4h&%p408  &  =#h 1F FlGP$%#h+  6 L&.:.h!F m#h F`lG"  FG( ####&#!'#FB=&BYO1F;#h F0GO0>1:F3F FGmh+?jfK@aeJfH# g!F#2F;F, 2F;FY !FFp3l!#bFfFE@#EF(h "({э |7j+QFF6p4 lkC dhlG(p# ^CC "hk@KFG"3Dld!jp6,3j,,Tm,(vۏBvh?ThF By 3p2p$ \ChDl8Gh C"hk`#G"#DmBe|!@F0"0#0$ 0g(?k #"3T3(RR_W 7FF&+l$jFinhlGH2F[B285B&` h #*s|+ pG pG-OFhF-FhFh i80F+83I*F0FOpFm+/J!\i@? (IF FOpim%IF#n+#J!Bi@A @B icnFn+J!.i@C n+J!"iOp#o+ J!i@E @F icoF \frvFOpFFu"FhF.3&4@LD)O`T# 40Vp8#*hsC"D lٱD3IDP 8*hIF BD2(@Ё@"YF8F)h@"8FAD68.+h#Dj+ ݌J1F~B@"+h#Dj+ ݅J!nB@"r+h#Dk+ ~J!^B@"b+hB #DwI3F(@FOaYOx+h#DCCDXBh)r@"!C<!XeJ+ n#y#&@"B*+hCl!#DCDX\J+ n#y#@"B+hC8!CD#DXRK*[FQJ@"B+hC|!#DCDXJJ+ n#y#@"B)h("D\RAJ!B@")h \R9J!B@"+hx"3C`#DX+ 0J!B@"Ox+h#DCdCDX+%J!@"B+hChCD#DX+ J!B@"+hx"3Cp#DX+5J!p) && .$+27B@"HOx+h#DCtCDX+:J!.@"B2+hCxCD#DX+ 2J!B@"+hx"!#D3`S3##&J@"B+h"IB#D 3D6 x .+h"#D_Q1Z`Fl&082B`R/C23&x2(qBxlB K/D4B }9@GQ -CǰF FNF@b@ '#FJ!IKF"F(F#*G "!!{ JCS!OH"_I"F dr<#YC-GFSF}dkWX;+π#L1sOpI"Fi F}Gʾ|1@Op3hx-чIT3h9F0FlGx1{S'0cxS@F  F yJ!F###F0#"9F20F"2#G(OpphI""1FdI"""R"ik#h+? xXI&`@Fh d0i;jS"9F&"QF,7EbjHI0F@ *!# ##FFi0F= F}Opi2F  F#h+Тh/I&{iv@  2F(F1 @ D###h+#lki@' IF F F}Gʽk!Jckh<#lFal$hlG#H## ~vFO#h+?t5J!`Y̠D W<["9FO膨"QF87E`Q/L#1 Fx1GEѸ!0F!a!J! @/ i;BF +#*sJ!"*!Fx"FOb##@##gUjd!@ FI:JrF!*##`# 3O3#cULd!@ FIpF5Mʰ F+hX @u! "!)"0(`0+J :@F(h!Fl Jp4#"CO1#@5 sj(@6$J! #"O1 F 3#[ {( {(`j,@7$#k0Ot##`O0npAMO3 F FkjX @u! "!("0"hb0 +^!BHNTZ.K"hj!FZ` p)K" +cb@! #iOtJ! #"O1 F 3# {( {(`ci@$i@$i@$#j Ot##`O0n%-OF$K%FhF (  +F J!XF>#"O1@F+F0HF5##3F:F (q YC0D1%%00Ű +&(06Cpdjv|1#"@G O1#??K1h#,!<OpO0 k[ c E0Kk[ Kc81#"@I #O1mX@J%'J!#"O1(F3#{({ `m\@K% n`OuKn[ Kfnh@M%nl@N% o[ȿ# gKo[ Kg &00 FŰ +K/7MUa #"SO1#@! #{/+ ")FPPJ!(F>(F$8 D{/+#s E01[ 11+AJt@" h,!<O01[ 11+ 1[ 1 1+1+$1u@#$(J!#"O1 F3#0{({(` 1+1+(1uO t 1+1+,1u@%$ 1+?~1+y01u@&$# `n&-OmNFF(FkIFTLO [ lEF ` $?Qh{OphimB 4F*FTI8F" @ hi1mBFC '1cIJDhGJ!(F@h@ idB"FF@ hi1mBF+ 3F1[ 1s 2J!F(FhOpidB 1K13$1!'J(Fh@ idB 1K13(1!J(Fh@ idB 1K13,1!J(Fh@ idB 1K1301! J(FhOpidB%%<-O#-F Fװ!J03`OO >h>H1FKhs̲̒03D[hkK/F6B8h(𰀐}1a3;hB@>`0F$P|h0G$}1 }aC #0x"3D2CQX)RCPQXBh)rI D!3JO6;h+BѸ7  #0 Dy1S %1@,"U (1O81""0;h[0Op;`OrAF x 3+fO1"(у}!1F1B11Y,O-L>hO<<i.@3:F!Q2B?Khs0)F F3`v7N  ά3h)F F0g,Khӱ@##6,K 0TF#ά3h)F F0I#Khs0)F F3`7POq0B P3I`@B PK`Kh+3W%0% & &t && 1 &`%! `Pi*O3 `+P`)1;#ca3<$q?hO #Fc$@hSE%lQFGջ ##$GF  +_+ݻ'"i3i$1) 6`#Ec09FXFlG(7 0Bؗ+i_+i+ `"/PcO02h-GxFtFF$O3`)hBOq #"nhF\iXB32DBCFRF!J`08a.<` 40%-CFDh,FiF&F'FPhjFTlGh#Bs ,FFX04,Elkj+ܫJIh+#+`(h FF;+<c3 c g d&jK-O}h# }M$(h D(+h!J#DhIFx*"IHKhI I O *h|I0F"DSi#xI0F,#)h !DP0+3ИX.F0 YDS0 #D 3F:Br M XFBNF=FO ct*IF Q0(I #DD#CRS#A(to< ] )0 ,($!I (0"#DZ`MV1D1 &0%-R D&ChFsl##` hJ0Ih+ H&":-OO3ǰFF% 0kKhTWF(9hKhȱhI*F|1#$ |Ah0G`]Kh^I"O4 FG$hi*O2O3G(h0G(NKh+hMN0h D2h JI"DkSkhjkkvh5H4-I:Kh(>I*F1h!D l+$(hOoIlF#G1h!D l$h"  o#IlG3h'I #Dh1ED3h#Dl!2!MF((h(?mIh F0(h(?cI"F]кQFHF(hl# 0O0%<%YC&&z%$1pF FF phBx1x1S%0FxADD%8 !Cx(PJ C $1I 0# K #3K K ]9 H&- h J+ IO2 K JKj]H& - 9 00X>J`k;+إhݱ1{#83@ 8(^#10K`0Kh0I*k#:*  ,0=!F 0!F $J $I2h2"K#J#K "J "I2h2 K J K F{J I2h2KJKK JIcih#KKo%&<%6d& Y (& &ͷ & = E %FL")FPK%`hCOI "MKyh0:qXhhBkD";P! 3jDJ" F -H3B>Kh+6=I "zFx:Ny1h0;Jh hB41'D"$#h7'7P#o8G3h,J+DP! 3uqoѽ$Kh"#I@`"K"zh0:A^hFhBa"#`mX`2,3BP!Jkj""0cBчO0&":&J &D&a&j&W-AF$AF,)h'HkOroDcI(F.(k@"oD" c# b$ #c# `O0<]D]U]L]FD"0 F!J##`bJ"cJbcJcOrchh"h2#o)hG)F Fp@$pv]<]b]F$FFFhjFlG$1*F1F hkGP$jF9Feh@#G pG0F-P!L#hhF $ iFFPP&hF;#h$P@a!O00#h"|!&k+hF F#c#J3!`h8h0G#c`$1- - JI "O10F$ +@h#!h3#1#o!hGJup OF0%$&h6&6#oG I Fx1S%x1C%`1+Ŀ31 p8F*I" F(I"F (C+h;l!:!X` I" FPI"F h+h4I" F`I"F +h+ }I" F@*hrI2#F t I"F n(8o":j-OOR-FN!PL] `fl+ЋO`;h+@[OP;hCOq 8`O8;h+@^,|O0+@GyK"O O`O1XaO|a `nK  1Ox a`gK`H X`1adIXa`;hJw 3Ha`PZI`S03ap0"`d a*FF'dOssFK1FR"EKEKK#2#@ SAF1`h+O0 ]Oa (@8`=H! (L8`IJq 8`(KG`"B2 a0F0Fqh+Kh+$1+Kh+Г|!jOp (!FR1n%& &&&d&(&H& &&] ݾ A &0%&D&& &FKh3"FI@P  &F p$a3F2F1FZF(fR##"# G(K$hR@BrR &k+K@mQJHh.-OF F%@W)@V*@Q+Eܽi+XKE ѣk+ѣhh{#{5SEѣk+ѣh|1[E F$1{CpFPM    Fȱj$Q">2$hikO2 FFYJ#|1`p((F(Fh)FhFl"iF F9hiFhF *FhFr(%-AF-PP$(*,.0F8O60F2($A#h F0G#hi" F"#GF@#h F0G$a4F#h FlGP     FFVXK "hCD8"G(P"!hgc F 3"c0G(# F # ##"#h0GBF#h F'>FO8lG!f2!F$$"(F$VhB/WFFE.K@Q-J.H#hk+G#h 1F FlG`BѸ?F76#h 9F FlGB BBѶ?>F7hBs! 2O2F(F+ J#|1`'O6<.%-G}FFFFJFa$F(dI2F a(bI@F&Fd(F(D]I*F@F>0ѭh+XHIFO0 }kk6j`j`+k#akkca#@0#bB0cbklbPR/{FI:F@F 0t@I*F@F0:@IJF a`>IMQF8"F F"F:I0FG*8I0FG 6I0FG4I0FG2I0FG~h"F0I0FB,?Gv.I00FGp"!8FHFz0' 0B BOЪ# (5D*#*#0^ "F a#( kd@edAkzd@^lkkClll'l:lOl-Am%OcFF)FF "CF*FF@FF FM0:`12(F mFO`pG-OFFE ,# uT:E; C "FPF+FYF k E{RF[F"F+FkBs7\bEsbFFx!Oii@1l a!ZEs B +k#1kEA@ F a9Ex#71 H C,ubF8E9C "F@F+FIF*i EyBFKF"F+F J EEIBADrEs 6Bs:EAZA,u8E9C "F@F+FIFi EyBFKF"F+FZEsi2Cj EzFFؐe0%##"#U#( (F)F 0k#pGB30pGD0+D0pG0%k#F (B05#lB C##d@,hEjB %jjCX@Bl"d 0 pG& L<'Bq##`36hhfhc%pF0K@aJHk=`hQ Fp@L0[`hA?`(F:5F6ІDFBh I F@vpFk%O5(FpD1F"( 1F(@5CFVK@JH8iFa H! aF(K`8FRX0+V #8#c3#dff# c`VD0`` FنD8 FkF# B@3hXjB jBCXD`" 8-OF1LFFcB[[F8 "QD 1I(F0F0 "Q6+I(F"F(!JF()!D(ph ` I(F I(F( ("TI(F D`"I(F(O9F F(+x+N0h()F#lrhC#d6j!0 #J(IQI"`LM!F QP  0)FxF+# D׉T#-O]$DFOc@h! r#ۨI 00FO9)k#FDD0+<Ѫk*3МI kh I ,X ] "0 hHh( C23?(CF 0#D0lkNlc ,k,k|O,@ (FKFhkh1F #p FEF# 9B%3@B1*F1 hh*F)-*#p(@B l   w*FFhXjB jBCXF"hF1FhFiFD1*F F -AFh&F3F20h+CATk ukBuF6  EkkEkBLkt ڸ @!"  EkkEkBTkt +`` FFFFĕeF#0 0F ##"###H%@(`O0hkB-@{ # BsO#LF -K+` F00*F!FC0 B(;i h3`2[b 20C03k+УB " 0$-AFkFF#F\B +i!@3Aȹ2 BBC! F$Kh;` B0#0"!F04:F#AF0#(0C02[b!a F!)FA+BBL04%pFhV#kFB ОB % K` p(F3P-0й#c04#)Ft(h;`2[B 20(FkFh  " FF(-OFKd]FhX ПK@JHKh+@KOqJEF_F&`` I2CUI(^ G <0k@08Px+Ю,3F F6 "!QC@,@̀6.&.wIfH-w+ s "!Qb +ѝ`0#kI"" "!QLFFO aI6H c[I(8G z +wTI "! tF(qD0`"1F^c#c 5PE0 [[  (EP# [0@ 0 3 0= k @nHF@(>P -I(7P +IF(J ((H! F#IFP0< I P|(+ sHF d]%D&T#[&iL5$0XQF0  0 0$050#D0Oc@0pFϹ=I(Fwt`#\C FF0F(FHF;hZk(F #[xhF?`2pb2;hk+@0I(F.(4FFCE0Ak(2kBBk*2kBB !F0Bc"4$P|d'Kh Kh8 & &{ {S{{zzSzzӈhJ ]ޚ-CFhF F ڈ z Zz ۉ0sxs+sxl+O&F"iF8Fdp#*F FCjF)F FD'F"iF@FHh#*F FB7/67.P-G 2 FFxPE #`,0.0〝00#r10cr20 00 7"I*F 6 5  3 1  . c ( ѝ0 00**+8ONF9F0#c˅  O0PpFpL&"F@!hF6hF4G. pP-OF8 zFF By&O P-X(ХMBMADqD BGлB?8DB> M EBF2FBtO  s0;PI RFF+ +*!ER@BN+J+4  B*Z BTٻѓF"Oq F(IFO H++%Ѕ+23# DC# n D<2D2## Fp@"!"O0U#1oU1 ,MO F-ACF=K@1F82B #111111111+h1F8^aq4Bѫi+J`BF2+2224+h43B(2+ѐ!-O,mFO !!FOc  O4 F ,mmI 0s@"!| Or!F 2K13^K@!^J^H u"h[&pkppqkqq25*ѶJU#O[OJ(&2Y 2FHFM(B,HFT6+P6+XFP&SCF,FF(@3E(FO(?hp1?ApXD8FF @3E(FO(?1hq?Aq0FF@FYF2F#)FHF 2F MFBBp Or(D<2F)FHFMxF(FOrBVE?wO4wd@.FR5K@ AJH)F9FFjCK@AJ Bq#V`4+F@ @0Ui-AWN G$EO6FEt qi ` B xc p D6E 4Jh` /&4%-OFFFFFΙ Ė4KB"2 #qFA\aEz3()8B,S2*K;`'8FD3B"+*" vFF4]\ ,FEF03+) БB /Op8`Fb t 2FC F#IFiBs4F# CpCEU3&1A\I )ИE36.BF Bu1*+O8AO   ơ2 )iB8F F HEo/?W2KS&!{#F2ƑD1  NE~ Ѐ C EyĀ2*  и#\) * 3+ K@Ta J H(1B| /?@$&p. (B y93ZFq;F!D `F(?Ю2ĂH  @EHFD"06D&0B1E!Kp"!(F2EO32A"\. (2*K@laJt+DADAEOAڨ/?fOsa .ˎ-O FFFFĕ{iJѫB O0!SB<ХJ$4 O4 K@JHLD2B#O5FF s\-F2* 4%+$+,ѸOsK0()SD41 ! +oc^Esp C BAahh C B s ڸ?qOs8BT F2 Q!D#RCB вBA By#Oq F(_Ѹ?BPKh!  CBpՁ!FBQ-=v"CF1F]@BB(FYF8ZDPF> tw#y{B?0*+"*@p4Bi @ |JU"!"!"+;#(FFCCF By8cC v 1F2CF]@B(FBB&ێ4%UB (FIFi By F2"D A1@B ue1vCF1F7]@B(F2B2E sOq 8FJU#1#1F22r-ٸ?)@n-ٸ? Ose1"BqF"2 D(&KEv$+v,# 4ZFF F1Ff\Ev\F&F#9DF@ BOq ڿcCs 44"qCFl <@B F:< *K p"!A^#\a BrPFD3+PF 1qB?zQ0q#U  - ЎB?i03+1 y"i 1Bp '?Q@ -AFFxFkN(H4 )F0F'(+,O0:FP!P# FtCF+"KO2h#RZEs FF"FQFXF*FkCEE@30BFFF@13h0F`!"d!*Fp#FGP@&-GFKFFFO<hRL5E8AOr`FFo-?, Cb#@2?$%BFF;`3hP@@j #BEs җ&MFM+h[3 ќI  +hCK+`(ВI MKh+J )!EJ;+{I@FIF]z A FYF( ^xJA1 q(D! {:#sd+d#FyKhtK*"-:Dh * qKqI (DqSmJ[ lJDkH#BFIFFB|+@#!q aJ0 Xf1Dhbh8t#as:@ ^@KA0 (q8 b۵ ]A0 Q0 d$ z/CSO"q,I 2 8Jd!q X)KD(qjJw; +{۵@Eq L%JO ~! % 3BR _+#d F4FFY@.A`&`&`&`&`&y9 l}`&^`&`&Q}",9N.z 5J9F(FD+ q0JD/K "FhCD*N&a]2A FYF],#KA0 ! p {jB?rOaa0FFJ9F(FXOaa0Fx| F pF$ FFF#FaB?aFB?`2bC``p+pFF FF&I'H5 Fj#AF3"!B1@! F0)"! FC"@! F0F!F(F"hK0I HpHH Fb>  F" F"sOsFF FB*F"K0IHOs)F2F FCF" K0IHp@ r@ 8FMO5LO3p1'0%J(F8F.O31 1 CF FFCF  F0 F O4 F)-GFm FF$ݧ7#`O0 mX&PFB o QF6LFB"FiFf$&FFFF:#`O0i\! FhhBFhB#h+2ñZ`bh`h`h1F(,Ѡh Fh+,*bB2F9Fh*ihca##`i&a2c``aKh> FH!@vL1pFSo@ES0+(#P1T1So@EU0+%#X1d1So@EY0+"#h1RulR->p+DP#L1;L1+DP#T1;T1+DP#d1;d1(F,52;2b.tb(F,5p2;p2pb.l`lb7F# FFFOF(:H1F! FD12N33@S,B@C,BS,B2C, FBS,BBC,)FBS,BC,S#N#0@_0) FFIHq"V(0Ч#`H!@)" K0IH@uE ) FF$I$Hq"(0Ч^#`Hj!@G1+ڧL7#||(#"1 KO0IH@9uG CoOrF!Q}0H"H *hF81!IVP03 F F033S< lKI FJ@+F7VLNp!FbI\#jF[FH"p1+^033FS< F@ T(FCF!@t13t1c+H!d"K!#f#G )7F F2I2H`#|DC*Hm%!j)F0@D(1D1B0|18\ "T_nHMQ-I n; f+X1 "K70I H0@!mZe "pːuE 8!F HCFѽ8@ I H)Fh0H)F F8@z|p FFFQ kH0I F3 Br K F-)FF"#FFz##b03 "r 81@?!p@pF<1FCS<1x1[hh#j11Q0C=CEUH PA\A ! Fhh#j Fdh-CFPqj44T<D#SD<T2X#C#D2qCCD0+3D&0 HF(F5FIF(F/AFjTI>H(< ((>(D9H)F(S(5J6I6H@=03H2JO1I.H0M+x+#+p81:F3F FAF#+p#JF%IHt#JF#I'Hl!J"IHf F{D!\1)FH1x JI HPxv"!O0e(m bp xa&08B$JQZF F$I$HN", AFH3!<1IH2,,O3,1( I# H<1H!FϯjFa!b#j3 F F@?-CFFF*xFF0#`O4jC JH{II F2S`h F$`T FxJ`O2iF\F;H!FFO4#`8h(U8FiF0F xIFFj# )H3cjkb> > ***> jF9F0F+j(F$2{`h`#c`x1Zh``"Z`#j%Fz`IFH F"# F-2+`h`z` !*@-C "FAOq0NIOH #%LH0Ob5OzqF(F\F)F@F7Ѧh7+Цh +:H)FW# FF01H  x1hݹ5h%0Fxp/R"BJє>p/%j-Tф>P**F1FAǹ"B+є>pB8-**F1FB(#j+<#9F*h AFFH)F<#0F[AFFH5F#j+H ;F'FjS>0#j+ф>P.Ю5FFl-OhFFIF F8I"@F OI FH00A F!FBI FF(𯀘I F(d0C0 S&60DB F F(ҀFO EG$1FHF LF0FNKFJ4`8FL@}J{KAAO6h81FCC81#x1h/[ "|(@x1h/n81#C81$&S*  F"FFHFD < # ;k( N(4(6($U(IIp( x( n(O I IYAQO $FF;j FPFS+8  E۱E "F9F BDh;jhPFS+8  E۱E"F9F@Fd081#C81O0 F0զf#` SXmзB T(FJF!FDx1? *P F$.5EU^$s(FS*0  E+P5R F*F[# [c H KDc`> F*> FD8p1pFFcHJF(p1tAt&p?J!?H vh+8I9H (6Hw$p>02H ]3hx1hll1+,HQ"1FF>0 dh%H @&Fl11F+""p#FF(C  "!,jDF IOr(F0I Hl1+?|$^X>aKh*hQ`X`pGa&hpG-CF FFF0&K@G%J&H{j#KOq JK@#Bѥ#`O0h`''`okg`<`lc4Fbʹع0KO$qJH{#eT0ʹع0K@!JH{#T0ʹع pG pG0K@1JH{ndCd ʹƒعPFFC 'K@# 0%K@Y1%J%H{L'$DDkB 2FiF *0O0 kS$0;>+٥#`4Z R( CB(<$DDkB k"S$04y^ ʹڒعX! /FH x0 F $ F"F#4B ?"a"FB(?b"FB0?#bc#es,=%hE+h.hRHh ЈB0jhZ``(F 5FBjhcZ`jh`Cпh;`b`b`l i#UU0hXj k#V0p@pG2+Z`Bh` N"a2+Z`Bh` Cb2+Z`Bh` 8bcO1F F@ *-CFFmN'T0۹3h;3`Xh#l+alGcK@AcJcH{Djh+ my F}h+h*A2cZ`jh`0G#+`ckk``ecb.#oB#KFmFU0lVp+5lKE"IF]h l"h2hh?QhkY`Qh `!i`Q` `"aF7ha`a0@ |HB ,U CF*FhlIjCF+5o4h+?i.h@B?\cmW0S0;YHB  5 BqX0G AqAa*-?)a&ʹعF HFIF |Bc4 FFh-AF#OmFF43OaCF2FHAF iFF F m4((@- ICFH2FF4BF1F(F $LohR]pGM FFFj3F*FOahhF8F IjFF FV` MlR]pG R]pG R`]pG R]pG RD]pG R]pG R(]pG Ru]pG R ]pGKpGLoK0 $pGLopmObiFhCF ( lN#`O4 F mpMI4dLo^KpGLo@L  4Խ@ ܻLo8FMOcH")F],4O % %Ր")F 4\V#`O08 Loh F 6 F E Fw h F@ JF O31CпO31 F@3pF FF!"hFt "hF+hIjFCн0C$ B I#(hjF0O0 $p iiCjFl3`022 C3pG pG-AF>PMV#O5`(F-٥7#">FF"rCF"=2ѝ0>0F#C0<#& F HQ> 1F FF(є> *1FXMh F dhhcpGh F 1dh#DFB +"*+ ,F$p FF>#/x+F" F( "1F(F(:!(FF(\oB0# !# "8c;`O0p3p")F!Kh.F;#Z1 R4#oB# "0F # c3px.+i+#oB0#! "`cO3cc O3c:+}h0 FF1$hd#`(Ff0$E ( F0i+dh𵇰hF F' h۱ah(FhSx+ai2 ich01!0F*F $hh(j#` iB@hx1hpGCj@hF"!hF "hF hI#jFC$~i-OٰF F#!Or OC uF8H1'8FY#0 Fo~0ѕH!8F i 0[x+gF(_عHQF$s~i+yҲ*"#+  *> 0D81%JB (Fm0"HQF++,йIRF  $$+# #(FK(d(FizsdD(FX0#P0lcd,b(F##k`{h`d`5}`@ۺ-AFF - i#\x!hDd#` FRzh* - -*FhF( ".052i%BD!DB,D#iBdhF0O0 I" 0I" 0O0 L04 %#F3S 2AҲ %D"0 !CS!"bC!S^!a"2CS^!A""CS)""C,0-AFF FF0H(FTAF{@0xF H F 1h"(F1\HH F 8F 3hFZ2`@#p`-AF FF x+#3`#` /!FFh1F(Fn>pH)FO0F! "@F# # " HAF$!F (1F(Fn(/#;p,0h & ` $-OFFFFF+x"+ 8<"+@ :5@/x'#;'#0UE~E$9F*x+F\*@Zx5x*/UEs1FE&7F$F+x\+Q,@5-)F F(F ѤO77#`8F,@E)F FF7F$3n (76666G666K]1FF,E6E#;E`", #DE$6FE+x\+jxx*{9F+F7FFm*0*Nb**,pѪEع7,иE##p #, #" 3Jhx 0 Ѝ xU0J 0+!UEӮ"dUE 6Eg+x\+;U  3" `F*FF20 ؓB F0+?l"!6,( F7F+g$(7Fm?'hXFxF2 + +pG+FpGXxCx + +pG?FpG-OFhFFFF(FHO=!|FP@IBF@H FO 5O Fn-IѪF F '@FF( "(F\.(U@*@"Z`8F E `8F6DF0F@  8F E #0U 01FDpU 0SD  U*p/=!8FBF!F8F(O @F.F(Hu 5pFh% i#jBi% fjUjB `j # 3p, `5, `5-OF1;FFF+m w   | ? + X +Zm=Fq % 9       M W a m w   4'-?(FF{ *F!([" 1[(N7 Z' @# 0FoFh$+Fh 4- #%40C0 )-40HmKhB !#*FFFG #1HCO0 {(#*F!F0x#I( o#1w@@y-0"p)F450C#0*Fp#!EѐIH!(.*юH4T<"##Dp40C#Cc0)lQI(FZ#l1I(FR#l1I(FHй#l1~ *Mwgżɼ)F8FF(?`p HV)FpxtN40C0E-41# 2>I(F(4# 23I(F(4 # 2(I(F(ФI(F 4 H)F!40#0 40CS0m0*F #!FFѐH40 S#cC#040CS0ݻ40#0ӻ40#c0ɻ40C30-<1?3vO:041F8FBFKFZ(ݬ0BF1FKF8FZ(Ϭ#P4S-<1?3xO 04gAF08FJF3FZ(JFAF3F8FZ(PO:JF3FAF8FZ(p43FJFAFZ}-B=!(F24H03I "F(FF4O0p#0#0 :F(@0#sC0 I "(FF4p:F(?I"(FF4p:FB.μҼ׼߼&3I"(FtI"(Fn`I"(Fh0I"(Fb([w4!)p")F8FFHO  :FF [0 #0 RFIFO0 #0F0=F(? 4  82F9F(?_pJF)FWI"(F(Bw4!p")F@ :F!0?b0FF(?[ O(P K4 8D2F9F(?pBF)Fq tI"(F(rI"(F/?? D"##" F8FI 4+?cH9FbI "(F`H)F幷0p)FR 1͹ *F(/!(FO3 4"1[~(?ש7 @#  'C` *Fg(©/!(FO3 4" 1[P(? 7 @#  'C`s-o40?iX*FpX^40CS0T40# C0HHù40C0;40#01ZSIFb|н40C 040# 02_@@!00##C0# 2RORC `C GsP0#S0#T0O3V0OS^0Ѹ4#0ʸ-ƀ<1?¨2#4S470'(? h+H)F-4$ U(F$(H-81 33S<ԱH?" F(F  I [`40C30d#*F!}( (Or(rcrH)FX40CC0B40#C0840#0.40C0$40#040C042#B"Cc2#-rHQF 40#C04{t#``-к$H4{t4{t4{tXHG-hUH?$ (4(FFQH)F?"p F (F I@ FFH)FpF0(FF#;:!(F~Fб" +o@!HF FI F1H0H=!(F^F,I(F F08FFF0&HԿFF&"I(F F(E8FFVFF(8HI(F Fh8FFtF(O6&<wLr¾۾(I(F Fp8FFKF:FHmI(F sFp8FFv6F%FHXI(F ^PFOщH)F&O  OЄKBфH&v1@H/@Ѐ}H)F|I(F .FFyI(F &FvvI(F FVsI(F FpI(F FfmI(F (kI(F FhI(F FeI(F FbI(F F _I(F F@\I(F F6xYI(F F&pVI(F FSI(F FFf^OI(F FLI(F FFNII(F F&FFI(F F&>CI(F Ff6@I(F FV.=I(F F&:H)FD!hz1,"Z(x1HN8F 8F-F#p*I(F YF8(FF(FV}+W@tAvl FyK+hB@kh+=  ,5EфFO %h#j"`,"3 36 @FJAFFF0F0! ܪ >;`7(F2Fк&`"-?H4P7#P740CC040#3040C#C 040##0-?(F@h2+~H)F⼃hh2Ѽ40C0Ǽ40##0-?(FF(#;F|I(Fp8WIHwI(Fd vI(F`DeGY.>qI0FT0oI0FN(~IC2S$e40Cs0t40#c0j42#BCs2#^40CS0T-?P0# 0*F!iCMHl4 >40C0440#0*40C@0 -??" F(F 4 H +>-H)F-??" F(F 4 H +>H)F-??" F(F 4 Hj +>ʫH)Fһ ` ˿%,E_-OLFF &FOY 0R@6n.<1H [j+Ѻ HOLD'BFj(F8O-OF FFF+G%K"`Q33S,S<yH<10FTJZFKHBFO ""J)F8Fh"FK(Fm22 p!A@ A2 FYPFO s$&r-AF F)4 1+W1+ax1+]"9F0F$   $ 0g47+Y0 8g<7+Y8 z@gD7+Y@ pHgL7+YH f( b(FA ] [ 1Y7(F R' M1Y7(F D'"F8FF(Km T"0F,6p47;470F,6f<7;<70F,6\D7;D70F,6RL7;L7-O=FF I gF(HO4O IU#BCcE##"-/#0O3`P7CP7N#[BUF"!F(F8F6cxBД90B(F!Fr Fh+С:h+HD FDFN#!F!F0F|B С #` H+ F"FPF(洚4Ěcq͚)F FF!F&v2FZ bBXSB"U*OH2@"r(K;!JHwbCx+С/#`  (KQ!J HwHCx+С/#`  ( K}! J Hw.Cxc+@h@ /#`  ( K! J HwCxS+@hCXBXAl/#` ( K! J HwCx[+@hKXBXAL/#` !"?-AFF F1K@{JHw"KOqJCx p$ +сyQC1FJ F0 F@yF"F8DA:3F"F)hxA00K@JHw!KOqJCxJxB xxB("F+ :#*("@DDպ#;pF(&K!&J'HwTCx+Ch+O1 ,"@:@B С#O4` Fp/#FN3x+P!FC C #0#3p(F K@'J0pB8a&FCx F+ #pN ")F D\7xG T/#`O0 F#3pBKOqJHw7p8a&N0 K@ J Hw!KOqJOs hC`\88LMT8(FhE-BF F$Ph050! P DDP1KO 1OhB%/K'/LO hB4 P" `V)h~F PH̳`O0W;;>+١#`4Y  Q@,CA@+١#`7Y  Q@,CA@<T0LP3FRtCFO4 F0@pG)F x0F FFjOV?  *F9F FCMFF F&B<K!J +*ѣBx*K!JHw6 {Bq"X({z<FC{B"`)C+Sg-O {FAFF,@qpH@F(3h81Y@;I:F F^008FIȐ>(I8F8F I8F2FI8F,FI8F&FI8F F`I8FF0I8F%+@ɀ3h81Zڀ FI3 Z<[LJJ 0l+JI+ FI F0𘀲l FI0𐀖P F}I0rj FzI00F wIF F0uЖP0soOr!Q0mI F0_Жx0+@3h8!PAȁcI3hx1@^I F0=ZFYFZF(@ӀF6!FXFx.0*DI8Fr(@ހZ<@\@OAJ Fx^ IHDHKII(FF Fk0 лDIF Fb0AHO4%2>I  FQ0;Kl*?(8I FD0!-?#@6 1+@Y Ff FYCF@R%H'J"'Ix F0^ 0+BhVNL!4w%1?JShqhk]XFF(?jBa"F~E T FxI 20?Q"YFtJ FrI0EqI8F(|oI8F(vmI8F(pkI8F|(jiI8Fv(?fI8Fn(`-?`K`J)FFF^I Fl0? \I:F Fd0?0F%(F>0h%(F?ABQI FM0?-? 0+?0+? FEI2F0?Ю F@I3!A06O:F5O3J8I F0ѵ3hx1hG%*2I F 0ѧ8F%(Fh F*I2F0? F%I!0ъ-9F F50? 1ZY*ѦO%CF@F(?k F'^-VNL4y8F h(FCF F8@)8FFF:*=lb"P$#lc $0۱Ziʱle1F(F0O4 ,(J (J ,( F( J1F(FO40$//$4NLpFIE<;NB Hp #`O0p"1F F4 Fkh FB0DFhF1AT1F:F(FAF:H F8I"8F8!F@!0H #;F6^BF(I)Hoa$.3i y0Fb06I H\6h(" F_0 Ѡ>h+IHH# O#I"FHE(OsBk I"FF H$ɛڛlFxxk$KF &F;F+Z[X#` &F *ѽB Њ Hch0F (@(ѠV#`O0(яBѠ"#|Qjx C   B)F+* FBDPHE٠7# F#O. 9D ;B@BE٠#O [FFFD,B ",+F+##p-OFF FFF%CB*뱻,ؠv7#`O0TKO X\YF\  (`(iF D8%@ЊB؟#`O08C% xLx1Fp@;Ly"F1hF xiFlF(Fpy.x1h#>0B*2F!F(mh !FEi!F(F(џl`h/#0 K@!J Hu!K@!J@ x/@Fh FFԟ>#`O0Cx+Ё)F1x+x:G0А"! Fh Fcg9FhZ#h Kx+ыyoC@ghX+kgx`e h8h0F"L9Fx+П#Ix`e(L-AFxFvuE5|2xEAFx29FD:xFF.8x2F!D |2 +D|2%O0PF F !F"D   C"9F 4I @@= ,ٟh7#`O4 F/ "F(F<i pG pG pG/J0FQhhz pFO00"%I" F3#OBOq#60IH1#@"Oq#$0IH #""!0 H"! (`0 IH0P^q8FQ(hCй(F3#x18@*8pF>`ư FBПO5#`(FFpOr!hF  "hFOClOS02F)FD`#hjFIOsh>> *FDl#hIjFOsh(iiF/`LT  ( 缥1 KOq J HuKh++P@B O0ܥCjFlCXBXApGQ FhBF#cgD#Q00PF" FhFM    jF IB + ")F FoCXBXA 0 8i(0PFT ["!C CP"!FI +0 :i-CF<]F1K@!JHuXKm#KO2qJK@!{JOb!8 F#pHF1p31caso`#`-F@hB`hC`FHFxsmXihC`hC `hC`h/Cso`oDCc`2#j"cC#b#cchP .]5xB Xh1FB ORXC X`*Fsmi"0-W=E5.Dh /N /F 5ǜhY 1F(F:F/K?G7=Dh F 5Ϭh 1F(FXo2F膳>F65D*"!FV0O0 <]Cv%IFlp(F:F/?G7=D''&<-C&FF"#Fb!#6"!0bD0F F/.F!F0FF(PF!0 џzh +(FO0,F.DBxB ҟf#`(FO0##DBӣh@/ "F8FF HW "$IF@FEHF#D5Fp FIiPF"hFQ kM     h-Os000h "i 0 I@#jF0Fp-Ii@ih%|2F CC#0C |2""!x2-C]6FObpA  (н BП#`O00+ѝ0++ˀ++w*<+6(FL0@뀟hV8O0+)*+:96սxF(н 9> :0Н0+ ajѐ" "nI0нX0bj FlBKx+++vKh #Zx* [h# #Zx* [h#P 4" C !FF     OsX0;hFI0}џh+Пh1+>I>H0+';"(F#Fx*0;+ O1 !(F ]*xHF(?[: d FJ8F F (?8@/ݮ:hB0+ͮ xjM N0 D F!Z#F0+Ѷii@ KF#!3 F+  pG+#`$`FV#` F+ F#` F$`6V#`FF+I"+O0pG -G%FF )FF"! F(;#``3I4H``0ܐ+FJF !QF5``0ўh+`hB%IjF0 нP-ѽ0cH`hCй F/$' " I`h n0I`hf0AF FG(I`hZ0 a`( F.@qB@lBpBfB@-OhFFFO#`eihM"i`h0CF+FhsD Fh2RJEFeFhai rDB- B hFYF(F!hB`YFJF0F,5iUD%DciaB!hC`?HF"O9!jFI]gBh-AFذF+("L5FŔ x"hш4(O3jF!8F,I#6#`O0X4("O31F,#8F"B0h%-O5P*PI iF @$P#"@h 0! FF@hh F@!Fw0O0! Fn0I`h00O0 ~B FVű.؞v#`  `(Fmx` hBٞd"#(F#;`BhhB9`3,1@pGpG8h!DB xD`@@C8F0[+D-OFF *؞"#DKB ОV#`O@F$F#F&F"FB  `+dAFFF˼Uмl QF, lBБ Eؼ4ѻxFE\DB!F#(DFAFFDZF+2Fў#`cSc FFF0[8+x #pO0 FFF0E8+h #`O0 FFF0/H+h ` O0@mShYhm#e@!nK h nO3#f03F$W F@8F0P33S<-Ր>0+)D&0ke#hx1h8B0YmkmB Rh>0+  H8@ 2 033S<ԓhe!pF F OqF0`X+ha K0#h+0#pOpp@B0 0cSc-OFŰFpFȰFUF3 ѭH O0E HOs: S<VOq KF(d0 `ñ*.h( B "JBћh ћh`#+p(0> kpS+ *p0#@R,h#k X q"?qgҀ(+TS,sh`jH $@D,IDB. .d9h0щhB @2C0$00#)@tF@5$p$DB..<0ӹ(1+@c#;`#-0;Op#F狱<0s,@B6#p#q<0 0.Ѩ+8##p#cp0KS BB 4.R.C.њ 5+M0+<Ш+@ 3##p#cp0+@rF7#;0" F2,3"RER:O 07,34'bE@t 5cF9GcSco 53B+#; %1 Fq2 5.D..GS<ը+@2##p#cp04D<}S(? S,  ҲќBМP  .ѡ:*DEp  ,3}2x,B&ТBFS( S,#Ҳ|BАPB .ѡ:*DE>  ,3V;0W0Ԩ+@'9##p#cp4 D$ 4˱Y 3B M#; $1 F 12\ 43D(1x3B=#;( F x2D(1x3D.@..􀮗W0Z:F!; 2F+(o!0BbpQ##pa 2PF Cp#p#q .y..CW03 2081Ի~՗Z0Ѩ*@"FP!cpF3 2˱3Bs:<#;1 " F 12 2.DOs@~+UQ#p#p# q4< #<S`6pI(p*"(1Zp(> 0>! A}jF*@#t FHHO0V#p] `FFi0/H.KBBAZBF!ѝh+&Hi '8F ] i H"FY(hBC!Fg(FJ H(h81E[ 5# #F0P F0`Hr"F>l,B8#F$ Fpx+pF(2F)F#U-OFɰFTI@FRFF(d(hZFQFF(mМ1F`F@EH0FIO_Or3Fi0FV6#RF[F(hv4# RF[F 5FU T0#0,0+A.@ѝ0-N=@#+JOq8F ,6H$ICF*FHF?hHxF(HIO$H~ICF*FFHF F~;hNdHjICF*F`HF NH\`^qe@csZ-OF$M F$NFUb FO, ,62B&p%B&F, ѽ0F V,XB3BѱFV ,Y,PFFHF5,6#T ,@FT,5F0F*-OFF؝#`) FB1F t(0 B O #DBҝ"#1F t 0O0*O!FZF\DHCFIFF0F`0T HQFF0FT0,*F M؝#` & FS (ћ(O hHz9FF(F.03)F+ t"F@Av0O0 M I(F0~#` t04^ 31]aS0[#h( +D(8D 0-OF+`h@p_0՗o0IF0h#FK IF0hy#F(НK+A؝ #`T0@$P0RIF0h#F(GC "E=0FF(U;  89F(4$B77W<0h0  oH~WNmt[ƭxm 9 -AF@F` "hJ(h+F"!A66V<%w! *^!F #(hAi;(Fcik`jG| F&H(F:F!(FD(h+F"!'Uh'`iwciV,Haiw#bR(Fi#3(FcbV#"b#F#A=AF(Fcfh0-OFpPFFi(<5 0#՜J{mH#2F!FxBFhPMO O8xB3Zh*Kl[@+(@#OzrdO`zsD F"(5 0yJzzH{zgjz {m#xB3Zh*mK{n+$*F F($<и?1cJP#h(^J \ " *" "*F  $0zNH  F 0p FMF(a2FQF0Z#kr>K"6ka(h(FE#+phOp*@#+r"!h(FOaOsBF*FkmwF(F6'&H K8h4+/1+#h81I FP h#F"!PFOxH (PFp hKF!7+8 zDCDCQybJ! Fp&P>`5 h#F"1Fh0 $7S : h1FK_2 r G1FF H F@sHC1FJJ A8 PFHh# F3d8@J!&a 8FP+h;+h#F J!-hjG: FH)# F+`=# Fd8@8m J! p PF1FHA1Fk*kH hJ#!+`#F#c Fd0p@32!a"2 .a J!5 FP`6h_# 3F F(C0H #h81T,I Fd@H6 F2F9FH#h812  H@9F F!G2F9F 2F9F(a F0K@!JHrL  #hf+` (ah F F#$| F@Gy !h0Ch0"*-CF` F hhiBrjBX0F(h3Y {ȀF:IFF&H~ hiIі@0 F)F" FKF!%#F"!I FdN2#C"#[ [C#h!(F h"!K%: 0Fh812>#F!Phih" F# F+`# F 0iZЛO*` FQF FH F 0@E8F0P3 FFȹ HI Fd8@ (aH F8@ 28Gy8 PF Hd Flh0 FCh0#d8@J! -CFph7X<@N233C23 ,FFѧHCI"KO0ѠIH<<1 23ѝI" 0(F0їH C@ &q"dh]fXc(FC7v2C(FCܽ33C. (Fh a3i2F(FyIFh BiX< X,r2CCi#3h*6$#i(F1F#@0ci1F((FFHF`a hJFx#i!ffah0Ch0(hhQK B#3h+E(FCBHX<#k3(hiNF(x?? "k arEv 4H h#3cb#cckDcckDc0KE0@,#h+p##`7dX<C (F/8H CXl?v3C`jF F H1 0cSc)AF0+?]h+?Y0KE2`jF FH(F(h+F2F!cX<2CД@ r K(h !G(FC7(hKbQ 9 8 0FP33S<Hh0Ch0# Fd8@H FI hiV|:@t#hc03qr C ]KpGbn"h0BI]Kd:-OF0PFFF# x+@HhkmBCF:F1F F'Oe> **z(#j+;7 cE85# 2F h;Fe0;#0 ?0"Fx;33FII e" ^"\" B2BF FHQ#Rh Bł30|H 'Ox+h+wI3F"Fx (+tI3F"Fx#O L pB:F h1FU@dI3F"Fx HP3+ѹR60X6#2F h;F0VI3F"Fx3FTI"F x$1F h:FF@F LHJ0F+h +#h81FI F^ hi" h!AK*m+m##+e'[<+<##F 0B"1F:F h06+7#3+[RԹ@3iO #I3F"F x:F h1FFH HF4V3i+h;3@3i;3@I3F"FxF4(:F^QM l#2F h;F8(+h3+!J+h+х@3ikb0kd#c3FDI"F xu+iBh8FF`( **XFXH IFRCFRF)F FEdh-OF FFFB DI DH+F O-! F*F-i'x@*dbz*a`B[.VBR T' $ RF½((B0DB?ӽ& O:h1F F"H2T'½0KhP #i"POS 0ʊ !PF(FFXFXE F H !DHF:簧p)`]F FmIHh#`hBBiF F0AF3hCH  I(F ]phiF(F1`.m,l-A"hh!F AHuh- xhE` *FAF H0+1h;*FAm+1h;*FAɧ0!]PF FO PX`` C   a` X`` Ba`O0YaIHZ0n "FC H= !] 0 F֧ FFh F!8F@|ie`ibh_([ FX,hx1h K jO32BеO324#38 h*[h7FP50j000>1(R<,C#B<#+ +Rz  F Hgjz S0++ hK*F!0zD  8FP#Fh!JEh0+ h!8@μ8 -GFMi@̱!h(cnB  gH(F#(FdIcf<(F0F(ѳiZY)h˱ihBE FWH033S<w/(F*hN23C bjhBєh#(Fffh0 3 *0r"#h ++(F(FC033S<s;C(F+(&Cici acia+?}kj$'O F/'BD  Bbi0i2Fx)њ2@*ٛn #`7/ K!(hdl(FIYx1 Dpq1:RmpG#Zز@FB F*pFٛ6#`O0p&F`!=dB*F"@rBU0FF(@CO `@@O#oCF#OsXhHh hBhhB0hJI Fh@Bhx1h F" F(dhx1h F h[h hhb@h"Bhx1h F h[h hib@h"BhHh0+@n8 pG pG00O0pG8 pGYiBi*Гh0h0ћK BрO0pGh0hЀ@pG@@pG pGXBXApGcScx1-GhF0  4#jpbj AF*F)F0FpF(@܀dh;h+їh0+{n3KOqJHqAF{nh FF znoCg2@{nh#)F90<"F00&("FO 00F-Scj%00 FyF(#yn81ynX1|)F F;F"FF(?b)F$oynXxXCXgW)F0FB1(FL8( hF(?f")FT!FHFIF|)F"00F!F0Dkx+ (F8 PFFF0F~FxBQF8F?8< $B")F+  ЙB"9F瑹hBC,PF<" F+H FF(?Co<CCgiFO3iF8# Fvdg11X"!0FFHIF0FXIFME9F0F"!F(9FBY3Ȑ?z0`j3S,hBC,PF<"N FH#cT pF0+K@!*J+HpAi )H 1:)F ;CFњfh1+Кbh+К\h+ КXh+iiJH 1_ki hܱhhB#hhhBaiPah{Y`bh F`5knB#h0kf0FpQ`F8Wl8F@L dF H F8#0-GFFFFF8?H$ F10 hHh;hhB!` F"9F(FF(M4 #F(;hEa`#a#a 0`0#a8h EFoJ F!PFbkjKMFE|+FRF9FHi!F j0њh+ IHi Fi#i##`shc``t`ErF@0 aiA3OP3S,S<RSBBДh0;`n(h!l(F&0F(h!$"gn1F4رhjBijB  "H1F"(FFH 8k(1F(F#k,( h+п0"Xfh ?hcjBF8Fu#!h0ff(h#h+ѡl(FH(hh0 hpGiBa-OFFFVFJx0#`F(F#")F8FF"и(2hhB!*`Q`ch`+h;3!F UF FO޻б3h+BѹC0#ai#a+h;3!F O24 F(HOl*hGa`2h`"a` B``3h`(hEF0h F J! ~hBѸ0-GFh O Աi'h.hx! RF4CF0F3#3 xh`0'(`0 #`O0p#`Kh#xF p40p#x:+bF;+^1`v\+x310[:+,F@a&hpF :(NxF_3B ,:*ДBBxC@*F -@,:* :,p(FK`pG`spFFN/F *|(:(pBFB k+2:*|*FO0-O4M\4!++dєL&h.`X0F(Xdh`FP. #`o8F 4M41F,D?cKh/dF'I="(Fn(YFxF32:*FO<\4 3 F(ڀ?À@F;_FO`)F(c#((FO7!+)#"#t 'FFF,FE(ObQFZ"+ZКh(F`k"OLg#  VF; +/Y<'o:++O \++ + +O ':+ѹLF;BY(Fad(F+?&6!FF'CDF#O2 O"p+x+#+?~X(F(v4 ;FT(а? 5F:#'=@a&`sFxF3:*ћF  <:+:# 0  B*@F De)F@F9o / #`DDDFB 1F (F=JFYFPF DEFaK`B(F(FoF`qon## FO3=]Lh#` a``a@a&-GmaL#FF#i!ahsx&p#h+6Тh*3"`o' e&F;/*lhXF(@h(@ щ`.p\#iEIh~`(O0 mhXFйh(Ѓ@щ#i`"a]h(FQF(F~`(Dl*faxDE1@:(#(ai1<\+#ca,\*"ba:*#*pkpoF+"@FpO3:F}F+=h\*?o+gDla|*:*+@a&h8F F)F F8@'F="F(d (@𫀚 #`o F^+cx:++:pyь0Fd(n0F\+cx:+o+mУ0 4#˼B0 З0 ۲T+1A+٣B, \$% I ] E = ] ] ] ] ] ] ] 9 ] ] ] A ] M #b_ّ # # ##:# #Fd"FFd#/A:*в+O4p(F8` #`o F;p L(Fd(FFd#FO4pF#"Xx0+CxX+00$$8"0޲ .١a+ءWB 2 $A+ء7 *`pO0#L`h#`p IH~``8 Xa&-CFCLFF#hk JybhOa>Hpz0 ##`  !HF됹`hCh;C`+ډ (0hZ`x +AFhFp(-&1F|(AFhFpAF,hFp( "p(x+0B+K"F47Gtx,(  pC+"BJ" ` (* F pC+Xa&d&`a&*K[h;"FFe(HF( Xa&h&F:K 8GXa& 8%L`h%`e`8Xa&F "F! 0K87F ,HXa&h&8+FO*` Ȅ ,`8 F !F" K87F ,HXa&h&-OFFFFȿ`O̿OO8m0@F4`hBh [(QF(LE!FIFB LEE$0O8U B0 pG pGpGpG pG pG-GF-FTOFF;h8cPDzhPFp@ #;`  !PFfꐹxhCh;C`+ډ (0hZ`x +#FAF hF p8 `-&1F(AFhFp,AF``hFp(( "p`(x+Ѡ`EAFhFp( "pJ(x+`hFIpa(IhFp(IhFp(IhFpa(?|IhFp b(?t IhFp`b(?l:!(e lh&-*#L`h#`p IH~``8 h&- K[h L"OcFF0 80( h&h&F KFFF[h["+FFFgH %`(  `h&FK 8Dh& 8%L`h%`2e`8h&-AF FFF #F*F! gK84F P @h&JOc0] h&-AF FFFD #F)F" gK84F P @h&JOc0] h&8@P@@@ @@0pG-A4F N# u(F !'F09+F% +O8F̄MhhpGHiSipGpG-O FFAFG@?F@D&WKOz hZhFAFDCA9FCD QӢB ӴOغ_=#cC ?XFiFFFl&FFFFR9FF "0FJ1FF (FB)FF  F:!F@F O30F FA Cc"BFܱB)F0љx@"h\xKhKIGKz x#F0ds@l&-AFNh3б3i( 3iwi@FB8GD8FB` TF0 i"FD$!FF(Dl&8? M$?i*j#DBiDa8 F( l&𵇰FM$0+DLEKEH&hFFG&hAKCJCIDHG&CJCK%)FAIBJ/z( F@HAI&h/F?HG*>J?K))F=I=J(p( F;HFF(#0'm&/A9*t ssssss&s,6ssss?GsTs_esksqssssssssssss"s(.ssss;AsNs[asgsm##r##&0##%0#lkh2B;k`kh+3#$0#h+;`lh:B3h+;`lh:B3#'0##(0y##)0s##*0m#0# 0KQFG]l&Ods`:pN$0;H}F:M&h2BO`@hfe`cc@cl#cA9!dYe@e#jhi@ca"fY#bf!a2*B"f1fn@c`'0CH "#3I&H Ig`H j`F`d  Mj1FF(`(#H0 U& dsP@m&Xm&KH0 pGl&K h pGl&-AF4LFoB70B3 X0BѪBpBN0B hBр`"1F(Fv'BF(`cia@FciD1F(F0љh@"iFh[hKhKjFIG#z hciBF(ci`aHAl&ds@Xm&-GF9OFF=il @#i@"#aO3D  0 0&0" nB 030Da`{nBO jHiDaVaciiB !F@Fni!F@Fca:iB#ia{h!F0\&0K,yi,@yi FGl&0$BKlD0v44l&KpiB l@.j&DBЛ@DhXipi@l2il&Jpil  @@@"iuBeO4 D0Da bTiDap2l&-AF_O;iB lCh@% /DB{У@Dh!BFZ! F2{j2Ѹ%FKD00@*iC !P+a@i Cakii3kaB-:hB##;`i)F0FAO1K#/03 ,KO0CCX AF+8)F`+9hB=`BKi+8 8)FAeP@*FZ!"*F!FlZFFl.%0#"iZ!h 0@#`l&0-CF>MkiBki3DB*n1F F(Hh3/$ F"F F/"9FHFh9FFHF0p;`oB0B F"1FFGF +i@FB<F`Bo ٣S@  ј%0+ЬB*8Z!7 )|0B0B!  O2HFF/H`0" 8FSFCF&HIFN FFh0B?o*Fp IFH<%0[B Ҫ0Z!D.c*0+ЬBbp! #`h)0+KhKIFG FF瀯ds@m&o l&F K'0CH "#3, F@6l&ܹpGpGpGHpGtsHpGtsK0h3pGhK0h3pGhK0h3ppGhK0h3pGhK0h3pGhK0h3pGhK0h3pGhK0h3`pGhK0h3 pGhK0h3@pGhK0h3pGhK0h3ppGh9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpGĊ;hF;+`ڌiB (]K h\ `p]KpGipFN$V4(F Fp4 , ԩK +K[hG pGԩF0 S pG0pG(h9!HBpGXK0h30o O0 pGh@FFR;BpGFpGF FK0h3pGdK0h3pG`7Fx M K*Fh@I+F"FH|0L%Fn h(9 xH+ pG pGHpGsJK3( FFpG 0;+AA- 3,۲ ٚBГBO0 , 2ҲB+F0-OhF3hCs`,q(FO #"!&qh B  X( 9"0DD 4"FPF DD ` ;ѹ і.` 3 -6$`O0.9,7KFXhB4`3,-$`#\C Y ++$02lкB@F(:F@-OEҗ #`1k-*`$KhBKhS HpGl\ KhBKhS HpG YP pGpG pG F H I FmHh IFH|I n@Hh bR]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBЗ#` I)F`J!Fh 'EhFhBӹh "` J"x46@d(T`x10: (hlm&FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00X]h;iP!0xCC@! pGh`K3pGlm&8FCi FB "iOF( F !F8 hpFFFS2Bңi5C"iYaB#Pp3#S(K}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhFi i$HP&`S/B2`jB2bBѢikR:D#iQ-AFZSBF FSA'0ip0iF FG2BҔtu(F)4YB7x\*CZx|*@0iF FGhKiBѣh #`t0+u 1R"B0XB`x\(]Xx|(Z32#`x|*xBoiF FG3)YBxB[xBBx|(632#`*=*7ѝ0+3c Fi DOAA3OAi Fi FSRi"OA F3\Z*ѝ *ЙB! F+  FiRiOA Flm&UiFFAi)DXi#ii+Da8F-AF FFFhiû/$ݷ.󮀰F#3D+(+++)Y.ݶ@)F F?FFOݸ &&F#FFa2+FROA FCF" FiOA FRBi)F FR"OA F6i" F9"OA FA(V+FrOA F8iiOA FRi)F FR"OA F i" F9"OA Fi2F FGhiF+'2OAR+F F6iOARFF)F F.?>FHFFi F!AF&N FF3h+#OsB-#@\ CTkK52hh*!Oq30B#@"\C#TKh30B#@b\CcTj"j1N$ 8F !@pjbZb PĊd`-AFs*hBPBxB Tx], N ,8x(`!(FA "F9F@F8@FB0y6!s#BFӃh #`K31BґBx[)Yx.)3 F#`2B ӣh #` K3"`xYBx.*Zx]*3#`lm& HJh0')б` pG pGFpGhpFN$V4)Fr4 p , Ⱦ)KS<GFpGȾF(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(6Ċd`-OFhBhOkB"I(FFPOA Fa#h3#`"|I(FFO A#j@"hh1N( ! FO##j@"h`i`!(F#jiD#c2Bx^)3#`#c#hB x]*3)F F#`C-*\Nt1Bx]* XB-*@ׁ[x]+ `)F F(2BXh+KK3U-*@ȁ ! F3#`Bأh #`f#hx-+]+ѣh #`f;Kh"hBx300 W/ ! F#Bӣh #`f2BHYBEx:*BZx]*?3#`2"`:F '|F(l FQF)F F70:+#OsBij"(j1N !kj(bZjb h #`fM  lm&hĊ3#`Bأh #`f#hx-+]+ѣh #`f=! F)FF Fb#Bӣh #`f2B YBx=*Zx]*?xh+#x-*@ZB@Yx])"`-& FFWE0+5WEݣh #`f0+#OsB ںE׮:F7)F F?3#`Eɮik"(k1Nf !kk(c #p3kcQF8F(ݣh #`SK3O YF8F{( QFXFu()F F  эZ"`x]+h+:k>#jiBkxCkp;K Fh/8+9*j+Ckk+@kj+=k+:ѫj?4AF FY#jjg(k@>(j7D@"!(FB"jh;`#`W i\A B2F0#jO@Q FhO0[*Zx:*?@=*?Ϯ F1BF:F)F FBlm&Ċj FpFi(KI h1!I h10Be F#`]#0#0 c` se pIOQ F p@۹hd`-CFi `\ и[@HVB+xChBӃh #`K3"h@)S#`xBxE𶀸Dڸn"jOA Fl]d -*Fb2B YBx\*[x)+)"\! F -OA Fid*Fo6BtZBqx\*nZx)*kѝ%`BUٛx^3ܸ"ڸ"Vt<+_Т0O`Q F*FDVVt, F1*FOA F6#j"Zdq/Тh"o(Q!@{E ! FZ#jifh#` c`[KBV@ O Q>"OA F"O Ah #`KK3!! F ih"+ #`@Kh3* FVB$XBXA0*+"Ѣi;F F52OA%`i FOAi F;F2OAiOA FkB+x\+kx{+5 F%`1BF0x,*-Z"`B1J[xh320Z) FBFݢh "` J"*F9F F2BYBx\)Yx})3#`S+Flm&^ ]hOs!`#hB YBx\([x}+ ! F!6h #`K3ܸ*?K.?hGlm&h^`Fxi?)πء$ڲ * +^) [)Ҁ\)Ҁh+ {)|)!ChBӃh #`K3"jOA Fl^d .2Fb2Bx)+o)! FE .OA Fid2F2Bӣh+FБK3Z"`x)+!0Bx*.@?*@3#`1hK*53i+FOA F2RiOA FRi)F FR\"OA Fi" F9P"OA#`! FP"OQi#j!jBbZj2Zb"OQZ#jjBbj2b !ji Gh` C`UKgO Q F8ChBӃh #`IK3#hZ"`x<) >) РoX Fe"OA"O A!h:K)+*3@𩀢iOA+F F2RGiOAR "`${*ZB,H[xh^0@"`h$K*t3,+Уh #`KZ"`c`h*#` F2BFx,*@Z"`J[xh320Z@ FBFݢh "` J"2F)F F 2Btx})q3#`?lm&^ ]h3#`)+*Тi+FOA F2RiOA FR}iOA+F2 FRiOAR Fm "` "`+*O 3`?X"**1BTx*(?*{*JZBFJ[xh320[= ! F7?*?{*?e3FOs3#`#hBx}) ! Fh #`K3hlm&+-GFFFJ ЇhBCL nF KB s "FF'!W%0 F)FP" GDu ZO" H)FI+FK%HuPO5" " R""tpOa!hF)#a+DaY#B #}K32BC"OahF"KaaaM``( !hF]c`)@ch FFF !cPFP{xC@_->س_!سo𔀳_kB)Fc#k!cO1ZhFx2*F)FhF_rг _kB@)c#kF D)F#c)1% OسOسOтFOMгOOG9سOeFPF'xGhxCO5гO2гOk#jC#b-?!@`c(@!(FF(@🀠c`kX#cc+k#0O $pB OгOpkB0)Fc#k!c[)F#cxGok]O3#c`h"F08Oг@OTUUuP D UD S lm&-F5x))D)e)D_F!c_hbcX+xG_+B%s"T}AFk+"ME##`#ld`s`Oe#3`#j[!hF:0FNb[rC_Bjk@!0;X!(F*c8FWj#:@#3B<+FbFG"0Bj\E:3Ҡ Z\B B2W# B$ P#AE@#@#W#03ELLBӫBB8W" 8F\,k+?n3PxAOбO бo+?_#jC#bYB8F; F(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(6Ċd`8FK Fh+#OsB \k AX@8k˱ K4(Fh3( K(Fh3x8 8@pĊd`-OF-FF FBԀ2hShS% xCO9س _س_ހ__𥀳`_𣁥L F@_𫀳O𞀳O ā!سOρOiS' B@ˁ?0O:س OM(O𑀳O OOÁOѲh)xIh0FO  SQBF!FsSFqF(ѳh+D8O@O3iB"xS10 _*2 (h DF[ 3a#x ?_jh ?'$&F-OFFFFB8F0O ZhR%`xCOгOwгO3гO qٳO@0&xF !j&xFRF.DO  +F9F@FRFKFFF@FEjb&xF.D RF#9F@F+F#RFKFFF@FE]b#xCDR)0xAO  RF#9F@F+F|#RFKFFF@FqERbF@_ س_г _Fi++h  h  EKj)bk*8k?_DEw;xR#0+e=   BZљB! @(!DD#DF7#k+E8F' RFYF(耸cl+? ' RFF(83HFF |D [\#0R B,?qEM[FSEF8x3 xBkB8F ^ (ѺE~0Fzcl+C 3 l0. +?L 3l"B\ blcC\ ZFعFYEh 2 F(\F w(и?y ¸Oq1Or2?f $@E( 6  =F(EJ2lX#3 ZFN+0( >F%& &&pGpG pG w0 pGpG pGpG8#MF`+x %`8Oq(FU( xm&7FM+xD 0(%`xm&Fhx[@(/! F8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!HwHH xn&  (  pG pG$P0/ 2#0/O-$MP@H`Lp 0p`R0*0S P000a P000T0000S Q^A 3 #Z20#%# TP@P0U*  T0 B2@TPT00#03R0S0 SX00G0S.T0S 0) QX 0[00 0 Sq 10H00 R03S XMX 00 $Ѝ P00#03P 03S 0 S: 00[ T0#3RQ R[#  ) H00P 0K?oR20S 0SX 0H0SX0 ZH 0X0  Q 00 0H[DI S 0g 0z0 C R9S+ ^1 Z 0tF@`!  , PT @-0CX 0  0 0$ЍS $Ѝ 0 0 Q 3RVo 0 H I00CR2 0% L /0 Y0S100B[T00S SB @ PTP=: ; D   20x0 R03S= " @-QM@00(,4`  P#USA\ 0 `U-00ĵЍ~ r0\pFAW`&S,- M rЍ@-@MQ(`0,0  P#USA\ 0 `SU-00ĵЍ~ r0\pFAW`&SG-M0p`@0W PV P%X P.Y PmZ PNx P4 P 3Wf  3 3V+  3 3X  3t 3Y5Z! L 3< 3ЍXYZ-  3 }3  t3 o3Ѝ f3 a3ZVX  PЍG\ H 8   P `  8 G-PQ⼔M00R p000`0 @P @0S nS a0CSsNU2  0oSm FPN ЍFPZ V000U000FP[Z V070U070PFPZ V000U000FPZV000U000FPZU000V000z~FPZO V080U080i0@q@iFPZ: `FP ZFP TFP`ZL V080U080?CFPo =FP 7FPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000lEP TEP  l 4  8 h @   A-P`M_NP 0@H@>SJM+; D 6"` `0!P P3P0 űp* 0p Ep@ (Dp@  㲱p@@@dkH EeHcH P㠱]HP`ЍXH00@pŸO-1MM @PD 0< "( 坱p C.F D` pY;@D8 (@s0Sn pȱp đ`  ᰱ00$ %0!`rt0p@ !0 α0S˱P s0S RG001ݍЍG0S 0K0S Rv P>p 0L8D<4! @P 0 00Z  0%0h,R gH㒲1ݍЍ蕱p ` 0@-M 0P Pp *p@ P  l Ѝ00 0Ѝ0@Ѝ0A-@@0s- lPP0P 0p` `"`0`0kGppذX`p aG``̰0`0UG 00xp@-@PCM2 /5P4 @@㟰pPB ` ᒰ@9G000妰t2 6 C>@F0F 00 P4D@@690S VS00 SCލpx@@0S6@0P\0\ @0  P@1:G?00@F00 p@-MQM@P4SY TE /4PB QP0s* DPQa P0`pH @ @0$=qp? H -p8 ۍЍp-0si/%@@ 00p +=@P0 @0 r P@1:F?00 p 04F0#S @F@F@,p@ xF000,t X$ , @-rP`O-$p(W,P0-S`@/U'Y1 ? dAZ0 0^AP :[#J P?5#I x@t4 2px 2BzhPY@rUZ0[%J @-DM@ ~P- j jBp m>BR* p=Q p>m>BR f@P P rp~4BP Q X 6BP  pp0S00S drdpE~BP Q<BP { $r$p*}BP QqpAP Q @p@0sSL qppAP pQ 0R`0 la`+nAPD `Q .S0 0SQ0 a`EnAP) `QA0.Se00b0SX0}0SO猀AP Qs00   5 < t t T,  A-@PU 7UP7UP!A`FFqP ``P 0!Eq1pP 02PO-Ml0 Pp0+ C+ pe p0P㜏㘟|  t0P0 SD[1S 0q!S1=S 0q!S10! R Zq[" X1S 0q!SA001 S'R:p& t  Z0VPt < SJ `.Q  oVyf !0C3Sz1*$s_Ylkq:nmzY\Eg:p}hT\T t0L]qap0PPA(* 3!R̂ \ A 0! Rx ^t0R p <t 0 V1Pt <SC j|h Ѝ  ` 000@<,ADt0 @1CPt0P  t    %[ '[9 P /R  q RZ+  ^x S:pW t0@P0t0 t;0 1<65XPp@0,^0 <P0  0=R  @D%0h0@< D  ^Pp$0Sʀ@"Dx@ D Pʟ !0\VpeS @0 SD P\0sD `0d [@0 000P0S,0@0,0N @` H(00(0C$0Sʀ@"x:@0P06@P0L dSl0 D`00d D0DD 0$0@0$0 0@0 0@(0$S v<Pp=Q j \ LH LXR@0Dh@0 SV<\QH@L^ @0D h@ 0R?AP  $h@` &0P 0@0?D00H0?L00 v> 0`0 ?d000P0?T00H0?L00/X0\ 00 0$ Rʀ@Q"2"2B S"2"2@0 2 0S,"00x2}$0S"@xr@00l@2/0 S  *($\0<Q0 0=R$ $ @%0c Lh0000< .: 6S ^00\$0/,>! 0E  0E $ $Â!2c 0R,,"΃0,!/#1    (  ͌ ( $ 00SP0 0T ';b0@P0^@2/0 S *P0 0<R$0c h0000 ; ,:6S \00^$0/.>! 0E ! 0E 0%!E!2c 8P \?H/)L 1!̀/0,0S$00#0S >  0 $  .1A0H L h0E 0C00000S P0 0  V BQ 0_  C00 00S \0 0#+;  +; f= =M S= =O0vo O-Mp`4">K@00>W00 V- 0< PL   ?0P o 0PP@v> 01? 1000?0 0@  0?0;`: < 0K2[!4+4`0000  000V :0x0P_ 0TPR dPP4`P0S R~ R z R v 0 0E 0AS q ?@$p'@TpET0}Np0A q0=萝 0PvD HJ0 0I0!|l00R0S1x0R00  C0 (0,' $ QP0 @ "4@RS0S S  xL@p X Z 0S0Y|0[x0 Rwt̰ [[<80>C0: :J0p0t 0p@`P V x0S )=pt000@@Dp x0@0Pe l  0 0 ^0 0 0 R1 R?Y0 0 0#/!!  . /J㪐 B 0S!0(0S00#0S>0 Av.@ B Q PS000S Q0< 0 qp  0qp<0St@T`p VP| 0 ?oR20S<00ߍ 0<x@0 qp@p/ Q# 0  pS@#NRp \TPx0 P0,P\000 0  ZR 0S 00@ V<x@ 0R`L<0S 0 0Y0ZS 6  x a: x2 x* x" x4HZP Ap@<0SD J4)P L@(㏂@"bX02*:"  @b"R0# P!qLUPP& @dT0;l70p@6;0xP`؋0@@@Dp<P ?v  # K R#0P- r 0X/0 U#10">/ 0%)$B@C "!!b0C0!Ϡ \0U͠ @`<!0S @D>! B^ ?  0$oqp9 p@8pɭb{;#00x;0S9@̰p.x ]@p̰[#< 0 "2#@T 0Z;0 Q  s!P L;T00I;0S ͠ @<!=;00@p7;T003;T00 @-@ aBp]ZWTᅤL00P 0 0R/P/ /x l  DP 0 H Sp@-`P P 0@ #  TQp Pp /ጤ H  P/j.0 0# /P/x000@-PP Lo>O@ 0" P0 0褣A-@P @`pP@0% P PPA-`X@@P jNpP@0& P PP踢A-`X@@DP H@pP@0& oP PPLO- M` +pP8 찟`萟 `PP P oN@ & FP P0S R Ѝz ,/@ W d5 0p0Sė A-PpQ `@Q P@D 0DB(000S   D@- M`ppPP( 9  ۬00S@ 90"S" 0p000S0 7/ Ѝ90"S1Ds\0pT000S @ Ѝ1Ds$   H @-@ @!O-`P MU PP2S*pPK `P@N P K <10`0@P6 0nS# =.'PP00Q Q mP  K@^ B"  0\Q 0 000oS@d000S dbp Ѝ4 ) WTRꀔ lO-BMM@p9X 0 0DP:&PP $ DPr00N40P0 C `KP@@e0 PPp 0P0  0PPp p@P$ \zРD 0 dQ`k`V` pP  r| -05P @PP0 PpS ଍Q TP8 00BލЍP/U ` P p@80SS  .PBލЍ .0H 00PPp?  !^8 P00 0.h!0 '0 0J8D 00 0.겡P`<80   ᣡ5J00!#8 00 0z.PP{8 00 0n.PPo 8\ 00 0b.Pdꄢ x ( < ܟ ` X -M 0  PЍ -M 0  PЍ >-M  0  PЍ ?-M00 0 =PЍT --( 0P    0/ 00؞p@-P-U@p7,,0 ? P  5/p脞 p@-P U@ph7,,0 ? P  5/p$ @-9@P 0003/Н| @- @P 0003/ꐝ< p@-PU?o@20S 0 003/p< p@-P`UV00P00@Sp$ 0P5/p̜ p@-PU?o@20S 0 003/ppt p@-P`/@Pp6((0  @p@/(H p@-P@P p 0 003/pЛ -@- M  _p@(0$003/ Ѝ@ Ѝ/|ؚ @-_p@0003/0 O-$M`Pؤ@ 0 0(0Sp$Ѝ60 (P@@4/$Ѝ茚 O-$M`Pؤ@ 0 00Sp$Ѝ]60 (P@@4/$Ѝ !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////@ ,  t d P 8 $  D Ԙ p \ H 8 $   ܗ ̗ h p $0(- C^ 0C$Q :$0S 537$$05 0;A, 0 0#  $0 0@-@$ MP05A05#05!0%0%>P$00$0Ѝ0$0Q  S,0 5,37$050$0/S 5<37 $050 0$0/0S/, p@-R@pP$(ASp0$ R05>37$ 5 $ !PpO-0@DMPT؆p 000 \0   C R \0 \%3j?F$0. 5,0 @S 5#37 ,05Q0,0m,0 S 57,05 50,0S R0#0C R00CT,@DЍ%3j8G$0P$p 0\T@d 0S1 `@@0 SS( S R 0C#@ Y0 00 P, Q0Ç0,  0, 0 PX@0S80S ,0 S 5>37,050,0 @Q , 0R0537, 5 05 , RS #0C 0S 0C 0S 0C`V  FV")VU*0FSQONMLKJIHGFEDCBA?><;:98765bV5?Q/0S, 0 a31 A<0100@p  0 00P, \0Ç0,0,0P @ RfV ?R0@SQ  b@S9 B88  C# 0c1#00FV 0, Q05 705 5,5, 00 RQf05= 3 7 ,50,Ly@ %:u0@$0@@@0TS`VLZ00 Q X Q=V, R05`705, 5 ,   R,0 Q  ,00,0 R <@ Zt 0Sq R@@ 0Pf &@  ?R]0@SZ b9 B88i00 @F00i-M0 0 Ѝp@-MP`@0 0 4/ЍpG-PRM[  `Tp{PCa@/ P @1< 0p00p. Ѝ80S&  0< 0 p00p30S0< 000@ pp20Sx 20S X 0 @< 200200ؑ d ܪ (@- @MЍO-EM MpX@`PFp+ ) D0P@&T 0 D@0PTx 0  Q`i  VEލ Ѝ200|200z @-`@M pP/P% /ED RP$  rR$   0@ P@- rR  Ph 0 @ Ѝ0 Ѝ@0rS 92 0 | $ A-`@#~p 0P/S /CP @0p S 0 S  (p@-IMM@`PP ᬜp 0: S X0 0wp IލЍp1O00@IލЍp100ꔆ p@-IMM@`PP ၜp 0: S X0 0Lp IލЍp1O00@IލЍp100 -M 0  PЍ 0P 8 Q  8 //p@-@P P`P 7 ~PP u P  p@*PPp-404-0 M  0 ЍЍ/(0P --M  Ѝ Ѝ// -- MNP8 00  0 ЍЍ/00-@- M@OP  Ѝ@Ѝ/O-`Pq,Mp;  RP$ Ppp @P$PX P@ @ 0 PX N ,Ѝ000:Q!0P00,Ѝ<p@-(MP` @{& (Ѝp0 0 0p@-@`PNpp p@<0< 0p@-(M0P @`T& (Ѝp\0Hp@-P@0 @  0`lNpp p@m00@-,MP@^Np  @+&8 \,Ѝ0\p@-PT0 (M@ 0`ENp  @& C(Ѝpl0C-PP@,M@/ ` p`FV`R V `@0@ .T N' ,Ѝ00 0:200,Ѝ<p@-(MP` @% (Ѝp0 0 0p@-@`PMpp p@<0< 0p@-(M0P @`% (Ѝp0Hp@-P@0 @  0`Mpp p@y800@-,MP@Mp  @w%8 h,Ѝ0\p@-PT0 (M@ 0`Mp  @^% O(Ѝp0 P $ Q80 8@-M80@08 Ѝ880/LL0000 0<Q 80880Ѝ/8lP/p@-@0@00S 000 XI t PP `00B/L00p@~!P,Jɾd08 ( O-PPMt3 0 0 @D `p@ P P00U tpp0 0C9 Y 1ATT00  RF LD@D T\:[ 2 0000~`K L V00 W7 1ATT 0`Fs 0Ry L 0e 0 B_0SH L0Ѝ V0  0 J L 0 @0pHX<0S3 03 Lw 0 B(@ 0 B`F   BoLtZ 0 B  B`L 0 z TL 0 0S B 0 0 b00 0 0 00p@-@P(Lpp p@0RS00 /H0H0p@-@  @P Lpp p@040 Q00 0R00 /,0p@-`@PKpT T   p@php@-P X @ 00`KpTT  p@p0O-P!M k 1D`00 S,0H?@@QZp L 10$+10[?Pup , PPDEQ|`0Ap2 @[0S8 0? P PP@[u  ,0 0 L00GC1  00 0P,0@Ѝ a 0 00~<0D0D 0@-00 @T AP80@080@-@P AP80@080-M0 Ѝ-M0 ЍO-PiMOȡ@̑ر Qp`P P?`K͌V PT?K͌U P?F͌(Z P>F͌(Y P>C͌ 1S PD>JB͌81S P=̌[ P=^B͌ 0`3@@@ 0S7800PH0`@P@P @P@P@P@P@P@P@(@P@PP@(P@Ppx@PqP'( @Q78 x00C40S000C,0h0PD 00Hp(0LP@ (0a P[ ,0` 0` 0[ k V2 p @T   @T,0[ 00 p @daXh@0 0p@pYP' W 0 V `0 1S@ ,00 0 A1S D 0|0 0?piߍ00],,P࠳0A Q X,@<00@ P$8 Z&  B  @R=     pW  PpvW0,PZ  p,匰$ [ !p0@ @pP X 0@0 @RP8<0\(04 0(0R"DHpLP@1H00PXPPL$P0P0 001P0,0P00T0JX0`P `<@@(p08`0P0J0DXKD0T0p`,  @  V f`p[0@0 PU0 PU0V,  @ Pܠ就ZP 0@POP U ` [p0 @X @X0 0SX , \ @@ , XH0 p0尡_D0|H 0 >p` p  0W  0Hp `  0V p 0G` P  0U `H P  0Z I P  0Y JЁJ P  0X Kq Pp  0W L^ P  0[ M,00@P0(p08`<@,  B U+@@0, P  , 0T0H 1ʙ D@  |=p+P0(p08`<@0@4  P ! , @PB BZ [ Tb0p㸀`, 0(P0 08@ < DX\V f!`pX3@ 0 P U  @PU 0V,  @ P封[P0 @PP U `0Xp8@(P0@<DX\Y2Z,< ,0pPC`@ U*4 @,0@1  ,Y0 0H 1 DP  |D=p}pP`@@0 0 0R> $0SF 0P,00U 0e1$0PS7 0H @ @  Z  @ Z , @ $0Q1B/P`PaP/ Z   `P 0,0 SS,0 P 0`0C 00 `, U# 0 0 B 0!0`S:  0 P 0 0 @ T @T0,00 0 @0,!,0R0@0 @1P``P$P Z  P`$` 0SC 04 ,01 X 0h1 0S3 0 L0 P @ 0T0p00 @^T0 ,00 P @T 0Q1V@` @0P T  0`,0 S\,0 @00C00, Y# 0 0 B0!0@SG  0T 0 0 PU PU0,000 P0|,0Q0PPa-@ p @`pl0P: W  0 `@ 5 0 0R080000SO-`YMq0tcSA P T3? 00K͌0 0u0S3?HPK͌0H0v0S2?p`F͌(0p0t0S{t2?@F͌(00w0So(2?pC͌ 00y0Sc1耍?B͌8 00{0SW1? ̌ 011s0SK1?81NB͌ 0810 @Yߍ 00u0Sl HPv0Sw p`t0S @w0S py0S 耍 z{0S  s1s0S N k<@-M@ @ 04@P$( ,Ѝ`0@-M@ @ 04@P$( ,cЍ0`0` 0 R/DDQ @Q$00?H/Ḹ0|$T0P0/ D @  R #@ R 00?H/@|$0P08 A-D   R'P?HU0`@S,p10 0D C  \(  @U"@U #@ R 00/ط|$0 00̶0tP h H ?30 R - D#@ DR<0@ 0D//ᬶ|$O-PL4M  0pS4ЍPD0L |c0! 0:|@Pa 0`D0ZP`@0PZ0 T[P V@|`@`:P! ?3 R #@ R< Dp H0L |" 00( 299`P0S R,@PR @P0 9 R0`Sa4ЍT `@000  0`Pu @|`|$0 00^긳0`0` 0p@-0PU 0@S PI*pp蘳0p@-@P 0PS P2pp0P0% H -? \| 0DR0 0 0R S0@ 00\R  /Բ|$0 000 0 0 /GO-,M|R@x2P0`0Vx `":\\ XrX L"LŸ DD 8"吢 唒圂0 00$0 00000 00$0T0  C10l01 0m010p0npp 0@z0匲 0吲0唲0圲0$TX\`lmn ! 1Q0'0 0 0 0 u,Ѝ|00 0000h000`0\0X0X0T0P0L0H0D0 @000̱ ( hd0C-pP✂M@ |PP t2j+;0@@ #B*@ @0&`@2 0C @@A3PU C pP pK 0p R\ @B0 @@@t(P9 0 @@@i(P. p* #p& p0 @V(P  &h000S :3S ЍP \ZBd2T@ TPЍh0S0pPb DO A-Z`ppP .ZB62S@ T000 R Aގ A َ<1[0@-0tM,@ CS:DkE{] RoBKC[#00:0A+80_00o0 kA{A<0 K [ + A56Q㏊B R 1 R 0S8Ѝ0Q 0 0 0Dpl0A Q Ѝ0 '###|<>*!f><^vA@@@0l 0 S/@G-MTȤPpk @+(@^T($p 0CS0Sl3XPH$H :k{K[+; @0H`80@ &p % % % %!<%8!%,!#`!#"%("$%P"4%x",%"%" #~ $@!#!#!d""e"#-fh@#`"jlh# nkp{#rKt[v+x;z |:p R 0S (@0800S \ЍQ 82 0 0D '~l J @@\  0(PU(p00Ѝ>A@J@ < ^v#x:'# #}H#zp-w-t`_q|nokphreybz_{\@|Yh}Vv +,-.`afghijklmnopqrstuvwxyz{|}A\ L @A4?|?@=>A-'n\PP p  @ 0^(PU 0(`<O-M`6 6006006000Jҽp−00SVF ) p ,p PP_ N p?P4S S SV0SpPr 0@p   $ `00 4S 0 0 40 s0 0bR$ 4S4 0P%00Ѝp PP 4P4 $0$ s 00bR 4000P ?21 R R0  ;0w $Q B q 0 ; 0hpP/4 S S040S% 4 000r0  cR$`S ,4051E ` prd0  ; 08 p PP4P0uP0PcRT T4Sz0y$0P s 00bR4S 000V0SYpP 0@  ` $A `00 4S 2 0 yS 2051E `0 pZ p 0$ "P0 s0 0bR40 ;0ҿpA P= pi 40 s0 0bR4 4$R2P0$0$ 0Cr?o  aR2$$1E00#?c p p 0pU 4 00 TP0uP0PcR TTe40 s0 0bR41E00#?c0`00$AR r  `R$ $ Q 0 0 0 4 00 40 s0 0bR 440`00T0! P00 5P\HPpM0@ 0S0:3S X00P001! 0*`00<00 ( 0 000p@-@PY<ppp@D0D0p@-@  @PF<ppp@x0A-P P @pT $T`0 @@TPp00<V> P@P@P@X@-@qP @kP P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o" ; : O-P0M(fS`pvpJP T0ʍ p 0rr I"Rp 3S(0$00 0PK ᾐTP ᵐ 0XS\%$ PT 02P<50 4504S0300SR p0SO 4SI 4S 0d/、 @V㌑T2p" =PT 00@p2Z LQU  P  P trP ᖼᓼoY=t3@x2 P\ 00@x2X>3@|2  Po 00@|2gЍH5S4S 4S0?o20 hD $@$ <% p 0$0(0eX XP Y QP Z JPp2?;~0p220PX0 0rr H"Rp1XF  *P]Z<3@x2Z  Px2?;~0x2V  Px278x2Y  P<3@|2Z P|2?;~0|2V} P|278|2t1S0- 4S)xL%R&nZVO  PJx2.#@|"78x2WY~ZA />3@B|2LZV+  P&x278x2>3@|24p2Z0@p2VZ[ ?C>3@|2*P  ᖻ>3@|2P >3@|29 ,9 9  46 0 00`꼏00- $ Tx Xl l  \pT 0t 0x|" R꜏ 4;804  P X0 0//ЎO- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-匑\ Q |pPl0@`P QV00` fP2 _ /0M CR0200pP00 @P D0P ;  Bⰰ +!;`帰 就帱0 B`~Py@0 <00k  ԍ0 d0  0 A-@PPp Pp@p `EPE`0 |2U @0 o 2@ p@-\`P@T 0S1 RT0S@@U0SPp@讆G-l@`pS0 ST0S"Q0S 0ST0A-0M`@@᜸P+ _ /0@M CS@j0 @ 0K~"  2 0QU $ P*#. _@Wۍ໺:6}46- X - LM  R  ʂ0   ЍpX0 Q0H00S :\@- &o/ 0 0p@-P0S :@#RA# #p `0:P #c#p# B0:#!BA##꤈T0 P-0M 00S ʃ0  > Ѝ̇804  P T0 0//lp@-P~|``p@0@ 0SP0P0:3S 8 L40 00 :#p O- Mppl3 dS0`P\0 *`B'WX p p PT p   r  `R  00/"1 R# @0S S9 SW0C S p2051E `px  @U ` Ѝ R k  P   Ѝgp P ` Ѝ0 r 1 `R R   S7J @y ` 0  S $q 1lR Q   ЍNp   B/oq"`Rm0E00#?c Ѝ 0T0 P00㞨4  x|2p2l22 1 0P' 0/G-@P$c$3`pZ 80$ RG V ʌ3S23SmX " R <8 0 @0S G 0W B20RP  pGPi V 0pG P W  PY @ G`QO-M00P0SH3 `3S,[*Y> @00! 0@ @00@ TP0 { p @` ֬P @0S  0 `PPEЍ` D P 00 C40/Ѝ @0 T/ P0  0 /l400 000S :P /0SL0 H0 0S :-P /R400 000S :P /RL0 H0 0S :-P /LR400 000S :P /QH@- @@\ ʌP 0 @zQ0 0@-0@T J 3$S B0pQ y8@.P T @XQ804 000S :P W/PX PT 00 R0S *P@04//|P000 000S :P _/PL0L 000S :P @-Np @/O0 0A-0`V* Z 3$SP! #Rp@4S@pp3Tw ANB0tQ 7A".|O,0@- @  @^N000 000S :P o/dN00O-` MX$ p P 0 ~p @wP  0 Prp@ 0 #@  Ѝ@$NP  P /p@-JP x3S P`4`0P˪3Vƪ  0s3 S00 0P 2 $R 0X0S H03 20X #$04p03ppp@-jP 43S @P4P0@⇪3Sp@vA-`PX JSU"X p3 @R S$ S'X 0lAQ0, X0p ,0\ 1B0010L10|10 A0 XP3PSSpP4PStpp3Upp@-@P X0P:"C0T0XppG- Ԁ\.P@p  `ᶪP LTL VW PT WV  H000S8 0ᛪ0 0 I|O-( \ @pmP`7PPP0 C CC0fP( P@@V \P P0` @ CP0 @ C\0! 0`0SZ03@800Q` I|0@-?S0Pp   0 P0X( @`b& p@`^  0000G<A-@PQP% pW0!  0S0J,H000 R   R   R  P 314-`T `TX *P Q Sp QW024Gp@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S X03@0SpX@ '(@ 8Q0@0ppp@-@PXa`R X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  03@0S L000080S@078@0p ]pCD0D 0 0S P@ ?# Q@080//hB0$0Q 00/ B0$0Q 00x/A0X0X0p@-@R ` 7 #@8(P?cppA0p0p 00 ?o2Q0SX@078@08Q@@//DA00 00@00 00*@0p@-P`0`0@T X0:20T1S@0?;@0p<000080S@078@0zpt@0P Q@0?30R@080//Rd/R/p@-PS @ `@?Npp?o2R0SX @0*7"8@0 8 R #@( @ //P@/+p@-@Px`P` X0:20T1S@0?;@0Y8000080S@078@0 p>0 0000TP PR  R ! R! R! R (!R !R 8!R !R  R/L1S/ >0 0000TP$ PR  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/\=p@-P @@0 0p@ /@<0p@-P@ p@#p0 Ql0p@-@ 0P00R ^ p@  p@;0L0L0p@- @ P%ppy p@l;0p@-P@$ppj p@p@-P | @ 00`$ppT0 T ^ @ p@B@:0p@-`@P$ppT T  R @ p@#@Rp@-P@00S ^ p@  p@O-@P, D | 0P0q00np  B PY 0  0CI60 SP 1 ЍTYS00CS``STZ0JS` ZPZ0 P0C Z%|0 00<"0@-@P`Pp0^0C (,, 00^00@UP 0S 0@//P 0S 0@//P/P/P/P /P/P/O-PP! + 1СD0 , 0S 1H``?c`@ p0 @s'W#갑@W0 8| 0 0p@ P @0@00C kA 0 000X ?o 2 R0S P 01 //(-(^,0R0^Q!R@!1 O-MA0@0S3, @ P `p0S! S#A 00 `0C``P  (0R0 (000C0T0 02/p 0P@S(  ЍT0 d(0A-S$p4@`P(0P@SQ Qa ppQ p 0p(0p(0S/p@-0P`@ (0@SpP0@-0^ 0 @ 0 Q@RHO- M@`P VTppD0S  00C(000@0 B T0@ 0S `%,0 R@p @ⴀD R`Dp՞ `|wp Ѝ@0 S RQ Ѝ,P ,0廝0P `00V  ppG , B(p!B, A0 T`  `  0Dp4P , 00@Hp`4 0Tp `0Du@U   PB  0SQ 0 0$ PC 00\R =@U 0 BQ 0C R G-@Ph 0pS: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R00 0U1Q0/P00` 0S 0 0V(W ѳ`F`V`0XPU0P`W`V``0 @p 0 $p0PEPUP 0 0PD Q P/$ $\/ P/xA-`PAPQ@P1p0$ VY 10 0 QV$ F 0R U EQpL @10 0 QV$ F 0R U E?p:   0F  Q SC$ 0R U E)p$ 0*$` P0`00BTP @T 80@Tp` 0U0 A-PP0P`00pQ0 0S:@$0P mH00@T 0W@P, 0S) 0@- \%@T \8x ƌ8 t ,0@0@PU 0P0U00 S0/0?o2?=X?A-P$@`V0S4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P 0 Q0@ B( `p0,0,0CA@1` R0S( X @- 0B 08SE?080$ 8R  R 00S0!R$R R d1S80080080 O-`QMRDp0[}PPx ሰ P,q ᰚP@0d W4) H0X?@S < ``@ `F0+; 008+;B H0|0$T`7 P \ l0 @8*BCЍ|P4. 㸙P( :"R! 0 RH0SI 0p V0 0 @@  ʨOЍ   PA-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,BPP D00cD0C 0R p$`!b00P@0RЍPЍ @-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ`@HP `JU@p_WNVPED 0    PI ֚L1D00S*Y p$`(D0@p`0S00,0UD000@UpC0@aCY Ѝ00H00H0t  P PEP` V IIP ЍP @ |$ 0@-@P0M0 t l 0  B/o"  lPP ;Ѝ0PЍ0 0H@- @  0M0 KЍ P-00 Q08SM$ 03Ѝ P8 /-M 0  0N NLN ЍO-QPP> 0000D&L00 0S $@P80@080000h0S $0Q$p@4@t@T0, a  @m t@T =0<00 R 0 S[  `600SV0A^ 00C0Q $0 0NL |5 0 p`dЍ P `0S,0$ 0S$000,0 0S(00 R, 000:3s @  @ R   VR0   80 0RkT4 00S 8  Q`  B R  HP0  P0BAQR# Rq0 4# X0:h2 3Hc0` 0b40 P0P@,   P '00S  @GFp 1P11qW 3#0 I 0v 0 0S` P 1@1 1RPTT<0e@t 0@@ 0@t0@00k R 0 4# X0:h2nQ40@@0b~H r(0(!*'. 00, ` (0 PF!x!(pp P@`A @H0P` !?3 pGWQEP  PH0(p P@ L H VX X0ZP0@0,,0S $080  400 L PUZ00 00vVL0 !L| ؓ Ȋ ܊|DЈlT0F7 /U0pEp0 R& 0 R PPWdЍ$00SgL000S740340 80@080B5 z 4000V h`  ] 08 00 @00CTqU l<0, 0H0x0y00C, 0 QyB$@0 0X40 b00C `[p @@p[ P<0@ ` Z`D` <0`V,p,@ ` `D`  R00CV004 SpS0I000PD Qj P` |@0P`@EUL E[ D | ~p!RQ (!R $R 0  0D(0 (0p   0D 000$Ra  4P J000!RB 4 p 7 0 00,<0WH%  R Q R(   0 `= @P0` 0H!W00  000 =P P ,@00@ WH5SzH5SsPR p0SO 4S4S 0S00Q0S9 L5S= @0 zt> P 0  @X` 00p0 @K00P Z `000<00  BM  <0000Q0P  0@000 !000P <  U P$ ' ?P }0   000P"  10 0g  0 ` R! W @1` P0 0P`1S? W 0 @P0 0>pL5S- <00 00R'W 0` P0 0L%`0  000W@_ 0 0L pVlp@-@P`M`. 0P0 R    80x  t000 000P 0  Ѝpo80 @0 @'b000c``DЍp0 000G-0MȐ@PP  ",TX $ \A` JPlppP 0Ѝ480 T0@000cp;`P`+``D0Ѝ0Ѝ@-@P @TO-PP ! 7 1D00S0H``?c`S., p !@G'T :#| _p @W 0 R( ?3 S 0S1S0 S  0 00X0 0R 0R0 0#0  RQ\ R RQ 0P // /p@-PP @0 @T $0`U VP `܊Vp`O0P 0@PUpT` @ĊT @pp!` A!@-@P@寊T R/0A-p,SP` @T @噊T0`PS RQ A0@ R ", "Q//@-`Q.pP@0D R "! "S0 R "! "S ^ 0N R ", "Q^pPV@@-@@@0S (0P0C(0`O-Mx:xzx*0p(P܂ pP H*40\` S  @s@!dRX@jHQ00) 8 @Y @B@0@T ROoB@TP `NNQR0)\ 4  |  bR\ T)` R&D) R! CP'I@0 8R S[80S  ( 0P00B(0X@0C0 8R CPf S ^\ d( 00Q D800 <08,0RJ0H 0@0( (P)0S700S00l0S# 0 S 0 80R#0l 0 P0S  0P(0@P(L70 RЍ47 0, p(,04 SBGg@`K & ,04 S5(&0CP ,00xP0S z(0P0C(0Bp&@ $ `&0 0@,@ R 50(600 80RpfF`@000 (P0 80@P0,@Sf 40 CRbڬ%% pp% t5@04p,`Y ʃ| `nR`F`V,00P0S  ( 0P00B(0X``!R 0[^[ $ $0 0C,@00000C S[ pH400@4 0,0104#0{d4`000P 0 ^% (@(#P@ ,@j4 Rw 0U, q  P+ x# V l# ,@(@?QW, 0 #\ (7 ,@  P J0,@( R @ p P  @ $@lP "  200  0 l80 S %\ "'H2 0( ,B@0S  B( 0P00B(0( 00P0 ! 40,`V7ڬA@ 10,`4 V0`F|!,`0 xP0S ( 0P00B(00@&A@0S  ( 0P00B(0 0@ꠁdh(XD4~4~~}}},$}|| `|L| |0,{zzzdzyyyxx,,xxwxwO-ds M`3p\C@4 P  804080,c`,0P Zn38@3`0T'#0CS 802PL袟 X0@DS,00S0 0l0S R "0 0) 208@0P0T0hP XRP4 @P 0, 0CS P 20 0 P1084 0, Ѝ04S00h0S40~0T104 ! @ P0P勓<1,`0 R*T$!P0 0 @T 0 R 0 P$ 0 0 00 lP @T000P0 0, l0  8@0SRC0PE@DP8@K 00SL008P( 4vvuhulHp@-P@0 @  0`pp p@*`0H0H0p@-@  @Ppp p@000@- 0Pp/ `00p@SL,0L .W @0*S /SR@@00@@@@0 00C@@0`` 긙O-SMБD@ HP 0S p` @ 0Z A 4/  Z8 $Z <RD!  . R !!! >" P   @0 0~00  HPr 00 R0S0 0?๥P4/ZWЍ H\r 00 R0S@0刀0pP4/pWꨘܐ d Q" @-@M R ! R "R pP^  0 0@aЍ /@-0QM   S S PpP$@4R @ 7Ѝ00- M %ЍL@0<< -M Ѝ8Lp@-0@R P\RQ ^R3 @%c ,R'Rq{ L @RQa0 L !a}0 p  % ?{ R`VD 0 FR;h!@P`   ^0@! cR{E0\R:R '  px @i%L {i{bؔO-M  }zPP 0%  0  S  g ` @s\,S0Td 0@ @  0 S$  QS%S  +0BGSSQPNMLjiIHGFEDCBA@3>=<:s876543210/.-,+*)('&%$#"! 8 0 Sw{H 00PЍiR%@0 0 `fv`  00S1.R0S*R 0 Sg@0 S[0@0%0dR% @00@  d 0 S20 @0r 0  0 0J0 St00@ s0000  00000 0.0 S0[0@%  0 @  %# 0 Sr[@0 % @0  00%+ %#F0 0@kP0 0 @ r 00  C C0000< @0D@00T0 S\R Z I00 S#0$,  n/  000S0\S 0 S00 C0 ؑ p@-@PM0P`0S PS   0 00Ph 0 Q00QH  < x0 Ѝp0ꬋBBBptBA-M0@HSD!00@0p0S= `N0   1N;AƒKa1#bP0 P  8 g=M%02#cQP 0 pW$P@PW 0fSPЍЍ 0 Ѝ踊 A-M0@HSD!00@0p0S= `0 %  k<7@ƒCa0#b1 ! 3>C120BQ0P pW$P@PT 0nSPЍЍ0"ЍL O-M0@S!0 0  0000S, Phqb*cE 0 pƏ⊡ - ?DB%.b CĠ #W =W =upP[ 0000pPQ  XW   RRl`$xPP U ,00 3mW  .m0SU $@(0 "K%ᚂ!b  P嚃!2c 0P 0 02#c00P0 pX00$0PB0P,=p@H@Y 0S`@Ⲁ l} `p`l tY00\ЍJx$p4d(0 ,(k@C3>C lᐡb  ! 120B *P0Q p@00K$p℡ 7(0 j(-8 ?T p -000 Tk@@0A@?SX>T0 p0A0Ds=Q=S9|7I_hm}^0S -00X.00  X@ E0l@! D0 Cr 2;0X'T OP͍ R'R ͍T0   R'R'Rp@p@I@`VtP` 00040tP, 00000V0R 1X!RL 0BS11ऀI PB=&@DQ1VTxvutqqomlkjihgfedcb^][ZYXWVUTSRQPOMLKJIHGFEDCBA@>=<;:987654321/.-,+*)('&%$#"t1S 0C11ऀ, R 3@ RX*P  0Sgp 40P040OU7 =@!1ऀ0100L1S 0C-11PSU #,Q!*P  4 P@6AT @D=AA0@a DrQA DR3@D1@ڕ#0S ?R ;RH p0S %S0 0@a0Ds RA0DS13 DOS !01000@Sl00l0 0St00t0QU PE=@Q1P COU?=-!1P@ Q @10Ds R-1!ORTP=@1p=1 !T!R   B!!0 @RS^  ?R ;R QeR p0SP %S0 00     00C2"0OQh0͍}SS  0S}S}S@p@r1S 0C1XX   R!#@,Q*P  0Dfp 40040@N, 40,qߍ! 1KW00PQU PEQ1- @@OU=-0@0@P1Q %-1 1OS400@sP 400@,T 2 sP 400,X (XPPÐ@oᨂPX p@|yvQA@pQA#QU PE!TQ1- @OoBT 2 hsPT 400,S000 0 0. 0 n00@T200&@D0Q0VT1/.-'*(&%$#"! w dR<*G@00NA!@DOo0B009@000- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/A-pQM@P 0S! XB _rP &`V! v00* V U{ ``ЍpPU00c ``U ˥% 0 0 R Ux ཥU`෥EP0S U, ਥ hDy>p 0S R s0r (0 000SU00P F  p0(0P }F  p00PnU<h0dP     l D  (  0R@-M  H0S@  Ѝ0A-pPuP U) @T`V 0PS |@P0DvV  TP LoA-PR pQ 00 @`R P0 C C0CP P (&0 ES  qP  0 000Q 0  R0 R  P U Eq0V Q ^`̇QP 0S  0 S o W0C  s0_S0S  0 S  RQV0C s0SPUE P 0$XGPG ") X$@ : 02 0nP< sPJ fPW P00R00V0S   qQ :%pP N@!pPJ9pPL2$ PP bq$P^q pP$!W  P P ?V00S    0SP V PC-@xaMt!P`p 0b P 000S; PЍ`P P7 0  p R 0S 0PP  PP004PBЍ 0 P @`+` P *p`P\ 0O-M Mp0:S*0:SS@ 0PS:S``#E PXP  p;0  0dAiP 0P:S  ۍ Ѝ@ ۍ Ѝ ŸC-P M@M`ptzP# 0/SC 0}P/mP 0 ۍЍCa0P ! p bP,tlQ0P 0S/S }pP 7LpX 0CpX P 0 ۍЍC0 PۍЍ p 0pYW P0L 0 $ۍЍ404 0 $t l h   l G-p`@P  ^0@oT  TP `@P@ @P PU   0!GMM-@- M@00 Ѝ@ Ѝ/+ Ѝ@ Ѝ/ 0p@-S @0  p0000  P Y0 p@-@ooo@oo o0o@; 0p@-PS@:pS nP!pm @-Q @fRQ ^nR sRQ# 0  \ A- @X p`fS@X P<0@P0@nS sS@X@@ 0 0S00@PA-P# P 00`p`0,SS00 0\,\@CwmP   `p`@d 9 G-pL@`P P9pWS*nUJ sUA fUH0D Y#R< @ 7nPF H0D@p H0@0H0|H0nUp@0 H P4 sUC fU; L00L0@P@ XP00W 0 0,00 m 0S000 0 @ QH0 $H00H0H0@ HH0@, ( H0@0H0#H0, 0H0$PH00H0 T O- MP hZ p@ apY ` Z`(080H0lP- 0@   Z0p@   @Y`@  00@Y V0S@P0@ Ѝ0 0@- 0 @S* 0\ Q \R 00\ Q  @00 RER\\x  :Q  R00\YA-`0p @PPUR mP!0 V0 00pp   0  0 0PlO-@P0 $M 0fP p{m`pV`300 `U l P  p$ _m|PP <uPl0P Mm00$Ѝ 0 Am?m,`$0V p C,  PY P PR 0S00kPL `V00mLpD0W@ @ CL 7 fS+ 00   `P pW P`0nS sS Y `` 00 l$Ѝ$00??P}A-P0p @``VR! )lPA0 `0 00P 000if[`FPk0A-P p@`WR kP0 ` 00P 00 0PjO-TMD0D $00, 0kL;040`P ||@P00PP/ 00rPT lP.h?PPzkP  !P2 U 00T 0#$,1P p. 0p0#1(00S% ( .S  ROS= = Ჺ@P 0 0pPu< <00Q4 Q 0/ R$,Pk TЍ# ᏺPP9 @ p@t ,0 S Q0S Q0TS 0 000`00,P+X ,1k0S&pk % @0@Sm 5p@tP00 000 000f0 PW ,pp@W 0 W   `i  )\W  R[Y!%P^WPk p@W  0 0C/S Ru  0P ,p\0G| RE G/R{yxwvutsrqponmlkjihgfedcba`_\[XWVUTtRrPON}~pW@ W(&40p  @ p00@%40  6 p`00 L>L00S P P^ 0 Z 0SJ t 0[ 0 00 0000n07pp`Ii  00 P 0R  S 0Q p`       $ 00 /t 0 S00P?W{ p0<80@PP 00Lℓ^0 4  T800pLS<@PWppp`2 0 0  000s0]P ,pBP p@tu p@t: ,0 Sd Q0S ] Q'DPbTP =P40  O[ 0 H,p vP00F P p@t0L <00QH Q 0C R 0  \ 0?P$ 0 0 0 0S00P 0 E0  D y 00 0 P  p<@P4dS0D8P/$P0 00 //8w 0@-M@0 KP 1N;AhLBH gMMl1#b 0 0#% @B4d0!XPЍ0v P0`0>//`v 0@-M@]0 CP k<7@hLBCNCl0#b 2 "0#AB@C1d!PЍ0v 1P00&>//u @-M@%0 X-8 ?=<;:9876543210/.-,+*)('&%$#"!  " U a  !00 (ЍpP P # U0  0: 0U5!00 P ~Pt D# U0 0 0"dP 0SC !00 cP00200U 0 KP 0Sh !00 cP00|20U 0 a  /PM  cP00i,20U 0Z 0"P 0S z!00 cP00SU 0 " P   rcP00Zʈ10U 0 !="?7D",JP  ZcP00,U 0 " LcP0000U 0"?7L"P :0S (!00 2cP00ʔ00U 0"?7L"P  0S !00 G$BPhxl \HhcP00$00U 0"?7L"P 0S !00 cP00ʈ00U 0S 0"iP 0S !00 cP00600 0a U  MP\  cP00$ʔ300U 0 ;P 0S !00 cP004300U 0 "P 0S !00 cP0020U 0"?7L"P w0SI e!00 ocP00p20U 0"?7D"P  \cP00e(20U 0U"?7L"P J0SQ 8!00 BcP0010U 0"?7D"P  /cP00|100U 0 [ P 0S} !00 cP00# 100U 0 m P 0S !00 cP0000U 0"?7L"~P 0SB !00 cP00`00uU 0 fP)  4<`\8L$hcP00400U 0"?7D">P 0S !00 cP00ʘ00U 0y"?7L"$P 0Sn !00 cP00?00U 0/"?7D" P<  xcP00D10U 0"?7D"P  ecP00Lʌ10U 00" P T0S B"00 LcP0010U 00"c P ;0S )"00 3cP00^L20*0 0Ra U  P  cP00p30U 0"?7L"P  0S !00 cP00 30U 0"?7L"P 0S  !00 cP00#ʨ20U 0"?7L"iP 0S !00 cP00D20U 0"?7D"OP  cP0010U 00" =P 0S "00 cP00ʜ10U 00" $P 0S "00 cP00<100U 0!    P z0S h!00 rcP0000U 0"?7D"P `0S N!00 XcP00 p000U 0d P F0S 4!00 >x<D@|dcP00000U 0"?7L"P 0S" !00 cP00ʔU 0 "T P  cP0000U 00"8 P 0S "00 cP00810U 0y"?7L"gP 0S !00 cP00ʜ10U 00" NP 0St "00 AP 0S !00 20 a U "00 x30p30h30U 0?G"&z"00 430,30TU 0?O"i"00 s20U 0?G"4["00 e20%0UjN!00 X20[20rU 0?G"="00 GX20P20U 0?O"),!00 620U 0?G"i"00 (10Z10jU 0?O" !00 10t10U 0?O"!00 p10h10`10`U 0?O"!00 ,10$10U 0?G"3!00 00$U 0?G"l"00 00]00U 0?O"!00 00x00(x0h \\ L|x`8thhU 0?O"fx"00 x00WU 0?G"j!00 t0000r00Z00U 0?O"P!00 Z10t0U@!00 J810U 0?O"2"00 1 00501 000,2 @@e`0 }L2 00*p2 00 2 00G2 00@2 0053 @@+00 m43 P00ܭJX3 p00ӭ|3 00ʭ3 003 00⸭#3 00⯭뺿!00  -Q*Ϡ?B0CS6S/ @RR#  S Q0 +C 0` 010+SQn {ȠȠ 00+C w{0 +S0+C3S S 0A.B0 B33200Pc b / /P 0S $0S 0S P? @4@P//A-0Pp`8P' , R( 0"0, 4000R40G@BT@! V @D8 ,0400G,0 4 00(@  (8/P8,0S0Q 400 @-P00>  4O R 0 S. o+7N<$PI@'Np LA0P R $ R  R S /0?0P  ,AA40q@aRA- 3 8S1R  -P@. 0` S ($ R +3/PP P4?p@8p0`P $0(3/p@  $ 4  (0 0```0 P 0S $0S 0S P? @4@P/Q Q@ \@!< < /<0C//?O- 4M00,00P 0S0 `0V0  ?/P00{p=?0U[ 0PEt@T7p0pp@>?00SA )0??000CS?0S 0@7sN?0 QP?0 C0(0 S@p0(0g( ;?O2`5?0U 0PEt@Tw0pS =0%T0PEt@TU C0 ` 0,0 SP0\$ @Dʈ7~+D?q@D0D 0B $0Sp0  0p7?@06'8w<#0#Y 020JK?HL0.0DSB?0i @p  |2060q @DS30P0;T0X0CG?0 C 3q@D07~D@N s Pl0{1r0ರ^l[0PEt@[UR!B"0$ 8 S 0l0S>0X p0P0tXp0  P 20 :@j l200@p 0O?0( (pd,20E?l 0T[l0PEt@[fU0 C00St 0 0000 ~$1岐T*Ul $Ug PEt@1岐^ 7sQ0D @C7{D7~D@NqKI?L0e$0SW$   0c@6?p0 (rt0p+@P7~@DL 0@Dⲷ'q"@p |J I @\0F?l00`P 000/ S  bP00S  ) &0S R?0P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000 @P`^1@0SS/Q  < 02!0C 0  S"$0M< @0 QG Q0c  B Rp#p2W S Q6 00S/Sa @0 < 0@0S2!< 0l0^pP\ G R R 0c ^  R S R 00S  0Spl0Sp0p0C0pp*x 000 0P,0C4p??0x p0 0 0 30 Ѝl0Spl0@@@rbPP 0S $0S 0S P?,A4 BR/A/Q /@o/A-5PXPv@ 0(+`3/PPs 8pWF ( 0(3/pP00@a  0 Q    +TP04 S:oSS0C0P0T00C0T0p0W0Cp1 (0 8#68pPp00Cp0@0 0 Q    +P04 S*p00Cpp$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-R|MP  80 @ 0 C 0xT0SC0p@X0s\pW0-p  p0 |Ѝ0`\`V30sBJP:P0u;J XS1ZP05 0Xs00R 0xPS0RSCP RT@!T0!01 00P200 0! P0S|Ѝ0W0P0S |Ѝ0@ ?o2,0%R00S020(0@0$00($0,0@?o 200040C0 0000p@ 0SP3:^N $ %30!`P3P'( %!<: 80C1 ( RP@00F#3 0Sx $Q Br $ARVJ  ` V  \ F C 0 Z(  V F*x $R AR  BR ^: 0 Q  R`, %Q  RZ  ! LAS4 @@  010(0! 0, 0( $0XA > O-p04M0C000 CPU?PU@PUA0PUAPR@oPP 0C R R0 PR \:0S@\!f!glU!1^  RX  p\h$X  p\h, Rl R O- M`؟ 0P0\QpY 0@SQ QKW0 S  RE R  R( (pQBWR BQP"S6Qt0S R: 0S S > 02#03/0@S0P P0W W0S0(0 Ѝ0Sp>00000 S *S0SWq00Q R60@SP20 W0Sq S00U0 00#400 03 0  0#400  0 O0S0c0?o20 Ѝ0 0S&+B(l0S0 B8@ B0 #22c0# 0l0S q000 R0e9S 60 0t0 0  R ,00S0Q01$ QP0 R1 2 00 00 0#400 00 00 S0 S 00R01 00 00 R  00 0#400, R E  Q ! 0P B R PE [ P ! X*H 0 ,0 SR B000 0 0 0 0 0 S0 S 00R01 q00 3 R}0ES IS; [S3 gS3 #0S0Ck0Wi  2RC0SS@ S  00 # #8 00#"0  0 ,  Q R I   R'   0P P0S0  0 P,0SQ4: R 00, R  R [  $ R  9$ 0P P0S0  0 P,0SQ: R00 B000 B000,0S+  Rg00 0 B000,0g  S  0Qf R00 00#40w0q00N0SZt 6l8&`6 &!6ƅ909&tl0QIt0l0" Yt0SWe :W㴖H 6SX \0l S B8 0 l0\000SFK\ R8 C0 l0\000S90 Zt0(l 8`R B  ^C 6&!6ƅ6ƅ909&6Rt0l 0Ct0 l S$t0 SW S Sl 8`0  W 0S0 B000 ^ ^  [ [ [ [ [ [ [ KPo᫲[@ ``S`051:P&0@ƅs04!ƅ0 0!1001  &6`Rt0l 0C` t0l z\0S B80 l0\0-00S=r#  #800#"0 00_T 0+00i*W6F &RA \ R80l0 C0@0,0g 50 0 005 B0 00L0D!C0C  ¦t0S*l0\06\0l S B8 0 l0\000S201\ R80l0 C<:86420A-`pPSq@PG Q00V0SH81 0P1 : (0sQ Q P00 00000 |0 `ap" 0S$t l00\ R6S S L0D C0 CA060P5#0Sppp0p@-@.PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV00PpPO-M`pH0S@DL 08Q1S00PP 0 0S $0Sx wpVoV`F0HSx0FSRt WrZpFYo᫲[iV @(& `4/@Pn  J@0`A4 ,P*   L @  ` B (6/, ` 8(6/L ` @(6/j 0 D(3/80S6! ( @ R% D PR! 00C60p删$0ЍOxv `fh00$0X(0 xЍ",0  000!ꌷ-M 0 @ЍA-P=PUPn`0@0 0 Q    & 0(3/@PR &@zP 0, (P3/ 0, 8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 &, @@ !L DD &!0 0C&006 0&;> 0$0;/ O-Q$M R0   0S!q"$!`Pß@P p`0+0*) `@$z0`&@!y0v0 qp0Pt0A1:SuPPQ "9SuPQ(6SuPQp'P5S>3uPs01+@$ "@QP`0.,Ÿ  "rQ"$ Ÿ! ! q R!   "  "rQ"$  ++ { R+! @$ $rQ"$ S4\@`Q@DPQT`&Qv`a"$&P%uPa PQ"d& Q,| &, "r a Q,d& QP%uPQ&T%,| a Q%d& "r Q&T%,| !%$"C0S 0!^q"$!$Ѝ LÁ!`AV1c/@pt  | P $ C-PRp cmN P  0!\00#@B .P @N1R C 0 @$' C-PRp cmN P  0!\00#@B .P @N1R C 0 @$', @-@P |p S]Np`@` 0!đQ00#B  T @-@P |p S]Np`@` 0!đQ00#B   00@- S]N^00# @L   0RG- pe Q RLuRnq@W-@He_V @0@0\\ 0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 R 0ɃP 7ᕓi΃7nP"R 0Q ?Yq00H/II7c ? Y?II^NNPV=H10C>@@ P $B0R pR 0`RpR`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0 R`0 0@0@0C 00 Q q00H 'ᑒi7n/0R#@-qHp@#/Ǡ @ V  CJQ-{ O0pG֒\0 P4 @ B^S 2ʵσv p X`^ 0`!`P4[ ఐ`G&f B&S`p 0   ]pWPQ=000?10 K`P02  `;I`;Tt !GXTT;0 X0\s0~060v000 `k%[`P`+ZGp 0`K< 0K⳾0 F 0 p@R 0 q0CR Y> 0 BV0 00000C05 `FR  = 0@N @0 0T00 0SQ R 800S@BC0 R 00Q<ЍP  =p`w\ / !02NX1@[ @೰6:#6\Y I 0 pA-P@`QT0R`PE+~P p0T S#|T` 000U0 S@S |jT00 T-`0R V1|T0000` S +-T000 0`0T00 0``0O-M@T00R!+Z+8ʀP c W ~㸐|㸀iQ6s0 `IP000P#406`0cXfx0Z㼊PḀeY6Ps0`PE000`#406P0cXx0AUVq`U0uPPPP0`#406Pc0CQ6T T0P[Q p@`DQoob`V Qf0W Q@z㷀+}hpY6`Hs0000#406`0cW3sp VfPE0Tv`wppp`0p#406`c 0CUVP6AP0[Ѝp尀 phYp6`s0`H000#406`0cWsw0 Vf[ PEpTf0v````0p#406`c 0CUVP6 P0jP0e觮  P`6e@pE SC0t@0P@@@0PP#406@c0Vdv@Q@645P0V/0P2 `fP, ATq6`f0P0pAT6qv`fpP0bv`wp>ʀO-f6M⼖S0 #`P  #  # #  #  A @b9 Ts0@ Bp000@p#4060c^~00἖&R @ P$ p฀n9 Zs0 N0 00#4 060cXx0qX xq@DphWt@>挥s0pH000p#4060cTCt0 BR@@@CAԕBԅApಐpiX>s0I000#4060cWsw0 0@༖^ hD B@n Tr 9s0=@Np000@p#4060cR#r0&0R἖f b ^9 s0@P B0``00@#4PP06c Qq0&0Ѝ0἖=0἖9 0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4j>0C&&0tA-@ s0`P Q!r  pp "$  a AS2s 6  u0U0U$0Q  00  0 ړ000*0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 S0q0@PP0#4@@06c 0C\| S600@PP0@@@#406 0CS6 S0ظ0@@6 0C606@PP@@!PPƂ0O-Q0  MR@, R 0p&]P+(+0O p ! RDAQ j  &!R:P3 "[y6 S9p3 s0000 #406 c 0CPp 66 O.V G.0 0R0 0xS0  0LS4j>X0C&&, Ѝ O  \ P+R +R ,RE R  Q ,^ &]R3 "[jP ЍOPj 0p\ R3 "[&0 Zp:s00 00 "$ 缦0j JP3s0 Z㼦,N(r :s0s00 00#40缦0j JR#r0{ Z㼦:s0s00 00#40缦0j JR3s0 A Z㼦r :s s00 00#40缦0j JR#r 0 NΌ⼦  Z*r   "$ 缦 j JPp \ ἦ "   P3 "[A r :s0cq#0r  ` h :Q0@-!DƓPV ƓPV @Ɠ@F !6@o0ƓAQDƃ<  Ì!!ܕ"܅  ( 0S A-@pP `0 C 0@ATUT @,'P r&/@- M@Pp*`P `忕 P    =p 9 @P Ѝ[ @@ ЍU@ ЍP@{9T  Ѝp@-P{*@P @@㎕p; 00p@-@j*0P 0~000* 00'p@-MP`V*@P P @i 000p >9PЍp P69U PЍp0p@-S P@ `0 Co0@T 0 p&y1r1FP@p%0p@-S P@ `0 CJ0@Tș 0 pj&t3i4FP@p%0S p@- `@P0 C%0@ZT @墙pp/0S p@- P@`0 C 0@?Tp.&y1r1FP@p/l%0S p@- P@`0 C0@Tp &t3i4FP@[p/H%0@- M@ P "p  @P Ѝ0B@ Ѝ0=@ Ѝ00@- M@ P p y!r!F@P Ѝ0&@ Ѝ0!@ Ѝ00@- M@ P p t#i$Fp@P Ѝ0 @ Ѝ0@ Ѝ0- M Ѝ- MtiFx Ѝp@-@P%t3i4FPPpp@-@P%l?o2FP p00pp@-P`y@P  0@$p@-@c@ @-@]@ @-@W@5 @-@Q@N @-@K@g @-@E@w @-@?@ @-@9@ @-@3@ @-@-@ @-@'@ @-@!@ @-@@@-@@&@-@@;@-@ @K@-@@`@-@@u@-@@@-@@p@-P` @P  A0@/$pp@-P` @P  /0@$pp@-P` @P  0@ $pp@-P` @P   0@#pp@-P`0P @P  0@#pp@-P`} @P  0@#pp@-P`k @P  0@#pp@-P`Y @P  0@#pp@-P`G @P  0@#pp@-P`0P3 @P  0@#pp@-P`7 @P  0@w#pp@-P`% @P  w0@e#pp@-P` @P  e0@S#pp@-P` @P  S0@A#pp@-P`0P @P  ?0@-#pp@-P` @P  -0@#pp@-P` @P  0@ #pp@-P` @P   0@"pp@-P` @P  0@"pp@-P`0P @P  0@"pp@-P{@#g>t3GP pA0P 0pp@-P`@P  0@"pp@-P`@P  0@"pp@-`PF@K#aaFP pP U pp@-P`}@P  0@s"pp@-P`@P  s0@a"pA-P @#g>t3GP p4`P  P `~5p@-P@"g>t3GP p0P 0pp@-P`@@P  20@ "pp@-P`4@P  !0@"p@-@R 0@"p@-@ P"l?o2FP p00pp@-P`@P   0@!pp@-P@P "!0@!p@-@ @" @-@ @9 @-@ @P @-@ @i @-@ @ @-@ @ @-@ @ @-@} @ @-@w @ @-@q @ @-@k @ @-@e @ @-@_ @, @-@Y @A @-@S @V @-@M @f @-@G @{ @-@A @ @-@; @ @-@5 @ p@-P`@P  O 0@J!p0p@-P@P  0@9!pp@-P`@P  , 0@'!p0p@-P@P d 0@!pp@-P`@P   0@!p0p@-P@P A 0@ pp@-P`@P  0@ p0p@-Py@P  0@ pp@-P`0Pf@P  0@ pp@-P0PS@P 0@ pp@-P`B@P  0@ p0p@-P0@P 0@ pp@-P`@P  z0@u p0p@-P @P 0@d pp@-P`@P  W0@R p0p@-P@P 0@A pp@-P`@P  40@/ p0p@-P@P l0@ pp@-P`0P@P  0@ pp@-P0P@P F0@pp@-P`@P  0@p p@-P@P #0@pp@-P`@P  0@p p@-Pq@P 0@pp@-P``@P  0@p p@-PN@P 0@pp@-P`=@P  0@}p p@-P+@P 0@lpp@-P`0P@P  ]0@Xpp@-P0P@P 0@Fpp@-P`@P  90@4p p@-P@P q0@#pp@-P`@P  0@p p@-P@P N0@pp@-P`@P  0@p p@-P@P +0@pp@-P`@P  0@p p@-Py@P 0@pp@-P`0Pf@P  0@pp@-P0PS@P 0@pp@-Pg@Cg>t3GP p0P 0pp@-P`@P  v0@qpp@-P@P 0@bpp@-P`v@P  V0@Qpp@-Pf@P 0@Bpp@-`P@aaFP pP U pp@-P`"@P  0@pp@-P`2@P   0@pp@-P @P C0@pp@-P @P 20@pA-P@g>t3GP Ip/`P  `P `1p@-P@ug>t3GP p60P 0pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@tp@-@Q 0@j@-@R e0@`p@-@0 P 00p@PP#0S  #p#0x @- @@"$ 8QP 0R @-P Q ao// ??P M0t 0 @- @-P Q @8@ f<0< 0 ( g$0$ 0 \ 8 0S p@- X@P`@@PpP p@ ( O|OA-P`p[# j.@P  P` `pph"څP` _" /W" `//0Op@-P @`_PpP p@@- #.@P $ T0 0 0 NA-pP .@P"  A0 0 0 婋P-`P  C` P0 /,0, 0< 6@M  @-@P @ f }0 0X d  -A-M `V $P 0P @P-pP  0P  =ЍAЍ/ЍAЍ/ U0 0t T (@-@P ;@  }0 0X 4 p  p@-@P x0 0 0R0 Pu-0P Q }# p@ppKd9p@-@P `0 0 0R PS-0P Q [# p@pJ8P/0 0 0R /JP/<0 0 0R0/P///XJp8@-P d0o0 0QP  00SQ #I7P/0 0 0R/I@-@P \0 0 0R  ,0P Q "00PI@7P/00 0 0RP///H7A-PPM 0/o0" 0P R Ѝ R0 p 0 p,`P 0 S  R @  `P .  00H66A-@PM 0 0 0R ЍQP 0  0pl,`P 0S ` P `P -000( ;$0$ 0 rG<5P  P H0-0/o 0"^ R  R/FP/D0 0 0R /@-P oHFP4P/D0 0 0R /@-P oE3P t0/o0" 0\ R RP Q y$Qqf O/E3t3P 80 0 0RP _\f O/E 3(0A-SM`.P@U Ѝ0 PP +pP 0 0 0P* S'P0S0"Q00" +@P X 0 0 0 @Ѝ( ~P -CP 00#0 0 P 0S S R/P/ R0/  @-@ @\hV0p@-S(M- @  S  P d` `YP rP (ЍpX  (ЍpP@  E(0$ $0 /lBd @- @,@-$@@lA@- M`@p;P P0P!s* 000 Ѝ%0"S@- M@Pp` `"$qp  000 Ѝ0"S 00 S 0 P :\03#/S 0 P \0///A-Pa`iᣁ@P {(j*pP  nኁ@P f+ԁW@Z, M(0( 0 d(p?  00 S 0 P :\03#/S 0 P \0///-M 0  Ѝ-M 0  {Ѝ0@-M@P0  @0nЍ00@-M@P0  @0aЍ0@-@P ,0 0 0RP= /P/0 0 0R / 00 !S R!* R0:/ - ^0 : 0P0*  R*/@@/ / =P $0 0 0R //<P $0 0 0R //;P $0 0 0R //;P $0 0 0R //t;P/`0 0 0R / 0   \ /!s00/S :<;P/`0 0 0R / 0 ɓ \ /!s00/ S ::P/h0 0 0R / ! R0* /0- ^04 T:P/h0 0 0R / ! R0* /0- ^04 9P/D0 0 0R / 0  R /\9P/h0 0 0R / ! R0* /0- ^04 9P/`0 0 0R / 0   \ /!s00/S :8P/`0 0 0R / 0 ɓ \ /!s00/ S :8P/h0 0 0R / ! R0* /0- ^04 7P/D0 0 0R / 0  R /$7P/X0 0 0R / 0  S /!s00/ S :6P/X0 0 0R / 0 S /!s00/S :`6P/X0 0 0R / 0 0 S /1/R /5P/X0 0 0R / 0 0 S /1/R /5P/D0 0 0R / 0 R/ /5P/X0 0 0R / 0 0 S /1/R /4P/X0 0 0R / 0  S /!s00/ S :X4P/X0 0 0R / 0 S /!s00/S :3P/X0 0 0R / 0 0 S /1/R /3P/D0 0 0R / 0 R/ /3 P H0-0/o 0"^ R  R/2P/L \ /  JQ\/`2P/L \ /  JQ\/2P/P \ / Q/S/Q\/1P/P \ / Q/S/Q\/<10PS@-M ppP ` F Ѝ@( RP +B 0R xR#  P 0S t P Ѝ P PS O-MM(@P p$`D1000000  00[ Q`$ 0`;/0 `+ 0S Mߍ cP 03/P 00$ 0:/P 000  0SMߍ@p@-@0@02APLs07LUa`L~0 0LWLP V~u0|0 ^P0ppO-KM PpO03@0 0 @@@$@@@(@0 0Cs0S[30 0Cs0S[G 0fSI W"S_ [Sz 2 0 @3/P 0`00S 0  0Ls0SR3 /SU p,p`0 S S   S S/S >S S 0 S S FU  RbP0/S4 0(00>S7 S> 0S 0Cs0S` /`/OR3 0As0SQ ` 0 S S/ S- (S 0 S S%`FV0S pW0(00>S`0   $ 00 0 c S =S`B`0"S0S   0"R R  "RC$ >R|08 DG-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R@" tR Ѝ mR8 pR oR sR ;R@' ;R@< tR ;R@>P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮fk]\"R /R@S00S@Ѝ!1 0  0 8Po 0 +r  R7* R0f* \Rc  uR_ #PZ p  RU*6+IP0%0R"R    H       SP Y/ Yy  ͕ 0  YY#*-"-   )& ꀥ O-@-`p 0Gs0S OQ3p 0Gs0SQ#YWS S @0  $@ 0S>S 0 @>SSS @@ @pP (0SP  R @#W' W0S@@W@#_PV `EP @P D :P0Sd1G-`-M7d!"@PZ ,ppQ ?pQ 0PH h```SI# 0 p hPPu5   p `p#Ѝ0p hPPu  000 hpJ#`D#Ao/A-PP o"P`p @!@P-#@@!@P p40,p0P4080<0  @-u@ x@-$@@x x@-@@O-4@T ,p P @Dp@Ѥ@T `P煑Q@0< <0 dPZ PZ P$ $ @-R 0P< P 4Q ,  D )@0@ 0 4, (0( 0 +l dH @p@-M@4 00R0SP,0SER 1`V- P` 0 0zP 40, 0C40P% &`ЍpS' RW"^S"Ѝp Z0 0D p yl0l 0D X cT0T 0D @ i<0< 0D (   4 $ |A-@`,pO!PP W 0 !y,P0` ",P0`C-`0M@SPpD  mP!00Ѝ!0 QP ,0ST !0 GP ,0S(0S0 0 0'P 0S>0S0"S0:S  0}S "S000"S P  P d @@ 0P !, (0( 0\ |$4  h0p@-S \  Q @PtPop 0 0  x0S 40 00$  0  0 @-D, $40@-S , 0C40P @ @ <0< 0 ( $0$ 0 Ė D 80O-M@ Ѝ@p` !PP @ ` @ЍȒ ^ |vPP0 t004QY  4 R] , 牡 0Qw  ~ P 0YIW  B B!8f,0 P 04 `<0 4 0<0 D|P,UN<U8U+*Y&  ᔡ@ W +P ( DvPP) N 0,S<SS> kPK @, <0P` 04 <0x<! e,0P kvYP {,x 2t0t 0F/` W\0\ 0,H D0D 0 L| `tX ,P4 ,p@-@PP=0S L  Q<0  0p@. 0 0K/ |p@-@P 0`0VEPP p l0 0 0@S<0  0pPp( $0$ 0K/H8,̑ 0O-S M@PR z`40SM x `yP@ Ѝ\P pP 00 0Sq 200PX 0S. @0R*  P# [` "P 0 P 0S 'P' X H` ЍO@P 0  03/P  40R 1#PP 0 0U/N 00C 0P |`<@zd `0` 0U/L H0H 0]/T<4 x<   @-`@u0,S<SS 0 0 HP HPG-V `p0VSV@P8 404 S `  S` E000!,0 000,00$ 00, ,0P ?o 2@ \0S0S P`P :  404 SS`  `D !@0@ 0c/C, 7(0( 0c/:L   |G-PS @- Y`' T 1p 0R  F D 004 00R% TP 3 0S 0 Gacd 1`0` 0i/0,S, (0( 0F/ x p4 ,A-@P-& 0 0R!p;4P 40S P,0aP0#   8 ,0040U:8 408 0P 4  Q@-P80080/$p@-P@80080p@p@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P00S@#:p@Xp@-P@@pA-PP 0 0R4p`40S @40S ,0@ PW `A-@P 0`0VpP0S P @T @ <0< 0]/@@m A-`P /o0P0"Q@@T @0R pR \@P @T G@ 0 0]/XԆ 0P \@- ^ 400\@/ 0 0F/X P0P @-ox@ T\ @\400\@/ 0 0F/ X@-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0Rp@ S*,P$1 B!%b400C40<00<0r p h ud0d 0s/?P vL0L 0s/68 w404 0s/-x t lP H P/4?o 2 R0S/0@ S/0P D- ?o2 ^0S 0 SO /P/0 0@0R/`P/0 0@0R/4 P H0-0/o@0"^ R  R" / 0S /A-`@PpP (0Sp 0P  pA `0 `QO-0S@9 0@S7  ` P. X8qPp@j P d P ^ P HPX0UUUB#1 !0@<  ?,BI PO 0s 0 SX% X@0Pp#r 1yP7 0 03/P0  40R 1#|P' `P 00C 0\P  @ꀐ pG \ X0X 0 \8 404 0 P(8Dk hk 840S 0C40/ 0 0 @-6@k Ԭ0p@-S \  Q @PPp i0 0 j Pp@-@P 0`0VPp0S R<0  0p@cD @0@ 0 , w(0( 0  j pi LSG- p*W`@ V 0P 0R `00 -\` 'V 0S  Gw@ <0< 0F/`0,Si A-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p@-P80080p@-@P 80 0R@ pP0@pp@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P00S@#:p@Tp@-P@*@pp@-P@~80080p@wp@-P@r8@o@@pp@-@P 0 0R`P_40S ,0AT Vp@p@ a0 0O/Pe 8dA-@P 0P 0R Pp`28040S ,0X ,0QP<00<0PFPD @0@ 0S/, (0( 0S/d pd Lp@-@P H0 0R@ p`P@pA-@P1 0R`P4P%80,0!qW&  P  1P ,0P < 0@400<0AkAD @0@ 0W/8, (0( 0W//(Dc ؤ c 0P D- ?o2 ^0S 0 Sf/0S /p@-`P@qP (0S p p@ @ B $0 //@-JP0p 0 ̤8c ФO-IMP ? @T `p0 R 2/0J\ P Y  9/0  pfPV @T!1 0 003/Y@ 9/T IJT T @T@" 000Q 1/0GJ' P70S+ 03/P. Y 9/!J@T 0 0( d 0 0 [Iߍ 0 0( P 0 0( GY 9/Z 0 03/X T0T 0( 4lb 0da (@a Тa ܢ` Ģ` 4P0/O-MM(p@ T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT0 00AP $ 0R000 Mߍ0 #,0, 0H R00^ < 0/0/@-@@dA-PPMp`2 0S/ n@0U  UU 0 B/P 0CU/PU  U0 0 B/Q 0C#@ T@! i;@04D .00m 0 R* 0 0@p@  V ~r0P@%vrPۍqr?00@ۍS0p I`Gp p Tr0P@@ p@-R 0@S PR :   Pp0P  ,0 `09\ \0 L0:H H0 80;4 40 p\ Н[ [ p@-@Q PPpQp0@-S MP@PA` Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPUt p0 EQQ Px, (0( 0 #<țlX  0S p@-P@ @Pp 0Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ #0 0@ W ԐĘ0p@-S+@PPU Q PpQp<|Pp/uP PQ mP Q>p@d Q0 0` uV ԗ0p@-SG@`PU Q Q EP<@Pp PU Q 4P QPU Q 'P QpPQ P Q/P >p@  c0 0| T tA-PP4 0Q`pp XpW* @P&  P N 0VC p` 8/PPWU`<``Q# PDP P 0S $P P PPL H P P 0 S p@-P@PP (k Po0@o@p xw011/@-@$Mp`PP P1S$80 02P m C$ЍM P 800p`P10  @80A4 40 [$0B 0 SR ,@R @-@^ P ^%QRS  T00QNRS"  TŒ 00 Z0 0 Q t G-@R(MP00Q P 0 ` p Pl `s0T?o20S00(Ѝp`0 0 0000000 0 00Q0/0 0000000 0 00P0/ 0-2/    S-0 2/     Sp@-@P(MP`/ 0S, R00j$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  `M P0V00(Ѝp@ R 0S V00PQ0 @0/@-@p00T0;0<0=^@-@T @-@T000 000S/@-it000 000S/@-it000 000S/@-i`t000 000S/@-i t000 000S/@-it000 000S/@-it000 000S/@-i`t000 000S/@-i t000 000S/@-}it000 000S/@-mit @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^ \#耒,0 02#/ᜑ0 00#/ထ0 02#/\0S@-@1/00/T0T0p@-@ P`0S PpJmpht/000 000S-/@-h-t@-000 000S/@-h4tAo//- M0 vH0 Ѝ- M wDPp ЍQ0- M Q Q l 0 Ѝ H0 Ѝ^ B$0C/0(/0$/ M,Y>+,0 m @Ѝ/(/$/R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ l P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@PBg8U5U5E03#0@3#C#!@11@  /  } : S-v P Sd0 V Sb0?0 !-0r-w0-0 R0U 7RJ @Rx00  0r -  w -    RB R7 Rx 0  r-w- R4 R. R$ R  x 00Rs  ! Rs0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- - S0S t T A0a0-0O-^A@pP8 "_P8  T^pP% 00^` 0@T [hP0=S AP` AT BX ! j_] k00C-PMTT"PP2LB 0D@$PTPf PppX`\0  CXlP hpk  hp` $`m n   !p[ p0 0S8P'0$'^H1H 000D000@^&T P #j0S vdp@ g g  Ѝ5oЍ @j0@ 0 g g g܁0O-Mp`@dP-TPk +T @`0Z ǿ  0ee 0 ]e P ! @00Ds \a0DSW0DA0DS70DWUX: QP S \ jP"00 0U00S 0pS 0F0 0 Ѝ0S U0 Ѝ0T W 0 p@0` 0 XR 0AA B PR W 㙉 㙙 p噉I㙙A p`@Wp p~BX0R"\0@-0 M@ 00 Ѝ0@I@PiT00P Ѝ0p@-BR"^p@5@PiT00PpO-Mp`@dP-TPk +T @`0Z ǿ  0d 0 d P ! @00Ds \a0DSW0DA0DS70DWUX: QP S \ IiP"00 0U00S 0pS 0F0 0 Ѝ0S U0 Ѝ0T W 0 p@0` 0 XR 0AA B PR W 㙉 㙙 p噉I㙙A p`@Wp p~BX0R"\0@-0 M@ 00 Ѝ0@I@PhT00P Ѝ08p@-BR"^p@5@PhT00PpO-M@Q`@0@HP8U00B PR"Sa,1,!0 000S 0:S 000+ C#F00@te ` p 0 0D0G0Z108,(\\\r8\q@[p([[ZS0 P @0P 0 0001 1 001Sa 0 p@-@0`P1S ,0S  X$0S  XAppp@-@R00C0S0 PRpP--M  C@Ѝ Ѝ/ -- M0 0? ЍЍ/0P0@-$M R\ P@0S$  S"\  B0!0 00 0$Ѝ00\L0 @0 P 50S$  G]̕Lt]lFP 4000S$/00//8F\F\A-`d!P`1P 8M00400. @  Q ^  @2 hWU\pU 0 0 40 30/8Ѝ @A\Up  KW@p@ pW ^P\ 0 P 0 @2\p(@p@  0tq \W- M  ЍA-!M@8!000 404 1pP0 0<804plt0P 0 0 <8 300!ݍP 00 Bp  m~PP@T Cn`4 P8TAtP]P @T@D~A~ TV0!A- !MQ@`0P0 <( 040 004tP>44p ptP2 P0 p B p ~PP!@T Cn`4 P8TsPO]P @T@0S x }\ H0 0 <8 30 !ݍ400}$ ,``U[^^O-FM M@$ĝp3 0ZT0d40X (`d 0F00;P0S 0F PU 0 P(00B`P '$PvPq$Uh ,Ph(,BP r$U , \Y "2 0 d4 30Fލ Ѝp 0kP1`P\P \P: / HqP@ @U  A=`W= WI 0! 0 0`0 !0 yPttu 0$0SP / q@!0 P  00! `0 00 00  `0 00 0 l60 ||)YYYYpY`Y Y Xh StSXtXPXg00-0ٶP IPh 1 S S   t#@ h# S`  000 S ST S0 R R R R B RQ@  BQRS 0S1 @+S7 -S[QUp @Un0S 0S 0  00_op`R0+S4 -SF XPPUpwV WPR Pp S 0QUp @U40S\ QO 0 000+S_opR0S @S0 PP v_opR0S @S!0 PP`  ]_op`RU8 0 0 2 30ߍ7XPPpPp p~ S!@B d( ĊRt"O-`l2 hŸMM@0 yP08006N M.0A 0;PY 0SV ܀ +Q+D4 0  0  0P @^P3H0: S4 d10`! 6 E   >x}0/CP"P2 0@-@Q0\MP0T00 @3 2_.p@0@ +JM 0  231 +456789:;< =>?  ! "#$ %&' ()* +,-. 0/0+ ; DL @0 0 T0 30\Ѝ0!@Pw| z @-FM0 M `@p00d40`~!DPPd@!a~+3 P V@GV R@8< 40 0 d4 30Fލ Ѝw\zy@-Px dMt0@ p`00\00!~ )~0 (0 0 \0 30dЍR\yy+4*4@-M8@ 4@L0 >Ѝ|?80P1Spp// 0 0@-PQ0M@000   M0 @R C0(0L @0 0 0 30Ѝ0)PPXxp wG-p!@1M ࠐ0 U040$e=㊿P&0E W07pPUo0 ;u0+ p@P   0U0 U  VPzVTP V@pU@  x p0 0 4 30܍ 0ELQVpxP|`xwdv- M 0 Ѝ@-Px dMt0p @`00\00 C0 (0 0 \0 30dЍguhu0 ,0O- M@Pd@80000 u  @0\80dl: >b@`'9:E`@  `&-L@` 'h@ l "H`4O <!  -fapP,(5_͌b! Dptp& 7|!x 9l '8*. p"pp' p`@$;`,P%` (  `&}`am8 )  " gq-9* $@!@@$ @fa01.' +)$Mb!.p &7 dA(,  0" P%͌9n `* ! o`P%(, *_ᜀ!4$` Pl(P .8  "**!+P.$_p'+**뿠`ꯠ p' p'$`篠pp@ p- 7@$ " *(O0 +ꯠ"뿠, ) `)0` *"`/4)뿠 *( 韠/`,, ( ( *( `菠 p'af! p'  杉 p'`(`& `&珠`&p! pio` `"``&p'` $p͌P%P%nP% P) P0 P% 00(P &,`@$l@$ "P`@$ "oO . ` "P, ;>F @@P%@ (@ P-.a.P P%M b! P %P! ,P%,dA쟠 * P͌ P P௠" nP] p$!( p'l+ p.+$ p'  eQ $@ ,p!-@$p +@$p, @$p'`뿠O@(@@@ @(pM'p%.p'.b!$, ,p ' p, p ,pϠ( P,pP dA],p,,pϠp ",ppn} $ $   eQ͌ "( " "/  . "@ gq  " @ " "@% @$l/     @.- .. @'@$`,A@$P@$P@$P,P%b!O@@`&@p@$PM`& P`&P` `& P P(`n ,],,`,`"`&dAϠ  ( `(` (.͌ )eQ`) $0 "0菠@0 *!  "!0 "ml!⏠ %  "fa04`= , /H,)$P@+韠 +@ +@ (믠 % ,c1,$PaA쿠   (`͌%4P!!_PPP`P P& `. .lQ$   0&0` 0# 0#Ϡ0 a00@0&@ ,`,=O @nA, $&` ͌ c1P&4P` P ,`Pl PP& ` !!``͌`nPP@P `].` .`.l @ 0@͌p'@0p' `p'0@00@@eQ@ 0&$`M0#la  (p0p0#pp p } dA  4͌?))()gppP (P( p( p]菠 4pl `(eq`& `&  Po,``PP@P*@ ]*@@ @n@$ `*+M ( (ePoP菠 $ P 佋P*  p,(,p' P%  P%  p' (! b*LdA`$`<`00͌`4`0`) `&k0_00`=.`.(`. `$ `& l `(`&`& P+柂`P%@@P0`( c1P`& P`&p,Mo``, `n`pp0#͌0#dA `&0.= .lP @$@$c1 @,M,n0#,P͌0#dA0.= .l$ @$@$c1 `&@(P,M,n P0#͌0#dAP0.= .l @$ @$c1 0@,M,nP0#͌`&0#4dA0 .= .ol` @$ @$Dp @-`XTHc1L@ 0#0#\`80m < P`   C$00 0 30Ѝb+ ;0   *@C/ #EgܺvT2A-1`Pp00.!؁0% "0 0%0?S@@h G0hS@H"p ` # *0S@@:p`F AG 0G(+ ;1CdiDi thThp@-&$@M0 P0 00 0~? S `` 0~? S  U E "0 0R1<30L <0 0 0 30Ѝp" (a!4 T` 0 0@-PQ0M@000   M0 @R C0(0L @0 0 0 30Ѝ0)PP_, _G-p!M@1M ࠐ0 (U050,erP&0F W08APUo0 ;u0+ X@P   FU0 U OPbOTP O@XO@  x0 0 5 30܍Ѝ 0,FQ=PᘺppP|`z_^- M 0 Ѝ@-Px lMt0p @`00d00 @0 (0 0 d0 30lЍMH]]  13L @0+/ #EgܺvT2O-MH@@P  @0\;\ 0EH  @ @ , p.`dK p' pLl̆  zP "P% (n+PhPdP !lˠ ``'H`&P` PPTg{P%hP(@ b+l@Zh@@@$` @X\a&)Ifk靇pPt e[, .` pȂ`p  n "dK p)d((i茆`Xp|p lˠ! p.p'np`` PPhP%{P`(`&l`b+\hj `@@a@$@' g{ L& +,e[ pfktl̂kh|  dK "  .` L* lˠ!xp+(akh`ppp PPb+P%P p.p'npeY|T``x@0@@a@$ 0@`(`&dʌ` )@hk0' i`@0#e[ , $1 MP3 * 0 0 8 30!ލ Ѝ"9p pPP >P* @D0*@5 H@?p@-+,@@PPpH0Pp@-@pQ-P0|MSR pOPH@a@@`P[yD   P(qDP8mDP  (1P*P@@@[\D   P(TD08PODP (`P @@@?DR0 00//;@-MP `@ p#DpPU0D>S 0!3100 0 DЍ>SH 0!3100F00F00:/-p@-M@P@U0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0z( $ 9p =Q@-@B 8XA^^14/.-,+*)('&%$#" R"  @  +S@ -S =S  +AR@00R- - ++  @     0RuS/WS\0@-X0CSLE ;0P0R ^ @@PSPQP@^  0  0 uS0WS+S -S00I0 0+S -S/0 0 O-LM0gS` _8@(P  㪯pᨯ 0 0E @ >E@Th87 00`0000 0 pa0FSX% $00+V@ 0-S/0=V00| 0P@ X B R d \VS  "=V  R   P:0@$?E >8E R "0@$   Y 0 S:$ E@ `=E0S 0"0C$0 WX    `V ,Vy`PZS  Z0P$D $=D R "0@$   : =Vq +0FY?o20S Zk 0W0 00X00@ Z$D P=D0Sj$0"" Ⴁ@ 0 T000 , GR;(I?&I0$0" GR|<ID @ᓷ00S@9D0"SV  T3* 0 S?*-/+  @ LЍ'}`pC~p =V  !00$cD P$5=[D0S  "2 @$~OD00LD@wHD@LЍ}$?D P$=8D0S$ 00C01Ds*D00 0+P-@`X` +B XRp R  0+B p-R +R XR 0 -R p pWp@PPQ`5-M 0  p`Ѝ 0P P C C C//o`/00/00/00/ 00// /0/0/ 0 /0 // /A-@pe`G1+PC1U PU  0 XP PdC@ӬѬ^C@PPr2UP ,000]p 00`@0p@-0P`@T 嫬@T0rS 壬Ppjp@蛬噬P0+Spp@[Y勬hA-P@`r\ 00pz<0p0 ` @ 00pj|@- M00j0P0@10 0 A 0100S6*p@& P 60 0 00S00 Ѝ0 0 @'0㐭B@6`0 00S B@ Ѝ4V(R4*t@- M,A@! @0P00 000S.Ƭp P 0[0 00S&0 Ѝ"ϫ;`Bt0 00S@ǫūRB@ Ѝ0$(t818!0@-Pp M0S'1@T0 `0`S@# 0SV00) 0S"PB0S% ;p < Ѝ|t0@T0S \A00@40 0 t't,pP0G-HM`00 0P8p ګp@ HЍ@ 0pP 0  !p «p@ HЍpA0S @We!0P Rᨫ@O- G1@000 `0 00@s40,0`$< 0P)0$iZ 4A$00 `< Z00[0SP$04@0 !"H T(02@`0 0,0$00T Q S #.E!b)L@T(\/H0#"A $1?"!!#6 0[ <ЍP3+00(00!k43/0(00!d30,0E [-Kd K { 2\ T$`@ `P40!;P 0[^P$`40@z ^X$:6S T00Q$0%!>!E!2c(\/H) L0T!"0 #1O"`0!0(0 0,00?!D@WS8 5HT1>O0000T` ;0S00@000 10`00d`00@t0d`000;000S@< ?00@pşO-ph MMM`T㰰D0>$5T0$0$*0*U@@ R R00C?o2 00⃰0S U0  S0E0'0Sw0000Sf0d+0!5 0@ 03/0S| 0@4$ 0000(@,00F$003/P   0S00*  0.S @T0S0V:0S 0S , P8 * R  cP $0D Q01/ 3 D1 0(0P00 0S 0 P80: S 0" $2 MލЍ0S} 0  0 0s00Sz P@T  0s00Sh0>4/P 0 0Df00m0   0D y 0.Sv0Sa 0.Sp] Rv  @% 03/0  00.SJ Y P D0 =P9 @,  2/0mB 0@ 03/=0Sw 0 e[BQ=0/ 0 0 @ 03/0HBEB0id@O-TpP"KMM \ؔܤ $ 2 /\@ P@`P\/\  `W!1 0 4 30cKލЍV6/\T*/ W0 /\ \@P  P`P 0   R  ; T/R  * R& R 0 00  0* r  R@  (03/0S0: SW/00Q˧0=/0`0O-M$MP@ `%0  ~S <    pH 0/SS;R! B00 4ZS *0H 0;P4S 00C PR IR*0S0;R 0X @H p S  ! ?*OO **S1 @s000S ?S! [S!^H QM00@ S000XS 0H , R @ 0Ა@< 0 0R  R QX Რ@ P +@P[ "t2 0 0 30ۍ$Ѝ@\0D  Sr 0]S!^[0?O0!0?O0-0O]S  s000-S]Q q0 ]S 0@< 0]0?O0o  0BW 0R S0BW 0R S@^ 0 Qu  0A0 00'0Y p 4.0P*0H 0;P 0!^[00  @#Q@b@`}p8QO-MM@`p  @ 2^ @P@\ [\ {\P }\U PE0]\\ \8(~PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S008( #0 }^S0CV 0F 0C   /2  @ ]RR ]RR { 0A- M`Pp 0S0 0#0{S @0\ @{\0 pMP Ѝ0}S0S ЍA: 0 @-MP M`p0 G0000 0 0< 0 ;  S ^00  ލ Ѝ; RPB @^P \^ \P^Yލ Ѝp@-`Pp@0T@D1 0CP@DP t000p0 S. *S8 ?0Cs\#S 0 P/0S /Q 0S 0 0/ 0 R/@-@"R,$ \5 BP   @ R# 0  0 BQ R 00\R @ #  "R 0@T p@-` Q QMP1M0P050  0 0 5 30-QލЍp @0  ̠p @EOp 0 \PD8  0P0h<T} hL@5C-0eM$`P 500S E p@#S!90 p嗡P$ 0S (%P @ 0Ss90SЍt ` p @0S pG4 0  0Sx t刄刔p 0fS0fS 000S3R0S <$ 0000@SV 0oS 0oS0nS 000S3R0S # 000 ?6P 000S3R0S x# 000 *6P 000S3R0S (# 000 6P( 000S3R0S5 " 000 0#S 2 0@ R@@&P00Ѝ0 S Sd 5P 000S3R0S (" 0@00q 5P  5P4 000S3R0S+ ! 0 00T 000S3R0S ! 000EtP `ⷪ@0S0 @  5P =Q(&  0P00 z5P =Q&  0P0 0 0 0@0 K $(`@,|tx `pw p@-PTC5P e@T$PPP 00p긾@-,@@P00@O-@8QMR0X0008 00TPz 4pu)p003 [W  t7U (8 0 0 30 Ѝ`s?0l0` 㰨p Y 2  ˠUM ? 0 0 0000S'  A0 $0Ӡp Ps7<000S[ i700נ@c7@Z 00 \700` ᫠PtZpJ A|\#R PA|\#R QA|\#R VA|\#R~ SA|\#Rw RA|\#R  IApP#R HApP#R  GApP#R& LApP#R> MApP#R4 NApP#R* OApP#R# DApP#R EApP #R FApP #R 0X:U 0 RX H 0  iP  00   F0 RR ,Z -0S 6 00p6pX 0 W[ 600 @6@ _0  G  0@p0  80   㰟0 "   0 "    u@@ୟ,0 pC* (@(xX { P;00St[v+ 5 _r/600n 1o  [id 0(@ 00I JX0`0`  X`H X`F 6vA0 50SY00>[' ~X0 _  &(`HR   [a X;0;0P p$ \XԶ- M0ˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpFEpP -P ЍpG-p@`@0S&@@Q0)Ȁ\@@\  P p0 R * សp0 ᖟp0 xd@<p@-p`pP`P@T T0T0 R@@p;P00XpP0A-`Pp@P@0S |@@Q0 R"@`@+P0040@ĕ@- 00 (C-`4MP&@P 0S|0V ! UpЍ  㽧0P;  =R6 0Q*G B&R&>$#"M = -RpY WꘀqꈀvKSБpk0X{FH _ 0괲ԲH<ذO-BMM5Pu0 %p05 0 0 0 $  G C+0 #P 40 4P P@\ P 0S l400#S \ P 0S 4d44`0`\ P 0S d4`0`\ P 0S 30 B\ r0P 0S .c30\ e0P 0S !c`30X3PET`0L + *P\ J@P 0S .PP[[ 0P200xS0xS0Se "\2 0 4 30BލЍlR@P\ Pq 0S @200#SF \ P 0S 2R0P\ PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ 0P 0S bH10\ 0P 0S b10 ! 10P 0 $0000 0000)0PꤰXdg f Hf x@}x(d Td |c |H(, ؽȽp@-d@@0S P Hp@P@P 4P pܼĪTp@-@P0P 4P QpPP/P ZPp@`@`jP$ǤppTp@-@P0P 4P %pPP/P .Pp@`@`>P$pdLp@-0\PP 4P p<`<`P@zpxȈ@-@@P00蜺O-S$M0M 6P@p0`U 0C   500{0?SN Sl *S00 *Q @Rt50*QLU 00  *QA[SU \S0  0 @ Q8 $Ѝ?[ [2 *[  @[[ \[0S @@0S /Sw .Swu 0W p 0W/Sm.Z\ Q /Q fpP  /P P$ЍQ /QS 300000  ^[![00 0 00 @  p /S \S> S -RE P0 U@ ppᷰ0]S^0 p S x ti p. 0Wn  0W/Shfp @`\2U/000 /ZU0@  0U ppᷰ]^^ \^  @P PӦU@  p^& @@ 0^ @ 4!  p [Q  @ P0 @0  C00p`@0U0  Z 0 P/ZY  /sQ /Ql 0000 @0nP@-@ P 0 0 Q 4Qa?o2c(p@-@lP-P X-P T00pT 00p^0 0 pءȡO-Mp!0@  "  vp` P lj10230Y ߍPT 0 WpI  P: [ ;` 0 0P P) @@ 0  Ap@ 0 &P0P S P &">0  "C0 !p@/ -RpO-Mp!0@  "  p` P 10230Y ߍRPT 0 ϙpI  FP: [ ;` 0 0P +P) @@ 0  ṙp@ 0 យP0P S P _&">0  "C0 ᙙp@^/ -R \O-Mp!0@  "  fp` P b`10230Y ߍPT 0 GpI  P: [ ;` 0 0P P) @@ 0  1p@ 0 P0P S P %">0  "C0 p@. -RHp@-`H@P@ ePpPpPP Q p@-`H@P@ PpPpPxP \Q p@-`H@P@ APpPpPaP Q 0 00 -H- M0 S0 0 0 0 00 00\100 M\  0S08 00 0 0 30KH Ѝ/T-H- M0 S0 0 0 0 00 00\100 M\  0S0 8 00 0 0 30KH Ѝ/p -- M0 0'--M  --M  A-`PdpQp @Q GPD@(0 0000A6]<0P R   0//xǟ 6 O-444 0p 34 0p (3 0pP 3 0pT 3 0p  3002#8"0l3002p * #(L3& 00#(283* 00#(2$3. 00#(332 0 00  R < 0@sq[C  1-)%!p     (p    p    R  $p (p0 p    PUt1`Iq0@0p0\p⾒2#8"0  !@@t@p005T0hAW5 V2H@00RH!x0 0 40 30<Ѝ a10p!  =)PX00X0xĬL`H {X8d@Ԫpg0,\4 `P4hL8  LXp@-@P> 0S0 '0@0T9  T04 0R/Q T: T% 0 \/RT0C"/QT 0C: B0PU0P!Th00pX@@PP ~"04@@0/S$@@@@|lԥPlC 0C,0P(  E Ϡl b0,0 W0r 00 000ZWj 0  30 S0pP( 0 0 0GWW0 0 P(0P(PW%SH7 , l,,0 Wv>C 0C0P(7 00 0!0W0.5  00P(,0 ,0$I"I/A!b!b0C 0P(  0 Br0 SfP(P Wp , 50 P(W 0$ 0 0W  =0 P( WWph 0 ;0P 0 p0 S 00W((Pg0 0P(\c0 , 0SP( 0%!E0?d"c,02#,0 0/ 0 0 000 0, , d ,00C0P(G 00 000{ n1, , N W,00C0P(w 00 0a, c0 =P(Y(P000UWb 0 0 0-0 0%P(/ Q 0 Sj 0s< d`K` 0 000 5v.1E @r2@00dR1Bn0n$d1N.b2#II   Ϡ@Dl@l 0C0c0Lnl 0C000C0 P US ZSQ- @ 81P 0B(0o R0Z  R0P P,@051E1? 3ccK?) P L@#(@cQ: ' @cR # 3 h0 0"1  B00,0DSd0,05 5 4 yyxypwdU) P40 40(00N~0 S(0| ̜ |@̜L@ `YooO`F_O  OG @DV@q 0 40N~ Q@ `(0̱P` 0(P0 0U(PP @ ACLCq| \^JS S  00S3P0S| z H/o("RPzX0><(TQQ] ppp@)CQ( 0 B ,##Pp% (' P%!E"ad2c;S,0<2#MP P(P @ @C>0P( $(0j  @ 0 @,\3P 0B(0H0@~0S{ 00@w0S 0@p s,0p0 0 0P , P(01(000C.$040a\Mc^ @P$`n @P$`G   {0P , P(0q0(000C.$00 0$ p  b0P% , P $ (0(00c$00M0 00Ѝ1A-0Q M@HPP PM Q%d1 P01$T G@@ Pp ʵ. R! v` PU  Ѝ0 P0  PgfF ` La `ѳU"T 0 ЍX  0 01"00Ԍ,$ $ onnnntn@-0M@ 0P 00Ѝ@-0M@/0P t00Ѝ@- P@hꈊp@-P 00M @`00,00   P00Q Q Q " 0 x p0 0 ,0 300Ѝp ,HN ,HH ,HB%,0@P/ P @/G-X# p`V@P0PES  R D PE0V R  SS0@0D@R@- 0BAs @ Q0C@R !@O-` M( VP? @P>  pP9 Q001Sp Y Ѝ00P@P 0 0P 0 0 =00 !00ܦ@-RQM @PЍTT !@QЍ! 00G-`-pp!p1 lM0M050?PJP @pA @\:^ X0p00 t-0 Oi00 TV.qύ@0ˠ (, ~@P  Ph X0 0 5 30 ݍЍT!00@O!00$  00- $  M  Ѝꔣ--M  Ѝ Ѝ/ -- M0 0S ЍЍ/O-R쑟 M@ p` R00?mh;00P @ P 200 P ! !  4X\3?OP2  VP W6 Vp[XPp0P`0 ``f`00 0 004 Ѝ`rpP" PC0 P P00 ЍXpP V QpP `@-@ M(0S2 0 (0 pp1/qpP`0)  0 0 PUoR <0PUo ЍPPT` 0S  0CPo_ 00P`@-P M(0S: {0 "(0 pp1/qp@`0/  0 0 @ToR <0@To1`V ЍP@T` 0S  0C@o T00t 00m e2R/p@- @Tp E2 Rp 00R0 " P 0S PcP0 00( 00 0 S ,P 4P 8P p@[p@-P$@@}Jp@v@@- @@oJ@i@~p@-,PPb $K@[p@~1!0A-M0 @`00S P  0 XR0P P S= p5( U80C0HS60 S0QT.* @DT*T( D0 Qs0U   "Q T #R.S 0A a 0C "T #R Ѝp0@4  R  *4 8/p| 0X\S 040:8 R РS /LxB@-Pp`*P@P@0@D尀 °U   zi똚Z@-P`@0 @- G~@ \\\% \!00qP`\ kqSHX70000D00,00 00#U00 00p;U cQVFP@|dQ ^1 \\00SdQ Vl60100 U =U U 0P060000  l 7PEuP000RP00ES0100C0{ U U 00p 50000  M70Es0 0_00D%00   00Es0$% 0W0Cs0 20M0?Q000D00000>-Q004 ^QV00/00 K 00Es0l0W0Cs0 000ESF0100C0\A#o,%Ao 00&Ao  00=Ao#P 00. 3010pS%;U d30000 00 C10PP 0AnSrXGFEDCBA@:gSKIC:-$ 0PE0P0_00\00]00T 00U 00P 00K 00F 00A 00<007002\00-00"cQ`adQx@0PEuP00Es00<00pL00     O-P Mp[ @ `@ 0 H\ QA 00[0SSQD00 00T 0000 Ѝ SQ00A000  00  ໅L[A-@ R`PPo /.#C=1"#BbQqU? 0S$ RV 10 R RQ 2/!1U 0000( 1/P p $@0081003/P !p0  $@V00 p00 R (й000P3/P! Up  R  SVp   0S=iP00U 4rq3qX334Zp2X2A-@ R`P Po / "H0#BbQqU? 0S$ RV 10 R RQ 2/!1U 0 000( 1/P p $@00810 03/P !p0  $@~V00 p00 R (?00 0P3/P! Up   R  SVp   0SعP 00U oo<1do10WnL00G-@P P`P $rp^t F 00 Rc</.#C="#2caqV; Y pkPY` $00100S p \1003/P00H 0 $0(100S100S& p3/  000``0S 000S( 3/000(㚸P`0003/P 0| p 0000S=>P00~00ml|.l4.`lHl--kG-@P P `P $rp ^t F 00 Rc</ "H#2caqV; Y pPY` $00100S p \1003/P00H 0 $0(100S100S& p3/  000``0S 000S( 3/000(P`0003/P 0| p 000$0S㢸P 0$0~00,kj ,$j+iix+4+\iSR: G-P0p`00S 3/0Y @IOP = T0 0 0 0 Y @IOP * TT0 0 H H0 0p`P   /l*hlh\h h) hSR; G-P0p`00S 3/00 Y @IP T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  /P)gLg00 @?00 @00 @0000A-@P Q P`\PpT@P P`V 0"S ַ00@p@- PHaM`=  4QP009 P; 00^% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P <0 0  O 0 @baaP/:P-0SP S:R S 0@S0S S P:P@P :R0P:P 00/\"@-@A0 R R:\|\00\0S Q0A|R  :RRO-M M '0pĝ 7 00D40t4!S SP G@`V 0P0  ppP 00S D  P R($'  0 00 ' PM00P000xP ` [0@`0 S ZK :SP\ \S S SP0TD*[0+ ՀP 0`0 SZBUP@0#SS ZP5@P00S0N0STD0A0:p%5 0 D4 30Bݍ Ѝ:SU @0T:H@DصP# @pP@DU  00 0S g00N@ ĴpP  @Ϊ4@00S0 4 p0(040,P$000= Pw 0:RL p0Rt4@<0 0 G0$<4`P pdPY pJ 0:R2 P0R 0E`F00S:S:00`0H FZ#0 D 0 @c  _ 0CXPp` 00D!Rp00GP 0H@D IpG<P @ p :00`0000 0 0(S,P p% 0`S `姵"0 SRC q@᜵m@00P  P1@<P兵 04`40080 p07/p P { E{0={/C- 0sM @Pp0^010X0pA00tAb0O➢0`P0P PV TA0 \ 0  $@4 (0 0 1 30sߍNaPa00- $  M  Ѝ`O-M`0?000301S01Z P  pP0%%[ p@( 0S0 R .> 0 3 30*ߍOP0 P P0C S 4$0@D 0zSN~}`{zyxwu1lj0 ea`^  [GW000P 0C0PG 0SH00E 00 0 0 0 00Sn 0  JZ 񏐨m:P0 P 0P0C0S0000D S9*0= $0R $ (p0J p 0, 00A@QD?g^Y T0@p Z3p80 P @T0C0808  0S0P 0 p0080 80 0CP/ 0T@0 0  0S0- / #RR 0T000C0 p0 / #RR p0T000C0 SP P0004 0@D }1T@!@=$080 + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Z} 8 00C0S_000@T80:S XRY    0$- 0        00080$ 0CP000&}   $   S|@ @px`& ZʱZ|  }(P {#P 80P# Pp0 T0C0  SP 00C0S@I0 S0  @ p p,0SP00S[ 00C0S000]0Ze p @ p,0ES[ P 0@0C0SQ0Z0 I @0 pES p PS[ R, 0@0C0S 0 S000L @+ D  p@ B R W. @JP 0 p@0C0S[0000WX +D @AQ 00 R @ pNTA 0Te@AQH 00 R p p@XQ[@AQ   R @ p0,0Ks0=0=$0Z #  R #  R4 WW p B PR @  PK0 SH 0iT nT  (p B@R  00[K @ R񏐸D" AR> p@ B R 00W@ NR- p@ B R 00W @_ (T @ B R 00 R@p )T @ B R 00 R K 0 S @5*ZZ 0@0$0pT 0U04 08$ 6 >`00 500S 80SG000:[aP 0@0C0Sz0Z0  @a0SHP0[ 0a P0[ 0`(P$@p 0 0 0[ ,$P0W 0@_p8p / #RR  @T B   8 008 80?03SS1 0@T0C00008000% 0SP 8W pA00000P<0 S9 0@P20Z/ 0@8pQ:8PB0 S? 0$0 __T?o20S0 p@0C0S0 S000 Pl 0  B 00 0?@0KA `0کpR P p PZ 0@DpP 0S80 00C0S0000 S @, pWp 0`(P$@"  (p B@R r 00 Rh$8 _00 00 P [ 0@00P P]U t@ 00 @P00P `, 4 ` V   v@P  PP0000@4nPP0WM 0@+P0W 0 @1P90 S6 0p@6PB0 S> PP`9 7P0 S/ /J,P60 S3 0 p,@{P 0Z p PP` kP0Z 0@ W @ ptTTP0 S R" @t[$ S C8 S6P0 S 0 p@0,0:p4ش @-0 P (p m(p` P1 P0 S 0 p p@  (p B@R  00 R P0 S5 { 0T@3p[Np 02P/ 0Pp00[ 00`=<;:987654310/-,+*)('&%$#!  h^0DS13b0 d  P 00Ds0S 0S0 S  \00T3`00 01@000@0@PUc*$Ѝ@\ M00  P- R@ ^^? 0 `0  ḤP 0J ZS0 - 0J ZS)X1 0000 $Ѝ 0S0 10000) F0' 00CFs0S`0`C F F F F F F F0\  @`\s\0\a\b\t\n\v\f\r7 QA-@p`P _P=0D! D?o2]R0S d0T"@=0 !1 U U 0 P0 A* P* A-P@p`P .T T!0DI1(0D,TS0 Ar_T $0T"@%0 !1 * O-`'S 7WM @(0無0T1060$010 y Pޢ0P 0 rp֢0P0 [0 0 190 P@ @U1 p00PU`p! X U0 1 #ӣP00? PP P5%0 \PU`p 0pGGq WP1 P! Lt`∢pP+ @ 0S V L0 G0CSa1  5* 00  R1  4' 0(0  R1 001 001 001 "001@\001001 H\ UG `倡PUB 0 p9/P00P #3 0 T1 30Wߍ0SIP/3#0 n[P 1l3zh#h0 ^[X 00^(0S 0S,0  3Z 0P00CDp(0<@(0X(0- p`0480@ PN n~9@`0 0>@@\@TL 8@,@ Tn*0 4L3>|8050 W (0$ 2,@0 D0R #<`Ţ[PPZM* < 000S00Dp P0 SR000FD BT ᢢPP2,0Z:@1i?F㨀R 0 P P0nSP0S  Ƙ@ØPPP(B(巘@P<tpp@-``@Pbp  @PppPblPp@-M@ 3dp 0: S  bp  ^ЍO00ЍO-p-$@`,M @]@300P0PS?o2P[$100 @e0@$0 p @ 0 T  0 * 0H@P p 0n  cp@D P0S^ @Ty0 pI W*@0P   T1P [ 0 AZ Tfᄖ@Pf WP#: 10 001[ 0 P0 0P P 0 S 0S[ ߗ pK0@ @`$0,Ѝ0 ˗00 0$00S$0fP05P  000 a ap`} pz pP pp@-P 喗 @T @吗T0 0p  O-@Q M0" pbP` @[ P51 5*P@ 6/P  00 U[ I:P PU@ Ѝ/O-RLM<kQp, @<000$0@ •P_ 0WP@0`p00< 0G000p 0 `8/PppZh*0d 0 0 `P `RP(0`4``p,0 PV :/P W X(,004`V1 011p1*`G0p 3/P00[ < 00[G   pW: pW0  [:p K (08/(0P <0 0K00 p' R `P0S Pp0(06,00S 3/@Ѝ _\0(p0,003/pP 0S /A-M$P@ 0P ɐ00 `pP zЍ00pO-}Mpl"`d2 (0H010֏ PP Џ@Pr 2  20 RF \1$@ 0 01  0D00[0  0@00, .48p<`>, PS H0 03/``唏P%  !0 0 1 305}ߍ          C  @c+P '%P||0c``'cꝜx H ,D ` l` H` P00/ᰋ 0@- UMH`00L10p! 0H1[p@2[P3[0P\ p  S 0!8 ,0 0 L1 30UߍR $ p@-M`@ZPPPЍp \P YP YP 00 0P $O-(p,@PYP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV P``nb@P V@0SZ V@I00] G-`R p@P8/P @PV!1 G-@Q0MP`000Q UI U .00P!1 0 0 30ZЍ0p )P00 S0 00 00WZPP 0 LZPP CZ0SPUp!0T  @ZPp0p p PP/Zp 0 P@0 ZPB 8 / B/0  Q  B / 0R B %3 % %//Q0 / 0R  B   2/ // 0R  B  2/ // 0R  B   2/  // 0R  B  2/ //0S :p@-0C@0 P 00 0p/0S :p@-@0C0P  00 0p/0 $00 0A / 00$0 p@-P@YP 0S S pp@YXP p@Xp@-P@YPp >YP yYP 0S SiXP p@cXp0p@/p@-P@^YPp >p@Y tY0@- MP@IXP Ѝ0GYP 0S0 0Y4 p@-` F0S pP@&XP 'YP XP XP p@X0S S  /0S0/ R R  /0 /! / CR ! / 00/ 00/ 00/0 0/ @-k/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1M A0 030pC<0 `:0 0LSP00 03/P 0&,`&<808 0 SS0080R0S` ' RDp4pՕuPUK Y HE:,@p 00p(p 0  pC 0pS@P00 0 3/P @ 00SS`SVPy80Sh Y( &<800 Sk&<800SD u0`P I/o"UQ]pIorRI(0S D0Wpp$P@0P@C<0Du\= W^9 @0 C ,0P5 0P,0(00(0'Q? @$4, 0 0 30~ݍ4Ѝ%S00&<800Sg &<800 Si  I'YR0`z XJ]0p,@W(PG Zq <0pH ZCPKﻟh`I :Z2 p0 0$0e   4P $T@r /r @0S S000 P0SZUP <0LE0S. R00~YR YYY. !Y YD !u0`P&pIorU  R I/o")D2000SӄR00R$0D4Q0 D wA.<0@RC@|D0.%WZ0@jROt00S000+D0zO4 00Q`PH00 03/P? W  R70  `D )<0.RC@=O&<80@`  40 `@% 0  0<(5$%0 5s (0Sp (  H3 D2 LQP QpQzO4 00ZQ`P00  `J P 㠂P $Q0 0R Tt4 4S W 4S 0000KQP0000S 0R $RW $R 0{O-SM`$0P4 00D10YpP UP  P$0Yp 0   C8000S0  P{ 000 VPw @@PY 0  EPᦃᤃ@l#d3 0 D1 30Sߍ00g00MQ @T^ 0 .T0@T RDSS d! Sz*0 D DD@Q00 00000000 9P70=S} Q0SN SB SC 0S 0 #P0s[0Sb Q00EC @S @Rd! S1*.T 0 Pk  vGP @@`!1 0 0 30\Ѝ0 SRJ 6@PF  0 `P 000S [P`P@P ᛁT I P X0 SR @P  0 S`P000S`` P봩 uP001`// dtp@-@P@P NLTpO--P/ Mذx0`?0p020" $ * ,  K    J F X  0S0S pL 0 / "2 !ߍ0S0SP;0S ^01@3> p& p"  0pW 0 Q ,.0 ^ 0S 0G?oP20Q00S0S  00K p P 0P R   L" l1,P0S$0 RSS0 0 0npP<p0 0(0 $@pW g872 G52 0W00S   S  R  R Q ^  ^# \Q/o" SV RW0S!  0 PvQs +0 0Sl QRh 0pS[ %0P,0U ֌P , 00 B 0PpW ,00X ,@8@ 00  {pP  0 Pp0 Rp  RSpRolRn  P:R \ @0 X0 0P 0 0Z. 0Z(0S 0%05f 0ZX @` V0@S =>$PX000 0X@T PP@P ~~TPX@T0 40$PP 00 0 QPb@T 0S S00S0 00 0RSQ  I LHP1x00x0 |z @p pP`$@P P0U 00P|T0P|O-LM‱P|Q0 P@ C  ] `P00PF 0pp R R R0 T@0P p R ((0( LP00 V pW X 00 4XppWV$@LЍTDV|Z  0冐P -|8<8 NP 4PPI 0 x`_O-M*<* 9j=2+X |z j| J3**?J0VA$Kr~A$16zA$0*4*({4~!"r%kz!"1j5r!"7j5 Jva&)C*0V7 8N,̅0  0! B 0%a0(@0#@,0 L7@ @$௏@|O!dE #.2* ㇇Dta& ,80Jlʎ$ !0 FO8 0.00#,0H IFc5p 8` *pa& 6@@!GDKHꬃ@ @  .x)HOLn # @*, $x \Hǎ @: @$"@F .dE! , 㘽O   * $yJj  .$ !!㴹D  ,bE ,FOlŎ@@ . !@C @@L@ @,@` @$ @Q^BK !  `. ધ 㶩Nn $ , ]/MlƎ  .! SD@ @,@ @$ @㡨MK ! . ȫӧNn  $ , BlƎ  .(! ֧7L j@,@ @$ @դOK ! . ZDn $ , JlƎ  .!  O @,@ @$*H @٢oF K !  . n$ * BOj  , qHlΊ @. @$ `@"FJ *., Ojn ,! D㾤J  $* Dj `@. @$ @`O J !,p KlȄ* .8`B  $*$Nj@, !@DM@ @.@$ @@ dH*. 9 M !,( ۦN lΎ$ *Aꪌ @. @$@eLdH ,!D)O   " *Db-  . Jl˂@ @@$9@ LO@@p !I[EF@ 00@0#0@, /H Jc= , }Ob+ . HȂ !OF<@00 0#0,Oc=   " Jjb+ ,DȂ !SO`00 0#0c=@5:K0   " 4b+L B ,0Ȃ 0 P0## +N ` H` 0UDP  DTЍ  0'C @/ #EgܺvT20A-`!Ӂ000@@hPp0"V>0: [,0hV@Hp` "0S@@:p`F ABp@-PM0`@ 00 00 |!7R8 bx b  D 80 0 0 30X Ѝp@ك @ LŸO-D @2 M<"0 P00p  `. 0\ @ 0 XS@@|[0 C" T. .0N|0[.\'^V*00[P0@^*0^0 8< 4^*0 8<@~ ~ } - MaP ЍDD!@- 0(M S $ A \/o"S R9/o"S R L 0 0 $0 30)(Ѝ@P @ B  (  0$\ S $ L R \0  R ( $Q C ߂`| {  A-p4!01rM @`P0X0100^pAtAh0Oh00TAV 2?O 0tP" 0 npP 0@u0P 0` X0 0 1 30 rߍP v00P 00ꉂz z 00- $  M  Ѝy  -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/@y p@- M`@P @x0`0P0000 @X@0@T  Ѝpx j\ X1! @-`0M000 Ap P@   L*Ap ?@ 0 0 0 30*Ѝ?PpW @@T PU 0ScP@<T'00@3 00ՁLx w 0p@-P0@ 0p0p 0$ $/ Ѝ0O-LMdU$`@P0 @@ftPI$qpPE 0 @@YtP:$PPW* 0`Q QD QR Q) 0S:00S} bqP  ` 000@ p R  R/ RY R 0 @T: ps 0J[0K 0 LЍ   @ Q`A@0S:   P (0   A0  ,0p 04`0 0W G   ` ``@`` @T: 0r00r `^ \LQ  QA@ \V ^ Q\ @ , p 0     S QARU  R  PP@T( Q  AX  " X. X4 p X @  P@T(:;X X X 0`p`   `  Q@` ``  `p`r {>='QO-`p P`PW<p0( w# 7[0` @w$0$ X`(0,`2(-`P p[(0 # 3X, `0!(-0P pQFf&``V0#03 U0S `V:PV Y5XX1!030# 0 q@000X; SP81 `3 `#S41`F2s2`Fs1`FS0`Fh`F0v`4:0;`0Y SP81 `3 `#S41`F2s2`Fs1`FS0`Fi`F`0v`0809``` p@-`M;p& @=p) P0u00 @ 0@;t `0 0+P Ѝp<|; 00v; / p@-\ ,P@\ \ PQ :\ :Ap00p00$O-\MH @P0( Q04 :;pɁ C$`; -: ^:cI :10喑a @9Ȍ<Ǡ `  ^ 0008` 19P80 @A4ƌ<ŠaЍ0 000 0 0@-S@ 3/@=@-] Qi7nIࠑP*i7nI P@ Np ^ @ `@D@P V% @D BD$ BPE&"PE@D"V%@D BH$ BPE""PE@DQ%@D Be$ B'"^ r N $`PFPEV%A B!B E BA &"A@!@ B BA!" A@!@ i Q7nIP# Lp \ @ `N@D@F$N B. B@D&"@DN"F$N B. B@D""@DNQ$N Be. B'"\  \ \ , ($`P\ \+ \' \) `P^ ^ NPN `P\ \ \ \ Pvlhd\XT (  C10 @-0@0 0 0L#d.\ 0@0\ SC@ P p0  0C00 00L  00t@`  t 0@- M@Y < `_ O-M M` ',@ఴ $ `!0006@@R@@0TP06l0P40 ,PG. 8 &0 0 x0L <0pXl6l&0  D < P0H0, 0 *P0 ?oR20S @0`1  H0PU 0P 0U VL p`V.p0S  80Up5P00P 0UG W<0h?pX50= 0X% W00 A`@V800)S T04p P, p/P* 4  )4 0pD 4p0p4l0 p{P4 0psP90SbmP k0P40] 0 #3 0 4 30ݍ Ѝ_3P 0`Ga0S 00ST@0`1   nD _4#2 0 4 304ݍ ЍOx9X <0x$? 0PrR(_U]" T "d`` `@\ h _@F`DV7T0Ა S?Os t@1 Y T |_ pI I s_ T 0 \㙻2P p 0II 00 .&) T@F`D 0 ほV`@P ꘡ 0  uYx 0 m 0 gL1l`0`0 ppG pG +_T  0 l`O0P p 0JJ 00 .( TʳHm _HxZ `Z D)PU  0R408 00^`1S   ;`1S0 ௺0 0 PJ0 0 P7P P P$0 0 xP0 0 lP0 0 `P0 0 TP0 0 IP`1SxYz < P`p0pW  0R 0 ^OpW 0pW  0Rx 0]<pWf 0pWa  0R0 ,0])pWGpWD 0 PS 00]`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 0p01 00p01 00p01 0xx1p0 [@lL c]tЍ tЍ 0 10 |0 u 0 n0 g 0`0 Yx0 RR H"`G "h"@E p $ TC pD(`@  @-p0 AM@M 0`$0 40 0 7PP0S Y@ 80 0 4 30AލЍ.v|K K 0,@- M@ p  PpX7`PMP 0S <0000 Ѝ00S.S 0S Ѝ4p@-Pt AM `0 0 $ @P 4 ,0 0 4 30AލpvJ I p@-P@`Q  @Q ZPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P 0`W00 Ѝp@-@MP`0S 0 @S 0S@V00ЍpO00@ 0PV00Ѝp 0@- MPa0@0@0@T  0U Ѝ0l0 0PrU:H@@ Ѝ0840 P0@b Ѝ0,= |K4Qp@-`M x00<@'P 0PU  0VЍp_40P 0`:Ѝp @@X< ; 0@- MP0@0@=@T  0U Ѝ0p0 0PU:L@@ Ѝ0<80 P0@ Ѝ0; ,4J0@- M@ T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP(,TL|hx0@- MP# O@VP Ѝ0 0( 0P: Ѝ0,0@- MP h0h@0@B>@T  0U Ѝ0O,0@ 0P Ѝ07 Mp@-@ML `P 0 Q@0P0<00 0. 0T @D [000T H0 0 <0 30 @Ѝp@Ѝ/T.0 a._tA hA O-MP`@PP  jp f0 Q ЍSr RSPP 0-S  0+S  0x# P   00C2"0d  .S 0 @ Tᘀ@@ ✀(P  S #3 @ P 0RQ  S  # 3!# 0T#+<'(0+8 +((0'<0'4 0(< p 0(4 000Rp n 0T  @ P  S #3 @ P 0RQ  S  # 3!# 0T A 0T @ \  S #3 @ \ 0RP  S # 3 # 0T 0 0 N 0N 0 0 0 00J 00 0  ;3@ O-@Q dM0 R  @2/R>03?1|gO" \ ^mnb`AS N T _.((H<S0c&sf~e~rHpl W E P -b AE#D((H'ᒾ  L>c@L<@<0d0c@02gࢲ"X ;ks ssZX 0H Y J XL ,0@000(0L04 $0\0H p 0P0`0<00T00D0:Z 4fY 0fX ,fdЍ @A  \ @R@0@g x  0 0dЍ@0Y0 0X H<  >` @-@P0D .R\*^QA@0T.S p@- MP`P`@IT _0w# x'w000 000 ;7z $  kWPc Ѝp l\ C-`@ MPp䀟@POP @U UP@Wy@ Ѝ *@P@p0 0000 [ P: T0S0Y@OoB@#- 88 C-`@ MPp䀟@Px@P @U UP@Wy@ Ѝ @P@p0 0000  P0S0Y@OoB@#, t7 p@-@PU00C0S S u P 0` PLp0X`u0 0C0SpSr P 0 /X0@-M@  00000 !R !ܳPЍ0p@-  0S0@Q0 R   =0H04S .Ppl@Q0R Q    R `Q 45 Lp@-@@P@0P`0pp 0,0p@X0@84 LD D p@-` P@0pp0,p@*3 LHA- @@P`p0p0 A3 LC-P0 M`p0qp@ H0  D@ <8 u@Ѝ 103 LxC-Pp0 M`p0Gp@ (0  @ Ѝ 12 L0 00/2 L0 00/1 L 0M 000Ѝ+1 LXA-pP0 M@P`0 p 0 pЍ1 L0M 000Ѝ,1 LxC-Pp0 M`p0p@ (0  @ Ѝ s10 LC-Px0 M`p0p@ 40  0 @Ѝ O1t0 L<@- @  $M0 ZЍ/ LH0H 0p@-@0pP p@ O'1p/ L8- , M $ 4  ЍD/ L4 R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-MP(@p,` 080PD0 R  P R7@ 00  B0 000 0ЍW Q\.Q Q. 0 .Q ^ ^ 0 0 p@-P0@S` z 00C0p~ 0 pO-Mp<`P@P*W3*00V.:Y `+ 0 0 ppZ,  `0 P P0  0P= 0 0000Ѝ`<0 PFЍ p `|@- MR` @ P0ASA0A p0SA0qp00C0 Ѝ@0cP  00P`O-MMP/͍$08?  `0000=0==0P >0=0 pt?@ 0,0=L 0H 000 0 P, 0S@ P0P40H0⯭0 A 0Pr0(0-0 -H< 0@Pc0 K0吰$H=D0x 0*00d 0P>0  00 PB0( 0IP9VV 0FSO5DM Oq {~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  0P1 R 0S .S 0S 0S00S.S9@0W) t9d @0u 0 P0D 0 ScD0C(9$^800440PI y@0p000 0 0C(0S0`0 @4Z$` @Dp 0 vP(0Ssʈ0 kP0 0`PL8000#8088, 000.0 r  .00Q$0 A BP00D 0Y:0@ H;C'l7  0 0 30 ݍЍ0VWk\7@0hP7W@0e @' d꯭P040H00  0  P@m0 u0P(0c6000#80꯭P040H00  0PM0040 C0PC0H[@0EWt c-@0d  D; 60P 0  P(40 C 0`P H[40P@C@ C+A0W 10"3$ 0;A000;A0200;A====C;+A0W$1 00=-;A>A C0==C;}W 5@0/@ ¸ 0P=40 C0sP30DK 0T*uPp\w `$PP 0(Vj  R @0 Y$ 0d  q 0  P@T0P`$*0@* *JDK1#00X 0 P@  !V5U5E?C0 S 0 kP40 C0P0Dk 0PCUQyD@p@Tp1 W2 0d   0  =PW 7@0~40P@C<8` 0PP 0 P 0  P{@ 0 Ps0D[ 0@CT t80NW 0d  080  0 PY`V]@DK 0RPP `@ Ee=H[p0 0$"᷷- VDKP0GH[0 0S@ 0p  P%0W\ G)`0d  D;90z P 0  P 40<@C8p 0  ?P  0 P 0  /PH[WU )@)@@:2 0D@ ` 0 nP  0 @PU Z 0 P@DKpZP 0 mP[ @ 0 DKHP 0 \P0P 0 D; 05P40 C 0PMp40 C0pP  0 P~lDK`P(D[0d  0  PhP(D[0d  0  PV}(P z(` w(<d 0`P@ DK 0  P@0W>@0 '@'@4@( 0Y00D8?0 P 0 =P@GV5U5E!?C0 S 0 ,PLW`= 0PHK0 k =0d PEP0@HK 0t?0 0 Pl 0DY1*<`8@p0p PYD V 0  PM `0d  @ 0  P?`F@P 0Y| 0 P,$0d  0H>0 0 P B'0d  D=0v 0 PW=@-0 W40 C03P0D[ 0SC* *J1#00 SP 0 yP=p0`PHK0 L=0D[@`FHK`=p0PHK` 0 RP<@0$P(0 PD[ 0U|:cd<@0X<@T,0 H<@0}<<@0y0<@0uP  0`P-V VB {pP@ 0 Px0TE 0 0 Po00d0@D0SV$ڄ 0 P_d;@0?X;d  0` 0 PMU `[P0d 00 0 P:0TDK 0 P. P 0DK P  0P40 @hjPC0`DK@ P0 @GP0DK 0S 0  PP  @PTT ypP`d 0 |P0VE 0 0sP00f0`F0TTD 0 dP$9@09@0 %@%P%PP0@@2 D;80` 0 >P40 C@0PH[V0 H[=0 0w PI@ 0 Ph%` 0 pD{@Pr7d @0  0 @ Pc 0 kP[ 0 PS@}% DK0` 0PE=H{0` 0S:p`F=0 ` 0H{=P- 0 P%FO% 0@  `DkpP=H0p 0S pG=0 p 0H P( 0 P"% 0 `@DK P=H{0` Y0Sp`F=0 ` 0H{ P| 0 gPP$ 0 D[ @@ZP=Hk0P ,@P=0PE P 0`Hk BP 0 P 0 2PH[R 0 (P@0 H[=0 0jP<<4@G8$0 `,4@0X 4@G$0 V 0 $@C4 0O 0 P_sp30= 0#@C3 0:P@ `PVV spP@ᾲ 0 P90TE 0 0P000d0@D0SV 0 P  0 Prp$ 0@C202"0 2@0 0 Prp2@02@|"0 lrpP@h 0 P0TE 0 0vP00d0@D0VV 0 gP 0 ^Pqp1@G!0 $@0@D 0X:k 0x!@Ct1 0h 0 <PLqpWD1D!0 bx@4|ХlXH8 `DtH|8PL<4pX<`X<  D4$\@dXx 8+I  W0W! ##000 +I W  +I WW" !" +I WW  # +I WR! +I WW! " +I W 0 ;I 0PPUD{ pqD0@ 0 @- MRA T  ,@0 4@(@@0 0404040040, ЍؖM- (040 1Ѝ03/ A-PS`p@ W@0 V :0?s00@PU O"P(00@V:DG-pPWp:0 W/ : W/ : ` 0 PPϿ W*(00@0S  XT0 $"  P@QA-M{p$0P@S` 0(01$0,0v(`Vj0Sf(0S$P1,  0(0, V.400!PV, 0,0\Q U/  , / , 4TP(0T0(0 SP$PQ0(00,0Ѝ0F AP(,  (`, Q!:0,0 ?0, s0Q:$( ,00(0 SP$PU 0"00(00QA-M|`$0P@Sp 0(01$0,0w(pWk0Sg(0S$P1,  0(0, W/<0<00X$PU, 0,0\P U/r ! , /r !,(0 Q0QQ(0 SP$PQ0(00,0Ѝ0G P(,  (p, Q!:0 ,0?s010, Q:!( ,00(0 SP$PU 0"꒴00ꍴ(00QC-XP@S`A%Q 0<,&?G,q`pP@T`SA%QT0<(,? 3:QP   Q QP@ 0Q Ao0 (0 0 8 30ލp]P 0-@-@R M00  BPP * Ѝ@Ѝ/ % Ѝ@Ѝ/l]PRp@- `@(PPWP0 ?p@.Eꐱ00pPRp@- `@P`P5P0 ?p@#n00pp@-@Q `P@PP0 ?p@N00pp@-P@P  p@ p@p@-@P 0PS <0S P 00p"00pQP@- 0R R  00p@-PP Q@ @Q Q QT00A D3200pP T0DS@pP p@-PP @P  T 000YiP IP NP4<@hP <00(S ~ 2010\nP 0Z PtЍ00XS <0X X000Z<00 0S @ tЍ:QPgRPDP R R4g +^ A ^* ~^P%b^1BP^  Pi ^    ` t  CgP 0 SO B ? p@ 04j  _ B\ @,$ ( ` Z`0  QQK`FJSZ[h0SV|Z i@Pb @IjP] 0 ` 0+j0Sv P2g J @ W L 0?G0jS*k&0B: HKV  L ??GRH0s0  p @Ah?h=h;hgPP!    ! \TjP@ h@P T Q\00`C00A`R AQ6`s (  $ wBP^  P ^ P.< ` DR+P  @b `. V(P jP8P ``^ U P L^ZkeP P?4PKPeH7LLj  @ 0 $Q0H0"00 pW9 @YCpWKQ @<@  0@ X  X<<0@ X*0 00<0Xl 0 00PE p < 0P @d1 @R  <0 @    @ C# AZ ~R 0 S$0 @B01` Z<0 080p@< p0p@ W\ p$@ @ <0p@0@@ T$@ pHXNKpW@d<@fP %h@P @gP0 @g0[@@ hP@40S Y Q @ g gg ggF}hPP}4PgPPsP e VVL C0?G /G[ 0W0j[0S ૴ {:S03V:gJ J 0 Qk6 C AH{{ *{0?G0 SWv{H0R 00 `: ૴jZ@4fff ffOK+$( ꃫ9 p PVL J J 0 Q{g ` ( 0V:0:g `  0 $\ 0 p 0\0< 0@0h D b0@ SZ CCG IH0S\0S{ ^ ^ NNJ ^MPtP  p`PP^` `PV LqG5@L{G {'Z{PPGP5VLP^  [ A5??T  5L$0L AH $0G{{ *{0Se??GQp  @o pNWp@ 0 Sp3 0` Z1 <00 K@P ૴J ૴S\ 04@$ @ P@ TPR 5d@eD H0P 0 bSx20AaZ!1 <0 `05&L [ p@@ R RT R  P Ӑ.<00C<0Zde P<00<0b4@R@o04S0S0ST V@RePeNe LeJe 0S  0?G; * 0S5\  `P %46$ $PpL V$(@4R0y S QH0 H ' @ p 5?55?P9O VH0忋SKL R0SG?G 0jS  Q R*k&0B:H @ H H040L R0S0?G0kS0S0SzJfPY fPqL 0@S0?G0< kS:7SVddd ddhs 0S L 0?G0jSS+H0S Q) G H  p@ @/  P5 `PVp 0P P   $$P V0 P pl Ch0h 0 5T DP0P 0 ,< E808 0 #pI ȥtI ĥPI ĥ,0 0A@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-0r0000-w-x贩 00诩000S wS -S rS 0S /xS /  @-P@20 0肩 0 P P//0S/ S S/0S/0S/@-@ᴤ0@0T S R RT/ ?/PP/=?0PQ/?SQ $0p 0 @-/pLE  ??SQ $0p 0 @-/ D 8P P P`/AQ/Q/Q Q/?0 H0pD D0 @-Q/?S0?/0?/ሠdD QP00 / /@- 0  p@-FP 0 @C` Ө Pᦡ̨0SpƨPG¨P`pp@-@PM0` ES aЍp 媨 P}壨0S p@-@PpP Q 0S PPG0SGp@A-X Pp@PEX `@ᦥP``O- M` V$ p@KV P@ብ0P RV F!00`F `! Ѝ0 Ѝ0eG`0-RBMM č dd  @T  { PM  < \TvP0 @-@-`@#Ms MP p $( rN TG " r @$@"p `PA0 "l2 0 $8 30ލ ЍSB^T"P@ 0$p 0 B^P.ᣞ!0 uH100A@  0 Ù0 P \ AL+\ -L+*)B'&%$#"   \P  h\\\\\RD뀾 ,i xuh h {@? dg f 0 $\   @010/C. * @    @RA-P(M`p |@ 0 @0@0 PP00T P@ 0 (Ѝ\= <  0?G0 5CS  A/0cS#:3 3Q31:0CS! 2#0@-@P S 0\\0 0NO-MP` p @P-Y\ +Y @0G `ãp" @0Iq \ aIQW IAIQ7 IUTPRQ f@ 0T  R0 S` 0J0 0 ЍS T0 Ѝ0Y U Pi piAPpb0 0XQ 0@AA \QUPpbPpbBT0R"\0@-0 M< 00 Ѝ0@f@P T00P Ѝ0 p@-BR"^p@S@PT00PpO-Mp`@`P-T0P +T@`S0T W  p S   00b 0 0?0  0נ 0  Ѡ P @p P 6 Q P  S  R- !" P 00Bs ^a0BSW0BA0BS(70BS%| Y[  Q P  S  R!" m"00f"00 0S \0F00 ЍS@ `?0|0T0q XR 0AA B PR W  pd pp` `@p YWSppSBX0R"\0@-0 M@ 00 Ѝ0@&@PT00P Ѝ0 p@-BR"^p@@PT00Pp r  Q0?0S @-P-- MY ЍЍ/G-`P500PE !R !U5  MG 0SP೛PU pWU@@aPp X 00 00 @CpGp ᓛ00 蚤0 @0 0A-P`PL@L@H0 @p D6U  sI A꠰ pp@-@Pĕ00C0S S u P 0` P㻕p6`u@-@ᤕ 0`00@裕- M?  Ѝ0 A@ 0/O-QPM0p 0 Q0 Pߍ0( 0 A`P 3 0000ᗍP @000 " P> R R R#Y@0S 0D@T:@D0S Y@D k @p`Ś ` V@D[ R B0 0 00 R R0 S S ?pP   KoP@ ؠP  V[*0@`[W 1000  S S S S V *@ ` P 00(B`F P` ``pḞ R @DpS0S CaJ q V p ឞ  T @D * 00qB"(A`F Pr `dBjpnH1H0@-pLM`P,! \ D - @.0 P) V) pp0 0] 0 VP .B 0 |0 0 D0 30LЍ_VPLpp  @ BTN8 Pp ȈA-p`MP`@T) X ``00  0=VP A 0 ЍX`` {@AT ЍVP @hwv0S/ 0S/p@-P 0@Sp0@` 0K00 Rp F``0Q00pO-p`#@\3OM TQd0 h`0410`1P0 Q 00T/00 Z.` P 20 00 [ .Q  Q\.Q O :!!PH [ 00:[.[<##=[0Q.S7 Y_0IS00X0 0IZ 00 0O 0 P00J `` <0 0C S::  ՘0 ` C:[ 0,$@(00000 0 `P$IP00 0 0 41 30Oߍ Z_00嫡004 <ᖮPPW U.R  :bP KM(   hr p O-M Mʟ S0 :pxe0瀕0D50t50 X*0 00 !2S> 0(*0: 0 D5 30yݍ Ѝ90$0(>0P(0 0 pP?s0X`[S#_ (t@|5  00 @P0 $03/P @@[: !232040b vP0H`X`uP(U 0  P [pE|ŝ< -8 L  p @D ,T0XP 0  C0L `P!0 $03/P @ ZU   0` S 0H R @x [H(0, 0@0(0<Q 0d0PD 0X Q B/o" RP h ZO[PP <`BpP0 0 00PW ! R soQ \ V\pp0PX 60$0/W  <0SP0 B@Gq 0 B^Pb B SPSP@Qp`0S 0  0X@@ @PC0@P0CX@S:@p `@@{?D0PX C0 0CS:204 R 0Ss !S8 0B'RSW4@P8H 0P%@F! SR4 0 80 j @P?0  0@Sx8XY 00`S08 `^X`0P#0 S S S 0S/P0 0S0S <0S0P.P0X@T*T0D 0R*P  侖<0X@0DP<000H0m4 0 0 @P0 ? 0@SL0( @00R?*(PP PXP0 CR00 S\@0 ,(0@0,(0F8g PzHp՚0XP CR00@S5ڕ@PX@$03/P X L0(@ 0L0B>0P @0( 0(0(>Z0  0% @r p ΍ 0 00X81sUb(嗕 0X0PZ0.P  0 } @PR0 , 0 S<0S0(P@0(0c@T @(DP ?0H %?, ,4L @0(1Q *(@0P(0c P (0(@@C 0L0=0P  @0( J@0,(0ꐤ P  k  0SA-@`M05 S Ѝ0p 0k<PP4 מP/ 80 0P"P  0 0P=͞U 00S S 0p=Ở= 0 ŸO-` BM0M 00S0. SP p @0uG#"0 =/P @T*X@$ ඇ P 0 "2 0 4 30vBލЍ 0     ! /;@PH KPPC 8 0 0@P@P 000 00000 00@F=T6 0p pIP 00S 0  0pW%  @% D 0  = 0 = 0  00S S I  (wvȗ 00  P @ P y700 0`Y 00 JUP'0S$: 0C000ᘉ<P`T 0S  0C`ÿ0  B0`V 00Y 00P BI 0 0 @0P 77000 00 b^ 0 V꤃ SO- $M@H` \0 #p p 00 30@0H`# 0 B0S0 Q6  R00S B 0 PR ` Z6 PP ᥎00[U X 000@PL  RWRY 00S ` R00 SR Tu*D00 Sm P^ TP`p^[  C 0P CTs ^a Q `  H`@幈3 QY/ P+ 0S " P 00S U0S S" S' S- PP 0R00S0 0nT $Ѝ`dP`V=W WS SSQ^ &6p@-@0P0FG p 00p0 @p0TSܖ00-M0 3/Ѝ/ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ R R R //00/00/ R R R //00/00/ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ 0@-RP M@ R R Ѝ0003/P PP Ѝ00P03/P 0@-RP M@ R R Ѝ0003/P PP Ѝ00P03/P @-RM@ R R Ѝ003/P 00S00Ѝ0 0S0003/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/ЍR0 p@-@PPeP P0 03/P U 0 xp@ 0/003/P U 0 <p@0/@oppp/4@A-PM@Qp` Q Q Ѝ0 03/P V*PX 3000  0003/P P P PЍAR X 3 P` }0SP3d@= ;A-Pp`@P  R 0 R 0\A/W 0A/0A-@MS`pP  SV ᩏ P RPU U U Ѝt3000SP Ѝ VP 0SPUU3 2 P`XhD;(#00@-S M@P S S Ѝ00 03/P 003/P  0 Ѝ00 00 03/P 003/ Ѝ000@-S M@P S S Ѝ00 03/P 003/P  0 Ѝ00 00 03/P 003/ Ѝ0@-M@P0.S00Ѝ@-M@p@Ѝ R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//0 0 /j L0 0 /j 8p/0/ 40/0/O-M0Sg Ő@P `%!E , ,L R^ Q XY@.PR @PU XM@RAS0SI <  cSB!  S   X9"S`Pڴp@@ P pG -W`W0P@|Wd `@FT0S0S V *000FЍ0X`.00Ƅ(00AQQ!X@R p P\ ! C]R" X @D#cd`!2br   D"2b20Dr 210D0Ls 0;S!S" Cr 9" X00Ls`@S \S X 0@@SQ P`Sp pg 'h0`0xpg '0!"4`0k 00|HT!HEO-$MhY@ Lt 0`pP`([Y= P @d0Q P @ 0Q㓐) P @ YT* PYw [\Yp .Y0D0CtXr0Q S.Qk ` P@] rPh  IZN0xSK2 000 B P0XY /Qh ]QMP R00   0 ]R' PR " XYnP   R J b"r R Z zA @ R] .RP`@N@ P0D0C X1A(00$Ѝ;00P   Z 4   \  PYX R0Q  S0 T 4* @DT\@YX(@ X00ɅS ` T`4* @DT\@YX lf 0G-pAQ@<*0S% R3 @R`0P0 0W*  0s00ᘠ    P 0 S00NAS 0SP!0QPP00W(00a  RO- MP3P#RP30U p`\ @0I @R: R R& p(000 ЍQ*@ ĠS? A @ G0RP@R\ 4 R @4 S0A Y*@T*0P.0 A\ R!"ɑ 40S0 4 0- M ЍO-pS,M@ [ p 0pS 0S0P^h @^W \bSP0[p0Cp00`p 0$PU P0S @Sg  W@ΆU `PU00 S 0Y* 0 B>\ A XP 00M X"0 Ġ?  0P R SAS"`!0PU`00\ڛ(00,ЍPᔏ(00P0S 0Q * 0F S 0S 0 `  0AUf0S " ! WE@_X0y  ABQ AAE\ Q Ԁ  r  0B>S. 0A 0 S*P R0 S P\0^$p  ?0B,40[p 00%000 0RLP00$H{ p@-P0 M `00 1000qp !@p < 40 0 1 30ލp@:Z `Z A- `0M P@(q0 0 100p 0 p0 (0 0 1 30ލy:Z Y Q:/R/0S/S:00/@-\@3#* 0^ @R R R (000S0QA^ R! Q 0Q @-A?S SAQ  0SLBi00d(00N/G-p@`0TS'  V WT P@0TS P?^ 7002(000QSp@-P@` P@ݙP`V  0R p/pA-APUQ?UU@A`pP W ځ1AP(0000?00Q A@-?S SBR 0@S Aˍ00ƍ(00/-- M ЍЍ/@-M@ Mp TЍR/0-S0 \ S 0^C00O- M@P ` P-Yc +YQ0Yd T@ @Q Y9`paTPO9`pTP" [)SQ" K0Iq P0aIQW0IAIQ70IS| V[SQ;+*%0S \0J00 Ѝ`Q0YXP  0LA@ ^P @T@@BT0R"\0@-0 M< 00 Ѝ0@b@PT00P Ѝ0`R p@-BR"^p@O@P׌T00PpA-p 0rM @P`0^010X0pA00tAc0O00  TAV ϠPOP $04 @ $00 1 30rߍR8Q Q 00- $  M  ЍP  -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/dP O-QPM@ ^ 0pS000!R !3  {PP E``#Q9\*Q30A 0#1#2#4#8 * P2   0U A 00 pQ%IP 0@pQ 0S  Ѝ 0T @00Ѝ0 0A-@P`pM}0 PN}$0M 000Ѝ$N T0 0p@-00Sh@@@pXPXXP]K@Ph)@P 9P DM t|l p@-P@ᮋ p@A-Pp`7t@t@0h@ `U  0<0 y*,  ALM  L :@-@*P0S 3/000S@蔋 A-P p@` F  o000 )@P p@-@PzPpp@!P1p@- BMa@0PD`040 E 7PU h10S ` 0L!  P4A0@ P; 1 0 w 0 0 4 30/Bލp+P )`P  6/P Q Q |0 0vl0 00P 0 0  `[6xK `K 4*ؙ?#cb m!"b[n!3: bQmn! 13c.c0 mA #c[ 3nA3: c2nASm1@  00C@aa0C0C Cr  \< @P0$DHd(T,@VR gR 0` Z` 0 Sx 0W0 `0R C S`` 0 `0 IISQ0C 0 B2:00P/A!b  xW0 `0R C W 0II Q B 0/C!b`: 00PWW0 `0R C S0 ~`0Q 0900P5W0 `0R C W0 \`w ~0Q 0H900PWe0 `0R C^ Wa* *BQ0/800P b bR  WE0 `0R C> SA0Q 0p800PW-0 `0R C& S),0 `0 l_`7Q 00P  W0 `0R C W* *BQ0P / b bR  D' 0 W0 `0R C W Q0P  & 0 qW0 `0R C W Q(0P &  0 WW0 `0R C WU PUP Q0P  & 0 6W0 `0R C S 0Q 0500PWt0 `0R Cm Sp0X*c Pc 0+; x040% WU0 `0R CN SQ 0W0 S0 ՜ W>G0`0QC5 R`1W.x0 `0R C% W(0051E!2 Cd0bSӢ Rӣd B3PR  b0  W0 `0R C S 0X   pXX0 S0R05`0P 0(30}W0 `0R C S0 `0P S0020[W0 `0R C WWd0 `0R C W80 s` 0SX @ Uqp z qpm 0@P1  0S! -RC SAT! P1QH<00ϠPWl  `(,1Q$ `PAP W60 `0R C/ S20 `"= = ; \Ļ`DH\# h@ l \PD8@ 0S  P  0P W G P ` QBP0l #`0 SD 1hW0 `0R C S0S4 1W0 `0R C S0S$ W0 `0R C W 0UP u! 20LII< @P$D?HA1cd(0T,@X%!E_d2dN`Re0eϠl 0 bSӢd Rӣd B2PR  b0  WF0 `0R C? WB0Q3 00PW00 `0R C) W,o 0P? 0``:#` . A-M@pP`Ă400 p00@00pT p`ᲂpFЍ謂"00Ѝ(@- @MЍ) C-Pd@ M`0`@p @@0  @  Ѝ( 4C-@`P M\0`Pp <(0 @  ЍP( 4p@-0L| ^ࠓ P0L|@ T.^FT00p^p=00pp@-@0M-S` +S`P0 P& 0.00:S V00c0Ѝp;0 P <0!" :R P 0 00Ѝp@-@0JS( MS 00C S! m1 P 0/S <0  0 P 0.S 0 }P 0.S  m1  p@0 f0@-e)P L@,(@l^3f*Sk Sq @ B 0T@ҜS_e P#Q@P Q\< 0\QTP@# N$0,@L ^0#S S 0@0C @l^#3S0@0@;S0C^:= 0<0 P /0S/ 0 S/0S/0S0@//O--M014   S j H叇"/[7Kk6 H`<0a/QH#x "xH q~~N`AN0S."w ?'P P00 #1?B! 0/Z0S< # JL"p J㩀A0S/ ̃? , R  " R0 0.1>0 Z0S P * *Ba AdϠ ϬT R @SX@tT)|rLk NQ @\O(@N(  @,\H0@ $ m@q P@P!PP"gף pC@)n$A[ O@:(@`&! P,$3#`_0RS@0@ oS^T\HNQ @ \O(@N(  @, )|`rL$0@ `@H@mHQ!P%W׳ pC  @*n$A Q O@:( P %! P,$3#` 0SoS0@pE)L\HNQ @ pC$  @(T0" R P`[ Ϡ! +P@. PP` @ R  Ϡ ,ό@ ` ` ቢভ` fR$  ` & , Ό(` Y`3`# 0C Qp| , SWT08?OX 0\ cSQsH0;SeER0/H ;0S0 ;0 H0`8 t@QqHPd 80< UTM WVU V0780P@`<0Pp? 00?0S  S   80<  ;/P80< SRS@PV0C~00 3 0S< Hu T~T00ЍWV `VpcK80S Tz! @T!Sz[U0 SR Z 00SJF|Flmph`0 `pQ Y:Q@PTJ#M @A8剱<Ϭ P ;N0Q8 5@0\?5O0(<2@ 0>;N$0S33K051E00)w(.L@x?ᏒL`F8c@c0CV;kYC00#,Ƞ @B@- c 0w(: 6S X00[$0/!+>0 (A O!2c0Xÿ0+" ?00 #2>[?`FW'@ PG`m1%0p:#0  ό"!/ W n13:$  p C0!".#2R> ' @01 30 #1`0U05? B4sppp00/S [U c 0,w(: 6(aS X00[$0/!+>0 oÂ!`2c0Xÿ0+" ?00 #2>`T[j@tc 0$  v$: 6S T00Z$0 *>Â!2c@T0:#I0$BNo : s0c (a  ov(: 6S X00[$0 +>`!2cX0;#0(``8?O0 ` cQ0 R$I"ITY BqgqgpC(1 ? c 00v0(: 6S X00Y$0! )>0%!EÂ!2c0)XLß8\?H)" ?00 #2>r?E$0CI"I0P0/A!b,!b S3 1I B !.50c((H<" 2c0 4S/  `00 \000U PE 0 S0 0(0 P P$0<Ѝ8\?H.+N)<2LQ @ 3 \O!EOό"!/ T(@[:.+N0 pC#". RD 7 0@0 030#!R̂"*h  “5.2L O\, 0C8PC@D10@e-0P00040tc )1 ?00u0):6S Y00X$0%(>!E!2c(\/H)L0Y("1 #2>N<`pc0qzT 0 ~@-M@00P T 00t0(0Ѝ 00p0꘍O-@P`M 0S7  V 02[? Pu 0PP ΌQP 0`O2%> 0!"R<0  0 S0  Q00v@z00Ѝ0 S. 0P0' V 0V"> PCu 0PP ΌQP 02%> 09`0OR!"3 0V @ 0 Rh!Y0h&P l6Ym&N # ⊡0 GP 0V000 PS?S00SPuu0 P800p0(0i P?S00Y` xP  Q`0Q$4 Q$!?8:Z S00C08*S R R P8ZC P00s L p@x̔\& NhCE;E> 0@ 0W㉱@ 10<@W9  *uP0WP@/0Y@0\0B0 pS.0h! /O0 BSP PsP t\<U02p嘮0A  LP@X 0 R 0SZ0Q∑X }Q!爁 000  0P\ 0 # 0 C!@0yn@@F ,h  Q^7 Q Q@Q@QDQQ^"R hNB 僟AhN $0 Hn $0@  Q J0ph@ $,P(0$0`\S 0 * 4"< Q$1 WU [[ P U0 @ p \`0\$4 \$!? K[ (0$@ T F nQ R S  0I0B0 0:0@ 0Sp`@(Fo0 R !0S P r1Q N hp m0P@UG A# 02 ?0cQ00 R" | dO-@0MP<SH0@SЍ0S >Sp@0GSh>`P [ 0hS01Ӄ!0 "0SmY,Ih0  000 001Y# <Y60`S0S >S@5S*S0S -S0 C Rp@0GN<)hh0 `Lhlpt mЍ*YY -Y00I S@0IS0   S ,S;SQhAl d ;S,Sc Sjh^&- Q 019mPhjp0 pK19mo\Ϭh6PcRp9l ukt bhp& l&w& 000 @ 0N\hPl@PP l @h P 1 0 0? 10/p00P 0,S0,0P 0Sh lub$ `(p&{,t.Ol6(w60h参@0 l0O ' @< . /O@ 0Tp)0`L4@岷@`p80 PxwvZ `p [  R- K   cX 5:< cR8 0#031` @0?0cY `4@0`p (<2@0<1@00 7 0@8010@<00)P 0L@ @@参L@40@pD`H P0& 0fS005:804fS0#031<`0`?0cPpcs VP 10@p1c00D`[HL@0 01 @p0\0=1@00)<2L40P8 5@80(<2@<0<1@X0 7 0@`010@d00H``P@p @D LGp @R * Z{ / c ^,  \ _ /ጱ ce  [.࠳^B Q ! !c 0 p?0 c@R`@0X<$ ( ,00#8#< cRX05:` cR\ 0#031d `0Y  lP 0 S =UY  Y.Z@pDH`LP@T0g.f>0X 0H!S1ð1Rp0`4@ A-PQ@B 0S !1h ? @p Dh6l6 `N`P 0:S LP XpHPhnW !oP0PT`X\PNLg@_`PaP`T`P XsA-`PA@pP nPPPWpPqpATW  P>UH QP |1`0t!t0V ;00ӏB m``@ v]=D0C0C P S\@0d@D/  @DK0?P0S00#  1PWPࣶ IK0U0h,sP@P0L 0Hp0 ;0BD<<;qT ;L:\p d:0@-V$0$0@!R !Lꘘ : @-\F<l0hN 0Q S \Pr 0 \ F<h0 0Q Sp/@-r 0 @-$@@e(@ ꔗ @-@@@\ @-d@8p@-PfP  @`PPprP`;0 +p@-PH@@<d0 E?Pp謖 8p@-@`PT000SDd80 @pD 7,7 0@- M@PF0 @wP00p0(0 Ѝ0m@-M@540 EόcP00p0(0Ѝ6l0@- M@PP0  EόMP T $00t0(0 Ѝ000p06Pl8lp@-M@`P0 P1P T 00t0(0Ѝp 00p0kkp@-@A-dUt00QU d 0P@H-p00 P@D @5 `p@-@PP 4 0p@0 p@lp@-@QP0 0P 4 0p@0 p@P0 0p@-@PP0 00 p@L $@-4M*b`0@b P `*M$ 0pT0 0Sp`4Ѝ0@-P X\0H@P@@̌ 2P0p@-@P000S 00Q 0"*X  T 0SZHp<02@T_bcꠑ 32< G-@pPb0jX` T]0SZ 0 P K0SZ 0R 0  S \Z^ UT0S ˜ ST0P 0  ^ 0SZ 0TUT@@@ 02 ^?<02 P?<0p@-Pp@d000S T00P  0xP@0pb x0d0 H0 @D0- P000^ N D0@-0@0S $000S 3/O00p@-p?LP@TpP  0 3/P q@Tpl0A-0`pP @P UP q( p?p `@00G-@R p@@T ` @D◆%:/PPA-`p@PpT  P t`P @L2L€000#S €^"RD//.0O-`A Mℱp@|| P2 0P2LB?0T- P R; S P@T" V0S !Q L/`3/L2 S1P2S? T030# T 03Sp0p0@T@@P20CP2WP2SW pW ЍS @  L3/L2 S @p.d.\.L.-p-- [A- p0`Q M0010.P@ `0xQ80|Q 8OI8V@1@@ @V FTAϠO=0@H @0 0 1 30ލ?oT 0 ` 0- 0 M ЍX  -<0< -0M$0 0 0ЍЍ/ 0--M0 ЍЍ/0 0p@-P@XW``00C`0Sp S u P X0` X PXN`pX2`u \0 X0`00C`0SppSr P X0X /X -404-0 M  X ЍЍ/ -4 4- M00 XЍ Ѝ/< G-p R`@:Q !SJ Yp_0"P U U * meJ0`00~+P2P _e 0 B 0 0_ P0PU` ``Pa+P IjpC0 00 _Fn0T @0 0_ Ijp--M  -Ѝ Ѝ/ -- M0 0; ЍЍ/@- $MPw*pp`P3 {@P0 !m0P(/S!ʬ0`@0 0 0 0 00  $Ѝ 0b$ЍZm0000@$Ѝ 4 @-@0_0SC5_p@-P`@i R T0U:T0T:p@duRRR@-p00p@-@!PR ! 00 0S uP0B`Q0AP R 0 U00Sp]P0\P `\P 0 um 00 RA-` P$@ R0 ,°00aRK 0  a0R00S 00@0A PA05\ &l plL<0@^㖌 1c000A X \00X00S PAA0 S< =<;:97310/.-,+)('%#" wsrq" %: spR V@8VL0V & a0 Q V  T D 4ЍPPؠPPؠ0 ## 0B Q00C$RNK P00  x3 0S0V `1!'  x 0SM0V `1!  x 0S60V `1!  x 0S p 00B S0 @#"00B 0B Q$R8 x 0S p V0`1 ! xO 0S 0V `1!xX 0S0V `1!0 *RS 0B@ Q 00B S@@@ x: 0S0V `1! x  0S0V `1!    x 0S pD 0V `1!dx$ 0S0V `1!W V  x 0S]0V `1!F +  x 0S p (  xz 0S px) 0S0V `1!x+ 0S0V `1! x 0S0V `1!xn 0S px 0S p 0V `1! py yp rp kp& dp ]p Vp"s R 0I0py V@ `1 | x 0S0V `1! | xm 0S #pT 0V `1!t ; x 0S40V `1!e ; xX 0S p/ T- 9 * p# p$ p7 p#l x 0S0V `1!'P x 0S p[ x 0S0V `1!  xi 0S p 0V `1!$R 0@C p7 x 0S p 0V `1!x 0S0V `1!x 0S cpx! 0S Wp@ x 0S Ipz 0V `1!  x  0S 4pe 0V `1! PZ gX PU bS PP ]N pG PD QB P? L= P: G8 0B Q@  "0 B  0B P$Rh x R 00p V@b P  p  P  p pO p P  P  P  P  P  P  P  P  P  P 0s 0 S p  0V@`1! P $Ry@00 P  P  P  P  P  P ~ P{ y Pv t Pq ~o Pl yj Pg te Pb o` P] j[x 0S pP 0V `1!p PE RC P@ M> P; H9 P6 C4 P1 >/O-MM@` `'L0\7 X006000X!R !0080d00  0S   R 6`堠0$0h000 D00 찍@C0,400㘰H0l \  PU @%U 0T  `- J 0 R 00S0,U` `0~0-10P(0 0FZS񏐅%~|{ x"#u1jihgfed9b'k}\[ZYWV0TSRFPNMKJIHGFEDBK]"&9'72.-+PVP    RV00sR P+>Rh1RhOh.LQ]T f 0@E` XT,dD|ύ @8Hˠ@`P`dVP``0@ 0@00+00F@ p`4$00F S$V (@HPU" 0T$0$S JUD0S D0p0@0S0000WW "2 0 6 30 ܍Ѝ$pGT0GCP P <40    S 0S0q-0~0X4 0 0 @TX@@,R00Sg~0}@0TP<8:P40 L@ * Q h 1 4X P~T0 00 00RPPU  0\n@  dpd` F0 dRK R~0 T P<8P40 L@a *6 Q  1 4  k й 9X5043821,1W HW V V U V/ ~ 0a P~0 0 @T0P0<080-!(R     Q @ Rj  `AV2S 000S~0000P,-1S 000SK?000,100P,R& 00@DTm 0 00p0000S 0 (0 PCU5@0P00,0080X@@0S 4 1 04080S0  7R10Pp D0P0CH0 i0PD0 0S-0~00s<0 ` $ 0p@PB0tp@`,PpK[ R@ PK[ p@ `tp>Q`000P,P GBP wT 4$0 pp`C,Php@`K[ \PK [pp @?Q@000_P,YKP FBP 6$@DAP0DCPa , ?Q0P0RP $@D+P0DCP@00HX 0Snd00`0 0QHp0@0 SH,  @H0TlP>0  Vڬ>$0t@PAp @,`K[ R PK[ p `t@>^0`0~0O$0 CBP  O0FCP U $0 }`@Cp,p@ PEUW0S`0P  O0DCP l$PEp vO0Ep CP] `$PEp jO0Ep CPg T000Sx<00000P, 000 d00000S00P,@T$000 S0p00+S>l, 0*|P0@ 0S $@D O0DCPl>, 000 S $@DN0DCP, H0p0C0H  @HTTڜz$p,Pp`K  @DT0\0Sa0 S R@D00000 00004D00NS `V~0yp  @ T@ 0 P@<@/P~0,|$@DN0DCPE  P0\00 0<p R Rndp 0! , 00g 0@!0 00 0g @0SQ000GpB gN0KCP RE@< A Q 40PA 0P0PTQ00\0S 008 p0T0 0\80$`0, Sp[Q 8[KJ0CQ PZ 0PLUPU ڜpPQA U@A@TTFPpP p<0@IY QpPPIY  @<0PpT^@) M FBP P F<0M F<0BP F<0M FBP <0Pw lZ0Tڌ5 8p0`$0PCp`@,P K[\P wM FBP b$@DmM0DCPd X< 010R0bB+ S- C S1! N L ccS!2f00 ` a000AF0NQ*pNn0 V00Cl0l T~0 0 0 Dp@ T@0 P@/<@ F<0+M FBP <0L04 00 4  L0OQ 40PQ4 L0404L0X@~@eVQ4 L0404L0SL401LS`-0~0͵X4 +0 0K$PEp LEA0P,~0p 8p @`2R@0 00xP,r000 Dp/ \ @T P 8 ;0\ P4 00<p \0/n}P\ L\ 8\L<P@P`#pI" . @S ,eO&Q!Q@!Z0I Q S 00Q00S 0 08<@P`< p00000np\ dp|T LS R R Q P (O XL L J F 8vvuTTA ql> q ' ) Q 40 41Ϡ~   a S 4y  Q9 40P    Qp 40 41Ϡ\  S 4S4L10ϠL 00q4p `VDqp0~0.\ RX <A R R R< 0\ PT0 0 @Dp8@/ Gqp 0 P,$@DK0DCP $PEK0ECP $@DK0DCPF 8 00 ER 0 2! 00Bl0IS 1(0`p x08 $@DzK0DCP! et@d c $0`0p`PCp@`,P K[\P $@DHK0DCP 3SL04pL0p0IQ 440L04ppL0$Q 440L04ppL0QS 40P1sSL44 01LQ4L0404 L0aQ4L0404 L0U  Qf 40P1Ϡkp$@DJ DB0P,LupH <@BOK$@DJ0DCP 4 0@ Py `00p 0S2L0 ( L0/ 5R 0@00@pJ FBPM @vp<^/Dp@ TP pI000I0S0 00 @0p\\p00Wp!2 0@0( @ L LPnĎPc. D 0S." 5 0001? PwL0P00L0L0PL01L0 400L0L0 400L0L00LTSL04L0004 'L0LRT? ` RX $ A0p@ 0@00Q 4 P4@,Q 4 JQ 4 P1glD `00p[ 0  0L0PL0P[ 0  0L0PpL0n$@DI0DCP@,~@K SL044 L000 0l0b L 40L Ϡ L0PpL0>L 40L Ϡ L P0ϠL  T P Dt`00F SG@ 4$00A S$Q0"S, ` : SL044 L000b3[ 0  0Y0Sl `4@| 0@00;S4L0 44L0k `00IpX 0SL0L0 @ @-` MDP@pUL8P0 PSL Ѝp A-@P`p=L0 P>LO--0p@j/ Pck] @  O (jY: 0D @0S0C CUZ0S  U #R   CU&b # 3S RUY *CUR"W * W@`pG@0S0@FZ`U00 E000DTY:?C0C1  0OW1 0S  ` 0SQ @e@`}멟P/ P P0SA0D@  R=U0 0U,  sR  Y 0D@ R(U 0U  sR Y0D@ RU 0U  sR 0 0000D@ 0 `?hhO-`-pЄ4KUDM 0Sp00 @P`U0ʳ?G @ 0 X @ YR YH 8<X`P *:8 R ?CH{0CQ; +c{7! G: A{ ZZ`PEU BBF3 _JRx0$000P(00I W?o2,0BWpG G0RM30 Z70  DЍOa<00C QA@a a40CG{A0$0Z0b000U0P0C00eP(0*@P PDЍIoᩒቐo0PE$0 0p00004 0<0Sv Rsʼ10[ 00Ӣ?+ [ +b +XP97@0000  Q0@DЍ   4 [ 00@P 00[00WY  0 R S~<0SD0SAʴ [4 4 0 @ DЍOaCoc?`(?yPD? h d7] R  RC086hg0P0]  R00Z00S R0 0HJ B (Q 0S 0P0B P0P(0= (0`>0P5 U ,W   `R `  0 0 Rd1 H;0""1 0 1 00!;R 0Q ` ++$ R +kJ:[ {{+S 5AH  04+C 0S021;Se 0[{ * r0  qK; P4 `a{+* p 0  J+t+Z SP0CTF  s9R  0r @ S0: {{+S 5A 1+C r 'a J0H+0 |30 c0""1!ha+ 300 Q+b P+a+z E XFZL$ R[ RZp `PY  0PP0S0S1 Wp 0pYJ Y 0*`P= 0d0P8X& H Y9R  p e(`P$(0 (0`P 0P  00P0 4 0[ G 4L QU  D $ P,@ p( Vp 0@+P R-  IPQP (0 SY[Q 0P,@P/Z 0SZ ' P@!U 00 G E[ b000PP @  1 0S0P ,W  qP (0!n(0 `O;cD +0{* p@ 0 r  +s  Pq 4J<0 R0?00Su0 00\ `;0  Q `{ A *N pN@  BB*N*0 r  P@y< `  s0R 00P@0m[s$0S@  `P 0Z  0P0 P00P00H Y0R p-0 PP    !M0P P  D0b0$$0$0Pg0 0C0`P 0S$04 R[ G 4W4 #[0Sk 0  g QQ00S Y Y~ R0P,@0`P 00P9UP 1P[ 4Q0:00C00+b {+ { +S 5@0P00   1 0Q Y6 Y p b -* P0 PR Y[>0S 0  7 Q$Y0P,@y 9UPPvp9   RQ R !**R UP0 P@ iP @f 0S]P@^ R `  p 1 @0;q8p0P,@0P9U,@ [1P* 4   6+S#S/\S//P@-@00@ R P@Rp@-@`0P0PR* 0PpP R 0 R VpP0 @! 0O- MPSWPE@!a0p  IQ V`":0  ơ R  RW0  * 0 S 00CX:XPE* R P  P  00S 0S W0*!1R 0CX:XPE* R P` ЍP0.- UM,@00L10WK    MX 0 "P  A kQP(Lp L@-XP@-hP@-Qp@-P` 0E` R @P  K00pQ`0`p@-`hOP@P  Kp-M ЍpFF|~pq1hpqpq1`p- M: ЍP/> 3D-@"M @Ϡ#90c 0>Ѝ0 00/m -M  0 p`Ѝ  p@-0@Q r P p0 S!P00py PP    !J @0O-M`pD@0DQ00P;5X# @0S S] @   b 0P1  P  0- T@@  0  "W @TQ 0P@020  0 W`h ЍQe @0R AX00@P00  L 0`00R-@0QMW 0000`VBoPQEp0 0 `b| V 0 <T@P@00R"000@000# @^ 0Sd0T 02ax PP @ 0"0! #000 @lx`@P 0Q/ R  B /A-`0@bSP)p`B @@AV * D0 BS   `3R0 pg3701@V * CQ B   R E PPO-p -@|M0;0 0 M0 d p Pl0-P-+*)('&%$ MT000P0$0 00@ S0000S`@ #T0`Cڜ T0 @l@00@ S0\ ( EQ $00 lp0l00+S9 -S40400l000C ^0Slll00S 1C\c,X 0d, 0 A(0S S ?o280jTg@Xpp Xaڐ* 9 g01+S5[X(0S (0vSj( %0hSpHp t0$0pH $h) Pp t0h0t0 pLW t0 h0t0 A<  R Q4 pCW pp Whpw"0h000004 St  <00S^40<000 0 ˷00 (0, S  J ?, D0LL@ Ph    !&Hp0 @P] p0   !HhPtp E `PN R P4,0D0, C0ED PP PE0CPpPU00 S 0SPEpGK,0SaEQ)3(0SoWg[  `P   PP 0S0SI p 80P S X 0S#C W <04 S0d0 p [c0[` KpQ 0Z00S@00P0L0h 0#Z00St0H0I `\@ 0P$0 \QJL[pp  !J $p Pp 0 S B\:<04 Sh  Bh $  XH0h t00@0C?oQ20S K x!)I Zɋ0S     0Sp|Ѝ 00XS PlP0P P0$01p Ql000Sd00d0R cpd d|Ѝ $ ( RiS IS NSl@8P l 0000(S0d0 0p 00nS 0p lpd0P+  ^PJT l 0g 0C ^(^l00l00(0pHpWt0$0@WD  @P {lp,000l0Pl P00W'"!,1HC0 AQ:S:?C0C0  ላ  RQzGpGp4656:H  000 S  QH 0S l00S l 1CQ;l00C P 6&V瞯.l00C0N YL\,4Q,a,p Ppu h00h0l@ZP3 l00Cl0Q Pl00l000000p d0sS(0pHpt0$0pg  4101 p W'"l1HC0 AQ:S:?C0C0  ላ  RQzGpGp4656:H \ 200 S  U80H 0d000KPt0$0pHW p201 툋 4P^>  OW 0@P0I$Pp  B\ 0S. h 0 h 0R00`P n0P$0 $0@ > P DPp2 Pp <0t $0C B<0t p:00 W0 0P0 ዴH^@UZ80{S相zI8] SM Oa0P$0y  p  d0P 0d00Sh0K0S pPp\  t00C t0  0V TRLPNt0 R# 00S S SJ p? 000 p  d"!@Q*M000  0c2300p S 00S 00P0d0M"000Sd0000d0 @0 pBpPp 0h0t00Ct0!HR00p0  0d0M"0 000000`@!0@d0 0P0I040008000c80  LTIT R0l 000p0PdA 0p Slp 0pD A<0p0<0t $ t X ,00 [d K P p <0h0Ct0 Pp{ !T T  TTQʽ (H^,t0 :( S<10:t$6t00`0l!5S00 8(! d  刋 H P9 J[@0P 0@00 bP :相[ p0000 P (@I @Q X@X @Ӕ(@ XcQ 0ӓ" 208 ,  J1 d000! ` `3P x3d  80(00hA1! 0 ` `` `P ^4A); \0t0$050`lS !00d0K AWW k 0S h0p |Q0x40  0 0Ch t0!0d0,W aZ!0d0!0< 4R0PP @Pt0 p 0Cht00d0Ppp04000P0d0I@  000p d0Sd0S`  p 000040t0P0d00Z!05 d000# [00Sp 0 WZ W0d00  3S 00d0 2Pp  h`1`f`Ph00h0!0d0<04 pSd 0S!0d00S00000t0h 0Ct0s@-}00<G-` 0pQ`pp@PO PP`q0s #8z *8 "80 W# G0 BW`E   3aV F@0Rs#8ḐA)80A#Y 0U 1 PP P`P    !YB@P@3ßO-0M@p 00S 21`C`0 000S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WJ:Q0 X  \60QR T0#03\0SuWa* G0V*0F@S3 F\   J0WN 06S ЍW*@DPD@ Q0; Q0Q l@ l@4 Q:@00XS Q0nM)ARo 婒Y" 0^0 n12000 QP0Q0l 1 c0R:|00Q )Q 0L O-M<0 THT8@`00Sp 00Qt0P00Q  EB0SG^E@0= PQa @0 \ ES YH P 0S S SC `Pb@0@00 00Vp@ !IT q Pe 0@S50000S Y 0 @PQb R  BPQa S@0D0CSڣ0SPW 0S] $E00TY0 p0TDX@N S0T0@ T  BB! BcP DRy`0 S0 S C U 0S S S IP@"00ЍRq  BPQ+Q~ -Q  NQ @N AY  ^!#AAPPn(@Ѝ P 0QP0Q 0S00 MS S80S 000 b@0 05I"00@By`P D` 212 Q`rQ  Q P PR  @V 0Sf Sg S @00ЍaF PePft0 S_H@"00ЍP@0M@EPL K`"VpK`W `2 p 1 PE@7`BQ@!80Sj80S 000i U U EP 80S800c8080S `T0)  RP!@L#80SU80S Q0   B @P Pwj 0`e  BR "@`P3 `2d"P1 5 H  P /A-@9>8C RP`.pn3 ^P W0@00 pU 0`PEPU 0 BP @` pV  p0 BP0U`0@-@-P M a@] 0 B 0C2S* Q*KU AZBKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ iG0"S1 1  !2R / 3RS/00 |0 c R\0a X0 c R80A 40 c R/\A-PU0000`A1 !0T a2!!p(  T2!ERA!1! 0T T0E1 CSB10R 00@-@MS: P @  0Q P~@ЍA-P aM1`p0S3 U10AT !0S 000 @T0  0S 0CЍ0@0D!1S<000S 000: tH p@-@P00p R pPQ`00App@HD `l80 0QApp@`9 tPH0  0#10/sP#8s R#4#2#10 0// /A-`P@100("@Up0p 0S1pP@P;pP    !D=`~P081#3S412s2sS/1J //@-@P0@0O-0MZ  @SpPA PaU* F B  E  ^'* 0H X0C0003 00ZP@T   `d`` XZ P` @T@T 06S @ЍG-0؁@pQ$A/ QPiV&10SO`P[ 1q0i000S h1b {0P4 p@ PU `@00SbPP# 000S 0803PU 0C  pPpd0!iV0S 80 (0R0i 5 lt(HG-`P塢0P@Tڃ0T P$ Zp !pD0  i )  \2!0L\0C0003R @@JpG \ -0P1 0^$23\ *G-P@p0@DTE1  0\D*32P ::P  @a P@0 0S 0SQ 0PApPEQ%Q  3!!@ V 0 0S03#V`F `F` 02NS @0@PpP 0!QQ!P3 p@- @A`DPD P 0`0R @ *\ l0D1R 56 501 P56 +CpR `C5<5#11C<C-` MYP=@P YzY0W6X0 W   0 C~GpGp50cp0 Ѝ  0P c2# R   W C>C0C012`0S0/0 R /@-?8aPM`8@nPP5 upP/0 S Q/ Ϯp! 0: S(QP 0uPP@0 00x0  0 0 m ЍC00Ѝ\PC00CO00. 4 mp@-@500C0S0 P5pP  B R /@-0rSL wS aS@ C 0 @0S! e C+Sr0 SR)# @0S@@0S0S0S0S@0p@-S6 @4P00 P! !( 0S 3/PP೼000P @ P [00 V00 !!4 0?OB 0pEC2PCP 0000@-@!R !P 0C 0 0 S /%2p@-@Q1P00SD 0  QO ;000S% 0'$0 3/0:s00P0p00P @ P 00< R 8000S20 0PFP1P 00s0 0@0 00 pB0 @0 0P* t-Ѝ/@-A@QS S S vB 0 6@@0@a6@@0@a6@@0@u0 0 0; B0/0P 0p/@-HB/41S C-@ -  !`0p EMD2/D d0 @"l f#0a 0VfgPx4p`T!dRAbPPa`k{8'<H0L0p&` &BZj XhCVf0T!dPa`C'RAbp@VfBTdA/ CGˍۍ pf APM_m[PQ 0kfPVpQ 0`fPKQ 0VfPA Q 0LfP7Q 0BfP-Q 08fP#Q 0.fPPQ 0#fPY`Eߍ /AOA,aQ@-P @41S + P *P0gAA-4!@ `PP/1S 0L1~P@wPPPU!RMPPP f!Rp ]V *A`_oR%A`"A``@-@P 0@D@A-@`rP] VapPePQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ   V @PC@PSSC-`@ Mp. Su$QU II P PQ VV( R0⃐0S (Q R 0DP  Ѝ0C$!o?감Y (avP0 R^ P Pv^UPU _^P`E0Ap0p(a$! $ P$(0Y (0 ^ S :0  P!@, R$!*(y(\(  0 S(剐$ 0 !(1$k0 5kP `l$|O-,M  R0 1 p3/,0 (Q0 Pt @P``^$`P 0BZ@ P@U pWW 0 {`PL @R㲀( PUJ[K` `,Ѝ 0 iPPu/  $`iPB $ 0 R`P# @R㲀/  P^ ^5 ^ 0Q#`[F PP  bP0 eP@  ,Ѝ$`0  ppiP   bP(pLW AT(Q`0@-@ 0! \ @+?00,1 ?00S@-@0 @>00,1R@-@1  0@>,>O-`0`SiM ? pPw;@P Uq  p >Q 0 p q+r; 4 p40*LDĀ `>PB H5 7 9 ; = ? QPP !V  Pp^4Q W!3\@ 0Ҵ\ \@4;P30 D‥+pW $cP G<2N ,0(< X5?PVAC  `DX Pu 0 6pj ఝ 0k VU 0SR A/ 1y $  p(0  ,0 0 4#pcgkopZ|`pZxZapbY|YdpYefX|XhpXiY|jYlpYm^n^x \\ DS^W\[_PPQpPxRPTQUQ QVXYppZY\X]X ^X Y CYGWKpA@WBWtD^E^F^HI\Jp\L\tO[M[NR+;R+ ;3S7[; R$?00S1S42p456: 89<=>00@p K[WW' K[p@XX( 帰R[@\\,嶠R ZK ^^. PBBYY)SRQBBpw 0AS[a@ PV IRR`  ;/@PJp( q PF  1 D0!NB;ḡ !V QU0 aP$4Q$P| @<<%< p@ED p0 (0$,K [pepUJJ 0!iߍOPK<P 0< 0 ppp<P<Q<Z0  @kA{40t?; pj7 D Z<P  B5 7 9 ; = ? <Z ڏ<<@P<P<P,0ay{<pw<p  O-@(P0P!0`5R5s`(P4QؑP, Ag ( ,0XD D S 1"1 Owcꁡ P ر   J; ^ؑ@-@ 13/, (Q0@-@Q )00 2 < 0 O-SMf `& 0[ p0P!W G QZ Z R U UUU  ;00PЍ5 p% 0 T !.@P 0$ Q10!12dPP1 0l%S@0 2X5X0 0L5 0  04085080050<0(5  B005000 S S ;00P p  20 2 `0 p 0 0^Wp W|3Wx# 2[ 00 20120GqS  000 G7w? @pP31S 07 0'P0 "  G(P 1S0S1S ( 1 29 2 1 29 2 1S 28 2AR0S " +H gPPH0b ”@S „9 LSPpT#0'+p/ SS4!"0X<$0X8X%0&W<(0W8Wt)0*pP<,0P8P-0.X\ k {Q<0Q80R<0R80:Q R$  k{ „SOL0SLPp&00p =&p P P P AP`ppR78@->rspq ppP/P/0 0 0P/Q* AQ1$%&'()0002 02  "00"00"00"002\/0 0O-RMPe @T Rp ?o 2`qAWsp R00 \\S 00Q2300C0 !  !pW ` `  0 1 01  p Spr pm Vj0S0`S 0S\P @ 9"00C 0!@0a`oobRH 0 =0A0@Ѝ@P PB WpGqX0 0 @ 0A@`0h[PЍ001 A0@0@W[P 001S Z 0I`[P0T !e A = ;1QC/C- MAT' }PT# `P 6^ 0 YAT R0 X 0V@T Ѝ0[P  000 0 1 01 0/p@-PTp U@ p p6PZ6P@x!x1 @-CM0M@P0,40メP9 D10@!,`@  P@*_p  p@ ip#  p U p  0 0 ,4 30CލЍh(0P6 Pџ6P@6?00=   0O-p@P%`5LM 0Q0D00 $00 2JU  a600 %5 0 D0 30=LЍw 0Q1S4  R#P䁄-  {00! 00 B0R :1S R[00 Pʰἰo 0S !# 0P0 崰0U P 1 A P: C[ *r B0@ 1 A010q 0v0q(0  0R 1SP  X# U{ 20 2](V Tw 0S/*S: pF 0 0S0400000,p8040,0 p1 0 0S0<00(00$`@0<0$0U3 "P 0㸱0 R410C00C S {?尰! 2 ] 0 JpV "0 . PPE " 0 | R[r{/0k0A00CR00 P {1 S0"1!P500` G-@( MP` A ഑ p0` 0U 0 0 Ipw0v BRxp \ 1^L br R  Br P~RL(0 . Ѝ0pQ1S  ( @a% 0     P, p 0 p 0 0R1S0C1ŁW+ V10C0S2Q[Q=X@a (00(0qv 0I@1P(00(0< 10C00CVT:Vp0 @aP  0@1PC Q10C00C O!P  pqP1(00  (0!0!0!0 4!Px 1 0C00C1P(00  ! @崑P(00(0 !|p@-@PQQp P 0 0!Q P 0 0s!ppG-,Ppa V0F_ 1 @P `Vᆐഡ 010C0S0SR 0SP "p ;!   J;1xVF01x  0 S001^1 C`fv`V 0Fs00 \~ S10C1 ! R jP 1 ! 1P O-p@MPQ 00 2/U U @300PЍ(P PV PЍ  `P  R  2Q PEP]Z*P0  0S  QᴠPEPZ0J0   [I0p 0BRs0 10C0S00 PP0 `P 10C0S1 1 10C0SPP W UP| 2P0 2ЍP C 10C0S  9 U   0  PV  R,p[ RX 0S0w  뼁W`m 뼁`WW 0H 1 P2 XAA\  !|P PB!! 1 0P 㴀CP1 \PP `V *   NP  T v  8`PUJPg U aU\ 0j200   P , Q Y qW`9 q W `0G 1P WR  BV`FrP! PB!P  `F 0pa P Qv!PEPpPEuPP  K Pp-M0  0P ЍQRO-`p"JM M $ G/'O R  PRLI@IU/ JP |100 "2 0 4 30}Jލ Ѝ >MX00 0TXS 0 I0;i0$ U"* 0S @0C/[00P0: S <100 R I R21?00A@V$ 4- ゚p"!10S X 0C \0 RK Y P 100W ḛp ᷛP 0@ox d mlR Q0P:Q0Q:'@-@-@@ $ @:  p@-@P#N-P$ ' p@o^ꌏ j| d @- M@0 @ P 0S  ЍLjO-@lMeppF P 0` $ (t0 F4<@ DnH C2 bG   p ($,08`LPPpT@ p@P , .PnlȠ P% `p'eX "gx0#@$b* c: dJ ,n P%l̠ e\p'` ```g|@$ L " ,0# ,lȠ.% P< P PPa`PPP p'PP Pgx`@$P0#.Pc:dJ " p'nZb*! ,g| `0a< l̠` 0```0P% "0#,@$ <PL vLP@P, X pPp0 p0004 d 8<`T@@``$` (`\D` +;H`P p0 $(, `048< DlЍexpand 32-byte kA-@p 0XMP `00T00  00   f&@  0 (0 0 T0 30XЍ D h1O-`0X! 0M@ p 8`P   000 0ap. R+ X   h   0 0| < 40 0 0 30Ѝ\e @-`\QMXPDf0S {@P P=UЍ᜙cppePU1  @@P tЍf0S p#P+p0 00 Wp@  pp /TP@  F  ꜈ 8 O-A@p1IlZdMP! p0 BZP0\00"?0 G0"[@ @ `@  @`T @@000X0SZ- 0 0 \0 30&dЍ  0 0M%[0S     =%@  S  H C-P- H DMH0D@D ` CPT0 +  C  +!0  \ P [pcd bc퍐ߪ  a ] Y $ P(F X$ D Z0 030 07F  P  P @@ P0f000d `0 0 0 30Ѝ`0 0e g d `<_Xhԃ p 00@- 4MP00,00 @T d 0T T H0 0 ,0 304Ѝ0$ '' (! Q$1 A-HM0@P0D00 `W @T( 0T pF `V 0V   h X0 0 D0 30 HЍ$ $ ׾$ X 0 C-P04M`0,00G*`@ gpW:T p 0T 0*T H0 0 ,0 304Ѝ$ Mꚾ T 00@- ,M0 P0$00 @jT ` 0T P D0 0 $0 30,Ѝ0$ ll  0@- ,M`0p P0$00 @:T ` 0T P D0 0 $0 30,Ѝ$ <<8  O-p1$M0C!H\ B簀 0r s0 0C 00@`PX  BQt !   Xi U P @0 uPp   r@ RSZ 0 `Uv`:00s0!01(0  0R 1S0"s0&1!U0C 01 0VH05 1H 5#010C001 U* `@ ` X@ 0Bt@S~e[{zyxwQutsrqpo'XPR* UO X !    } !    tL 0   r0P@@`uPt@p>[0 s0!\ 0s00s01$Ѝ00 0  r00  r0`Fv`00s0ZS0 ` P0RtXC-Mp`@P& PP! 0!0 0r 0000 00!! 0 04000000@PЍЍA-@p0P A`q080P0P0 00S   L| P00 0 00 0S$1   @p P@  0  P 0 0 0xWO-MPp@Pi Z0 q 0  㲱!-@@^C  0! 0 `PG 00!Ჱ 00 0@0 0D000%!Ppp!P@Ѝ 0 0 `P 0 0! 00岱0 00 0P 0 001p@0ᰠP@Ѝ pA-LPA u` uP| pa |\ L|挀@ X@  F0!| @0 B 0 0r0 r R  B`r ` PVP0 0 00 000 0O-LMP.x0`tp0 @20 Sp40$0 ,P_ "1p 0Cs011q "  00004P0S q, W $ 0G 1`P% pW 0p00CwprS񏐤S 0`4  N PI E APLЍ 1! BR,*0S00"B pW 0`0 000CS^[ZYXWUTSRQPO71 0X       WR   !@8 B   D0@<8 8/ 00Z1   0`Q!01 B 0C001 0C s0 !1 B1  0 04S[  0S  2 0pPO   q[C P0`\010C0010C0S 0C s00P0010C 0 @Sp  0C s00\000400S T P  N JLЍ1X" 0C s01 1 V00000 : 00`0s 0 P 0 0 0e 2 @0p0 0` U  CW *r  Bpp G 10p100 0  pCp00 0000 6 2 0 p00SL 0P p003UG- `P@PH `V4 2 8 0 ` Q0< R    P; 1` 0C00C 0 P"0 0Rp  pW 0 10C0R p oW0 R  cp0Q  P ` MC-P@$M`pQ @00 WW 07J  (0pGW[Y8WV4S0GS'00$Ѝ(0}W# ,0p110C RB0 s0x 01p崀 mP ,0p1! B Rt 0 jp0 MP ⼁pP b0 00(0rτ⸁ 0p0 (0P=`PY 2 00  0S 0S 0 X~弁 0 po 0S  00 P^ W1 W 弁qQW# W(0X6W6 p  ^W  P7 H⨀Hx긁0(0弁z(010Cx0XW( p  7W  PHx꼁, 1$ P 0WS?q X0G ,p⼁ 1  P X10C0xX弁 X0H 1 0ⴀCሀ !10  ZP p p c0Cs 0 ]각 0H㨀HxU0! 10崀 p 3Pp@-@`PP I0 00(0`0Q0(0pO-Mp@,0 01 PD a`F`V. `s`V P @ `Ft@@ 0P 0+00P 1 0@P@j 0 X @Ht@ 00@ 2P   00P Ѝ 00ЍU= 10C0SQ P `  ᴑC @Pp )뼑0 S00h0YAAS뼑0@ S 0I 1 PQ xP> 1@ 0C 00C1 PP. a0 S00 ,@VTK a 0R% P0F 1HP{ 2  PqQP  Pw a _ AU1PE@D @`@Dt@@! @ 10` PA1U @D0PEt@ @C10`@T0:1 010`C1s 0P!0s0 0B!R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/h_ P 0@-P`8@(P  0 0 E DH@ DX@ D+0/X:O-p 4M(@,2P$0 ``0p  pP`@%0f#"3?0,"0 \00#0 %0  d! "d! 0 X!p p\  P`@ 0 `.@X!.b!!     !  " !)! $   c! c!,    $(`,!A+ ;K[k{(b a`+; A4Ѝ99A-@PP$ p$(aV!P90)  B CI0 CX0C0(0 0`0$0d0K  E B03?\0h f# 08R(@R )@ bW#+P0 C C CC)8 bH# 0A-~a@Pp @f(X6 @s 0刁@pG0 0$0(p0$0. ?W?@`G(?`@``@0@ 0 T   0$ < 00T$0?pW( > 0$ q0 00$0?W@`G?`@`` 0$ @@< 00T$0`R @-/ GP 0@-Pd8@(P  0 0 E DH@ DX@ D+0/4R @-o/ p@-@P X00m]`\  0P "P p4 5O-MB`0PH,P}0< P0P$(P4PP<4 ,P8P<``P P 08 0``( 0 ,44$0pP0&)(Ǡ'Ɍ(@0000&7 @90#()',+$0#+$,   0 ,). *  @0 ! 0 *0P Ϡ) . %̠ PÌ 4@ !$$P $  , @ P0( T,PP38 @0`~?<`008 0<  PP @@  0  4 0p000 !1 !p壠#$ቯ ,)* /3(<ᩃ( *1笩ဦေ 0嬾ᇑ1>*1 96,à+͌ +%7% 9 ,0# $$ɠnj (ˠČ 0#ˠČ (  , 0  ,4  00!(p0 0,p/.!.!~rp'/!!(,#̠p' )Ì   ( " p , p ,8p 8$pp0 $PR (,]< xp|`tdphPP l@\T@0LX+; k{(rK [p xb|+; B Ѝ3$1p@-@@P`DQU  0pRPQp b Qo  0P0L0@H 0D0 0p@PR Q b Fp  @0A-a@Pp fPX; @0D 0 @0D # H00H0L00L0pGPPp3WR`G```@0D P;@0  S0D *H0L 0H00L0UpWP @0D q0 @0D #H0L 0H00L0W`GP``` P@0D ;@0  S0D *H0L 0H00L0U`R @-|/A-@P` PA78p@CU < p@-@P X00k]`\  0P $ P p0*R @-C/A-@P` PA(p@ U  03?0/@-<P1M00AP@;P񏐽 U L U0-*'<9630-*'\YVSPMoka^[XURO%"1/d]VzP;DPnE@5Py|{xsrqponmlkjih{xi{POedLl]\[ZYXWVUTSRQPONMLKJIHGFEm\7P 7P 7P9@ 000P$0H ƿp H1ލ3P 3P @ @1ލ= @02S, DP9w00   i@ 0H Ϡ |p h 0H  lp ]? R @ 0H Wp HP 1ލ d \@ 000-P$@ 0Z@ 0| n| l| j| h| | | | `| ^\z Zz Xz z z H㤉PC ]H㞉P= Wn Dn D@ 0h :h h h h h h h h h h &h }h 0 @ 0wa ra @ 0@ 0t@ 0  F     EDCG+*)(&%R d<|||d{zzxzx @ 0( ( 0P$ 0H  L00pH  \@ 0eH@ 0_ B <,dxxÈG-8M_(`p P 퓰य@U@W@V@Tn 0S?!Q 0S !Q0Sz Q 0 00 ^p" P0 ! r R  #|:W UQ VPw 0 `00 " Q!W  Up& 0V P`P( U  V h! 00@L) 8ЍV `00S0 0 V`0W Up V0 P`0 jP0SQ q0Sj Y @P0`0  VD pC dC HC C B B B !A p@-ή0@T 03/@TJ  PP E00@T 03/@T\ಮp6H00@T 03/@T$pxA A LA A A @ @-MX@@P Ѝ 0  pЍO-@R MpУ ഁP `@80 S 0SI: L 0 Z 0 80S6  Q?0 8 0 0 Ѝ 2 Z   0  0 0 0P 00   |P00 2   P   P  000 0@-R M@P Q\   0 013/Ѝ0s/r?  ;P100@-P U1!^ 0C B^ \ L0D0p@-0P`U 1!^ 0F BS @\ `fpUpG-`P @P0pS:ؑI Y `1`! p~ q PU  @ThpP pPO-Mq  PpG 0G PU @P U `1`!  <[  0PU0 $ ЍЍA-0P @P 0 a`F P pV @D: ,P/0@ 0A0SL*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp40``S#U!*`P840#U:I080pO-@R"|M2P 00t00[ 00S80S `X"P2 0 t0 30|Ѝ4P`0  嘷P8| 0 1\  8 40`00 0 pW`: P8$[= * *J1'0` !  4PU 80  P@R88P`0XA@ ظ 0* *J* "@R080 :0 S p8P8øP8p7P 8 ` 0孹`P p8~00zP8奸vP8or00`j&І D4 O-p-M$ ) 0H 9,0020L2S(0 PU 0P"4S7S5p90U 000\0h00 P0.0Rd00e0 0h@00S d0P05 0CX 0 #?01H0 0p 0S000S1!R00:X Y 0dc/0S0c/N  00S 0 Yp!SRPU *00$ R 00"00'7 0 2 30ߍP2S`708 R0009 4P`4∐\ 00400Pc40R 0 @ ˸p$ 0`U:: :J&` #S6P06_V[0ࠓࠃ48U00St  0\ X``VP ` p` pPP"X[v  00S8 ^(( ^ %P`00S !SRPU 00$0SD00m8Qp 4Zv ``` Zo XPF 0SS 0 P[P Z_Y0KX  R&c/u0 0# Y, !SRb@T W00$0S ,0S !4$0(0S (0@TP  L P!SR@T 000$0S?00 ZY0 0dc/0,04 p 8Q!SRPU 00$0S00dc/p v@   p0S 0` E%C"0`P0S(UX`P%`VX`P2 08@ lRP:P᪶z0 S (0(``` PC_oVRPU 0S0SᑶS 0 8080\S P \`0P  o`!SR@T_ h00Z@ @h  L`Ӵ(0P`2 ` 8@P@,@ z `Y$0S00<00S0!SRPU Q00$0S)@ W @ P  l2 eȁ P0 l/ `+ L+ A-M`@P`@p`@ᐨ,0 0000(000ePႨЍ( 0-  “ ƒMp@-P@Q 0P !  2!0 2pp@p@-@P` VP p0-P@  P 0S RP0/OP *0?c0 3??oPP0/0/8!81@- 0MQ020' 0S0. /!PR*/ "RR @/ 1@t0BQ R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ Dx pw Dw /O-,MbP "100 000 0pQ PT 0@`P&@0 (P P$  ;/ P;/PaW0 0P`PU0b   E BR  R L@F BR !R5 0T0TF SX:PJ0C0 000 0p0pSpP0 @哐(T**Pc`p@Y* p  Wp ;/P T T  0 X0 W p0p0W:,Ѝ  P;/ 0P 0B  `@U, ;/PW W 0 0R0 0 R0T 0g:W 0  00@DZ 0[W  P S0PIW 0 00P=  R0P0 S*T W  RW  0 P WE P @F B BR !R AK;/P ;/PP ` 0 0;/ $ P ;/P0F $0;/ P;/Pڅ0 0D0P;/ Pf;/P ;/PPPWAE S ;/P`  R0 PP0 C 0QYP 0  F"!  R @F B BR !R A"! Rw0 0ST;/P?P ;/P8;/P}$ ;/P`u;/Pb ;/P Z ;/P0 0Q$ ;/P$`Y 0 R0b- M00 Ѝ|R Q0P:Q0Q:+@-驿 4C-S MP@  $3/t`0  QP ``4P4S  $3/000 Ѝ00A-pd 4V:@T@T 0P0S  00 S  0@P0`0dp@ B ! @-MP` pI~P)0: S"(ձ@P ˄TPKQ+;@bAl(b`ph`C@\ 0 ttdTЍN00@Ѝ $$4/p@-P$0r0" @`}Pp$U04  0B0 0 1R  0 p %  00@tk M 0 ASL @- 00S 0"4O-SMz@ApP`ᇁ0S*0S'  TP Z !P0 00 Q   0    ЍP? $ 0  QP08$R P/(O@p 00q000S0 0p  4 S  $3/Ѝ v00q00mO000QA 000/0@-S@  R   0 僱0S~p@-P@T @T 0 Tpp@T{P`p  0S S/P/O$(0c03?c00 R  0 0 3??oP//@-@ MRpP:Q !SV@ЍA0 0`I P Fm@FЍ0T @0 0O-0S) P& 0S# p@# ,0aT T 1 !3/Pp@DR00C0S T,0p@2P ?0T` BB \|  i V`! 0  `C``@ 0p0C0S 0T `p@QQ   D R !,03/`PIʼ0@00 "R( Y `10`!P0VQgRJ,03/`PY M 0p@D0C0S T@0T p P@0S*V* 000vP@DS*`A 0`V:⪯0P 00``F0 ``i 0Y0C00 00KP  0 0C0 Z `0005P s00r 00n0% p@-P`V @`0@D0T0@T ,0 3/0P`ʼ0@00pD0Spp@//p@-@P|00 0 PpP 00, @ [PỢpa tR0 q R/ S/0 0@-@00S- 0 ,   0 P @P 0 0$0 s0 00R 0   0  0c04H` @-@M`ppP` p zP0 :CRo  S L D0( 0R Ѝ ; 0 Ѝ;00_ #3 @-lM0@R0d000P C 00  "2 0 d0 30lЍ 0`0S p|0Pv X"X p0 0R0```ppLP0 ```0S$p!@ ᇠPa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00  00 %  w 0SP ` 0e p pp 00 p@kP ^ `^ 0^ ?$>p@-@0MP00TaV( 0T1S O60T1S0`ҡ00U TX!\!R Ѝp@\!ס00Ѝp@跠00U\!X \!X0 000S/\Z t0 0p@-0PUp@0╠00TQ嗡0`U TQUP ≠pX1P0X1ꆡ0T0`X10Z th0h 000S/@-@0n0 X10CX1S @eOT1 0 @^Y t0 000S/gY t0 0 0S/p@-@0PEU00 \A\Q X! BX!R p@5`N00OT!厠00p@*X t\ \0 -4M0 0,008 00 0 ,0 304ЍDX X  ,D%yO-M@Q`@0@HP8U00B PR"SS@ BP 0 !#00 P0Ѝs00ꌎ@-0MP0@ >S  @ B"00!,3,0 pP0ЍQ00@-@'o@'o 0p@- M0P@000@`0@PP  OP< (0 0 0 30 Ѝpѯ/ l/ / G-Q `P@ S V @" RpSQ P` 0Ck ?o/o0CS 0c0<ÁVS' /o?o BR  0b0<ÁppϠ0T0S?p?ᬏ0 Q RVP00B  V 00T# 4o 0a08/o?o0Cs! p R 0b10pÁV V50o800@b0q<à)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO 0@-@%P  000 /,0,0-M 0 000 0mЍ*  RC/A 0\R#R! R/ 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGOn 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 000Q0@- @P' ST0 C0 ^@DP \T0L^ Q^P 00PPQPS@R S Q0 S0 0 /U/ S RQ0 0/ 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@Q0@- @P TS Q@DP  ST PUPQ P00S @Q R U// Q#/ C//s R RS 0 0/U/0 00/ R S  Q  R  /SR Q 0 / 0U0/ 00/0/R - /P0 0Q00/R0  S 0Q 00S00/ 00// Q#/Q- S  BP0C S P QP 0U0Q- S Q P 0S 00P 0| 0 @-M0@000!00RkRk00Lk Nk4 ,0 0 0 30Ѝ `  0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/4 40 00S 0M00Ѝ/| t@-@p@-0@ ,pupPl0Pp(||////// //O-4M`p P U uP1 0 A  A0( 06/4Ѝ 0 S@' 'S㴐0S S7 2S@0SQ00P00^) 00@[0 0 T 00 "R 0SPD @RUh00\0 0 S00,00@x}T}||t|`|L||{{/Z/[/O-M$, 0Q< 0000<0p0 0 40<  =<;:9876C43210/.-,+$)('&%#"N TO tpXgX `<<@ 0`X \ [: Q ^ [p4S0CP Z0Ԅ0˄ R*h 00CS0Cc Z  ˄0S*] 00H 1!00H Sa   0  00S r0- b PG *X 00H S` >6&00H S8\4\1 0@T v 0   0 P  BV`f F0 P 0P 0400x00vO 0[SV00`G@ V0N`\d `X [f* QeAQA` Zp˄Q*[@ a 0 0 00 0lX PP[ 0` < 0*P@PPr 000 0vq 0[SV00j@` P0,  v [QV`P/ 0  0 /+ 0 R . 0yPv\ r\500< 0 0V 0T P0v[S @0"".!00d0NF @K< 0v 0 R001&:@,00 `$P(`Pᜠ+ @ R! ⪠$ dVP0  c/* `$P(@C0 N CF @ 0h 0v00 0 e@.10d0Q\ 0@0 N DF @@ [04  AQA0 Z 00˄Q*0\ ZD@ Z>  p Z ˅3] H x 000 0G [00K0D"42 0 0 30Ѝ 0 0 / 6   # 0 ` @`01000   @ 0 0   0]  @0r 0 ( 0 @r   0 0@ r 0@@ 0f F0 0 @r  000 0x0 0`o 0#8T0  0ql tЪ `0` 0A-`pP@PU J0PEX@S 8/`upW, x 0SS S 0R / 0R0@o/ @-&oO-p !P1CM M@`00440@  0 @0 44 30*Cލ Ѝ0`P 4 PP \p 0 dPzL+   0/\,  G-`0S+ S'QU$ pW!@0 S0P@0#S0S 0S0S0S# P Y Q@0 0R!R  "R R R \O-0ഀBM⸏xMXH/ P`t! X' 0 pgP@P Uhh0 ZP"IPD <0 0 4 30BލЍ꿦 O-L!H1 @ AMT M00400?1 Y.: p`x (R5 P_0#s0S"uPU/ 0 0@T gg 0 P PU $ 0  gPL D0 0 4 30Aލ Ѝ x (Re| | O-mMM?x /| 00602 @x?T080 1S 6 S`1  8 ?,@ X@0q0x |\- @0P0 .0S3 SH0uP`【  R LP4 p O ḐLeP* R!Rㆃ7P @`PT 0STup P```0SPU @  Y 0S(ڐ- @ T |- \ x X < l Te 0d<0v?HL00D0< 0h S1S D 300S S00`01D 021帑Y[0P0S|000x0@0<00SsATp D0CPo L0PPPym 0;[@@ 0 ȥP @0PP D0< @0 < TL D0 L dH0S  P0S Q <00ox0. S00P00SS |`P@*pX 0@9/PU +: 0 6 30qmލЍpW? <@PL0Py !dL0P0   8 : X0X 0v/$ W G $   0 T$ 0$ 0W 岏  v@ Š01粐0a 8 4P|@ X00H0  1aP0kL @0P P8t$@$ 0n (0l00H0:8$@# 0X04 2!  `1S 0    0P0H0`PTgʌ PH ?`!!! Q;   <38 @ X0 [ <*0P RB @ haV @*Px 0|@6/P<0+S .0CS5@30P.PtPU a8 L2@ X00`!8 2@Xوl S0d01SD 3h0h00S S`` ``P19 h0 aP0 h0R`P101@PDpcpP 0@ 000 _@00P`00P 㸐D2  \ <``4Hthp<h TP0D Br DR _Pʁ0l0~P|0@w@ l06SV `p$0bc[pY0P0{ D0P TP0D Br DR _PN0l0K@I0P 8D!@! 0| RW00 0R 0`1 k 8 10 XP0[0  (Yᵖ8!@H"H 0Ӈ$0 P 8 @2 X@0[0  (k P0SZ=00ᇖ8"0" ेd Gr R000 P T Br DR  R,#_Pʏp0 P @ 00`PhP 1011S100u8 30 X00<0l0l00e8 4L@" X@0x[0  a({00P8 t4 X0c`mW 0p0h z(0l0^0l0[@Y0P 8%@0%0 0G0+S .0CS"@@>0P ו8p%@% 0 `+0l0(`h0 1 7fP0@ ᳕8&0& цᦕ84&0H&H Ć괠8 h6@lXຆ/ /MM  00  C R1#0e(6,Ѝ0/M- 00S  R BC0S N 0Ѝ/M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@'_P$Ѝ0 /_P0/0$Ѝ000 $Ѝ00@-$MP@_P$Ѝ0  _P0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-P #3CM M,p@0Xd0,401$D D$ 000 S  - 0p y P@ȡ0$ \0Y PN00A  !< S P0 $\4 0; P0 00 00;  P00 ` `P10,430KCލЍS" ` 0?s0S0Q. Q( Q" `     * 0/?r s0Ͽ|Xຄk`g`d`*d  dl@PC-PH AM@M`p0 4" R3 0 @ `! P,8ĝ0  0 0 4 30!AލЍR} PP 0@ .R@@T  @ @ U`̞ | ԷO-!1AM 堡M0  0 40P]pPLpPG `˄PPB @ t+0MP7 0S4 `  0S+ 00@ p@P00@S 0S0S 00@ K@ @ @_ [D ,0 0 4 30AލЍT p( O-p#3CM M`P0@X0,40\@o_0S  .S@0SV:T d10S#0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $'_000$0D DR @@ 0S+ .S& 0P0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@( 4P/d!  0Sx0h 0@$0000]0@P@Tk0!0$  00$0s}0S 0S ^V0 hO0  ^T O-p0\MPl2@0`#T V0 DCg UR3*@ pϿ16 /O 00S 0 \Ѝ!0g'' 0  V X0 F0 0]P0wpsD^@^0崐SUHPP   B RX00 B 0]P '^$^%^^ @ຐ\Ѝ0 `F 0S0  s^w ^ ^0s^0S 0  @<0\Ѝ HC-@0 Mp`(P%@D T@+)]?Xp]뵐0  ] ] 0@?0s0?0 Ѝ(G- p@ᴒ`ḂP E0S@P0WU!P ]@], DGp]D,0O-䡐 MP0S5 @d @V%0V@Q\ 0\\"  p偣 pp p $@4 O-aM0 MP@060G[0# 0 T =0H0E`@01&,d!n d! .0A 0`11@05<0ጌP 0ʏ 4 Br@p d1 2d1t.PU `@ @`0H SD@_ S\  S S00 Q@0S SP C0SQ0 0CQS000001P nmFdosmaFaGP P0s/0r$G$0 o t)F s%r&G, / X  + 0HP 2#S;S 0S! 0 S 0SV 0 S 0 S 0 o>R 00sS2 S S 0  i>R2 S S0S 00 S S SS@@  `0ᨀ@_AP@ ܵxH d14( ff, 0, 0S? e2R2$ S S400R00S 0@0 S S00 0S Sl  P }05 C0  C1 0`XF; 0B PRT RN0P $0T $0R@0 $@8P $0 S 0d12d1 AIV| Ꮹ1|WAp 0τ|`0S X `0`H@DSH .S0SX P`.HX00V0S 0 P " 0"002 0 6 30&aލ Ѝ l9s4GRB T T0 SD3H`00`080X3LP0(0 00DpP T T@ TT  ;T R[@T #(0  ;T 0s000@@T  pP 00'P  X0們8h1P @@T;T x4P0 0s000@@T;T   PX h!2/R !R/$0l!0@ S0܃DpH`LPO c8R\2 S SX0SD 00 S S SS@@9  `( _AP@H `0DS \R=* S S00 Q0S000rOP.P `l1  DQ fD@`|Q0 SQP@qP  X0偑h1h13?S 1/S$Pjp0p-PQ0 2 {4[XV!!1 p@-Ph@lHMP ^ T 000HЍpp Qx#r c+VV p  X0x1VPT $000HЍp(,+aD+RA-P 00P00S0p `V pP0\\C\ `@`@ ꃃ `` O-@-\4\0QM @|0P0 p0P0  (0$0P0@   MPw zPY' RR - 0 !⌰pG#Y 0`P  `P yP ` R Y0@0 0000 R  pG`o P@T $P $f a` AT #Y  @TpG  0  剉Z00`Qߍ P 0` `FQ* @@Y;8 d ` P叇:@@T:@DAp PP` R    Z@D ` P ^pW @D Up- $ M Z @D 0 q U p 0   0  ;8 @0否0 0  |0僦 0 t@{ @0@ 0@-@P @rE 0 0{ v `(0( 0@-@P^00T 00/Hv @-@P @LE00r{v ȇ@-@P=00@-@ P 0  0p@-@`M 0 0 0I{PP P :LP 0  ЍpЍp 0  Ѝptu P1P0L!@- M` 8Q0pP0 SpG0S `^p4 Ѝ@@xP 0xP 0S@ R @vxP  A0ʉ Ѝh0d `  ྉ ЍDD D  D##h8Сش0A-0PU" 7U"P7UP!q|@@``FlP $dP 0!E`$1(`P 02~P<""O- Ff M@`0, S0 4 V FPp$@0(RB q0ЖYT0i(1<0 BRQ#)16: 5 0(< ܅ 1ş c p0@00'(p4< P( Pz ph40SgX% 1S H 40SkP6S (% 4 0S00S S404 RR 4 ,00,000S$0ğ 0000( X B2*3Q Pq Q^P( 0D$ Rp (40(s1%40(8p(LoP4040^# (0p Ѝ 0Q 0Q*# 0(sx30!8(p04Q(A%01Rx(# 30<!^ ^ w䂟 S:p 0(" <!%p0(0P^4+|20( p2 0(< \2 0(< H2 0(< 42 0(< 2 0(0 2 0  8 ( 쁟00(0(1 0( 긁(0(10(0 R 00! 0t1t00`10r]p (4p Ѝ<p N7p 0q^(snqp|2 Z 00K  Çl!8  00S@  @ 0~0 T0 00Z @ :P80 0 0Z@ R 0X$00 $Ѝ(WWWW(0 $0 @- 1xuL p@-@@`V 0 CQpPaP P `FP @  p㭄P 0`0p@-@00 R \\  $0!0D0 0@  ( $ T@-@PL  0S  T0S@Q*@Q,P/0d 00 0Q,0/01P/0(00$ 0/p@-@P0`P 0(0 P0S  1T  0C00`p,p@-`0P\@P  PWP 00p-P A- @0S  P p00   ($ 8PP(p`P0tD*O- 슟  #0 0000xqp Z Z 000@Y|J @PЍ < 2R"00@D\ 2: 28KP0 0^ 2< 21 0 010010 01001001  B 00l100P 0 R00   0ST 0 2 13/pT`0-00ᝤPP ` 02 2q00@Y@0SwZy 2: 2diPr 2 @0 28001,00أ 8<,@C-`@ MpPQ 000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH DP (0$  (p 2 00P9 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p x ЍR @-`@ MpPQ e00U,0`V( 2S * 2 P13/PPF `P 0 pr 2 00P Ѝ 7 Ѝ00PO-1PMS-:00 X0*q`I`[ 廛p@ p W  , 00 PtZ 2< 2Ѝ~PЍO-MrX>*`00Q̱P@傛0p@ W [KPE }P0# ̡1PE PU0 Y 2< 2Ѝ1PE P0 0 Pt YЍЍ"1C-S` M2:rBW R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 Ѝm}P"! ЍG-MpZ Rb'*Q* U@0U @ RD0 d P X U 2< 2ЍE@ЍЍG-邀@`ᴑP 07 pv`p IpV`F1wv`010 R 1\`0!B L\ L| P~ \!2 B!0C2pp@- @TP ` PP  pPp@-`P@Q 00T T ! 0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-`P4M@Q 00 Vv 2+ RJ 13/p* 0 004" "0$ 0 004 p`0 9/P 9/P F0  ^ 4Ѝp$  0qp 0 ؙP 2: 24Ѝp`?(0 0,009/P  S0!`$P@  @00CQA$0@D3@N0!R T00@2p@辡8 O-0 pdM@/Wp Ꮰ0P$0_ 0 ᇠ PX $wp0 000 00QI`@0@0( 괰\ G  p ||/0 0K0 0Ჰp`@ Qڴ0SPPG  NK0 |P L@ D0pz00$0( 80@s`PP0<0H00 0 pP`4 ,  BRz r @T 0 ^~pPa(PQ0SEpP  0 000{ PA0 s00pW70H0SB@PCLP ؛0S 0Q0S<0P0Z 0  00` 0000  V0 P[(P:,4 Y    +<0 000 000 P'T0S0# P0X 0 XPUU `,Pm( A0q00L0Ⴠ$000000dЍ4 80@0@ QpN0`0NPP `^ ,0~pS ,0p|0,P80,8@0p,P-,0S?8@p00,P#0p4 O-\p? P0`S0@L$P ov uP' Y  0z S40 ̻ 0 (!S$10$10 10 0S0P  0P0 S0ݞP  00S 1$10$100O-P@ M` Xp@pR 00P 0 1 !H0Css`| 0 ~r P PF`P `0LPP X Z `0Qa Q 1 !rY  pG0 0Css00L0 H0H   A 0@000 0@pW* P 1!{0P0Cs0 Hxx!0 pW0qs0 0 Hೀ 00ഀ00B000 Ѝ@000 0@psQ0 C0 0BPP @000 0@p ЍA-0p`@PQ"  0\U@ 8T8 0PX APQPR0 B0Ӳ0Sr 00ô000 0 Ss 00C00000UU800C80O-P0( 0S 00Cs0Z@ ,WPI  0S"᜝@P  0 S 00Cs0 S  p`V S@  0P@@A-`P 0@T@ Tp Q Q\\PTG-@`P 0S 0S  0Q;@PS" 0 00ᲀ\S: 0 BS P= \0 P  0 (!0S 1$!0$10 P P 0 㼐@pᲀ 0p 0 S 10 B\ἐrp P $1 (!0 $1 00 O-\?  M0P`p0CS0@L P t TsP& 0 0  eP 0{ S0 u Ѝ0 0S0㠜P 0 0P000@- M@P p10 Ѝ0O-M 0`0p  @DHPpC p P -z X  0  ‰r 滰 \ Lpര0 ``p0000S XЍ 0  /P @ C0C r 000P @G-`d"`2(M @0 0$00w?0Rpj2 S:0JS 5PP 2 S p 1 P ZP崀@ Z1L PH: CX ": L01|  p舸” 2 0„ 2u 0 0 $0 300(Ѝr  B0@ h1x p  0000`0p 00 p剩P202]to m A-p@MP`Q *00 2   Q `:1Q#0" B31"000 VI VFEXBAF?0PU: Q * 2 13/p1 \* 2<00? P#\0 : 2 E E0P VP V$P 0  Ѝ)00Ѝ0PU Q:(0 $P0PU`PpP  qP 21 s'r@--M" # @ M.<xx  0Sd000S 3/E <= ,j 8 80 0(Q/$(0S/  i L <<00 R/( 0S/  Pi T, -AF hFF #x /! FD M)h1 J#F I H F0khBF1F8FAG5 "hh-OFhFTI \M*F1F FBыK8h$$*m" !   0^рI B(Рb+I+GFF"FFFFF&F+FFFF05FCH" 2h*6H(a5L2h>F O !OFbh:b`*ŀ FAFv )@($*\ -t/@ -@,$Z^ 0]I 0X)F/$*p$'*@ $B JIHd U? $"$ 07 %(FP&Phah$Z$ -  .I/HJFHd SբR )H0" "`d S?DE4 FK' -x'$*- M &0- !0j1 ^ 0-E@? \"hP `x=碉"`0F6\-OFhFI \`K$J&FFFFD!(F9FVJCK^R(7G((>иfO  9h(mH8 (Q xwwwxwwwUxw{xO Ox(e(X( d(!uI hO sI hB:W" -ђEђx ; `iKh- (,й6*aM F$0B^I"F#m@aOrdO@#F(c"m@`l@!OOrF[h`kG#kC#c(cbkqH a00#ica<2Cй2Cй#mCO "l`lSC3l!ik DG]M#m@\IM6@SBA((F(D(Рj(D a(ъ)FPHPI ,NI LHOSU`#`3hZ2`+51EJB@#m1 BA`i! ##2C kl-@i(FG0@vh+ -I7%m 2BBBAҫ !0 [jGFPF/ф49F@@ @ XТ ` UYm)Bh YHF00"j6#GCLHt#m6214B2223B2#mZ/2# #2b6PEE2<4A 2?RFF4.N 2123B2 "13A:"1F0 D01GJBѸJB宸VU?j! i 2!iDf2CaaV?lkhG0I% L%?-OFl]hFI [W `NL<2F9F@FE !kh#j)C|I^G8-(+.?GMS #&047I F(FJ[,!4FY3IF3H ~j0K!hF`cp+IjC*Ij+(I#bW%0+@𨀢l#l*G%F@K #lV<ԣlV<0F`#m @B+k8F$5FE(أ "HXrhS,&k*+#m+Q!Feccl{@B!(rI `ObOs*@Bck'flYE@&k.@EckB#kcccl(9F\ l](9F a `Z"2((@B~F@AZuI >@I#ccV(( 0h7Fcm+1hjH 5hpCO(F#F5hak(F 1(4l  j(F8cm+TH)FlbZ 0cm+NJ1hNH78FHcm+GK:F1hHHvcclЕ8+h0BF.[ШhQFF,2L,.2L.02L0 212B2242 [B4262[B6282[B82:2[B:2E`v9FP6nshX(,hD#2B23`#p( E(S("IFH  ls( x(фIHKh|K"zK""xK""uK"!3; Z l(NsI $! pI oHF(AgIlHlHB,^K2#hJiI_HZM)iѺ(tUM1+b.@SL]H!Fx\H0F&(S23SK"VI FUI -AK" hxh!FhQ( F chx!+"AHh+/I9H0hx+ (7H6H.6Hh4S2kL2+T |h&!:C4  m4h "M&"L#H)Fa!HF0FR(2+?PK(F"IG >8K"IHJI H L H!Fv ((֮J2+?%K"h  -AF hF/! FD FqIHF(BЁ'mLBF1F(F~CPjK!hh)𗀠i-! (***BBh:W"P+iF(F ((@pC O@#`RI*F PJ1F(F@0KKh*V#Qh 0{!F w(e(L(2P(3F(,нcf8(S ׏oooooooooooan#c`kg`i#'aca`d`b#ga#a^'`\aZ`X= a jai)gcIV#yh"iF(F zF(upCO?WB F")FCf >kf-OFhF2fI Z %C4FJF9F@FC ]KhW#pFFF-h!F8F 0  (1h^FQH:7h/U%m(p(OоJL hF "h GI@FPFZ.FFAI@F?I PFj, ь WFh F(I OZ&:F)F F~C KhB і!F8ꈹF L(P(u&&(мt HdKd@I"-OFhFI ZL%&JF9F@F.C љKhE4ܖKi 'f( W(&P(R(Od(tv(i( r(Ox(&bfa#ac`#f`a`afb~I O FF2W$0sL+TXFNF`-^qOOV[-EiF(F cj([+=NpCO@pci+@VaH)F,/XF8XDEx/+%/!XF 0.+ћ0#.+ћ0  NHGK"aKFZhC+*F  FibhC#/F!cj A#j A@0F"FܐO0FFph+ŀ1I_F!0I P0; +m2lll\llihj (-jZ)FFPF##a@ZI"FF vi3kj+?++/NZYFFHi+Ѫm|(")F0F"##}X!i^QH8l2;Ci Pбik)jHFii۱P0i+#+hii vi"hC?`(jYm(j'(R h+I!(Ci+h+?;h?+?5h+0F4 ii3;H)FZ##ah+?h?+?h+ї+? Z)FF+Hi˱pC`O(F (<УiC)F8F&ui*ѳ`OjF)F(F(gO(F h(F iF(F/(S|h+?Nvh?+?Hph+Ai+?>(F&9^l-GFh F2I 2NZf'O2F!F(FC,KhBO;D&Tp0F*p(v("K' F(!hHF&0 h/%hO /!(F0Cx++x#C(F ( H)F;F0+(FX!p! " O#"  \ F F B7  L ! p (``Oܿ#c`.LI` ZHK!8  &(ŀKh++'+шK"% dK"!"K`#~Kh+JzJ6 *uJ! +wKhwKhtK`qKh+ rK"`qKh +.#cKxdlH>kI#FkJ(F F;F FeL hCh;C`+ "hhY` "_HphZ`+:#MK6 0kGKxSSH(f3#OK"`@K0+cAKh+_ =Kh9K(a7K0S8Kh;AKh?K`v+ ?.K60+:H+5H8K$L ` #1 rSKF0+(H#X#x+x+#zM$&FU 41F,ѓI ~_!Y!Y!b!Z!Y!Y!Ne!\Y!-GFhtI YjsNtK$tO`3h BY#9FPFTFPFEkJIF(FB2h(.cI 6a+R#1Y5U$! (  PI$$MI (KHxJI (HHnGI (EHd,У+h3=M#3hq+Ff(@6IBmع*hh#x320[ FfFF!F#3I" F a;H!F~KI $(H f`6f6l6Bt @v6ht@6t@6h66g2gt6&h 4-OFhFI YFLz&FF5FFfx `oSBSAJc`K9FXF2JCKтK + iֱ+\5h0F `0@uI2F R(&G((1H8 (Q O%h(d(f(!v(!XIh!O%OO !%%+=5 йFI %EO33.chW*+=:!@FkW*`3x;#+'6I0F-K`  ")FXFhF(@.I j.!@F((I@F0F$I0F0@Fch ``P0; +onn4nn]nn]nh#")F0F0FF(h+c Ig!V76&`7PHg!YpY:9F'FPFFhzHmiB ѠhCjBђh`oТhiGȱ)jHZpY9FFPF',F+(j~'8FdheR-GmFFcL``c5`G5 `c85`5`ac@C5#aaHHFO&AF:F(FAѢi*@}I" 0F8hD7yh)wI2F NuOA86(!9'-15VQpī#fB Љ#55#53FF#5#5#5VKVIHFr AQIHFh@@NIJFJKh "!?F h"+ BI "!?Fh"+ 4I "!?Fh"+( (I#x Kh0#m#5v#cas##i#1k#j3#bg#X#V#TI z#iAB%@AB!Ig!~& s. 1Jc@G!ai BI h\ Ѵ`hEєBػB# `#55KuhO@ # ` F%b-u%*pX#&! -h)cX#&#JOcd`ڃJI -O%:..GX#X#!I5s xPpCO#55>.@k'-@F#58F-@FQaH`KaJOa`K(F2P2H>K>I(FF22Fù9I PDh#+ " 3H2  /I/JF4CF0FY FBX(" ."I2F H21FOrHn(FLF(F`v@FFH2 P<i!^ g!!+(,^H@^Hzch;c`+ FF(F (0#hZ"`xch;c`+ F#hZ"`x +% N-(d-@F<0OS00OS0?HAF-5@F11+1[4HB2HA(?d/J,Hq%*I(H-(I  Y(?@FHF#-2I2@F(I #=-?T(FFI*F HOrHP@ "!FH({3g!i!,mdg!(-CJh(KZ`,p$NO XV[8F)FZiF `0;`0+ AF n4, X0ZX "p18b!+-OO#FFFFFO   AF:F FFA ѕJ ,$l-&t(c(S(P(FdE  Bn( t(#Fa(тJ&-d-ХrQBQAI{H" ?FvJwI ^!d-A R-S--Q-pI*F @p-}r-Bl-",;X*XF2F # X*"aIXF 0^I &X*"ZIXF 0XIX*" UI XF 0RIFP X*"FC    "IF,<X-FAI"F&WE&6BE:I XF p08IF5J6IF(FDX* 3IHFJF2I(Fx1JYF(FF(F+JIF *I$ J&IF$I ,@𖀑|F&X*HH!F FXX< 5&5zB6~D"5D/5{D=5J5|D(Y5f5u555}D55555^(I ZF(F%KB.=s@3B0QF(FhFXyEW(O 0 IMF0ZFF*1F(F"PFFF(FIRFHRFFO+yara6h-OF-#LO8222423322JIFhCcѐK4Nh2)L C C C C@-dR@SY"03`d20hc @pCO#d210hC3C2Cd2% FI I+@ekO@C:Fd(0aCb9Fh+@:cH~z(IR( 3(B/(C18(BEGIS8'(9^8888888888888b@88fj888r88888888(  . BA8(#0B###6N "#20h x (2h0I *KXa&#d2"#42#2#2#2#2!M$!Njh4U0F>, a#2232#2K/!h0FDF3x+?:0FM0Y:!Cؔ!D&C-CF#;3x;:0F*06:/!(FFF! yx9:(F0":/!XF"prx*?:XF0耐{x+?:(F0:I @J#O 2:I8h(:h3h\ I3ocOc3]J N;F2I0h(2h;h\#BٌI*DX2@N/!7h8Fp8F \H2hpCOрKa*6hXD/!0FzhyJ3FyIyHivHwI 0F! oHH*: d0VBBWsgHcHcIOR0F R`IB [H0F ~ !JU#BVH0F'w j'r#3FK `>Kh3;Kh4?KFX`CB?CIs!cAHO;2#23=H2+?si38H-O #::*F!UX0?WF(?F:!UXx07`%HX7`d20i+: 0C1hH0i O33ao" 0a01hH86C̔!&SC^C!{CCД!#=^CC8!CCDKDhDDDDV#1OqH1hV+F@C@ !@P\02T7,2P7OsH7(2L7H7'\Ts`L7P'?+钗@<"82.!(2锗P3i`uh;(FW`(4gI*F |fJfI 01hdHaJcI0i 01haHJHF9F7-@!@)F GF`WH0i (5aTJ ! PJ !'NJ8a3023,2 3(2CM\2ӹ#SC#)I1!D RObB\"ZBX23K"Fy()@8h&Fh RO#Fa!iOrPF1(i'hC'0K:F 0@H#+b#a"2*E+@EKZiiBID,E!rdA EedAE^!x!ؚ!!!AE02o,2(2?+"\@3?! 2JBYCaw0 L '8F 7(MPFP:PF(7:: # cR!Ơ aPPCFp2(F1&CFяH02  /ъKd2+ꮈH$K1FF\PF9FCCFE5 L  HF5( @3B  23B  lKo(Oe(regJBs®Oc\2:?31*?+?䮗0*(ڮ!*ծ!*Ю1K #L Bs i3a(?1B{ FO +a2"C';O2B+@7N ( Hxi{?@)1I1H1J-Hd!~(@.Iv,H#(Ѐ*OOjO &3F8F0"Or#0#3FH,"?"#,#"##3F("H(9H(ВlE!GE(!UF|Fz;EEFF5F#QF F#2+Db.@uK\ibkF2+@pHoH!(mOO O #"F8F3FeH(dK6!.!,߿$0c 03+ 2+@TH42O08$)CMH$LHK(oKHJHf0FO FI(Dg0FV4\2::E,2:O :TF$8IFXF< : ʹFFS"QF F ]{i3?B1F&H#C9>KXi(1,?c!FHn]2C"Cs THM(HHE(HFFG5F!3G|GGx!ؚ!-FGH.H-O]M-#O$ 0F+FFCOka+FCO@E`JIF0FHFXYiYD#aiD#0KhO ;Ȳ OWOajJFa6/!(FMF(F,P `KOaJ eHFdFpHFFHME9(FF(2 jOaaF(@׀Ij Jy+c+P+UT+]~xKyIFyH d*Q"is{Ya{iCaRiBaYH 09iB iBiB8h7 *?1:!PFfHI F"+CHBFQFQF( AF +h 8I:h) x 5In)Qxo)2)#1J1LȀ`!F Fr}!I F 0I  F |  D<`BI  ya;0!+I JTm,  I 8X!!edA888 9-OFP FL'MNBF!F(F>C-$G00EH'DKh"! T(?I N0ܻAZлC+Aـ`K"TaܻCL𕀛a"+=AEIS`dhW( o@! "!ѧKh#0B@)0 +w,,@V' qOa`F(𩀸@ЁIV'(@AF FhBF@h+I"FA(Ba8(€(< /27K`E}Kh x+ 6EvI l̡>FE|lJSh3S`wEt#O o";B 07idI8FXbI8F0aI8F(@𛁰hAF(@hYF(@7hQF8FXph rhQI gOaq:F_F KIq #3h +F (LFY !F=I  AF(D0 (D  E$B@F QV'F\HV'^ @V' %IV ( i0FHhI0F#`BF 6OaqJF_`F(#3:F 0F+FF[[(!&1[ ZG.c[x[^Y[m[V[`V'nFV'FPbF(PFF(_I@Fh^I@F@\I@FV' ZI!YIHFhV' (?k iv PF (!F POb P/!(7F0FsBCB!#"9D>r# P3p!CF'5J0F5I0F0۱̠#33!F PF+F G V(I 0F|00F Fd DK$?>I#"EH### h"B5K.5I#oB=H### h"0,K ,I#O25H### hOR#K$ #I#oB,H### h" K(I#oB$H### h"K,I#O2H### h"K0^pH!&uS,hZ4HlKhK[h FSPJ#xh320ZԝI"FG FVFoBH#!F##"KX`yI#oBH### h"{K`hI#oBH### h"j~K4V{I#c"H### h"YzK`FsI#oBzH### h"HmK84jKh0sqII9I"=H , 8N4{h4z-H)F$0'(J0I"*H hAFh( HOr4 AFv( p J !I C04;#X44;h+4IBx"z*B*#C&JI!RP!.@fyf8U!H!- &xIN@Fh#T4SI@F(KJIT4+сI@F(Kz*!x2zKS#Bq uIt`6oNV#KC3 F! D0V# gI#BFdӱ a F0#aHAFOZQFOpU8RF[I aNN04$$T+D*@)OĮ!CIdL$H4rC"i4+DEH2FKFAFOs.yU`VERFy F2FjB6I6iy*F*O04ܹ*Oc04@̀0oˀ$_Q%HORKKS Os۱s۱_sOQ40B-*/ F$4*OqOaOa`H!:P!-79!7Rf*04 4S$O0u( 44#0444 0+ @4+#kJkIlH~#@4,4K$4 *Կ,4"F)F@Fk?ХB: Fsh+?xh !F`/МSJ#Fd! : a j(VLI "X )?bOS$4.FHOb,T4++(Feо?HU 8Jd!F F  4Hb\$6/Hg0JR,JC !Zgx#<$6B@0h P&x ! x`Z"8I v`(? " FDAI vBz Z O ?qUI "F{ I \yR!8p-OO3LmTFNF4#FF JFAF8FCFCѼKh43#4/; y"!"!HFX&`́4Os44+@K $[h*sy@!@0FF3@oI2F Z-;C-_D=-S%!GGGGGGGQiGGGGGGGGO ub=--S%GGGGGGGG=[GGGG{GG`K" haJ x2+?4?0\I #443##4NI#"RH### h"LKX`FM#O2KH###)hOrCB?*hCI:I#"AH##" h##OR#:H#Ob1h# #OR#2H#Ob1h##oB#+H#"1h##c"#$H##1h"K`#oB#H#"1h# O2oCH#OC1h"rK!&!nZl63h(4x+XI O P#M!!D0щI2F4+F \C#$ t/y6P$#I/ tq oIOcnJQF0F`iJjIF04dHRF9F`JbI4 !LF\J^I+ZI"]H \K >  SH"0'OJTI$"PHg9Fl(GOr49Fx yt0@JFI C 4+4 ?IC1j2C3J;IbC:IlN9K-J9I,NGj2Ie1j $0Bq -I]o $ZС#3(F&0# I#2FEt(F0tH1FOZQF TaF(jIRF|!.fyf8!0V9907Rf!i $ 4*@+` 4i4 $+vFPF FAF~*F0F|kB(F ܡ$ t0w4+5HJF;F1FOswXFTcERFw(FYFJFnB%I gwIFOExOc 4 44IFOPExOS+  IFFOExt|IFOPEx-GmFFh"!pBF9F FBC Kh<,@@85(S -CEMCC]CCkCCC=CCCCCCCCCCCCCCCCC !C7CMi}CCCKIhr#40nKhj}KIhbyKh([vHO2wK!h p0C p0KnKh GlKhCjHOrlK!h<8dHO2hK!h._HO2dK!h$ZH"`K!hHUHOr\K!hJPKh NHOrUK!hPHHOrQK!hRCHOrLK!hT=H"HK!hp0CV6H"BK!hW1HO2>K!hp0Cu*HOr8K!hv\%HO23K!hkp0Cp0KHF0.ee8O RFQFHF\??F F$h+ RFHFEF F,IJF &fZ}#26Ƃh2x+h+HOrK!hd4W#@/! Fb2CKOaJrFF ih FK m&Cf8Q-O'- FF:F! %LKPBڡI :F! ()F0љH*T0іI'FO5FJIF0F CяJh @ @+@~<;+@(IC84(ŁgP8#5:T[E_dPhCC`"x ( ZI hCc8;C8;xhCPKh8oHGJ x"  DI8 RS+ ?I"x ( 7I< 7hCshCSh0I C@`-Kh@; hZC~hCzhCv8;C"txF ( IqOsBIhCThCPhCCL`RMb@A`"aaab"]caab2bPb&nbb4"xF( I&"xB* {IKyIhyJCcyH`# hFsIhuJC tH`# hoJ x* ?q iIO iZ#fI#|dI2+aK nl(?i\I YKMQ HWJ FQ` S A0 8`( {*(+ LIhHCIH2s<+D>2CKhBoCEFFOsVz A 9!:I`"2BUڵPkI` @_Ki[hraI`@Հ0HHI2"YI O\ 0BUIjiRja*?3QI1F 5;f80IK xp(!p H ȿ`I8@HHI # AF( {*F , .h+}@FC)I##p+t Ch+`@F&HHV-C6?8~A@@"d"  e4A"0""`""Me*e"hemehI t;JxO  Eh  IFFH"d2"B`+?®hW  #0+@𪁡2B`8ddBKʌ2C  d2h?𶀚@񛀠hh#OzsFXCHI }Kp @@  Ճ ݅8F́kO IBD 3jh2EcD陣@'@ 0?`ԇH F>zF0F' B 0JK   F(@ k/1 >H h h3SsEbF”FbPC \0~EC 3+~H Fz;FF0F2Z +J(+V; NHC;/N'KF; +; 32H 0 K'gF"ve ""ef`"; C H;IFH# K 0B  E܇H FWzF0FJ JDzHD zO0E'8FhHF   `;+fYddd-8CNY#2F9F Fg(?ax): #%')+-/1357bH0 aHaHaHF_H"1F F#0'YHYHYHYHYHYHYHYHYHYHYHYH#2F9F F(?խUH#2F9F F(?ʭax) MH FJHJHJHJHJH#2F9F F(?FFAH#2F9F F(?;H#2F9F F(?6H#2F9F F(?zax)/Hq/Ha/H_#2F9F F(?g!y*Ha#2F9F F(?[&Hee"D"Kffffffg%g9gQgjggggggghhixiif#2F9F FJ(?Hm#2F9F F?(?Hb#2F9F F4(?묀HW#2F9F F)(?{HL#2F9F F(?լwHA#2F9F F(?ʬ!xrHhƮ1F FX0+`+?+𸀏'0H FzF0FK]H5+њ  ,/ :* DPHD ܩ oO   ; 3 FF/   BF F/A2I+E1JF@FN@,HV :(HJFAF0@ '#H@D ܪo + H" /HO0,iiiiij7jj`"j-j,j2j-OFFIxF-+4 F(=ѨK$"`OO FF:F1F(F C9ѢKhBw'>3FS}](FRFV)X/DDd(Y SuIF .$I F(цK"@Z`d+ '*!$DtDOvKh [DdDD4D$D$O O XF/(FYF(F%)F FcI .ѝbF(QfphUKhb "!RHSWI2F SAUN[h "!+OHSRI2FMHS -7OI+F2F S)MJMINHS#JJ#IIJHS!Fh! d! `! \! X! T! <08I8I2F!O000fh+1H+L\!hF-K?F(FS*I"FF F  & !O004h+H .HN)F FRH0F6D#aXjTw|@'(-OFMFZH0KM(FH&whK(F+`;x-+04RF88Fd0RF! V+8LFFO D+?V;pD>V?D;+Ѥ NF$3`+~r+TR+i+C t+x+[ h ԑԡV ObPFFЃ C#+d0sBF;F< F)ki+6 , #HL*sj:FIFHFH j?IAHAH"#_:H kicj1I5H5K"2H#-H!k(I/H  j"I*H$H"#Hp$HS iMObV F FRq<"h9L-2D>]t]@(-OFF0ݞM'1F*F FAљKh,#0*oДH"!@@0+{ڏI v(c(S(GT(ML(7 d+R#%-=EUem#D0#3#3#80#H0# 3#$3#(3#,3~Ik($)LDshx*:B FJF F>/Ik($)ԀLDk@K$33sh 8FKsl+@9F0l"FRCF@h7+hhFHO4h3+@0+xg+AH0+= I Jh( F H"x5$05$5$4$ \ +_H,@[Kh+XhXFXH n QQQQQQQ  /FC+Fd#b F- @"p$@I0F>LO =I0FO :I0FO 7IFO 4IFO 1IF&h+?TWx+?S +?OiQh)?J2a  h0>$=,?~(FFHlx80 F#)FC(3C<0C ")F FOB H,F 4$b 5$     V2 -GFh F퀹OOL)F:F0FRA ѵKhBv\ RIF D(DРb++R#Kh 6#$6#(6#,6#064#6#86#<6#@6#D6#H6}$&B4&< C"<&,&28&rH:r4&r<&Z0mJmKnH) FF(`U#PgI(FQ&(ZeK #D#xhaIP(1^MOjO W(@F #+p#kpWHnSMP6jhCM`TFOH8RHnPT(=h1!oF(f.@9nCF@+?HQ +x++ .F0F37H6F(F !8Bak,Jhkxh320Z8.<#XCKZ`PBD2m 6۲20 Ѹ:(3xsA$8 s,^A$&-CFFTIFpFL"F9F0FB/ѡKMh68.I,iLI FV I FR ML*F9F0FC BF}I}H4}IBF{H.t(p@(A83(S ,**',****************3,***********?,*K,W,*c,i,o,**u,y,,,,,,*,,z(cci+_Osci+X#ca7ci+Q#ci+K#ci+E#ci+?#ci+9 ##c`#a#a#ci+(@####`#`##bKh`ci+Osci+ ##i+ KIh a.(߮#cb F$p D&h-`:ܮ-!#j+?֮chh+Ю&i.̮W)P h)F`(ۮqI*F #i+chh+&i-5-gI0F(dI0FpcI0F(@-S4-(-=-?S%-u.+.+++i.MI0F(cj+?L - -~W)'3е AMBN(cAF@Hc-ei#"jih'Zi##"jih(NHhW)OW).A" 0(Hh2??#H&OBF HF FKHѲ3 C "4#F4`j(?ѭ i)F F(1F F(AFHp `Zt-OMRNF\ F'2F)F F&CMKhB<(=4OU/@F MR(f(O#4'e*OaZ 9I* T/e a*(@ `(>pCO@гO5 `jF!K(> d ZFOa0F40F/Kh+H1F F0!F*PF~ `jF!( `jF! F( H a Ow* F$-CtML%&I POghKH8X<8KDX@8K`XdXhXpXtXXXXXXXXXHhLhPhThXh\hxxxBFD8O3l8cHC #8FF:F"B? PI*FF T .xL H }K<|HFX{IPp(@mK"T(XuIF(@eK"XT(oHtaK x^K^J,\Lh8C<x%fH6hXdHZ(bIpd `KAKJ]K8(B HDM&`h$ dh?K$QM&FL*FCF@8M#F"HJ!|h #<,wP FB ( #Cn(b (@3hP/IF"F:.I FPKTQ+I FP K"h(I'I FP0 K"T(X(="H!F8 I F(AK"h(;$_Pn$;;;!;';j8;(f;u;;;;<< ((`@;l;4D+R#%57/5777w77777[777577777757777757!67e6767)77777777777E5O57w525575777755-6=6o6677777=7K"(HK"X(T(K",K"hK` x+?KIh pK,B,,2,~K",|K"H(} #zKFh FuK,:`|x`mqK"L(hqOObrH9ho^? 6^IOb Fo! & :!hȱh MH!LI KI  FH!F(CI BI @!h0FF F5FKFHOb'F F FL[h P|Px 0 h,8P+ ,*OK",+-:F)F0F Pn$NR'<==''''= =.:'$='0='<<D{$%@=,8+AF= ,8+Л-GFhFpL"`h4gI1F(F#3)p2+"l!߀\I H- R(:VI ,9(/(-08 v(%3331F:F(FAIKh/V#PFJ+xh320*(F(@I" [qh@F=OO O )F9HOr=? 5K5J !4 31I /I -I +I (F (I .p0&I!%H%H$K(F4!H?4KMi i I FI4+FMiw(??/%_POhPP2%6P1MMhF FFCIFAK"`AO:F!F0FC>KhBg:Kh(^ ~6KhV8I(F(6I(F(/K"`n(+b(9(%0(%.J08`c +R#@@}@}@}@}@}@}@}@@}@?V(JIHzI*F K"`K"`K"Z`JIHf jF!d h~T?+є{5% |{{=Ah{-AFV;ELH`#`#`I##a }O`aSS1hoI#;`j8hmJmK( FF]- 3hx-*+*[xKN0KP nV{AF=8F(8FWH2axCTH+aHRKaRH"a?OKa!j!!NHF-ci 0t( eV =o F?Kh;?Kh#iC=HK=M  +h+8K9IhT蘻F(5H!2 (h(?? *Kh#c*Kh+!(H  cF(N3h+ (5`Kh+c5%9|D|q%4|9I|P|Y|h|<6%r%|q%X@f|r%x%|r%r%-OFvLF'hsI Oog`BF1F(FC*nKbih:CV# 5 q(h(=U(@!aK!h"_H(]I 4u(`(G(DI(FE(;fVIFFVH a+R#DDDDDDED EDDED9EDDDDDD?EhC`h#s7K/Jh+Fc`#`t##aqO `0!F*(IHFIFPF ,V#K 'h %OhCsKJh+Fc`##H"FX(?:H5#a2# H"FH(?*H @ Bid稒%%Xh&XXoY-OFF IN(ڟI \5F,ĕ0FK+H"!"H"!"H"!"+`0+ ii*ݭ0\0 I0. K Iht@М%%,\hB\H\M\gt[[h&-O$FF&FJF9F(FC-PKME8.J0FM(7,C F"FM  %DIF(5W) 0\\]!ҝ ]\&-O#̒$JFOp0FKM`K`K`K`NKOr!F`,h乊J#MOH5J5"K%#(XфIH@FJh0@EhF@F(5ihm(9 D(%f('C(*uIvH p(-r(RF9F0FB002mI"mH,y#F#iK"`$eKfI@#0\O8hfF8hf#FhlJISHmp(m+O$KHKI II HI 8hck@CH.@ # 8N F@ NF /@$ FN BN FN $F@F O/H"!FV #0$*K`" $)K`m#&Kh)À 9j8|2!K" `L9(% {h%8%0%`%%8%;d%%h9vz0=%<%3&yq%4%%%@%%%&%(?r $T8`,G1H $z +H $ (-X!(FNF(?P&O #XD#A#p3B #*F!F #O3$CF?-  $(F9F#(F$: F$2 +ѯ H $*P&NT&N6  #;>-OF˰hLF&FF O3`RFAF8F<FhяKWE!ݹN"HFF<HڈIJF p-a-b=-   " 4z-->w|IoB#{H#" h#3sKqIO2oCqH#" h#l  hKh`6OF[5 8FH pC_&##&^J#aX)Fa 0YVI(F0"0P##bNSF(iNI.л0ѹ-JIJFIIFGI 2FOqF( " 2 "IF,0FT(9IN$ N(5I3I 9F 2  ! (1F8F$  &I&J3FF(?t#I(!IVI@)Fd`!FX*FX* I`&^&Ae!ht@7,Baƫ۫,(;I O0>IF8F+O  BF((h+ >+IBFh+ >&I) 2DBr2DFGF:+OqB #Bh+5EFV >M! HFN6, F8FBІBFFFa4 -O(-OFF3}  0LhI FHHl 3}I F (IHHO(r! $ ZK! FVKhO3y3v3U3L0 F?w!FD0 ?n! :0d OE?c@#FFFY1F8FKTJZFfCL{(F0BXC3XAZA0 [vabD# FFD}F(@Y@0BgK gJ+!3XC3X0B@$^MV(&M( 6(~?(s4(O h$N8(S wUS5USSSGUMUSUf('j8(?v(?sS UoUSSyTSSUSSSSSS-U4KhVMZN1KhfZD(L%E=$9Y%CcY%e0##*#Y?%H<%O |$x$F;F !C(1Y?EH#[ٱ$ѵHo$s} &rM3E](ђH0B)F C# FV!CtF(F;F !CZE сH3 4'0H#X >0wIwHA Ah+@ԃ )FCH탘NSfKhBN&Y^@@كUDރ",0@׃VIYHAX11(FQX1 30rV#>yX3!rF>n0IXYԛH@ 2F9F>~(.ݗH@dX#RCY" !K@)0яIHK@?~HF@bXF>|@(qIHIH "K@0^h+xIH@gXH[<, Lh+wH@dBh+?<h +?ڭX23"SY2kHOq0 &h+eJ\IeH@.eH@0 h+_JSI]H@ TFXH MIYH@XH@WH @ >81Z_RI" A0OHCFMH*<1 Cc<1,1"EK,@0N.IAH@H ,1":K,@0#I6H@0I3H?lA0YCY.H怘@fF+H@[Y C@YTFFI%HF+XGԘJF V0AFV#>0:IH掶EC )ʶ@sD ޶"2Gm0S Ƿ۷N#V IV"TJJHLKKn FA0эIH! F>H SOqE0чH@ y"K@!0IH@a*XY\CsXb Ah(4tIyHbR#A(PFbS"@3ahBh Y*qkIL  @J >JXfHxj+HFbS"#j)[hhFh A @2XY >hh.>N1ZԟF2 TR՘PԋEIL  @ >)F FCx1>Nh-?+j;3F"!@mh 032F9FHF>3jK0F>M0F@j(Ovhx!h:՛j 2Rh*?!K@2k`h F`@hh,Mmh#B`}˱mұ)W  _yP qL 4H@Y@C@@ZM3HiM-Y? ~޸  Q/0@-0 ph P ^0n@0 , 0 010D~x0D/10!O-bM M b [ !b1 0 0 30`bݍ Ѝ"]\ P\ Et   $9 Hp;` 00Ġ80G( Gˠ x7p x8_S0 @G `0 0 00⫪ 0媪J P x8`@##[*ᄔP 0` l840Gm7V ` 0` l840G_7BX^<}|<]8]??0ƒ S"*0@- R P@ 0\ R^D00"@80 0 0^ 00"@0/[[[@-M @(((Ѝl  \/\-M 0 p 0 S 0 /O0 Ѝ0/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*//7*/>*/ 4T*///*/@-@ @*/*/*/*/xGyxGCKxGxGxG眗xGyxG/xGIxG矔xG=0xGHxGYxGQxGxGjxG(xGCxGPxGxG砓xG xG rxGd;xG;k4 xGxGCxGHxG琎xG xG3xGxG;xGxG硹xG煉xG禂xGixG8 xG։xG7xGGxGxGxG}&xG>DxG=xGΑxGĉxGxGxGxGxGoxG'xGi)xG*txGxG̃xG7&; xGe%xG&xG矧xGxGk(xGcxGMxG缑xG畘xGDxG ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics formatsector sizesector size `%s' is not a power of 2.maximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectorssectors/track%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u%s: can't write sector %u1601803203606407201200123214402880usage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraectbdchfesprdletdvcmiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderr Terminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noatimenodevnodevmtimenosuidnoautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_RC6 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC6 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC6 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC6 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC6 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_RC6 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC6 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeBootUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. # sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalogLC_CTYPErelease11.0_RC6evbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.centropy-file/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc /netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICmodulesbasedtbgamesgpufwmanmanhtmlrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packagespkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%cr%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1181: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %sv6v7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2efsnilfsminixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d 9tw }zي}y}E͓l͓)ɡݡݡe}Mqau(2?KW]+ h] ] n}m}vU|-&'9*I/0~Iu;u;???AASCEI-KOR"pushdnepopdne2mRAi A@@ ! Y @@ I 4-  9  @@  @@ unblock and -DNO_CONV?c$ddiic@Зc@c100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directoryDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# unknownline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/tmp//usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXEDITORmalloc-c/bin/shre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesAutomatically adjust partitions [%s]? Invalid answerreallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tableQrounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] Usage: %s device %s device command [arg [...]] Available commands: nonerwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grewfalseArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%x%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%#llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %s%s%d%d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): ???CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address boolquad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexNODESTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendormalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<liLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELLlessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETAKiBMiBGiBTiBPiBEiB.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0link#%dsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLinkz  E!Z5Jdz# _^F<>?PATH=  tf d  s c  m  l  r  !p !!n ! v (!b    EOF reading here (<<) documentW&c&k&o&s&x&}&&&&&&$&&&&&&&&&&&&&&& 2&8&=&B&E&K&/R&K <p}-+?=q)@"),)2)8)>)D)K)U)@))abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'g!0+tf!1+`f!1+f!8+g!0+1Cf!0+f!0+f!0,af!0 ,)7,^v c~T uO|:_x,j6z, +|, ~,  w,H(,}',, !2**                  -<-<>=-*-$^)H+->- -]>-e-Y>r#!"Q$---~---l.}.}.U> .Aa.}.=H.p".p$y*.ц0.8G6. ->.D.&:,\!Y>L.EKR.Y.۝_.O 7qh.oZ1b1 h1l1p1Uu10.z111 11 1 1  15N1T1:R|22227t9222-/22[2ez[<22N2322222[33333#334#434243434#6$4*45 24@84@<4 66D43353535c5 3@333Q3355 3C$3C3C$3C3%3-0363?345F3N3X3 5`3@h3@p3 x3 43053@@53 P5222222235 b4@!!!@ @!@!@!@"@ "@"@"@"@$"@+! @)"@/"@8"@@"@!!G"L"R"Y"a"g"!m"t"z""""""""@"@"""""""!""## #####!)#0#8#?#F# !N#L]m  3 O b m vc k?$C$H$QP$U$[$a$g$n$#u$y$##$#$}$wU#^R\#f#p#y#####k##L#5R############$$$$+$;$  #         !! !!!%!+!/!6!J!@!I!P!Y!b!k!t!!!!!!!!!!!!!k?$C$H$QP$U$[$a$g$n$#u$y$##$#$}$wU#^R\#f#p#y#####k##L#5R############$$$$+$;$k?$C$H$QP$U$[$a$g$n$#u$y$##$#$}$wU#^R\#f#p#y#####k##L#5R############$$$$+$;$53.$0=dHHHHHHI+I I I I I JJ4JIIJhJ{JJJJKK1KMK iK!yK#yK$K&yK1yK2K3yK4yK5K6yK8K9K9K:K;K<L='L@6LAJLBLCLDLELFMGMHMJML7MMHMNOMO_MPoMQMRMSMTMUMVMWM\MaNc"Nd]NeNfNgNhNiNpNqyKsyKtyKuNvyKwNxNN O4OSO`OuOOOOOOP+PHP`PzPPPPPPQ"Q>QXQ^QwQwQwQQQQ#QQQRR$R/RyKyKyKyK9RQRcR|RoTRRRRRR S,S,S,SESdS{TSSSSSTT:TBTtTTTTTU?UyKyKsUxUUUUUyKUUyKVAVTVgVsVVV[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype].7L9R9V97^9f9l9v999999999999999999:D ::::":&:2:B:N:^:returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock<<<<        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_reads}@:uCpv=@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-:u}}}}}}~,~6~f~p~T! @^9D΁܁+9hp |H\<Pdx \ ^9f9l9v999999999999999999:D ::::":&:2:B:N:^:H(@gpք7   ۅ  )@օVu†&>Z v! A# A$& A1 A23 A4 A56 A899Ç:܇;<=,@;AOBCDވEF G H JL<MMNTOdPtQRSTUƉVމW\ac'dbefghipq As At AuȊv AwΊx9Xez܋0Meƌ'C]c|||č:ҍڍ2= A A A AG_qŽԎ;;;Ts̏:V^Đߐ0[ A Aؑ A ; A\Ԓ*,@u0@g 8@\A<@-5@LL.;P@r#\SFH0eC쬺=SFU0eC:Hah!IdontNeedEFIʛЛ(s*K>;ڛ|nQn- q+|nQn- q+ |nQn- q+ |nQn- q+1<|nQn- q+J^:=rGy=iG}NY;Mt?domWC 3KOOzyD<#*=(3Dh&Ǧ\ M}-Ҝ@Mjy֬-чH9-чH":ZIчH74IчHR9GIчHjR2IчHf9mL6 %?ay~S'@ )Ѹ*1@ )ѸB:1x )ѸkYh@xpbackupstore_gptstore_tblnAt@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapssetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus9printallmaindo_setifpreferencedo_setifcapszi0pvyi--->--ҥ6@|h2Luu%0;GS _kw@ 0@ǭ̭ѭ֭ܭ  @init_current_mediasetmediamodesetmediaoptsetmediasetmediainstGx 9   `@ xmedia_statusmedia_constructorѯگĮҮ׮گĮҮĮگĮگTگѯpگĮSگSpaddr_match7settunnel'  print_link_addressessetvlansetvlanifN:tN setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchan@CFIsethidessidsetapbridgesetiffragsetifrtso@nEv(uv}* #X|\5* p@xMinvalid major numberinvalid minor numbertoo many fields for formatffs@[\ \\&\.\6\l=\E\P\@V\a\h\\o\x\ \[ Y\\\\\\]] #]@/]@]N]e]@]]Z]]]]]]]Z]]]]]O7` -x`Ļ̻ һڻ x@$+ bnorripbgensbextattbnojolietbnocasetransbrrcaseinsO7` -x`Ļ̻ һڻ )@x+2@l`@8>O7` -x`Ļ̻ һڻ H Q)@x+8l`@2]f@jZ1O7` -x`Ļ̻ һڻ @O7` -x`Ļ̻ һڻ )@x@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorO7` -x`Ļ̻ һڻ 2x@-u1> @  (@ ȿ@ bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacbnowccmsgrecvrpcrpc_getportrpc_callsendrecvxO7` -x`Ļ̻ һڻ @8>6n9PfGZ{Av%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@WBhCwFILNOcSabc e f2hyikmnorsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp `  @  $1м|^t0 Non-system disk Press any key to reboot WSOKGC?;7DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY-Zr -MyEsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_print te9t9(t2t9>tDt9"Yt9>tft9ttt9tt:t;tE<t9tt9tt>u55/u/=u9MuUu9Muiu9Muyu9Muu9uu?u9uu9uu9uu9vv9;vFv9Yv`v9yvv9vv9vv9vv9vw9'w,w1@1@Rw9dwiw9ww~w;wU4U4w9w9w9w9bitmask_scanssssshw.disknames7$8F8>>>>>>***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20260107  " $#!%Z^\`[_]a55: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data},^D\ @&B%@%% %'%8@%bmd%A%%#%"%%D%%%%7l% C%&%2]D%@]@%Qd%Z)c%hpb%c%a%%~%%)&&% &&%&collectFB.;^9f9l9v999999999999999999:D ::::":&:2:B:N:^:NAME=V9R9L9.mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds^9f9l9v999999999999999999:D ::::":&:2:B:N:^: edit_fs_type_extM' A E s e  A% % %/ 9/ 1L e u edit_and_check_label ^9f9l9v999999999999999999:D ::::":&:2:B:N:^:disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzY a a c I` c ] [ b }\ ^ [ [ l c` i M_ ] X \ d f yh X X ai e\ W\ [ ^ [ disklabel_change_geomЁ outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default H&(&&d&pm_from_pepm_whole_diskgpt_freegpt_create_new E ! 9  i  y  c l  e  -    - U  7f9ʛR9 N9":j J!`:u}}},~f~ ^9f9 7L9R9!9&+/V98h9>`DDH":N9:XJgpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC쬺=SFU0eC:Hah!IdontNeedEFIʛЛ(s*K>;ڛ|nQn- q+|nQn- q+ |nQn- q+ |nQn- q+1<|nQn- q+J^:=rGy=iG}NY;Mt?domWC 3KOOzyD<#*=(3Dh&Ǧ\ M}-Ҝ@Mjy֬-чH9-чH":ZIчH74IчHR9GIчHjR2IчHf9mL6 %?ay~S'@ )Ѹ*1@ )ѸB:1x )Ѹҍ \pX9A mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newЁ i I !   } q    # E a    l & * a )0 % !  )      u1 2 mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************}{control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2^dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionbcwdeԺfghi~jkl/mnop|qrs!)t u16wv<wxCzSyZA`BmCDtE~FGHIJKLTMNOPQSTUVWX Zխ14!6*4|E~Q}\Zcs YP\vl%2t8>FK[%dp|default_configread_configrt_compare_proto ۙ ۙ rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtq q rt_buildrt_deleteř ř sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initd#-6AIscript_buftoenv%make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcpkvdhcp_boundmM dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa!$ !$ -$ -$ $ $ VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B i; ; ; ; ; ; ; < )< ttA< Y< q< BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ p <D <L          tt@   pnlcs_path X^  bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_max   $  < ȥ T  ltt   !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_popunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %smemstream_seekrshrcmd0123456789abcdef %x:%x:%x:%x:%x:%x %256s 0123456789abcdef0123456789abcdef0123456789abcdefkMGTPEBKMGTPEKMGTPEBkMGTPE_getttyent: TLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~_fts_readkh?marshal_new_auth_authunix_create_xdr_arraygethostby*.getanswer: asked for "%s", got "%s")& @"NBCDB  d'@Bʚ;0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as5gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef0123456789ABCDEF_xdr_bytes_xdr_string0123456789  %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC 0123456789abcdef0123456789ABCDEFQ !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG @Cisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB 0123456789ABCDEF0123456789abcdef/& ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::sa^_@n ppNp`'p<ppp p oo`ooo oo o  p p p p  p (p 0p 8p @p Dp Lp Tp \p dp  lp  tp  |p  p  p  p  p  p < x   , h , tn ȉ XD $ | r  Lxn 0} (  \d  |n n  lo 0n 0n n n n nn < xn n nn n ,n,n hnhn nn nn nn XnXn Xn X8 n n n n oo  oo oo o Lz . o $o p (o ,o \0o  8o  @o Ho Po  To  Xo  \o `o ho poxoo o ooo o 0o 0o0o 0(npppqq qqq (q 0q 8q Dq PqXq\qdqhqpqxq|qqqqqqqXpqqqq4n`ndn ln hlptx$|9,4<(DU           0ظ<HXdxظ4GBFEK$zy}$$gntsxzlyTrbmnЇtcid pTȮH8 ȴ$$yekdh atadDloob,4OOOOyara<p$ܒ،$@Lhxėܗ0< Xd x  Ę@ Иܘ $0T`ظ` (08<DHPT\,4<`DL\T\`lx̟؟ĠȠ̠РUU\hlpx|0ȡСء $,048<@DHLPTX`hpxȢТآ\0@LXt|ģУ$8P`xĤؤ0DXlХ  4H\pԦ$8L`t$YPHXDHXD\\\\PxԪ4Pt̫ @PPPhTMp/t`Ihpܷp4<LPdhpt    ̱б ̂(,48LThlx,бȴIJȲܲ $04TX |!"ij#$u%$&'$,)HL*PP+TX,lt-./0Ĵ1̴Դ23 7,0cHLdlt|ȵ#0$uH%X&dh'$(x)H$(04<ȯد ,@HX` t|  ظظḬ̇԰ܶ 04ط@LPhl|hptthhh܇Cjjjjjjj< P8Ŀпؿ (08@HP\dp||ظظظظظظظظظ 0H\t4@L` ,DTl| @`t Ph0Ld 0DXh| (<X|,@Xp$HDDX}̅h8pCt3hlp8Dt1jjj|ظظظظظظظظظp\qeTJ&&<&&xF`,'HEH4 :'Ċ; &0&3 H &@&DX&|?/'i>o<'\L+'d&=':'@x='Г&ȓ&/'6A&p`Tē&ؓ&&&\ &t&&8&̊&̅P='&h&H&X_M&thԓ&̓&&X0\='&T60-'\&lh&&`e@c0N<CtD&&&ph&&pd cb< 0 HPt.~ bjWjcfhklm o,o8pIp^pgqqrxu#tvOwwx(xzzBCnJOPSTVVXZZ2 >G O \l(j(iaei >2 nf\/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbinZ!}-+?=###%%%}`!`!"a# #EV#e#F#IOi)#L6#l<#mD#CN#nU#f\#b#pi#bp#ux###qs##hv#VV#xb!@=d bu;*jI=*N$5?*s=*b@+N|=4+3o<U+D<d++%<+y<+>3G3Vb3l3S33Q.}OS.}O3}S339X$0}Q3}X33N533P33NYHOH<9B9 ... ...L^^ssCuuxvPnqj)"R`j)Ěj)i,E\ AabCdhlNsuvW:w:z T<<LX L t)جt]άL6( t¬TLTTD,Tl<\" \u" p \\}H((h<\(@!`\/@!TY(hh<lu22Dyj>V>D V|VD|6|\@@!lDy>D6Vd du d! dҥ ҥ\¯LlQĮĮll]dҮ ҮlXX\ DfDfDMmm\0L NNd| :\L \^h8l ool d9 @ @lppd* d5* d}v v\#x| Kں  #^1  U #U ([  '@@O7` -x`Ļ̻ һڻ )@x@8...... ...... lost+founddA.##.Ps8 " , 2 N1   ( z  ,fG?<#\6 !"#D $%&'() *+ , - / 1* 16 2B 3K 4P 5T 6%%htċsssssssssst. (prog_root)`v'x'z'x'']v%''''' '''p<I.T<'<q<Am<]l'<v<9l'<Ɇ <-<5z'< <Y<LJ<i 3<Ɉ֭<uy<]{<%}'<'<v(<A(<ي(< ^)<Ɇ(<(<u#(<l<i ((<Yx(<sW#<=y<w(<.(<z'<9l3(<z<8(<=>(<<%}D(<MK(<{<~T(<9s<E!<~(<%}Z(<S<l`(<I<h(<Un<9sm(<Uns(<  <%}y(<]~(<x<i (<(<!(<%}(<%}(<%}^<Yy<x'<=xT <u$<Am<1<Ɇ(<фP<F&<Ւ(<s(<r(<U(<|(<%(<(<M<у(<Ր(<uL2<Am(<w-<ɓ(<2<͏>&<Ւ1<u(< m)<W<<l)<)<vL.<AkY.<r#<=)<P<m<wN&<Ւ<@$!!6#9'@ D(3F?>@<<HHH!g<H%>H&tH=&pHE'|I$"I CDI)!+DI)!ccI!.tItII%$I%$sI"?I3#I#(-%MEQF3PNc(aNl2s NhN-% !"$'(+-.03569:N O O  O33ONONO¢O3%3%3%3%3%3%3%3%|3%3%3%3%3%3%3%3%tip.record  /etc/phonesPuSPd$P2%P$P<PaP3%Qa Q3%l1a3%MN~QaO3%2Qdu3%a-3%(Qa3%'N /QN6Q¢wa@Q3%DQa3%KQ$RQ\Q`Q!QNeQN'aO3%3pQdzQx3%QdQt3%QdOp3%Q2 NQQ,3aQ3%QN/bin/sh0|}x~~~$+2=FQ\cnt|ĀЀ׀] '.'5ALW\ejrr~\D%ԁ$\n>|b'AW'/eK]bvrу !bD  z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ,,,0,0,0,X,,""0,X,X,X, e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [< is a directory is not a regular file (use -f to see it)// ($ $"0>w;AN];h 7p z  #28 Ǎ׍ (! 9(2<&:fG)S]5feo:yw%64 +,Ύ-ݎ.*?ES/)/7'CFɋP iɌw | :fՌߌ  Č ЌڌWmkRkRkYcWbkCkc kG ky wb YMYrWca@r%>_}b@@r%ŗB@r% c?r%4__d?r%?Ar%ӘD?(Ye?r%#f?r%C[F?r%wg?q%řh?r%AZi?r%}j?ݚJ?!pr%k?Hq?HK?hr%.SL?lr%qm?r%›nx?"r%Λop?Oh?Q!p`?HPX?,qH?r%5]r@?"r%s8?!r%4LS0?!r%iyt(?T ?=u?r%ŝV?w?"xr%Jx?(%X>Ar%y>r%ܞz>r%)">H~>!|r%Qu?>#>>Ar%Ÿ>`r%؟>dr%>>\r%Z>(eĠ>Pr%ؠ>Lr%0L>Hr%r>Dr%աx>$@r%5p>$8r%Xr`>!4r%X>!0r%P>!,r%ע H>( 7@>! r%FZ8>r%t0>r%أ(> >r% 1>r%Rf> r%>ʤ>!r%=r%@=r%iå=r%ڥ=q%,cɦݦȨ"4`FR\fpϧۧ)ɋ+=FVj|P?Ǜͨ٨ *=IN[h t% (press RETURN)SzzzP@P@\@tags643{}abcdDgGhHilnNpPqrs tw xy !:#=̒%%-e^H-i^C-k^UKXWx DW% WVnV9 Vn(tVn}TVo Uaw dU?qF TvF4TvI T SSFdS9qFSvFRv!FDRqv}  Q# Q` QF PL1qq~F dPN)q-$ 4P; OO2$DOy_u2$$Oy_2$Ny_ tN 4N N M TM\M[dLuFLkF4LgŀFKk!qu%q{qaqet]yuͅqu{f e{hi{]_^`ppup~_p7 q]qv]p]p]p]p]p]pb]ypl]p<]GpD]UpL]apU]mp{׃݃XQuRSuTi{UYtetuyuPvQuRuSuTuUVtWI{x1p7py?p<=>ǃ?σҝo] p]prqqzy oSrur]rArzy-rUvoTo_o_o_oҝmo]yo]o__`6`!rrrrAs-ssń݄!}UsQjokwisiiL9Eo7Yo S[c=oEMs}s]uE#?At)ttsss {Ezs'v99=w-wwMwx xwwwwww%o-o5oouoxexEx+x+3nn&x'x(x)xx)y=vy y%xSyIy?yx3yfm) n\`%nd`=nj`UnN#mnv`n~`n``` a8]aRraaa%aI-a@aHabcdf1hQhhhiiiiiijj~j7klmn oo~'&oEoXooooooopNpp*q`q}qq6qqkrorwrrWrrss(s4sssstFtzttttu8vv w.wxyz|}~v#Pց `ւonZ?O^pۅχ<Qp+&ɋHr!ԐǑD4O^͓ܓ-?IUe{˔ %AW8VaWs:Ӛ_ћMd<Ĝܜ+Ity_Νڝ ,7Mfמ  &~0=AFLPszŸ۟%:O^q~*ĠΠ۠~ 4<Wbmzjt;4Pqjħҧ֧ۧ6X~Ȩ9JUrȫ[bƬX|F`0Ivf9|ɮ׮j)EJZwʰҰ.L.12VZl&4T`~Dzز (3I&Ӷ~,1DQW[hx'~:I~_(-HUap 9M~9]RYּۼ>yf_ Ŀܿ =f~ u&HXnw(5=GLV_pb!(.5@GNWar(~9CXi{&)8LXbgl~g~9!)=Ufny"1BP[hty#+P9 1l ";M)IOSX\beid5mj/y u  6 "$*0/5; @F10N&Z'U(^)e*֭+j.1/ftpz@~,;ҝ @= S 6>T #YU ?U 7@S Q9S ARqQ BWqQ C\qQ D "]R E dqQ F ":qQ G qQ H hqQ IP ZP P u 5y x n 1u n 1e| u n  /<JWds] \ ]U \  $  >C             \Q "  c& %  (  5  8  B  E  U "X \ ` d h l p t x |         ؅tt ! " # $ % & ' ( ) *$ +. ,4 -; -H .O . / /O0O1Z 2^ 3d 4i 56n 7t 8z 9 : ; < = > ? @ [ \ \ ] ^ ^2 _= _F `S {^ {q | } } ~   -dd-ddTdd:dd:dd { {@|@ |`||(|rsss# s#(s#0s#4s#hu>tu?|u2u2u2u3u3u3u9u7u8u:u4v4 v4v5 v5,v 4v! Dv" Pv# \v$ hv% tv& v' v( v) v* v. v+ v, v- v/ v0 v1 w2 w3  w4 ,w5 8w6 Dw7 Pw8 \w9 hw: tw; w< w= w> w? w @w!@w"@w#@w$@w%@w&@x'@x)@x*@(x+@4x&`@x'`Px,@`x-@px.@x/@x0@x(`x1@x2@x3@x)`x4@x5@y6@y7@$y8@4y9@Dy:@Ty*`dy;@ty<@y=@y>@y?@y `y!`y+`y,`y"`z#`z-`$z$`4z.`Dz/`Tz%`dzCtzCzDzDzEzEzFzFzczczdzdze0sez#z#z&{&{0({8{<{@{D{H{L{T{\{d{l{t{|{{{{{{{{{{{{rs0|4|8|<|@|H|P|qr r r@r@T$r,r4rvU+ڌ.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BkHllP00V00$bTTgXXt(y^^='^p^5P^aMSGTXTS628 5040 5065 5082 5104 5107 5112 5120 5127 5135 5143 5146 5149 5152 5156 5168 5177 5190 5219 5234 5778 5812 6495 6783 7491 7547 7621 7717 7892 7915 7938 7944 7953 7975 7979 7983 7986 7989 8094 8297 8536 8977 9415 9450 9465 9477 9483 9495 9544 9564 9604 9621 9638 9653 9700 9738 9786 9868 9992 10128 10169 10207 10244 10279 10289 10338 10488 10494 10499 10503 10523 10633 10653 10659 10673 10685 10696 10733 10767 10791 10893 10930 10952 11051 11106 11164 11175 11191 11243 11411 11618 11789 11853 11905 12177 12727 13256 13688 14026 14359 14472 14487 14496 14656 14827 14977 15141 15164 15188 15203 15278 15418 15595 15750 15762 15842 15943 15989 16015 16085 16096 16105 16118 16144 16159 16175 16188 16243 16254 16269 16473 16706 16735 16750 16819 16893 16966 16996 17034 17088 17507 17533 17562 17666 17772 17957 18069 18184 18288 18975 19234 19374 19410 19580 19621 19757 19780 19817 19862 20113 20209 20263 20362 20373 20410 20447 20474 20483 20517 20524 20549 20576 20611 20625 20639 20668 20682 20699 20708 20730 20748 20765 20776 20795 20821 20839 20862 20879 20894 20909 20927 20954 20981 21003 21042 21060 21092 21320 21394 21437 21483 21630 21786 21830 22109 22136 22495 22679 22831 23012 23159 23317 23338 23386 23396 23404 23415 23426 23436 23443 23458 23470 23508 23538 23577 23630 23688 23709 23716 23735 23756 23763 23786 23808 23828 23850 23881 23918 23940 23954 24000 24029 24063 24103 24138 24166 24214 24223 24232 24237 24246 24255 24272 24276 24281 24287 24291 24329 24338 24365 24385 24408 24427 24454 24476 24508 24524 24529 24539 24562 24584 24601 24618 24631 24640 24649 24655 24682 24689 24713 24734 24758 24771 24790 24815 24838 24854 24860 24872 24902 24910 24950 24961 24972 24983 25000 25017 25031 25048 25264 25568 26016 26232 26496 26768 26820 26856 26892 26943 26960 26998 27012 27019 27036 27039 27044 27053 27065 27076 27085 27106 27148 27186 27202 27233 27258 27293 27349 27389 27410 27430 27471 27500 27548 27781 27816 28023 28042 28079 28140 28178 28217 28373 28388 28434 28482 28505 28541 28551 28561 28572 28577 28640 28688 28732 28793 28826 28927 28945 29084 29106 29229 29243 29253 29276 29381 29437 29553 29584 29589 29615 29654 29664 29707 29717 29733 29748 29766 29789 29819 29840 29866 30063 30106 30110 30116 30122 30127 30138 30152 30181 30213 30225 30272 30322 30362 30389 30405 30414 30457 30463 30471 30475 30495 30512 30524 30555 30811 30860 31436 31463 31495 31523 31575 31581 31587 31592 31613 31629 31651 31680 31821 31955 31968 32104 32106 32108 32110 32127 32140 32158 32185 32189 32195 32200 32208 32214 32254 32256 32266 32281 32298 32332 32364 32402 32431 32460 32482 32525 32551 32595 32731 32805 32807 32887 32933 32981 33086 33188 33227 33294 33301 33362 33426 33430 33437 33559 33628 33916 34054 34195 34276 34323 34329 34352 34398 34401 34427 34470 34535 34597 34667 34735 34828 35047 35072 35076 35112 35130 35158 35200 35244 35308 35358 35434 35456 35508 35552 35591 35625 35655 35686 35711 35720 35732 35740 35751 35763 35782 35806 35855 35872 35896 35939 36261 36264 36278 36291 36303 36310 36321 36328 36335 36344 36354 36371 36387 36437 36445 36453 36463 36474 36492 36509 36530 36552 36561 36571 36598 36604 36614 36633 36649 36667 36687 36696 36707 36714 36731 36750 36771 36781 36798 36804 36820 36835 36850 36871 36893 36912 36922 36927 36932 36950 36969 36988 36994 37013 37033 37053 37071 37076 37082 37099 37115 37136 37149 37157 37177 37201 37218 37226 37237 37258 37264 37276 37298 37312 37321 37342 37360 37369 37403 37426 37453 37485 37508 37528 37539 37571 37587 37598 37611 37634 37656 38164 38194 38225 38253 38267 38468 38690 38857 38944 38961 38979 38996 39025 39072 39083 39102 39124 39203 39395 39423 39541 39563 39704 39723 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_RC6. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_RC6 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_RC6 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_RC6 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_RC6 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_RC6 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_RC6 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden?Die Festplatte ist grer als der GPT angibt, soll das korrigiert werden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS628 5040 5078 5095 5110 5113 5116 5121 5129 5137 5145 5148 5151 5160 5172 5184 5193 5202 5228 5239 5775 5802 6368 6668 7309 7356 7469 7562 7596 7615 7633 7641 7650 7675 7679 7683 7686 7689 7811 7996 8224 8744 9095 9124 9137 9150 9155 9175 9194 9215 9274 9291 9305 9327 9372 9398 9439 9517 9635 9749 9803 9832 9864 9903 9909 9942 10065 10072 10076 10084 10108 10190 10196 10203 10215 10229 10238 10271 10290 10302 10412 10474 10493 10612 10663 10715 10727 10746 10798 11002 11210 11401 11461 11510 11777 12236 12902 13325 13647 14072 14204 14236 14248 14426 14623 14784 14918 14938 14971 14985 15054 15167 15339 15474 15494 15606 15698 15721 15744 15803 15818 15839 15854 15875 15895 15920 15934 15958 15970 15988 16198 16448 16469 16485 16538 16606 16679 16716 16742 16818 17275 17301 17323 17430 17537 17738 17811 17895 17995 18490 18728 18879 18913 19048 19092 19231 19272 19317 19364 19608 19741 19803 19897 19902 19936 19970 19985 20013 20046 20053 20078 20096 20122 20129 20144 20159 20179 20219 20236 20256 20277 20299 20314 20334 20356 20371 20384 20398 20410 20422 20436 20459 20482 20500 20543 20594 20631 20816 20879 20915 20964 21055 21185 21238 21498 21545 21906 22056 22225 22365 22485 22617 22657 22704 22714 22722 22732 22740 22751 22762 22776 22801 22843 22876 22909 22944 22998 23023 23042 23064 23069 23075 23105 23122 23149 23167 23188 23210 23229 23239 23269 23295 23322 23371 23399 23426 23479 23489 23499 23505 23515 23524 23544 23548 23553 23559 23563 23598 23607 23638 23655 23682 23703 23723 23742 23768 23781 23789 23805 23836 23867 23888 23914 23927 23935 23946 23952 23976 23986 23998 24016 24027 24047 24063 24089 24111 24127 24139 24159 24185 24191 24221 24235 24249 24272 24291 24310 24328 24346 24569 24875 25293 25494 25734 25918 25996 26051 26118 26158 26181 26215 26226 26234 26257 26260 26263 26269 26280 26292 26305 26335 26379 26392 26405 26442 26456 26467 26478 26489 26506 26517 26564 26587 26636 26877 26910 27165 27186 27219 27272 27298 27325 27481 27487 27530 27550 27569 27598 27605 27612 27619 27624 27673 27711 27745 27802 27830 27875 27892 27993 27998 28075 28089 28099 28123 28246 28327 28437 28465 28470 28486 28515 28523 28564 28571 28585 28598 28606 28625 28658 28678 28698 28914 28945 28950 28957 28964 28968 28982 28994 29009 29042 29055 29110 29168 29204 29222 29240 29258 29295 29301 29309 29313 29334 29351 29362 29384 29562 29606 30308 30332 30366 30385 30430 30437 30444 30448 30472 30483 30488 30551 30672 30795 30808 30942 30944 30946 30948 30958 30967 30980 31007 31011 31017 31022 31031 31036 31063 31065 31078 31090 31105 31133 31177 31224 31240 31262 31273 31306 31326 31375 31475 31529 31531 31596 31645 31694 31798 31896 31937 32028 32035 32096 32160 32165 32171 32280 32339 32590 32731 32858 32926 32963 32970 32997 33043 33046 33067 33112 33163 33222 33291 33338 33443 33586 33611 33615 33649 33666 33690 33742 33793 33865 33931 34029 34046 34077 34113 34147 34171 34195 34228 34248 34258 34266 34274 34284 34295 34309 34335 34383 34406 34426 34467 34766 34769 34783 34795 34802 34821 34835 34842 34849 34858 34868 34885 34901 34949 34957 34965 34975 34986 35004 35021 35040 35060 35067 35084 35101 35108 35121 35156 35173 35192 35212 35222 35238 35251 35269 35289 35310 35320 35340 35360 35373 35392 35405 35429 35452 35465 35476 35481 35488 35506 35525 35544 35552 35571 35591 35616 35634 35641 35648 35661 35670 35691 35704 35712 35732 35760 35777 35783 35794 35825 35833 35846 35868 35890 35899 35920 35938 35945 35968 35987 36014 36032 36052 36065 36080 36101 36115 36122 36136 36151 36170 36715 36748 36776 36805 36813 36850 37162 37339 37416 37433 37451 37466 37488 37538 37548 37565 37587 37646 37804 37828 37958 37983 38109 38127 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_RC6. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_RC6 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_RC6 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_RC6 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_RC6. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_RC6Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_RC6Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Annuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS628 5040 5076 5093 5108 5112 5116 5121 5132 5138 5144 5147 5150 5153 5157 5169 5181 5191 5221 5233 5663 5690 6266 6626 7311 7372 7450 7545 7585 7607 7625 7631 7640 7666 7670 7674 7677 7680 7802 7987 8215 8744 9162 9191 9204 9217 9224 9244 9263 9286 9329 9349 9368 9391 9435 9464 9505 9571 9683 9797 9851 9880 9912 9951 9957 9990 10068 10074 10078 10083 10124 10261 10271 10279 10298 10312 10321 10353 10394 10407 10532 10590 10609 10728 10784 10836 10847 10863 10902 11152 11324 11496 11551 11586 11836 12240 12539 12807 13168 13348 13667 13687 13700 13889 14033 14229 14363 14383 14416 14435 14536 14691 14879 15066 15086 15165 15263 15301 15324 15414 15435 15458 15477 15501 15531 15575 15608 15631 15643 15661 15929 16248 16279 16314 16378 16453 16523 16554 16584 16676 17167 17197 17214 17354 17495 17692 17811 17958 18125 18683 18979 19160 19205 19368 19422 19557 19593 19653 19703 19994 20103 20160 20257 20262 20297 20332 20347 20371 20404 20409 20434 20450 20473 20480 20497 20512 20531 20563 20567 20587 20605 20617 20630 20648 20672 20690 20709 20736 20763 20775 20796 20826 20856 20881 20914 20949 20987 21240 21309 21364 21425 21543 21702 21756 22017 22068 22444 22599 22743 22883 22991 23176 23206 23249 23259 23267 23277 23289 23310 23319 23325 23357 23398 23434 23472 23509 23557 23581 23593 23607 23615 23623 23651 23668 23697 23718 23741 23750 23769 23781 23825 23863 23890 23934 23962 23989 24042 24053 24064 24071 24081 24090 24124 24128 24133 24139 24143 24178 24188 24218 24241 24270 24292 24314 24336 24363 24375 24387 24406 24440 24473 24494 24518 24531 24543 24556 24562 24588 24598 24609 24633 24643 24663 24683 24700 24726 24750 24763 24783 24817 24824 24853 24876 24899 24915 24930 24945 24960 24974 25162 25467 25898 26089 26324 26512 26554 26604 26658 26706 26728 26769 26780 26788 26812 26816 26820 26829 26840 26851 26866 26897 26943 26956 26969 26999 27013 27025 27037 27049 27067 27090 27135 27158 27218 27470 27497 27759 27777 27804 27853 27883 27914 28046 28053 28102 28125 28149 28178 28186 28196 28204 28209 28262 28311 28351 28417 28450 28494 28517 28618 28623 28700 28714 28724 28748 28871 28952 29062 29090 29095 29111 29140 29148 29189 29197 29211 29224 29232 29251 29284 29304 29324 29540 29571 29591 29597 29604 29608 29623 29642 29668 29677 29689 29743 29801 29836 29855 29872 29884 29919 29925 29933 29937 29958 29975 29986 30011 30189 30243 30934 30953 30988 31018 31064 31070 31077 31081 31105 31121 31127 31202 31352 31471 31484 31552 31554 31556 31558 31568 31581 31598 31625 31629 31635 31640 31649 31654 31681 31683 31696 31708 31723 31751 31795 31842 31858 31880 31891 31924 31944 31993 32093 32147 32149 32225 32280 32330 32429 32524 32572 32662 32669 32730 32794 32799 32805 32908 32960 33206 33367 33522 33593 33646 33653 33680 33730 33733 33754 33800 33855 33914 33983 34030 34135 34278 34303 34307 34341 34358 34396 34449 34489 34565 34630 34724 34745 34783 34823 34859 34883 34906 34945 34975 34982 34991 34999 35007 35021 35037 35065 35117 35134 35155 35199 35541 35545 35560 35571 35579 35598 35610 35617 35624 35633 35643 35660 35676 35730 35738 35746 35756 35767 35785 35802 35818 35836 35843 35861 35878 35885 35895 35926 35945 35964 35984 35994 36013 36026 36046 36066 36087 36097 36116 36135 36145 36162 36176 36199 36223 36236 36246 36251 36255 36273 36292 36311 36316 36335 36355 36380 36395 36399 36406 36416 36425 36446 36460 36468 36488 36514 36531 36539 36550 36581 36586 36599 36621 36636 36645 36666 36684 36693 36737 36761 36788 36803 36820 36834 36865 36889 36920 36927 36941 36956 36975 37520 37553 37581 37610 37618 37655 37967 38144 38221 38238 38256 38271 38293 38343 38353 38370 38392 38451 38609 38633 38763 38788 38914 38932 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_RC6. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_RC6 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_RC6 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_RC6 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_RC6 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_RC6 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_RC6Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisMSGTXTS628 5040 5081 5097 5115 5119 5123 5133 5142 5148 5154 5157 5160 5169 5179 5192 5200 5211 5236 5248 5757 5789 6281 6570 7115 7161 7265 7351 7387 7402 7420 7428 7436 7463 7467 7471 7474 7477 7588 7773 8001 8477 8811 8840 8855 8870 8878 8892 8910 8931 8982 8998 9008 9028 9074 9104 9157 9214 9325 9446 9490 9523 9562 9596 9603 9636 9713 9719 9726 9733 9762 9874 9880 9891 9908 9925 9934 9963 9975 9985 10086 10148 10168 10288 10325 10381 10395 10416 10453 10663 10838 10987 11022 11074 11291 11605 12129 12491 12781 13174 13309 13322 13333 13479 13658 13789 13923 13943 13976 13995 14078 14193 14334 14459 14473 14581 14674 14703 14723 14799 14816 14834 14850 14869 14889 14906 14918 14944 14956 14974 15175 15414 15441 15458 15514 15576 15636 15667 15691 15750 16096 16126 16143 16251 16361 16501 16575 16651 16729 17221 17441 17552 17583 17710 17746 17874 17901 17941 17987 18203 18327 18395 18495 18500 18536 18572 18586 18609 18642 18646 18671 18690 18716 18721 18736 18751 18770 18795 18807 18829 18846 18859 18871 18889 18913 18928 18945 18958 18969 18980 19000 19029 19058 19082 19117 19152 19179 19366 19415 19447 19495 19592 19725 19771 19963 19993 20315 20444 20584 20724 20841 20976 21020 21063 21071 21081 21093 21105 21113 21124 21151 21185 21221 21252 21287 21323 21370 21390 21407 21425 21430 21437 21463 21479 21500 21517 21534 21552 21569 21582 21613 21638 21669 21700 21735 21762 21815 21825 21835 21841 21850 21858 21873 21877 21882 21888 21892 21927 21937 21966 21982 22008 22025 22044 22065 22081 22094 22099 22107 22122 22148 22167 22195 22213 22224 22230 22236 22257 22267 22278 22296 22318 22335 22348 22369 22389 22409 22420 22433 22455 22462 22487 22502 22522 22534 22551 22568 22588 22607 22784 23068 23378 23558 23769 23957 24023 24070 24125 24169 24189 24218 24230 24236 24252 24256 24260 24268 24278 24290 24305 24324 24360 24371 24382 24421 24433 24443 24453 24463 24479 24497 24546 24567 24612 24856 24882 25136 25151 25177 25234 25268 25303 25445 25462 25511 25532 25548 25577 25582 25587 25593 25598 25637 25672 25702 25757 25790 25836 25850 25929 25934 25988 26002 26012 26036 26122 26170 26276 26310 26317 26332 26359 26368 26407 26414 26436 26455 26471 26489 26521 26540 26557 26714 26745 26752 26761 26769 26776 26790 26808 26827 26837 26849 26890 26935 26964 26985 27008 27027 27065 27071 27079 27083 27104 27121 27130 27149 27295 27337 27847 27855 27879 27897 27941 27946 27951 27955 27986 27999 28008 28054 28180 28271 28283 28347 28349 28351 28353 28363 28377 28392 28419 28423 28429 28434 28443 28448 28475 28477 28492 28503 28518 28546 28590 28637 28653 28675 28686 28719 28739 28788 28888 28942 28944 29012 29052 29097 29172 29238 29273 29354 29361 29422 29486 29493 29499 29598 29654 29930 30054 30165 30227 30265 30273 30295 30344 30347 30368 30413 30468 30527 30596 30643 30748 30891 30916 30920 30954 30970 30995 31043 31079 31140 31194 31275 31297 31336 31373 31405 31429 31456 31482 31496 31504 31514 31522 31536 31549 31561 31585 31626 31652 31669 31698 32022 32025 32039 32051 32057 32073 32085 32092 32099 32108 32118 32135 32151 32194 32202 32210 32220 32231 32249 32266 32279 32305 32312 32320 32337 32345 32362 32386 32405 32424 32443 32453 32464 32478 32496 32516 32536 32545 32568 32588 32599 32614 32626 32645 32664 32675 32685 32690 32696 32714 32733 32752 32759 32778 32798 32823 32840 32846 32854 32864 32876 32897 32913 32921 32941 32961 32983 32991 33002 33025 33032 33046 33068 33085 33094 33115 33133 33142 33173 33189 33216 33235 33255 33273 33294 33308 33328 33335 33354 33369 33388 33933 33966 33994 34023 34031 34068 34380 34557 34634 34651 34669 34684 34706 34756 34766 34783 34805 34864 35022 35046 35176 35201 35327 35345 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_RC6. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_RC6 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_RC6 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_RC6 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_RC6 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_RC6Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_RC6Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..