08Pi'&<  'ie0\P''`'2 2i'&P@@<@T 08Pi'&<  'ie0\P''`'2 2i'&P@@<@TU i`'2y?AiiiQ$f iiiRAiiiXAiiiYAiiiZAiii_Aiii%Aiii&Aiii(Aiii)Aiii*iii/altroot/standAiii,Ciii-Aiii.AiiimJ<iii`hpxXmiii[\Aiii$iii$>iii$iii$siii$ iii $iiiAiii'Aiii/Aiii0AiiiAiii$Qiii8@HPX`hpx$iii1 $iii$iii$iii6$iii7$iii$iiiAiiiAiiiAiiiAiiiAiiiAiiizMzLY?$5}p"GxřxHTT (087"Z819$0 D-H@L<: =%WE@+/ "[W.@8N  8C2 . ...profilealtroot bin dev etckern libexec mnt mnt2 sbin  stand targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi  ... . .. catchgrpchiochmod cp dd df ed ln lsmkdir mt mv pax pwdrcmd rm shsttysync . ..MAKEDEVand round # up to a multiple of 32 (needed for mfs, not needed for tmpfs). ninode=$(( (ninode + 2 + 31) / 32 * 32 )) # Try tmpfs; if that fails try mfs. # # For tmpfs, allocate 16KB and 512 byte per node. # Actual requirements are much lower, but the size limit # is only intended to avoid accidental writing to /dev. fs_bytes=$((16384 + ninode * 512)) if mount_tmpfs -s $fs_bytes -n $ninode -m 0755 \ -o union tmpfs "$dev_mountpoint" then fstype=tmpfs else # This file system size calculation is exact for mount_mfs(8) # with 512-byte sectors. 40960 bytes (80 blocks) is the # minimum size allowed by mount_mfs. fs_bytes=$((8192 + 2 * 8192 + 4096 + ninode*512 + 8192)) [ "$fs_bytes" -lt 40960 ] && fs_bytes=40960 fs_blocks=$((fs_bytes/512)) if mount_mfs -b 4096 -f 512 -s $fs_blocks -n $ninode -p 0755 \ -o union swap "$dev_mountpoint" then fstype=mfs else die "Failed to create memory file system" fi fi # Our current directory was in the lower file system; change it to # the newly mounted upper file system. cd "$dev_mountpoint" if $do_redirect; then # Redirect stdout and stderr to console ${MKNOD} -m 600 -g 0 -u 0 temp_console c 0 0 exec >temp_console 2>&1 rm temp_console fi echo "Created $fstype $dev_mountpoint" \ "($fs_bytes byte, $ninode inodes)" } # # MAIN: If MAKEDEV_AS_LIBRARY is set, then we are being used as a # function library, so just return. Otherwise, do all the real work. # [ -n "${MAKEDEV_AS_LIBRARY}" ] && return makedev_main makedev ${1+"$@"}  . .. cgdgroup master.passwd netconfig protocols rcservicesELF4D4 (@@,,@rr%%`t ,,%%NetBSDAPaXUSR&ffffUVS,_!Ƭ%9s 9r[^]UWVSu,Ú_!]P PLt,1t&tuAt[^_]Yuڅtft9s1u+z 9suփ 9r}tt~t111us t0#t&wfuUSQE$uԋ}{̋CE29sSU]MȍXE9s1u\tED u|E9rϋU]u9r09Jt*t@E9ǍvuUWVS*]!E@@9s{*;9r[^_]UWVS*é]!E u &M 1ME @E %t/tu(nj%9s 9rEt E$.,$ Ǭ%9s 9r$ED$E D$E @$-$=%MD$ D$ D$$1ɉL$$[$SWD\!5u1ƃ5tЃtD$l_[SW[!4uYƃ4t|$D<$kt?t<$ktЃ_[UWVShhhp&D `1t:PYxOvhp&j /XZ3h=hp& hp&j jUEU MsMU HE]dUVS1ۋtVPZYu C܍e[^]US輑Phhp&qhp&hs@ CtsPhhp&=jUWVSE tuhURhc@5& t5&h7j耭u.M.E.WVSQRP5&hGE t.RPhn u5&h|1e[^_]U5&NXUjhc 5& t5&hj谬1USRj EPSh xU:t ShjR]UPEU Ph JtPhEEEPhc5&{ t5&hj1UWVSSuE H1ۃv>PWKZYtCuދEhDW"ZY1tFEEPhc5& t5&hj胫1e[^_]US u Sh j2]UVS1tSPZYtFSh#jķe[^]UWVS ]u} Sh } ~Sh.1}{EFE} t!vM9Mt66EE1EEEK>tt,uh1}}}}}E뺉t9WuhjU9Uu\}t }uEEEqEeEEVEEċ]9]}t;$}t)}t(u9ut8Eċu9u}l}uE EEEԅu.u9u<E45&h "}t}uuu1ۉ]EuM9~VQuhjk]lS EYu h4jȥ1}E1҉Uuĉu܋UUMM]]}}Ph c5& u EX@1}Wu 5&hRj腥EuPE4hbCE rhj#^ElU9U| &h &heXZCtCPhO_Xj g^CtCPCPh, CtC"PSh Cts؋C4h C$PhZYu XE\1e[^_]UEě&]UE&]UhVjˣUhlj輣Uhj譣Uhj螣UE E EE] UhjjjuhBؚ&ܚ&Uhjjjuh&&Uhjjjuh̛&Л&Uhjjjuh&&Ujjjjuh虬&&Ujjjjuhqx&|&&&&u(Ujjjjuh5x&|&&u(Ujjjjuh &&Ujjjjuhګ0%u j,UWVSux&1|&&1&>WXuWh'j=SxY_u ShTj}xxuShg]hjjhEPuu뺋&#H t uh P&WPZ_&t/#=t &&tt hPX&ƒtuh<t?%t4!t$t & &hj肠٢&e[^_]UVSК&uX&d&&&h&l&;x&|&rgjd&&h&l&&&X=5&u𡴛&E &)EU}t 13A}uke[^]Ë&& t h&l&Uhhj萟UUhhjtUUSË@4URs(PZYts$hjiS4K(E%= u!HPhm8@QR @ C !jjjQR Bu@u8uK ]USQH9s S ZSPEPS ƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y hEj覞C4WPs(Xe[^_]UWVS]uVh&jC4uu s(P(?8jVj$+8؍e[^_]UWVS`&}t h&l& x&|&EUEUEU}uH& t?11ҋ}9׋u} ytEU&&E&& t(jRP5&&P Bu@u 5&hNIuSh`&Ɖ 19|4 u5&hr% 8t5&hj+11&E & tKE8& <&5|&5x&QPx0&4&&&1ɉ & &58&=<&9}u;9uu6E9|&u E9x&t&&|&&l&&9}u9utT&t%=؛&u؛&5&h{XZ&t5&hj)u}h&l&+EUEUh&l&=x& |&9}Er }ME EtURd&)P5`&k h&`&d& ؚ&ܚ& t8&&&&SQRPu ujhgbj e[^_]UVS]M Eu fft3SQHtlpCQSCAQSCAQSCAQSC AQ S C A Q S C A Q SCAQs[^]ÍL$qUWVSQܚ& ؚ&t/jhj~ ܚ& ؚ&tjhj~ jEPgi]eƉߋE׉ptiD&%@&ƉߡH&׋pt)ptZYt puDžp1t5&5&5&5&5 &5&5&5&h6jd]S,Ss$Sj}(&,& t7ƃ/ tQRPhbjdSOS+$Sj@}$ &$& t7ƃ/ tQRPh{jdSS$Sj|$0&4& t7ƃ/ tQRPhjdSS$Sj|$ 8&<&iቍhltpRPsƉ׍xPjhtptWVxPhlSQhjd]S!$S$Sj| eY[^_]a&Uu~ jUWVS&&5̛& Л&&u3jRP5ț&ԛ&P B@;1S0%v[H0%S5&5ț&ԛ&P$ t&u:5ě&hj&uNu<)u&hj螖t5ě&hN!XZe[^_]UWVS&& &u?j x&|&%x&RP5&&P B@4tAfEEEPhm5&&P tS5&hj11;5&&5x&5`&5&&P$ ~fEEEPhm5&&P @t;5&&s>5x&5`&h`& ;|&C;x&7벍e[^_]UWVSƉ׉ˡ&҃Pj hWVRuVJVSh (e[^_]UWVStÉ׃= &t%tPhh Vh PV =0&ssVPh s$s sssshF0sxsnWVnWVssn1ቅ11KcRPh8(( t+jj@Po PhJPY^=(&tYC0S4Ɖ+s8{< u$ t(jRPWVj@P5o Ps Ph9hp&hAVp 3^`&d&FV EUVwEU`&d&GZe[^_]UVS1ɉ & ğ&j?+hjG[ZtSZt|/uShShh@& @&uj>h@Vŕ NPYthPh&YZu1SlZ5@&hK>h@Vu VeX1e[^]Uh&tlP蹶Zy60 P5@&h3hp&h"@>1h&@&tP5@& 1҉@&YX1X&`&d&1Uh&t*P,@&ZtP5@&~ 1@&ZYu*Ujh&h&跞2 yjD&D&H&D&1@&@=uUSUE l&@&l&M@&Ћ] Ӊ)~@&@[]Ã06w $@1Ã1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HøUWVSӃu]1&2&&@ujjh&h&UN thh=Y^&&&&`&)&󤢋&1&2&&@ujjh&h&M thhg=XZSjjh&te[^_]UWVSƉӀ:0Bhi<XZGu̹@)1󪍅1 CuA uyjSVڍ e[^_]UWS1|&&&1j9P*ZY1&Cue[_]UWVS&9|&1ɉ |&ujjh&5&=&jjh&h&K thhQ;XZ1ۊ&2&&Cu5&=&u講_u&v7hVuP"Y^#~hzh:XZ th&=&~|&P|&&e[^_]US]=|&uU ]&1|&=&x|&P|&&[]U=|&uU&1|&=&xU|&]UWVS hCfY18]E }=&u>؍}01҉U"]BuʀEt@9uSAD Ythh|9XZe[^_]US&&9&&RP ZYu[0 Ph9hp&hY 9&H&ua&tjtJj]&& &u &ųu١&P&&M 1]UWVSSU&=&CE;U tM&119~149u1ɉs19~H &9E~@1Aˉt&X[^_]UVS5&&&19| t!&H<u &1[^]UWVSfEp E}u.h5П&_Z]tjEP_ Y^uD1GhRD^_FP&Zy }Ou PP x. E uh:؟&| zf%̐&Ѓu-hR踿ZYuu h6X넋&jEP [_bE &&9&=}\SR ZYu[0 Ph9hp&%hYI6&H&&tjj&& &u &uΨuً&EHП&П&8lx #xtދ&PRRe yɍe[^_]U&1&&&&5&H 1҉&&H&Yu&tjtjUWVSPП& t u h5X 6ƅu П&8u@П&S5t&Ë=t&X9=p&|^SYt=ğ&tj jsPEcUjjjRVI ;EtGSZyh1e[^_]Ë &Q &y ;0&| t&J &Uh&PĶXZUWVS u1ۉ߃=̟&tVI NyV贫XHF `=& ĝ&9^&؁}U|WQ ZYU=&ĝ& &u&tjtjĝ&u ğ&C1 mCE &9&؁}ULQM5ĝ& ZYMUuXK0n Ph9hp&诲hY2&H&t &/t1 &ĝ& &u& u ĝ& KF @t.0 Ph9hp&h=2ttĝ& &}ĝ&8=ğ&t=&te[^_]UWVSu VE=&ğ&E血&E1ۉ&ğ&X=̟&t5&11҉UuiEZUU&5ĝ&YUt(EEtBD&PPjAƒ u- &t C&tjtj &u &uݨuEVu9uuHtg}tIuğ&=&tEu~hp&h&H;ğ&Y^=&u3B=&uğ&dğ&=&tJE ğ&uhp&h8:XZğ&t!=&t9uuu$&Cu &19uu=&=&M ğ&=̟&t1ҍe[^_]UWVS];!uh݁CP"&XZS h݁Pǃ u$0 PSh3hp&\hJJu WYXyh;!u7W_(Zy4譿0 PSh3hp&ha4/W菥ǃ=&uVhhp& &+E e[^_]UWVSu] }9tU=̟&t VP*VPZYy009 Ph9hp&zhy.C1e[^_]UWVSQu VJ[=̟&tW1ۅtW;uRWNZuZW95&u=ğ&t =&u BRUPu xËUF?륃=̟&tuX؍e[^_]UWVSPu]>!uhEFP"$Y_V u Pƒ u$0 PVh3hp&^hRuSRUǃ Uyl>!u7RY&Zy4觽0 PVh3hp& h.-R艣ǃ=&uWhhp&ڬ tE)؍X؍e[^_]UWVSW11 Đ&yh&舤^u&P&s=ԟ& ؟&9&؁}U|WQ ZYUu[ü0 Ph9hp&'hYK,&H&&tj j =ԟ&؟& &u &uΨu١؟&uğ&1ۉ߉ u|&؟&0؟&П&u̐&@t?0! Phhp&bh+f%̐&1П&-f̐&9t{t ؟&؟&П&މe[^_]UWVSWП&C{ u)ÃEП&:TRPx Y^tE̝&ȝ&9&ށ}VR: _ZuZ 0/ Ph9hp&phY*&H&t1&tj tj 5̝&ȝ& &u &uҨu١ȝ&5П&ljD s} us*Ext؟&M| th)YoE̝&ȝ&9~P&߁}WR8 YZ=̝&ȝ& &u&"%ȝ&25؟&NjM}t/s2PR_Ztȝ&D } +s#̝& ȝ&9|R&؁}tVQ ZYM5̝&ȝ& &u&uxȝ&Me[^_]UWVSQ]utuh輥XZ} 9EueF95<%}h&h43^XP^w<\u7\t.ˆUPhryZYUtF-/B000CL r1e[^_]UEH!&EPhht@js x$Efv@%Efv<%U=l&uEt&E p&t&p&9~ 1;&~h='XUWVSSu &}t69&+=&=&=&t1C~ Ku"=&tn&u=&t[uSPEZYtI=ğ&Mtj jqP;jjjWus; t9&HhY&X؍e[^_]UWVSP]U u h.&XU19&~BPSYX%KM&uSwP(x?]9tWZu̸1e[^_]UE &DBuh%XP<|&u&E&1UE&DBt|&EhR%XUWVS&&П&EDJ@t t E@П&޹П&0U?& } $@}^@П& &П&8f|y@t t@П&܃tQ18j hП&5П&p%Ǎ v辴8"uhUA^t-u18UBQ@u^t -uօuh$^\1ۉj hП&5П&$Í v18"unt@П&&.j&_t|%1Ƀ/QP_ZYtП&M:+@П& FPП&@PX.t(@П&l&;u & p&&9Et9&}؍e[^_]US1l&&p&t&p&xLl&t&p&П& ;tK,tF l&ʃ~l&p&IuAt&H l&˃~l&Iu J П&:;v&l9tt&t1[]UVS&11Å t]9&u 1ۉ&J@։t&[^]UVSuj Zu+ 0C Ph9hp&脡hY!FV CS FC؍e[^]UME 19tx\uHPQZY1҅‰UWVS=&ujEH!&&PjhEh/ykh|^tZP螥[=wJ@ P/ Yt:WP轴XZ|3/t 3/D3hSX5&jhESjUM=&tI &QU=&ujEH!&jh&|UWVSE&1ۃ=&u-9t =؟&| t8f%̐&=П&?u1П&BП&: u)u ?.u tԍ4&WZu# &uo&tj=t[j&t PTCXPPj0à t9u& &&u른e[^_]UWVSSup&Z;&|1ۡt&x&@&9t9u SEWáp&ZYUSWjq/ u &t$195&~FPVjB/ u)ϋ&tj&jSS<[t<\t.RiZÅu!h! { uh]-[1C뵉) &=&9&Ё}UtVW_ ZYUu[.0Q Ph9hp&~hY&H&t&tj2\j 5&& &u &uΨu١&5П&ljП&=ğ&tj jRPe[^_]USП&< u h XH< u=&u$htXJ П&R t8u ӡ&PKXu1&t=h&u P\GVrω0;UU Mr3)9 ڋEEW&}RUu谪 ZYU&& &u&t &M9u}EMELE B19uu)d9|T&ځ}tVu ZY45&& &u&_b&Cw}9|T&ځ}tVu販 ZY5&& &u&&؍e[^_]UWVS] Sװ^|=ğ&tj jsPlCjPju 1ɉ E&}t9U3 9&ށ}V5&q _Zu[C0f Ph9hp&uhY&H&b&tjGJj5&& &u &uΨuك=ğ&tjj   &NjEpSP-  9~U&΁}V5&H ZY5&& &u&=ğ&tjj S6 &Nj󤋅  ?u9Ћ)ȉË ؍x&9<t t tjPju o&=}tV5&" Y_5&& &u&~+ uEthTZDžW=ğ&tjj S &Nj󤋅 &f u1e[^_]UWVS&t&H&1ۉ]1p&+t&9U졄&@&Pmuu PuƃU&PP[Z&3E&1SwYu' &&tjtsj&t PۭFZPPjƃ t9]u &u &uuE&G&E  EuhXE tu RRK x1e[^_]UWVS&E䡀&E=L%t =H%uhNYm=&t &j&&E=&ZZk EtTuaPR@POwGHm uu^13^@p][sHZPJJ@BE4qE@E܋]k  9]}3:}z}z}׉}8up}xK Ń=&t聺L%&EL%H%&EH% &u&tjt j`1e[^_]UWVS&&Ht7k X< u'ʣ&B0Z9tSe;S] ZY1&&L%&H%e[^_]US&9&}Pk& &EuCk& &u C&P&k &ZY]d&j Ph&Yk tP[ Ph9hp&nhY5&胤 1&&1]UPhhp&Tnj e &Q &y ;0&| t&J &Uh&PpXZUWVSօt%ˀ9u RPhRPh!k uqRPh k `{tZC<i1ҍ{t2Hs!t ,I< ϊG< ĸ>e[^_]e[^_]UPEEjEP5&8 UrhPhhp&"mjcUWVSf@8tXu1Pv}1҉hW3à Q}8#)tSWV 룍e[^_]UWVS} 5&fDž<^|1҉hPj6à t[|8|8u |1ۉhW9Vf8uFt"SVW yF`|8#u5V|1ɉjjP @u7|8thjH1h)+jWj@bfDž=&t fDž9DžjRjz fDž9fDž9&jSV  @u{8tJfu ft>(@ufDž=&u#K,&@tftfDžftR@u KfDžCe[^_]UWVSQ}u VW~[ZÅuzjjʛ XZu haj/;s jEPW(ƃ ?tE8thhj_/cz8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19} 9xu90tEEEE1,]9Xu]9XtiB9xt A,9|90uU9P uU9PuACk,QMuR ZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPY_}ËBt1Uj]L$qUWSQ&-&wȡ&ڞw ]]5ԡ&5С&hj 5ܡ&5ء&h,j 5&5&hDjҤ 5&5&h\j躤 5ġ&5&htj蟤 5̡&5ȡ&hj臤 E$hjr EPP$hj^ =&t>u&1 uj\eY[_]aÃ=&tUE Puj蠣 UWVS}u _Phjۣ 3耛  &B9tT &e[^_]UWVS$ ]5&t(Vj$V 0Y^ugh j0Pu L yWip4$[ 0ZtWVP< u WhQ5Hjj0։( y0h5"jju ։ƃ C Wh VPƒ jjWT‰ VXh 蓑 _Xuh]j\ [^jh h R(\y Rϙ Y߉R踙 Zt-w1ҁbt#bt!tu h1 Њ Јt u hjYu V$5ƅ/ t jZV8 jZVP4 djjP7& $&0tS SQPR(&,7kP Ɖ4W 8t t10hj軠 \9s1BFu hj苠 1e[^_]UWVS\]ƍ}ZE5X(,a&V&0З 4ŗ 8躗 EPSSe[^_]UWVSĀ]p$tVP:V9Y^㋃p tV3:V9XZ㍅xPC1RPuu t5%9ΉЋt}"Q_85%VPh/e[^_]UWVSP] AEH1RPuuƉMt1׋C|1׋ujQ1RP<t2uPhj諞 E01RPuuf‹N tkvkk ыEe[^_]UWVSTE>E8Iu EuEEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉU1EUE}t EșŰU9UuU9uM] E} uWVE,# E: =&EEIu E5E@1 t1҉ËM ʋUщe ʋ}t}\SQE,c$hiO5&{^Ãt#EUSjPVC0Ht h"豗 XStTX&&E1С&ԡ&E<1EEt E\]ԋu)։]uEEIu EE1 t1WVuu}9E E~1҉ t1EUWVRPH9E cEEEEuuԋE,#EЃ EtEЍDEȻ8&ELEЍDEȋEۃ0EЋHatE/haQuuPh>3REЃP2‹EЋ^_9t"ERQuuPh}jj E؉E܋EԋU؃EU1ۉ]]]ċEEEЀt)X@}99EEȋ}ȋW:X@9]9EEȋ01}WE9L9U)9E uuE,!EujP1Eă1ɉMEEËE}t;k;xd[}Nj}ljEu 9EcMQRPuEPE]tXpXju5XZ9u9]EE@]k,Pu Y^Ek,tԉEVFF EUFVEEtP4@0FVGPtP,@(FVGltF Ek,Dԉx(F Ek,Dԉx(@P$]Ep}}EJEt#1 t1EU!X1 t1EUEU9]LEE܃8t)E"9E1EE܃8E\]ԋu)։]uE)‹E#Ju E`Ek1 t1WVuuPuuhj֖ t E܋P @E܋@1ҍMQRPuEPcE0ju31ۋE;pE܋EE9shI9uEtpp E_uuE,#ujP=.EċE1 t1u}C<҃<DEE܋}k,Pu" E_Zu E}81ۋE܋EEE9k,}}܄t3w 0x}܋t|px u}px}Ћw04/81p}܋tpp u}px}Ћw(,px}܋wp J9utGE܋@ EMk,}D$uuE,ujP,EċEk,E‰r(Er$ t1u}CЋ]E<҃<]DE܋EEEE܃8i}Eȋ];\9E}Eȋ}9x }98EЋP9Ut,EQuRuuPhjÓ E]E]E Eu&&EEUEԉU}E\uԋ})׋E^EXIu EEEÉ1 t1RPWVPuuShj E}8LEiEe[^_]UWVS uEP}F VM]_9EEr )ӉM܉]Fƒu>uFt 11E`E9sWu h5jJ N1ۋE1)ډEUF@]t[ ][]ԋ]1ҋM])ӉM]E9Es 1)EU1U9ЋU_U܋EЋE]ÍEeM1SQRPFVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW&}EEPhEPƒyEqRPhUj xhj,3W_&}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QRPhp1ɉM؉M܉<EPURvSE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]<E1Em}&&ȡ&ȡ&EЋUء&ܡ&ẺEMEPhPǃ yNQWPh0FPhPǃ yNQWPhj 1eY[^_]aÍL$qUWVSQ9q$&&,(&,&?1&&1&&1h8VW, ta#DtNJC91&뷃b$0&&C&C4&u591U&e591E.(&R5910$&@&/591& &591&X91&hp&hYX&)lj80!hp&hXZ=&xhQ!=&x 8u5&t hjtjj)hky h+jj [_@u hjj hkL hjS00h&@PW@ uh8t|j/SZYÅu@ &׉hjDShj8Sj$8 &P>{ &1urhJj jcD&؉8hDj$ 803PyP3hij謋 W5&OG9= &=&tf95 &~W&4FX烽(ta1(,,9 & &_=&tjC&xrP&0j&dh1҉ldPh &Pà t$\8:hj11ۃ= &*6, &,4@lXRjPjjT($tPhXP :8zJt&Z JZ04z($J 04zh P&1С&ԡ&8Y_9t4VZyPhjPhjB 3‰.Ju lxtH'‰`R840Ph tH891҉ t1҉Ӌ+049׋0|9؋4}Y 9؋4}s8014߭0ݝ0y11SQRPl1ډ߭ dܝ0v7ء& 40& <0[10=4&pݝt{\P!S5+ ݅y+؉Phj3 jPh( \`+EU5&9Ɖ 9jSZY@݅u؉NPh (&ܝp ܝ0 LRjP011RPl$01tZL9rKjQ4#^X0290Q_|OlaGl막 9skQ k4 JHJZH XH J HPW4 D2 D2GlFhljP88P PuPhGY[# 1҉D<50&$&8Hȉ9r09rÉ014#840Ph`k840Ph`j] 04 4111W9m09Ћ4J8JZ8<< 89 +4i۷m۶R<8SPhPDPh8&SW(~LFD\`HP\Ph8&W\DHY, X049Ѹ4}u014"80Php1ۉ898r;D\`j\Ph8&W\D𙋝09މЋ4}88SK t+4i۷m۶hQRSPh DPh8&SW|$~FL,NY8&D8t8&011҉VPh#K=98~k,0D$Aۉ7<1߭߭&&ȡ&ȡ&ء&ܡ&1XT0 11198 P t$k,0Ћ 9Pu9 tyt_|;TRXR801RP 1RP1F P @ 9| ,PQpQRPjW'k,0Љ1;P} PTQXQ8)Q t p|룋Tșڋቅ044؋ቅ= &t 1P8&k,8 $98p 9~Љt$DPShSpPhPÃP PJQSPhhj} #tV":t&Phj} ,+ePhjo} , E$) 048<11ۅt9 ks F(tȃ0tBE;Pdr,9u:s (tvRPYY09us,9uihcc (_tZ t @ (jS#EY[t8(w690u9,GjSXZ (w t WV^_Ɖ׋E t1 $DH 9|( k [ (E9s@(ERPWV0,h<(j  袋9.}*WV0,hkjr (wj fk,Va 4Z1ɉD0q PHD0,hjor ( j X k,4 1󫋝,0rrz E(t=@PtȉB DH9v@l9}&E}t8Ph4<@n $DH $4 9$0x19E4E‹E@]t+Hu>E0]\)Hu E1ҋ] 1ҋ] t1RPWV$kDt 18x, $$y11jDP4Pu2DH1 9؋$}W $) $119ʉ} @H9؋}{ =&h j&l Y^wM t1WVSPE(\=DH9}bk,4_$SZ G(Zj=0j P4t0$hFjfk MH=&tRP0,hij(k EHa‹E1tIu$X1IuEC1 E E t14k,kD,49Et@E@8RjPjjEj8P h PR v%<DHk,49s"4jh EP bRP@8tGpBu] E`&%Xe[^_]ÍL$qUQ X&T&5P&5%hEM MuQQ$RPh"$MɍaUS]CtS P S tSPSCr s L] ZSE] \&X]USEPsH) H&L& @&Hu0d&Z[9u |&u' |&uhfjSP4BPQ X4CXZ@]UWVSu EEE#%`&P& \&M11ɅtJA9~ʳ9M}#tP&hzhhh,}9x4u }9x(u9p$t버tP&e[^_]UWVS]uuu SO trNj@thhh1GGWX9w(~6Gthhhh ,wVw 2 G [^WY@&%;\&X=t&u =l&uBGWux&GWtPp&WGtG4WPZWX\&j@j1 Vj1 G _4E UG$W(G,W0wE #%G8`&tz8GC GtWP { _ Ge[^_]USEM Puhhh4h*P ʉPHPPP s E]XPs2H H&L&@&1ɉH h&Hh&.1ۉXt x&Hx& p&Hp&P4JH8`&9t!tXYX tAP]UWVSUu }uWVRcËECUtX&RT&EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=%Y,A0Éa,ڋyY I4 s RPWSQ\ RPWSQ`e[^_]US]C%CSjS]1]UE UMQ1]Uj'. UU P&PYtHJ &@ &UWVS] &C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdW CW ${sV ]e[^_]V UWVSuE EEEE%&1҅9su}K}9y,u^}9y(uVK0ts4q4s4 &K0ts0q4&&C4&=&~ttpRZg{$u{uCuڋ[0n=&~ tRkX&&t$;3uEE EEuCe[^_][؉؍e[^_]UW1&&&11҉&_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE%K,ϋS0c,ʋ{s K4 es RPWVQ\9Cu CC17RPWVQ`uh5W YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPY_}UVSӋEU tt RPʹY^CSt RP踴Y^CS e[^]USËt-w1Ɂbt#bt!thbRh91 Ȋ ЈS^Z19tPQh1 Ћ]Uuu tjAUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus ( C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPY[L(ștșe[_]UWSvhsh8h h!ÉЊӃttRP胲Y[LXștșe[_]UWVSvhshh"h&!ƉӉȊʃt$uҁTXe[^_]UWVS vhh hh ƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPȬYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8j! ËEEC1CC"_C_C h1C C$hjl! Ehj]! M쉁j`jK! MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmEI EpdI uI SI EE싀}@u jR^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u&EE %&S0tK0J4&&C4&C(tS(P,&C,&މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hhhqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhhhh@]9~ ]B뫋EEP E̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuh}t/EEtP1uuRPh辧]9]tSuuuh6蟧uu] SY[9t$PRuuhnsu6C 1҉U u$C XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRP_MeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPWZYU9닋E芀{at WVhwtC M苉9t.CM苉p9t$1SQ1RPWVh蠤C(S,C S$]9UrSPWVh rWVh(^ ~}t5EtC(S,C S$9Uu9EtPuhO EUjuuWVSuEE؃uju [X }t$EtC(C PWVhp辣}hh,hhEzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRPߩEuuWV̩9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWV{9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPh臡EuE‰9u+|vEL։A9u9u V9s9sE]Ã}thh&Y^tCpStCHuRPuuEU}t hJZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhF&6EtM}`d)RPh  tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j( E1҉PEMA][A[A [1ۉY Y$XZ}t.hj ËE쉃P^_ u =%ƉE} t hB}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVh LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhXZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Ph`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhXZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhB_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuuܕƉ׀}Mt1׋C|1׋URju1RPQtPuhd Ep 1RPuu<t֋F Ft:_vkk փ~t*uuh? tFVC(S,FC vkBHMQjPjjRt PhXZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhZYEP tu}rz}zP4PR:X17&t C0S4C(jjP0uu Se[^_]UVSUE 9| 19[^]USPPhkhp&hp&hv|%CtsPhyhp&jFUSSE] t$uhsjZY¸tr1EEPhvd5Ķ&/ @u35&h"jȶ]UWVSPu }t}~^hcSY_DžtFh݁S_Zt)hESZYthS[_t뫿}}uh&vZYuUEPhud5Ķ&^ @u65&h"je[^_]US}tQ,Shzd@5Ķ& @u5&hj諵RP腈=vu8&UWVSQ5&Ctt+ t&Pσaw <v ;v ju_{Gfw$k A E1E)й 19u5{$ &1TtDQt!@ u 9u1 Z[^_]UMU 9|]UWVSƉ׉M0&4&ÉEE1RPWVRE)Ɖ1UQhn-XZ}Ut4&H9u0&H9u u9rBRWhIf e[^_]U塨%=&tvPhR?5D&5@&5L&5H&5P&h[ 5,&5(&50&54&58&h5&h Phh$H&L&5%5D&5@&QRP5P&h,hN$4&0&5,&5(&QRP58&hbN 5 &5$&h5 UWVSQƉe1ۉjEPV` >u#ËE8u98"u w܉1e[^_]USʈP[$PhPhPhPShhp&Z,jUWVSEM %9uh5% hj蓤ًEEUMjؙ]!É]]!Ӊ]uuWBuAtV%%=PuR蟉 3P5&R草 9%uNE!5&}e[^_]UWVSEUϋE Et EU@uSh\XZff=Ut+=&t fuuShff=u%Cth fLJ_f=Ut1=&u Sh/Y^&tShg]XZj(VPĊ x0XŃ~X r&t\fLJᵃVe[^_]UWVS9&u&5& 1Xƃ"&e[^_]W|$wUWVSDEUȉM̋EGWEUċG WEUEEEtE11}=%E4&0&U1҉U܉E1ɉMԹEM]̋ERPSQPE؋UEUuuRPāRPuuȋE؋UEUuuRP蠁RPE؋UEUuuRP肁RPuh,"uuuuuuuh h&jdh& u hjΠhkh&Y[&U슀&< <$u z Ћ &DQu<-7j EPh&WƉ׋EEhҳPEЃEPhuF tuhu/ t L =%Ήʋ5$&11WVSQ)Ɖuhuʞ ui $&ω%$&Ɖω uEt5 &1Et &1Et &1)Et &1)׋E؋]؉E]hkSYZÉ]; t,h&}Zƀ&uh&h 9uE|E9Ɖ]}.uuuuWVhuȋ}u}e[^_]g_USE Pu h8WĐ&HĐ& yh&Y&P&؃ t9@t* Đ&y h&Z&P&8 u hj!1Y]UWVSEM䡘%E@u h>j%EӍEƉωؙ!M!Ejuuu:Bu @u%%uhuP nR5&Pւ 9%uVjuu5%Bu@t&K!Nju5%R5%腁 9%ue[^_]UWVSRá&u ƀA Mz΍& S}8PR芄 & e[^_]UWVSEыEU u1+ˀ &1ۉƉ)߉u}};=&}=&VEUEUE9&&}=&t Ev&KiE9t 5&tމ&ʅu+ &9UE}M1E܋E9E܋U}t0}t}utsƆj{ȃ[^_]UWVS EӋEEh&@Ph&7E 5&t hj"EU9E|E9u|础&] }) VRP衂5&31fǂU }u@ &5&֋M)}CsKSCPKSs FSj&Ee[^_]UWVSE}u&"&ƒ<1IE E#֋EU EUEUE9@&D&M`&19Et\tSMM1ۉ]]9ً]M}3M9MM }=&]@uEr&˃t & &t!=&>&1hj &[^u hj謘fǀUE裘&EU &&EU&&&ytbt]t E^&QHu&<=&/h>Ygv&=&&;&KxZ 5&t1;EM |9UE}=&t`룅&E 9&u;]t~&H&1+]9~ Fu%uF PPR~ & * &1RPEU &+E&XZEU &&EU&& ]3Ѝe[^_]UWVSË@S t+5@&=D&9u9t hY]sǹ󥉍1󫍍@u'C CuRh3NXZߋe[^_]Ã=&u x t"1UWVS|ÉסT&tP Yj/SN^ZuS5%h)hT& SwT&YT&u hjOjPzXZy5T&hrM[^xPS許ZY@tMuи 9E} 5T&h/T 5T&hF?h h &Sz 9t5T&hLf=&Ut5T&h]Y^S{XSzZ tje[^_]UWVSÃ= &u1Ҹy &f=&u1f=ܼ&I؁= &t#&`& &ܼ&f&f^&Ut&1^&u[^_]UWVS á&fE4&0&8&`&11t#f}u&&t9r $uɡ&E &19E~+f:uzti 9t@Ћ &t=&uaf}u&! 9*=&tu7h Y= &t f=ܼ&u/hh@7XZ= &tT&!9T&=&tPh_XPhZYt 1= & = &uLyt{1j &tr&!9tSP5T&hA9=&t1~f=&u3 &5T&hZYu& ote[^_]UWVS(ÉEU EUE؉uF=&Ee[^_]11ɉD11ɉt<u ȉhjhhPtPQRh fu1k t PhhWVhh =%RPSQoPh5Y[=&u" &9u1ۉ)11ɉj-j)XZtƒ?RR%Phhu0&u u4NX,t<u=&&.XJ~hShX @uE=&PhShB0 PWVh)${:u @M9u1&t(f}UuuhSh( HQhShRh=&f}Ut?HPhShaEPh R=&9tT@xthAjjPRLRhGhShP(R Z)uhSh] 6)uhSh ƒ<=&&hhO @ u ShhWVڍC$u u*&j! Xchje[^_]UWVS=&ujjju uA=`&t+5& HֿuVWh PVWhVWh 1EU RPVWhPVWh$%PVWh$PVWh5z ?PVWhGa%PVWhX< PVWhi%?PVWh{ e[^_]UWVSdEUMċu} ]t'BuUE$1ɉMH1҉UUUUE&E̋EEE 1҉UUE`&fE9&~5 &EE̋EEUE$1EH&E$1҉UH1ɉMMMME=&u(}t"uPh uuUEtuS&}t.Efu ukE ]PEP& E&}u(E@EċE̋p1u}@ E1E}u E@Eĉ u"E̋p1u} u5 &1u}E E4E̋@ E1EẼx @&D&)EU}t=& &1҉EU}uE9Ɖ115&=&&E&E1E]9]~JE8t6EӋEU9ȉ|$E@1ڋ}w1EE뮡&&)9E]| hu}=&=&1ɉ tG@"&t0&&1҉EĉUȋE9Ɖ|*&1EU9Ɖ|1Eċu}E&"&t8&&1҉EUI19Ή}E9ƉU| 1EĉΉ볋E@Eău;5@&D&Q=&Dh _1}uEĩEęjhjjjщ¸E &EuE1uu11}t#&&EU&&@&D&EU11ҹuuRPQVEĉU);E}EE}]u)։]u}tt&E&19}9}tH>tC9Eċ]|N1ӋF19Eċ]}|]9؉ӋM}EUG롾`&19}tHt?19Eċ]ȃ|19MċE}]9؉ӋM}EUGu EċUȉEUEU+EUȉEUE Eu h E Et}u9}E}}u &$&1RPuubu 9tۃ}u E9uuujjR|EUEPuhh肺h&jdh&u hj蚂h&[vEHƀ&t'& t9EEHPh&h$" uh&EP躎 uċ}ȋEEă}t6juuWVUċE&uD<=&1EjuuWVUċEu=&tKt$|=&us=&t Phj[P]juuWVUċEt)/juuWVUċEu}t }tPhjQ}uf} E U u }EfukE } 1E}t Dm:}ta}tE &1 &&9u19tuugZY &UӁþ]EU]̊EĈC})}̉Guw OWPE̍HPD3}̍_S^_E}tgfǀuEPkE }Pw& =&u=&<t &(hHYtfu'uEPkE }P =&9=&t hlZu&}ft=&hH[E̊@EċE̊XEčE@‰8&p1WVjjjE1ɡ4&p1WVjjjÃ(Uă?1ɋ50&1WVjjj^}̊MO_U? ˆWGEĊ_EčG‰8&p1WVjjjE(1ɡ4&p1WVjjjËUă?1ɋ50&1WVjjj}̊MO_U? ˆW(} &uKye[^_]UVSá&u hRX1ۃ=&u Sh{(Y^jjڸ`&CXZu҃=&u=&thX1L=&thCu Sh]δY^g &RP1҉8XZ=&tC&9&A=&~hc5&j5&5&RP 믅<f=&th9^hj[&t=h&Y=uhx"k PhӳXZ h ųXhgbX=&nPh蜳Y[=&&PPh| j=&t>u Sh_XZ9&} h ^X; &RP1҉u Sh!Y^jjڸ`&XZe[^]UWVS ˋDž t Dž @uh%G3ZYߍ1jh>S4 t 1/9Cu苅9Cus Pjvs ;Cuă=&t.{ t(s$s shGe[^_]UVSPE%;%u*=&u!URhmdPr y hQ@W2X`&11@uhB=&u111H &~ ف &@uh1^E&01C;&}. &&&@@uSh1Y[1҉U%;%u*=&u!URhmdP菩 y hQ@t1Xe[^]ËU\Phyhp&gjUWVS|E|x&wShhp&*jS EZuh(|ƉjRPu 9u9th j蘩Suu] 9t"|thhw Xjc1EEfU}EEEEPЃ<]1E ÉEE|ƉuR~EEE_}t V PSE4h '*&fEEE&&19E~WtL9u.;u&}JPaR@&4h<tuu u@뤃1\3 9sR@E9E~WtM9rϋU9sэPaR@&4hjJ }9sf}wfE@f*&}E4hY[n}tGaPE4h } t}t}u$EEfEEEfEE4&uEE]9E@ƒt<u+ExمuuEEZEEu9uu XEe[^_] &yUh&j 菲XZá&P& UEU 19s f3P]UERPZYUSBHBy;B| X RQXZ]UWVSQ]u uhS/F fw4hPhS FPjhSFPjhS Sh9XZFXt Sh9Y_FXt Shl9XZFXt ShY9Y_Sj v(hS脮v,hSv v0hSev8hSWv4hSI$vS6EXZEE FEe[^_]UVSSPPVu ujVSh~J,@uLt!t"誹0 Z2tHPShwjpnj諟UVS]u VSYZu Shjon;/t"Sh袼XZu E e[^]鋼e[^]UQPhhp&肨j9UVSPh݁PѨ[^t,PjPuVؼVt jPSZYS˞Xe[^]UWVS EEu EE}]EEE1҉4&[1ɉ 8&@&hXVuN NtJb$ 1=@&@&D&<&8&뗡914&jWh591ը u hjlP聨 YYH&J&4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjPSXZt1h9}PKZY uċ2jWSh!}@uL藶t!t"聶0 ^2tHPShwjGkt%@u=8&p&8&_8&MDžb=@&tDžx4&t [dP=H&t p=D&t {=<&t 1ۉXPhhbh{jjSh~hVu haj]jj/G P vZYt| Sh~hVtj/C PuZYt|> XjUVS]u VSYZu Shji;/t"ShXZu E e[^]ӷe[^]UMPhhp&ʣj@聚UWVS]u1 11҉t11ɉphu u athg$591`CpX591!CtXDžp591XCxXDžt뀃K|wK|njVh 591b u hjhP X<&P;UtU tu4uVEptFuxPVA!Y_@t#ECpJtuUxPV!_Z@u8VhjGgxPV ZY@tuECpECttu E%Cxe[^_]UWVS SVpPtWu uhWpShx,@uSVhjGSgr@t@1RPhhSĺ Sh 覞(jUSP]jEPSj"U :9uySu h-jf]US]S Zt@ heSZY]US]SP Zt@ hSsZY]USP]jEPS!U 9t :uy Sh?jf]UVS]u VSAYZu Shjf;/t"ShDXZu E e[^]-e[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RP6Y^CSt RPt6Y^CS e[^]UWVSӋEU ΃tt RP86Y^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]tËUWVSEUˋuE FUU tJ$1EE ~uJ1EE ~<$ffCRVڋE E CRVڋE uEE }t>}tWWV4Y^Ɖuu4YYEU0`}tΉȋUʿBUƉ4s {$s({,s0{41{D{@{HUM䉓CPsKC 1sss$S{l} E 5`&=d&}t M U JpD1HӉ5`&=d&}tCS}t#RP3YYCh}t1ҋM M  t1WVڋE BY^1U ~ 9~}t 1҉TpTt1|(@ԃ} }t1E 1ɉKXE HpED1Hy~Fuhshlh"h}t1҉1҉TX1HF붍e[^_]ÍL$qUWVSQXAAA TAAAAA A$A(Q,A0A4PA8xA<@t1É1ɉWV;1҃t0119s#hU3+ZRP5;PH0jjjjXSËPF߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY PChV跠ZYthVhi( u&;s5;slDž:DžDž u;tU('DžuLDž Dž;DžsDž ~|t~(uydh'^_PDžDžt9t h&Y9~Wth&XZ.DžDž9|ċ9|<t h(&Xh5&h9ȨDžy(hw%^_uqh荨YI;rhw%XZu) u 111(4<81L\0,$H1dH@D uj$_t⋅9t PhG$Y^Ht2{{ @D0{{@D#Zt⋅9t Ph#_XG1t{${Q!#^t <8(Ch4CpHt ǃ ǃL@tA"ƸY9t Wh "XZHd 1t1\{ChX\Clg{ OtIh,hp&跐D8ljPh]hp&苐t@t)1L@t31#LC LClC XkT,Pxu\xtJxHXCdTCT~*0CPPlxtxp1PF ^t1P YttuxPZt*1 t1s{ %1t t1s)Й t1҉p11Ҋp t1Ҋc t1hl t19s hl)ωptct hlCS s{C`hCpC1ɉt‰ Ju s1 t1WVtp.ct9Ǎ@4pp4CtǍ@pp11҃ʃʃ p t1ct"uM 1FCXS\u 1Huw?ǃH3Qw ǃt)t%@ @ v#vxǃ ǃxd‰9rw~uZ9$}Ldu2Whnhp&ϊ 9Huhp&hlXZdѽPh dt$hZhp&WOPh|7 v$tpPhK^_j cY@uhAh7XZ+1߭ڍP lWW$h2HuƉƉ1 t1 ‹)ЉʋCtSC8S< C$1 t1OD1t 0 ‰D2耽tC|PYBu@u0 Ph,p tu `duCPODž1v 1񉅰 t1 t19u9t hT_ tG ?9|$ tj jhq$t*uQ1҉Ɖbu 1҉h t1C` t1)CS\)CDž+x|ƒu Q]1 t1҉Ѝ Ɖ1҉"vJt\9Ћ}x|) t19r$mh^t+)CS)C +V ‰Ju 1 t15Q‰扅Q‰扅扅tV׉sX{\׉sh{l׉sp{tC`Sd*\ȋΉs<ΉsDCHK@hM Yu jjhH@1󫋃@t<<f<%fGXD@<f<%fGdDSP1R_ZtT81RP}XZ1ɉtpxpx t WV^_Ɖ׉ t19s=Pd/D ]j\ ƉX P; YP FZ@HRjPjjt PhN>^_@ Gt3~S@1҉P-HG 1ɉO$)~\@HG~F F <@4PXjjXjjS'ptK KS1P1ZY$~dt.<f%Tf-f1GfFjs ,<f%Tf-f1ɉOfFjs1)щ1 t1҉GW jhZY<f%ffAXZ1ɉ19sDA u҉=v D PjVjj{@ DžDž1p_<҃D 9sh5&h" Ft Pt#u?RPY^f*uGɉf1VfN@ tBhhPhqfFu=@ A)G G p 6p<uGG9rhh@hh)9rhh@hՉϋ)1󪊓t@@tf)thh`hhLP4PRAH‰ljX1OtVjR1RPQytPjh66 H TƸ1tvkk ʃ@u51rrrrB 1z0z4z8z<@1OBB~B1ɉJJ(MB 1BBZN9s1BBrz 1BE]9s1BAJ1B$79s1zAJ 1r@4PY=&u jSqqXZt 1{@{D1s,1ɉ9\FH|‰1RjQ1RQVAtPhr3‹p JuI!F u1kF FtL<1 t1F tX1 t1 ‰ ‰1 t1ҋtC@SDC,F t 1 t1҉щ‰8ubvVt \Ɖ 1 t19Ɖs)щ‰jVXZ$t,CpSt'CH\+ƃu 1 t1WV@Ή+tC@SDC,)ȉʉщ‰_1v- 1Ҋ t19sƋ1𙉵st'{++C8S<++C$BHQjPjjR t Ph/^_A |tVC@SDs8{8tGpBu= E&%Xe[^_]ÍL$qUQ &&5&5%hEM MuQQ$RPh"eMɍaUS]CtS P S tSPSCr s 蒝 ZS苝 &X]USEPsH) && &Hu0&Z[9u &u' &uhfj,P4BPQ X4CXZ@]UWVSu EEE#%&& &M11ɅtJA9~ʳ9M}#t&hzhhhl}9x4u }9x(u9p$t버t&e[^_]UWVS]uuu SO trNj@thhh1GGWX9w(~6GthhhhSlwVw r G [^WY&%;&X= &u =&uBGWu&GWtP&WGtG4WPZWX&j@jq Vjq G _4E UG$W(G,W0wE #%G8&tz8GC GtWP { _ Ge[^_]USEM Puhhh4hkP ʉPHPPP s E]XPs2H &&&1ɉH &H&.1ۉXt &H& &H&P4JH8&9t!tXYX tAP]UWVSUu }uWVRcËECUt&R&EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=%Y,A0Éa,ڋyY I4 s RPWSQ RPWSQe[^_]US]C%CSjS]1]UE UMQ1]Ujmn UU P,&PYtHJ ,&@ ,&UWVS] (&C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdY CK ${s7 ]e[^_]% UWVSuE EEEE%@&1҅9su}K}9y,u^}9y(uVK0ts4q4s4 @&K0ts0q4@&@&C4$&=(&~ttpRZg{$u{uCuڋ[0n=(&~ tRkX &,&t$;3uEE EEuCe[^_][؉؍e[^_]UW1(&@&@&11҉,&_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE%K,ϋS0c,ʋ{s K4 es RPWVQ9Cu CC17RPWVQuh5? YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPDY_}UVSӋEU tt RPY^CSt RPY^CS e[^]USËt-w1Ɂbt#bt!thbRh91 Ȋ ЈSZ19tPQh1-Z Ћ]Uuu ;jSUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus i C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRP2Y[L(ștșe[_]UWSvhsh,h haÉЊӃttRPY[LXștșe[_]UWVSvhshh"hlaƉӉȊʃt$uҁTXe[^_]UWVS vhhhh`ƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8ja ËEEC1CCCzC '1C C$hja Ehja M쉁j`ja MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmE< Epd1 u) S# EE싀}@u jR^_}E UG(W,}x0xdEtFVtRP1YY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u(&EE %@&S0tK0J4@&@&C4@&C(tS(P,@&C,@&މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hhhqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhhhhW@]9~ ]B뫋EEP] E̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuh}t/EEtP1uuRPh{]9]tSuuuh6\uu] SY[9t$PRuuhn0u| 1҉U uj XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRP MeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPZYU9닋E芀{at WVhwtC M苉9t.CM苉p9t$1SQ1RPWVh]C(S,C S$]9UrSPWVh /WVh( ~}t5EtC(S,C S$9Uu9EtPuhO EUjuuWVSuEE؃uju [X }t$EtC(C PWVhp{}hh hhPEzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRP% EuuWV 9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWV 9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhDEuE‰9u+|vEL։A9u9u V9s9sE]Ã}thcDh& Y^tCpStCHuRPuuEU}t h,ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhD&6EtM}`d)RPh  tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8jnR E1҉PEMAAsA 1ۉY Y$XZ}t.hj-R ËE쉃P^_ u =%ƉE} t hB肉[1ɉM%EPjh WVu*hjQ ËEp }쉻PP P jPXZtS Su%}URjh  t1RPuhjQ EEp }}M쉏PP P jPW^_utCHSLC419|} tMhxLY@Et} t#h-Zu uuS9u uy X Sy X]=t Sy XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWj}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVh LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhXZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Ph`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhXZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhB_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuu" Ɖ׀}Mt1׋C|1׋URju1RPQtPuhd Ep 1RPuu t֋F Ft:_vkk փ~t*uuh? tFVC(S,FC vkBHMQjPjjRt PhXZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhZYEP tu}rz}zP4PR:X17D&t C0S4C(jjP0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP  e[^]UWtBRBR t RPkY_}ÊtBRtUWRP@Y_}ËBht1UWVSӋEU ΃tt RPY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]Uh$hLhhh6UVSuE H$X(1y9)tNp1SQRP#  e[^]UVSuE H$X(1y9)tNp1SQRP  e[^]UWVSEEEH@}W4}t D) D)ƅ  Ex 19}5uVSh$, E|BD1H)CNjEahE@ EDžp%pp@tUkl1ɍ9~ډM}}x1:xURjV1RPQdtPERPhrE‹Mq EJu KE! E1k֋^ jQ XZE4fHEu_ƋEJƋE1 t1E虋uƋEEڋ}tG`Wd}G@e[^_]UWVSEt1Pl@hEUE1EU}+GpWtEUG$:EPDUME@`1҉Ɖ׋E@H+EU)׉u}E@1ɋ}9ȋ}7UMEFuE^$EEtphxlppxt@DƉMAHE)׋EEIu E3E>1 t1҉MRPWV\ ‰C0E}Mtp`1 t1s(EAHEpNjEƉ1ƋEURjW1WVQ賹tPC01RPhrkE‹EEp {0E,Ju I! 1kF t2EC 1 t1Ek( ju!EZYv{0t EEBƉ׋EE 1ҊM t19Ɖs)щ‹E[M t1 ))s(댋Eu})׋EEIu E>EI1 t1҉MRPWVg C0EUM t1C(1E܋Etppxtpxx|E@HƉMALE1CCC$C@CECE‹ER t1RPEPEE}8W S E1CCC E}EEDu1 t1ES Et=p`xdrz1BBaB8C1B8BPC41BHC(})8OE@@B 1zBaE>BvB0C1҉PS41p C(})҃0C(E)ЉC,E@rEx<u&@&&E@@]CjSJE܍e[^_]UWVS,}E @u +FEHPE؋AHƋE X01ÉURjV1RPQʵtPE @01RPhr‹EEp E @0E܉F uMMЉF <u v0E@4uPuu# E܋E PEHEXYu܃}tC1ɋ9H~@ Ɖ߉UPSUȋ AAMX뷉OơH&L&Nu"h%h\hXht5C0S4C(S,C 3C(S,PTPTC S$pCE @0膮E @BBEPuϦ CPCP赦^ZuK ‰E1 t1҉É։1 t1Yt)G8W<)G$}u h%jE Xu9utpE MAP9q4uX&\& y(xh&l& `&d&A%AQE@p&t&EY눋EP&W~Z} 1e[^_]UWVS<] E@(E؃} G,u1uȃ{1ɉMȃ{E9C(rC,}t-wSu"XZEtEPt@pEЉUvӋE@HEEԋEYE؋E u1 t1EE}P{}̍OKu؋uЋ}ԉ t1WVR8}̉CPP}M؃1ҀMt)}}9s6H 1B׋}d}9sH 1qBC EsE̋E#u1 t1EE)C(C,}K S$u,C,E Ɖ1u)EЉD1E,C,EƉ1u)EЋUԉD1T11EH&L&EUE@(E؃} G,u_Pt%WVhA_Pt h~)C1Ƅa2=u(YYueao1ɋ0u<1ҍjh2P{ tj2WV2 9u]hh)PƃaZ7+tWuh)  1ɋu׍PPh *VzuPLZ;v.Phh*D aPWhX*1 @Aƃaa9tRPPhd* ƃa67^u 1ɉ]uh*VhV uVh+w  (j2P 2 9~#1ɋ!th* 6mZt1sZ9{~c1ɋt Whc+6VhP* uVWh+  j2PIG2  7Yt uh+1ɋ.th#,s]PPPPhq,V\\\\\]th},[XZ4]@t 8t0Rh,& (p SPx؍e[^_]UWVS]CjP% _Z1uh h,q[^F9~?{jW% ZYu Vh h,:19~DBh݁u Y_uu h h,q z-‰UWWBZt uƄshF-hP0shP-hP R$RW5 DžuƋSS9VhQE u RWh-CPPPPh:_QfGtRWh-G ; ȋC AEV_4V^19s~4( FY' Z1e[^_]USRÍEPjhjjj jSC U tSh.Rj]USКPh.hp&Sh-/hp&sShe/hp&c$Sh/hp&PSh/hp&@Sh/hp&0$Sh/hp&Sh0hp& Sh%0hp&$Sh<0hp&Sh]0hp&Sh0hp&$Sh0hp&Sh0hp&Sh0hp&$Sh0hp&Sh 1hp&tSh.1hp&d$ShO1hp&QShf1hp&ASh}1hp&1$Sh1hp&Sh1hp&jUSRhPY u Shj]]Uuu u @uuh1j]UWVS(`؟ԟh1Rh*rPEܟП119П~7̟hW؟h ̟u ԟ0F`ܟv1ܟȉܟ9}J̟hW؟ ̟u ПԟEܟF`벅u؟h1je[^_]UWVSlj։1EEjhQв t(jh 2S輲 tjhS訲 u Ejh%2S苲 uEjhSp t}~Eh*2EPhrWhC2EPhrW =|&t=2}t2PVhV2 }uE4Vhq2 e[^_]UWVSÉ`hPdzlb1󫋅dhx|h2VhrS`h2#|xh20tplh22u2RPh%3h?3D1҉¸1 RPhm3k0Ph3VXZ24t2Ph3684h3a_X&FP<^ v PhBP j[PYvPhBPN u|3PZvPhBP uB=&thp&hBn`^_1&uhp&hCQ`Y[&YPhChp&q;hhP e[^_]U=&iu='t jh'4h?C\ZujUSh]Ch' 'XZthbCh'O YXthjCh'9 XZthrCh'# YXth{Ch' XZ']UWVSu }1ۃ=%ÍF &s==&tC}u^h&P^XZuWVhCh&!؍e[^_]UWVSl]u }1=%EF &r=&ShCh&K u=&iu =&=%u(WVhCjd]Sr}u WVS VWVv YXt%RU "PSO MUufJ"uWVS"Ã}uPt^XfKEe[^_]US1ۃ=%ËE H &s(u ZtfPfPxtP#X؋]UWVS=&th&hCN]XZjj_Xt^=&th&hC#]Y^ދ[F@H & s &sV_Vl#XZu1;5&&WVYXt{F &ra=&tS PhCh&{uS^S"XZ"S\s s'C$' [uWe[^_]UWVS uE H&EV-Y1ۉ]t7Mp p.[ZuhCaYYE9Euu XZEECt 9t@Eup9tY}uW]W!_X)=&tWDPhDh&zW[[YE3}}1}uhEEuIEtCC;EuEt4G;Et+MMTĈ} t:EH$fK=&SxVøW}uW\W XZWZXuuu VBÃ}uPZ_fK=&t%SVËE\SVPh%Dh&W_}ufCufCECuSVPMTVS/!fK놀{uSPVh2Dhp&EPuu VyfH=&gP_UËEV}ubW[WEPuu V2Ã}uPYYfK=&S UøFSVPhXD}ufOfO=&WTøfCthjDSuWXZ{uG{t hDSWW_XSZS[ZYuuuu ViPY) uSXXs s 'C$'uuu V&Ã=&tSVPhDh&O1]uu VhDhp&2EVPhDhp& VPhEIU e[^_]UWVS=&th&hEW^_1;5&&sxWVY[uۀxtV& s؋X tf{u0=&tSPh8Eh&JS#YSXZ[5't[^ tO{uDf{t hVES|UY_=&tSPh8Eh&SXS!XZ[뭋v$롍e[^_]UWVS=&th&hnEfV^_'1't#{ t{$C$SWSFY[مuȋ'thEST[$XZe[^_]UWVSP&=&Rut6h&hEU#th&hEU^_5&uY[jjQƉס&EXZ&9& &&WVPƉXZ& &9ƉsIWVYXuWVhER S?PhEhp&ufcWV}PƉ׃9u9tRPWVhFhp&ExCRWVGXZu h(FxRYCu h>FSSXZCt SVfcXSPvCfcY[&U9Pu(Ce[^_]UWVS=&th&hVFZTY[f&j_,B jjOEU表&&RPOEU5 &5&TOƉXZuuCOEUuu}OEUE9EEEZE;&E &sff&j+7Bm [E;&E &rj9&uA95& &rA- &S9u&9(& &9ƉsQWVrXYuUhCPXURUPhEhp&-UfbWV2NƉ׃9uM11 WVXYuUhC5PYURUPRAUfbXZ9&t A_WVde[^_]UWVSjjY[t<Ã=&th&hoF)RXZCtSPLfc_X[u=&th&h~FQ[^1;5&&WV!ZYuыXtCtNPP xu StjSjjPPAOfc[룍e[^_]UWVS=&th&hF+QXZ1;5&&sJWVaYXt3fCƒfS{ufCf{t hFSOXZ[Ƀ릍e[^_]UVSuVZuVhFhp& 1Suu YXt 9t@uu hFM {u}t hFSOXZ19e[^]UWVƉjhRPe `'t9xu9pte^_]UPhF!CZY8u"hGhNG5&hqGhp& jUVS@fC$'=~B ')fD'5H'jhh@'Ht %Z1$'5$'CPS@'Pq5 'C$' e[^]USjjj0f+CC]UWVSƉӉ9tR)yShGhp& j%RP6^thF P6n F e[^_]áD't#UPju u Ht %iUWVS =&uu 9uEffthB1ƒ=$'t fjEPW%WYf E{1;] }ߋW ('=$'ut'?t"GGȉffWttG%)Wu9rG9=&th&hG/MXZGt=&th&hGMYXG&O9st+PQhGh& =&th&j XZ?te[^_]USjh %l Y[th - Zu Sm Y11҉P]UWVSX=&th&h H2L^_5&5&5&h)Hhh %?&߃WhXIhp&W &؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃShBhV踷V^NjP ѡ@'a5@'kƃt(@hgbPZYu)5@'CYu*LShzIhp&\ 7ShzIhp&G FhMP:YZu5@'Z1ShIhp& @'Ƅ=FVvhPShIhp&辺:hPSM{1RPSVH @';5@'Bơ@'Xae[^_]UWVSuSM_X؉8/u@1Ҿ1h[PXZۋtm;thlu1WP ѡ@'S袾^5@'Yt@9uVSBP uȋ2lЍe[^_]UVSu@Y1ۉ tÅtƋS ؍e[^]US]3Ke X]]+ UWVST=&th&hIC[^& nVUX=&E}tPuPuSf uSf EZY~/9jPuSjSh#KhQ5&K &&MU)Q tS蟓YPhOQ5& 4Q=8&t8&h&Ph&5&h`Q5&ޠh&hQ5&ɠ$5&hQs+XZ&@ @t hQjDf]UWVS} u=&tWh(Rh&m EE]99ru4=&Q;]uPh?Rh& {CPCPhS*hRћ=&t R3C4,%hMRh&谟t}t?SHK))PDPPCPW2wQuSHK))PDPPCPuwQ<SHK))PDPPCPWvQ @:{NhrRPѧZYt hRP躧ZYtJt%uCDPjWx R?CDPuzZYRCDPjWGy R@{atNt)CDPjWnx R?CDPuyZYRCDPjWx R@t=&t/RhbRh&蕝 =&th&hR5(YX=&th&j rXZe[^_]á8%x=!'ti0UPDI XUWVS @*'}tt=hR]%[15"'5!'t=& 11ɉ1"'5@*'tjv&j=&th&hV[_=@*'u &@1҉&$&'PY&t& PVhrU& hh "'5 &'VB (&'h5 &'uA"'"'@ "'e[^_]UWVSÃ=&FC=TtP=ltIʁlt=Tt1=$'u$=&th&h;VXZ$'ht=$'0ȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRP+Y^Chs,s(+_YC(S,C0ȉC0C4ȉC4C8ȉC8C<ȉCYh&苂 =&A=&tSpXhS40 ZYy*ڒ0 PShOYhp&=puWS1 uS1 uI0=Ehhih jVEPSjJ E Et EPS Y^EPS XZ=&uuuWh)S`=&tShXh&| =&tSnX=&u4hhS, !' yđ0 PShkY=&th`' 'PYuW5!'/ u5!' 0 &Ehhih ~jVEPS5!'(=&u=&tNqEPh`' 'P Sƃ tV:URP '0hYh&evӋE EtEP5!'. XZEP5!'. ^X=&tuuuWhSu5!'6/ ZY5!' , Xe[^_]UVS E(&EEEf&=&t=&Tt hW[hWY=!'uh!' Z0!'EP ËEXE8t185P&hYY^Uv"_E-EF&9ӋU9uu&HtX5P&hYBXZ݃=&u;& EEUPE0i MUUEЉE^XA&& uE&1ۉ&$M u9t5P&hYZY11!'e[^]US|=&th&hYZY=!'tjjh@&' =@*'t 18%@jjh@&') 8%y&]0耻 Ph@&'h3hp&}&&B(&'@*' & &'9~ D@1ۉ(&' =!'t RQZYRQ58%7( 輍0ߺ PhYYt!hhZPh3Zhp&}js &$&'=&tPhSZh&| &TuF (&' "' "'&&.uhp&hjZvhp&hZ?[X=@*'tB=&%Sk8"' "'11 "'=uI)У<"'=&u =&tu&&&&&&&&EPhgbZYy#^0聹 PhZhp&{jyrE荐w<%<%PtPhZhp&{j@r= &t hp&hZR&u,=&t5"'h[Th&A{ hZX=&thp&h[jq&&=('u&]UE Puhp& UVS]u =&u0VS%( ZYy#+0N PVSh?[hp&z=&tVShd[h&nze[^]UVSu&u8jjhVgQy"輊0߷ PVhu[hp&z%=&uVh[h&y ؍e[^]UWVQM1y;5&&s!WVZYt xt@uωeY^_]UWVQM1y9s!WVZYt xt@uωeY^_]US]h]Ch`*'T`*'XZCth[h`*'0 YXC th[h`*'0 XZCth[h`*'h0 YXCth[h`*'Q0 XZCth[h`*':0 YXC@th[h`*'#0 XZa*']UWVSQMS=Zt$1tH &r11Sh[hp&Tx eY[^_]USuh[hp&.xhp&Q&HQPy PoY J t&Hy PoZ J: t&@ t1yt nw1y]UE Puhp& =&u(hD1ʍu1ɉMfEEE'E0VhQ`56'dX @u hbj(E<u 52'hb<u52'h-bhp&(b ~<tP52'h@bhp& b_Pu󥀽_y-`9CShab _h&; j RZ<hib^Xe[^_]UWVSE] h Zu hxbj&1󪍕 19}J jQhWi ujQhb8i u#Fuobu 4jVh/h ÅtIjVhbh u'jVhbh uƅ7fDžjh0uhj P56'ƅp9؍t hbSsY_uu"-hS8 XZthbS% Y_hbS XZhbS  Y_u hbS XZS52'52'52'52'h c\@tAtif@ffh-cS sY_o`f@ffhJcSrXZ(/f@ffhcSrY_m!u hcZEVh^[Sh[X4S׃X9uEe[^_]N e[^_]UVS ] }t3h$V&gZYthѣVgZYu E'j EPVE U:uy 3hcTsh$VfZYthѣVfZYu E-j EPVE U:uyshcj"EPhU56'`S t hcj#e[^]UVS ] }t3h$V3fZYthѣV"fZYu E'j EPV%E U:uy 3hcTsh$VeZYthѣVeZYu E-j EPVE U:uyshcj "EPhU56'mR t hcj "e[^]USUBBPJ R PhdiY uEd]dSh(dFYXZ]UP}E 0蟺EEPhQ56'Qt h.djc!U}tqjhQ 56'Q t h9dj.!U}tGgt[tPQhxgVSNf@PhgVSN1ۉ؍e[^_]UWVS]}hpVjSzPhgO{vThgOY {yj hgOXZ,C@tPhgOYX,C t PhhOXZCȅt Ph&hxOYX{w j N_CȅtPPh9hOO S C h:VhSh-OC t PhfhOXZhpPjSuj NXu'tPh{hNj M W;} } <;u GVhhNYXujhhNXZjhhyN^X>9tR;U }MuRlhhFNZY1ɋlhlPh!NhAlBXXhXe[^_]UWVS] }uhhM^X1C9~D3PhhMFZYj LX}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`uE @u hbjEtU2'<uRh <uRhhp&O #<u jSRPRhhp&OjPFe[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt2uBItu< }[yt ut܊ y_vCm t4\ 0H2N0H2N0HB]9uX[^_]À\um tf\\M t݈@U!Phhp&MjDUh3aUWVSÉ֡$8'P$8'uhh 7'Y_ 8'hGhUhWZIhEW _ZuhGPh[j茋 J<' u.h 7'Phth{ Mhh 7'Phh{L1X9ډ}Dh<'7? $hL <'tWPjh8'?;9}~ڃ<. uP<ؙPhȀKLh@8'` YuRh1jQY[j3^C 1<$1$jWQXZhXZ?e[^_]Ujh@8'2 U=<'u h.輒XjnBUSh.覒h1jPh1jPh1jPh1jP$hhh. xVj"h;P9 h<'=j PS# jhS (h8'O$h8'S S ]U,PhIhp&JjAUWVSы&:֍RD{@u1ҊBuT8t9s &DY@tJB[^_]UVSËHuPs8tIS8kC4`9s `RO 1s0s4s8X{Xu1ɉKXCXtP+ Z1CXe[^]UVSu] EPu36Ex9s)e[^]UWVS`ƉUUP 1ۋE9߃u*E|fE|Shj EPEEEEEPhhj EPmEUfT ȃ&DJu.D=uUR虍P U_Ce} t EPuYuhTFXZe[^_]UWVSS1}11#tAEtSWh̓PSh?P܌ @u hhԃ5W~ }YCu}u#hrEZuhhكjEe[^_]UhރPhPhPhPhPh0PhPhp&,H8j>UUPh?5% H@' t5@'Ph5%GE Pu5%̱@' USÅtN @'t#W0 Ph@?'h3 tŋ]UWVSEEEEujj}WjVP蜁 @u"e[^_]ËEƒUt Phjm P8t ZtjjWPVuN @u ]=@'u5%uh C msM;Ms"VvvPḧ́CE Tj BX]e[^_]-| UWVSEE]EEjj}WjPS觀 @u-u^s YtjjWPuSt @t̓=@'uuh?BXZv<9t's sss ssshڄB ՋE荞 kT؋U9u FE1}h@?'hZYdTEM9Mt?SjhR*[B :1;{s֋TM4Ph4BG ,j CAXue[^_]z e[^_]UWVS}}} }܃=@'É΃=@'tO=@'u:=@'t }u&}u35%Rh A@' 0h&juVN}u!Rh?hA@'Y_~7j v@X@'~#@'~}uڋUe[^_]уtut3]ߋMtu*E r4s6Ph}4]ߋMEtPEPhb sPh+Phx@XZM]ߋMtuuEPh@$M] s SQh%SQhZ@ }uEe[^_]>@E e[^_]L?e[^_]Ã=@'t@'URh@?'4%hUWVS=@'uhDsjL9j=PY^Xd 1Dž\ Dž`hj`Ph@?'\PVS@u!ڋ\==@'j8Dž`1Dž\YdX@DŽdj`R`PPQV?| @u!R08 Ph@?'hiWBuh@?'h:XZ&@' @'uPh@?'h3u> e[^_]UWVSWE}u =@'R˃=@'t>=@'u3{=@'tNu%"u25%Rh >@' .h&jWSu"Rh?=@'XY~7j <^@'~"@'~uى؍e[^_]it1RE rGK=@'tUPhhc=YXUt2=@'uUPh?=XZUB9|SWhS*'= NuEe[^_]=E e[^_]<e[^_]UVS]=@'t EhS}HY^uEEYO1҉jEPS. EUE 9u%Suh =@'j58uO8u̸]1PSEPuVuuy @u1t =@'1@' @'u}u}tPjUEPj UENY^tF@' @'u}u}tjjMUEzjj UEXZe[^]UWVS]=@'t 'EEkN18jjEPEPuuox @uuhЅkjS W u%Suhe =@'xj.4juV舧 |WvM8u|1PSEPxPuuw @u1Ft =@'x|t1p@' @'tpjxUEY^?URV EPVhjduVw8pPUEG$tk@' @'tjj|UE~XZEURt EPthjd]S8jPًUE$e[^_]UWVS(%8@?'t f='/='@?'SV$ ZYuVh='# e[^_]É)@E̍EӉljDPh=' h[h=' uUWVS`Eh='+@ZE1]M;>r2jPRU聗 Utj@uVRP V3h WGjEPjh='RU UuE Eu1}u+E9Eu#/tj@uVRP; V3hj"GQ1EEe[^_]UWVSEUE5@'$ˋ @'@' u'A' @'h@?'h)[^=@'tu*jtHu!u05%uh 77 *h&jSu. Hu"uh? 7XZ=@'~(j 6Y I~I~uڋEe[^_]1v{9}E0Phh6FYXt WhS6XZE e[^_]5e[^_]UVS]EjjEPuVuus @u Be}t Shgjo @' @'tjIY2=@'u Sh?5XZuuuuuh5e[^]UWVS]uEEU E$EA' @'=@'J@' @'t}jjEPjuVr @tdMt]QMe XtMMMjjEPWuVr @tM;Mt Wm _j@?'PY}e[^_]m }tuh@?'h = t)tu*Sh uShbShSh:SXZe[^_]UVS]E jjEPuVuuq @ul} t Shgj EUEU @' @'tj cXP @'u EPR)P5%Sh4&IuRPh3 uRPh3e[^]UVS ]EjjEPuVuuq @u}t Shgj @' @'tjE=@'u5%Sh L3 EU=@'h RPy t P4zXuuh3 e[^]UWVS,EE̋}uu<=A't3EjjEPEPhE܍Pk((U܉UȉMQMb XۋMЋUuwuM1BH(jjURPVWo @uCEԋU܋M؃t (9t$9uދẺE1uhgjG 1C(9~ˋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPh%uhjURF0UUС@' @'t7j(EY(}t GE܃t9]e[^_]j =@'uuh?11XZv$v vvvvv vv6h1,뗍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph|<Dž|tW` XuJHxjjxPVphm @ut9xt Shgj4 l%EpujjڍE_X=A't=19|Wh%ShjURI. jjUE{G ŋ=@' =@'t jQ=@'u Sh?P/Y[|~+t4Wh3/G9|~ hT/Zj 4.Xue[^_]g e[^_]ÍL$qUVSQ$A QEjjMQuVRP*l @u}t Shgj @' @'tjYd=@'u Sh?j.XZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$h.eY[^]aUWVS@]=@'t Dž SzXuhhj" 1hVyR Y^@18jPS> u.@8"uSh9t8uShj 9tҀ8úw܉ hVyji 1PSPVuuGj @u1t =@'1ǡ@' @'tW EZ)AP4<$PUEV-e tV@' @'tj EvX1P3$PًUESd e[^_]UWVStx|h@?'s3l@?'$='U3Yh='h)ȉl)ȉ='u@?'u|uH1ۋx9t担tgbuRPhPPC뿃} t~|P%xwRPh PP|PgbxwRPhPPU Dž|%|%Ã=@'( =@'th='h?i*XZh='h@?'h+Q* EHv hh5<4lh5(*_X}uC|@0|psPh@)Y^P|p4hK) |p@h\)|0 A'XZpt 6hhh A'hhgh A'Vyppu/hWh A'hhph A'揃Vyƀt2hWh A'}hhzh A'iVys2hWh A'Ehhh A'1Vy s2hWh A' hhh A'Vy s2hWh A'hhh A'Vy s2hWh A'hhh A'Vy s2hWh A'ehhh A'QVy s2hWh A'-hhcMh A'Vys2hWh A'hhh A'Vys2hWh A'hhh A'Vys2hWh A'hhh A'qVyt7Vh j V%hWh A';hVh A'+(h A'|p%Phˆ&|@H t Phӈ&_X|p(h݈u&j % }r=@'=A'u }|xXDž1DžtxTpj`SPPWt!c @pu\t|@9uߋ|@(9uΉdQpU ^dtNjp󤋅|@XPwP] Y|XX=A'uTE tN|@XpHv9} |pUE"<=@'uh@?'h?$XZ|@XPvhPkX}|ps E z-UEÃ}tP@uj-d Ph@?'hjs u|xtjh='h@?'|@@uojjPjxt2a @uDA' @'=@'h@?'h|@@EH{$|xtr|@8d uq=@':t.s j|xtjh='h@?'S A' @'=@'h@?'h)"tx\=@'j|@4p\R _+jjPRpx@Pt_ @pt*|p`t7|@4`&RZ ^K;58 nЉX1ɉp`9ptkp`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQTQ ZPtރ NjTCXpsRY X1@'d1ۋ|;X4,F\sA' @'t%xQuujPtC`jjPSxt^ @jjjjPSxt] @UjjDžjjVSxt] @uIp38 u3SP XjjVSxt]] @u jٺ@?'|c^_9SxX [DžjjPSxt\ @tgjjٺ@?'|^uO Yuh@?'h:5%! KjjPSxt\ @u jڸ@?'*SW XZhƀ='lƀ@?'e[^_]UWVSƉLH@'j=P_ZƅTt9sx?u @ƅTGh VY[.t%%8| 8Vs tG=^jhS2) P` F<=t:%M  T=@'u h]s 41Dž81ɉh 1ۉtpƅY1j,T_ZƅtF1ۉH1DžL1<1ۅkj=Vk[ZÉluhV(ZYu09@llhV(ZYu D1j,S ZYDt @DhUmV(ZYHt;OHuUmPTh~, =@'j/10jlPS- ZYuUVSuV$@PVP?!؍e[^]UTO'E]UVSË0>-u F0j PV x;3ue[^]UVS@Ë5O'=X%tjtSvZYuFl6j j5SHFSc$PFShΈPVO'5O'F Phj@]S<Sfe[^]USQtPj=XO'uS ; Z]UVSÉu=XO'u VS7< ZYe[^]UWVS׉΋]Uu E E!UuU&t[^_]USt<0„!1=XO'uS9 Z]UWVSLEӋu>h%VZY)ƒ?EljDUhbbSP0 EUDEj URPEU:*u%jjWSRPEP,tEuj>u E9hbbSV/ e[^_]9`%t3UVSRPjuV9`%e[^]#`O't úO'=B'uO'UWVSƉӊ>uuVB'HtB1TO'hp5B'V. =TO'1҉TO'hp5B'S. 9=TO'~؍e[^_]UWVS,E9PO'B''}]6SPY^y#B'B'B'=LO'u O' LO'SV Z=X=&wAKw2if0[nRf0D=,w$==!f0=Xf0=KwJ=w$==` f0 =%f0 ===f0wf0lf0af0Vf0Kf0@f0 5f0 *f0 f0f0 f0EۣB'EݣB'EܣB'eẼEfE1E O' 5'薲 Sj5' EPO'e[^_]USEPhht@j 1ۅu E]u+h-eaZtPYeB'XČT~B'h(5aYtP)eZyB'B'1ɉ \%=B' B'tB'0h8`ZtPdB'[D~B'h3`YtPdZyB'B'=B' B'P]UPUEN'1J$ (U@UClyUNUFUIۍULэUOǍUR뽍UU!u,UX uN'N'N'1UVSPh}_P_ZYX%h_[u1ɉ XO'PhF'1 [^Ht XO' t XO'AxB'B'B'cB'PB'\O'y1B'B'B'B'B'B'B'B'~1҉}'EB'UYt0Uu|O'UuxO'UrB'U`u[tO'UEulpO'=\~'t8=4B'u/UiXlO'UߣhO'=lO'u1hO'lO'=hO'u hO'U6O't8uB'O'U֝O'=B'tt8uB'O'U&^O't8uB'O'U/O't 8u O'1҉B'EPhhhO'O'GEP5O'5O'hO'O'بY EP5O'5O'hO'O'&NEP5O'5O'hO'O'& U?"UuO'K3t O'U O'tހ8tٍUb4ÅuO'8t&jjP2 PuuVDEÒO'UңÅt =\%uO':t+B'HPjR2 PuuV?DEqYO'U46uqO'UÅuUR…u=B'uÉO';u Z'e[^]ËB'tO'nB'pO'^=dO'tg=X~'t = B'uMU=}'t=~'uB'xO'=~'uB'hO'1҉dO']1dO'á`B't 1=dO'úO'B'O'O'O'USc=X~'t = B'ul=~'u<B'lO'flO'8thO'8t=\O'uB'=~'uB'|O'!=}'tdO'=l~'t9B'~j CX]6]Uuj5O'0 =t~'uO'8t B'Ã=x~'uUjlXËB'O'qO'bUWVSu M1+uAM]-}tue[^_]USÅthpPZYu ǒtEPEPS tt<`Ux˒Ux< ˒Ux ђUxܒ]]ÅtVUVSQ覰Xue[^]t<+u;+uC؍e[^]e[^]U帒pO'O'O'|O'm1`O']UE t  &@t]USuZù¡O'ڡO'ڡO'=}'ttS蘯2XڡO'`O']US=}'t`O'u ]SJX]US]SZ3`O't]]]UuZu Y9Ã=X%tUhXúO'UWVSu}]E Et#jYu7u21ۉ] EjYut$RPyZYtRPjZYuÉE1ɉM E t9Et'hÃu1҉U t EE.vOԺu Y 1EEU҃Ut<9u t0G9Eu߃sڅu}EU e[^_],1E EHe[^_]@O'B@@@ 9uUS]t=h%tjh\XZh%]Ã=@%UWVSO'@@ˁ1 }1119މM}Z O'9t+9xu"9puUpP5@%" UхtjhqFXZ뛍e[^_]Ë O'…t8=O'u/US@t11Ҁu 0@4@[]UWVS$O'$@(@u9t9pu9Hu,@;Ps D15~'%uމuv@E9t(}9~u9NuF9,@<vԋ{9t utt=8~'t @td%x; @~QMh ji( ZYMu 18~'0 @@@xCSP{x B C{WG B POE܉G1GE@Gw x ExO'$@(@ EUF1҉E܉UEUEUEU9EM|!@uWE9@u E9@t`?@]juu@Bu@ujh[^&O'M]艈@@h%Ft*Th%=*u:Vt3st!dt1k1uUE 0e[^]UVS hj1$ h+DhP'o hxP'e hlP'[ h`P'Q P'XP'P'\P'xP'PP'|P'TP'lP'HP'pP'LP'`P'@P'dP'DP'h0D1[<=:tjh:?j FWZPÃ$0%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=O'tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=O'u~ 9sSCM9sICKB~PR_<9r)S{Y"9sC%[tS[Z1Me[^_]U@P'E1uNHP'Ev¸u6&E^u =d~'t%ED]U@P'E#1uNPP'E¸u60&Eu =d~'u%E]UE=O'tE]P']USQ]uhhP'Uw?SSZt'؃@PCYu@Sh(S5P'SZt. S YtS5P'j hP'"yEP'SEPEXZP']UXP'E¸uH%E]UU 1}Du% ]UWVSSEIuRfP^X[RVZY1uEV Xt SY-hR'jEPVPhuV)ZE8} tE 8؍e[^_]UWVSRh|V:hNJ:Sh^PQOucjhfV=Oǃ u.hs:Sh^POu0Sh]V O Sh^PNEW% Ete[^_]UVSh9P9ZYu3h*VZY1t=hQVY[1t(VsZt ؍e[^]te[^]UWVSlht`ƍxPV]Y[{%=eh݁VV) GShV #jhV7  1҉p1ShWP t t u@hWYZhWYZhWpYZt<"u5vptp~HpSPV t!SjEPU)U t1e[^]UEQ'U Q't@]UWVSSuE 8=}'u ^9uO tu QMZYMuGCQ W _Xu s ZYt,jjEu VC EC3FC^ Fe[^_]UU Et1ɉME U]6t E]鋙]áQ't);4&t!UjhR'PQ'@ UWVS]=O'u3Q'=Q'Q'Q'uPQ'Q'ÀuQ'%=ua%=tSSHQ'%uF Q'AQ'Q'9~1!PhQ'ZYu(1Q'K1=Q'4LQ'15Q'=Q't1ۉQ'UU1;L&u PS_/EZYKHA$D}e,+1Q'#1=Q'15Q'Q'tQ'8 1ۉQ'Q'=R'vx u-x Q'=R'w1ɉ Q' Q'5Q'GZq1Q'Q'8\<1Q'I1Q'E1Q':41Q')91=Q'Q'=R'v6x u0Q'=R'x Z߀x IQ'=R'w15Q'1ۉQ'Q'8 uQ'8 oQ'oZQ'Y1ɉ Q'=Q'=h&yQ'-R'h&_h&[} t9s RUVhR' Uuω_1Q'ItVhR'@Q'R'XZQ'8=Q't }Q'tP 15Q'_.=EP[¡Q'u=Q'R'R'u"zQ'tމU&U; u C9re&Ed&E11ɉMR'9t)9s"RUuV Uu ta}t%8EEF9rL< u+9sJu/8ENu9s,Eu뾉9suՉx1F\Q'Q'tP XjQ')@P,Q'Q')RSPpQ'0e&8uCSm<XuSAQ'_WAQ'W? Y[Q'Q't{}t1Q'PhQ'o-1ҋE7_ZQ'E%Q'Q'9Q'sQ'u,15Q'Q'/]1ۉQ'Ku5Q'DY.Q'=R'v d&8Huh(Zu[1Q'vQ'e[^_],e[^_]UVSQM1uuR'EQЀ w[jjjj uuuVtjhʙY[11RjjE0RPuuVuɋE@1҉PU8.uEPjEPc EUeY[^]1Q'9Q'|R'áQ't @@@ Ã=BEZ'R XE=@u$HZ't t7tut g ]UVS=\%u=X~'t = B'ut/LB'PB'u ujjj5TB'RPV pZ'u)=\%u^5l~'O'l~'1ɉ O'-5l~'O'l~'1҉O'u H5zY6Y5l~'O'e[^]U]UWVSt e9ZƉׅu‰['['O'='u0t;5['['}jjjG 1O''ld8e[^_]UWVSQE)ơDZ'uDZ'DZ'ǁt#t1 2ux%DZ'Su5DZ'áDZ'ƒDZ'@Z' t;x- st jk1j1Ztjh蹱ZYtV1VJ)Xe[^_]USVáHZ'$N   tw #58Z'jCP7tW6%I/f5$Z'S5(Z'5,Z'q1,Z'?E48Z'؋]`DZ'DZ'PS5<+u C< uhB'tP[Z;u 1hB'ShB'X58Z'jPCP=t71ۉD9tt KtXEC<tiи e[^]Ujj#UP1҉Z'YYuZ' ыuUS]t CPX]UPKPEEUWVS<DZ'B'@HB'e=HZ't1HZ'18Z'S u݃=\%u yhK5h&jYO =HZ't)SZH Fu]EE1҉UURPvƋEY_tPnXi Fc $j1ɺ97 8Z'191;8Z'^  Sq?@j1ɺ;4Y u lpSrj1ɺ%[Ze4 t u.Sp_eZ'j &% j1ɺț^8Z'19WSXt1E9EsWQMS_ZHMt QXYKEPU8EtWZt WYWEP.XZ}tE)}+} MJx҃u̓@tAu=}' =}'B$}mu;B'}Rj#;kZ'XZ끍e[^]UWVSÉU΅!CEC1ɉ}M98P@uBgtB$@ur5X-(@t Att+e=}' =}'B!5B'V9}Pj#RjZ'XZ믃DuA1x8tLuxgt;AyuȍIty@8u}O@Gdufu die[^_]U塬Z'Z'|Z'rZ']gUM UZ'y1E E՛]7]UM UZ'y1E E] ]UWVStV_u |$WXZtu h[VhWSЋ}tjS; Y^y SZP; X؍e[^_]Uh|ZjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'\B'<%tXB'tRPY^CGjCŚXZutKH݀u=9us8Ft38Ft1 \B'<%t XB'tQPSS迓ÃCFe[^_]UWVS]S^u1jjjS踄Bu@thVS}9 ~ˍ19=O't)RP芨ZYu FSW_XSjW]ƒ =0~'u9P4Yt"SWP;5Pi:vRgZd1e[^_]UWVSu'X=u VZ SX؍e[^_]UWVS}1ۃ=u#jjuuuulƃt*u Ee^_]+e^_]W|$wUWVS4GE̋G EȋGEċ7uu2,=}'u2=O'Pk$]'RPWVcWV4Ɖ׃ - ~'uWVcY[uu}䡔'Eu藊t ub EUcuu3uuEUEU9uE'$ uuP&EU ~ÉEf=~'Et& t uEUĆ t t)E]Xȉslz( 艆E }  Eԃ'g} t}uS*(EƉ׃}s}t$ ]'_E@)1ۉu؉}Z~Nt;} t1҉U诅RPu%à }tA臅E؉U'襅t u`Ɖ1X~' ~'uM9)ډƉ1ۋM} t} u.Ɖ> t t u* uxuuل)ډƉSDL=~'t)} t} u}t裄ƉE„EWu؉}ܹ11Ƀ}t&= ~'tM\RPj =$ Mj}!SQ{&uu+z^=~'tMWVuuRPEU$=P~'t;}t5 u't t@t!e[^_]g_鵃e[^_]g_UWVQM1yHL¸u 1= ]'jjPWVeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|'EEH=}'uk$]'9EE}11軁 ~'uEU)juuRP蹁EURPǃ[^y=P~'tLۂւ t u, u'<ͅ u@)蔂'訅 u B@u2E؉Uuu+ZYZuu*_XE؋U܉EЉUuuY[1uuЋ}EEÃ'Ex u5#Å^IJ  ]'MCEă=~'XmRPSO!Eă J…u = ]'~1҉X~'uȉ}E=~'u  t umU4 Ut u uU Uu uE9ƉM_u}EUI}u}uEę)ԃ=~'t t u}tu}EE9ƉMq1҉uȉ}uȉ}̺1EjuRc"uuvt EЋU=~'t.WVuuRPE؋UEЋUԍeY[^_]aUWVu} ut\WV趀ZYu[t t u݉5H%=L%΂Hw t5P%=T%e^_]UWVSu} ucWVHb xb)ޅ~j2ajjjRPV tEjajjRPM)S= ~'Ee[^_]3rWVEZYt1ۉ] Ee[^_]E\j`EUj`EUEU!YY@tE9ƉEU!ЉE9]}O}t-9uE|#jjjuuEB')HPt%x=u\P-Ux=uOP+Hx=uBP=ÍP^wƅPhjWdΠ5j PWO‹ 9u\Z'Ze[^_]Ëx]';p]'~~p]' ]' t]'‰x]'US\^'X\^']'^'[]É19&t @uUP`iYtB'tB'tB'tB'UWVS$]'UjS@EjS5}tUuuYXtP5]'} ljE5]'5]'D5]'9E]'E]'$]'XZ1e[^_]UWVSÉ։9$]'~]']'< +t[^_]UWVS׉ˋ5]'V]'Љ[^_]M=}'tt*ttt t XÃ=0~'u[USjm5P]'4ZYǒt:t1ɺNC=]'t<t1ɺ*C]UhD讽P]'PYZt P]'hU艽L]'PƽYZt L]'fjh=U]'jh,U]'$]'h]'h]'ނh]'Ԃh]'ʂ h]'轂1]'ZU1}]á]']'U]'1\^'1]'9]'~"]']']'1ɉ ]'@1x]'t]'p]']'l]'h]'<]'d]'`]'H]']']']']']'h]'(h]'h]'h]' h]'1҉]'UWV=<~'uu uƉXZ11~' }'u=<~'u u$ZYt]'@=~'tʺ@b P%T%~'ut79MM |-M9 H%L%U |]'@x@]'c B}'9\^'H1Ҹ WVY^1 tj uVRP;FVeƃ1}')9~1Ҹ G19tD=G1Ҹ \^'x]'e^_]á~'t}'=<~'u }'DUS]'9]'~$]'<u]'Ph]'€XZCԡ]']'\^'x]']UWVS]u }Eu@0tjxYEe[^_]d=O'tW~Z=O'tw/P'x_uSQ~[ۃ]'~K1S|YuSWV~_ZV]'t2dZYu]']'DV c_tW]'uVb^ƒt B'V]'tcZYt tB'tB'tB'Ӊ؍e[^_]UWVSEUMЃth]'} u)}u#=]'MH]'}tuEPjEU RPu ugu=}'t[]'tR E['['ut;UE }EU ['['H]'u=H]'tr1ۉH]'1D=H]'uf=H]'uJ8u u1ɺZYG9{Ft]'1k à]'ك}u E1O]' ]' E1~RjEPy ]'1҅~ ]'TRPuu&Ã=0~'u}u9EEEE55x]'+5]'Ee;5B''EPv_ ]'9]'uY=]'u=]'uEU ]']'1=]'~+9=]'~]'81ɺGh]'w|Ym19}E81ɋUG ]'9]'|1}uEPh]'|XZ]'9]'~Չ19]'~=]'   ]'<<@B)5]']']'9 ]'}1ɋ}' JKݸe[^_]UWVSƉP_[=0~'t<x]'+]';B'~u u1ɉZYuFu1e[^_]UWV։PsWV ~ e^_]UWVSƉ198]'~ @]'t 8]')C1[^_]UWVu} =0~'uWV1ZY ie^_]á]',]'x]'(]'á,]']'(]'x]'UU1wR5P]'.+ZYUS]1w%SZ1uS5L]'*ZY]UU1uj jL1҉PPYZUSE] xt+uxxt \tf1҃‰PTx6 ) 9tu!ـuJ!) u'@S$Yu SZt놸]UVS] uVjSu 93sPuCZYHte[^]UWVS ÉUu} l]'E졘]'=0~'uuS]'Zt ]'1l]']'dSPEZYtJHWVM^_]'xt ]'Sh]' yWVMZY5]'豍1]'Sh]'xh]'k]' ]'Pdyh]'x]'@}]'2]' ]'9]'}%h]'xX]']'= ]'9=]'| ]']'؉ESjEP8tU$ t9r)ډh]'w5]'1=]'[^0}'t d~'u"uu} U]' p]'~@9]'| ]'|t ]'D0tu u. u#uWV11ҸJt1Jutq]'ЉERj]S*sƃ ]'E9s=)У]'RjSsNj]']'?4WtVL)x]'~뫣l]'m}]']'=O'ul]'PapY]' ]' M9u3_u(t M:h]'t E)M Ma_uM]'UK_uFM@t>SrZt h]'E)]']'PoSPYtE u1l]' }'t =d~'uuu} U x]'+\^'4& ['~9|0&)ș); ['}s$[')WVgU ZYu K=O'tw.PmYtu} U؍e[^_]=O't+=0~'t"SqZtSarWV WVMUmZYe[^_]鈉UWVS]u }`]'t4 u ti5\]'5X]'1ZYt 1`]' }'t =d~'uVuR=<]'`]' 5X]'=\]'10]'4]'_@8]'1ۉ<]'i뷃=O'tH=<]' 8]'@]' (=O't<]'un8]'@]'ÀuWV1҉ZY%=u+%=tSl<]'50]'=4]'_1%ul 8]'A8]'@]'9Ph@]''l[^50]'=4]'th@]'lWV@]'. 08]'1ɉ <]'<0]'4]'P8]'1҉<]'8]'=O'uufe[^_]Ã=<]'~U0]'4]'1҉<]']1UWVSQu} EE`]'tt t5\]'5X]'1^XZ]'tl=}'tcB';x]'p]'x]'t]']'Q}'B'D;x]'~ }'=}'uB';x]'~1N=]'tx]'@B'9}Թ Qۃ=B'tt =B'u =0~'u 11Ҹ *=B't&}t 1Ҹ 1Ҹ11ҡ]'e[^_]UVS]]' ]'ށ9]'~tu ډ@[^]UE]'E ^']USEM =d]'t)=~'tu ~JH1҉ ;\^'9~^']']')Ћ]']'[]d]'1]'UWVSQSMQyq uu RPG\ZYuh[ƒt1ۃ tt 't[8$]'H9UUt Z]'[C뮋 ]'t ]'teY[^_]UWVSQMQyq 19| RP[ZYu$]'X]'D]E t$'u}tjU$]'Et ,ZL]'UL$]'T1;]'r H$]'E)K]'Uz11҅t ]'ىt $]'eY[^_]UWVS} ]E1ҋE}~[9sWUSjMQjPhUt!SMQPEEP΂E1jRjVE)E뜉+E)Ѝe[^_]UVS ]'1 ]'SutFjjP t ]'@11ҡ]': ]'e[^]UWVS5B'B'j:Y119=B'~ !AtRP x]'9}G؉5B'19|)e[^_]UVSu E!y=VPY@ w>uV&S_XZ1jjVM u뾍e[^]UE1҅x &]=w't&w'tUSJZ P+JZ HX[]Ã=p^'y-U=<~'u Z'1<~'jhA5ZYáp^'xW@dp^'UWV1ɉ p^'5h^'=l^',9Ɖ}jh5p^'XZe^_]ø^' @=@w'u1@w'w'^'t^'`w'w'w'w'w'1҉w'w'w'w'w'1ɉ w'UWVS EE} MEEw'w't"C 9Ku}9{u E9C֋sw't^'t w' 1t^'ЉpHMH MHxC;4-=t^'u`w'PHE8}w't'Xp9ډ} EӉEEډÈ}tEt^'t^'@B [^_]ÍL$qUWVSQQEU=<~'t E]!@u 111]9؋]ع5w'w'tF U9V}}6E9F uE9Fu N^*h^'l^'1=p^'w'~t-uF"Hh(V(h( TEj舦C'j9jWj Ejx by u Xh#Xu>h:tu R5_UVXtˋURUGÉ<$GL$QMt5蔻WPURhMQS> Wx_urVZ5YS Sxj u u jVj8}t&u'h'X,j &u& VCZ'u蜬X1҉Ue[^_]UUWVS]EEEEuu OZYt jhhESh YXujhߤ,XZFh&S&h&A%j 8jUjj F}u}u)NÃtNN@u,E UM;M MM|E UƉ @tt t MÃuV< jj ]Fj`Ujs7BZ'jTe[^_]UWVSu6EU_}u }tcjT/Ɖ[u u11j:/Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw kw'GPw'kw'1|''t'|'#tUEEPh**YX1ÉUS.w$tX|''^\B'w'1w'w'w'w'tPuX1w'w'mNt jhgB'K \B' w'w'w'w'jhw'{/\B'w'w'Y[뉉txux ujh 5)XZ1]UVSw'1۰#4t'5t C'Ca1ɉNF FFFtPtZ1FC6ue[^]UE]UVS E%tYu EP.UEY^u uT@2M5\B'sS CKCtPtZ1Cw'e[^]UEt*xu x u]?@ @w']U Pu]jEP-UEYYut@ \B' |'|'|'E|'|'tPpsZ1|'w'UWVSPEf=|'uJ=|'uA=|'u8\B'|'1|'|'$~'|'|'tPr_15|'{u#jPs蓾Csr1ɉKs {SC;\B'u RWV UP號ZUte[^_]UQMt\B'9Ptjh&XZP@ UVS]u \B'1k9w'u$9w'u9w'uPa~#4t P'@5u1҉[^]UU19w'uǀw'ǀw'=u]UWVSu薾[1w't:PPVD uEw'w'q1҉w'YSqXue[^_]Ã=}'UWVSu h9uD;w' C Suu|'ue[^_]j }WRP` su sʽXh*VCZYtVWsPh/u:UWVSEPU8mEP8 UtYÅE8 u@Ej URP!ƃ xuu=B'E8 u@Ej URP Ѓ xCU: uBU1҉SK C9~CCtP pY1Cu,CZe[^_]USE] =tS_,,B'XLt1ۉ] E`u=@%x1ɉM Et^S*á,B'ZtP_oXS茫P軦,B'SEo5,B'K]s@=@%y1ɉM E]J#,B'EEPh4#XZ]0B'#&x$Ujh@BRPB'RP$~'USEtzE 8.MU u4@E QhMRY#& }t jh}QhMRC }t jhk$~'#&a#&y$~'EEPhӥ>Phj ]S3S<~P|0uD]EPh"XZ]á#&x$Ujh@BRPB'RPh~'USEtzE 8.MU u4@E QhQ-R<#& }t jh"}QhQ-R& }t jh:k~'#&a#&y~'EEPhP>Phj ]S2S;~P|0uD]EPhl XZ]US] }u!jSŽYZt]EPh XZ]US] }u!jS^YZt]EPh XZ]UWVSUE t tP(|'^w=}'E}'*}'*tRGYEEPh^XZ]UEtHw1E Ev]8B']U}u=}'u]g.]Q.]UEu=}' M}']UEu*=}'~!EEPh }'XZUEu*=}'~!EEPh}'XZUEu#=}'t=\B'to5Bu @u]]UUE t#u?#&^u2@t+#&!#&PJFEEPh@ US E1ɉ }' }'E 8,t)EPh\E P }t jh3}'E 8,uf@E EPh\E P{ }tjhXZ7}'05}'5}'h j]S=(]܍EPh/u]UVSE] J1 RD+~vQQ r/d~Q wG$) t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPhL1CSPh}'Y}'E sEEE sF@tK@sN@ sR@sW@tY @AuU9uE-EUEPhgXZe[^]ø= ~'u=}' 1=}'á(~' B'+}'UWVS }8uMEPhzY[1bÉUP(/$@PƋUXZt=}'t <\u {t C<$ut PWpZYtFFC؍e[^_]U@uPhj*h }'%PRhj*h }'% }'UuBPhh`}'z`}'UU1t 1BS]UU(4t B tB]U}ou<¸`u1]1=}'U}'.EEPhzKZYUWVSu ]E0`_18-u@JЀ v#tuKuEPh&j uP yu˅tӉuEPhY[뾅t1҉t؍e[^_]UWVSM}'tFPtu)QjP_XD}'ZjPEP 15}'1ۉ]1U:BE<-t><$<~,Ht<+tO<9 ~1EM؉Uu7u*à U܋M~ZEE܃߃A<vG}-tA9u}t%9~-7=%Z9Eىu1ۉ] 1ۉ]EFt}u Er]$I}t}t E1EEȋu} t tE Ee[^_]UhMzYtPz~Z~#&øU =~'u[h~'j~ ZtL1~'EEEEjEPj M9 't'_k~'';EMMEEE=~'t=`^'t=}'u#&=~'tuPjEP EufE=O'u);>#&9u '&P\Xʃ=}'t ƒftըu1ɉ ~'uu uV 1҉~'=O'u&u~'@~'~Fj.Y<1҉~'y!.8m.8#_M9 'tu1 ~'Ujh~'| UQEPٛEUUWVS7.0Z[uu"É4$k"|$WVuh"WPf؍e[^_]US]S)[ZuSh]h~'. ~']ÍL$qUWVSQ Yq AQEU}WRPq1菻 ˉE؉UM܋EuƉeWuuRPT u؋}׋EUE؉U܋E!E1҉UԋMЋ]M]E1E9M؋Er1EEEUeY[^_]aUuujjdu uUQMAQ jhi@BЙRPq1U EEUiEi@BEjEP- XZUS#&'t,#&'Sh'5#& 9t Z']UE#&]Ã=~'t 1~'s U=#&'r|#&P#&M1~'E]UVSP't Z'E1~'EPSXZt'u> E~'Xu{ VoYCe[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uu}MQuuRP薼 K}Њg u؃}yC-^Su'.XZeY[^_]aTUVS]1)EM}IguyA-NQu -XZe[^]ÍL$qUWVSQ 1AEI1EEEM؉E܊PЀ wPwW PwO79ʉMЉU}?jjuuuu}W/;jjEԙRPuuW9 ]F8M덃}tE0ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPwW PwO7;UU}AjjuuMSQuVs:jjERPERPV69 E8늃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPwW PwM7;UU}?jjuuM1SQuV9jjERPE1RPV8 E8댃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%~'e[^_]US5à Hw ot tSRX]UWVSu} ~'ouWV"XZE e[^_]$=}'u`~hB'WVh#&nB'\B1s9B' Z'e[^_]@UEU E Ex]UVS]u .uu ]e[^]#&P-ZE E؍e[^]KUS]tu uR4=YZtg=B' Z'j ZQuj>X؋]UWVS]uE %=@~'t >t:S$PKfPjjjjSPwf$9twVIXnjjb1=@'1҃=4B' PSWpÃtWI_}t-jh[^tP= 6oIZY>1؍e[^_]US]tP  3>IZY1]U1}]UWVS|}ue( u [E E@~'x9s^U xu Yw 8u 9Ut 9t'B@9Uuu>}1҉W1ɉNG랋E10E18](11}$1ۉ]]uuPEPjWufƒ1ۅtEUE}yȍI|5xj9E E HMM9|_y1UE1ɉ e(s )؉ùE(tE}|9|u1Au߉؍e[^_]Åu1뎋M1yyuu$E<:N<%<.uFu RPY[ +!@ *u5\B'蜋_vG9^.1u؍U؉ƋU؍C<6$*  ,'1Jk ]'RY19}' B'{9)ISQRP迯 [u  u11ERP[_19r B'+ }'ISQRPb 1(B'N5\B'5\B'P5\B'PDwS/? x(t u(5\B'pRY EӃMЉ]1۹}9}RP薿Y_9nRPZXZH'u70EЉUsӋEЋ}!@ȉ9څSQZREЉUXE E)ӃMȉ]1۹}9}RPϾY_9RPuu@'u j ]SRPlWIx u ȁ@'wt,'1&t E;5\B'KZtP X@=,'@'@'e[^_]U5#&USh~'=}'t¡#&u 'PE1҉dB']U5#&*UWVSSË@ 1uuC1uEl@tg}tC E;P p$}p tJ;V ~$}@}tՋpt%lj;Pp|;P p$| putC C 1Z[^_]UVSË Bpt9QuAACPrt[^]UVSË Bpt9QuAACPrt[^]USË@tP;Y1CS5Z]UWVSNjXt 39s|=jjj,VC 31CCGtX_CPSk,C e[^_]UWVSÉυu/1ɉH @~'@'13CP:1ɉK^։UR Z9Us&RUjEP!P;Utܺ1҉S @~'t @'SuWV>ƒx6Ct Pa:1CZV( @$jCVPS{1e[^_]UWVSE֋xtBE3ExMAA ;NF |"Gt=NjEFOW9M}ԋE9G(u։NV ΋O W$9M|-G뿋EFOMOMW(]9]]|~E9G(uˉV;NV |9Uu=NV 9Uu9MuuwG\_ t;C$uE;C u K S$=EÉGxG tC X_ h9UuC;G$uM;O uFV G W$WtNZ9^ u;JuurBE(ÉGx GtCX _;C{u 1szp9uHtyt1ۉZY@9Zu9u E[;Zu;Pu E2[1҉PB;XEu [^_] [^_][^_]M'uU5D'Z1=H'UWVSE؉U܋uE)ȋ} )ϋ M]܉M]UUX9QDP9u9u>EU܃EU9EE} Ul'9}EU܉EUC뫃[^_]UWVSEUM}EȉE΋E?UtW tP9sFu h@ RPMEUu  @P4E4MEU Cuu h@ 7PMEU9r9ut6F5L'jjWuE)PV5H'5D'$'e[^_]1D'H'L'T'UVS=Z't 5'}uuf'1ۃ=B'uDSgYuu CB'H9RPSjY wyr5'e[^]UWVSP%ET%E@u }H%EܡL%EH%L%P%T%=B'u e[^_]=Z't11B'H9~qWEUwZ}u}tQVkUXE9E܋E؋U|59MEU|!Au#uuoWZI `x t e[^_]Pe[^_]UWVS]3t~v 94V34ZY1CCC ''''e[^_]Uhl'XUS]D'#t-=l'ujhžXZ]1=''E]Uh\''XUVSu] t1ٸ\'t;pX[^]UWVSEUE|E xB'p$lB'h5$~'uX'tXsmS+Zjj1CCCj y]e[^_]*X'CX'Z'e[^_]U€u1=X'1]UWVS4''EU血''E܉UtE؋M܋]MjEPjujuuu $''u}u܉}Mut}9Nju|M܉]E܋URP ZY''9E}|!@uc1}9}}Uuu[^tDjjuuƉ׃t$EUEUu}M܋]Eu׋EU裈''E܋Uࣀ'',jjuuEU}u}tu܋}뙍e[^_]U jEPXZ}u}t j)jRPuujgUj1'=}'u]]USj5L&#ZYt8jٸD'Xx =}'u='uS1]U=P'u @~'@'D'L']xUWVSU EEt :CM@tE3L' s+jhEu jhž=}'=~'=}'1ɉ 'MMM1ƉӃu]5$~'+PXZe n=}'=~'jh_XE:jx^@='@1ۉ'.1EPMD'Zx}' ~' j1'#X=}'t =~'TƉp~'u}tpB'xu }@u}uQB'HEP5$~'X}tW&jjRP艞ƉӃ*W ƉX}CjYj111 ƉXF=G;=B'}W؃&MxuƉYjZGMEPjEPjuujjE Mt=}'t =~'tZ}~TJEu2EUutjEU9u9t5$~'RPy =}'t =~'tjFXEe[^_]Uhj 'XZ=~'t.UhjX 'XZ=~'tUE]Uhj 'jjm=~'tU}tOhjYX=AZYq- STYuZlj4$$L9QZVh$Ph9tVXh݁W\ W f;?SDYSCjjщ‰#&#&P#&' VhP th='t&tV^ XGP_t u Ƅ@t Vg [ u& u&DH@ZutfTP@tCu* fLHt@u C@tC fLHuDPttDP@yulDP@tG UDH@cBV] Zt1'''%#&#&t''1e[^_]US#&h/S|ZYuwh5SdZY¸t_h<SLZY¸tGhBS4ZY¸t/h*SZY¸tjS7 ZYxP X1]UZu E ‹E2ttHu jhHjhUjhnXZÍL$qUWVSQ 'p x tWV虛ƉY[jj1EUXZ'uBEPEPWVNE؉U܃E EtEU}u}ujh=Y[=<~'tuuuu誗=0~'tEUju4P4ESj:jEPuuS"4(eEuySsXZEЅu u؋}eY[^_]aUWVS' ']11~1t2#&t AFKމt ' '[^_]UWVS' ']11~1tr#&t IFK݉t ' '[^_]á'á'Ë'tUrIZøUjCD ZujhQ蘋 ZYyjP胋 ZYxU']øURSjEP5'hU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tPrZ1CC]UE1҉P]USUBt XZL[]UE]ÍL$qUWVSQʋEqyIZJ ZrʉWVEZYeY[^_]aUWVS]E EC9C|WtjjWVRPCPltjs3ZYtKljE3eXECHKM e[^_]US1;]}E Pu[CXZ]UEU 1ɉHr2P UWVSS] EEMȋEeƉϋE EtuuWV M9u"9uu uEZYe[^_]Ujujh'< UE='t&uf=|(&tE]'@]]UVSP'1=0'ud'1(hAjJXZhAj<Y[h'; ^tTjj"XZjjY[h!^'u '15|(&='t j[P ֋5T'$&t,PVlZYu'8@1ۉ'Z8,t@8u݋8tH5X'R'PZY'@8tSAXh݁5D'^Xuc5D'h?Y[S3$S5d'I& BP5'&P(^ZtbShV NhҳP#^Zu @׀8 uS[YοhkP#ZYt @׀8 uSXh8t%8,t8 t@Ћ8tH5X'R'PY^'t SZ@'P 6Pe[^]UD'jjXZUhj8'XZU!@'jh '8 &Q &y ;0&| t&J &Uh&PXZUWVSREƈEj}W5d'$ f=(&tk18'5(& jW5d'ԃ j =8't.V]"Ph Ktjh'5d'# 럍e[^_]USQhjjjj| }Åt4EP)8 Z9u< hjjjj]jjtjjk(&j/Sʸ څtPjRS hp&h=bhj} hp&h=bh)jb USQjh(5|'蘁 f=\(&t#<(&;tSZ$S5t'k jh5t'V jEP5h'E }nu5<(&h4xXZ]USPjP]ShF; t=<'u)(&S Zy ShL.ZYh5X]US]j5X'< SP t Sh`XZhejVUS(&t$;tSS$S5d'd j_ jUS(&j/S ZYPujuhRSC ]UWVSUu 1Ɋt< uB< tЊt* xt t9tA8uˉ[^_]9tAW|$wUWVS$}EԋO_,$&uVRPSQw M؉M 0$&VSQRPw Ɖ׋]؉]4$&RPWVy ƉEuhXZTu&tO t'Ee[^_]g_b1HssP4 $&Rhn)OuUWVS]S$S5d' 1ۉ@'jh-5|'~ jhx'5h'p ƅ jP5d'W jP5d'; =0'!Ѓ uh'jj h '.3 $3jSXZjRY1=@'u=jP5d'~ =0'҃J"=@'u)uRyY_uՊ< ttJ< uf=|(&tFVhwxXZ)9='&:WPu } 9th{T_@'VPu | 9t h{^f=|(&t$jP+$Ph h 'jjA jhx'5t'l| SjXZu w~ Ye[^_]UVS hVhZ Pf [thSwÅyhTYhVh t&} } j S4} } h3j 5|'&Vjj  PO1 Z~<9u6jC h} jo Vhje[^]UWVS]ujh-5|'{ 1D'hjREh'jj jhx'5h'{ t@t PFXd'f=(&tjURP{ Ph jY _XjNEU^111ɉMKy!SPEZ=D'MuCPE=D')uf= )&tm[ƃT )& ufuE 6 u, fu'f=l(&tj ^EEu ft EPY} tf= )&0f=|(&tGWhwXZf=(&18'5(&耠 XjEP5d'Qz =8'=D't jN X,=0'#E (&9uj% X< tf= )&uj Y} u*jLƉSsuj,f=|(&u>E tPE Z+u}f= )&t WVhWVh jhx'5t'jx h 'jj e[^_]hX UWVSEhVhF 'jh-5|'w jjVjjMh'jj (jhx'5h'x sà yhX11ft#jKƉXPr- Y~G9uAj5d'f j蝝 jjjjV Vh.j f=|(&tjQK)RPh@ejhx'5t' w h 'jj辿 jjX jjLXZe[^_]UWVSE[hVh 4jh-5|'v jjjjh'jj7 (jhx'5h'bw qà yhX11st#jZJƉXP , Y~T9uNj5d' j5d' j+ jjWjjN$VVh.#jf=|(&tjI)RPh@jhx'5t'u h 'jjL jj jjXZe[^_]US,]S5d'跭huZ 'u M e 'Sj5d'ս h 'jjǽ ]US,]S5d'IhuEu %ESj5d'u ]UShShJ S'E'&[tE'&jh5|'Xt U(&tU(&5(&t5(&5(&t5(&f=\(&t_(&t$(&f=(&thhuY%)&t%)&,)&'5)&t5)&jZE)&t$E)&f=L)&thhX]Ujh{t 5d'djR jhzt 5d'KUS]Q1uqjPt XZ]US]CStu RZYt1]UVSEhYPZYtP ^yhoF[PhdhP} ƅul(&uQwt $kt Xw ZSt $Gt 1ɉ $PhSS- ju*h'EX t Xs X1s $h 'r à s XP{' Y9u tthp&hl6RXZ댅yhW9QExuPh{uPhhp&4 Cƃ ''8 u = 'vH@ 'e[^]USErjPh'h uxh'hhPq \'yh'hZY?hSh t h'y X5|'&5\'S ]UVSjPh'h] h`'h'PY[vEe[^]Y Hu `'d'5d'hhPq Ãy5d'hXZ+5`'hhVhSVe[^]UEjPh'h uXh'gh݁P uh'hXZ)j5'&P f=(&ud'E{ UVSjPh'h h`'h'PY[vEe[^] `'Hud'Rh݁Pà uVhXZ@d'f=(&tPh3Ph;hVIVhgS e[^]Uhp&hNjUWVS}<1ۉX'l'8'%1u~11Ejh %&hu u蠘 ='uhp&hhNjbt&`'FtrE96/ kU DЉE8'뉃a$- nEtPt=91WYvh^Z?9591jh 2VP jh%2V8 hcV^ZƅhjB 91hzSZYkhb5SZYLhcSY[Åh뫡91X'91P'Em=l't hs91j/RU蓓YZUt l'5Rhhl'' EPjhjjjj591A8'U P591hRg! 'tehtM,'0''='1vldZR&E)t8HuR}t h=KE h.RUYZUtP'",'0''h%jh%jh%jh%j 58'hbj h'yh'u hg@u hvjh&+ EXZtKthz hb5hc Xt 1N11҃='1(&L)&='&1ۉ|(&='t ,)&=,'t58'' Yu.t hj=,'u"58' Zt58'hj e[^_]U'jh' U4hJjEXZu2EZt1'=,'u!ujYX='h'+ Zu(j ='$uj ZYd'j Yd'yuh<XZ'Y='LjP芁 XYd'tPj Yd'!URP轠XZ='uM@EPj5d' jh t 5d'% jj|YX1}UWVSS]='uhYu hj\ hZt8/t PXx&&|&&Sht&&EPTƃ 1=l't6l'X'<','10'=8'u'8'%;/u%l'jSY_t4't t u!hShXZ h_j贳&&9u QRPF &&Euڃ=8'u h8'hzPM @u 8'%h4'hu+ @u 4'=0'y150'=l'u\)j:hIu= 1҅‰0'l'uShL"t%=X'uX'=P'u Shdj苁 j:h}u '=,'u3X't0'tR5l'ZY,'<'j:hʝu肾 t (&j:hQub t (&j:huB t L'&j:h3u" t1L'&j:hVu t \(&j:h}u t l(&j:h?"uŽ t |(&j:hu襽 t1|(&j:hau舽 t (&j:hVuh t1(&j:huK t  )&j:h}u+ t )&j:hu  t'j:h,Cu t L)&='u 'h&&=$'u $'`&&('t Ph2|^_ 't Ph)fY['t Ph1PXZ't Ph:_Xh'hu @u15'h 'h&u @u1ۉ 'h'h}u @u ' l''''tj,S\ZYt@l''؍e[^_]US bPhhp&辸Shhp&许jeU=t'tht'htj~ j$U Đ&yh&OZuj&P&=0'҃ !Ujj肽<'hqj jh'o Uh 'jj讪 Uh'jj蘪 U E E1ɉ <'hjEXZjjEYXuhڴXZh' YtnE suj˼YXuj迼XZ=<'uXE M9Hh&"ZtU < tU EE9sE @E Đ&xˡ&P&UE Mtt @8u1]UWVSu`'`'FVtI)~@t8u\Q ^@P u f^?봈@`'[^_]UEP^vP'^?<tP@Q'R' P'Q'P']UVSEPhVXZ@$&;t[Ct =T'uG'&PPh#sC <Ƀ*PZVQPh 렍e[^]UVS,u]S5d'VSl VSl EԀ€Uԃ='t̃Ef=L)&tMẼeewfEf=(&t %‰USj5d'§ e[^]UVSuU ]=0'tSRV^ y@19t `' @G8u hEe[^]2e[^]UVSP'&EÉT'@$&t68u-Fu#EPPh蓱SV1%tك 8]tjEP5d' Íe[^]UVS<)&t8u#L'tP[u[L'<)&Y<)&hcSּ^Zu0'10'hb5S诼ZY…t[hS蜼Y^tVhlS苼^ZtNhzSzZYtShhp&`hp&1Ҿ11Ҿ 1Ɋ%&1 !`'Aue[^]Uf=\(&t'tP}Xj蟩Ujhx'5l'\ jhx'5p'] UWVSjW5p'] ފ< uf=\(&u"0U)څ~CCjW5p'J] ǡ'tP֨_9u1ۉ\(&ƅy0h V芲'ZYu ƅnƅy\(&jP5l'[ e[^_]1f=L'&L'&UWVSjj jjhjhjx'fDžd'fDž 1ۉjjPe\ ~Ft=jhx'5x'#\ ~$x'!S 9X<uY8C L{ t VW ZYtAEPuWYVVC Zu h1 Xc9s ts tC Ke[^_]UVSá'H!vd3VtY''Swt^' &H &x&&P& 'P'"~;0&}h&j ߰XZf{ u<@' &H &y;0&|&P&!h&j!蚰^X3hY[{Vh'C ^ZtaP;'s Vh̪>Vh迪'C Y[t'PP3'$h茪 ='"~1'hq Ze[^]UWVSQu E]K:EE<\t<^up{tfKG^KCxЉwŠSzЉw>t18uG(NJKyЉvK KNjUBbM8t1ۉZ[^_]UWVSS]hѣSP^_ug@'&; CteE0ƅUB@tE[^1='h`' Ztuj^_1j5l'&y $EP5d'S jy []]1uMY9sE:0u}FEtjj譭XZEe[^_]UhN|'jh`' UQjhxt 5d'j;1 jhyt 5d'j5d'^^ $j1 j5d':^ jhk5d'Q q<3t<0thtդhˤXZj0 EPhf@5d'bjh5d'PQ j0 j5d'] jhxt 5d''5d'UQM*Y9MU~ /QRh hp&.ÃThp&j +XZe[^_]U tu@ku hMu hm󥍵ѶxԶx9t PRh`3u hjr[ Vh:iP豋 1@uCPh{XZWA e[^_]UWSÍ1Dž7h萒h耒hph` hMh8=hV-hv h jXX uɋDH<1DžDž?ڋD1DžL`jDVd\hKRh&k Vh:iH @u)Kt&j.@h&kj N1҉ @8t.Y1C9}Ë8PhhGXZދQhtXZ뛍e[^_]UWVSfΐ&fuD'Th*Rtw[_~tuΐ&fp=d'tTjjRo6 à xTxPSYmZY@u S.7 X9E%=tIS7 6h` !jjR6 à y6h^XH'mD'y hT=&&f=@'u8=L'tL'=@'uL'@'@'5L'5@'S65 ƒ 1Rpȉt@'PW 4 ymh)jO xPW+lZYjE=\L'RRtA@'YtaRhw蔝XZ2tp)Z4t5D'h`H'ZYΐ&ft9tSg5 X>e[^_]Ë &Q &y ;0&|< t&J &Uh&PËZYU.2PPhhp&j'W|$wUWSˉ1҉'M]m hh}fU fUm]mURp pSQh-&0hhp&h$e[_]g_UWVS]E }܍p(}p4EPSt Y^tShXZe[^_]UWVSPu} FM% FVFt5RPW6 à tFI1ۃ8t/h-&h[XRPh-&5 à tŁftvW6 ZYt#/vh-&5 ZYu}u2}u$h-&hY[}te='u\VlU蕗1҉UtRW26 ZY@uTy8-tRh-&6 ZY@u"~lth-&h[XuVh-&VZYt؍e[^_]UWVS'dt2h-&zh-&Epz4 d h-&!jjEps1 ` @Euph _X-xP='t ' 't 5't2} F='u:xPh-&[^@} 1ۃ='h-&hhp&蓅Đ&HĐ& yh&[}Y&P&0 t+@t( Đ&y h&)}Z&P&Ѓ߃Yt`01 _(,h-&hB!`1 DždWxPh-&[^@t1E%=tEjhGPhh-&/ à uA 5'uh-&hkh-&gGPhh-&/ ÃtNjOGXW\X\t;X\E@hDžl-&X\ptX \TX9и\T<0XPjj`jjPj?0TjwXPRH X1ɉX\vRLP)TPS, L9th-&hXZDžd:)։1X\='tX\hoPTyY^EpheXZ='Džd1X\t~hh'`*- ƃ ~KVh'S, 9th-&뎉X\='tX\htP`- XX='u`- XM='t#S`OD Y^th-&hvXZ`- ^du S- [z'dtSWLZYd='um} tgG t^'9GuTxPSHcY^th-&hXZDžd$E9Gu'#G%PS/ Y^uS, Zth-&h[^Džd='tWh-&9ZYde[^_]UVS]hVs-+ u sh9'Ƅ} t'h-&3Zth-&hF[^.h-&V, ZYtVhQ١'t jsPZYe[^]US]} th-&Zt h-&hFsh-&|- ZYth-&h]}ZY't1E ]]i]US]} th-&XZt h-&hF$s$s sh-&TV th-&hhZY't1E ]]]U%(PPhrhp&~juU(PPhhp&~jpuUWVS|Ӊ΃=(u\=(tR|Y_u%=@u"َ|h(XZt#h|Vu =vQZVSGY_u%=@t=(u^VS_ZuQ%=@u?VN ^u6?XPSh)hSy=΃=(=(|8/uVPZYti|hUhSWtWJ t=|Ph)hWxVWt|h_XVS ZY=(S|轅^_uS|h茐 j/|Q] ZY|tpj/S:] Y_xt@xxV[_Zt=(|)~=(ix)؉t=9|u fDž.Nj|ƄPRZYkx9Íu fDž.׉ދt󤋅tƄxPR>^_|9;x9 ;p=(h&TShhp&zĐ&HĐ&yFh&r_H=(=(uS|' ZY=(u&P&0t- t( Đ&y h&YrY&P&΃߃Ythp&h =(t%=@uSP SZu4=(C1=( PSj|j' tS=(u1#|(PShv޸e[^_]UE TET]閂UE MQTU TE]{UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_] [^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]醁[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_][^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_][^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_][^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]x[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]~Z[^_]USU EAHtRSHtG t uF u:] M[]9t=T(uyDutJt] M[]%(1 []UWVS(UL( X( $(01d@DHLP4TX\x|hlEE8jj h SQj]S @u hj+ ShPcXZ=5(FډWVRP@ =\(tRPQc e[^_]Ë &Q &y ;0&| t&J &Uh&PJhXZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPX(tvv Rh#bÃ=$(=`(tBjj hv\vXjURB @Uu hj@* RWhaà L (AF`VdEUQRuu1 =\(tRPWQaÃ<( 8(Et*=H(tU]Ã=(u=(tF%=@u FaÉ؍e[^_]W|$wUWVSEUEP,V EZuEEC u=,(tECu}EUE؉U܋=(} (ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut'C  CtNV [[^]UWVS(]j((X=(uEԃ}Eԋ@ ẼM AqP=X(tvv s hp_=$(F`VdẺUЃ=`(tBjj h RPj}W @u hj' Wsh_ K (AEUЉMMuuRPv {=\(tRPWQ^EPv Eԋxvs$EPh^=d(u7s,h}^ wshj^ =h(twsh@N^ F%= u9N % 1RPs4%1RPs0h^dVXN\=`(t3jj hQRj}W2 @Ws(h] "{(=\(tQRWP]=t(tF(V,= (tF@VDF4V8[<( 8(Et"=H(tMUF=(u=(t@uZF%=uE@ Eԋ@)RP501&I= u(1=$1&X8u1(1&X8EuEX8tX8EPX8 uhTj謜1ۉ(1&^X1\X8u 1ɉ (1&sEX8t;X8u݅x QF=$1&uh~m5,1&h3j> 뗋,1&WSh0j@$1&(8[)Ht u hjh jܛXZe[^]Ã=|(<=(1&/UWV5&wh>j薛XZ=((u6~OfEEEPhm501&< y(~uz1=(]xl15(5h(~SuOjjj501&T<xFjWVRP )WV501&)<x(1&"1ɉ (=(1& hmhj蓚XZ1e^_]ÃUWVSPE1҉P1;EE (1&(jjj501&;Ɖ׃xtEU =(uX(] \(9É}EjRP501&F;y%Uh0jК(1& )}W =(t1e[^_]ÍL$qUWVQ1y(1&I(u9h9jjj501&:y(Th00j (1&)y11҃=,1&~h]ZjRP501&3:Th~x(19}oMQRPWV: U Uthj茘XZjfEEEPhm501&9 yuTVh0jC'(1&1eY^_]aUWVS&=5&tp&PU+5ȭ(=̭(X u1=8[)=5&Oh WV5d(5`( RPVhhW>5d(5`(hhV>0WVhhVv>}}t^=(tU5(5(hhV9>Vh(h hV>(VF$Vj =5&ubhT(1WVRP RPVhhV=V5T(h"hP=0h h(l(`(d(WVRPK RPVhhRN=5l(5h(hhtW,=05d(5`(hhV=RWV5T(,1&HP8[)0h3hP<8}uV5Z)h"S@%VE$Vj }*e[^_]Ã=01&y1T(((UP[) Z)t@=(u7=Z)t Z)5Z)hd5Z)1@5Z)=ܭ(tGh(501&>"ZYu1(%=u \( X(u5ԭ(߆1ܭ(X=5&w= [)t 1&~ jP$ YX501& 1&Z~jURP [) Z)t.=(u%5Z)hqb! 1Z)5Z) 01&( (u 1T(1((=8[)t,1&[) Z)t̃=Z)tZ)J1Z)=8[)tg5Z)hGZYuQ`(d( tjhRP jh5l(5h(e RPh5Z)}>j5Z)01T(ZYUVS ShZ)js yNh0jݓ jSjG yNh0j豓 5|(=$1&B 5(6=[)u5Z)h[Xԭ(hD1&SFZYjh<1&SFZYU(C,1&uPSh覑h4PShY蓑hz艑5&whhh[5Z)hWhMhCh?9h SRxhgbSEZYu5|((1&5Z)hb1Z)[^|tFu=y밉؋]U((=5&u>|(t5=~~ h~Ph.thPh\jy@5ԭ(Zx%x((((1`(d(1 y((T1&~x(~UWVSZ)t hjfx(=|(T1&u|( yI(+(EU EUT1&EEuuuu u})׋E9ƉM}u}WVMZY+u}( T1&19}d( ((;(s5x(PY_(+(RP_Zxh(Ɖ5(T1&( ((T1&x(EU)`(d(1ɉ h( l(z5&hjwXZ؍e[^_]Ã=P1&US=5&uhjvXZyx1ۉ`(d(15T1&5(ZY~%((‰(`(d(1+P1&~C9}Ph"jTv yu뙋]ÃUWVuM ()ȣ(^_]UWVS$]CDž$$ x$|$x $=[)u15xPu ^_y狳I1Vh?0jmvPuZYud% 1hH0j(vۉ15T1&5(u 7 ƒ (9|Ru -WQQRu<9uUy%"0Vhp0j@u79|$u9x$t hjtZPu lZYy/Vh0jtNjE49}u;0th뗋9}3t)1;x$|$}Ru ye[^_]Ã=(t1US5T1&5(ZY~'((‰(`(d(=u.=8[)u(1$x1`(d(Z)]ÍL$qUWVSQ Q1ɉMM u15(=()9}Ή5()ډ tƋx(]؉}܍MQWSRPۿ Ɖ׋EUEЉUԉËU֍ ƉύEPWV yEU)u}`(d(19<(+(щ9|gx t%u؉}9}M؉]܋E(+u}뢸eY[^_]aUWVSU Ӆ~H(+(U U  )څ$ 9~؋5(}5()É}봉[^_]UWVS}x$|$hlGdDžp } xAxPu :Y[u]%r,dhH0jqۉtE1҉P`1h9Ɖl  (+ ( } ^ș9hl}hdSpPtPQ5(u O]hlS} yE] Cpt1;x$|$5(=Z)0\t`A9\u\()hl} xdptZ;x$|$}L pN;x$|$_Zyz~'Vh?0jl[(+(~b9}P5(u )(19|5T1&|^y t hbUxPu fZYy&Sh?0jk+0}94u;Ethjj 1tV&ShQ뮋U Ze[^_]UVS]E xz$usP Zy&Vh0j*k$tAPc\Yy$%Vh0jj$3K1$Y)Ze[^]UVS|]s|PVFXYxS=([)t1F $M9$$u0;|u(,$U90$u;EuVhjki 뻸e[^]US|]EPS˓ZYy1=([)uOE%=@uEhgbS[ZYu\S Yy} t$Sh0ji/S[Zy5Z)$Sh0ji̋]UVS]EUdh1ɉlE Upt1x}=5&t =5&|PS辒^ZuZ=5&u#EUdhEl=5&u$Yu(!Vh0jLf=Y)tY)sVhP$N $uWyi 8=Z)u<$8$V y5Z)$h&Wje1Y)$E1҉$Pe[^_]UWVSĀlj։ˍxPQZY=([)t1|9Nu*;xu"F M9Nu;EuWh7j0d BE%=@u8hgbSVZYt'S YyTShU0jdjS#VZy-}tӸRtvvS uSW ZYu1}tuSWhfRjxd둍e[^_]UWVS|]($1u(x$|$9ȉ}$9$U  xWV蕍YZ@t$E%=@uVhjb KjAZe[^_]UE$tH $E] ]UWVS]E U$usP̹ Yy3Vh0jWc=Z)u($=Z)t8k<$8$V =Z)($ttC($5($=Y)u(jT Y)PI Y)XZ($Y)!%PVY_5& 5&t%jjL$H$X$T$V$tG{WV' YZy-WVh0jPbVS$B1$Y)Ze[^_]UWVS]Ct1$H%#($Njt1lp$H$3 5Z)hZY=[)xPVZYum%=u[hRV肶 u/ tVh0j>ap#ƄWVZYp` `D$@$WVP :WV VhV P ZYVh!j_ Uelt lt)w$V#pZYxDžl=Z)tVh&RjD`뒉l<$8$VO lxDžl0=Z)u =Z)tCi<$8$Vy =Z)t#($tA$u($(($$u ($.($($tbYX$5Z)hYZjV8 YZxPVYZy+thG0j_WV@1$H%# PVXZ=Z)u ($jZ) 5& 5&t[j $P3VA=5&u =5&t51$PjL$H$X$T$t1e[^_]UWVSu }SE8uEEME;E~])])؋ME8tR<9rt >8u9@}jؙRSu%u h_E18}t}t:|[)t[)E|[)6SVu譽 96u h}ix[)p[)Ex[)ҍCtPR-:XY P4Yuhoj%\XZ>CPVЉUPEU 0j\̍<+E e[^_]UVSu] }u1NjjjV y qShjhY)V˰ yPSh}0jt\e[^]UVS]u x@P謲 X=[)t*jjL$H$X$T$xe[^]UWVS(]} $(v(11ptWPu ~ pt1@9uNjt9|$up9x$thjsZ xPu ZYySh?OT$9X$u;t hjjju ^y$Sh0jZp1$1e[^_]USY)tP 1ۉY)Y)XY)um1 Đ&yh&Yu9&P&94&uu%1S Y) t뭅u tډӡY)AY)uY) @Y)tϋY)zyP1ZO밣Y)j5Y)hY) Y) &1]U=[)Y)=[)tY)=Z)t Y)@=Y)u'h 91Y)YuhjjXXZ1x[)t9UVSut>uh+j 0XuhFjXY[FVZH~ 8/u3E ؉C1C=Y)uY)Y)XY)1e[^]áY)t@= [)t Y)=[)u4=0[)t+UE$uY)tjP5Y)̣ US=[)t8Y)1t6{u+uhmj(WXZ3h9hp&V [Ƌ]UWVS]=Y)u =Y)u$15Y)yx5Y) Y)YtHHQf $3 =[)tȋ@PURURpp p0;9xjjuuuu졸Y)pphj6Vphhp jW Rphp p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=[)L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPĪ y$Y)paVh0jUƄ  ǃ$h Y)pCP>h Y)rP5Z)hg t1Y)@8e[^_]W|$wUWVS<ÉUMMQEP\u}j} 9ƉЍM}QhQh(j@S輧ue[^_]g_UWVS\]uCE=[)uPh9V ue[^_]P}W($ݶ T$X$E(j8$H Ej<$3 UuuPjRj4$Wh4V$ w'@$  R%PhF|$x$hQVuEPh(V$Pw ShXu ShXV~ Vj ZYV1Xe[^_]UWVST]}T$X$uV($蓵 SWVh`aQe[^_]UWVS]u fVfuPZt%t0SRjP}W@ VW與 Cۉu ]e[^_]p e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVS EEU1} t EE1EED}u^9r^MHYW wY0Xu}u}} }u,HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UWVSS}]u 9yK@G?ș9GG1 Ԋ< u G9r11҃G11ҍO9OYЈ\$ w %Y\$v Y\$w\ D$G맊YЈ\$w0GD$9r h11Y[^_]UWVSUED1}uo9ro]H 9޻r0WHM] M] u uu,HM0Hu} u} } }t9sԍr19r)A9r)‰ð0E E [^_]Ã=[)!u%U[)hijMXZ1ø1UWVSSu] E}MM1҉91=Y)u0K Y)Y)9-u BY) &=Y)u" Y)QY)u Y)Y)1Ҁ=Y)t7tMM}E] ue[^_]: E] ue[^_] UWPZYtU:u W3h(x:u9&9}91@&W3hhp&?e[^_]1UE E EE]W|$wUWVSjEPS Ɖ׃EU E9Es 11M9ttuj,VZY…tUj=VY_DžUuhUj #ZUuhjJS, juZ) Z)BZ)1Z)Boe[^_]UWVSQÍEPS:` ^_u C #ƋE| t@E]S#ZuZ)1 KDe[^_]Uhp&h( j5&t 9tU5&Uhp&h hp&h\ hp&h3 hp&h- jUWVSPuh[S6 ZYh[So_ZÊEhViYXu+Vh0jOJ }t/1e[^_]UWVSlj/E 0* ^_Z)t@E Z)hP Y[dZ)Z)[)111҉U11Ejh`1&h=u uKzX$4 91|(591hd |(렸1P1&덡918-uxu1ԭ(Ejԭ([[)QЭ('B([)3Z)$15&=5&u->|1Z)Z)=Z)u Z)Z)5&c [)T591=Y1[)o,[)` 5&GЭ(8Y)91Z)#[)EH9~2MxPV$XZMuhjFjEƋ91Z)PMЭ(1Z)[)Z)591EЭ(ffԭ(5&Wԭ(5&Hԭ(5&9ԭ(5&*ԭ(5&ԭ(5& 5&91Э(Z)1x5&1ɉ [)591"DZ40[)|Z)&E <5&umu}t Z)p&Z)&Hw69Uu }uj@ ؃kL4&8[)Z)nt HuZ)1ɉM`hkjDhP[ZhSZYGZ)Y)}tE^Mth*uZYE&t*h݁uEZYuuhj D1E1EE^E}tES %[huZYuY)u$XEjhu u@Y)t EtS$[EP臖u$XZ1ɉMEHjSu E&EE]}t EtS:$[h*u/ZYt u[=Z)nu2j5Z)S dE>GEtZ)>}15Z)jP$Y[yRFEMhSZY;GCjP[^u}uhP9[Z_uh*SY^&uS(…u_h*SZYtVt^=Z)tShzFtjP8ZYy*h݁SXZuSBhRUZYt8jhUR UujjRZYMpjP؃jSu1ɉ P1&}Jԭ(t 88heCԭ(Zt 8ԭ( Z)11jh`4&hu u z$5 14&ă뿃91|(591h4[)0[)x91ԭ(f,[) TЭ('E([)@3$[)΀ [) 9191hp&h!t 54&h=hp&2 5,5&h=hp&hp&hs Э(0[)91Éѣp(t(19| 591h<%thhSjV=X [)91ShceZYuP1& SF P1&Yyhyj591Z\@D[)/[)Phj<j(1ۉ[)591Y591*ZZ) Z)@|Z)gZ)U1x5&IZ):91Э(+Э([) x& hp&j Y[{%E1 u15&Z)&nEE u5& Ge%1ɉÁ u5& 095 u 5&܋E5 _5&.1 t\5Z)hhp& 1 AI!7 PhOšp&Pp& 5&uu8[),5&v/t1jj} 4 &&9Em&9Ehj9ME MZ)PZy$jj} 4g^_'&&;E|1ۉP1&e[^_]áZ)t PZ)Ã=Z)t[U8[)0h=jN9 tp0hlhp&o5Z)h^ZYu1UWVSM11JqX?tCt*tK[t~=0[)ttjMYZF}uvQUtPU!uX1C<]t:m~-u Vt]t:E :U|^:EuĿ1}!9*A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puhj7D։9r KNKNp19r)XӋE}tE9r NKFC1e[^_]UWVS 5Z)h6[_Vh,6h\|6h~r6h W6hMW ZYuhW[= u h&6Y덊uh6ZX<.uuh5X1t3L@LuL@L%H9s tFCC@9u&>t!tWDhDj3|tHL@t<uDhghp& WDh}hp&t@th WD0 1e[^_]UWVS]t K΄u h4<\u FFu8uj Xuhj2^_DžoGjQP4: t2hVP9 SVhjd2 W[띍V֊t\uF8t)F8 WkSh j2YR3Zu% W5hj1$N1GtYuh= j XuhR j0[^C31CVZC 1ɉKECE C=Z)uZ)Z)XZ)1e[^]USZ)1t6Cu+uh j0XZ3h9hp& [Ƌ]UWVSuZ)t$tS= [)u S1u=0[)uSu$t9utZ)}FPYuh j/C_Zt/1srCt/1ɉK;WZC Hǀ?/uC C$c‹@t 9uBSS1ɉ$[:h ja/XZe[^_]UVSu1ɉ$Z)u,= [)u1=4[){C |/t[t0CuPFP3~ KVPZuɡ4[)u '$tVZYx 1$e[^]UWVS]=x5&tjs{.u{.u Ct:u h j/V& [_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh j& TE@jhXuh j&Y[0t;u GM1GtAt0yVhY &O}thE8t`W yuhu j%WbGƒWt+G 9OG}Vuh j%W1G=H[)u=H[)D[)x=D[)1 h e[^_]UWVSM=`[)tPÉֹ=1:t9pt@9u9U}tjZUuh j$[^1p1ɉH xe[^_]Ã=l[)u1Ujh l[)YZt1h j$XZ1UWVS}l[)$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujYtGGPwZt0 $$$CSEC ECECEC1vSYh5 j#XZ\Uh 3 Pq 1$$CHCUwC3S[^e[^_]UWVSMl[)4$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3X]e[^_]e[^_]UWVSS=l[)t51ۋ4t#1ɉ v0EEPXZuC u͍e[^_]Ã=h[)UWVjhGh[)_ZuhS j"Y^C~ =Z)5Z)K5&Z@u"5Z)Vh 0j"5Z)X1e^_]1Ã=d[)u1Ujhkd[)YZt1h jp!XZ1Ã=`[)u1Ujh=.`[)YZt1h j3!XZ1UE$$ $]UWVS(}=`[)$ $$$EUE 1҉EU苟,$0$E1҉!މu؉!ȉE9u9tE1!É]!ȉEܾ 1EE11ɋEUÅt#@ u9pu u90g@E]!؉E̋EU!ЉEЋEU3E3UЉ Ӊ] O $$$Å}uIE EtAjX11q $$$AQ C AK 1St$P[)T[)P[)T[) u+P[)T[)M!u!9u^9uZtLP[)5T[) t:UjZt+UM܉HUPp K HC $$$3GPhjhOj$P @ $$$E؉,$Eԉ0$1e[^_]Ã=\[)u1Ujh=\[)YZt1hjXZ1Ã=\[)tDUVS1\[)0tjjs sss3觵[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ \[)=1Et#؋M9Hu9p u M9Hu9xt@$uj(eX҉UtMupUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!RXE Ee[^_];e[^_]UWVSEEE EM}\[)tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3SXZ1e[^_]1UWVS]}E=Y)t";/tPS^ ^ZuShj$YuShj. hSKoZuShj ue[^_]?GFG4W8F VG(W,FVGlFF X[)F5X[)e[^_]USX[)tvCX[)=Z)u{ t s3hXZ5& 5&tjjssss 3輲=|5&t s3YX3SX[)XZ놋]UWVSSUE @~ T@119}At41ɉMU1ɉrE1uZ[^_]UWVS u=h[)FhGSPl <9tjww 55&躻;Wu;G t h7*SR55&+{ 9؍thO0j SR yT$X$G9__W1jXjjj55&G WxNS55&z 9u)T$X$GWh[)W8hg h0j7 WwXhj#ZYe[^_]UWVSQd[)uhjXZohu u Eޅt6uY_tcvj h^t;ukƉYt#ukGZt _E81QVXW_hja[^0^SuZYtSubkF_Zuhe[^_]UWVSu} d[)t=h7V t&3V2ZYuusVź [֍e[^_]UWVS EЉ1lj t׉ EE1EEL} t} t} uA HA@ AA4AA (HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=&ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh7h SSyEVh?h SSy=VhJh SټSyVhXh S蹼Sce[^_]USSˋ t%RQPGE31U1ɉ EeveRu P ]URPhcjUjhoø1҃=[)t1UME1҉[)1Ҁ<u=Bu} u,J=[)t[)1҃8]UVS]} ~;uqjhP u%=5&u 5&hj0ZY15&jjPƺ 9؍e[^]UVSiÅ3hVZY[uh7SZYt)SVhjh7hhj 5&vSVh*jt[)o1e[^]UWVS]u hVZYy\- 1{ǃ4$K<vCVht[)|[) x Rhp[)x[) U jjFdPG%($jjFlP/8$jjFtP<$$jj F|PEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1$$$$ 2t|,1ǃ$ǃ4$($Qw\1ҀKƒ $x$|$ށ$1$$$ǃ$($w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%$1$$$1|/uDe[^_]UWVS]$Hwv$08 =[)t_hPj hyhhŃ d~ Ph뮋p3Sc~Rh땹1jdRP1ɉ$$$ u#EƄ5/jj o11_Z1u9E2jd PEP藲jj o11wE1Ex$|$ƅz ynH0P t9uon19r)J9r)lj°0󪋅 th$%$1$Z)  Z)t54Z)=8Z) T$X$($1jjWZY8$1jj_sZY<$1jjgRZYjj {5^_un1jjMZYuJhP٠^_y>jhZYx鋓$  Ѓh3e[^_]11UWVS}} ?jhV ÅulhXViY^¡[) [) u[)h`j XZjjPƺ 9tPVhj ؍e[^_]UWVSu] hS2ZYy- 1~dž4$1E쀻Yt"h YPW:z/@E K<vM E)Sht[)|[)} Rhp[)x[) } jjCdPo%($jj C|PлEUUEщx$|$@uAjj P T$X$H$L$`$d$ƃH<$P)Pr yjjCtP͹<$ ƃ(8$P P< ZYyjjClP藹8$ 1$$$$@$D$<6tL<5t_<2Pπ2j8$7 j<$# Ãuj W P  uj S)P1jjtDhP莕ZYy|jj ԕ[_x졌[)u$  ЃH5[)PC¡[)1ۉ[)[)_Yx)ЙRPnZYy넸e[^_]UWVS$ƍ@- 1U ډe[^]wUWVSu>-u~t2h݁V贬_Xu$ü0PVhaj[&1EPS ZYt/G}vEVWhtjEUt&u1 S`Xe[^_]á[)t UU RuP5[)bUVS]u F5[)tRPS tD3j S|ZYu1e[^]US]}t Z)Z) [)t=Z)thp&j 1Z)ZY5Z)h?hp&Su hp&hp&j ]USjhQU Y[xEhEP>[)YZt&h݁S([)YZt135[) ZSV X=,[)thQhj ]UVS] u}t Z)Z) [)t=Z)th&j # 1ɉ Z)XZ5Z)h?hp&Vuhp&~SPhhp&hp&j XZe[^]URPhhp&葩jH[)URPhhp&kj"UWVSƋ=[)tPhhp&? =[)u ЉˋQtjP諫YZt聹8tɍEPsOa XZ=[)tVh迼 ^Xjs js訾 g} uVWPREPh2hp&莨hp&IĐ&HĐ&[yh&KY&P&؃t- t( Đ&y h&Z&P&΃1Ylje[^_]UWVSAօu9VP%'ZYt&[)h%^_F%=t1jhR @txP裉Y[|x^9|u,;u(^9u;F u%=t訷/R Zjjj  ׉NX^\19ȉ}{ 9}Dž 1PgP 9y+{O Q ZCjjj/ ' NX^\19ȉ}{ 9}Dž 1PO 9+{#O P Zrjjj^ VNX^\19ȉ}{ 9}Dž 1PN 9+{TN )P Zjjj菚 NX^\19ȉ 9}Dž 1WN 9PPWU# +^hM =O _jjj裙 ~\vX19}p1҉ u݉19} 1QPM 9u#)L O [@H[)h XZN Ye[^_]UE @E E@E]陫UVSutYSC t } uC\)@\)R]sUSO\)H\) u\)te[^]UVSu\)@\)[)؃8t VPjZY|\)u \)u\)t e[^]e[^]UVS[)1؋tJ9tFjPZY|\)uԉe[^]UWVS\)@\)ƍPY11ɋ[)tx?tBA'u9t h \)u\)th jVSj19}VphJpA7&HQP yP7&H Z J GSXe[^_]UMtA'1[)]UWVSu^Nj7t#vuWY[Åu jWXZ ׻؍e[^_]USh ]ZtaujY1"4he)tP{ Ãhe)X؋]UWVSP}U UWRW"ơ\)@\)$߬WC1҉S URC\)H\)u\)t e[^_]Ge[^_]UVSuV[t#sV=ZYu} tC t1ى؍e[^]Uju ZYt@UWVSj0Y1he)8u&S;u0h57&XZhe)Phe)uj=CPoY_uyjS5_ZDžuSh57& Shw7&xWP yP7&H YlJ ]@PS3XZKe[^_]UWVS5\)&DCtWjEPV4\)\)] "E :MAEI"E uV)PRh"E tK\)|\)C"E u)BUP\)NjU󤡄\)Xu,Ƹ^ À~|tH;= ÊV~-t >θ(%)%#Ƹ Ƹ^\)e[^_]U5\)PhXUWVSQ5Di)|\)Di)PÉ5Di)^=F7&t xuKt;u膫1҉jEPSSƉm 8uE8t+X8t`"E  tBUUue[^_]W|$wUWVSE܉UM7E܍Hw$t9  u !AuEU Ѹt݃} uWVuu> WVuu? &MΉEEUM EUEU)?EU t1?EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉM][EU11 EU11 ۉ]1E.E!EE!EEU11 EU EUEUe[^_]g_UWVS }Ӌ7VT_=\)%us Љ UUEU=\)&t wE\)\)S1 VVڋExYtEUe[^_]UWVS(Ɖӡ\)\)EЉUtSUЉt@ vSUиƉX^MƉׅuGMIt!ElM̍YWVщ‰Y[ƉWVh'j]S胓jSu e[^_]US7=\))u _[]W|$wUWVS4ƉӉMЋ?E1Eă0HI\)\)SuЉE뭃$9 "tFكPE4EȉU̸=\)#4EEЍpًt(SEȉŨwhf\)SEȉUYEȉŨw><\)ƒ}'u1EURPh'juVjV3EУ\)\)\)S]U]\)\)SWڋEXY E1ۉ]\)\)SWڋE ЉE҉UXs}t V\)\)˃'u1ӉMȉ]SQh'j]SjS5\)P 똋M̋EȋEċ}eʍe[^_]g_W|$wUWVSEUϋE܋sá\)\)EUVU)\)Kvu^*9 89 |u0VQ{\)YYuRPUMY_Kw9 9M~ ߉EUce[^_]g_UWVS}USƉ׋ \)AZwSjƉXZ=\)uJE졄\)\)MQ1  SUEY 1ۅÉ!1e[^_]UWVS}USNƉX=\)uJ=E졄\)\)MQ  SUE X1 1e[^_]ÍL$qUWVSQ q}WH5\)XjLPdZYt5xIu,xNu&1҉Uj PcZYUtB@)։5\)@뽉\)\)m1=\)t EЉUWaEЋUԍeY[^_]aUWVSRE} _6&6&@c)@c)HO;t(@c)sx&HP ωʋ7@c)tx BMP M҅xJ H+ 6&QX5Di)SƉRPh1 e[^_]Ë\)Ѕt /tt@1ɉ \)HUS]u1Z;/uPhgbZY@tEPSZY@tҋU9u;Eu3E3U ]UWVS}V*VPX tS\)Y]e[^_]鰞S語ݠZ8"u뺅uʠ0Ph< e[^_]UVSu=\)uE=5&t.1҉5&hS#uPYZtS^\)Xue[^]3e[^]UVSu4t =\)\)tPY\)@\)\)\)1\)jR\)H\)Zu\)tG =\)t,j5\)hPj5\)hSjhS>[^1V@$袜\)VP 6&6&@c) >/t[5\)>t'@c)H@c)FxFC/XVԀ~/u#@c)KhMV蚗ZYu$6&9r :ƅuh@c)K;/u>thgbV`ZYt @c)x/4蹞X/ 謞XV>t@c)H@c)FxފFC96&u @c)x/C lX/=@c)uX@c)\)@\)\)tPX\)\)56&\)j5\)hP j5\)hS \)H\)u \)u@e[^]UWVS} ]\)@\)u4f Yy \)u\)tuj;ơ\)H\)Zu\)tut hW Y4u1-=6&u =V7&t5\)h9XZuÍe[^_]UWVS6&hƅdh訲Yt ^t>h[dW1ZYEthWZYEuEE1}}FHπ\ut}tnxP0tB<wV$9 NE1>: 6 2 . * &щǍ@0w\9Eu}7&HyP 7&H X JF>/7&HyP7&H X J }u-7&HyP7&H [ J 57&*7&fBYtfBhGj(1e[^_]UWVS]u }7&t7&9tx u h7&X\)\)uo/Ph?h7&c \)t\)Ph?h7&B t&WVh7& x0hSh7&ZYxS{Phh7&7&HyPh7&H X J E7&e[^_]e[^_]U塸\)u~fU\)jP UU 1\)\)@\)tuRj Bu\)t \)U1\)EEEEjEPj/ =8c)t=6&tjQjjj? U=])u ])E Puj:UEPu u(UE])jUS]ݔSu 0uU”uu 0uUEPu juUuu j}uUS] pSu0^ ]UUu u0A UE Puj+ Uu uj UM@: ft9uPU t@Qh.j h\)\)á\)UWVSP}\ YuOƋjjP. ǃ t 3!/ ;ZC jjP. ǃ t s. {Xe[^_]USh Yhe)8tN6&7&蒟\)thB sXZi)X=jjSP5he)#j1]W|$wUWVS ƉӃ=\)uj'k<\)X \)1ƉU1}m M1EmPP$hjS};6u{0ujh>SyF S蟆ZÀ{0u K{.te[^_]g_1\)\)\)\)US]tvUUt[F~#CtVj RPWjEpS<:~5j Rs WE@C us XCX C @C[놋]Ã=\)USQjj]Sjjh$6&脻@tBEP\)Zt,jjSPjh$6&S@t\)PATH@=5\)莶\)6&X\)]á\)US ]t6;u1Ct*pêZti)PjEPCp1(]UWVS }W1t@\)B\)PWrE_XZsnEX;t.Ey"xV+ Y<0_Ph1Psu踇 ua \)u\)t[~5jVXZ}xuk+ juu jssYX}yjs_XZxV2+ ^uu&+ Yu u|Z u.qX1\) \)u\)te[^_]UWVS}u 7&tu u1\)1E܍]SXZ$0; uwYX=7&m=\)%jw~XZ=7&K\) \)4jwNYX=7&=\)=\)=f)tVW VW=Sr =f)tJVW=f)t0jwXZ=7&=\)u=\)uS ZU ?1=\))=f)tuW =f)tuWS讋 =f)tuWfك=f)tmwww+1ɉ \)jwXZ1=\)\)jwY_=\)tr\)f=f)tW,SXZTjVW S6Rhnh7&SS赊Y S謊f1SXf)t=6&t\)t tP*tj=e[^_]UWVSE ǃE܍uV5Di)ju _1j,Y=7&tKt>=7&u5tU(YUt E܃PuRcXZ=\)u VЉX_V%Zu1\)tje[^_]UWVSWE} _6&6&@c)@c)HO;t(@c)sx&P ωʋ7@c)tx BM؊P M҅xJ 輊H+ 6&Qч^\)PS}ZY1\)\)e[^_]UVS]\)1js&XZ=7&=\)tT\)u\)H\)x1\)뼃u \)Q\) 1ɉ \)MwE5\)=\); ut-t)E Ps5\)XZ=\)Ro \)5\)e[^]UWVSu=\)=7&u1EP莇E؉E܋^Yt$hPSaO =\)b[E؋E1҉\)]؅6FDi)=7&Pi)PӦPh7K~v v7&xWPyP-7&H =_ J=sV7&xWPYyP7&H X J 57&_jsv GE Pv =\)=7&uJ\)t:u\)H\)-1ɉ \)Hu \)H\)1҉\) \)=\)EP蕆Xe[^_]UWVS]uVۅE؉E܋S Di)jPsM[=\){tuGDi)EpWSZYtV1=\)uZ=7&uQSC ; tDi)u P \)[_.[Di)u P\)ZYu뇋[g1\)V豅Xe[^_]UWVS]} 31EsZ=7&{5Di)i)PoP$hStj RU57&UR hXu hX7&HyP7&H X J 57&0X\)@\)ujS)huSPE}trt}uyguu \)u\)t3jsgWsj\)H\)u~\)tunUu;RBg1ɉ \)\)H\)[\)e[^_]Rr\)\)H\)Zu\)t tJ=7&tA{t;5Di)i)P询PdhZ7&Ee[^_]e[^_]USD\)EE1EEpX=7&tlExtc5Di)i)P3ZYEP$[EXtj S57& [h[57&/XjEP ZYtlE\)\)jXEuKt&:EP`$TX57&XԋEt\)j5\) \)@\)Eģ\)j Ep;XZ1ɉM \)t5u Ep-Y[\)@\)E\)jfX \)t\)t뻡\)tEt"EP$)X57&Z]UWVS}] 1CCC =7&EPƀ\)@\)E^y h1xjWdjWP:zu31ɉ \)\)tu ju jWu E؉s \)H\)Zu\)tEP輀Xe[^_]UWVSE ,1@i)X@i)(Eg- `tfE=f)u Ext,AEftfwE= t= t\ˋE@ft5\)@\)ju_[^|n8t4rn8t*hn8 uxPWZY@t EnWlX뀃 h u tCƒv~ ])PSP6h"jUWVSuU F^fftfftdNi)$U jS$PJP2k IU yхtvhXZWXtkhXtZhp_MtIh_Sh\)@\)vP$PBc\)H\)tShY[?\)th,Ph PShM~ t-7&HyP7&H *Z J*7&HyPv7&H X J e[^_]UVSuJ t"8u%uCVPldZYt؍e[^]UVSu@J t8uVP:dZYuCݍe[^]US,6&1ҋ ])tHft fux@ |u[]UWVS}\)@\) ])t,Pfu9x fu9=,6&| P蟐X҉΍^])t \)u\)t e[^_]Se[^_]UWVSSui)X'1E8Et$}u <:uWE}:u uW@u6u#<%uUFPh#YuZYUt>:uGFC딃=,6&y t ,6&u1҉MRM ,6&Xe[^_]UWVS\)@\) ])t!f{usSmXZٍ݉w])t \)u\)t e[^_] e[^_]UWVSutA%< ]) ])tCVPaZYtdߋ} tX\)@\)V]$eÉ1fCC VCPl \)H\) u\)th=])؍e[^_]US@J tjP)f@SPXZߋ]U塰\)@\)]) P"\)H\)Zu\)tUWVS] j/uK)^_t[EtFxPuZYy Fh8tHftftfuEEu E u=,6&yƀx u91ETtE,6&tuDYDžDž\DžXDž`juEP` Wd])Z?/xPWYZ2E%==])NEWZLȉ`+6&$cWbjuƃfx`QWfXZF FfF CfF fCFC,6&f~tF\`9\HPh#pZYtuYDž 5])h+pYZ`9\~8e8ke8]eXKWuh05\)@\)dTujuY_f~udfF`FDžX t@Et$jXPuh357&f`\)@\)dTujuXZf~udfF~ \).\)!1 e[^_]UWVS$EE111E11EEhEyEZtPEbw$; 1EE1ɉMſE뵾뮻E랃}uutjLY1҃}u/}u)}u#uEEEhe)81 ])tROft!ftfIu:}fu.} }tуtEЉUSW>XZEЋUԋ?몃|u57&^7&@hOL[EjWZYt[@ft:,fuu>he)Phe)8ufHu*}"fu}}t˃=,6&x ti)PuЍEPW}t f}uA-tf}tjW~Y_t jPFXZd]uEԉERuIEe[^_]UVSu \)@\)ju!Ë@ZYft&fHu sXfCFC fFC FC \)u\)t e[^]e[^]US ]\)@\)fEEE6&fEu EEPSL\)H\) u\)t ]~]UjuTZYtfxup)X1UWVS 1ɉM11uhvZt(ptvtVuEEлɋE 8ctu ދM Mt4PhHt}t5h4he):t/1E he):he):{RPhm? jjV XZu}jV)XZGfEGEEfGfj/V ZYEEԡi)}tEjVEPGEP.]My`uh9XZhe)Phe)0Ihsj w hTwh9he) 87&HP 7&H he)Phe)0YV_8uVP WZYmIwhwh9J he)Phe)0i)PjEPV1MfHftPh%Y^jVO_Zuu hYV`]0ɊPhόehe)Phe)0 u%h,uhB uhWVh9he)Phe)0_Xt!he)Phe)0E.htXYEE~uh넋Ee[^_]UWVSEPZ])+6&PY6&XY}GE܊_tkta}t\} C<v2u+:t$ t/t6EP=V7&t"E u @c)xB *\P}눃=@c)u\@c)6&8uu@h|&XtVZ^E %E1b PFbYuV`ZZPaX VLZXu‹E|}u5F< v@ @c)])y}[P])Csu2bG  <w @c)])y=[P])8t8}t!߀u8CuEԉEtCW tC̃W8uΉ֋EԀxAȋE1҉U]}t usu]uM΍HMЊ1uEΉEAx<EЍp[<:MhV; ZYEąM9EЀxupx9u"E EEE9s2>uF9utsE"E tdU9UvsԋUE͈@ĉƃEM9MUPxYPEPx EXZt\uuЀ>-utF<]tm/uu}NtFuc=])Uqxvtu@r t@١]);}u5])S[rxRPXZYyZ9tt1t9s'@ZxvttE]S@ϡ]);EtP9Uu8/t}G gb[P XE9])t@/Džp>t F1ptJxw@tu@o\)tS Ypu{F/uS{ Zt߀x .u o.uǍx jWt tptWuO 5]) 덋EG@WPu@/VP_Xle[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu])skY@uP])DV Y])u+6&,+6&EEt;t}1ɻN)ЉE=F7&8<@.<*&}tE<VE)HPh(1ۅI~@@c)H@c)Cx])P])S։M BP])SM뻍G1҅~օ)xu u܋E%PV1ɀ} k])+6&ыE))])]) @c)@} uS5Z}EtsŠbG  <w2 @c)x])H ])U AH ])U @c)x])H ])U@H ])UԈC뇻11EԀƒ v! @c)xM])H ])CuJ @c)x])H ])ĈU|@H ])U뫈Uc@H ])U뫻1111ɋE%Et>@u=le)uM @1 1E @€}E$0< U5])Q8])^_Uzu LuЉU E PuY[ExU^1 @c)])y?P])5])+56&uuuuVuu%])+6&ʉ]))@@c)uZ0uuuVuƒeuXE)Di) Rh誩}O#uOQVHPRh#u EEEPVE)HPRhg-u9u1ۅu"uԡ])+6&Pu 1Ҁ}t`]uu E]Etq|wt ]) ])׃usuKt@뿃uHuEe[^_]UWVS]E %E1ɉME tE7&j)u j)E])+6&E܀;~uE t u SXZE 1Es‰E<}<@~< T$l< <:<= {s{u{y{@u{=uy1=])}} t @c)])y<P])e s @c)])y<P])Di) @c)])yf<P]) s=])t(])+6&M9~xu@c)H]) uE uE 1* @c)])y;P])҃}u C< w @c)])y;P])S @c)x])H ])U;H ])U tsDi)E#E PVu R])pd])])!V[N @c)x])H ])U;H ])UۈEE t5UuuZYUtU])+6&jPHP UE {~=u}1Eu V[X< uDi) @c)x])H ])Ua:H ])UۈEE euu+ZYP])+6&jPHP 3މe[^_]UWVSEu ]=&7&t1҉])P ])6&])6&@c)1ɉ ]) ])PDi)Sp_Xu&])=@c)u9])@c) @c)])yg9P])])+6&Pq6])])XtAh])W])1҉])])Y_ÀtS5])S+5])@_Wj6x])])Y[&])1҉])tNFe[^_]Ujju56&z@E5UWVS$EPEߋ5])+56&hREС@c)H@c)ZYx])>8P])=6&VW]S6])+6&P+55Di)W蘔EԉUS66&]))Љ])@c)@c) 7])uuh'j5])蝜])׉Gu}"tj)PV8 ]))O]))=@c)EЍe[^_]UWVS]u =])1}DPS]XZ])=@c)u7])@c)=])}=6&}t }tA;tWh9h7&褛j象= EtPV)KSh葡jWV肥+])=]))@c)e[^_]UWVS]u=])CvE%PuuXZ])=@c)u56])@c)=]) 6&}M  t?9s@UVWQM} MUt <CÍY9s1:UVWQM6 MUS9st{u8u@@9r9sS륍Y9rVSQM SMt9s{u8u@@9r9sS뺉A9SVSQM u;Mt;uCCӈ)ȉ+])]))@c)I9tKCCG+])])@c)x C])4P]) ])@c)e[^_]UVSu]Sc2F ])6&])6&@c)1])jvW@c)H@c) x])4P])])+6&P1ju PES2Ee[^]UWVSuFPhx蝘7&xWP[_yP7&H Y J19}E 4'ZCWh??7&xWP_YyP莖7&H [BJE 4x7&xWPYyPF7&H XC9| J1e[^_]Uh蟝Uh蒝UUM 06&t 9PuH]Ë @b)1-06&B t xt 1z1@b) 8b)UWVS}u ]\)@\)06&z tj.06&J B ZB$B 8b)P@b)Pjj55Pb)e[^]UWVS]u+`b)i5rOCShk\)@\)19~Qi@tǃu=uFjR ZY@u'tPUPh蜒9+`b)i5rOCShwHJ΃utBƃs \)u\)t e[^_]麑e[^_]US]\)@\)9t PLZ1ƃ1҉ \)u\)t ]W]UWVSTÉ։Mt&uPh3]Sv =E,EtM}~EtEtCzMB9tMtEttt t tM IuɋE0u#E@VYEEHEvE9u]=`b))i5rO 6&+9t# ti1;J-R@PhjEP舊hgjEPs URZEUt%‹E0hjRUDURǃE@T=uhR( YXu*tQhjRfhljRTu =t̉UQ(Rj URP/E@Ut$RǸ@)$D=Ph`/ U:Plj$URXZKyS赇P Y P G~SEPHXZEu EL}tzKySgP _ P KySEP|Y@P|4M}tWhOS藈 iEM0EKySP Z P EEE}S{X>e[^_]UVSMt.t 119}9ivtC䋉11tJiD} u&ƒuu=tă[^]UWVS utF>%~W..[tW-XY*Ft~uH<-tB<%t<+u:6&6&i`b) `b)\b)E1MxdtS~JH~?u(UFPQM YZMUt UQW,YZUu뗅uV7-ZtjV,`b)\b)XJxRt~i90tM΅x29\b)~*i`b)t" *1ۃ} uVP؍e[^_]UVSh6X=Xb)tYh8r7&HP57&H Y肈Snhe)Z8Phe)xjhe)0Y^u hHf=P+`b)i5rO@Phj8 9DiPhO FXZՋJ ;1e[^]UWVSQ111Uhr5ZUt$jtptguܿպλǍH~hv he)tyt hyUjPYXUt 1t+`b)i5rO@Pht$Ph3]'XZ1tiHi0i0h7&BHBCY_y3R4X9H 7&z99y9H y:؉؍e[^_]Ã=Xb)u!UjuZYu11áXb)u!\b) `b)Jxu 1øUE=6&t@=8c)t7uR+`b)i5rO@Ph57&趂UWVS=Xb)t.5\b)`b)NxtS{X1Xb)\b)`b)J\)B\)uh=ViP*Ë\b)`b)i߉_19~i9uFPB^`b)\b)iƄDŽIu\b) \)u$\)tAt \)@\)=N7&1ɉfǃPb))؃} ~iE PZ \)u\)t諆؍e[^_]UWVSu]=8c)tSSzYXuM18c)\)c)jcjjz1Pb)XZ}u*=6&}u=6&)=7&t u a0Vj _X}u-V56& ZY@u`0HhPhCSjrSjr{}tXb)}u`SjzSjzu }um߃u2`u)jn jhQ肵 thQhx苅t$=6&tSj\rSjTrSjLr_e[^_]US]U M=7&u1t uEM E[]$~ UWVS}tE1ۉEPu EPǃ u8f)t\)@\)`b)E1i\b)M9i MEEM99u]Pu Uu6$уu>t6Uu@ƃP}uuPtуut 1ɉM1҉UY}t-}u tƃ<tƃ1҉[tgu tUP=8c)t =6&u;u uEɃ@ ;u uEuEu7&P \)u\)t胂e[^_]UWVSjjjà ~ jjj=7&tQCtN56&y 蠯^9t7薯P56&$ ZY@u0DhjPhCc1`b)95\b)|btPu=Xb)u>SX5E t t&tt M ڋE8F떍e[^_]US1h,Zt$ltptZu⻀ۻԻ͡he)u t8t Phn cjn Y[=6&u =V7&u@t4jhe)0‰١7&he)Phe)YZxuS57&?XZ1]UWVS411Eh+Xt)ntput h5de)Eƃ}t1E̅u4Xb)E̅trHhe)8uEu=Xb)tO*jjV~ uVhjV9Y_t Vh [=Xb)t}`b) \b)=he)Ix.}t ?u1҉1E؋Eԅju4EZYtxu M؉}tDE؀u8jPqZYÅt j7V薃 =6&)ugXE؊u CM؈`he)8tu E؃]ȉ1}ܡ`b)\b)1Jx8t(t uEuEĿʼntEĉE܋E܅u%}jbjuV贂 OuA1ɉM܍EPjj @usE܅u ߉:tU܊jRU_ZNjE؋U9t}uuRY_Eԅt < tB փ8t "B1tA1}~ unFEf"dt`@6&t ɉ1:GS@6&<}tO~u/SCAE\U$H "N  $E 1E]CMtjBBu] t}t E"M@EEDb)EHb) [^_]UWVS]} =Db)3x$< fjsZYu h;4Xhg[_jshe jsshj n[ ho \^ho Q[Y1벋st7jv3XZ>t hr 'X6jsjs u7{t1hXhPjsh1[(hv js u h;4_hjs { t&u h;4n^hz cjs T u h;4H[h hUh ,XjsZYu h;4Xh js u h;4Xh h7Ks hjsyh js h Cphs t=jvihdjv U; uh h A_vh s)h sY 1\ %1&1_ 1b  V S9tRhxj}W^oWV^w-C yh*he)t he)u7;\)Phe)e)jPƿe)\)XZ=\e)t6u h#kXH he)\e)Pthe)e)he)te)qe)le)1ۉB9tt 5le) he)e[^]U}ujjjjuXE\)@\)jche)Z8tPX \)u \)u19WUU0 wj jRT] Hu1xe)qe)UWVSu}Et8uLu+E@1ۉ1۾E?C:-uލBztՃz-uztĊ] :MtKu5>:u$EEEjEPh$}[à uVh $cJz:u벉뮍Hz:xuWمuU6<:u!EEEjEPh$[à tuVh$h7&>Pjh$`1H9ujQh$Zà 1Mjhh$Zà M+E@1?1ɉE11ɋU Phxj MQOhMQh4$_Z ÊEEEjMQu EZ( t1E1҉URjTe[^_]UME  h;$XUP ute)=qe)uxe)1ɉ |e)qe)h|e)hxe)RppUVSM`e)t:u>he)u1:-uztXhe)z-uztBu he)ͅtɍr8tuPh^$9Yy:u܀y:u.zu he)J he)2u Phq$eT5de)15`e)e[^]UWVSj,he)^_zth$:8->E he)1`e)jhe)Ytzth$Sle)uD8-u @P5le)P)Xgle)9Zyh$9|EPá\)@\)te) le))<}_߉ƋM9sω9s x19r )ЍpkME9s 15xe) \)u\)t|RS[PYle)9} h$\)B\))أle)te)ljNx=pe)tE73 ZEy1ۍ te)1u1xe) \)u\)tQ1e[^_]Ë7&z8U @c)x@ 6@7&J87&z8]ÃxuUSt P XK]HÃ8uU1҉P8u]UVSƋXCF~hy1A1ZAf@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P7&JHR P UPUSUJtXxv-u~u C $t h%7&B0+B8PCXe[^_]UWVS46&E=u6E8t hh? 3=6&6&@c)} E=6&6&@c)\C@c)\GNà " @c) G46&(=k@c)H}t@c)G u͡46&@46&=-} uE( u ƴEu 9E@E菴t9u& u46&7&HH FՁt| tf,jE)VP+ &kx\[x @c)@x 46&7&HH @c)xO H6&)Q7&X46&U)Ѝe[^_]UWVS@} 7&B ]urV Y wVh%Vh% 4? h%j"S|GSZ؅tWh%}xM4? h&jPGGSUWVS]S;56&MM E,ZY96&ulPc_H=e)9s<wDu 9rMW5e)ZYt%e)=e)M܋=e)5e) &&S>e[^_]ø7&ztGUS])ttt*2&#i)i)546&P])ZY]UE])jZEEU\uHر u"46&7&@8xtjjX聮jjh耮 镱UVS7&Xt 1ۉXX=x tjb7&1҉P Y7&1p846&P0 @b)x8b)P8b)0Fƃ)c t,~tŁF $>  46&7&PP @\ |td;Z=t 蘰 uc?&u7&@197&@_|u7&@7&@$&t;u,7&@ 7&@ 訬7&@7&@r7&@_蒯=t0 u746&@46&7&B0ztjj[Y7&1҉PjhI Và ؍e[^]UWVSSá7&@tuxt =7&,uyGEt7? t,O8uQPZYu? ^_8Et2jw.Y_t XS4$PSd Rt 7&1҉P؍e[^_]UVS7&p$ t jj7&ubX(x,u{ upV ZuhJ&P: uBPV7&BC1ɉ ^t‹(wjpVe P0+P8RuF Xe[^]Um7&B]US]V9tjS]UWVS 3t u%j 8XpZʡ7&@؍e[^_]UWVS7&@}t11[WT@ t1MHwRFuv7&@@},jEu-뤃uj p1AXumtCMuj 18XMHXj 1҉WPMHGYljރ}t' }uZߨjE#BW}uG7&}u:7&@@ T@ }t jj7&@e[^_]UWVShEӉM7&@E1E\)E豮E+6&]jEP=( ZYt I fxI u fx @c)E46&7&xtjjZXsbf@fLd;xcTd*"t~L tgF=.H#"$d> Džd't+pЃ辥PЃv;46&7&ht蔥PЃw tSdCd\ƍ@;w`u h&\u9\uh&ރ?bDžd Džd11`PЃ `w t0)Pw t0Pw t0臡 Ad9ud(=w h&0=@c) á@c)HCw6 @c)?ʀJ R @c)CC@wj @c) ?ʀJ w @c)CC @c)?ʀJ vH @c)H@ @c)qwj @c) ?ʀJ w @c)CC @c)?ʀJ vH @c)H@ @c);wj @c)?ʀJ w @c)CC @c) ?ɀQ vP @c)P@ @c) ? @c)?ʀJ w @c)CC @c)?ʀJ vH @c)H@ @c) ?ȀP vQ @c)QA @c)?ȀH vJ @c)JB @c)?ʀB< vA @c)AA @c)ph '} ~€ u @c)st] t%舡't:\uy=uh& 46&7&xtjjFX  ŠbG  <w @c)C @c)sfxt @ @c)C=u @c)s\ u'46&7&@8xtjj^WHtujXY>tt-uVƉCY;b)} ;b)~b)}>uQy>u |u &u !Utv&uya1ɉK7&dj`dB(7&@(X46&PZ-7&@(u @  1҉P 蜘y1s7&X$7&@ W7&\H,hP SV7&p7&@ X P(Xu1 @c)GD@c)r5H"0ǗjhډMX@c)HXq{t "E @c)X+56&T @c)`X@Džd{1d#kDžd}tm"E uW&DruJt?:}u5e)e)jjhe)ٖ 1ɉd躖Džd "E @c)t> @c)x`@`H`"E uKЃ wC @c)x`@`H`iÃdt@@Ѓ v6t'H@c)X`XX, Džd @c)x`"p=d%:t #u)Ph`? ֈ[Z…t!Džd[Sh`? 跈ZY…uH% @c)x:F p:Džd @c)xF p_? {`@9Ë`uBW``Dd u(}t# @c)x#F p#Džd詔d1ɉdGfxufxt dT6&Jwd@ ӈd ӈ{dNj@f@f@dK@I 1҉P:'uAW|I u1@c)X\Nj@@bG f@@c)X$諓H @c)JNj@@BF @f@e[^_]UWVSS7&1ۅtXC17&0x tjR7&1҉P YF8Pv v^S‹FP U8tSj7&pZjhH P`7&HUJ@ B 萘]e[^_]UHu+]UWhPT\)lژd7&`\)\}1󫡨7&X1pjEP5 ZYE\)\)E7&Tjh` jhH Pc 7&B t$Pt=^7& hppDžt1ɉxR|T}E7&jjtP袉 6&pnX7&`7&d蜗Zl\)\\)\)u jl[ Džpu^jQ-DžpY'X7&`7&d.Xl\)\\)pu hpp}UWVS 7&@1ۉ]}U 7&u@$x @40$> j袿jCjj Cu;jiF EjUBjbjUB뻡7&xu jF Y1҉V @j]j á7&x 14$pCjj_Cj7&@A. u7&x,u pr[u hq'j腾 7&PS @0CB7&Yx u`x,uZhp谹^ZuGu 7&up0pY1҉US@PvjjfHu?8j@7&1҉P P7&J0HCBHYvB7&@-ttjjjCV7&@^Xjk 7&B0+B8C j f7&p0C57& ~ uhv脸ZYt hCEFu7&xjƋE0FEY7&xu;7&x  jj p0‰EEU表7&@Zu UBE밡7&xt jj@0FjF 7&@Yt-Pv jj u 7&@FEM1҉@{j jeC1҉SY^tNjjLX=V7&tt3j7&@X&}t7&@uWd^_Tjj 7&u@$x@1ɉutt;tj ;XZÉs؍e[^_]UWVSV} uE E1ۉ]1]7&xn 7&u*p0QƉXYtա7&pZu1뿋H up$E0FE뢋}9u}} uwj7& 46&H4^S ZYuh'Sqj/v~ t h't 7&46&+A8F%F7&1x4R@@u} u jj1E1҉j1ɉHEFE F 7&@0F[e[^_]UWVSS7&@1uG u=V7&th'7&@puWj Y1BUjBËUBpXYUj)&C^Ut1ɉ ֡7&@tj)pZƉe[^_]UU7&1ɉHHPtjjYX7&1҉P t/Ht37&@j7&Ytrrh')&7&1U11ҋE]FUU Et 9Pt]UMe)tPt9JuB]US]j袷SCU PUPUP X]UWVSEP} [y h1}%u;57&~57&ExWZ=w PWV% `jjj uNuU jj*jj!jjjj$jj SEpuj:uU Ee[^_]1=e)UWVS}u }t~h@VW à VW) ZY}t9u9t:WAU X19t-y袹0PVWh(SU SVWh(L$97&}7&؍e[^_]UWVS]{tN7Gu e)} t} t&Wxjw PR+GxPT YWZ1Ce[^_]USe)\)@\)uSwe)SL\)H\) u\)t ]#]UVSue)t1u(jS#ZYFxPT X6utse[^]UWVSu] 957&}57&97&}7&9t7SS jjSV%9t8VS W0PSh("؍e[^_]US7& @7& 7& ~.CPjjR x97&}7&P2S X͹ؙ } e)]UVSue) ~;b)|l5e)j V}R à x97&}7&9tu~tvhxS S4|@ ZYt vVuQShLMSh*EF y)KySP-Y P-PhxSq SvXZۍe[^]UVS]葪0u&=f)u f)u\)t]=|f)uTY=f)uZf)tOf)8tCt>g)f)@f)=6&tu\)up \)0[^]US]SVYt ]]ߴh$SYZtS Zu]US]*t%S ZuShxj hdf) df)]UVS]} t"KyS P ^ P VPhS  t?uSh ZY?t.!KvyS9 P X뭋P 롍e[^]US\)@\)f)t8t P21҉Yg)u1f) \)u\)t ]]Ëf)uf)t9u=g)u 1UWVSu} =f)t=8c)t?u;f)tۃftGtt; f)Wt2<=6&"f)uQ=\e)uH=n7&t?$=6&=7& f)u> uU4f)tY<I<tG<0<#t5<< f)uw EPjV蒞 @}ttKtR1N=7&t tFv =6&u <t9uy PV}ZY@t\u f)u jV ZY1E܉EEEN>v r DjEPj? e[^_]UWVSu] uhs蠞ZYtshV~Y_uh*B j57&h h*VN_ZǾf)tl\)@\)f)P1ۉf)^u \)t\)tjW\)H\)ZYu\)tG@u15f)1ۉ].{hv V DjEPj7 5SP9 XZ5pf)4Utf)Epf)]UWVShA P ZYj'V^_Zu <)ș19e[^_]á\)@\)7&t,UP17&7&Z \)u \)t \)u\)tUWVS]߅~91Wu u6 ~ )Dž~E u F ~) 8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfuh)CfKS u>\)@\)s6C CC\)H\)^uV\)tMFfu9s\)@\)6CPRC S)S\)H\)ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 97&u]e[^]e[^]U57&uXZU57&u~XZUPuu EP E u h+*uPJu UEPu u UE Pu57& UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'V{[_Ztt~tnh+V褀ZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%hA V ZY<tBEt7KyS'P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KySbP'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'97&u]e[^_]we[^_]U57&uXZUh7&Mh7&CXZU8ruPh+Ph+UWVSSEPE X856&6&@c)j=RUXZYj=SXZYU))9~߉Ӊ @c)I @c)t$<=t xFU蔗p UCɅxUvU] Ue[^_]}, UE1@u,Di)+@i)Rpp h,jhj)观 j)UWVS]} Mt t9u t113"E ƍCt9t"E u1@t)؉[^_]UWVSS11h)tZuA=u܍P襓EY1h)t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE*e[^]h,S"|ZYSHZ9u;Shj'SVY^ƅu+Sh.XZ/<'uh2,sXuS)Ph5,t e[^]UWVS]} sSt"CtS҉XuEs1Et Wh!Y_}t5uh XZ$7&Jy R` 7&z9 _F>=u y:Cu}thwUFPZY7&HyP7&H X J e[^_]UWVS=,j)u(j) h8,j)Y11ۋh)tJG} tE t8tEt.(j)9P5,j),j)%(j)XZ,j) ƉW 8t9J8"u/EUE9EsShn-&9]u Sh-EMDJ@t@E}u9tՉe[^_]g_UWVSQƉp ukIe9Fu[~DJ 9uJjjbJ Y_UP(PUR9J Hx N9 uWϪXF!؍e[^_]UŠH8-u>1tfzuh jjh`C 1zuHh jj h D BRZl .uh jjhpD h-PZ}ZY1uhD UVS|ƉӀ8!uxu :\|fxqpftft!f u&PUZ?;*;"|f uPS[^1PSgZYuNf$B |&E%=E%=@E%= E%=`qE%=bE%=SE%=DE E E 6M;MU؉!]m ]G 9>(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$B SV-{Y[SV{_ZYSV{[^SVzZYƉ׉11 Ɖ׉11 ylj։91lj։9rlj։g9(Tlj։I9PV^_xPSZY04]E9uc9u_E98PV^_uWxPSZYuD04MU9u9uE98f9]PVM^_t1PxPS6ZYu鋅|9u;xu͋ 3E3U MQ>~u5!uډx!(u;)u{u ?e[^_]UWVSu] h3x_Zu!Nu xtP!zUW Yu UR&DPtÅt S0 Z@tM}th6uZYu }tM1EE8%u!Pz^X6h._Xz}1ɉj EPuhljыE 9Et:8u5 t/u u 9uM|8Mt#y޸euPh.M EGSWl YZ@u'.|RPh( Etu jW. XZMu-UVS@'b)^)b)^)51t j=S<YZt hSLXZ Phxj@]S.g jShL/|j h7&hk(j h~h4$We ƒ uQ-j PhX#2j,hQ/h#!j h~h7 $e[^]U =\)t 1@b)j)Ɔ?j)@j)e[^_]ÍL$qUWVSQ01Y1ɉ j) j)7&f`~Fj%s 1_Zu1h%SV < tLu%j)ۡ&)ƍ NAEčCEԣj)j)EĉEEp<<\uB1ɍUiE衸7&HyP7&H U[븋JE<%u}%u?7&Jy$ER~ 7&ZEYui Yh:1Vҟ _Zƀ>*uFE$Eh2V讟 Y[EEE8.u(px*u Eh2Vt _ZEEu uhA1}f?f}‹}G}HE @,1e[^_]UVS]ss 3shN2?T N tVTRPhy2T S+ S. VPh2S e[^]UWVS uj:u 'ZYE u h2j @E } hO E Pb Y_8j=P'_ZqxEPh2WO E }w t24&4 u44r4r"44@u4@t"4y4Àu!4y-4Àu4PI4 r4 r#4' 4 r4 s#44 r4 r#45 r5 r"55u 5t"5~5u5u"5^W5u5t"570%5u$5t%5 u^,5?'3t3^,5}wu135%45u35;5u:5u":5B5uA5t1B5`%Yt@I5JQ5@3>uMH5*tOP53MH5 P53^W53@Q53^W5^W5}w s 3 r3%=t)wt=u&3=u3 33Q3 r3<}vw s3_5#'_5 r^5 g5rf5r#f5n5rm5s#n5v5 ru5 s#v5~5r}5s#~5oh5r5s#5F?3s3sj3^}uS5PN ;t3CaP3h5jd,WA 1 11ɻN ;}t SC8t{$(Wh5j ,(PLA CPh5j }(P%A $A u,Pk We Y_1Ƀ bt,PI EP@ XZe[^_]U Ph5hp&D j; U塸j)6=j)uePRPh26hp&D jN; UWVSQÉU10;#uCj EPSS T 8t Shj E8tWSh6j e[^_]USÊt%<#ueS|UZt@j)]UE E EE]LUWVSÉU}utj VSiR  @t 9E s +T8"u"3O;t)t:Et&fDB@fO1e[^_]UWSPh6s(Zu$).j URPQ à uS8"u h7j 1ҍe[_]UWSPh!7 (Zu().j URPQ à uZS8"u h17jk 1ҍe[_]USÃ=)t =)t?)9t6t2@t=u@QRhP7OV )1))]UVSƻ`W t[PV1KZYuICƒ )$)C()Cj)C 1f‰)te[^]% Vhl7jH e[^]UVSÉ֋t8uVh7jURM1YZtVh7oU XZ)1EEe[^]UWVS11Dž=0)~ Vh7U XZ1 RPhS~=t=0)Vh7Ҿ &f}Uu1.=0)Vh7T [^v49tV Fjs5 UWVSÉ֋t8u Vh7jURM/_ZuuEU8/u`)UU@j}WM/nZYuC)EEE܋E@jWM1IY_uEuƋuEEEEVh9Q XZ)1e[^_]UWVSRÃPjh9h&= Cfw4[ hOPh:h&= s(h:h&= s,h:h&w= s0h&:h&e= $s8h-:h&P= s4h4:h&>= Kh&h9 Ea6Whz:h&; vWh:h&; F (tl0F c)h4>S!;^Zƅuq;jP11҉ZYth>>E _X )Fe돍VhV>S* HuEt9j)s(he>TE j)f)[^f)uƅhBS):ZYujhh)hmS :Y_ujhx) {h>S9_ZuAjV11҉Y^))h>S9_Zu.jV11҉Y^)h>SM9_Zu.jV11҉PY^L)h>S9_Zu.jV11҉Y^ )lhS8_Zu.jV11҉ZY)-h>S8Y_th>S8_Zu.jV11҉Y^~)h>S@8_Zu2hV11҉@Y^<f)hR"S7_Zu2hV11҉Y^f)Wh>S7_Zu2hV11҉Y^f)h>Sw7_Zu.hV11҉wY^uwf)h?S87_Zu*jV11҉;Y^u;)h?S6_Zu9jV11҉Y^tWSh>f)Pa<w{tSh'?;=j)rShB?kA <~!jShb?IA ‰))]‰))hkS,n ^ZÉ;uh7@ Y[`Z 1Vu1Zߋt ujPSV uO`Z )V*1YÀ;thkSm ^ZÉ;1ۉZ ]&DPt7hP11҉ZYt&h7? ^X Dž" !v&Sh?? h?{? 1ɉ)_ `)Ft<$`T u^ \`)l)F )!)13FfF`)l)F )ta)t613Fsl))h`)Ze[^_]UWVSP1۾`Z <`Z tCtg1}jSEP`& th?= Y1@E h9 jSP 1E4m FZ9uuq_Xe[^_]UEU M= 8&tMU E]29]USÃ=D)= )u1҉t%Ph`)XZI u= )t =H)tI Vux=8)u=,)u7j_ h`)hedAS/ tHh`)hrdAS u/h @j h`)hedAP y h)@j ]USQ`)WEV)WEVf)h`):f)X=D)=H)u2h`)hfdS y[88tQ88t:@rE=H)u2EPhmdS? y hK@ZaZ$8&hV ! XR=H)t1&h`)hgdS y\@:]UWVEu `)t `)e^_]Uh)hmd5$8& UEU 19s f3P]UERPZYUS]EPu  h&hS; ƒt$< ttj S@ ZYt1]US@8&tsPhE# %/`E EE]e# U=)u PhEP: ~9$u ~#EPV EZY9uy8t/j} tu Sh'M辉 Sh{讉 _X뿃} tu /Ph'M萉 벍/Ph{z [^띋$t $PwAYPjAZ}tEGjPS y h% XAЃu ƀt/tu1PH$u h" e[^_]UE)E )]á)á)UE Puhp&t hp&j ! j` UWVS]8ށu=)t5)h? YX=)t"=)u5)h[N 1)XZuu !ZYyWGPh` t7=)t.j j X=)t5 P5)hiN) j e[^_]UE Puj' UE Puj UE Puh UE Pujj; UWVSx1ۉ)Ph[^_yhNhVu ]t Ƅ1PSχZYyShNLY[u%=`uz 9u;u)Shh)(ƃ uShN뜍xPVR_ZyV끋%= VhNe= u:u*ShV`( t ÿ"ShN0S螿 [+S蒿 Y0hVc  u|h)h5XZ|듉e[^_]UEP; ZtPRPh O u uhOhh )  )U)tjXj USj0h ` jN)jj ]USjX jjt jjk ]UWVSÉ֋x CPww wwփt=)~j  X)e[^_]UWVS1=)))1)))1 Dž腾 u/h"Oh-OI [^Dž SUYu藼 Åu~3hV ǃ uVh XZAP~XEtVhKO! Euu듋CuOHujsVsUYE >9 C 8H1u"Wh]Ohp&\ Dž CC jhPjV Ãt'$Phzd@S @uS[W YD &9rDYt)PH)t4KRWQ  u <tPȉjW8C1ɉK C C1{;)C))XZ{ t%Vw. YZuVhoO XZ?jaVGG GG1CG8{DžaETuDž)Eu)} u:E 5j YtshO s _Xtvh= 6M 9~=) 1ۋ9U tE 9}?Cԉ a^ EtPs sshO …g=\Qs sshOhp&W ҋC'BDž 1)C) 1F)H)~ + )(Pa ^t5)9F6냽tr)t`:t(hOPhOhp& )t/;tTPs sshPhp&W ͋ ɹ  Ph!P Y[0F1҉StPVS s6s6S6 uU89;))?uǃ tuU E t$9{p1҉ e[^_]UWVS]fU ffCffBCffBfCffBs s艗Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss趖Y^} GWss蠖Y^GWs$s 荖Y^G W$CDȉGDs,s(rY^G(W,C@ȉG@s4s0WYYG0W4CHȉGHsNjCSMEAE@ufFZ[tA 1H)Ee[^_]UWVSu^8C@PvBBp+BtPR|[^t)) hPqY=X)t-5(9&jjjj)) h QZu5,9&RPjjPt)=X)tohQ" b5)=) t(jj[[XA!HfAWV#1))XZ=X)tj u _)) tjjRPe) )u hQ+5)5)[^f%f=@hKQhiQ ZY5)=)5(9&jjjj)) xRP5,9&jjy\jj5)5)ƅDžc WV@@PP WVf@5)5)5)5)蹷^_8thtQ1ɉ H)[)) tCjj RP}{C9s#Qjj RPzN019r)#u 5)5)u"hQAh# 1H)XZ謶fH^_f@t 5)5)hMu6!@t%hM5)5)5)5))Z[@@fA\5)5)f@5)5)ChQ<$u thQ =X)j XeY[^_]aUWVS}u w wTXZCfEE9uc0)t=X)t =\)tj jjjw w'u0)jhQW  w wNYXG )9O u,9&;)tf%_f=@umGRhQw wgE)PuhQ =X)us=\)tRyNj hRXZ=X)t2h(R _=X)tfE)fCe[^_]Z h4ReZHt1ɉ H)x밍e[^_]UWSáԙ)p8hSY t& ԙ)q0RP¡ԙ)H01z 1҉Ѝe[_]Ƀ=$)tf‰Ã=$)tÃ=$)tUWRPoY_}UWVS(}M] U ));E] w+EU 9ԙ)p8}E9|+F]!É]E !ЉEEUEU9}"=|)tWN#uVu uhFR 5ԙ)}̉Euuu u;}EmEԉU؉E܉U\TtFЋ]!FEU؉E܉UFEUӋEUEU EU9ME FEU}9Ћ}=|)tlSQu uhnR ԙ)\Tumq֋]!qISQuuhR ZE̋UEU؋}9Ћ}};=|)tSQu uhRe ԙ)uuhRJ $럍e[^_]ÍL$qUWVSQ0QEU}9Es9=))EsuuhR"{(),)ԙ)sx1uЉ}ԉ t9E}rEU9E}\1ҍMQRPuusŰEUEUċEƉE؉Uu܁Tt-s։!U!CЉEUuuuuvK` t1Ɖ׋Cu}ܡؙ)t`s0WVխؙ)ԙ)@x1҃ RPuutM])Ӊ (),)ԙ)@x1RPuujtؙ)R=P)tЍeY[^_]aÍL$qUWVSQ8QEU))Ӄ ))}9u}9u9=) )EsuuhSy))E؉U܋E9EEE)@Ẹ)ԙ)\1ҍMQRPuuqUEUEUEƉEЉUuԁTt-s։!U!CЉEUԋCx1RPuutK` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=)u )) ))EUܣ))Suu5)5<)腧=())})E5)=P)19}VVdf%ZYf=u Gvdv`YiYYF`VdvlvhFiYYFhVl1tttpM,iYYM؉DpTtA u1MiYYM؉Auv<=)u ԙ)(1E؉Ẻ}EċM9MSuu5)58)躧rVVif%ZYf=u+=l)u"}uFV c9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡) ) )=P) )ЍeY[^_]aUWVS u} ԙ)M]1EuuWVYp ‹Mt WVh'Su1) )1(),)5)=)5)=)1)=)8#AH)=P)态1ǣ)1ã))5)t C) =) )Qh)ZYu hLSte[^_]á)tUP$Z1ɉ )1)UWVS u=P)tFVFV zEUԙ)H0AEUSQRPt w 1҉UtE4PX3)RPuu n)1{{E U 1҉CS1CC E UC SEC$EC( P)1E v 9st DpTtD(D,T0Gу} w))9)ub11tDXGu뺍PR9ZY=)u hsSr))d)P))e[^_]UWVu} )RPWVem)t9xu9p tWVhSre^_]Ã=)tQUS))\;)r 3X5)5)1))ZY]áؙ)@ UWVS$Ɖx@t@VЉ_uDž v vv ԙ)p0vvxNjHԙ)P0@t 1ɋ9}=؋ÉA빋EU RPlÉ19r= )thP)tF1ۋ9}&G q1bYYQCG W58)ɣ[X9}W ʉ@~e ԙ)9Htԙ)9Xt~zG=P)t T <tYv vhShRw RV莤t"G=P)t 1ɉ ؉L1҉G 1H)C|W58)[X"~@)EU 9GG=P)t ȋT tdtJ1҉FVuVЉYu uXZ]gE E H1ۉH)FV RPRPhS¤ShSo hS蟛Xv v!ZY=P)t@V+EU FV@V z+EU oFV hS 4)gX g؍e[^_]UWVS uE 8t18E 1ۉX0X4P)tFVFV щ} G$W(ff%f= ԙ)fua(9=)t;9ظu!t F Fu~hu)}t@󥋅 󥋅 w0NӉWVSQh1P) t ԙ)#8tU@DNL!Ή!؉HT tԙ)@8] C t`d E x@1҉H)P @RPRPhS聡ShShl hS^YHE p p^X=P)ԙ)tp0PCSp0 ЃW)  B=P)=l)tzGf@t`r@GpufGGhtGtSfGyXZ G=f@u1))))FV =P)tGFDG FHGXGpFDGtFHGd F@VW[X=P)=L)t =d)G\uG`Wd uGhWl tlhU[Cht[ou 1ɉ H)21G\G`GdGhGl f!0XZ=L)ubԙ)X4 ؙN0ʋF4f0F0V4=P)LGWF ԙ)W\tF@I0D11 ԙ) G\<#8ts@DYL!É!ÉIT tA8F D`Td uDžFVVV[tbGhd19u 9RPh[mA=X)t h[- Yh&b7mZ_XF0=P)tV4CSCh~@jjv4v0vHvD wh[@hUTlH ZY=P)t `)@ `) 4e[^_]UWVS̙)E1ۋ ԙ);Y,EUu\TtA!A1EUAEUEU11tAu}׋E9ƉU}=E1EEU)CBHLY4DEUE9ƉU}:E1EEU)븍U1Ee 1ɉ ) ) ) )Mԙ)];X,}|1Eu| ԙ)EXZ\Tu]e.Qҋ}!Q1E]]UuI SQh )p5<)ԙ)}=()t =$)t =$)t5ԙ)u5<)P =P)tE@x ԙ)1҉EU=)t6ԙ)p,kEd1<SVuPh[hp& 1)=X)=\)ExU t1U u E#uh\=_XExU uۋ}G\M]ȋ} }tyt<҉UEyEE)ËEsM]1EUH뫋u!Ƌ}! uEU9]u9MuډM]EE)ËE} u 1s<}%?}u}9t uuu(xYuuhL\;jO 1xM󪋅xC|UEUpt|}9r WV/XZ Mt9uɋp9u|]5)= )|U) )ԙ)M]11 19E}eu5)9|]s1-h1l|]+hlȉ uv])]1t_}}9u}9to<%?u9tSQh6\:jԊ M]WxY[M]u Wuhp\9MEsE)lj1VEi1 )e[^_]UWVSEP@EUE@ E}juu# t )t`}9xuPu9puHEuuh`Ep p{ )qyEpxu}qy )9)u )u덋= )98tEUMK؍e[^_]UWVSTU1EE ę) )111Eԙ)x,9}=)t2kEd1E7uWuPh\hp&O 1=)1ɉMԙ)M;9ظVSXZts]u$)=P)tGuEG.GptEGtEGEGtEVSlZY8tEPWZYuEHEe[^_]UEU @,+B,]Ƀ=$)tf‰Ã=$)tÃ=$)tUWRP(Y_}UWVS EX8=P)t 1Q=l)tt1;))slj}1RPk@C^_DžE@4} G0.3ChgbP芙ZY'Mqy u9tXY_8u695)|_ssدFXZC SCS u95)|)js s]Ah_,#hP%O 3ss訦1ƅs{Dž ^_=P)tBBBpBtVR`ZYu h_["_PsstQDžd ss輥VPtVf@Y[5)5)~VfHXZ:e[^_]UWVS(EP@EU̙)Eԙ)RVuu!EEmƉׁ\TtCЋU!CQC RPh )S5<)ԙ)}=()t =$)t =$)t5ԙ)u5<) ExU t U tuh` XZ1ɉME@ Eܾ}juu |EE1E؋UԋMUM)EMBę)Åt4}9{u}9{tPHSKę)PX#E}tlExU t}G`ǡԙ)RPuuӉE1EЋE̋Uǃ))Ex@t+jjԙ)@4 ؙRPEpHpDp pa ԙ)Ez89x t0}t*E@$ EL@ EUMM}tttoԙ)E{89x u^E@EL@jRPEppK` tPuSYdh 5ԙ)5){%5ș)5)W=$)t)PP-zXZ5)")h )zR@)e[^_]Ã=$)tUWVS\U1Ec 1uԙ)X,9] =)t/kEd1VSuPh7`hp&Rw 1ۉ)ԙ)u1EE1ɉM)MU;9WVWVQEu} P)tCECECXCpECtECd EEP$$a EXftbWVYZt=|)WVh_`!WV^YZt!=|)WVh`bs SEP襛XZ)Ѕ9xu39pu.JZHX)R׫jhQEPLjhQ$tC CC Cu jh`jh`EP躴`WVPh`E?Ee[^_]UWVSԙ)̙)|jj'P1󪋅h_X=t)xX$=X)uh`*G^uha)[=X)t؋1ɉ$p)h 5ԙ)5)!5ș)5)+T=$)t)PPvXZ5)t)XHXI$~6P9)`~$tl<hNjH`ltW,Ћ9G0sVha$^_n=X)tVh2aY[hFaEZC=X)uՋB,t|Fl$1~H`F|@ltË#XLS5̙)|^_u hZa|̙)p)h 5ԙ)5)}5ș)5)Q=$)t)PP/tY[5))ZP)tt DžPLDžHLPP1󪋅lPP TCHX$~@=)u\t`H`CXDžU X)Xtu{xlLtuQ+HhVHXDžU 1DžPDžhDž\TPhua1hDž\L1 l)׍G@tutL9t G@L9uՍ1󫋅<8tx@8txؙ!lj!׻9tx}^x`1d`dtx)ttx1tX,9t=)t4ktd1=VStPhahp&n 1)tl1p𙋝ttƉߋ\Tt#@`Ћt!؋C1Q@ RPh )F5<)|=()t =$)t #=$)t5ԙ)|5<)r =p)u-|xU tU ttha[^=()th )(H@)Y=t)t =)u() h) d) ԙ)Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP5)58)kC ԙ)𙋽l׋pЉ`Ɖ׋`ǁ\TtAЋt!A1qhARPh`)E=t)tthaXZXԙ)ph5|)5Й)l =$)t5Й)5|)*n_XЙ)\8 uǀ\T5ș)5ԙ)KY^=t)th bPE_Zu)5Й)5ԙ)CY^u9L)u ԙ)Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP5)58)Aj5ԙ)HXZΉlߋpËlቅlpplp8T<DT9ƉD} TDP)Tl)Ƌ|@`ui@,L`tLH9t||`t||`tLH9tușD1ff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU u H1׋h󪍕U u P1׋Xu"xLu DžU t11ۋ;WVBZY< <<tt<<tM U u P`ك⋍`9s WVPh.b CVtuPU u PU u P1ɉ`T9lpD)8lp1ۉL1[8L9˃<1҉@<@8 rRځU uT ڋ`Lى4ً4 @LC99hHd`1HU u HU t PLP1~\Hd`11ы1Ƌ1f$H```ktgU u Tjj(R``)ٺ!PMH8șlp`3$\`x`11;dsV`!։lt @lt$9~؃҃u`GCl뢅t$9~ș`l tLjS P =|)`t'W3VslsQs thKb_ (hbPX<ZYtej PSh 5ԙ)5){5ș)5)A =$)t)PP-d_X5) )^1ۉH)=p)tP|x\|P uT|PTxU u |PTHU u HhRP hb\P@;ZYtw\S|p HU uHڋ|xU tT |GThRP'h )c;@)1H)=\)u)|xU |P\1ۋ9PU u P|U u |W\ !8uC<1ɉt[|xU t |B\u0tȉlPhb,YXlAu1ۋ|@H9=U t | |G`U u T !8uC<1ɉt[|xU t |B\u0tȉlPhbOXZlAu농U u PXRP txhcP8Y[taU u P|xU t |G\XRP h )8@)t j SVk  =|)ts hcZ DhbPu7_Zts󥋅ƀƀh 5ԙ)5) 5ș)5)<=$)t)PP<_Y[5)&)Z1H)e[^_]UVS1;] s8ShzZ ^X1E0PhgcY FZYuj X XÍe[^]áԙ)!UVS1ۍsrT =X)t409&hc|Y YX"lctcP.Zty=X)uɡԙ)t4象ԙ)1ɉ Lh P5)J 5ș)5);=$)t)PP]XZ5))X15H)Ktԙ)ԙ)=X)t hc貟 [hc-Yti=X)uۡԙ) h P5)5ș)5):=$)t)PP:]XZ5)$)X1H)jWjWYXuj]Zuj]Xe[^]UE)E )]á)á)UE Puhp&o hp&j q jQ UWVS]j8ށu=)t5)h?nW YX=@)t"=)u5)h[NJW 1@)XZuu 8ZYyW虗PhW t7=)t.j )V X=)t P5)hiNV j_P e[^_]UE Puj' UE Puj UE Puh UE PujjO UWVSx1ۉ)Ph[ ^_yhNhVu ]t Ƅ1PS ZYyShNLY[u%=`uz 9u;u)Shh)wƃ uShN뜍xPV _ZyV끋%= VhNe= u:u*ShVx t ÿ"ShN0S] [+SQ Y0hV"[ u|h)h5XZ|듉e[^_]UEPI ZtPRPh O u uhOhh`)FS `)UD)tjXj ^USgj0h@a j H)jj]\g]USsgj jj3\jj*\Sg]Åt3USӃ=X)tPh?S YXShcXZ]USu=T=Tu =Tt=Tt=8 uI,)t=u 1111$)) )()1<=T=Tu = 8u1ہ=,)묃[]UEL) h)t,\Tu ǀ\8 Tu ǀ\ 8=d)t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXC"Zu"hd'[=$)t hd)Y=()t)PPQXZh 5)5ԙ) =$)t5ԙ)5)QY[ԙ)\8 uL)ǃ\T1\TP)uSChEZd= V )΋)ѡ)ƉϋKdC4)RPWV))) =)TC,HEƉ׋Eǁ\TtC!C1uCRPh`)'=t)=()t|)PP^PY[ԙ)ph5|)5Й)h =$)t5Й)5|)&PXZ Й)\8 u ǁ\T5|)Q5ԙ)u tc=|)udEKheܑ =Й)ԙ)shX9s΋9tRP+ԙ)Ph0eJ hș)5ԙ)*() h)[^ d)t[h 5ԙ)5)q 5ș)5),=$)t)PP#OZY5) ))XE)e[^_]UWVS]u E)8)D)xPS= Y_y\0PShzef=T)t(jS<)_ZyT\0PShe5%= tShwhYp u13I =)t 8)=X)t"he/_jS8)ZYySheH 1ɉ @)X) @)u SheH XZ1@))))))1))h)l)1x)h h膊)h hlǣԙ)h hV|)h h<Й)  ʅ ʅˆt heVSSY_¡T)t"ujV_ZyVhxL ^<)=T)u%RRjPVM8@t))t:) X) T)PDPj5<)S7@u SheY^Tu Sheh"tVR_Zt%hfV}RZYtVSh$f `LuShOfC\uShrf+5)V4uShfuShff^_uShf܍X1‰11p~u 1ۉ)}Tu%HSQRP(DžTӃ~ ƅtBtѥPD1D1É1P1RPWVOډSWRPnhgZ1ۅ~;srPƉρ}Tt!1׋ t1)1t ;r5Ch:ghXghughghghghgD 5)hh@^_=KÅtԙ)\Tu [t1ۡԙ)!@)=X)tth"h[u hJhYYԙ) h P5){ 5ș)5)%=$)t)PP-HXZ5))_1ۃ=|)tԙ)PhzhB Y^ԙ)=()uNtJt2=@)ue=X)tPhhXZ=X)u hhXԙ)8<))C,)1=)C0k NKt鉅 ׉ ЉNj׉   =P)=t)ԙ)=t)x=X)t hh^hh[ԙ)1҉XǀP1ɉh P5)A 5ș)5)#=$)t)PPE^_5))[=P)5=X)t hiYh8iZXԙ)PP #ԙ)ǂL1XǂP1\hș)RC h 5ԙ)5)E 5ș)5)"$=$)t)PPD[^5))Yԙ) tyPh[ihUT Hu^ԙ)  h P5) 5ș)5) "=$)t)PPlDXZ5)V)_ԙ)vuh~ighi`[^Hu\ԙ)1ɉh P5)7 5ș)5)!=$)t)PPCXZ5))Xԙ)@_X5)?))^ԙ)(=P)tx<PhjJY[=P)ăxԙ)(=X)uh_ZHuqhi _=X)th 5ԙ)5) 5ș)5)$=$)t)PP=[^5)m))Y ԙ)8<qH։9u9RPhjqԙ)BHЉ8< =X)uh_. ZHuqhi X=X)th 5ԙ)5) 5ș)5)K=$)t)PP<_X5)))^ ԙ)@DqL։9u9RPh kԙ)BLЉ@D =X)uh_U [Huqhi.~ Y=X)th 5ԙ)5) 5ș)5)r=$)t)PP;XZ5)))_`)=P)0PH҉8<PL҉@D15`)ԙ)=t)ԙ)=t)?,=X)t h/ki[hOkI Yl)ԙ)ǀ, 04ǀ(<PH҉8<PL҉@Dh P5) 5ș)5)=$)t)PP|:XZ5)f))X=P)OL9=X)t hkklXhkL _p)ԙ)ǃLǃPǃT\ǃX`B,F$1҅~K`F@#CLh S5)t 5ș)5)=$)t)PP&9[^5)))Y =)tvԙ)=)uhh P5) 5ș)5)X=$)t)PP8XZԙ)ph5)5|) h`)58) 5ԙ)Shu‰L^_u Shk1׉1ɉ5ԙ)9)~09~NjLWF8HLNd t1RPS5<) t>t Dž)hkhY^Zu1ۉH)j , =()tHWSS6 ԙ)WA8HLId t1RPS58) =$)t WSS6 ԙ)@0 ))11Shs£)XYu Shk1׉^,jSe)_ZuShl}=) )) ȉڃ9 sA)))1ɉ ) )jPReã)j5)>e)…ˆt)PhEl"Shr̙)_Zu!Shhl[^1H)jZ7&ԙ) \)=T)u*t!hfP;ZYu ) )>hSP5)5<)ƃ ))))=LBALt[=)hlh_Y_jjjjjS6:=)fGW69fG)CJtejPhlk =X)uh&bBZu9h[v X=X)tC=)fGW8fG)_fCff=v]hlY=X)uhmZu8h mu X=X)tfC=)fGWZ8fG)_fCffuihmY=X)uh_lZuDhiDu _=X)tjjjjjS8=)fGW7fG)f{f9}zD3<:uƃu}EEUEURP5)u uk )9u)E ;}|v)EUtJ9tFRPؙUEЉEe]EUSQRP_RPhn& RPhX& Fyj % Xe[^_]UWVS}u EUEUEE)ؙMʋEeEUMuuuVW 9Eu@)UMtwhn& X19]~KؙEURP5)VW )9tؙEURPhX% )E e[^_]$ e[^_]UWVSQƉӋJt,B=)n9us sRhnC 1҉Sss ssV)1E1ۋԙ)9)؋r09~ƋL߃=$)t VWWj) ԙ)VEA8HLId t1RPW58)=$)t VWW) ԙ)X0Ede[^_]UEU z t]]UWVS]ԙ)Hdu } t1)9{ u9st7S58))uWVs5<)Cs{ ECe[^_]UVS)5ԙ))t+NdEU  t19S u9CtCt[)uh!ouu uS$SPC))X)K؍e[^]UWVLU1u} uĉ}ȋEER艪Xe^_]US]U tuwtttoPhLo9{@uRs s8 RhXZ=X)th8oi YhDoZu 1]UWVE5̙)ԙ)x=$)t5ԙ)p5̙) * e^_])ÍL$qUWVSQQ9) )s RPhhoH5) ԙ)1ۍ}WSQRP9U Ƹ89&;sAeY[^_]aUWVS\]u EUEUEUEU uEU3E3U u uE [)uu1_Z=)u <vuE (4]e[^_])U1EEƃE9Eu E9EEUEUEUEUEUEUEUE ]uuMURPZS?()lj$SW wG/ 9raEUEUE Et@EUEUE EMRPMURPcZC1ɉ )1҉)1)E EtF?N)Eu ]e[^_] UWVS]\TUH} FE 8uh`O} XE u hoh`SP =|)t hof _L=()1@J =$)uE PP1$Y^E \=$)uPP#XZ1fEfffE@9uރ=$)tE PP#_XE \Ǎ=$)tE PPy#Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\P UWVS}u=l)1H)8)y <)h)P^_=E)=)=X)t hov[h pVY=X)u׋ԙ) )=P)ux șRQn))h S5) )5ș)S2=$)t SS XZ5)))8)Xh)58)5)Th )58)5<)S)1t-)t%FS58){sSSSϡ)9t )Ph%p#1=ܙ)=ؙ)=H)ԙ)=X)t hPhFS yL/8S请 Y h5qj$Wm jjW襶Ãy}tW> MZt8PhF|@S/ y&hF S^_PAtP@Y}}Wt9P@Q XZtP@XiutQ ߋu0Py@_t Pl@Yt_Q ZxSd룅tCQ X؍e[^_]Ƀ=$)tf‰Ã=$)tÍL$qUWVSQ0EЋAEqy AEĠ)Eסԙ)X0]؉E܍EPuuWVEUMUȉM̉E9މEsMp1Mȋ])jj`SQŪǡ)U4ڃr hAq迯_W!ʈEċxlEHX)!9tPRPhWqu)u< =X)t hi(M ^h_2[u 1ɉ H)1!EPT@P}ЉWE1҉PPPTeY[^_]aÃ=$)tUWRP Y_}UWVS EԉUMQƉ׋] ԙ)H0ș9Ή}EE5EPWVuPԙ);B0u ExthzqtXԙ)@0RPWVCUBEuWVPuU tUB EPE܉UM9E9u9t/MC E܋UM9Mt}u ƉaE9t }tcM܋EPEEPT@PƉ׋]E9u1 ce[^_]UWVS,E @XEȍ]ܹ1juȋEp ޅtPEp[_E P@#EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0hqˬ,=X)t hiJ Yh_Zu 1H)1)V] CSFV sC8S<e[^_]UWVSPhjjFƉRP/ÃfC9EPjjSNԙ);B0u UztWV2K_X5$)u  )QrRP3 E@ `ԙ)M ȐȔh P5)蕲 $5ș)5)[^=$)t)PPEZY5)/)Xe[^_]UWVSE XChSlEEUE EE=P)tP@P @ƉuOEXuhq1҉H)YX5$)ԙ)@0RPWVqS E@ `ChSlEUE Eu hq蛩ԙ)H0ș9M}sE E>EPuuunLԙ);B0u ExthrPXԙ)@0RPuuUBEPT@PChSls}EgUBXEU}GWEU G8W<5)#uTGPWTEUTE@ U B 9t`1e[^_]UWVS8]tEЛec EЍc)ԙ)}}{rT 9RPYXJԙ)ws$d 1҉Ut4Vh7r=X)hJTF Xt4VhZr賨=X)FhJToF YRt4hzrkj t4+XZf%f=tCԙ)ڔڐVPhr5=X)hJTE XEPjjQJ=ԙ);G0u Ext+Crt4ljE Gԙ)E1ɉ ‰L_XP=$)%JXF^9t(ߔߐVhr蒧E`QB9uР)8BufJEf9uwhUT@_uS hUT/Yu(hUTZu1H)}tԙ)ؔؐ,F_Xԙ)1ɉؐؔԙ){rT uDVhrʦXZ=X)t hQD ^h QYsS5ԙ),XZԙ)t4*EEPjjujHԙ)Z09u Extuhs1j @E܋E=P)tP@P @u4puSQRPӠEP,ƣ)X1}9}~hԙ)X01uE)ù`1j@@P0_X1U9} MȉыU @ۍzEE܍Hhhs EPUEk[^1E9E~+u܍Lphs EPUEPS |s1ɉKs SZY9t&Xuu h{WC?sPsT1$lPsLsHWpu/}tsLsHh={WVp^Z‹;SXt)tsLsHha{Wp~ YHE ~A Eujjh{h{Wo(uu h{h{WT  EujSPjjuu W Au  ujpPl1RPsLsHWn t 1҉ll;CPs㋕lSTp4aF(V,+F V$dh~>VhhtQDhdv$v tQh{W>,jVjhdv$v W 6lQPl/SX1e[^_]UWVS ƉUMjQRPtuh {V_XfUt+tuuh{VSn^111 tuB t@uمtr} }uWuRJtjjh{V~jjh{VjSjjjjjV pfuuh|V~uuh.|VjSjjjuuV,E E܋E E EWOM1ۉ]G uuuh$|V ~#1ۉESPuuRRh@|V EԊWуt=t8juj1RPEUEURPVi u[]PB2EUE UM ]}uSQuщ‰ @tE9 SlX렍e[^_]UWVSu} hjY[u)Vhp|M XZÉEEU(,E$E U$0418%jhSPVUuhVSQ h|Sb<RP輰 ZY@uh|B$D%=u?$Phd@9 @uh|S&^_$uh|M, ((Phd@ @uh|뭋, (h|S딋Eu ǃ$$, (uO1҉MRQWVq ‹MtQh|SV  (,u(,EU싋$1҉MRQuurƉ׸9ЋM|RVh&}StRVQuuhB}SWVS @tEjjEP11ɉ @t_jjjSEtHt*jSZYt`@ P$@ t^9sVu jRPS@u7tP6xXhk}SS 1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@ @u%hx}SXZuSh}S E]w]US]jSYZuh}jS YZuh ~SXZ11;FN|#~$u~,u;FF |F1҅8tZu"[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu+_ZNjF,uVЉ||t2@|jmURj$O8QJUR|P tijWR*F uYjuWUu!@uuZYjuPUu@v0sh~us[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h~S 1e[^_]ÍL$qUWVSQ qyAQEUy uh~S{ZY8$E܉E1EuuWVi tuWVhSBHEPuuuugƉ׋EU tuuuh?뷋]9ً]}eY[^_]aUWVSu 1ۉ^hVy591}_X1td1SщU f M YZMtUBuShsu} $f (f   VhVyj|XZ똉e[^_]US1,f  f uh `u܋]UWVS ]} WhSλ 1$f (f E؋E!ЋM#M t:;tTUWPS舄 W f S{ UҋE!U!E`uE Et;uuhjuV蔿 ;tTWPS( WVS ؍e[^_]UWVS]} tEU E U uhS_X S^u E@P;E sPu hS؋E pVSZYEtu hS 먋EЉE܋EЉE؋E#G0EE#G4EEU E UG0W4S(_@fVSZYM#H0MM#H4Mu} u }p0x4S^@+u hSn Ee[^_]USP] ;u:j EP591  U:u1҅u591h.u Ћ]UEUitstau+u PJ uPZYUg@RhP UE ft*u 5914ZYt591h7uA US] ;u#5910i Y1҅uhRu%XZЋ]USEU MitWat&bt?L,RP@st?ttMr:~hdPY[E1eRP6 $RPn[ZR@8Zfu%S5913ZYQhvP\ ֋]UWVSu }jj hWVj]S;yEWVuha }t ShM ZYj e Xe[^_]UWVSQ]M tu EEQhS'M $jEXZM uWhS 9jVQjjuuS U 1ɅuWhрSKVT‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjSA_Zth2jS,Y^ujjjjSbEUE Eu hSXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSZxt h7PP @9E}}EU u hU'EUjjjS@ $ueY_u hojPjuujjS9 uVhSZ p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS1_Z@)QFHVL}$E$9EsE܉FPFTy 1;VPsUWS1ZY@UB߃}uujSu@jp juuuuS u ha @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9&tE j 1҉Ue[^],(hۂ)$h蹸 $1RP,(1aRPh h  jSm uh| XrX CRPh5K s,s(hSs4s0hg$C8PhxhxVi-Vhz sPh 1e[^]UU E$E8E U]UWVSVEUFV E܉UEUEUEUE9E EM|vuahNWE UEUEԉU؋E9EEM}6u&uuuu uuuuh]W(1FM]3M 3] t?uuuE Uà hWEXZ맋M܋]3M3] ut.u}t#uuuuu hWEFE F E$F$ku}tRD}w+Mk D}w Mk Dw k RQh҄Wx1ɉNE C E$C$E;Eu6E;E u.FCstX^EUEUV#E9Eu2E9Eu*FCstX^E܋U+EUFV vE U+EURPEU }PH SK UMUMUMNU܋M+UMVN VPC^sXPtB؍e[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuuY t/E؋UWVRPZщΉE؉UMWVuuPY t/EUWVRPZщΉEUMEEċE܋] ؉EE] ؉E}EăxfPEЉUԸ]9ظ]A}tE9E؋E8E؋U^9uEE؋U܉EU}TWVuuzXEUE Et6EЋUEȉUWVRPPXMȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}tE9EȋE̋]9uȋE|E] u?9}EEPWVuuUÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@Eu1EċEčeY[^_]aÍL$qUWVSQ ȋ]yIX P@EUw Uyh %uhurXZ~th>O_ ȉFV E؉U܋E Eu.E؋U܉GW FGFtxM؋]\MЉ]uuuuVM؋])ӉM]MЋ]9]u 9M9ME}uuSQh_uEUGW )ډVFV )ډFV uFGFtxM]SQM؉]uuU ‹M؋]t&M]uuSQM]UM])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U M]uhu+GxpF)^N^ 9MEu hy~t hFV E؉U܉ȉ+EUEUE9E؋E܋U} hȅE؋U+EUEUFV ȉ+GW VE Eu FGtxM]dM]O_ ˉȉڍeY[^_]aUU Et 9Pt@]UE]UEt ‹@u]UWVSEtf1yAQ $T$D$T$ D$9E E\$ |I11҃yuEԍe[^_]UWVS@]u }(,EUEh WV} t(qtsu&jsEPjjS@uvE95&thr j[^uujjjSlEЉUԃ}u}t.EЋUԃEUE EuuuhSE$1RP,(EƉ׃u؉}܋}9ЋU}uuuuh(SjSEZYtE̋EЋ@E Et hdfEЋ@ EjS^_u h}?jSzZYu hx!x G EG$EjSG jS9 tu hS^XPH UMċM9Mu"M9Mu}u hSY[1p GPGT<9s/jhv V tV(F,9ŰM}ỦEȃ͋u}+u}9űE|uuh֋4E؋U+EU9E̋M| hU9UEUиM}9|E 9ȋU|&}tE؋U܉EUh4SXZE9E؋E܋M u}uU4}u hVSYX UMH0xh4S{XZ1}9}[uujSD@1jp juuEU+EURPS uhrS @ r $󤋃p PF V$1FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@.Eu}U؋EhS_X}ffuS7Y^@,hÀ}|h4SXZje[^_]UWVS]1uuuuu11hόuu w btENtoat%itClhY1EPS &EPSEPSZY@kq`1;EE}=S0UU܋UUZt&xuPtM9Hu M9uU@օtE 9&uEU t thr jZYWVRPuSe[^_]UWVS EЋu} jj hRPj]SyEWVuhL }t Sh8 ZYj P Xe[^_]UWVStƉPZt 9St[Rh7V *{ RhOЖ $1s3щ¸f$1s sщ¸WhhV (WhxhtS SV% uhhV賐 SVh#; GPhxhS Sh $jmSj$G8P7Sh h+ G0W4 uh2 X1RPhP?P ލe[^_]Ë &Q &y ;0&| t&J &Uh&P XZUWVS֋U} $ s Ev` u>h/z X ׋󫋃V6h}۔ XE/ze[^_]ǔ h轔 X8ShxhtS Sh莔 shEE뚋A t h}\ XhǍQ C SX1ۉ019u 9tCuEэ!ltPPhƓ h贓 _tjmWj$8Sɽ1tttShxShhWWhV ZY?hCzH Xu+u"ElVE Ee[^_] e[^_]UWVSxh h h|x hǒ h  xà Džp&Džps3x po s sx pR Ct Ph- K Cs31 W{ WhhPD WhxhtV*VP膝 uhhP Ph3葑 XZ{ h)hxhVVh^e VhZ hM jj hx$K x$cRPjVg x$K x$cRPhې "jmVj$G8PVhގ诐 h 襐 G0W4 uWh2 X[tVh^j GPhxhVVhF ZYgRPhPP9 hg K Cs31 OC tYC 8P)s t󫋆RhxhVVh葏 1e[^_]UWVS}] u1EEEEh8VSn t^l`~\a wT$0s ut:xuCMÃM뽃M뷍EPW EPW6ZY@uM딃M9&th`s j^_xjWZYu hB X]t UI;]E}1WUM^t xupt9Hu 9uu@܋Ut4h h> h| h) h 2 W+ƃ E&EEv6 u v v uЍ  FtMPhl觍 XZ N Fv6U vXZp hg[ Y볉؍e[^_]UWVSD] 1}v }Euhuu Cl tditHTt*PLt7olt Pwb&hY1tukVS_Z@ut6PEPSB @u#tjhv V t E 9&thts jZYVh EPS&e[^_]UWVu }^_]UWVS]u 1ɉMMMMMhuVEk tfitLat%bt0lh/Y1txEPS~thEPStXEPS"_Z@uG1;EE}1SM}Zt xuPt9xu 9uU@܅t95&ths jeZYuujjuSe[^_]USЋQfPfQfPQPQ P 1Ҋ\ \ Bu[]USÉIQHQH QH QH QH QH QHQHQHQ0h/RS\ ]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVks W~ uu wu螄 uRCu1jSks VC u%u vuc uًU EGue[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh`W(4 uEyƒti WhFn jSU~11|u@ugLt;I)ӉtuߋuIu|u@u1Rh.n XZFtY~jWTƅjjhSPW]Y $thhSFh ShPm _XF1RPhWhS豉Shm thm Y[jLDZJjAXu言 8/-hj5H1jvSzv Shji Re @uD 81h j ÉhЗl Y_ t 9ÉѺ})؉Rhn-l XZ hٗtl Xhߗil _ t9ֺ})؉Rhn-sVw ZYu+C xu"mt s sFYXj j Zu Xe[^_]UWVSE @80ƅ77PhveuX t 7u{~ Cu X0u: ^t h0p jVh ! Ttg81ƅ9!@󥍅8Ph$jPSu0Ph$jPuV[ VSh*j2Sd [t hj2T˅t_S zuR(,Wsu ZY,u1(zu%B sV>p ZYu+C xu"t s s>YXj kc Zu» Xe[^_]UWVS@J9sr[^_]UWVS]u)ZuPe8E_@u h x hu0^uh x hj",sP3^ s Ws ^ hsu t.PEhoufE tZuEYLEPh>/uP }Chs@Pu[ @qhouXZt VYhwuXZt QqXMEPh>/uHPE Mu {hE EEEM؍CU`EPu u @Muh x hfEftft5fu6t2C t Whjt*}tC(UhC0ut3h̙jC*t C0sHtS4KL9sщ}t:s@shuZ us@s`ukZ @u;4t 81t/sl`}t$CU[s@s`u5Z @uEsd6CptSuZY@u s\hs8sXuY @u s\hte[^_]UWVSPuZu1iu _tQVlYt=WuEWu ? MuSCVT[^PQS_ uV9ZSX؍e[^_]UPEPhuZƒ 1tEUWVSu\PhVR t\Mfnj4Zu\VXtd$1jRVmVhiSX @tt}f1RPhu Y1e[^_]US]uu S? @t ]]1]UWVSu u[^u r PY9Esr ?VƋ}M)1Ze[^_]UWVSu u[^u fr P}Y;ErIr ?VƋ}M)1Ze[^_]UEPh^uNƒ Euq UWVS8uEPhVN uhh0x hhg h3VI_ZtPƹ}[E]ShiV5}ĉjSPh3u ƃ SqYt=EUu؅yكۉM]! EjEPXZuVh3u HVHe[^_]UWVS1Rhiu4 @t|j7RPh=hSsހ>tVhs'] Vd t j7RPh=hSr;tSh\ Sxd \ e[^_]UWVS]h3SY^tVPZthh x jVhe V ƍUܹRhiS3@u hj$e[^_]UWh%1󫍅hPhiR3 t|}UWVS\Phu/L uhhy h0hd dShiu13 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVvZtÍEPhVgK uhh z hh7d uS1^Xu h4jZ#CPSZYu h z hFPhou ` uh z h`j#Sh1e[^]UVSSu] EPSV @uhy hj"hxVQZYuhhy hhmc oEuoPRSɾHe[^]UVSSu] EPSV @uhz hj\"Eu hj"hwVĽZYuhhz hhb PhwSHHe[^]UWVS}hWt[^ul PpY@vhV苉Zu hj!VPhW@u hj]!xtdPhiWp0 thћ뮉`S誑X`e[^_]UWVS}hW诼ZYuk rPpVֈYXuhޛDVShWE@u hj 1҉Uu]EPhiW/ @u h j SX1e[^_]UVSÉЉʉƃ ι.uQuRPShX e[^]UWVSu1jS,Vhxi PP @uh% UЉUPXۋUu h>j U]Vhxi W

VHe[^_]UVSuV[thsVRZYuhhy hhn^ P^fx PS+ZYu h4jPڍX1e[^]US]EPhS-E u /h &juS,ƒ 1Buhy hh XZ]Uh躛 1US]dPhӜSD uhh+ @u hk X1]U1EEpPhiu+ t hћj1UhxuYZYuhhz hhu\ Phou ۷HɃ0 v+BwBÍBwBUUf ]UWU1ERhiuG* @u h j/1}W|$wUWSÉЄtGjj hQPj]SS4 zt.PShdR hb¸TXe[_]g_UWVS2 uhy hjjLhB&1& _ZtjmhB&& ZY¸ uWPSh*hp&T =h?&t VW?XjmhB&% ZY¸ uSSSSSPShҝhp&CT $VjJ UEU P]UEU P]UEU P]UEU P]UE1҉T?&T?&1]UE1҉\?&\?&1]UE1҉d?&d?&1]UE1҉l?&l?&1]UE1҉Pt?&t?&1]US]ShB&$ YZt c =CЃ v؃߃Av c hB&W Z>uc B&1]UE1҃t )]UUp?&t H9t@]UWVS81ۉ]܉]E䀖5Ĩ))EЉ]ԍEPjB ZY@MЋ]u hJEU׉uȉ}̋}5)ɚ;EEtJ*EUʚ;EEt$ӃMЉ]ԉ11EȉẺEЉEԍEP [@tEЋU ЉEhjhuGEċ@C t@PYEąt݋@EtCt}tMEU9u2U9u+9u}SEZtjEPY[=Ĩ)u4]늋U9ыUjSZjuԥ jG EPj!A ZY@UE]9u]9u9}~ 9UȋU}h#bj?UWVSÉHPZtP_D 1D1V9"LY@u hy h&RPHSƃ uhy hdjR1RPhrhW_iWVhRM jVWZWhiLE @u Wh t PhM XZjVWZWh~iLE @tt PhL Y_j K pHZ@uhy h# u =`?&j:RPh1hW-b?tWhQL WS | j:h1hWa?tWhɠ L WS | tHSW?YXjVW~YDž@WhiLfD uh֠K XZjS#jVTW'YDžd1hlWhiL D @t|h{Xu hl@1dWhiLC @@u h@lhJ @R蛃 =_)t%owhy Rh*J Y_HS XZ=_)u0=^)u'DjHSDP jV`VWV^)-{k?PLB @uʥ=^)tXPjhq:˨)%X th3TX thToX thCTMX tRPhNaI hqf˨)j_ th3T^ thTY thqTZj G 5X?&X%SV65p?&tjHSVv e[^_]UWVS]S^t EPu S @u Wh}ju - S YEtuhy h{jLEP EZt hjZu1EVtRUWS ZYU}tRUuwS ZYURhSXB tFE=ͨ)tFtj=̨)tFu[=ɨ)tFtL=ʨ)uE=a)u+Hu)}tj QF Xh&v ZY U6"=a)tj F XScu[uk j]@ UWVS,ÉUP(^uh@hS螪ZYucU̹ Rh8i(S @uY 8t hjjhuC4 uh hjEܣ))u Vhjoe[^_]UVS։PCVSPhͤjIUWVS]U hSة^_uhh h2hN ‹)ށ؃E u %ERU NjUR&WP tDPEVDZYUu 9ER~E ËE É)X1e[^_]UVSP]U Ch=SZYu QX WPhS舷VP Ãt7EPS5)Eƣب)S}1Fu2U)e[^]UVSP]U hSSqZYuhh hhM PʶSVPs Ãt7EPS5)vDƣܨ)S|1Fu2U)e[^]UWVSS]U hSҧ^_uhh hhL Ƌ)%EVV;WP ƃt1PugCZYuHEM É)1e[^_]US]U hEPhPSo3 uhh hh?L )%˃ uˁEU ى )1]Uhp&hZ@ XZUWVS]hS葦^_u3hSS耦ZYu"h=So^_uhS^ZYtP) ܨ)ب)!‰)d$1󫉕tVh7iS @u hj e[^_]US] u?PhA E tP>@Yt PhA XZEPp@YtPSh A Vy܋Et PhA XZ]UWVSuV[u h/VYu1P4Z@u hԃ hp 81jS8PN8Ph8i(49 @`%1󫍅`PhiVT @uhԃ hƥj7 tWph֥@ X Ht#t8uP9u Q蠇 XVhw@ XuSh W _XjPtY^u haj\8Ph8i(48 @uhH|=Ph? hgHH9Tt$hO? hgTj)> j > P4Z,H%(h֥z? _1ҋ0t` xtO(9u 09t4#HɋL TuQPh ? ,딅u h> ^j > YjmZti 119X~M%9u>uW0<Ph> h> h&4j = F뫃 u]e[^_],we[^_]UWVSӉϋuu<0FZt2tVWP̢ u31ɉ [u1V{ZVrEQ Xe[^_]UVSu]}t Q j蝵NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjP6uP BpWY_u sP ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URP; Ɖ׉‰ 9иr E8tO 8"uoO ;sC| C 9s} O "WViY^u O 볋K(PUE Z@tE}G _C G1e[^_]UWSËtPX1e[_]UWVSÉUMU1}E;E t[ztMUj8 l^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(P/tXC$ue[^_]UWVS1@}u N -E@} uE@ } u"PR[^uPRZYu덅LPh^E 0+ tu 112L 17 uu- _tHhVyHPH H,ZYu Dž,E@0tj/S Y_0t @0`1DžTXDž\@PTP,S4Q ǃu.@xuP0 L kTtHu@xPSz YZHu.fDžtt0u_SrXDž,uTtt,~L 1҃0u$SqZDž,T(j DP0̼ ,D (t8t,v ,vK "SbqX%Dž,(SIqX(jDž,10dr<wWr<w7 0 u0 Ј0E޹Eވ0 A$(Pf_,fCNj ֋$B$@tPM ^(SISo LEHVUE [@2Ex0$,S ZYu,Sh hjS@PVVn uh hFj%SEpE0H uS h h`jSXE}G }xG }G1e[^_]UWVSu]}t W< Zv H W6UYumH #NPڋE Z@tEC sF C1e[^_]UWVSU1EX1u܉u؅Cu3}Ej1ɋUE ?E1҉Pupup Y\uu}Wu Pu4EAu{}uE$EXExtHu E؋Exu[}t1}t.ERG EG }ue[^_]UWVSQu}uG EX$Cu S{0u3PE 0脗YZun?-uGPRUB? YZUu{(WR-? YZuA{ Cu CuHPE 01YZtPE 0YZu^[F CwH$ PĪ-w7A` w7`XZ1u(7R_uCPhjȋK 11PE 2Z@tEF EFC4FCF1E Ue[^_]Ujj$fZYt$І U PUPUP UPUPUjjxfZYtȆ U PUPUP UPUWVSu] FtVuVVPjX1;}t$jaXt0TQ1҉FNG1 VuVVPEjXFue[^_]UVSuj(jeY[t2 EC1҉SCCuu SB @u SiX1C؍e[^]UVSj,jgeY[tDÉ E CEC1҉S$C$C(uuuMU @u SiX1e[^]UWVSPu]1҉U1+Ei̋M ;}|1_t79rC GM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EVEtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S: @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps @u܃C4uu P!Z@u1]UVS]u j^Zt$pSuCCC]e[^]e[^]UWVShɦu5hЦu&tÅu'j`h hצD \A  V蔠S茠Y[@8Fthݦ^F1󫍅Nv󤍝tJvr󤀽uCU9 t hj|t uh!jPtjSlPhJiu @t1 h=֭ Xe[^_]Uhp&hM茺 XZUWVS, =`) ƅƅF1RhKiu3 @PXujPIY_VjWhQRP qpujPXZpVjRhVpQP hW7 $,hR7 ZY,tRVRSPh+ e[^_]UjhIiup @u hj1US]DD&9t@tu)@5)4X ujjSn ) u DD&DD&]UWVS ]UUEt ;0uK &f|JxuEuE} tˆUPu ZYUtC}t:=&‰EHffUtSUBf<fuhE9r^h E9rhҧA X1_EtE &WtU0 &fW ƒF-C+UE9~)1E؍e[^_]UWVS]u ~;0uS &f|PxtN=&119} fLOu0t ,@t@ޅtt SVhSPhS*x) %hi) Y19};PhhS) GXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9s6< 1LuÍKكt :M؍AMPXZtfP׋Me[^_]UWVSQUU} uj[UuhRZu hjjPV5 u} ]e[^_] UWl$1E|Ru ul}UWVS,E u:[u h hj6Y@uh hj Px Z@u h hݍF1jR! s3 ^_C xyDž@Rhi @uh h脧 ZYq:u]S `)PjjhVPR u+t"/tVPhyh& } Xe[^_]UWVSu FPZuk9 8+u1hju\`%1juS3t \vSh iRt @u8 81t8 8/th5F Xpe[^_]UEU =a)uRP*ZYE EEa% UVS] t4sVu 1 ZYtC P;UuPVZYft1e[^]Uhp&hT聲 XZUWVSSÉ։M1S>_u}uJhxjjhP/ uW&DPtVh:iSf @؍e[^_]UVS]u1ɉh@uḣ hjEPhS| u~7 )EfEVh9iSƒ 1Bu hjle[^]UVS ]u1ɉ@uh hj8EPh٨S$ t,juV E؀8t-EPhS u6 )EfEVh9iS=ƒ 1Bu hje[^]UUE9@t-EMfuu tURPh¨ # ËPt<Pt2PPtPt (4øËtI't?t2tt (4ø UWVSljӉʋuFEE9s]19tc  ^w@v|UShW K 1UvAE9s:2UFPhh)ȉMP芧 M UuRW5 u9utD7...}e[^_]>) 1e[^_]UVS ]uVhiS @u hjEPh!S uhh hh+l* E߉EVhiS uEhpǡ XE1e[^]UWVS$]uӹ!1j EPhS?uht hjEVhiS @u hj1e[^_]UVS ]EPhS uhh` hh+) uVhiS @uhE؉EVhiS @u hpj1e[^]UWVSxhShu@uhT hjDžDžDžDžDžShé~\_Zu?Dž1ɉDžDžDžDžjSh˩n u ؉8 &DytRx:uL҃0jWVhVyPt;9u8tMhԩjjRVjPdƒu1 ;t 1҉Ŕ@|Phi8uƒ 1Bu hje[^_]UVS0]juVhSо@u hH hVw6Zu VhjUf@fEލEPhiS4 @u h+j1e[^]Uhp&h; XZUWVS] 1}EPh8i(S @t&E1r r%1ʹ|󫍕[!RhiS @[< v Phjh [P\P <fDžLVhiS @t%fNth=_)t h%m XfDžLVhiS @t%fNth.=_)t h8- XfDžL VhiS @t0Nf=) PhC _X=_)t hK YfDžLIVhiS9 @t0Nf=) PhQ XZ=_)t hZ X1|󫍅|Phi8S @t}u(j  $PhiS@)_ha7 EEEEĉEEEԉEEEEE|Phi8S^@uhp Xr}uMu u uuBEH~HE&DJtx:t~&jPhé uWhi{ ^_Eyhéc Y111Pt՘hXZGj,V DYyhé  Xhm Y4t8hy XZ h Xj  _PhiS= @PhiS! @jh@ P˛ u ftePhx [^Vf"fPb1PhC  ft Ph( ZYj @ Xe[^_]U81EE1҉UUUUUUUUEPhi8uF @u hj.1UWU1Rhiu @u h+j1}UVS]EPhSl  uhh hNh+t! uVhiS @u hj1e[^]UWVSÉUPh S Ǹ) 6 9|j<  )X$j< ))_ j- [/UEPhh EZYUJt)Dj> Xe[^_]UWVSƍt1fDžfDžRhiV y h}j[h' 1p)֍H(@!P }_9p}p' Džp hhhh:Th=h5hpph (G(\G!PO(!W Y )t  )E!)tI@tc@tC@tP@ tS@@tB@yA@_GlGdw19~L9}B`fWGu uw%k pfx p@tp d#z= tt= w-g [=wOf?v'k 11?1p%1=$v-- 1p-1ƍG P-h )Sld`VPPpphʬ G"`G!\ƃ0`*w/wNtA2FltU0W=_)FQSPhh Ql=_)==_)$YdPh XZ&d9 ʃlylRPhm CVy빀=_)FPFPFPhh7 F1d^1ɉll9d&j> [S=_)FFPhWKStRTRPh$ RPh. l대=_)FPh5 XZlF=Ptlbh@hD Y[=_)FPhE& FPhJ ^ fdV\ǫt5X\PQh  \K XdˉX\lT\lXtWl̫Pt٫PtPt(4PQh 7 lX 렊dزT<\t=PuEFu:h]h XZ=_)%FPFPhb t#=_)l򸳭h]hx Y[=_)FPh{Z XZ1D dD ҃L ll\ltdRP\Q4 h Cuhh [X=_)FPhE FPhJ ^V l\lǫXt5dlPQh Y lK dNjXfld\ Td\tR\̫t٫tt(4PQh  \K lXkT؃dPhQw ZYkl=_).N=_)'$ }itsnti[`Y RK D(=068/B(G!PY` tF)`j )hXh'e[^_]UWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEhō XE1e[^_]UPEPhȭux uhh hh+ ME\UPEPh/u0 uhh hh+ MEUVSjjj"臷 y hѭ \1ɺxBhPS޹ y hÌ ZuufiuSȺXe[^]UpPhiu< ulha Xl$Eu hjEE1UPEPh\u8 uhh hAh+z MIE@u h8j1UPEPhMu uhhЉ h4h+! M E@u hTjA1UU~ tap t z Jt1G&]á)t H@4 ~ )USE UUXt=EEEE1҃UjURP 뺋]UE PujJJ Ã=)tMUEE EjjEPEPjEP;GƒEBuhƮXÃUS E=)tF9Et:EE jEPjjjEPF@uuSh5 ]UE PujII UE PujIIjUWVSj߉ N^ _9ȉ|+)ډE܉UE9}| F@ 1F11~辰 uEvh!z[^E=)t*h)趺Yth)F$0hG*j tvhoj< ~(]tz; uvhXZWuS1}}}}jSjf y hЯYF,P0svF,0hj0 j跓Z1EEEEjSj蠴F$P0/vF$0hP j e[^_]UWVSӉι1j P f6j SP E8}u Ef4S v\jSP PuPhCoXZ+ e[^_]UVSыX u X(upVpɃ0Vp e[^]UE조)tQMQUEUUEjURURPPtEphgXZEXUSp>C YtP>s$>XZC(tP>s,>ZYS>X]Ã=)UWVSƉӍ1Phuj P4 fDž6jEPb ff>ffv  ![^]USh:h)h)hS S肟]UWVSlE`E]U1EqEh#R uSEPSjuV? @uhDdUE`EEE1EsEE[EhR uSjjjV> @u hcXe[^_]UL=)t]]UWVS)t `@41踟ƅt(G)1tQCP6 ZYtH؋[4)CuCCt jP贮XZ[4Չm댃K9tWPsh;CF t~u CC)Cdu-shKCZY#jP1[^1ɉK ~ e[^_]UVS֍XjRSA tjVhhSASAZthhSA e[^]UVS=)jh)j|PhȀ @t`E EtXE9EEEM|MQptAxjpPj ͱd )t{t C1s41))tPP^t hٱfYjjjjj= )t T1;h7hXZh =)t,~ %F6t uY ~ e[^]Ã=)UWVSEࡰ)֍UUEj}WURPP ECCEE)jWPP tsh-X^_1҉1ɉKCt-C0S4tP4)S4tB0؍e[^_]2u G& z CjCP XZ؍e[^_]e[^_]USQ1ۉG&u +)tW{u/u G& z 9CjCP衒 1XZ[4jEPjs tUkG&tڋ]USS)t H@4jjhhbh;^>hhbh;I> 14 jRZY@t1҉)j YG 8uM=)u)2 8 tjEPjs t؋U  8 tCuh=UXh ]UWVSd15)|~11ۉ]]]]]E}W]Sj uVSj M Ãjhj ZYujw[1uuuujEPjE1}jhh'EPhQc hQhܲj讆j u6hy[jjjq jWj= jVj3 j1ɉ G&jEPjq u 8tvh/Z6UE$E9uW,Ph{jWj jVj h Eƒu+=t$hajS =G&^ =G&tjWjo jVje G&pÄt8=t1 SEEEEEP4X)jWj jVj  e[^_]UWVS(! Åu1EEEEEEj]Sj jSj wEEв1=)uE1ۉ]jEPj莥 t%h)轪Yth)hj VhQhhQh׳j hhQh jjjSo j ZiU9t/jVj,oǃ u5 8thhQh&Ẻƒt(ƒuIhhQhqU h y=thhQhP0jS趥q=tt9u=G&ap uEEEEEP Xu{ e[^_]UWVSl1={ (E`jjEPh)h+@umh Z8EPuVh#^ @t5U1}EEEEj`RjjjV3Vu)uh) _N9t hִ^-h[h) ZYt={ uF1)1)jjhhmh;8hhmh;7 É؍e[^_]USQjj]Sjjh G&3thu%ȭ)Zu hajjjSPjh G&2u‹Eĭ)]USW Phhp& hp&h踂 Shhp& j UE E ] UWVSE u}8@D$ 1%$1D$D$ 1 %1ۋ$T$ L$ 1 ډ9tt (  9\$ t\  @ 11ҍe[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9tt / $ 9L$t\  @ 11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]t  $09tu\  E@ 11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9tt  $9L$t\  @ 11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]t  $9tu\  E@ 11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]t  $9tu\  E@ 11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]t  $9tu\  E@ 11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$tt 9T$\ uwy|$y|$L$ ˋL$ ˉ$4$19tt 9L$t$9T$t @ 11 [^_]Uh jjh@G&u, 1҅tPUWVS jEP$Eu_X1E9}2uSP ZYt!SP ZY tG1EEe[^_]UVSQË0tRVh!EPV(ERhZe[^]UWVSQ1:nuzouP:X1҉UhVyPZYt98nuxouSP,ZYu}SP|,ZYuE1V(Ee[^_]UA PPPh'hp& j UWVSÉϋu ,PQZYu Wh1}uHt*hV ZY41Uu1u4h[,P/ ^_u~u M }jPZYt1ihVjhW uU jZP,P t% 9|\ 뭋QRS u) )u1BhWj VhD EtEtEtEt6 u0P,P[6ZY@tjj@"^_,t#jhS uhԸVU Y[0tShShhV 0 ,Dž@hVy,Pl XZ9 PWXZڄtVB L<-u.1j=V¿ Y^t$S@LS4Q ,t1ɉL=)t>}uh _17=)u卅$PY@uNhߤk XA=)u}t2ҋ4h= GXZ9j X=)t=褒 t t6h'.k X t 0#XP##=)tj}t0$j j(@u hj _G&,W3h)h,R P,Rn 8tV,Rh'Mkj ;u 8uWVWhIj j t B"[P5"Y}u, Ex](jj L WS$ٖ ~)t}u2h&,Pqv XZj P$萖 ~j,P_ @uhYi X,Ѓu ƀt&qttP )PVh" H}) )0SV1Y_@uVh!h XZ e[^_]UWVSj Ph, ;11to tZ t =)t> FOtTQPh _ !ǃ 끍W.OtTWPRh? udtjOtTPhT  t 0h hx XZ=)KtSp+F=)u=)KtSpOtTQRPhbg =)hThH sds`sTsPht2 slshs\sXh 0=)~chSjjhju.t%j S ^_tSh h, Y't\Ph XZ He[^_]US] 1t-tPu ZYu)1=)]UWVSEt48nuxou )P讏 X1uho_e X1Y,u@B uP _uhale S}[^ljxj,Sϸ ZYt X1e[^_]U} Phhp&2 j UWVS]!11tE1҉91&111ɉplh@u uB 0r=dS6EXZEE FEe[^_]UVSSPPVu ujVSh"螸,@uL t!t" 0!Z2tHPShwjĦj UVS]u VSYZu Shjæ;/t"Sh XZu E e[^] e[^]U! Phhp& j UWVS]E1ɉ#11d111lhhu u HuLf$M,9tQG.C|g$@ UC| C|C|C|591 CpZDžlL591CtXDžh.591CxX591Xjuh 591u hj PX591> XDždC|&P;Ut0ttSxt SxߋM |u4^uWUEhtFlt#uuxPWs] Y^@uRWhjDxPWT] YZ@tECp'xPW:] YZ@tǃluECpECtuE%CxdupVF\ V @$XZK|ǃe[^_]UWVS SVdPhWu u hWdShVŴ,@uSVhjTf@tKRPh| hSSh 0j USP]jEPS`^ U :9uySu h-j葢]US]SuZt@ heSZY]US]SFZt@ hSsZY]USP]jEPS] U 9t :uy Sh?j]UVS]u VS7YZu Shj;/t"Sh: XZu E e[^]# e[^]UhDj蟡UV h`hqhhŽhPh+hp& j UVSQÉj EPS\ U:uVShEj1e[^]UWVSuEE@t") 1VFe[^_]P[ _u ho_jVP ZYuj ]e[^_]?UWVSQ]E10u1G&hu uw 2F$@ =h)td)뷃=d)uh)c뛁K뒺a91C8K t l)hK\cPD91jC@K@2K&g91@PKs4K I91C(KK@KEPuh@ 591Aƃu hj\Et l)tctKtK@tK t=h)d) s=d)th)c@tKt1҉,H&sc sKsC  sC sheV!`)Y_EthpV C$KXZEthgVC KY_EthmVC$KXZEthvVC[ YYHLTP[ PTXȉX1\ʉ\@uꋆȉȉ ȉ $ȉ$(ȉ(,ȉ,40Z YY04<8fZ YY8<D@GZ YY@DHȉHLȉLPȉPTȉTXȉX\ȉ\e[^]UWVS ]} ȉKɉOCȉGC ȉG CffGfCffGCȉGCȉGCȉGC ȉG C$ȉG$C(ȉG(C,ȉG,C0ȉG01T4ʉT4@uE\TtyLup1TTʉTT 3M1ҋMfQfMffVBu@ uhPPn ȉ MCTȉEGTCXȉEGXC\ȉG\C`ȉG`CdȉGdshΉwhClȉGlCpȉGpCtȉGtCxȉGxVX YYMU tEȉEEȉEθ 3U9$| ʉ@1\TtIMًU4U9~ ʉ@EP1ɋE9~f4Kff4HAe[^_]U11ҋM ʃ=u‰]UWVSU ]u:LABLt ߉։U fCS_fCU ȉBȉCB ȉC fBffCf9Juftf=vfCDV Y^1e[^_]UWVS]u u0P}u}u EP!= XV _=v1LABLCEȉC ffCRVCP谐 uu>V Y^S~fCe[^_]UEU 19s f3P]UERPZYW|$wUWVS,EӋWEUGW E؉U܋w 1҉j EPSq EЉUԋU t5zt SuhS]$ 1t<16 1Ƀ 1Ƀ 1ɅtuRhrj1ɋuЋ} t1M 8"t$M tM9uM9t Suh맋E9ƉU}7=)tuuWVSuh uuWVSuh?9u؋E}<=)tuuWVSuh uuWVSuhj&e[^_]g_UVSe =)tPhhp&w hPhhp&] hp&hI G XZ=) ttsh9hp& j˲ =)u UP蹲 UWV=LH&uHH׉=T)t&ɉ HffJ=LH&u f@ffB^_]UWVSƉ˃=)t/=)t 1}mQ)X)Puh Pס)RPSu5)k9t 0PWVh^U j"̱ e[^_]ÅtUWRP~R Y_}Ã=)UWVSSƉˋ )=)tSu X)Qh S׉ș։ЉEMRPSu5)j9t 0 PWVh褷 j$ e[^_]Ã=)2W|$wUWVS#Å=Դ)uд)BB4)Դ) ) ;))ؙ=д);|*9Դ)_1)։ؙ5)pؙQ Y JtRz!9t !9t ҋ1҉ؙ=)Q 3Xe[^_]g_W|$wUWVS,EU؉M܋ д)A Id t15))X=T)t)5д)PPV )xU th{X)H xU t@\M؋]ȋM؃=T)t)5д)PP д)A Id t15)д)̴)JH,1X9M؋}ruuh д)\E1ҍMQRPuuVlj֋EUEȉŰϋEЉUMԁ}Tt.CЉ‰!!SʉEUԋCx1RPuuVXK` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05)д)_\T)@xRPuuVÃ=T)tKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu %ClRPuu-VÃ=T)t]Su,XZ1EtttpXM Y_DpTtF u1E0M Y_Fu @ߋu1 %CPд)H05)EЋUpXe[^_]g_UWVSQEӃ=D)1}=LH&tBBfCUC)f UZ[^_]USÉЃt't7uFɃu0 ='Shhp&i ]W|$wUWVSLEUȋ д)A Id t15)yY=T)t)5д)PP )xU th1҉U؉U܃xh _1E؉Eд)X`u؋}܉ tu}}zU tStX~KM< Ʌд)@8EU܋)J9M؋E܃|R`뮅tGt%b 4!Ή8뗍 ?!8u{!8hvSh0hp&赲 Nt% tSt1\uWEahMÍ Í ? # Shwhp&/ д)$~?)EE1uԋEЋUEUClM )EHд)̴)EHesE@E=LH&nKdu؋} t1RPWV4W}WTU u}WT }U P}t}}}GXE1}EEċKdu؋} t1RPWV/UMQuuRP SEыEȉEEeƉϋMUeuuRPTEȋ}EЉEeЉƉϋRPWVU}f E9C0u'=T))5д)PP K4EDS8)‹}W S8)‰ }W$D4Ɖu}܋) д)9A8~zU tR`˃]1ɉMM]ʋ]؍ @뛋 д)A Id t15)$XE؋U܍e[^_]g_W|$wUWVS։ˋ@1󫡠)=LH&t@fxfDžAa x覃‰|fDž I&=LH&tK&д)@40u 1ۉ,д)@DJL!ȉ!؉ pZ4JdQyt@f fDžAS 蘂‰P(,iKL04H81Ɖ׋ȋʋRPWV=9sv Dž19s H11WVRPBKRPAȃȻ)щWVRP=F 041~ H`9))HRPSQ@1ɉ*<؋Fȃ1~H`F9}Sh螗 G д)C`Cx1CC8<Hщ)9~)׉8<C,B,$1Ʌ~ @SL!Љ=LH&(C|HL!ЉjjjhjC4PjE £̴)uj'f д)H41д)H)̴)ȴ)H4 ډĴ))ʉ)@`#PL ~ PhHH&P<h)PXd)P\t)1҉PTX Hfǀƀ_ д)%ƃC4D8<KC,ș)׋C)ȋ1)׉C8HK` tƉ׋Й)׉!lj!׉11ҋ!~ ) 1҃1)׉@D04=LH&>C s(H1@)t ǃ^F=)s0Kd t1RP߭ڍlVV$h[ д) ؙy8PۅI4WW$q,h2  д)A0= @ ))=)u\Tu kУ)jjjhj5)jBA £)u)9)uhlj& )1=)L))9|RPhK ))5) )H [t?t  Lș)FOu뺸2=D)t?jj5H)S$=)STb )uPؙVpjV uؙ=)VY)д)Xlj=T)t PRXZд)x)\=)~ hXDž=)~ д)A,XÉƉ׋ǁ\TtA!A1׋AId t1RPhjj f&&ftRhht@P蹇 DžPu ft)=)tu1'1=д)1w,1д);x, h&j д)1҉牅8[9<}Ƌ\TuAЋ!AAA)uky4D1ҁTtYӃY19Ћ|h3(_д)1=))CU C )C5д)$~N`Cp=LH&u*{tFx9sCxNfKxF,H9u fSCf{CTCXȉC\OK`ȃ~:=D)uCh|{lN`Cd9sh%P[)д)P t+)lj1ɉ1xU u@\€ )H xU u@\€ )H ?xU u@`¡д)@`д)$~%)Bl5)Fд)=LH&~!{8)9rKd1VT~U uVT~U t PFXƋP1~FKd1111f3д)@8P!tx ))D4)Љ)9s?zU tR`ك 2)B$C1ҋ9r)д)H`艅 д))BY89&zU tR`A`д)$~%)Bl5)Fд)=LH&Kd1VT~U uVT~U t PFXƋP1~FKd1111f{89rNд)5)$.Nh񉍸Flx1Dž1҉)D4);xsxU t@` )@$벋!ʉt:@t@;Npr1tɋ$9~‹GDž붅t$9~‹ȴ)Bȴ);Ĵ)u^=T)t)s4PP )@)д)Z4Jd15))ȴ)д)H41[д)Z0 } )؋5)=T)t5д))P5)4 д)X05)ދvxx д)\t4Tu %Fl %CPO붡))𙋝ڋÉƉ߁TtAЋ!A1׋AId t1д)Y\Tt=)]s8)){0ƉK`Cx1񉅰69s)9s) %Cl뀡))9rߋ д)A01q8𙋝ڋÉƉ߁\TtAЋ!A1׋A׋1Id t1(Z~==)j.- X܋ д)𙋝ڋËƉ߁\TtAЋ!A1׋A׋Id t1guWVRh8l 9]=)Dд)P,t,=)t hK X1j X1b~j X=)tjtx|m_u=)thAv5д)04=LH&0FF4+=_w hYjWI)X󥋅`1=T)tR5д)蘾[^)=)t ǃ\8 5д)x\󪡄)RP)SMY=T)t̴)д)r4PP蔽 д)X4HdLH t15̴))Z;ȴ)sE=T)tд)r4PP8 )@)д)Z4Jd15)X5)5)h д)@4P5̴)R eY[^_]aÃUWVSu]tVH_uVhL&jG`1ɉPhd@u k tGRhedAu w @u!< 8tuhc& XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(hmƹ ߋSh{&VnCPh&Vp C Ph&V{pCPh&VlpCPh&V]pCC,$C,Ph&VEpC0Ph&V6ptPL X}!uhzd@u lv @RhedAu Nv @uuh&jE41}󫍅Pu ^_@4ȋ9褠9t(Ћ}1ۉ1E1ɉ [Eƀ*Pˏj PEPw 1e[^_]UWVS4}jhPjW˚tGjPjVWV%+u$U ʋMQ؍e[^_]UVS]u VS莟YZu Shj^D;/t"Sh葒 XZu E e[^]z e[^]ÅtUWRP Y_}UWVSuuuuÉ֋EU)jj`RPNju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVS]MpM1}tfF^1 :^F: 1 MKMKfCCCCC s({,C8CUWVSƉ׉ˋ )%)RPSu5\)(9tWVh0 h"j>e[^_]Ã=)uPUWVSƉ׉ˋ )%)RPSu5X)](9tWVh hAj=e[^_]Ã=)UWVS==T)u14)$)T) )11;))4))9r(9T)1)Ӊ5d*pPY@ JtTz!9t !9t ҋ1҉15)1ҍQXe[^_]W|$wUWVS$E։ϡ$)EP9EYuh haj$<H) 1RPjj P)f|uPjj h hj;B 8)1uME@Ztjj h h^UBP)@ 8)1u $)P)fK 0)XH)<)19։rWVh hjA;P)1ҍMQRPWV4؉EءD)RPuu]؋K1ӋE؋@(1҉¸ڋ 8) t1E؉Uu $)D)RPWVaM&؋EÃ=l)t x)ߋuEfEf%f=u0 Cdu $)E؋UouϪe[^_]g_ÍC(u(UWVSQU=P)f to$)9reSXtX 8)1V@)_9r)u $8u@)t%1ɸAuV*[1uˉ8كsh hjl9 P) 8)1V $)aVéP)fH ZYesf@ ,)4)؍e[^_]UWVSj8P E \)EX)5)F[_tVh)C!؉t Sh0j8 )9s QSh[whVhj8v hVh9t SVhסM&=M&f uft Whu @$8) <)5$)$()F0)4)أ,)sË f)É$8)D)14)x$1ۡ))9׃}SQRPhUjV7$ t$$)D81lj 1=) w ) i;)s))1 1XOt t \Nj)‰ 9sCÉ$11  D1ȋ )$5$) ) <)@)1H)M&ƻd1()@)D) H)1ɉ L)8tDž111 P)T)X)S\) `)d)N1=h)l)|)))Hj fp)Dfr)t) fM&fx),PDSXZ,t hSh)l)Y^t&Ss Zv h\jSh)f ) )1))l)@)|)5@)$)$)+4)1 v1ҍN11WVSQD19sȋ)Ë H‹ )9s؅u|)f))QO£P)Xҋu h1@))|))fH)f fӡ4)|119 t4tu )HtHKC H9u )fC tfCfCF@<,)0)=)$Ɖ5)5)5)$)й1PVuh;i @) 5H)P)P hi @)@$)`*jjjhjPj{ £d*u hl `*1=)up5)=)9| WVhGRR ) ^St1޸ =)~ h^J[Dž =)~/ H@)4)1RPhjjf f&&ft0Rhht@P` DžPu2ft)=)tu1ɉ$1҉1 1$$9 h&C X=l)t)t$] )$fz)$@)14) d*$) <)5P)5`*)֋$ @)4)ȋ 8)15)1SX$)`)1׋<)H9$u^@)$)+4)$)ȍX9s`)@)‰э`)1ۋ$~9s ƃ`)C$_9sك`)C׋$P)8 8)1h`)H)`)1߉$))Ѱ_$t;P)D0 8)1h`)~`) $)1^1T1`)@ u렡P)| 8)1h`) $)F[;5H)s"1;=D)sM& Ŀ)G=)'$=l)t)t$~==)gj.:c Y܋$@)4)1ҹguRP Qh8c 9[=)B$<)t,=)t hKc Z1j b X1$~j cb X=)l=l)8|)u )"'O&/P&V1fDžTs` fV8\`d:flfDžn$)Ɖ׉1҃ $((ˉ$ʃv)uh hXU| 11EET$Euh h 8)$)S_uh h PS$Yt @)1h h;'91҉C4)D1;<)19 r )$1 8)1$} 8)CX)=$) @)9 9GPh hq{)tЉtF 9rh h@)‹ȋ$ 8)GB 9s11ɉ *\T&h&0 hp&0 *,*Gg XZe[^_]W|$wUWSøth+hBS XZ5x*h_S 5p*hxS h+t PhS _Xx*t?p*9} hlS [()hMMEuQQ$hDS j [R p*Z1\+h+EEH*ۃH~-@*]PP$sRR$SP*QQ$SEWW$S hT&PP$ShR <\+**!]**Ezuٞzu=p*\$=x*$h Q e[_]g_1UjjY XZ1=p*P;K U=`T&u =p*ujh#)uY x*ZY9*~*\+ueUSá**xFأ***wr\T&y1]Y]W|$wUWVS*x*ff"*t* *=0*9=$*u ;,**f *f*]f*1Ej]Sjj5H+3yhB[jh+jjh*5H+iy\+t hc _EjSjj5H+e3y hjuh *jB[^*t*f *\+ s$ ,*ɡ4*ȉ $*(*s$*,*+}f*Bf**4fpjh(+jVP5L+jÃ9t:y h YSVh+he hp&+ Z1`T&x*% x* +x*@x**,** * *u*,*,*,**Av.}fE fEm]mE* *5X*=\* * **`*U u}fU fUm]mU}ЉEΉ߃ɚ;~ʚ;Eހ}* * *,**H؉ * * * *E**=ɚ;~ * *-ʚ;*h*rW X*\* * * * *`***=ɚ;~ * *-ʚ;*\+t ;\+te[^_]g_UWVS<ÉUM\+tUUEčs}uyMăA}9}fE؍t E;t*uJ1 *$*u5}t4\+u+JEPuhK Ѝe[^_]W|$wUWVSEU܉M7C]\+MQURuhK t htK XWhhK \+Y_t,%E RR$Ph1K ]+t"uCp&e[^_]g_d e[^_]g_USȩ=+u SPhhp&M jAD UWVSƉP)¡+_tEtPh!E +9U|} VhGjtt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ +1҅w =w"=w'=w?=w W=w F=v=w=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPsiPVhU S^PVhcH BhPSjr PVhqH S^PCPVhrH h&$ Xe[^]Ãt"¸7ttUR計ZøUSљRPQhSdh&S] &yUh&j hM XZá&P& UWVSDuh&:$ e[^_]ÉÉhG ` aXE1ɿ!t0\Љt }uCEtHP1DA u1tЅ}t2}uKU1ˉj.h+EPj輑 :U1ˉugVPhj.h+ZE h+h=F XZT5+VPh=sF G 0=+UWVS @<tPh6F Y[C tRh?Ph F ^_PhE XZCH<$` hC PhE C@  ScsshE C! <t <t COS C #CPh9dE CZYPfwk$ hKhH:E X1ZhUhbhphW"E _3huE ^!h}D Y PhiD XZ뢍A9shڋEԍsfCfhw:ffEPEPEPEPEPEPh|D jfEPEPEPEPEPEPEPEPEPEPEPEPEPEPhD Z@u6'Vp>XuX }u MU1 +U1EDe[^_]UST&tuPG ZYtC]UPu*fxu#@Phehh +9  + Htu DPRPPZU}uE ҃' hmhRRhjPPhs: UEt#t#tPhRh/=: XZUVS$` E׉Íu 9stMtJ@Sh9 XZe[^]UVSU#tYE uLjjEP:~ à uU1j.0 Y^ƅth +@PfE YZuUuRYZhPh +3 +e[^]UUE Pjjhh +PR$thhmh + +UVSE UMYt @ȅu˅t6t1R )˅t8u3jS\NZYt%u#hPh +3 VShhh +37 mVPRhhh + 7 DσVQPRhhh +6 VSQPRhhh +6 +e[^]UWVS$u} KE 0~y111119Bt} |t 1M LtMw tLxw tHuGC@u?6ttxtu#2 @"@Ƅ9t(Bh1u "ω9)51u- uh#h +M [^vth?M YEPjjhVPP!t hmV!M XZSVhhh +4  +e[^_]UVSMQ +Q!+يۊ@ BZ@ XÃ@.)օ~=+uC +[^]UWVS uE Eԃ=4V&tL1ɉ 4V&hh + [_u(j.h + _Zth@Ph +/  +uhh#h +/ F<t^<t<udEԉE FEe[^_]!Uڹ1ˍ}fEu jEP[^uԍEPmZY6e[^_]VPFPhhh +Z3  +e[^_]US]U MC<t,<t<u/MU ]]OMU ]]U؋]!S"PCPhhh +2  +]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV_XUЅҋEtuu SVZY SPV }yE Ee[^_]3 tEEԉE E@e[^_]x3 EEԉEE E0e[^_]Y3 UWVSXEEE EEEEEEE"1EEEE1҉UjjuVjj]Sbpyhg)EuhyXe[^_]PcXu jj'jjVWjSpyh݋EEhyXE9^CU!‹M9A}tSyM9,sxEt  Cy;8V&t8V&PuCyPP C E1ɋEtttHP1DA uЋU؋uЅ~uE'uPsRV~uEuPjjucE#CP>h*h*h*c1 &H &$yh&j 6 XZ&P& }e[^_]iUUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һ3~kMUD8-u^@PZMt$Ut:u?DX,t*DX\}uCNv t4}tEEEe[^_]UjjEPEPu u-h?uuum(US Ph:hp&f2 Shwhp&V2 Shhp&F2 $Shhp&32 Shhp&#2 Shhp&2 $Shhp&2 Shhp&1 Sh;hp&1 $j( UVSƃ=$+u E4, 0,t!tVWjVjjhRSyS X x,e[^_]U}u]U}u ǖh hh!5P, 1x,UWVSE]uu1҅‰uTpuCE xhWFZYu u0HhWFZYu1t/* uPVh15P,W e[^_]Uh9h,u uIx,U}u͕x,= ,tP,E EC]魖]Uhwh̢,u ux,UVSE] u1=Ȣ,Ȣ,u{yt KshVEZYtBhVEZYu 1Ȣ,4V۾^sh5P,D 맣Ģ,Ȣ,노Ph5P, =Ȣ,t5Ģ,h5P, 5P,h蠕Ȣ,Y[t1҉L,x,e[^]Uhh ,u ux,Uhh,u ux,UhhL,u ux,=L,t1Ȣ,Uhh,u uMx,UVSE] t~ Ɠ1=,,u=shV"DZYu,hVDZYu1,9s>,^hsh+1 ,+, A ,,8uQPRhK5P,B ,x,e[^]á,t8u5P,h͓1,ZYƋ ,Uhnh,u ux,Uhwh|,u ux,UVSE] u NuoshVBZYu,,,_hVBZYu1ɉ ,,,HV軻Zy$sh5P,$ 1=,,,,t  1,,PQh5P, 1=,x,e[^]UEu\x,HuhE PEP tЋE ph{aYZu9=x,uJ= ,t5P,hXZE ph=aZYu,,1,USUE x,u +Pt ]鐐pYtePZ@u Sh 裄 @ض=,t"h,h5P, 1ɉ x, 5P,h44XZ]]j<]UEt~x,=HuhME PEPM tӋE phY%`ZYu ,USSEu觏x,HuhE PEP t0,h5]jE[Xjh+cXYE tE ;u1ɉ 0,jju 蚯à uu=0,tڋtShYS_[Zu ,E =0,u=$,t,,1ҋt0,,tuj(XZ1ɉ 0,]UEu}x,}Ht}6haE PEP追 uhkE PEP褽 t}E phsv^ZYu!E ph{_^ZYu ,UWVSUU] 3E=$,t5,,1ҋE _¡0,t@0,5,ujΗZY1ۉ0,EM9t EPr6Xe[^_]UWVS}u <jj耗{ ÉXZS4CYujjPh#* à uQj/S_ZڅtPhRW| =,t65P,SxP,HQPY^y Pj c Y^ J }~j5h,hWS? jWS{? ShE} x,j ~P_Z9uWjo[^WjcZYt1 h| Xx,e[^_]UWVSPEEu蛈x,%HhE PEP EwɋE ph#X^_t 5P,h+CY[}h:ܪZu ]E XShE_XS 1 t뙃}hM蒪Xu ]E X ShWXS 1 t-U}u"E X ShWWS 1 ,/e[^_]Ux,}tF=,t =,u#í=,uP,E E_h,h5P,I 1x, Ux,}t׆=,u#<=,uP,E E4鵇h,h5P, 1x, UEuvx,{HuhE PEP tӋE phVYZu9=x,u<= ,t5P,hXZE phZVZYu ,UEuمx,{HuhE PEP# tӋE phUYZu9=x,u<= ,t5P,hXZE phUZYu ,UWVSu huS# 9}1hE4S F 9~hhgS GSh?UY[Hu jNZ,e[^_]UEu资x,/Huh#E PEP tu uh- UEuix,/Huh8E PEP賳 tu uhR UEux,[Ht}6hE PEP_ uhME PEPD t}E pphXT USE ,u螃x,2 ,Hu hiSYE phtSXZ ,]USE ,PvAx,2 ,Hu hxSYE pheSXZ ,]USE ,ux,2 ,Hu hSYE ph SXZ ,]UE} tu萂x,=,thRXU} t}uTx,Ã=,t jjXZj`Y=,t jjuXZj Ujjj UWSREEux,=uE XhzXu]ShWRS 1 e[_]UVSEu0Hu$ZYthV-$Y[t뷻wGZtt(,t$,5$,5(,h5P, 1x,e[^_]UWVSPU} uRUyZUuUE (P,Ee[^_]A Ë@t P31ɉKXWħCZ= ,ttP3h>5P, e[^_]USEU x,t tt<]rV&t8CuPRj hU5P, jrr 1x,]UVSu x,}t e[^] rvxXuvh(5P,8 ,Ct P*1҉SY3h^5P, 1x, e[^]US ,}uqx,<=̘,uP,E Eo]{r ,hA ,X]USEU  ,Hv4qx,P=Ԙ,uP,E E]r ,Hu hJAYrh:AXZ ,]USMU  ,Avpx,Y=̘,uP,E E]q ,BuPh@XZrPh@  ,]UWVS @Eu} t.px,AHhE PEPu tЋ5 ,} 19~j k,Pwr t*Cu%whP5P, x, h@hP,P 1ؿk,X 9Xr&DP@tCP,<$t<\CFC &K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP,)PE 4V E 43߿iu6CDžؿ9}~),)PE 4Vc E 4 ƃF;r<,0oXu 5P,hu!5P,hox,^X~ t=,u 5P,h΃= ,t:5P,hP,nP,HQPYYy Pj YX J j 6R <,P58,V =,t3~t-P,HQPy;P| J PjI XZh@PhP, q8,E<,E 9XCؿt G9}ce[^_]USËt P1XCt P1ɉKXCt P1CZ]USd+jyX=$,t> Phgjd]S ~!P,fJftPSRx jh +@USdjlyX=$,t>蓋 Phjd]S9 ~!P,fJftPSR jh +@UWVSƉӋ:j:Wc YZuWhV豦 :W耠PәYZtj%W0 YZtWhV{WC uf{P Huf{tCPhRVI h=V;XZe[^_]UWVS ERU, ZEE0U;OwuCuRS该 uCEÊ u w)tu C;OvE1e[^_]UWVSË@t P1s_stVx Y1Ct P1CZe[^_]UWVSljӋu,u<MP^wEPMQSW螪jFw>yFE8 u@EuhXZ,HEHwuE1e[^_]Å8UWVSH%Pt=&ufTwfUtePt^ftwftO0Euf]fۃW})߉0ufWӉ)Ӄ@YA]AXZ[^_]UWVSUu u hjoljjhPo uW1ɉK fCPjhWH uWC fCjhW" u WC _t36v CvCF C FfC (Wuh' Ef: j/RUs ^ZEUu R蛜8)ЉUHQM!ƋMQURP { uEubCYj@V ZYt_{ u1҉,Mq@P2j:Ep t@PMAYE@E@tu[uvVj]RU袮 YZEtH:UttWuVh)PERVn MVu WuVh6tEx:u-u%p/Uj:V/ YZUt>t3 3ׄtK3Gpj EPVH >tU:u PvWuVh[[/fC*C tt5,u5,tVњCZ{u\{ t[P豚CX1e[^_]USZKJy ;J| t Y RP XZ]UWVSP1ۉDžfDž1jhP jPCZY@tt8tt8uVhxuDž8tj;P[_ÅthP4ZYtChS#Y_t>hS_Zuh[gVShDž DžsDžVÉj@Pɫ t1҉,@PYj:薫 ^_@P輘[H8?u1;u11ۃ/j/SyZY9u$uHsjh[S9 cu)uR,1ۅ%pu'j,u911ۃ=,Džt*1;t%hS謘 ZY11u @11ɉ>t+hVd _Z1ɉ=,=,t jjvXZ=,薁 hPW 1 t1ɉ,1҉,QPp,,YZu u*(4#Hu9z uWh} u Pj踾Pj艾Y_t ;1$j/S虨 _Zu Jx;hh֝R 1ɉ ,Pj=,u/; =x,hp&h^aXZt>ut>uGt>t݃t3hSS hh[Sݖ hVSі $hhS 1 tL5,1ɉ ,=,t hh hhSa Wj;5,F,uj/VQ[ZtP1ɉ=,t WjWjXZx,-1ۃcÍc؍e[^_]UWVSl<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh +82ZYu PY[@S]^K<$7Zffu0t#;thRS ZYt h\3t$?t?u+u =,uhW衑Y,,,t <,j/P薳_Zt@,P[Z PHY, t 8uthc1=0,=4,8,<,DžtDžx=,t0 tRPP ZYu0,4,D,,h݁PA^_44u ,4Pחt$P߳ Y[u/tx8,<,50,=4, t14Pu1҉$WVP_ y,Ph= ,u=$,<$,-,Ph 5P, 0,4, P, u5P,j [^RPhQ hSh +S Ș, +G lt&DB@`舄_2t1SDžDžDžDžDžDž1ɉ\P ]&ڋZ\dUdt:j `Pdo 8,<,`8tediƅ$ dOud8*u@j pVP >p8-/@dj VP 9pd8/Pdx*u,j pPRR pd84, 0,Ghtd+tXH ׉dR(s^_Džh8HR˵ Ytxdtd軁2dt]dthXrd`ujh^_p@9'd't;dƅu AdutPMYVZt<oZu&J4, 0,hS_t 8uhxڡX+PX+~ h^} ,1uQu2P7ZYu SiXhEXtSхtXSJXOtS1Xt _t [uRh!DžDžDžDžDžDž 9,u h*P ZYu Dž8&\ 8|uQjj VY[ hE@P5^_88u @PhDž0860,4, !At9Nj}3uNuE8, <,!F9= ,X5P,h@=IXZAu t=8,=<,9u 9t PhN h  hEPj ^_88u Ph yDž0`thtjU_ZhjTY[+t9$,tK+tP^$,tЁ~=}+P{[+1ɉ @, D,Ģ,@tPjWTXZDžjT_4P5+5+ u hwL 10jP5+= ƃ +9u h 8"ty- "+R)PhJ: ( u @;t+h=1 Y[t$hAt@ uƅ= ,u ,șu+1jPO XZ؉|tL𙋍|9Ή| ||=Ȣ,S|19=+|19lj||Nj4PWj5+9ǃ1@,D,|)ډ|8+@DžftSd uQ tڃ#tՋ9 PhE@8 [^4Pj_h)u뮃=L,P,9@,D,|#Ģ,R虓 YU)Y= ,tYjPL XZ++y @B19|@B)R.b X맋VN1u%Y4P5+5+J ujP$h=5+ ^_th ft=Ȣ,u 4P~[t`h% 6 =L,u׋ @,D,19}ċP,Ģ,9|P, \뛸#PjO8$ Y0=`txu tjSj>=x,t ujOY+ !ȅ!Ѓ„tt jZ+!ȅ!Ѓ„tt jXF(#e[^_]UVSu=+uh! ¹x,[11ۉ+h j<ÍE PV5+ 5+h=M05+M 4, hVq ^ZPƋ+Y!ȅ„t tjYSjk<XZe[^]UWVSDžXp,++jj+P>M + yhM " ,,tjXRjhP$+<t <=,=,5 ,=,u  ,hH WÉ5 ,_~It,=,t#x,-wQ5P,hu .Y[=h+h95P, =,x,-v+,h Z=,=,=,5 ,=,u  ,hH xÉ5 ,_~It,=,t#x,-wM5P,hu -[^9h+h95P, =,x,-vtP,hC Y=,u9 =l,t 5+P5P,h yH  C uhC S茫 _Zx,$ w=t5P,hb ,+<t <flpRPdPRRRP`P\Ph h@+, \`dtk=+x,$ lpRPRRRPh h@+S #+1f+ Ћ Ћ ȣ+lp ff+9+YlpRPdPPPPPPPPPPPPPPPPS`P\Ph h@+,\t-5P,h *5+/L+ \u`u dt 5P,h 붺+1f++@ulp ff+jh+h+ 5P,hB F5P,h 6hH SZ [^^1ɉlx,-w 5P,hu ERpRRRPh h@+t5P,h )XZ:u:u:u˿++󥋅pff+j+Ph+5+YXy/+=l,wPsJX+1p,>=+%h+j5+&[_Zy hr  ^+=,<<+<+P+P+P+P+P+Ph Ã=,^=,Q1҉,++=,t f++tPVI_jj+PE + y"hM  ^ ,=,u#jXRjhPg}@uh $+Ph+5+"w y%h%  Y5+H+x,,tjXPjh5+|Džh+1󫍅hPR5+b @hD x=,,,=, ,t$=,=,\t+<u1ɉj j WhStPtP35 ,=,u  ,WS\h aÉ5 ,~5t=,t,7h+h95P, =,u Iu<t=,+P+Pj+P+P+P+P+P+P+P+P+P+P+P+P+P+P+P+Pjjh HÃX1st ,<uBDžXjXPjj5+wz5+E+X1=&5P,h e[^_]UWVSD}+=p,tWPHjjP5Eƃ HPj5+E @-+EfEjEPs, M]ġ,ZZ<ډEUjEPG, M+M̋EZ[+Ey@Biy1QjEPV O 8tE 8#th= +EEPEP5+Dà ty5+D+VjS$D@t?}uEjEPjjSxW5+׋ Y[Quh X5+4D+Z1(葨 8\胨 8#Nh  뽍e[^_]UWVSu1ɉ +hj/E[_t=,u`++=,W+`+5,,,Ș,thPBUP UBCȘ, ++ 󥍺++󥡬+<<++@@+,DD,,HH,4,LL4,,PP,,TT,,XX,,\\,jhT,`UPō j`PhT,貍 jh@,U썂qP蜍 $jqPh@,膍 ,U쉂,hh@,PW hPh@,A $hh@,UˆR% hÈSh@, uj,+ t1+EEe[^_]e[^_]UWVSQ}j/Wu[^t#9u jh[jW蠗 XZ/jhgb苗 Y^y Wh^  nhWh`+k a+ƀ`+. d1.F9t@BUUjh`+/ XZx9U0t8u-Ou5P,hp !XZ10jh`+ YXy`+F<.u1F@F0볍e[^_]UWVSu+u/h X=D+t x,1Ee[^_]<fDžƅfPftjjWP2< t h  Xhh 5+膓 5+Cm +Ã(t h ? X=D+t x,jZ<Xt(t#fVfthWP> jYu=x,(ujtZjlXe[^_]US E1ۉ]hu ZYt E3=,t8E,u=Ę,t=,ۃ9,u%h kYt!5P,h PjSxXZjOX=,u)5P,h[Xj,Xx, 9,uh@+h)ZYt}jSWx[Xjh`+ZY!hj(Y[E0,4, uuuh( Hu.RPh1 tԋEPj(XZjxXbj~$_XE@E0,4, uuEu Ph(# Huv@+j1$1$vE$j"(XZjY1ۉ@+uu h;5P,躐 RPh1 sjh+Y[hNj'XZ1ɉ @+hue [Z¡,tt =4,tSjtjUXEt1=,P9X=4,t(MEu Ph( Hu\j[뼋Eu(Eu Ph( Hu/=4,tjY1=,PZ=4,tCjX=4,tqj]g 1ҡ+~j1$X=,u06u=D+tx, hQ XjD8Xj9Yj1[=D+t x,EPj3&XZ]UWVS1X`Ģ,pt,(1\@,D,8,<,L,H= ,t}u=,tTuu u E 8-u}tuhE5P,6 u hn5P, ʡ,9,u:1ɉdDžhDžlDžLEjh+[^u#jPLtXZ뺃=4, j9Xhtj$XZhj$Y[hh*u 脖 ^_uDžT&1L,E 8|u]jj $Y[lE Xh݁S^_TTuSh XZi1=L,Dždh݁u [ [^TTu u h yDžd`tTfzt T@xRPn ZYxE%=tu hy5P,} EЋUԣ8,<,?jh+^_o50,=4, h3u ZYth=u ZY,twCTfxu TjWVPTT@jWVPŁ yu h Y[X54,50,h1 6DžL}tEuuh(a H ,LZ\\uOuh^_뽡+t9(,tK+tPY(,tЁ~=}+PHZ+j)"_l@ujj !Y^l=Ȣ,t=L,t =<,y Ģ,1ۡ,8\fxt \PTfyt T@S5,5+ +F uu h XZ` 8 @,D,P ta\`RPP)G @\@ @@,D,TXRPFPY^@uzt[pt95@,D,|@P,#.5P,b _ptĢ,pt륋\`RPj mF @uu!P\@ @u@,D,pt P,9@,D,|P, T@ @t,ʸ#s Xu h3 XZ\@ @t"軘 `Ih  XGjXdtdTR^1T\Pw~ 1ɉ\ $Z[zhPjXZDžh=4,u x,c+xP3X+\t\P~ ^1\j[x,1;@,D,}jYh@u l@u"hPj\XZ㋅lPj J^_+xP 3[+du \u)TtꋅdTRY؋\PD} XHL,1҉0,4,@,D,e[^_]UWVS1,4(0Ģ,PT,1=@,=D,L8,<,L, |,hu ZYDDu =,uVu= ,t}t}u&E 8-u}tuhE5P,蚅 뺋E Phn5P,聅 ɋDtE uPu 1ۉ8Dž<Dž@1=t,uDHjh+HZYt=4,tzjXhtj/Y[hj!^_<}tWE jPl [^E j/PweZY/ 8tN% 8 tDE Ph^ w [^x,. E h*Pr _ZE 8|uuU [t,gb%E 9u jh[E jPƆ ^_/ jP跆 Y[n=,t 耔 8 uW@t 8 u"E hP3_ZyE Ph6=,t 뽃=,tE P}YE D,uJugtWjjiXZ,9u(ju/^_8,<,x,=ujPiY[@ujh+T$_ZbDu}u-k0,4, tRPh1 ͋E8t8Puh( Heh݁^00uuhY[ȃ}E h*Pn _ZuDž(&15L,5|,E 8|uXjj v_Z@E hE@PY[((u E @PhA15L,5|,Dž8=E uPD Y[((uE Ph yXZDž8`t(fzt (@xRPc ^_@tE%=t1ۉL,|,+t9$,tK+tPBY$,tЁ~=}+PD?Z+j|X=Ȣ,t=L,t =<,yĢ,$1$,Dt@0,4, t/(f{t (IjRPQv 5 ,+ +(fxt (P0ft 0@$VSW u0莐 8 u@,D,h^ڃD4, 0, (jjjP(11y4E PhpY[1,RP<[Zt׃ t;50,4,(|jjjP떃 @,D,$@,D,04RP<XZ tl(,RPj Y< @tz(@ @unz04RP;^_tA UL@L Hu (,RPS; @uq$u{PT9ȉP,#5P,W YPTĢ,ډPT@,D,띃@,D,PT P,95@,D,|P, 0@ @tJʸ# 4 8 u@,D, h)Y݋(@ @t谍 ,E PhEXZjX8t8(R^1(0Pqs 1ɉ0 $T[Lu@,D,y3`LPh5P,| 5P,hAXZ뾋D$ u=|,uj6 _苅8=`tju)[^X\Bu@j`SI ^_X\lp1tE SPPZY@XPj $L+‹E $Ph'5P,{ `jh+ZYt$x,1;@,D,}4jX Y*hNj^_=4,0P+[벋<@u @@u"hJWF} ZYEt ue[^_]o2ø=,tjPhr5P,s W&t$=,t~ tPg2PS92 SQ%YE ]e[^_]ZxQMZƒMuQWh5P,rs KSu QWhދ}u#Uj PMQj MMEPjUR rPj hU5P,s 릍e[^_]UVS`P, @,,$t!uItJuB,h,1,P`P,]&8!]& u @ u,tJt ,1&,h, tGtBB@"u\uXu@!@B؀"@tՈButB@,`P,:@,`P,,tHt ,1,1h,[^]US`P,P,@,`,1ɉ ,<,1ۉX18,{P5<,/XZt8,@ڋ]UVS P,=$,t,SP$^Z8tPh5P,'q 5P,J jh@hP,h&\)y}uB5P,ht.=$,t P,Hy Pj s Y[ J Rx=8,?<,0ZÃu 5P,h+u 5P,hx t =,u5P,h[^1ɉ ,j 3uVg <,0P58,S =,t3{t-P,HQPy;P| J Pjr XZ{ n qh&jh&j e[^]UEt]1]US]u hj4SZu Sh)j4@]U=]&u ]&P,fPftPX%Z9]&ÍL$qUWVSQ@ , L, jP +,,_[+ ,y @Bxڽ߭ݕ @,D,=,19}a؞v3߭ٽf f٭߽٭؉ʃ. u1.WPSQhZhPi ٽf f݅٭۝٭Q~:Qֺt.RPhm)PPNi Ãօt Phh)PPi Ã<RPhw)PPh ؉1ɋ9ϋ}'t' @Ńu4 %%y)Džkdd%1 P%1҉ RPh)PPg 8@,D,19݅8,<,t50,=4,9H)߭߭ٽf f٭۝٭h)PPhf à t!Whh)VPCf Ã<RPh)PPf Ë+,,Ɖ׃,9}19},h)PPe à h)PPe ؃ uP,fJftPVR[ eY[^_]aUSy 1;@,D,}6=$,t%P,fPftjhP jXy ]UWVEE왉U1E}ujEPj? e^_]U0E E1EԉE؉E܉EEEPEPup ƒ xEÍL$qUWVSQ@@u5jh,,,0,4,,,XZjPQ0,4,@,D,+,,_X,9},9=,,sB,󥋵5,=,1w~s9؋}gq WPhhSc P,fJftPSRjjj-jh,e=L,uhjjujjj =L,l%_hqPz(,Y[tPhhP:b x8,<,19߭y|ݝ݅ h߭ٽf f٭۝٭y1d~dVh)P=Pa NjH,~-(,t P@j Z)Å~:ùdh)Sh Ph)P=P"a ǃ119ʉst @u4 SQh)P=P` +,,+ ,y @Bxڽ߭ @,D,19ظw ȉ߭s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4 %11d PVSh)PP_ á8,<,9lj@,D,)ލ 9lj݅99Ћ}h*VQT^ à +0,4,߭߭ٽf f٭۝٭?~~hrtPhhVQ] ÃhgVQ] à <ЙRPh7)PPb] Ãuh)PP8] à P,fPftSVP  eY[^_]aUSq jq X]á$,@ `t1US$,HyPX Yu1ZJ,ƒ uɍPv"u|,$,HyPoX ZuJ"\u%$,HyP [_x"|?thphpE8h,}z=,t5$,P4T Yt u $,Hy t u5P,hJɋ ,u5P,hXk,,,$,HyPS Zu@J&DB@uGG9u u ,u3,+=$,HyP`S YuJkPk,B,k,,$,HyPS ZuJ< u6 ,k,9,u@ , {u@ ,KZCh,han_X$,@tREQ [5P,h}XXZ5$,"Q Y 5P,h1ۍe[^_]1US]&uhS蜔ZYuИ,DB@tCjhS u Ԙ,UhSUZYu ؘ,8hS8ZYu ܘ,hSZYu ,]USZKJy ;J|< t Y RPP\ ZY]UWVS ,=,u  ,hi^tIhh+O ZYƺ9¸} +.uh+Vh5P,Y jhh+ 5,tjhh+c uSt , Ę,1,j hh ,FP t\h ,h~5P,X Bt 1,1Ę,t*j hh+` u5P,h^_̘,И,Ԙ,ؘ,ܘ,,+\#hY1u<̘,u 1҉̘,@u̘,1+ ,e[^_]U塨+tP*N X1+,Ę,,=,u1,+1,,,tPKY1҉,=,u1 ,U+j X=$,t%P,fPftjhP jh,dUVS]Xg 0jX=,tf+t-fPftjP5+(M 1+ +x jP5++ 1,jrX=,t>+t-fPftjP<5+L 1+ 1ɉ ,1,jPZt Sh9jbff 0e[^]UWVS],=0,t =,u$u 1ۉ,,Pu7=,uE,,P,@1ɉ ,=,h5,VL /thh[V hhSV V yVhaXZ1pP= ,Xأ ,5Ȣ,L,1Ȣ,L,} t1=,P襼XEEEt!jjRPPh ҡx,-cvt+} t1=,P;X= ,5Ȣ,L,h݁V\T ,V =,uuhg^5,hh,,h u5,*J 1ۉ,j h,$ ZYu,e[^_]UVSQQMq ,=,u  ,=ܘ,ut95P,hPhYZuBj h+b$ ^Zuj UR@PGfM te5&DN@tVu=x,u=ܘ,u1ɉ ܘ,t=,u5P,h+FP, XZz ,eY[^]UWVSQ4MY= ,}=x,}=,u  ,=И,u}5P,hfPh ^_j h+I# ZYtj.h+4# ^_th+V Y+uKjhVY u7Vh 5P,Q f+20h+hH5P,oQ + 1}V)V ZtVh[5P,>Q EPhsV@ tEEPC _uu ,u\] ,gu=x,u=И,u1ɉ И,t+=,u"5P,h+nP, XZE ,Ex,eY[^_]Uuhj2h@,Ku hj@,UWVSP}u jjOhjAWhV?ƒu&WhV?ƒ uWhV?ƒ USjEe[^_]Uhh,uZYu,UWVS,5 ,x,=,u  ,hS荩_uSj h+ ZYtA8thUWS$]؍U1EEEEPShuf\ƒ1uu\Xe[_]UWVSu] }VuS\ u1N tutfN lS$L ZHˀ; uLUJ9uD Đ&y h&? Y&H & t@u҅tff t1҉e[^_]UVSQuhP,K [áP,?vPhqj~uhPF CƃP, 1҉UUR@)RP,Ph&yhuh5P,TF j8,19<, U e[^]UWVSD]} Sj j VhRuW. t&hh(4Ry= j h(4Vl= ,tzW9Vt vuvvS @uTV 8jjjhSvv.thh(4S< U 8Sh+Y[4jjSƃ u(PPh&h#PjS @uPPhPfDž=,~"jP,XZuWS @ U 8$}uT 8A^PPh"9 >jPm+‹Y_+y@Biy1fDžRjP uY]T 8u=,~{BT 8#tLVjS^ƒ 1BPPhnuT < tQDžPPhhS#@uS S e[^_]UVS]u SXu ]e[^]UWVS]} KyCS: Xu?C u8@t4,S 8ufc S 8#tt S  P0e[^_]UWVSu }EÃu3F u,@t(R 8uff R 8#tt R [^_]US] h~S K YZ¸t,hSJ YZt;uEuh躿XZ]US]S2oZu ShjO]U6Eu hj2US] SuEZY@u Shj]UEu hjP- Zu h@jUWVShuE ]E1҉UUUt PEXt SE_=,tIEt Pv1ɉM[hnEEZt Pv1EXhPGE[_EPEPEPVy$x,5+ ZEU+P,t\RVhjP@@ 1ɉMEPjP]Sh&}yh5uh5P,@ x,1VhyP? Sj=,tTRUD É4$D |<$WURPN7 WhaS9 WVS1 E(tPu_]uh#}[^t^}u-h:Yu]SESD 1XZuhE1ËuVC 1 tts;}u-hM__u]SESC 1[^E8uhRYPhW蹘ËuVuC 1 EtPhW茘_Zuu,,^ux,5 ,9~Lk,Ph#8G ZYu0h@hhP,5 W<,058,jWC,1,Et Ps1EX]tSB _1Et Ps1ɉM[]tSnB Z1EtPsXe[^_]UEux,=,t%5Ș,h5P,<= x,gHhE PEP6 EPw=,t,uE P ,U u#J,t8u hj=RPQrZY=,t"= ,t5,h5P,< ,j hԔh , 4 ,,j hh,3 ,j h<h`,3 @,$j hh,3 ,j hh ,3 ,=,tjjE p UWVS0u=,uue[^_];]ȹ 1SjhV5u}uVheSOSR 1E0ES8XZEče[^_]UWVS,EPu EP~Uȃ uK ỦEЋE0ufEjEP,EUXZ1ۃ=,~yjEPE+E‹E__+Ey@Biy1RjEP uJ 8tJ 8#tuJ <_J 1҉jEPV u J yJ 8EJ 8#7ËU9} )‰UEuoX؍e[^_]UE]UE@(]UPEx$tEjURjj0-1USju[Zxj0j"kZYu SY11҉P$]UVSPuEj0jjZYt,0@$jjVjEPhhV ؍e[^]US]t&S13 snsnSn1]UWVS(]=,~jEP,EU_XEE E̋C t 9EsẺEЋs})C C)E}1u)EEЃ}uW3F u=H 8H 8#H C(H 8u5C}9{r:T}|D@^uC,eH 8#uPtjZYCEЉC{uMEЉC 1{UfE؃=,~;jEPE+E‹EY^+Ey@Biy1G 1҉VjEPY u G 8tG 8#tG C(9: 5,Ph5P,6 hG <C(<1EЍe[^_]UWVSQ} ]{uhdCZC{({,CS 9Sts C)9G1s sSjjEPlu{(uS{,t{uEB KSBCEC9Cu3pVshZYuvF C(1E&Cs} {s}MC Ee[^_]UWVSSu] }VuS u-~,tut1ɉN(YS,: ZHˀ; u9UJ9u1VjjEPXt} ut 1ɉN(t1҉e[^_]UE Pu^j+ UE PuHXZ=,u ,UE PuSKXZ=,u ,UWVSSƉ׉ˉʁv )…tRUWV] tUus ؍e[^_]W|$wUWVS|xˋ7GEGEhaE_u h7hjaEYtU 1u]EEEĉu1EEEEE11E11҉UUU}u}tp}tj}u^Wuu EE)PEW|H u hE\XI1ɅMEEU1EEEEu4}uhZ8_XEE$$ U:tJ1u9u}uhu[^}h,YEEUBUHEjjjE ]U tt hOBUHEU:t h+BUHExU2uBUHEXFE7U2BUHEU  BUHEujEu U:u$ Eu U:u BU"u u NEHEj8hjEPXuu dh7TjEPvE_ZwV$d Eȅtu}%)NhYEEZhh!h7uhO+MȉXZu~+Mȉt] QtuuEtUx 9tthp'[}UM}uEP跖[EEE8v9U];t h EUu}ugw}u EhU];t hEU}x1h v EPYu.eu&eXZ}tuEUVEUe[^_]g_W|$wUWVS\EUMhN\hB\EZYtu h7U1󫾄  }Ej8hjjjj5^&R t(huZdSTd 1}}djjjE 1uu11}u/ڋEw=EU]E}uKhuu y hW9qtvPEuu8EMș׋EEM jEP*ZYdKM)ىMڋEt;M9u41MU]E}tJjEPEZYvh AhFu%cSc EEEPYt%h0ubSb PPPPEPEPEPEPh*hSg( ,ڋEthn_EUu@bS:bXZ]EUSe[^_]g_UWVSEU܉M=^&t h;GpY1҉^&jjju! Bu11@tGjEPu uu hn thnX1M1SQM]uuh( E1EUM]Ή)׉u}u܋} ߃1 tL}xA19ʉ}u}u}1 tiE1-Phj]S& LLD.Shh&* uh' $e[^_]UWVSǍxPW ^ZyhP[1E%1=uUЋ]ulSWYlu ha2=,t1hTځvRhQlW tht l)u)Ӄu hZ/w hhpPSG V_Xe[^_]UWVSÃ=,jPXZySh=d[_PVa ZYtV5Sh0 %1=u ThSP P- ǡ ^&9},)ǍW5^&1 ZYu5^&W<Y_, ,uSh(jPV` t@uSh tShZljjjVT =,u[=,uThh PFǃ ujUj XZuPh=[_g=,t1ɍP3Sjj1ɉUVt h YtWZt h, |X,u,u#u P>n _ShB n[^jjWCƃ u WhX xPV! ZYtWh} V9u9t2RPh VPm Sm VDVjPZY@uSh=c=,5^&Sh hR " =v ^&)A5^&=,u:hh R ƃ uRh h&F Ix_=,uVY@u h, ZSil Xe[^_]US?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋC1ɃL Muj RP.F 5,5,hi"j؍e[^]UWVS ÉUE9C8uqBhzu0t'Phh,M t Džh,)ȋDPS4F hY[< u5,5,h%Ph1hn))=w(SXZDžh,Phh,S 5,5,h5%1_1ss C1C1҃u\ T,Y_l,uphj]@,X,qph,jh4,} vh-(hL,"XZ,4,l,@0,m 5T,u V"ƒ tD,@,Hu>#u~nu ,T,@ fl,l,5T,p _1+0,=,u8#uxnu ,M 1M I t0,,t]Ut @uKf 0,-t0,1ɉ X,=l,;G l,,t1BJM pЍe[^_]U ,@ t=\,t/=`,t@HyP YuԋJ5 ,PctXZ1UWVS|u= ,uQh,8u==\,t h3(j ,&,T,&,),, ,tQHyP Zt@ J5 ,Ps5 ,h$,h(,ÃYB ,=&u 1~1PT [=`,tdh`,R h`,5,谹 t $ |,9,r|,kP5,,XZ=,k 5,1,15,{u5,sWY[ =,uuu =,z ,t5,CPj V u,H @))Ӊ,SPV茮 Ij5,5,h,;jjhh,j5,5,h,Fj5,5,h,\ jjhh,Aj5,5,h,) 5,s?,<,@=,&uX=_&u[h8l Zt8tP^_&X9TPhht@j uVft_&_&<=_&u _&t 11<tR<@PP7Ht%tv$@P 1DžHP u?F;5_&r5,h4^_5,j$N5,j A1.W6YtKWN8ǍZ;_&r5,h4證^X15,Hj@ tfWz6YtZPh  _ZNj_&,t;_&r5,h4XZ1@HЉ0,Ph(5,,B 90uH@)< F;5_&r5,h4~Y^5,j$5,j ,@ @ ¸:t P$;P5,h"j, ,u45,5,j5, =,t5,j ;XZjh,g^_1ɉ ,jjhh,rjh,,@=,5,5,j5, =,5,j XZ=,r,=,BHPj W ƅt*,4),,H85,5,jWU =,t5,j Y_8,4,, ,u45,5,j5, =,t5,j XZj<|,9,r|,kP5,9,^_=,k 5,CFP YFG=,%=,CH@u. ,t$P9Qs@,R5,Ph(jY5,j1ɉ@9^Z"1ɉ ,,1҉HLC0tZt,uH 9Hu;Ptj0Wh,CP Qt,pP @9u9t)HL1LH9L}jjQh,t,PHσ)HLL'Hj@$YZ"L HjHWh,9Q tUAQ )HLLHj@YZ t,QNu9AuAQ 똋 ,j)ȋ5t,PQh,~CP t,P @@DjH+@P@Ph,8 t,,,,,,t󥡼,,Cxt45,5,j5, =,t5,j 4XZsF uq=,u~uhh PF @t"5,5,Cp辡 ;,t Cp jhCp薡 Ht1 ,=,1,[=,h{uhh s耢C @t5,5,s# ;,tshj輼jhs Hփ=,ujjhh,o\,,,,,,\=,,Hw{5,=P&t 1,,,9IFTu@1*jjTPkH<9Hs B@9u[0QPVGu 0uՋ@9s3<jp$(Ph,.<jjVh, )H*t,,,,,,t󥡤,,5,h5, $, ,u45,5,j5, =,t5,j [^?Cv1s ,ue[^_]U塠,txt1҉P x{u@jjhh,US];] ttCtE8t  1:"u#C@؍e[^]USPYt@Uv‹EBu Shm)j{]UVS_&tt2JughVPà `jh!jhVPrÃDh&hVà u h)j)j P ZYth)j߷tS hjVq ؍e[^]UWVS Ӻ *_&uRPh*hVƋ{sCsCV <$jjjhRWPVs ssJPtPh$*hZY1@QRBPBCV4 $jVp hjRp $V:'Xe[^_]UWVS։Ϻ *_&uRPh*hSËNvBvBS ZuQQRPSGPP+tL8tߍURP9jjPEu׃UtEuShS- EuR3:XZ1e[^_]UWVSxjj@EPjV-uVh]!qh_XIDž||PhF8SV @uSjh-jVh?EUY^ uh-g_h`RP. tPhCY^0E  1WV%1RPh-=,t_EPhXZ=,vFuh-uh-Ur-t|-tPh^_ &yh&j ZY&P& SLXe[^_]UWVS vFt Yhd#Yu(hd#h-j{ jh-W tVZu/ 1҉SjPRi ;uWh-\Y[뭉 8uዅs Cn]V迊X1e[^_]UWVS E׉M=,vQRPh-&EE1E}G ut`P8Ëw(,XtJ9G$tR G(ErUf9Y9EUurUa8PSv UuŋZP$ w83jjV;XZE|jEXijw7h݁P{] uh-VPE:Y^Uu h .j?R_ZtPh%.jRPhC. +jj7‹G$Uw v6UBZ,B tJ H,B,1B Uԋw,G$uEV7EV7S7ES7]܃SVu؃VPuu,Uthm.u/Uuu6u ۋUu% Ph.^_}t u7[1ɉM1}t EBE}t uS7XZ0]{Ee[^_]UWVS u V0ZtP)_uVh.Y[K SjECP6Es6 =vh.hв hNXC1E<GPƍGEPVSuֳ9th/hв hh.E D>EPuDh&juV薶 Ht hdjߩh& $&fZe[^_]UWVSu }th*/hܲ hh.REw*vhW0à uWh,XZ6}uhPVB VFSh?PS<e[^_]UWVS)uFv}hH/2ph)jhPjE 0Ãt^DžPhF8S @t5 t'E 0h]/S DžPcSю_E phS L uSh,wu(hLS S躲P. E p-[uuPz,XP"P tX$YX&Zuhv/_"X@_&t$t Ӄt t@0DžP1\E T@X@tP3[XH PE @\SUXGYWLT0ZX@HH$  jjh ST^y h/PS`P pP=Tsq=8 f=T[=TPStURPh PTԐy h!9^=h/&X= 8=T똃uXX1u!s1CV1ڸ/XLt%t [0us1{V1js1ɉKVx1jڸ/aXZVWg1ZYHW0s0s[0^_HDjjh PT謏yh/5fUjjh PTuyh/\DžH4`jh>`P'^ tHuhu僽l\u1p`BJ13@ 9u@th/5XTIu\@@싅TT\Xu PuE6؋[H!ʅuP tHJHPX1҅uӅth0Xh10_X@ T蛉[^X# T~XZ1ɉPPe[^_]UWVS(,,50,uE}9s_ t f t!UEE =~ `  9u B뚀}tU ,u5,[^_]ËD,<,B4,B0,,,8,UPh9hp&ejUWVS<,u3j <,_u 421ۉ@,15D,B@,S9D,r14VP<,ZYtT01@,e[^_]UVS]g<,tD,49u>u"8t 0,8,J 4,JD,$,[^]US]t5<,tD,;u1҉{t s7X]]*]UEt?1҉PPPBPP@1ɉH,<,t D,;u]0]UWVSÉO 8S3C(<,Zt D,;t C 1ɉK$1tfVftPS ZC 8e[^_]UVSu j0Yu e2Ép VCZtCUC؍e[^]UVS]<,t D,<u'D,<,4h@5,rXZ<,t D,e[^]UWVS =,,,,=(,u (,=,u ,&=,u ,&<,t D,<u'D,<,h@5,XZf=0,8,(,}E f t"U؉}E ~ `  9u Gf` u}tEأ ,Eܣ, u=, , u5,),8,=0, $@ 8,=, ,5,6L,X,L,,P,,L,,P,,L,,P,,L,,P,,L,,P,d,L,,P,F,L,,P, (,L,,P,  ,L,,P, ,L,,P, ,L,,P, ,L,,P,,L,,P,t,L,,P,V,L,,P,8,L,,P,,L,,P,,L,,P,5,5,%L,_XY(,b%,5,5,Z%P5,/&,L,L,15,(,a,T5,j5,5,臧 "+,HE8,D,<,4x,uP4,,@,P 4,M0, ,MM9rz}Elj=0,if t ,=,` Y 9t   5,u=GYML 9s 2M)ˉ]x(u K|EHE1M9s ]@x,uH1ۉ4,XmZ u؉B UԃPQyUԉB[Zt2]أ0,]X u"J0,)ȉEzu1ɉJ2 v 1ztd,HyPH YuEJ <, D,tJʋMDF9uMH1 F54,l 1҉5,SjD,<,upV4,u4,@ @t)M 8t 2+9 10,f` 띡4, D,<,B1ۉ]u7}u5,`YED,<,@,E4,Uڋ D,<,4A9Q s4MӉUSPMAYZxUu 3nX 4,@@D@,}t$}tm}lj=0,e5,uN1҉$,t ,0,(,H>=$,Z5,MXID,<,4,Bǣ0,¡,E@31,@ @=e[^_]UWVS]tU<,t/D,YZP$ Sh;Y>vht*1ɺUSh<Sh<(>Sh <>v<U v#U v $<U vzU vh7M 1҉ U Sh0<uSh4<ShD<=v<U ;vh7M 1҉{U YSh0<R= PhY<oXZv01e[^]US]3LP91ҋE s4P|<1ҋE s <1ҋE s+1ҋE CPwQ$ hc!hh"h5 hyh&<1ҋE Yu js Ph<XZ]UVSu] &t;thESYZtE ue[^]Sh<H/XZe[^]UWVS uE 1҉1ۀ>1E E@tZt u t tEBPWV輼ƉE_X1hkEP腼XYt(UPhk) ZYUuGR|DY1VE MZ؍e[^_]US1;] }E4{CX]USEU M9t0@B[]Uj裼1҉PUWVSu} j臼ÉxGW{KC؍e[^_]UEp0US]t3X]]]US]3E X]UWVSjËE @UBC@PU2JB} 7OC؍e[^_]UWVP}u VWEWPVJEe^_]US]S $S]UE]USj]uhxPC;u jjt؋]UE ujp0 UWVSu} jÉ8WCJ؍e[^_]UE0pUS]ts^X]]Q]US]3E X]UE@]UE]UWVSM] 1;u&9tqC8u B1҉[^_]UWVSu} j#ËY9sЉPjVCXZ19sʃ9sVO2K@׉؍e[^_]UWVP}u VWEWVEe^_]UWVSPu~W荹WP6=~uh<6h=ʍ 9sPRh =S1RCPES Ee[^_]UVPuVkEVEuUWVSutiPERUӸËUUEP迸EȉCvNjMuuURS{uu0S*XZ1 PuESu Ee[^_]UVPuVMEVtEuUVSu j'É0VCuj QRP[Ht S*X1ۉ؍e[^]UVSh݁uZYtu PS ؍e[^]UUg=} uU E]UVSuu PVE ]e[^] UWVS@EEEEjjEPEPjEPtE@tEȉEEE1uԉuEjjEPEPjEP-11@tjmUMU tt&1u.)>t%J>1>tB>);t9>]UWVS0]u SzYwzK0<C,9s1S8U1҉UȋS(U}ԉEE܉MC4u9sMSuV _ZuVYuEVSXZEče[^_]UWVSLuE}(u(Q_EEE(EEEEEEEE E1EĉEȉẺEЋEEԋE E؉u܉u1҉UUUE8Eu4EPEY^u[}$t }$ދM(},tE}0t?u4EPu0u,"t&u(Ssu0u,hSEu(SMS Ee[^_]Ujju,u(u$ju uuuuu uUjjjju(u$u uuuuu uUjju,u(u$ju uuuuu ucUjjjju(u$u uuuuu u6Ujju,u(u$ju uuuuu uUjjjju(u$u uuuuu uUju"UjuUjuUWVS]uSZYu&s;119t]  2 AJxe[^_]UWVSLuV ÉEE$ljESEZYtOtKE EEEuVuVG 1ۅu0]uh‰EXtuSV- 1ۉEuuS Ee[^_]Ujuu u-Ujuu uUjuu uUju uUju uUju uUE#R>#w@ ]UWVSjuZYPͧ [u!u u Ǎ\3u u j ؍e[^_]U E D$D$E$! ]UVSÉ1ɍU@EEU T uXZ[^]UWE }_]UWVu }^_]UVS]u 1ɋ΋T11TAu[^]US] Ee…u)҅uURqEtH))H11)1E}t E@ƉEE1ڋM1SQRP?e[^_]UWVSUt_ztY1;BsP1ɉM1;Zs8EE܉]EE1uuRU^3CE܋UE}u@1e[^_]UVSU/:#zJ zutAJzu JzutAJ$z utAZ,vwKwgJ049rTz(tIt@w3J4t'wB@z<t [^]UWVS}u 1;^sj1ɉO@_DjHWhPF G@jHWhP F@ ChPXZe[^_]UWVS} r}hj@SG0jVS#GjVSG, jVSG(jVSG8jVSE$jVSG jVSGt%w PS GDtw w1G XZGjVSpG t wPS\ GjVSGG t%wPS3 GDtww?1GZYG$jVSG t w$PS j@uSE e[^_]UWVSH]} tKtG{(hs SWƃu1s W}W0jEPSWjHW$e[^_]UWVS$1ҍ$h3$h[$l$h$luNj$󥋄$PD@@5т歁RQ$$$PL@H5l>+h$$$PT@P5kAك$$$P\@X5y!~[D$pT$t$h$l$$$$$p$t$$$$$$$x$|$$$$$$$$D$xT$|$$D$hT$l DŽ$6_DŽ$:ODŽ$+DŽ$rn<DŽ$;ʄDŽ$gDŽ$ɼDŽ$g j$$$$3$3$\$`L$d$$T$`L$d$$ˉ11ΉP$$$$3L$`3\$dL$ \$$$$T$ L$$$$ˉ11L$\$P$$$$$$3$3$\$XL$\$$\$Xt$\$$$13$P $$$$3L$X3\$\L$\$$$T$L$$$ˉ11L$\$ P$$$$$$3$3$\$PL$T$$t$P|$T$$3$3$P$$$$3L$P3\$T $\$$$$L$$$ˉ11$$PL$h\$lL$x\$|$$3L$p3\$t\$HL$L$$t$H|$L$$3t$h3|$lP$$$$3L$H3\$L$$$$$$$$ˉ11L$x\$|P $$L$\$ Ή3$3$|$@t$D$$t$@|$D$$3t$3|$ P$$$3L$@3\$DL$p\$t$$T$pL$t$$ˉ11$$P($$$$Ή3t$ 3|$$|$8t$<$$t$8|$<$$3$3$P,$$3L$83\$<$$$$$$$$ˉ11$$P0$$L$x\$|Ή3t$3|$|$0t$4$$t$0|$4$$3t$x3|$|P4$$3L$03\$4$$$$$$$$ˉ11L$h\$lP8$$L$\$Ή34$3|$|$(t$,$$t$(|$,$$3t$3|$P<L$x\$|3L$(3\$,$$$$$$$$ˉ11Ή@= $$$h$lD$pT$t$$$$$$$$$$$$$p$t$$$$$$$$$$$$$$$x$|$$$$$$$$D$hT$l$$D$xT$|$$$$$$$$$$$$1ɋ$T3h3l3̨3̬$ωTAue[^_]UShP2XZtCXC\CPCT]UWVSU] tPtLr@+1  1uIMu}141|@u1ZY[^_]UWVSD]E tP?v 4PEE1EEEEUu1MuԹ1uRSZYe[^_]UWVS]u U73+KT KPM<})D`uC@SDC@SD19Ms11sH{LS`1EE؋EEEE܃m䀋E}})=vKC@SDEUC@SD1E9Es11sH{LU܉s뗋E-kU‹u)ƋD`lj1[^_]UWVSUM tA?vREH?w}t߈4]5Dž61ɉ:>B4F߹󪉍0T1󫍝dVRU[^U`t ߋ0ߋuMhSRhS1e[^_]ÍL$qUWVSQHAEQ1E}1};ST SP1C@SDC@SD1CHSLtCXC\CPCT)T3`1S`Uo}E}j@PhURj@S1eY[^_]aUWVS] u}UEu tlK?w}tut@wޅtPRSPSPZYxWVV xSuVbà hP؍e[^_]UWVSt]uE @wRPW5ZY1jPW VSW u uW j@WZYjPWH VSW5 j@VW| }E XEE )؉@Ǎv4jjj@Pj@P3xC jjj@PSPx󤉅hR|e[^_]UVSXp@J!ȉ!ȍJG!! ȍJA! у>у+?҃/ [^]UWVS É׉ιE1EtuEE9}saEE11E9t/FFǃщU?6CCUwʅt)щ?CEE [^_]UWVSEU1EE1KSz) ЍS!кZ) ! ЍKк9) ҃! +҃>/у? ‰ъA! сt>FEȉEEHwMKG];;s.U}G}ك}wMЅEuE81[^_]UVS100 wwk r@9t90uA9u1[^]UWVS]u {CEjuYXd>$u}FRUO $EURV词 u\MC8jh"BV菍 uFU<ƅt+EC8jh&BVd uFUƅu EC,jh*BV/ u܍FUƅtˋEC(jh.BV uFUtUS0S48$uH}CUw{US8$lHEEUMƅOEC1CCC C$Ce[^_]UWVS,]} juuEЃ f$CE̍_V蜈 _9H}U)Ãv$v=BE̍SUȋEp8hn-]SkSS U9sIH}̉M)ƒv3$m=AẼUȋEp,hn-S"S U9r EH}̉M)ƒv,t=AẼUȋEp(hn-SS赇 U9sH]֋}̉M)ƒv,p=AẼUȋEp0hn-SSi U9[H}̉])ƒAf$CrEHpY)ƃf$VC}weZ@EЍe[^_]UE1tu@]USE vA1[]UWVS ÉRPuSP~PPU}tPPXZp x$P`d`ҋ`dډX\3C`3SdSDC@`d`ҋ`dӉ`d11߉XҋX\ډ33`ҋ`dډ11Ép(x,P @`d`ҋ`dډX\3Ch3SlSLCH`d`ҋ`dӉ`d11߉XҋX\ډ 33`ҋ`dډ11É $p0x4P@`d`ҋ`dډX\3Cp3StSTCP`d`ҋ`dӉ`d11߉XҋX\ډ(,33040`ҋ`d04ډ@D11É8$(j jʍ YXCE1҉} }}33 PQE PSs 0 {0u}jXXG;{n 0t001҉1RP!} yjte[^_]UWVS]hL,2Z@ t@@,@,D,L,@,h@,hlW S>^ y hL,2XhP,K2_@ t#hP,h@W@S ^ y h2Bj-hT,2^@ t"hT,h[W@S] y hT,(2Yh,,1Z@ t, ,h ,hRW S] y h,,1_h ,1^@ t,,h,hRW S]] t h ,1Yh,j1Z@ t,,h,hRW S ] t h,q1Xh,-1_@ t^EPhYW@S\ h,;1h,11h,'1h,1h,1h, 1h,0^@ uh,0Y@ uh,0Z@ kh,0_@ Vh,r0^@ AdEܣ,tEࣸ,E䣴,,,E裰,tE죬,E,,,h,/Y@ t/h,hWW @S[ y)h,0h,/_Xh,/Z@ uh,/^@ tvE 5,V,YtAh,hfW SD[ ǃ t;u 8#u5,31,ZMuyE,e[^_]b/e[^_]UVS]hL, /^@ t6hL,hPWSZ yhDBEhL,.hP/ hT,.Y@ t;hT,h\WSZ y hVBj%*hT,.hP. h,,y.Z@ t@ ,h ,hSW S/Z yhjBh,,@.hP. h ,(.^@ tC,h,hSW SY y hBTh ,-hP,. h,-Y@ tC,h,hSW SY y hBh,-hP- h,-Z@ t9h,h]WS@Y y hBh,N-hP- h,6-^@ t9h,h^WSX y hBlh,-hPD- h,,Y@ t uVhYW@SX ydhB#h,,Z@ uh,,^@ uh,,Y@ uh,,Z@ uh,w,^@ uOh,a,Y@ t ,Eh,H,hP, Etbh,*,Z@ t ,Eh,,hPQ, h,+Y@ t ,Eh,+hP , h,+Z@ t ,Eh,+hP+ Etbh,+Y@ t ,Eh,x+hP+ h,`+Z@ t ,Eh,G+hP+ VhZWSW y hBz1ɉ ,h, +^@ t ,h,*Z@ t , =,tch,hXW SV y hC,th,*hP* ,th,*hP* e[^]UWVS]h.\*^@ t!h.hW@SV y hCh`,**Y@ th`,hW@SU 1=.h.)Z@ t .h.)^@ t .h.)Y@ t . =.t#h.hW@S|U y hDj%1=.h.)Z@ t .h.h)^@ t .h.P)Y@ t . =.th.hW@ST yhDhc&)Z@ t<c&hc&h WST y h*DDn-,(15,h,(_@ t ,h,(Y@ t , =,t!h,hW @SPT y h9D1=x,h|,V(Z@ t x,h,>(^@ t x, =x,thx,hW @SS xhh,(Y@ t!hh,h W@SS y hNDChd,'Z@ t!hd,hW@SS y h^Dh.'_@ th.hW@S`S 1ɉ l,hp,t'^@ t l,ht,\'Z@ t l, =l,t1hl,hW @S S @um 8t hrD1c&e[^_]UVS]h`,&Y@ t9h`,hWSR y hDh`,&hP' 1.h.&Z@ t .h.&^@ t .h.w&Y@ t . =.teh.hWS%R y hDj!.th.(&hPh& .th.&hPG& .th.%hP&& 15.h.%Z@ t .h.%Y@ t .h.%Z@ t . =.tch.hWSDQ y hD.th.I%hP% .th.(%hPh% .th.%hPG% hc&$^@ hc&hWSP y hDhc&$Y@ c&k c& 19tef0f9,uQfpf9,uDfpf9,u7fpf9,u*fpf9,uff@f@f@f@ hc&-$hDhc&$hP\$ 15,h,#Z@ t ,h,#Y@ t , =,tch,hW SO y hDh,th,#hP# ,th,v#hP# 15x,h|,V#Z@ t x,h,>#Y@ t x, =x,tchx,h W SN y hDx,th|,"hP1# x,th,"hP# hh,"Z@ t9hh,h WSxN y hENhh,"hP" hd,n"^@ t9hd,hWS.N y hEhd,<"hP|" h.$"Y@ t9h.hWSM y h$Eh.!hP2" =c&15l,hp,!Z@ t l,ht,!Y@ t l,l,thp,!hP! l,tht,k!hP! =l,t.HfJfBfJH5.PfVPfVfFPcfFY.HfJHfJHfJfBl) v SO0EEEPZxf.4Mx .1. tʁw9 u 4 4@ ;.s-.P.p.P..P$uɸ3Bt 5..؍e[^_]UWVS..5.uE}9s] t f tUEE ~x @  9u B뜀}tU.u5.[^_]Ë..B.B... .UPh9hp&NjDUWVS.u3j^{._u 421ۉ.15.B.S9.r14VP@.ZYtT01.e[^_]UVS]g.t.49u7u"1t . .J .J.[^][^]US]t5.t.;u1҉{t s܂X]]ς]UEt?1҉PPPBPP@1ɉH,.t .;u]7]UWVSÉ\ 8S3C(.Zt .;t C 1ɉK$1tfVftP- ZC\ 8e[^_]UVSu j0oyYu e2Ép VRyCZtCUC؍e[^]UVS].t .<u'..4h@5.rXZ.t .e[^]UWVS =..=.u .=.u .&=.u .&.t .<u'..h@5.^_m=. ..}E f tU܉}E ~x @  9u Gf@ &u}tEܣ.Eأ. u=.. u5.). .=. $   .=..뎸5.[u5.h/Sf.o%=tс p5.ݧ.YU.J^w Rh@SjsPh_S5.j5.5. 1+.HE ...4x,uP..@,P .M. .MM9rx}Elj=.^f t .=.@ Y  9t   5.uGGML 9s 2M)ˉ]x(u K|EHE1]9s ]@x,uH1҉.PmZ u؉B UԃPQ zUԉBY[t2]أ.]X u"J.)ȉEzu1r26 v 1ztd.HyP> ZuJ . .tJʋMDF9uMH1 F5.l#W 1ɉ5.Sj..upV,D.u4.@ @t)V 8t 2fV 1҉.f` 띡. ..B1uu7}u5.N[E..@,E.Uڋ ..4A9Q s4MӉUSPTxMAZYxUu 3X .@@D@.}t$}t>}lj=.\5.uN...H 9...Bǣ. ¡.E@3=.@ @ie[^_]UWVS]tO.t/.jWVC 8,ukpjWVC 8,uNpjWVýC 8,u1jW@P訽C p <:tu _>t50.hSjPh$W2 y hSjh@.%_@ th@.hPT hD.^@ thD.hP+ hH.[@ thH.hP hL.Y@ thL.hP h0.Z@ th0.phP e[^_]US]h\.FZ@ t!h\.h W@S1 y hSh@.Y@ t sDhD.Z@ uhH.Y@ uhL.Z@ uh0.Y@ uh .Z@ tEPh'W@Sw0 yCh T5h$.Y@ uh(.wZ@ uh,.fY@ ukjh .LZ@ tE .h$.3Y@ tE$.h(.Z@ tE(.h,.Y@ tE,.hd.Z@ t ؋]ph`.Y@ uhh.Z@ uӋ]UVS]hX.^@ t=X.EEPh!WSS/ yh TLhX.dhP hT.LY@ tBT.EEPh#WS/ y h/TjhT.hPQ h@.Z@ t DhD.^@ uhH.Y@ uhL.Z@ uh0.^@ uh .Y@ t uVh'W@S\. yBh TRh$.jZ@ uh(.Y^@ uh,.HY@ u%h .2Z@ t .Eh$.Y@ t$.Eh(.Z@ t(.Eh,.Y@ t,.EVh(WS- y h?Th .Z@ th .hP h$.^@ th$.whP h(._Y@ th(.NhP h,.6Z@ th,.%hPe hd. ^@ t 4"h`.Y@ uhh.Z@ uՍe[^]UWVSSƉӍ<9t]Vs? ZYUue[^_]US 9tZ9uBPh@Fjhl.C2l.]UE.E .]UWVSS=.5.19~uu6 ? ZYtCuhjjEe[^_]UVS ..19~Xu9ptBhBUj-e[^]UuZH UWVS ]E tP3h 2 CiQd%,tnC0h,|fswZ$ C0hxU==h=C @t&C0h}x&LPh1Y[aC8u hc'1۸tugSRh1 1C u x&댹Dv&뀋%u&Php1C0XZ1۸!t t&Ph:1_XC u1;>k ^f;u$f{uf{uf{u f{j 0WhlU0 f=tP8Ph=0 CP Ph=0C f9Cu f;Cuf;CtQPPh=0C f9Cu fKf9Kt)PPh=Y0CPPh=D0GDž`C#t.t&OuVyPRh / 1`utIdVCp Y[t hm/Zj .V PhyUjj .Xe[^_]UWVS}] uGhL(t<tQ=a=iEPh}S* Ht ShmGUEPhxS* Hu؋GUtslwSd_Xho_j 1u1:tqUA 1ɉj EPUR\ Et ShUjMA 8"Mu w؃~QhUѸ ƋU: uB7j.S9 ^ZƅtFu&EuShU끋Wj.V ZYÅtC t&Eu VhUEċ ƅt)E k,}  BE Mă}uC&EčC6EuȉEt7E u)E k,M  BE Eu9uuC;EčE]CS Su{ ak ECK %K ȉCM[ ˉ]EEHE% ME@M %MI ȋMĊIU։u؋uUЋuUԉ]؉EU0 ؉EU0 Mƒt‰ЃtЃEuȉE n…t E E k, E CE NEĊPB<$  }uE @CE P$1 E @XE} fG\E@fG^E@fG`E@fGb ]ĉcfGd{GhCfGlCfGnEf@ fGpEĊ@ EfGtE@ fGre }uVE u)E k,}  BE Eă 9tuȉt몃E]9]EEEE $E 119~k,u 9}BM yXtQd9}fAd} fGdEEe[^_]UWVS,UEEЃEtE @E EE1Ut}E 1]{}E܋CEE ]}48E1 JM1SQRPiM1)ډӉ11WVRP|Ɖ׉E@EiE@B1ډMȉ]WVRPF‹E]E ]ЉEiEEMȋ]́Ƥ~WVSQM1ӋE1RPSQ։щʋM1Ӌu1WVSQEU1}t}E1}E܋EH @]S)iU1҉UCMejh@BRPCӉƉ+u}؁EԋU)ڋMeʉWVRPHE܍4EUEUE}G ƻd1)‹EPH p}xE%E ]C}lj߉C؋]_ } xi@B1jhuu`jhuuGRPWV;]e[^_]U$EEEEE&EXE(EEujEPuu uUVSÉыS t%[+Y$<$+Q$T$,$e[^]UWVSÉ׉1t )E1XJ~D>Phe:YX؃t w t u F17tA9MuuUM7Ph|XZUM΃`Ѝe[^_]Uhp&he j4.(.t9W|$wUWVSH.1B(.1@y&% 0f0 s fL..s fL.P s1fL.f .f N.X.t0 1sI.L. ut/H.8. <.P. T.fP.1=Xy&OfH.@.ffL.fN.=.tjVBEȣP.EȣT.ZYXy&X.l0.U1EH.]5..jh.5H0ƃ x9u hhfsXVS5D.hpf0HujhTy&jN .... .u...5Dy&=Hy&u؉}mrqLy&E؉ .. ..E . .=ɚ;~ ..-ʚ; ...we[^_]g_UWVS4ƉU)'hfY>^ hf]FfVRVRPWSPhfF j.]SFPj auj.h(4S Shfj.SFPj`uj.h(4SW S\F^(ZU)ڃ<,wJ<w1tR<CSPSPhg<+hf"<:tI<" ރ w1Ét7t1z)uz/uuB 0@u1L 9rhiZ~)tD 9rA΋u7~.ƒ  ˆtыTHT<&h2i|! T@f8f;@. TfHf0.8@0.@y&=.T@ȉ1T@ ʋp)Љpyhl@Bphl+hl݅ ڽp߭܍ .vٞv؋80.5....8y&v8y&.v . 0Ѓt,.80. Ј00 tjhUy&j譵ݝ8P PWh]i0h{i0݅8tS؍1fDžF 󥍅Phid[^݅8=.tQQ$hiD ؃t hi*ZT\1NjH9s:P.@8t!t\SQRhi B뺉 \ <jh:.T PΉ 8iT@f0f0.C0.0s,.0. ڈ00 P9PWh T@‰ffP ft2ftGfTffRPhiTfPhi TfPhio hjy^0^ TXGTWhj.VSjPVT@4P hZm T@f0fftf_fehjTxh#jX0tET@th=jhQjX%818ߋ0fPH9?H)T@uC=wtvhi f9ff0P=v 101P 9 7ȋ8 8ԋTp_0t3t uh^jh˭>XT@t hlj'X 3 hwj!KY1H1ۃHu ˃j.RVjNuj.h(4R Ph=XZHuu hjY ShjxXZ eTp\G뉅PT@O9u~TX\H9s&( &DQtx=RPCYXDž8\P9H0sZPhh  H9\saTHSH\Zuh|[.8utS YƄ0\x01hO4T@Z<t"<t%T@02h˭h^jX~^T@0j,XT@uFShj[_8uD\9Huj,hj_X)syShjShjj,hj[T@ZY9Ptj,aPT@Phj%0P(PWhT <x2<w><tG<T@8PhwkP $ <uT@<w*$D hjBhk;h+k4h-h8&PhPk,T@t <uhhk?G^ PhkY[THLhkT@Z<t%w uhk<uhlhk_hkPh7l[^T@8PhElTHmhWlhdlholh~lhlhlhlhlvhllhl+Fj.STPjIuj.h(4SS Shlj.STPjIuj.h(4S Sh mhmhTT@f8fZYfw2$X h2mhCmhQmhLmh^jhkm}9HuhumnhmhmS1ɋHU t Shhm&uj.VSjHhm[hmhTT@fHfZYfw-$l hj!h2mhCmhQm hLmh^jDX0t-T@<m4D h]RPhG^_0 0uh&k [g v狝t݃{)!C2t!#t1 hm3thmC YhmuC HC SRRPC PhmKHǃxPhn,XZ h#nXCPh6nY^19~gVHYZuVh?nXZCj.RPjFuj.h(4R# PVhNn F땋L 9؋4.0.t9~0 4t490. =0.PUWVS]u#0tP3^1ۉ00Sv 0@$ +0Yu  U1҉05&t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSUtWB<:u1<2E 028uFut<@t*}:u<:t"u}:t;EuݍG1ɀ@t1ɉ[^_]UE`y&]USE] u:À|u%u@C8t9EsHt:t @|u1[]UWVS4}!}u[=0tQu Wn[^u<50Pi)YtHWPD3XZh5)^1u?" Dž)Etw}xjjjuS !jh@PaE xDž1ɉ1ދ9rqhQuͥƒ ?tuǦZ$ 0S0 0HЀ u%V1It 1:u4:ut75Dž\t&Dž t t11҉V9r)ډ)ށVSj,ZYu"S/^u讥[Ɖ‰,1i<#au SZYNFS;/XDž`y&K1j=hS Ɗt F:uFHX)ىMQRPu[Ë tK}t u莤XWt.^tCu F:^DžBDžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QWU*ZYu:W-Xt u藣Xx- _<ljljƉlj )PVQw SRd ,Ymt uϢ^)؍P9s&PS:)ZYuS, XË Dže[^_]UPjujM UEU0tP1҉0Y10001UWVS1=0uE 0=0uYh)0000^_u=`P50`Y[t?Duz1=00t=0u00u@ @uP100P0@Zu 1Uh)PAڋ &f\Yf:u#t =0t|0\L0E|0\u 0N1ɍt:uf:Y\tAߍP50^Y^u'0tB @R10ZD돁NJ|Äu :t@PFjWjM EÍ@ wCe[^_]UVS]u uu ][^]UWVSj=u uj Pjd ^Edu! l4uEdUz}<:<^uFC<:{Mu])CdPV%ZYuV([{<\ůCt}<:tyHЀw1GOD9t0v뛍{1e[^_]UPEPhh 0h@0uƒ1uEUWVS} uHu7uuW1ɋUà =$0u u1Ɖ>1e[^_]UPEPhh 0h@0uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ2߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס0EС0E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSPU} u]RU $URjW $WjV $Vjݐ$S ZE] Ee[^_]麐UVS@ÉjjjQjRPu tN9tLtHVPne ZY@u: j@]S0 詏hShsPdy&=0ti 1e[^]UWVSSÃ=0tO1t 0<!j,ơ0!0)Y9sRUz,0Z9Uu)@uÅu,0!1ɉ1ƅtÉ5001e[^_]USX?090r0É0 4t1[]À=|0UVShhhhsdy&hhh htdy&dy& =}0tVM=~0tB` =0tQRPhtӋ5dy&=x0ts-=y0t =z0ts={0tNSQRP֋dy&U0hhPh4tӋdy& UhhPh;tӋdy&U0ihhPhJtӋdy& U0AhhPhYtӋdy&U0hhPhjtӋdy& Uhy&hh\Phwthhhh|tdy& e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVSS000k(0h @P 1ۉ^,0~0XY1;0s6U1h GP KGU C(XYk(|0009s +0@0GUC(XYk(|00009swU1h GP +0+0H0GUnC(YX݊hhhtPdy&=0t 00e[^_]UVS0;0s4>ubC[^]á0uÀ=0>UWVS 0DžDžDžjjPh0jSu@u 0誆 0P01 @H0hSht_ tƄ181ƅGhtm Xt1' uʊt͍B<9;$ 0R0F}0:}0.~0"~0hy&0B9Hhy&@hy&|0|0py&Hpy&0J9@py&ly&Hly&0J9~}@ly&u{0l{0cz0Zz0Qy0Hy0?x06x0-ƅhsRhtPdy&Ct0n3" 0=|0t h_Ypy&9ly&}ly&=ly&‰0 0 0s5000)I 00H 0tH 0 hy&0X0 0Ɖ5050#0tA 050)0={0t*1҉j Pha h h0r j#000h h0M 1100}ã0u&0 1t01e[^_]1À=0u1á0u 0UWVS@É;0;0j #¡0_9u739u0P"Y;0u;0)00jVS> 19Z;P 0PPh0| =0XZVSZ Y_@u:p j@}W0xhWhsPdy&=0tԼ 950u"tX 0PPh0 XZe[^_]UWVSEЉʋ0!Ë 0)){ MA L>D=}0tMjRP- M950sxu@)lj|| >;0Fs"J| u| | DT>| T 9Ss$EExSW$ ED CSW ;sss{uISC P XZ=}0uE@,t 0EX,0؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC 0‰ى[^_]UWVS¡0!9t> 0)su܋tu 9t)D @!u܋D UEPh0 @ZYe[^_]UWVSQӋ0!‹ 0)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS$E܋0!9_C E؋ 0E)puЋ|~0Uׅu9u)Ӌs V}t Z}܉E)+F$Iu*w ? w)? w 1;SsS |C@C;Fu ;u1ɉHt SFP XZN]H9t9sxt PFPe Y_SVR XZ{EЋT }t Z}܉ыU܋E؍e[^_](E܉EEPh0 Ph0 =~0t KZ{ SC 00e[^_]UWVS90t09kjjh0) ǃ t؋_ jWh0 EWh0f 0=0;0r;0rw1ɉ Åuj}먋 01ÅuP=0@u1jNj0!‰)[9tP0Y9uō30t]EPh0 XZt>G 9r7 39s0jWh03 EWh0 0=0}뾉؍e[^_]UWVSÉU 0EC1t}9xts@Ƌuzơ0EF}}1U9sK)K)21ɺCPY^y)VxK)]K)1ɺACPV*MKZ{uoEA)VHXK)P؍e[^_]}O}M&؍e[^_]5e[^_]UWVSSlj1=P&H9s?MjB,@Pr({ Mu e[^_]C(S,z{,f P{<t[F &01=P&H9s &29se[^_]UWVSfU0P9s'H9r f8f;}ux]u)Ey&HuVQMx t uMQ ZU9ufG}uf 1e[^_]UVSË@9r{uC0C0KP9s+9s'8[u"x.u. K9r !f3r9s:.u z]u{uC0C0[^]èu'B &fAf'f` ЃðUS1u4ݠ! ZYuCC u1]UUE ft҉UŜ!]1]UWVS É1=P&H9s33C8C,E &E&E1E9t*C(p{<t@}f;t5}f;t,Ff9{419ts04f;|f;V~ @1 1{8C pPWZYuF;s$rC8e[^_]UWVS Ë0F;CsGjhvV u 1ɺjhvV u1ɺmS j@B@Pr ݪ u ؍e[^_](K A QrqЉE1}C @t E@<S9s8^u @E@89]u @]-@-9H:9<]<-3K&9)BC9S9{uC0C0S9]p9rD-tN[@3K9ȉu,M؋U먀=Vʀ-ux]Z {uC0C0{uC0C08Dz@U׉DRO^fE11=P&H9}"uQMBZYMt UGjE@$E@PEp _ u j}G W$JO$f4PY{uC0C0EH9G8:>x]49r{uC0C0<]t<-u{uC0C0=ȋUC9r{uC0C0S9sH9s8=ux]u {C~8-P9x]x-t  -f9=P&f9~0{uC 0C0f9UG1=P&H9|f9jE@4E@PEp0r u MA0Q4f8fpBQ4EV~{uC 0C01E, U%Gu48-u@-U;Cr{uC P8]u 0C0{ Ex8tC @tEHP&E11}tf~)f=t#M9tFfE@fNt/Ex,x4uzx$utx<un@(ffEf=t^U܉zC P U܋pEp(Ep0tEp i1}U܍D2 9Eu'C HC M+H 0؍e[^_]Fe[^_]UWVS$@ @tbF &f tNt & t< &ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]UWVS]CE q39\t[p;sr{uC0C0Bׁ)>t~+90y<1ɺE {*.MC @+1ɺ(1ɺ4~t6BЉE8NdBM@a C @Dz({PUCxMu*@uC 0C0{ 0щ3S9ryn3S9Y>*ubF3CHE)PHAKE)PCHE)PXKE)``[^F9>\~{3ƋK9sI:,uDz;9s6J&DJt%9~{uC 0C0PU:SY9s"H9s8\ux}uDH9r 9r 8\ux}u{uC 0C0 1($S B@pr@ wML(h/S9s#H9s 8\ux)t)\ wCDLpS9s(H9s!8\ux)up39Zx*{uC0C02SUEECE^ ]k3US9֋My*CU z5{NGe[^_]UWVS]x;s?SB< $p!^[m\p{|;{r{uC0C0S B@xz@ wt(hw;Cs8)t~)p wCDLp@;Cr{uC P8)u0C0 1E1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ]};US|1ɺ(N`g;{r{uC0C0Pu1ɺ1ɺ!Cxu{'{9Jր?u#@}{C {P9sx &Dyu@<,t<{uC C0 0}{uC 0}~{u9C 0@}t{tE0C0+uN+ue0C0-0C0C 0C0+tv *t?{CH)VH$K)PrCH)VXK)`L_X5CH)VHK)P^CH)VxK)K)o1ɺCPO^MNj;SsE:,u@BJ&DJt%9~{uC 0C0PSY9s8}u @48}t#@9r{uC 0C0 {9s9r։v!?t{u#P9sP&DPt o1e[^_]UWVS} U0E tEp9) W2 [jLYt3SUUw$@@EjP|1҉UYZuSX ]lp1tEEU1}Eu<\Džh.111h1xEEMU싅hE1C CE$C1C C$C(C,C01҉S4S8S qAG9r 9Y&EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ&DJ<_&9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,&DJu _9wu G9w NDJ_9< u AЋ &DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hxNC0Y(9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV uE @MC9uEƉ]]uuu uMrE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMQƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB ;E!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS4ljUMȋEEЊEЈE׋G(E؋G0EܸMjPh{PM UE}tEfEE9G t9GuGt E@fEM E1uE9GtfEE fE1ۉ]̋M9Mu }tEEf} u@uIf}t6f} up`@(E}Qf}tP&1Gu@$E~1ɉM1f} u @uDf}t*f}tr1w@(E}{Gt f}tByf~u"| f}G1҉U}@(E1f}u1GuEf}t}u?f~gGuE1}uf~@}u f~u7tÉEVuuuM UEMuf~u;11ۡ&f}UfMQPf_tIf}tAf}uf})E@&Buf}_uڻzf}&EDBu#f}_uff}thf}u4fzXf}tLf}ufztBf}E@Buf}_ufztf}u;rfzu"yVuSuM UEf}tAf}tY &E@Af}_ fE@Af}_ 8uY8E&DBuf}_f}u7E&DBu&f}_tVuhwuM UEUąUt }udU܋E9UtxM9MtpEU9UtNM9MtFЀ}tEVPEPuM UEuuEfEEGE@}t)EG1EEf} &1Ee[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUEju uM‰9EtMIFEEjSVMU tUU9tESVMUjuVULEju uM‰59EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y&EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ&DJ<_&9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,&DJu _9wu G9w NDJ_9< u AЋ &DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hxNC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PVG uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0He=XSw =H=PM=@=`=h=wF=w=xU=o==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEfflEffEff}yPTfEff<@-/f}$(f}UEMA k MM)ʍ M ыEEHM)ȉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1uԀ}t!puRUg UuEEf u@EuLft:f} upucp(fE}Rf}tT&1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U‹}}f}}t4EC1E>t$E@Ef} &fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUwEju uM‰`9EtMIFEEjSVMU: tUU9tESVMUjuVUEju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tT&1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U?‹uuf}}t4EC1E>t$E@Ef} &fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVU|Eju uM‰e9EtMIFEEjSVMU? tUU9tESVMUjuVU Eju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y&EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ&DJ<_&9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,&DJu _9wu G9w NDJ_9< u AЋ &DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hxNC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV2 uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=P&lt1ۉ]tMEAEWo YE}M9M) N,F4EF8EtwF}׉ƍWOt%%"F9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$5U6DžDžDžDžDžUE@fE@fMIL$D$ ƶD$D$$*Ht$ D$D$ 4$HEDžDžDžUE@MIMI Ɖ ȉ } Dž UE$^D$D$Ɖ$C D$:4$ Ut p9EDžDžDžDžZ DžE@fEEDžDžkzR%KwҋP;V9s%u9sF?V?4 r9i_oJdNN9sVu鋽D$ OD$D$$EV9sNu鋽E@D$ D$D$$(E^V9sNu鋽*N9sVu鋽dNN9sVudNN9sVu=Ex( @<ዕt9dNN9sVudNN9sVu ydNV9sFu鋽Dž6pSdNV9sFu1fTA D$(A D$$AD$ AD$AD$AD$AD$D$ `D$D$ $BȄLN9sVu鋽AD$AD$AD$D$ D D$D$ $AlBD$D$hBD$D$  멋AD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ D$D$ $@dAD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ 0!D$D$ $?N9sVu鋽N9sVu鋽}nȉN9sVu(@D$ D$D$ $>N9sVuA D$A D$AD$ qD$D$$K>{V9sNu7@D$ D$D$ $=N9sVuD$ D$D$ $n=N9sVuZD$D$D$D$ D$T$U$)"N9sVuEDžDžDžD$D$ D$D$ D$L$U$(tN9sVu*})mUE@D$ hD$D$$;EDžDžDžDž DžUyzUWVStn~ ÓU11 rEEEEEEEEEH>U DEED$ED$$U}ĉ|$T$E$F ƃtdE$5E ƃt'D$ED$$1҃ډN MD$|$E$MF N MN 8D$ED$$aN 8t[^_]N UVS } % 9; D$D$ $2t@ $謄ǃ $ǃ ƃ 1 [^]M 0ǃ $kǃ ƃ tM 0ǃ $0ǃ ƃ M UWVS<{ uD$/4$$ D$@4$ƃ%D$T$$qL 4$zƄ=D$D$D$D$ D$D$ D$$g tVuw: ul<[^_]À uMƉt$(D$ |D$D$4$7=L ? L UVSdz Éu 3D$/4$ " t$ $D S D$D$ $/BD$ D$D$ $0 !Ѓ D$D$ $1[^]Y RD$D$%@4$r D$t$ $1 FƉt$(D$ |D$D$4$5=PJ ?)P$4tƃ Y$J 8#tJ 0zJ 04$ƃtI UE$]fffUWVS 1x VE@ E։υEE y ]]U ] }ED$D$ $D$ЉM;MM }$UM T$L$ U$D$ЉM9ureMϋE eƉϋ]ڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEE9EE }E2MϋE evUWVSPv ٩D$T$|$$|$D$$&D$,H*)R)L$L$|$}<$&teEU +D$T$D$T$ \$,K)v)D$T$)iD$T$ e[^_]øUWVS8u }܉E؉Uȋ&8}tGC@%-Z+]E[t_E@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }KtO0)Ӊʸ9иbv-t9+E]܃}thEȉE̅um 8[^_]E@ta(uk1f)uAÃPt((uރEPXEȉ 8[^_]18[^_]Éc}ȉk}ȉ^}}Љ}9s]tSÃPuހ.tEȉEt,} &UЋuԍLDFt uf}am}a.m.f}pmR}p.m.1EЉ$]8 1E܍'D$D$EЉ$]; t#tWuՉD$EЉ$]z< u݋FV }؉WF2}S1}؉}+E܍}̉D$EЉ$]< tu}܍{D$EЉ$; KD$EЉ$]; Hu݋E܍}ȉD$EЉ$]; u݋}Љ<$]@7 |?sE܍D$EЉ$]F; uE}u8}DGt.E܍,D$EЉ$]; u1ۋEЉ t.u}.E}Q} auD$EЉ$]u: usu̅u#D$EЉ$]>: uݸUWVSp 9Ƌ'<'wwEVN)щȉMEED$$dct_FMȉFD$F$?ct:F]؉F>FDF 1[^_]ÿ'E {UWVSIo fD$\D$`D$dD$hL$tL$D11rD$DD$xD$|$$1D$TD$PID$LD$T>,K\$XD$Xtt$T=qw 9=D$Lt$Xtt$T=qw 9=tD|$P\$XL$HD$TD$dU ID$Tb\$XL$HrCMT$X)Ћ$‹RD$\T$`F3W<D$|t$xt$X$1=\$H\$PD$Ptqwt$H<g9D$XrD$TD$X$Bd$$3dD$Te[^_]D$\D$`CE@$@@(L$XD$|)ЉD$|$)щ$N0lPT$|@A$D$\T$`AQ T$TeD$T!,K\$XL$XD$|)ЉD$|$)ى$NiItсqw 9=lL;$rD$DD$|PT$|X$A$D$\T$`AQ LD$T\$XL$HƉL$HD$|;$rD$DaD$|CPT$|X$P$T$dL$hPH LD$PtD$PD$T$L$HYЋAԉD$81\$(9ډËT$8QˋIL$0;T$@9щ‹L$0ً[I<9qUD$(B$L$HAQD$ D$<Y $\$щ‹EL$XD$|)ЉD$|L$H)ى$NE@ $T$HJZ@U@pHhXl둋$L$HAQD$ D$KC^D$xD$XD$T݉D$xD$XD$TD$dU DD$TD$xD$XD$Tt$P\$Xt $D$|;$rL$PD$DL$PYD$XCD$|PT$|t$Xp$B$\$dt$hZr D$XLD$Pa,KD$H&E@ $D$H$D$HD$\ E@$D$HE@$D$HvE@($D$H_E@$@($D$HDE@$$D$H-E@ D$8_$D$HX4""""9ȸ"""3ȉ)L$8 I] ApAhQl5$D$H@MQ m$($,$u@yރ1D9$($,DŽ$\$P" $D$$0$$L$$\$($ \$$D$,$$L$D$DŽ$DŽ$DŽ$DŽ$DŽ$$\$,$à $  .D$ t$$|$(5 D$ t DŽ$L$$$$\$PD$TT$XL$$D$L;$o ;$b D$D;$Q D$<9$@ D$,;$/ D$;$ t$T|$X! $D$DD$D a$4D$P=D$L%w\$Tt$XD$\D$\ t$D9%Gtԋt$Pv WL$T\$XL$l\$pӉD$DŽ$DŽ$DŽ$D$T@D$<t ] 1uUT$$]=tFuɿ [^_]UWVSCB huДt:̔>t M1uU T$$O=tFu̿[^_]UWVSA u0t:,>t M1uU T$$t M1uUT$$,UWVS> qE D$E$P D$ED$4$蒀NjE8tB 8"tnHC uOt$ E D$fD$$҉[^_] 8"u썇vsC뱋 t[^_]ÍvҋE D$RD$$@UVS= puF$4F $44$4[^]UWVS~= ãpE 1t 8u$+E]M $#NjExlD$4$/MA XEU PMbEED$<$ Dž?nED$=<$"HE u M D$<$7uM+E UR V tMV}9~t!Љ1OMV}9~u oSEK1ɋE g t&}G$2<$21ɉME[^_]É|$OD$$<$2̉<$2E$2ffUWVS8; ónu D$D$4$uD$:4$DžD$D$4$hF$ $q)D$$lD$D$|$ D$D$O4$?6$(AD$D$|$ D$D$4$5w|$$Hƅ>d~kD$E D$ ED$D$4$_tWD$D$zd@ $ $袦D$$z |$$ƅOD$E D$ ED$D$$$+D$E$fPtD$$}$/$/M 8[^_]À>/uEt$D$<$t'D$<$贤^ 8E D$t$E$}8[^_]ËE D$p3D$E$E D$D$D$ ED$D$O$3BE D$t$E$_g: E D$D$E$:Dž1D$ D$E D$E$LDž1` E D$D$E$10$% t$ D$E D$E$<$1D$E$D$/4$h E D$!D$E$DžDžk E D$C- E D$C-US( 6 2iEEED$D$ED$ ED$D$E$b1x E([]øUS(5 hEE>ED$D$ED$ ED$D$E$0x E([]øUS(55 ZhD$ D$$?D$D$D$D$D$ D$D$D$D$ $0x D$([]øUS4 gED$D$ ED$ED$$x E[]øUSc4 ÈgE$ UF4 ogUt ]Íl]UWVS4 5g}|$E D$E$9s [^_]^ ?|$ t$!D$$[^_]UWVS3 f}|$E D$E$9s [^_] ?|$ t$("D$$[^_]US 03 UfE$t []ÉEҔT$$EUS 2 fE D$E$3t []ÉEҔT$$EUVS2 eu4$!t[^]ÅtEt$T$$EUWVSK2 peu} |$4$$t[^_]ÅttE|$ t$`"T$$EUVS1 eu t$E$x%t[^]ÅtEt$T$$EUWVS1 ød}|$E D$E$u[^_]É 0|$ E D$"D$$[^_]UVS(1 MduE D$4$vt[^]ÉEt$T$$E[^]US0 cED$E D$E$j5uE-T$$E[]US~0 ãcED$E D$E$5uE-T$$E[]UWVS$)0 NcD$ D$EUD$T$EUD$ T$E D$D$E$>Ɖ׋D$ u $[^_]J L$ EUD$T$EUD$T$E D$ ED$"D$$$[^_]UWVS$g/ ÌbD$ D$EUD$T$EUD$ T$E D$D$E$診Ɖ׋D$ u $[^_] L$ EUD$T$EUD$T$E D$ ED$"D$$$[^_]U. aU!Oፀ]Í]Í]Í]Í]Í ]Ím]ÍK]Í]Ív]Í]Í]Í]Í'v]Íh]Í6$]Í^]Íf$]Í]Í]ÍZ]Í]Í ]ÍK]ÍU]ÍO]Í]Íb]Í.]ÍL]ÍG]ÍB]Í?S]Í]Í ]ffffUWVSP X$Hp)9s L H 9r,P 9s P P P$@(@,[^_]Ë #p VpUWVS, !`ƉUx HEU D$ T$ED$9s)L$><$~F [^_]D$$ۋP Hx,tP(9s ,P P 9s 

S S KC S$T$ʉs[^]UWVSX+ _E}C11L܃r׋EEċE EȋEUEЉUԋEE؍WỦ< <<]E;EriEE؅jEU9s UEUȃE9sv ED#UȅtEDDEX[^_]ËU#EE%ju}čE܉ƉEEU$T$?uẼƉE wt  ~ 1ҋM!E! tE̍PUP v)E;Es MĈEEU̍JMR wډuuUtE;Es U>EE1ۋE؅EtUE9U9v UD#Eȃv UDEȅUDzwMaEEEE}πFI:k=b*}wű]u@MEU$T$]jMʉM}uEMũ~uYbO? wűEЋU t1҃EE̍PUt'E;Es MĈEEU̍JMu܉E}ESfO?zw<@lfEЋU t1҉EU<@t$ t1!E!UGE̋EFE̍PUE]Ȅt&9s MĈE]ȃEU̍JMu9s U=EEEU$T$U]}EEfCE%#jxE%#joEUEwù}FG8U}1 =FEt'E;Es ]ĈEEU̍Z]u܉ʉME}EMEsEЋU t1҉EU<@PGE̋EixủEFEE;Es U=EũE,UD$EUD$ T$ED$E D$E$]fffffUVSr% ×XuED$ ED$E D$4$D$ED$4$U[^]UWVS4"% GXUEzlj(aED$/<$>t<|$ D$ED$ ED$ED$4$/4[^_]ËE  E|$ED$p3ED$D$ED$ ED$ED$4$u8upED$ |$ED$ED$~D$ED$ ED$ED$4$|Mo8u ELR8t ED$|$D$ED$ ED$ED$4$USg# ÌVEU M)]]] ]][] USEU M]]]] ]][]fffUWVSt" #VD$L$<$xt$gD$<$1 Dt$D$$ũED$ D$D$$!rt.UWVS öSD$ED$$Ct{NjE88/tbD$/4$…tL)JBU=wsG|wdD$}|$M$pEs(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVS ëR}UtlƍxD$4$_tD%=`u'$U tĄ[^_]O1Ą[^_]|1UWVS R}U)tlƍxD$4$q^tD%= u' $U tĄ[^_]O1Ą[^_]1US(= bQEEED$D$ED$ ED$D$E$x E([]øfffffffUWVS PÉUM&ljEDWp1҉]]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}‰ DOu냉1sUWVS( OEUM؋ufUވM݋U 1ɋU EEԋ}&Et$$UEx}P$u܀G$脮Ut}EMU E1‹E Et~MލAf qC\PЙDžNE݉Et$E$Uu0Eu1([^_]À}. G}ԅ~Mȃf wC\PDž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVS ƫMUE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ -zt$D$$E[^]ûu111[^]U  M  D$ ED$E D$E$]U L  D$ -zD$D$E$]UWVSa vLNj2FEF<\<^t{Ѝ\&r7%Ӎru<: <&~Hپ!J'JP'EE[^_]ÍFFZ%P& QuJ{E< v^]v.F<&]1DsD]}MMލ[{D~Dyuu}M؍\u2<\u7{ESȍэf  ΍ f )ʃ0Qfv)f )ڍ)Ѓ0P}E[^_]ÍJ{P]1TQu<.tt]<*yMl1nVU}uf%p}O0J%}d J]܈ZQUdEVU}f%p}O0JJMf%ctEF =8}Ef%pPU}W0PUEtEHM%+%c֋EE&VU%p0%Bp0%{B2}%*fB %-}O0JJUECVU%p0%B{10}B%/%{B 16}%B*%p0B%{10B}%m%B+}O0JJUE'UB\E%p0%@p0%?}W0PPEUMU܉ȉMbËE%>%tEU܋EFt E%+%;E֋EEL1<1JfKMC|D7<\F=]EPU\EUVS :E0t t~9t $sK EED$D$E $`uI tG@t  0  @x [^]É댋E[^]É @uUWVS(J oDUEtBEE0E}<$UT$ D$D$<$-u蹵N))LXU܉e)‹M)LXUѸg4 )3,fD$<$}EtTH tCp$1҉}܉ 9t-~fuUE܉D$$=UuF([^_]1([^_]ËP 30f([^_]UWVS( CUEtBEE0E܋u4$UT$ D$D$4$5,}kLЍB)WUeЍBM)WUѸ>Љ)<; eD$4$*E܋tRH t>x$1҉u܉ 9t(nuME܉D$$MuՋGy([^_]Ë;e@x([^_]UWVS( AUEtBEE0E܋pu4$<UT$ D$D$4$*}-?L) RЍ)ЍQGEeE)  IȍE) GE*SRЍ)<;XD$4$E܋;XAQ tJy$E܉u9t(~suED$$[uދF E܃9u؋E܅tЉ)E eD$<$-VUE}<$mUĉT$ D$D$<$%Mĸ-?L) @)ЍQAE-?LeȋE) @E)AM*SRЍ)XUD$<$Ute}tu}cu }ugFEE30f$z<EEe$J=X$0>렃}u E$S1҉UffffffUWVS1 V:E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUIUƍp@Hπw09}맋E D똉UUUWVSn Nj948,.օR@08G4<11$rD$ \$4$01󫋅0t=1(}J90t <u 90u狵(P)1~u,H]Y8^4~!%u~V%8H4X0@,q9r0t$$48C,s0K40u4 8$418 @0@4$48G,_G0Gƅ`%4& Dž,Dž$Dž(Dža`0:~LJwDɋ4TgXKJw! .ʋ DNt{,4ʍ\qЉ,'~>aDž,>~`B<=w^4gW0)?(t9,> z$t-.(M,Dž,Dž(hDž$YilP[J߸ V8uo'dwEOI PDEG/8W,G4G,[^_]É,] CEP0 ]P,&Vҋ4hE EP(, B08H4X0@,T9BtD(\$ `T$0\$ȉ$4t8C412<'urR1҉,,0O0PD]PEEP08P4H0@,Z9PJ8K40U{UJP,0$40,OPDŽPUw}7D$$~>D$t$$-‰E$20UtYEE[^_]Í$臜ƅSE1ҋEEut$#D$$|M$-@ x Utb}ut$ҕD$$Y|EJ#D$$8|$臘Ex t;MEt$D$${L#D$${ED$D$ht@E$5tEftUft IA(Q uEt E19$t!D$D$$6RB(D$tD$D$$6RB끃}p#D$$zĕD$$zUVSW |'EtD$ E D$ED$E$ƋEt$Q,[^]fffffffUWVS 'ƉEωD$$ٽtB4$蕹ƀ?u1)9tXzzt"D$|<$…uۉ<$_9t 1[^_]Ét$ED$<$3[^_]ÉUt$ED$<$3Uu[^_]UWVS 1 J&uEUt E<t] [^_]É΋Ex %1ji˃1҉9rExtftEx(1}fWVu~9Vt"VT$<$]ljFVEptft]CPSD  Ћ]XgËuVf;h{CftMWҍTRӉEf}]}^ Qu F 8vE9uڋE}f8Pf]s} H u yf}uHD$$%]D]C ExD$$!]‹EPn!f8t;Pft2]{u0 ftXHt݉f8pxE;x T@$`|$D$$]Ex E@$E11MȍV HnsffvrRPMu v@@1҉P 9rjD$$]]C(11ɍ&mC}G G$t$]G$uyf fE@$$]Ex D$<$] ]C$f$ffs@sU@@Jru9U@}t*JrHUznnJrfM6fy'bUWVS, ê E׉MT$ D$D$  E$?=v(ƾ軾8,[^_]D$E$CƅtʋE$βUU܉T$}|$ D$ED$4$tJUMt@:tOE$Eǃu(EPEǃu E䉃 14$,[^_]ËE܉D$ |$BD$4$u΋MUD$|$E$ܤE=D$E$JƅUWVS։Dž)t Pv9s:ut<:t׃u)u͋[^_]ËrtftƄE$txDžiDžUWVS  1ǃ $8/u$S… ${$Đt!4$‹ [^_]Í$葐t,D$ %D$D$<$74$2 [^_]Í$.TI/@$Rlj($<$uDžD$$Nj$OmtQ<$)4$‹4$|$$)t4$$<$t 눍 wUWVS îEEE EUUD$$rtƋM‹E1lj4$BtKMUEt8,1ED$E$t' uMȃ[^_]ùȃ[^_]Í,HPEEE[^_]US *Eu[]ÍED$E $#[]UWVS֋N ufS[^_]Ë~Of JN fJy8VӋ6s!uu [^_]äftuutYyZfUVS Ƌ$F$F$F@$F$F $yF0$n4$f[^]UWVSS x}wu G9r [^_]Ått$$tw[^_]É4$}UWVS U MuR u+ftO؃tXf;0t&nt(suXDu/1ۉ[^_]ËEx DC볃UWVS x ÝE 0@ Eu Ct8t\tɀ^tăt8uH[^_]ùx1[^_]ÉdUWVS5 ZuNE|F9sXtd|$$tH~NU fFF}t<]fFFF [^_]Ëu1[^_]É<$ 렋}<FUWVS< òE@ EE@ 0t$$sM4$KE@E܋uFX1tftE$u}D$|<$_nHM|$E@ $E$衡xDMED$E@$TM;UBNju`P0@|$E@ $k$E Ǎ@ED>D$E@$Uu$ EE<[^_]ËMAOMփEtfEtǤ$E܉$EP p,@ @(@$@,׃ EtU?Wx0My ɍL L$ T$D$E$$t8}uWfUE$Ep@@LEMA@AHADALudfxG111D$ T$L$t$D$ED$ ED$D$E$tam7GED7Mnts{HP|1뉃}t>px111rx@11buE4$E<[^_]px1113u܉4$֨u8uDMUU$EU r}fm몍$ZE0GU7UWVSS x UJEtB9swt$U$Ut]rJ] fBB ]fBxzE:us:u.u'EBB [^_]Ëu1[^_]äftu%u0tۉ4$U]EfUWVSH m uVzF9sHtT|$$t8~VM f FHNMLF [^_]Ëu1[^_]É<$GUWVSX  ED$,E$} D$|$]Kx_xD$|4$]hPU4$]= t<$= E$]= D$$P]ÉE܅F@ t$$<Et E 2t E D$,E$qEN EEE&E̋EE u<.tjDy@u붋}]D$ED$4$]ËE8g E E܃x f_EĉUED$ EԉD$E썈$L$E $@EċUڍwEJЀv)ύ)ȍD$4$Pu [^_]ÿU6 WE=w ]1]UWVS  )u4$ĎUT$ D$D$4$i}-?L) RЍ)ЍGEeE)  IȍE) GE*S)ύɍD$4$>u [^_]ÿUWVS4 ?ufF(}ȉ|$$Kkt4[^_]É<$?@1t9lufV(4[^_]UWVS u 0fV E0 4$@V(EfD$FD$ $U=UwDE |)ʉM싆t7T$UD$E$U9sUJM|M))‹FtIT$UD$u4$eU9r4[^_]1$0[^_]ËUыU|UVSm ÒutgF$SF$HF$=F $2F$$'F,$4$9 t 1[^]ǃ  @  @tÍ fffffffUWVS lj$U_D$$ ̋Et$UT$,0U$C09UuED$$ 茋1[^_]ÉUED$$ lL$2UD$ 2UDcUWVSd 1EE1EEƍLEE> tqE9D$t$U$Z0Utˋ$g10$X1UDŽ0试5Euu ;t1< tHv0FIU$s00$d0UDŽ0+UWVS<# HǠ1U11ɍLt6ufE+<ȁ<[^_]Ã0u@W@0ƃ:uVƅ/lFu,$a\9L$B\2(  Ή$.D$.D$D$ oD$D$o4$s~{qD$@|$/$y:tRP:uVpƅz빉1$-Ή$0Ή$-D$-$|-D$0ω$Y-D$G-U$VU$M.$/fƅD$/4$a/tY1ɉL$oT$/T$T$ L$D$4$t$D$$0F'1҉T$oT$ L$D$4$p빉ovFUWVS < au}D$:4$Qt!D$p3T$$@t|$E D$4$+ [^_]ËU t考 [^_]UVS 蹾 uD$:4$Qt!D$p3T$$tE D$4$  [^]Ua ‚Ew0t ]1]ÃL]UWVSh >Eu 1MU1ҍx,U0ED$ D$D$@U$UzUƒE9~ЉLEΉ )t$|$ʉUM$6)MUӉϋʉU$<*uD$-*UD臎!L}|$t$$(uU+u h[^_]ËE%UWVS`譼 EM Ǡ1U1ҍp,U0MED$ D$D$@U$U6yUD$$ tEED$ML$ED$&;EUT$$ u@< f!L^ut$L$$&U+uW`[^_]LU$(ED$(UED#UWVS`K pEUǠ1L$\1ɍpwb0tNT$E UD$ T$D$D$@T$$T$wT$1t>$LuT$ U MT$L$$qL$\+u`[^_]ø"UWVS ~ ãExw|,M0t_oƃtAkƍLU$:'ED$+'UED [^_]ÃLu$&Ɖ [^_]UWVSp׹ }EU Ơ1uM1ɋ]p3,M0mQm8@E4~Eߺ81xEM}EL )|$t$ʉUM$]$MUЉ΋ʉU$]%}D$%UD !L\$T$$]Lo]U+p[^_]ê0f%.t&CD$D$ ]oD$D$@}<$tGj뉉f>~$E~LSC9u1Uf~7g]]USt ÙEPw*0tֈ-[]ÃLu$'[]US DEPw*0t聈-[]ÃLuU T$$Z[]UVS ¶ uD$:4$ It!D$p3T$$tE D$4$6 [^]- [^]UVS J ouD$:4$Ht!D$p3T$$QtE D$D$4$&" [^]ËE D$D$4$ [^]US ĵ EMPw*0t#- []ÃLuL$U T$$$" []USa ÆUBw0t1[]ÃLu$X[]UVS  >uD$:4$aGt!D$p3T$$ ~tE D$4$  [^]B- [^]fffffffUWVS虴 Ƕ}E1EL xt=1}t ƒu@u[^_]UWVSĀ ;}E|1xƋE 1L: EL* E|1E]ELB Eƒx  EB A ǁE9uʋE%u ͦ EpxEPMHx }1E]uJ˃4x MN K u9uʋ]uE%BzBE9yxE+?1[^_]ËUL 1ۍUL @t?Et鸓$I )9uu1믋}L: E1ۍEL* EEEu1}}}8tDAuEƃ@E}t,ى%I$))9D E9u }u _]uE,^@]l1҃DD [ u̓E9uEL& a:!@t$E,Du۸@u܋}L ƇL lE}8,L8L 0u}̤L ], ]Ec M{ }~Et M  ЋU 1ҋMDŽ,  r1ɉ]] u]U1 L ȉу9uMՉʉ EMU1 L ȃ9uMՉʉ MEE@ttM Љʃ Љ Ѝ Љ ЋU‹Et 1itEUEEt @FEǀ ]UWVSXk ŒuE EM1ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EEL& EEEƃ4x  EF A Eu1E1EE܉}ԉEEƃ4x  NjF A E؃uĉ}EEHE EEˉuEE܋E؋uu؉EEuuEE]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋL ]3L ]3L ]3L 3L 3L 3L ]3L 1EEԋL ]3L ]3L ]3L! 3L" 3L# 3L$ ]3L% 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}uL u3L u1E䋼L u3L E1ljE3L 3L 3L 3L! 3L 3L" 3L 3L# 3L 3L$ 3L E3L% }m1]E%MɁ ȉEE%MɁ ȉE1E1L EEE0Ãx  NjC A EuċE8upuE+u!1X[^_]ËME$ 4UWVSP4 ]E̋uM M1EЉNjE19$}܍]]ȉ9u<$…E<_t:t< t<:tMAE̍ŗ}ЋU+ZP[^_]ÉUĉ}؋}1D$ D$E؉D$$u+EҀ09uE؉$tEԀ8*sx0iE̍ȗdEEEEEyD$ D$$<$]7D9tD$ )D$|$E؉$nf}2ae}sha1f}1 }argo}argo}argo}n2d}M̈, _ȍ0 , MẸE Ȁ`QŃ?}<9E ЉEE9uËUċEEԃEM̍1 MEṂ̍M/^Ń?}t}<9U}Ĉ  ڃM4`À@~^뿍^҃?뷀@~Q>Q҃?3}EԉD$4$p< .t&U<:MMEM̍, MME&}n2idN}DEԉD$4$대}EԉD$4$ nEËED$ T$EȉD$}̍D $,EfM ȃ?9̣K?9̣K ?9̣K8̣EfM ȃ?9̣K?9̣K ?9̣K8̣CEf?9̣K ?9̣K 8̣CC EEԉD$4$I2}n2i] UWVS) REǠ1EEXUэuuUS1r 9uZ9MuߋU$U+u[^_]Ë] UWVS,豤 E؋U1ENjE1Z}uU܍S1MJ 9uMZ9uڋU܉U} D$ D$|$<$uEUZ8uECу9uF9t܋E}U+u,[^_]ø]- UWVSDͣ U uU1‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$舞 @D$$ t@D $9sÁ t׉D$@BD$ <$L$ $?293?!~9.?J9)1?߲9%?+59#?x}9#DžTDžJD$$D$$襼(D$$xRP489ȉ )ڋ09<} D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$n$D$$qQtD(,481։ 1 <90Dž|Dž@mDž ^DžODž@Dž1UWVS莟 ǫEu 1‹E1D$D$LB $DžDž4$8$u t$4$wkƉ$dDžD$$6k8vu[x=uUT$$ D$$j DžDžDž DžDžb|$4$zj3ptjtmt2$袔1U+LĬ[^_]ÍT$$x*tT$$y6OT$$xۋ%t$=N$fuDž!t$5N$fDžID$$!iƉDžDž|Dž[<Hv2BIڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/Ӄ? ЃA! = ЅiD$$gt*D$ D$D$p$W$蹑 4$p`|$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$?D$D$4$!D$D$|4$D$D$p$$%D$ΗD$&$GZUVS- Ruv$Z‰)Ѓ[^]øh`UWVS4 ÉED$ut$u 4$bu3D$ ED$$KhEE8$E $]ôh`)‰UE E h`9tt$u+E E܋E$]^NjED$ut$u t$u܉t$ D$D$blD E$TLD t$|$ ML$D$E$_}v/lj|$t$ ED$D$<$/9]uىE D$E܉D$ED$ED$ ]荃D$D$b}<$ETU^D$O O ȉD$$9EPU9uD$]^D _D  LD ȉD$$EPU@D$D$4$E4[^_]14[^_]EWfffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSƉEfM䍾}܁H1۹1҉}f;]ǃ? u}19uEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uu9Muƃ[^_]ÉǻLUWVS .9ɍ  dH USHf`TEPƋ@D1\f;`6 uދ\19u111ۍhXdLD1` Ѐtfu Ѐu拕`1Љd1f< Ȁu1hXLTdPhxP9GTP0`DP1\f? uዽ\1Љd1fH Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@D98uԋX1ɉ`T1f|=؃ u9uѻ@TXO9uu⋽`E؉`]BbJ9uߋHfǂ E $2?ƂE aH E Ƅ E $,T$ T$D$$F7D4$O`D$HD$T$ 14U+u{[^_]Íxƅ??tOlEȉDRH\UWVS %u(} 1E14$N$?$u 1H$9u勅)ȉx  @4$[$D$(|$4$pD$D$4$VT$|$4$:}<$$D$(L$<$T$T$<$$D$(L$<$ۄ|$0, $K$lj~T$,D$4$苄Dž0Dž4Dž8Dž<$,D$4$Bt&D$uڋ(D$4$uڋfǃE $1ƃE $ D$D$E $ C?D$xD$ B$t$,$-1s$D$(D$<$腃 ɋ D$,D$<$O|$,$ńB<$ʉ)Ѹ%I$))Љ)‰ :D$,D$<$ ɋuo$D$(D$<$荂9$D$(D$<$l D$D$<$E $D$(D$<$p D$D$<$ ?E 򉓌E D$06 < ȉD$$E E D$17 = ȉD$$=E E D$28 > ȉD$$E E D$39 ? ȉD$$E E D$4: 5 ȉD$$wE E D$;T$$ME PE @D$D$,$fE+[^_]À$')MDž0Dž4Dž8Dž<Dž Dž DžUWVSX MMUu1ƋE1@Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\E[1ۍT009u$-yD$@|$<$KyE D$D$<$2y|$$z<$xD$@t$<$yD$t$<$x|$4$szE+[^_]Éu4$mxUT$L$4$xt$4$zDž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TfUWVSQ~ vutJD$ED$4$MNjE9t.8u)O8"tE 81[^_]Ãu1sOUVS} EU ]~ÍLу? H9u[^]UVS} ŰEU ]~Íу? H9u[^]ffffffUWVS8Q} vƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$t8[^_]É<$5uEĉ|$4$Eă8[^_]U| ͯEt t&t1]ËM t6NN]ËE tVN]ËE tEN]Í5K]Í5N]Í=N]UWVS:| _u} 4$9uw[^_][^_]UWVSd{ u}$}(E($FjEEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$a…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$ <$qUЃd[^_]äftumt׉UE4D$ ED$E0D$E,$)8UtE(D$}<$} E0D$E,$k <$[qjfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVSvw Ûu4$xu1҉[^][^]UVS>w cu4$@u[^][^]UVSw (u4$u[^]}[^]UWVSv }u <$ …uA}wLU>…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSXFv kM $;ƉEE$dljE4$dƉEE EEEED$ML$}<$1t.1EM $lM $l4$lEX[^_]ËuE$ dEtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVSt }u <$ …u8T…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSct È}u <$b …u=…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSs }u <$ …u=h…u+t"11U2 у9uUɃy Ѓ[^_]úUs ¢E##+ፂR]Íq]Íx%]Í%]ÍR]Íу+?҃/ [^]UWVS É։ϋMER)Ѓt$9uuE [^_]ÃEE9sDE11փE? كCwʋE9EuljUt)?UZsEE9rEE [^_]UWVSEUEEEEM4u}Ov(}W];;}}UM0~^z) ҍ^!ڻZ) ! ڍ~л9) Ӄ! ˃+Ӄ>΃/փ? ҃A! ځ}w ҅Uu}M[^_]1[^_]UWVSE0 wG׉1w7  r-у0 v9t}0t ؃[^_]Ã9t1ۉ؃[^_]UWVS *D Owu} FEFED$E$O?$ug$E D$EUT$<$ u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=u}tUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSXYB ~u}EE 1UE1D$E$wƋẺ$-E+} f$OME Eĉ4$U9PMMȃ/MU)ƒ$v=yM}BEŰB8D$z=UĉT$ D$D$u҉uȉ4$V4$‹E9\BPBMыE)Ѓ+$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$4$9M@}uȃoMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$D4$ ‹E9JBacMыE)Ѓ,p=yM}EŰB0D$UĉT$ D$D$uȉ4$4$‹E9BEЋM)уf$xqE̋H@$i)ƉZf$E̋0QG}̋O $N1}E+/EX[^_]Ë}ȤA}f}ȃ0f0ft&"ffvE}}qM^rEM)M(W}ȃ}f}ȃE҈AyuӉfE҈AyuӉfE҈AyuӉ fE҈AyuӉ$fEUMR)уtu]UVSU ṽщcw[^]ffffUWVSc< ǀo|$`Ѝ$$X03ps$X$\2z9uً$XA$\A$`A $dA$hA$lA$pA$tA $xA$$|A($A,$A0$A4$A8$A<$A@QD5т歁RQ$$AHQL5l>+h$$APQT5kAكD$ T$$AXQ\5y!~[D$pT$t$X$\D$PT$T$x$|$`$dD$@T$D$$$$$h$lD$(T$,$$D$xT$|$p$tD$T$$$D$hT$lD$`,T$D$06_D$4:OD$8+D$ $D$PT$T$X$\D$pT$t$$D$8T$<$$$$$$D$@T$D$`$d$$$$D$0T$4$$D$xT$|$$D$(T$,$h$l$$$$D$HT$L$$D$hT$l$$D$T$$p$tD$ T$$$$D$XT$\$$$x$|ȍ$$X3J3Z3 3ZX9ue[^_]UWVS]u {@1ɼCg jC;ʄC gC+Crn+C,hC0kAC4كC8y!~C<[ڍ~@M]u 01pq]u11r9u]u 1[^_]êCf8fUWVSLS/ xbuE Ǡ1U1҅P?EEEEEEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$tFXF\FPFT蜖UWVS]Es8U -ST SP!<}J`)ЉE< u zeSC@SDC@SD1EU19EsH{LS`#ǃE}} =%M ȉEC@SDEUC@SD1U9иEs11sH{LʉMM逋E)=w}U `< u s,uu1[^_]äftuauit11t&fuUu<oҹ`^PffE pE땸+UWVS+ _lj(UE uà1, M1ɅH?fM?W0E1Dž2Dž6Dž:Dž>0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$$&$p 1߃}rMEuQEuHD$\$$$D$$(e1,U+[^_]äfEtD$$$($tBXB\BPBTD$$D$$$Ǽ$t맋(UWVS\) ù\ML$} 1D$‹D$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$T΋9EAT AP1F@VDF@VD1FHVL%t$FPFT)ȍT`D$D$$V`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$~-!D$0 "D$0 !D$06 "D$0!D$0f !D$0Hy!D$0* [!D$0 6=!D$06@ !D$0I!D$0 "D$0q!D$0v, !D$0Xa"D$0:bk!D$0M!D$0|/!D$0g!D$0N"D$0!D$0!D$0h6!D$0J{!D$0,]!D$0?!D$0!!D$0,!D$0m!D$0"D$0x !D$0Z!D$0&D$ D$ D$%$ &D$ D$D$ $ڕ4&D$ D$D$3$訕l&D$ D$D$a$v&t$D$$Mt$ D$D$$3o&D$ D$D$$0!D$0&D$ D$D$$軔5&D$ D$D$Ù$艔&D$ D$D$T$W&D$ D$D$$%&D$ D$D$x$]&t$D$$CLt$ D$D$$谓&D$ D$D$B$~&D$ D$D$$L&D$ D$D$$&D$ D$D$$&t$D$$8Kt$ D$D$$襒&t$D$$Jt$ D$D$$b&D$ D$D$y$0fD$1ffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVS -]E81}8CC twS(s$tbD$D$$ЉƅtpC@8@4?E D$$tEt$S($S$CE[^]DK$DC C(1uиɸUED$ E D$D$E$]UVSEM tYX tRP$tKPtD;u@B-4?w3t)x6(r@1 w#EB?EEEpD$D$$]}}GU܉B0G??E VEX}E؉mE؋E@N?EX څ}wOE ]UԋuM؉]]BƃvUԋU]uM؋]EȋM)ȋuFMA :E@O?EЉEEE_ E}M̍}WPGX LWTG\GG?} mmEԋE@H?}uЁxE܋UĉP pUԉxuUVߋuԃItftE@t E@ \ )UUԋEHDM)щHDE@uFDF:?9EP UR$tB1ҋ}G9?E@;}W$tB}GDG;?}wCE@Uԋ]uMBƃvUԉ]uM؋}EG< }E̍-U܉BE@Q?UBD?mmEԃ} wCEUԋ]uMBƃ vUԉ]uM؋}]SdCh s`}mw ) }E̍&U܉BE@Q?Uԉ]uM؋}uȋE)} 老B??or]ԉu}벋Et1] 9uE|0C$tH$MtKD;H(s ACDEuEP)uuԉ E@??E21] 9uEE|0C$tHMtKD;H s ACDEuEP )uuԉiUԉ]uMUԉ]uM؋}uȋE)}ԉ]u}W4])Ëw89)W,ƋEPD9sȋ}9s)E)‹]SD}9u}ċEPD @E@R?E&А{9UsBE]ԋu}MCǃ9r]ԉu}MظЋ}!]CDCD})U:f*EEE@P?uȋE)EJ c M)ȋ]]]MYl]ftYt]9]U}E؋UMyQ?x ft }E̍(&U܉BAQ?EE1UċuЅ2 E}GDuGH?Uu ЉEE!ȉp@U9Us|E5]ԋuU؉}}xCǃE!MMȋMMHfM@M9r]]؉uu}U؋Um})}؋M}v]ԉu}EǀXPHX׋E!Hp9Es_UԋM؉}؉]]ZBE}E!u4E~v9rĉUU]M؉]m)E؋]艃sD 3Eǀ@??Mu)ƋE@D9E@#E@ u}UU1Ez@ t$EԉD$UB$]#cUB)uuԅ=REǀXPHX׋E!Hp9EMUԉ]E@`E@ 9t$EԉD$UB$]ybUB)uuԅR"EpHXL@K?9]sB}^Uԋu}MBǃ9rUԉu}MظЋU!Ћ}GHU)]m)E؋U艂rDE@M?U4}wC}]ԋu}MCǃv]ԉu}M؋Et }@$t@0NEB))9E}E̍-U܉BE@Q?}/]ԉU-}E̍EPD@B?} EEUԉu@}E̍]܉CE@Q?QqItDUЋ])ڋ]ډD$T$ $]̅`EHU܉J0X xEpEu99E̍U܉BE@Q?EЉEE}U̍M܉QUBQ?mmE9s55]ԉƉȉs9r]ԉȋ]M)؃1u]M؃w-E̍Y&]fDSt9uE@lu荆4FpFPFXD$FXD$FpD$ D$FtD$$]n}F]܉CFQ?]ԉu}UT$UEԉD$}G$]F^GUzU}E؋}uȋE)BEԉu]?EED$ED$}G$]]G7}E̍ך]܉CE@Q?} ։uU! yf}q<9}swU}]]؉EEIPUuU!Muu4NfMvM9rEԉ}ω]؋E]M)ȉ])E؋M艹EAD<"E@l@E?1EPL@I?]K9s5\]ԉƉȉs9r]ԉȋ])؋MF]tKrM}uMEE@G?} }uȋE)EEP$t EEt E@ E@6?EEfvPjEfED$ED$}G$]c[GGEE}UUԋuȋE)EE>Eԉ}]>@ WlaE@l@F?1E܋UĉP UЉPUԉUPEUPuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS }u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$q\ML$M L$$[\9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$ Eԋuu1E܉NjEEFE~@@}S?}GS?wH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃUEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]fffUWVS E}Mx11 rtE xfDU9uEExfG0UofxZUWVS4پ }̉ÉEЋ@,E܋{t-Ek@^S,sɀ @\Yl])…A8D$ T$D$u4$]x-FlF\4@u FE@@\Yl])…x?A8D$ T$D$u4$]-FlF\1n1N1w1fEP}]ԉU}]ԉUt}]ԉUc}]ԉUR}]ԉUA}]ԉU0}]ԉUUWVS } EJEqEp3 Y}OE@ M苔M9~(uaE9tF}LDDF|EE[^_]D$E$E@FtFl9F\EXYtYVDFLfDBDD$D$$Cdž   9TE,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS 蓋 EuE EM}EEEEE U$o81f8]vEFF ^$}uEEG} }UD$D$F($V ÅUF0@*P@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]A|A13u3 eEDF$EDF F( [^_]øCE%@F4$}U ED$ED$D$D$D$ D$E D$E$]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@ CL{DMqD-{uvuju^CMQ+QS $ | 0 E[^_]älfb.t&ft.t&`fV&ft&fu5AfY{8f3f+0f(-f%*$ E1E%> g,UWVS8$ MEȋM }׃}T,uĉU 2A3؃u߉߉UθEEEE]ȍ,ỦuEʋ1E؋u3ruԋM3JMЋ}3z }}3z}܃<EEEEE܋EU U҉3tRET  }9`U릋}>X8Xr‰]f9]s‹EƋE܉D [^_]ËEX8Xrf}U냉E܉D [^_]UWVSLÉ֋EЋJ9}A EǃPǃT=1E1M̉ыU"P\ ƄXE9tf<ufD9uM̃YẺMM}ȉuK}11҃P\ fƄXU)‹}}t T7)t4}뤉MMuEFM̉uȋuЉuM̋uȋPM}̉uu9B3XEfpfq~` UЉv}` UămẺP` ` }Љ6` MȋTMEUĉX MTMȉT Ѝ UȍUffXEX8*%MuET` Eȋ}P FE̋AEAEAEč< 1mu1 9r EЋ}fD}<ET PEE]<)ދ]4 ]EtD9}7]Ѝ DD]9}EfA9u|‹]fC< ]9{11uK: fNuExBuЍ|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]ȋ}tEčPUȍ4C: fEȉC< ftfC< fK< f< Uą$=uS< }ȅt>uă\ 9M|uЍ<L9t)fWmuȋuĉ뤋MċEcȪf1E*ȪfUWVS ERfDHDE1E69t*9}tuf| 1]9Mt>9|9}6}f| tK9U19Muƒ [^_]Åt49]t Ef| Ef u1]z E$f u$1ENf t1E*]1UWVS BE%Z]\ ]1һ}܉fMMc9t|~ | Uf UU)9fGHOOGPWW )UUDu  ډU ʹ)9fGHOOGPWW )ڍL0~E fOWZ_WGX_ )fEu99E1EM9MUUUUVU9ƉU@tZϋD $MaEFD$M $迚Ut*uE1[^_]É$!9Ut$WUWVSZ ýUΉ$ɷtWljE$E EEED$t$E$FtQ<$FQM UEƅu$[^_]+ [^_]+0[^_]|+0<$Pt[^_]UVSY u E$t$F[^]+ 1[^]UVSY åu E$谶t$/F1[^]* *[^]UWVS(Y ME$[ tPƉE$EED$ED$E $t 4$O1N*84$Ot;*8[^_]UWVS X ċ}GtSD$UF_ƋGD$U$Jt)4$¦=yarauE 0 [^_]É4$)1 [^_]UWVS X >}GtSD$U^ƋGD$U$ėt)4$<=tciduE 0 [^_]É4$`3)1 [^_]UWVS W øuFt>D$U:^NjFD$U$>tE 8( [^_]1 [^_]UWVS -W R}GtUD$U]ƋGD$U$ؖt+4$P=yarauE 0\( [^_]É4$r1 [^_]UWVS V Չ}GtUD$UW]ƋGD$U$[t+4$Ӥ=tciduE 0' [^_]É4$1 [^_]UWVS3V XED$E D$E$ tSEt4}D<$\ƋED$<$ȕtE01[^_]Q'[^_]9'[^_]UVSU ňut$E D$E$r t.yaraUFƅu [^]&0[^]&0[^]UVS1U Vut$E D$E$ t.tcidUƅu [^]l&0[^]\&0[^]UEU E MMM] UEU E tcidMMM]UVST éE D$E$vƉ$Ǣ=tciduE0[^]1[^]UVS4T YE D$E$EvƉ$w=loobt 1[^]É4$ŊU[^]UWVS S E$ډt,ƉD$E D$E$vlj4$M [^_]1 [^_]USS æE D$E$uUT$$dA[]USHS mE D$E$YuUT$$A[]USS 4E D$E$ uUT$$A[]USR E D$E$tUT$$)B[]USR …E D$E$tUT$$WB[]USdR ÉE D$E$utUT$$`B[]US+R PE D$E$8t,ƉD$E D$E$`olj4$( [^_]1 [^_]UWVS ZL E$D$7t,ƉD$E D$E$nlj4$ŗ [^_]1 [^_]UWVS K E$D$y7t,ƉD$E D$E$nlj4$c [^_]1 [^_]UWVS K ú~EU$T$7t,ƉD$E D$E$9nlj4$ [^_]1 [^_]UWVS 3K X~E$D$6t,ƉD$E D$E$mlj4$蝖 [^_]1 [^_]UWVS J }E$D$6t,ƉD$E D$E$qmlj4$9 [^_]1 [^_]UWVS kJ Ð}E$D$66t,ƉD$E D$E$mlj4$֕ [^_]1 [^_]UWVS J -}E$D$5t,ƉD$E D$E$llj4$s [^_]1 [^_]UWVS I |EU$T$q5t,ƉD$E D$E$Illj4$ [^_]1 [^_]UWVS CI h|E$D$5t,ƉD$E D$E$klj4$讔 [^_]1 [^_]UWVS H |E$D$4t,ƉD$E D$E$klj4$J [^_]1 [^_]UWVS |H á{E$D$F4t,ƉD$E D$E$klj4$ [^_]1 [^_]UWVS H ={E$D$3t,ƉD$E D$E$jlj4$胓 [^_]1 [^_]UWVS G zEU$T$3t,ƉD$E D$E$Yjlj4$! [^_]1 [^_]UVSTG yzE D$E$eiƉ$藕=gntst 1[^]É4$'tU[^]UWVS F zE$'%t,ƉD$E D$E$ilj4$j [^_]1 [^_]UWVS F yE$$t,ƉD$E D$E$Gilj4$ [^_]1 [^_]UVSBF gyE D$E$ShƉ$腔=atadt 1[^]É4$vtUEt 4$vM[^]UWVS E xED$E$tt,ƉD$E D$E$uhlj4$= [^_]1 [^_]UWVS oE ÔxED$E$4ut,ƉD$E D$E$hlj4$ې [^_]1 [^_]UWVS E 2xE D$E$gƉ$P=gntst 1[^_]É4$$P$U93DžtڋUT$D$4$$t U:[^_]É<$;UVSD èwE D$E$fƉ$ƒ=gntst 1[^]É4$A$tU[^]UWVS &D KwE$V"t,ƉD$E D$E$flj4$虏 [^_]1 [^_]UWVS C vE$$"t,ƉD$E D$E$vflj4$> [^_]1 [^_]UWVS pC Õvut*t$E D$E$%flj4$ [^_]1 [^_]UVS C EvE D$E$ʉƉ$c=loobt 1[^]É4$yU[^]UWVS B uE$xt,ƉD$E D$E$lj4$9 [^_]1 [^_]UWVSkB ÐuE $jxt%ƉD$E$蟊lj4$[^_]1[^_]USB =uE D$E$ˆUT$$/[]USA uE D$E$艈UT$$F0[]USA tE D$E$PUT$$0[]USmA ÒtE D$E$UT$$0[]US4A YtE D$E$އUT$$0[]US@ tE D$E$襇UT$$0[]US@ sE D$E$lUT$$%1[]US@ îsE D$E$3UT$$p1[]USP@ usE D$E$UT$$1[]US@ rE D$E$褅UT$$2[]US> qE D$E$kUT$$2[]US> íqE D$E$2UT$$2[]USO> tqE D$E$UT$$$2[]US> ;qE D$E$UT$$12[]US= qE D$E$臄UT$$22[]UWVS = pE$D$#)t,ƉD$E D$E$lj4$ [^_]1 [^_]UWVS?= dpE $D$(t%ƉD$E$llj4$豈[^_]1[^_]UWVS < pE$D$d(t,ƉD$E D$E$lj4$N [^_]1 [^_]UWVS< åoE $D$(t%ƉD$E$譄lj4$[^_]1[^_]UWVS $< IoE$D$'t,ƉD$E D$E$Clj4$萇 [^_]1 [^_]UWVS; nE $D$D't%ƉD$E$lj4$5[^_]1[^_]UWVS g; ÌnE$D$&t,ƉD$E D$E$膂lj4$ӆ [^_]1 [^_]UWVS; *nE $D$&t%ƉD$E$3lj4$x[^_]1[^_]UWVS : mEU$T$,&t,ƉD$E D$E$Ɂlj4$ [^_]1 [^_]UWVSH: mmE U$T$%t%ƉD$E$vlj4$軅[^_]1[^_]UWVS 9 mE$D$o%t,ƉD$E D$E$ lj4$Y [^_]1 [^_]UWVS9 ðlE $D$ %t%ƉD$E$蹁lj4$[^_]1[^_]UWVS 09 UlE$D$$t,ƉD$E D$E$Nlj4$蛄 [^_]1 [^_]UWVS8 kE $D$N$t%ƉD$E$lj4$?[^_]1[^_]UWVS q8 ÖkE$D$#t,ƉD$E D$E$lj4$܃ [^_]1 [^_]UWVS8 3kE $D$#t%ƉD$E$;lj4$考[^_]1[^_]UWVS 7 jE$D$4#t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVSP7 ujE $D$"t%ƉD$E$~lj4$Â[^_]1[^_]UWVS 6 jEU$T$w"t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVS6 øiE U$T$"t%ƉD$E$~lj4$[^_]1[^_]UWVS 86 ]iE$D$"t,ƉD$E D$E$U}lj4$袁 [^_]1 [^_]UWVS5 hE $D$!t%ƉD$E$~lj4$E[^_]1[^_]UWVS w5 ÜhE$D$A!t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVS5 8hE $D$ t%ƉD$E$?}lj4$脀[^_]1[^_]UWVS 4 gE$D$ t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVSS4 xgE $D$ t%ƉD$E$|lj4$[^_]1[^_]UWVS 3 gE$D$t,ƉD$E D$E${lj4$b [^_]1 [^_]UWVS3 ùfE $D$_t%ƉD$E${lj4$[^_]1[^_]UWVS 83 ]fEU$T$t,ƉD$E D$E$Wzlj4$~ [^_]1 [^_]UWVS2 eE U$T$t%ƉD$E${lj4$I~[^_]1[^_]UWVS {2 àeE$D$Ft,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS2 =eE $D$t%ƉD$E$Ezlj4$}[^_]1[^_]UWVS 1 dE$D$t,ƉD$E D$E$xlj4$&} [^_]1 [^_]UWVSX1 }dE $D$"t%ƉD$E$ylj4$|[^_]1[^_]UWVS 0 dE$D$t,ƉD$E D$E$xlj4$e| [^_]1 [^_]UWVS0 ücE $D$at%ƉD$E$xlj4$|[^_]1[^_]UWVS :0 _cE$D$t,ƉD$E D$E$Xwlj4${ [^_]1 [^_]UWVS/ bE $D$t%ƉD$E$xlj4$I{[^_]1[^_]UWVS {/ àbEU$T$Gt,ƉD$E D$E$vlj4$z [^_]1 [^_]UWVS/ >bE U$T$t%ƉD$E$Gwlj4$z[^_]1[^_]UVS. aE D$E$iuƉ$}=gntst 1[^]É4$}tU[^]UWVS b. ÇaE$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS. ,aE $7 t%ƉD$E$Et1닋F$ʉ<$1oUWVS s$ ØWu} D$|$4${u 1 [^_]ËED$4$yt|$4$| [^_]UVS$ 6W$ tƅt'D$4$(oFF F[^]UWVS# Vu$ …D$$UnUBB BU4$-EE$Ut]NjMs"EtfEtBEB Ѓ[^_]׍D$ 0D$D$/x&$K$n1UVS" Uut4$[^]"D$ D$D$}x&$UWVSm" ÒUEtw} |$ ED$D$$ƅxEH $M…t1|$ ED$ML$$UU1x[^_]1[^_]ÍD$ D$D$Ux&$#U! TUT$ $]UVS! îTut4$E[^]D$ D$D$}x&$UWVS (! MTutb9uXFt@~ G$r…t>FtAD$$UU [^_]H4$l [^_]1 [^_]Í UWVS þSutJ9u@~ G$…t,Ft/D$$UiU [^_]1 [^_]Í U, MSEt 9t1]Ë@ ]U %SEt9uP@tt ]1҉]Í ]US REt 9t1[]ËU tH Q9Ur@tD$E $[]Í U^ REt 9t1]Ë@]UWVS' LR}t;9u1G $w ƅtGt"D$4$[^_]1[^_]Í U QEt9u @t]1]Í ]UWVS íQut 9t 1[^_]ËU tM 9uFtA F EP$U DžtŋE HɋUtOFt@L$D$ ,D$T$<$F~}~ t$s 븍 UWVS Put 9t 1[^_]ËE FtE $XF EH $M …tFMtI} |$D$ ,D$L$$U.FUV}~ t$"o 믍D$ D$D$;x&$LUS PEt 9t1[]ËM tM 9uL$$)mUS úOEt 9t1[]Ë@tU T$$a[]Í USA fOEt 9t1[]Ë@tU T$$ []Í US OEU tG9u=t99 u5Rt@tT$$[]Í @uፃ ٸfUS èNEt.9u$@tU T$$W[]Í fUWVS 3 XNu~(Ft  [^_]D$ED$ D$D$4$1tȋUBU$E DžtFD$ED$ UT$|$4$t}M9Muu>uyF8"udF1M Z$ ƅt'D$4$eFF FE 0 [^_]É<$D$D$4$ctՋMofffUVSUE 9t4J2Ht"JZxPx3H3X1 [^]1[^]ø[^]US üLD$$!PF $[]USY ~LPF $ڋ[]UWVS41 VLM EpAQAtpǜD$ T$L$D$ uԉ4$D$,|$E$ipt2t$E$5mt|$E$^q4[^_]Í*14[^_]ÉD$ T$ΜD$D$ uԉ4$Ly&D$ LD$D$@'$UVS! FKE 0t$lF $k4$1[^]US KD$PF $&D$lF $1[]UWVS Jlj։M ML$ED$G$VEU9ErfEG[^_]8"u1UWVS 9Jlj։MML$ED$G$XV!ЃtNEG[^_]=8"u1UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS0 UIƍD$$踋PF <$藈t$lF E$t $E4a<$kUЃ[^_]ÉE<$S$ 'Ut֍ D$ $M`MAFAFA<$ t$E$Mt+$E`<$M $B UЃ[^_]ÉL$ME$M9uE<$訇UЃ[^_]ÍӜD$ hD$D$M@'$@UVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS Fut 9u4$^[^]1[^]UE@]UWVSv —FEt 9t1[^_]@t9H@1һ9ˉr|9[^_]ËP@Ӂw?Ӂ19ωr-9[^_]ø@[ QU EEt 9t11]ËP@]Uy šEEt 9t11]ËP@]UL mEEt 9t11]ËP@]U @EEt 9t11]ËP@]UVS EEt 9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVSi ŠDEt 9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS DEt 9t1[]ËHX@uȉwދE []ËHP9ȸsUS ¢CEt 9t1[]ËHX@uȉwދE []ËHP9ȸsU Et 9t1]ËHPwE ]U ¡>Et 9t1]ËHP@uxE P]US6 [>Et 9t1[]ËM tM 9uL$$[U >Et 9t1]@tHxUxU M3P3H ]U =Et 9t1]@tHxUxU M3P3H ]US^ =Et 9t1[]ËHX@u xExȉ3E 3U []US 1=Et 9t1[]ËHX@u xExȉ3E 3U []UWVS <]1ɍuEEESt [^_]À{(uSU-tn+ti0u UzxtmMMti;t D$@D$$~tU [^_]ù RAu_Uu>fUWVSP ;<$eFH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$)fuP[^_]Ét$D$$G_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$GeuP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPw W ӍPЀ w 0 1UWVS<1 V94$}cB BBB$BBB(B8O)Bf^.t{BQDžT$T$4$Є\?D$D$ D$|$4$D$D$ D$|$4$Jcut)B wB8|<[^_]ÿ"[upB8SxauZxluTxsuNxeuHxBJB(z xru"xuuxeux̃+)D$D$ |$D$4$D$D$ D$D$4$bu1<[^_]ÍHJx"t%lBB(уzc<$N1USEJv[]ÉuUS  5E ;Et1 []ÉD$ED$E$C []UWVS õ5]u}E E $<‹FUJv<F H!uix-x-PVHt|B-ttlB-u<-uz>tBFv1RU/}u*}~,Fǀ  *fu1[^_]À/t>t t  ủ)N] t9uʉT$D$E $]Au?/ F(<>tt uHvf~ t{ lqG u\.x$E]ݜD$ D$D$l'$ t=u)Vx"xPV HЀ"u c"tXuEF(>FFF F$GFV1u)щN$x><UWVS02EEu }8X1t9s]<<{<&uKatAlt,gt{qu({uu"{ou{tu{;u"례{tt;10[^_]Kmpu{ouހ{su؀{;u҃'`{;u<M{tu{;u>4EMMt<".E<\tdMt&ȋM)]9t 9rD]6U멀{p'{;CEt)<>tuE$Tp(r EpD$t$$t}(u GtXtA1(u~u EpENjE$[^_]Á8versuxsionuE tE E D$E D$}<$t}DžmD$t$E$z<$D1k~WIUD$E$m]UWVS .,$Qlp$WthD$D$E$dp0xD$p$Û$MЋEԉhl!tW91!ȉh! D$D$p|$D$ D$T$p$eƋt0<$eplD$T$4$iE D$4$NjtPD$T$p4$oipT$4$m7t$|Ĭ[^_]ËlЉhdD$D$p|$D$ D$D$$dƋt0<$"dhD$T$p4$hD$D$D$D$ D$lD$p$vdptdtAT$4$[6t$j1p$hct$G1UD$E$]fffUE 9E]UWVS%)ƅtBD$$yEt E$@<DžMu% $1\$@DžtED$<$@D$G$iEG,w0G4G8G<[^_]US@e(|F $g[]US?(D$̕$j|F $g[]US(D$|F $gLD$F $赥1[]USù'ED$E $z[]USgÌ'ED$E $J[]US7\'E$hE $zh[]UWVS(&'UM܋p4@,EEGEt@E<E tu1<$Z0[^_]D$4$=t؋E EtɃF E䍃lE؉}} ED$4$=;EZM9U9PUUE܉4$<E܅UT$D$4$3~D$4$<4$<U܋T$4$P tEO49H1bEq<$YD$4$>Ɖ0[^_]Ë}4$(<E$5mcD$4$v9n}э&D$ D$D$'$}E$l5n 4$;EԉD$4$J=D$ D$D$'$軫UVSJoE 0t$F $蔘F,v }><<E]E tE $[^_]Ãt}E9E)>E1}E9E)><<Nkr<[u1R}GEt"E9E7E)ȉ >}> D$ LD$D$e)$ə=2D$ LD$D$,)${UWVS .$lD$$UUBB BE u Ѓ [^_]ËE $UtJNju} s5E u%E uBE B Ѓ [^_]äBE B fE tM $1UWVS 9^u} tEt=$莿t%T$$EAE@px [^_]11UWVSuE u@1$!DžtD$<$GwE G [^_]ËE $tDǃ} s E uE u뛤ƐfE tM E tE o1UWVS :u} tEt=$jt%T$$EE@px [^_]11UVSutG9u=Fu!F D$F$tH[^]É4$[^]1UStEt 9t1]Ë@ ]U+LEt9u@]1]UWV"Et 9t1^_]ËU tP 9Urptt} suuɤfuufUWVS]ÂEtH9u>P pt0t{$U袼t!NjUs*ut[^_]Åu!1[^_]ftt鍃*D$ D$D$)$!<*D$ D$D$)$U°Et9u@]1]US_ÄEt 9t1[]ËM tM 9uL$$US =Et 9t1 []ËM9H uU tL$M L$@$E  []UWVS u>t=~(u7Ft=D$ T$VT$$t F$ [^_]ËFD$U$11tՋ}O $M詺EtFVT$U$MUK9}D$ڢD$4$I$@ƅD$4$FEF~ E 0%D$ED$F $ljEt\UF$F 9:" D$ lD$D$)$膒E$ [^_]臜8"uE$$XƅtEE$1 1UEt 9t1]ËM tM 9u9]UVStÙ t$F $ƃF t$F $~ƃF 1[^]US!FE xtW]C$$[^]fffffffUWVSƀ8$tD9t- P9/t9rq/u9t9t8/t)ȃ=%׋ƄfDž.$sP /.pl@istX@XXXXf@ X $ڵƃtb|$D$4$9 84$$r1~8[^_]~?1[^_]äƄ3f P4$c$Clj$Bׁ|$4$0D$$~84$UWVS~ǛuM ^t^F9tX^ [^_]ÉMD$$ş…FFM빍D$ 0D$D$9d,$=sD$ 0D$D$:d,$s,D$ 0D$D$;d,$r1<&D$4$Xu1<\\D$\4$-tӉT$4$tŃtaD$$Buύ&T$ T$D$#d,$nt][^_]UVS-V]u {u3vut&D$$}t,u[^]D$<$Su 1[^]D$/$6t6u Ht>D$$u뼍&T$ T$D$Dd,$mE >][^]UWVS<e]u {uZ~uvDD$$t4u~ tku btXD$$Yu1[^_]D$<$;t6utwD$$u븋vt%u tD$$u댸[^_]Í&T$ T$D$cd,$lD$/$;E >][^_]zUWVS UEx } $.ƅ$tzFFF E Ft.ED$4$ׄu`$b14$X [^_]Í <D$4$u뵉4$1 [^_]D$ 4$ztFu2|D$4$kD$ 4$ESD$4$-;>@D$|D$4$-D$ 4$Ex UWVS KpED$E$5t>Ɖ$hE tU4$tU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVSqÖutFwyM MJ]ZMJ [^]$耐t|] X]XMH ]X뼍D$ \D$D$A,$i,D$ \D$D$B,$h1fUWVSvÛUu }t`t`tAtA}tA uutA} $[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍-D$ LD$D$Z,$gUWVSED$] u}څu59D$}t }GȋT$[^_]9sut E|$8XD$1σL$uT9r9ڋD$)]t}W뗉u 11҉ËD$\$Z D$)‰$ L$t$ ؉։L$T$ ދT$L$T$ÉӉd$ D$T$9rFt>Et(D$+D$\$ $|$ }_D$9D$sq+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )D$T$‹D$ ‰T$D$ L$L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1MD$9sFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$uy9r9,)|$ȉ뙅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ ЉD$T$\$\$ L$4$Ét$Ӊd$ƉT$9r []UEU P(P$1]UEU P(1]UEU P$1]UE `` gPP]UE@(]UE@$]fSL$D$ t9tEA.&f€tuuuu˃t@Au<.t&€tAt9AtAt9Au΋D$[US ֆI D$E D$E$( []fffffffUSEM -~@R`b҃⻃rQY҃ⶃwQ@H@vu xYQƒ ҃⻃rKƒ҃ⶃwS!wxu xKSƒ҃⻃rƒ҃ⶃwQ%== AAxf []Áus닁@/st> uhctBu wue[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$mD$L$8D$9\$(N"D$8D$e[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(#D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$( J"D$8D$D$ED$E$V/D$@D$DD$@T$De[^_]C"C$pD$D$D$=u4$9)EE8EE1҉MԉU*}D9FEE>tHED$|$U$<0uى<$,}9EuEEE>uMԋE܅Ex‰ENjp,&t$E8:tED$ED$ $G;G910E<-<+<:?eB9FB 9F <;uEy69EB &tE8:tD$W$:91WE<-QEx:T:Fw E؉Gw t01EE4[^_]ËMԋUEE$*EME8<:y)EEw vSẼuE MЋM؉2&t(E8:t ED$l$T9EEЋO191EuEEyU؉: P}:EЋutE $MЉ)E)uK&t$E8:tED$ED$4$n891GyuE&8tE8:tt$$+8910&tE8:tED$$7녀z:}9E~} }؉ &tE8:ht$$7QG Iu UWVSbäI u$ǃI E ;M8-p$xI - $D$-E$TǃI --|$E$.tAx:ǃI >u[^_]Ír$I :u>u t E8:?부xt $됋>uMx:tE9M $E8:t} t+|$ D$h-:1I $[^_]|$ D$D$&$!'E 4뤿:US o`ÔD$ D$E$m []US9`^D$E$]]US `2E D$ED$&X$ []US_ED$ E D$ED$&X$[]US_ýU ED$ 1D$T$E$[]USZ_D$ D$D$E$[]US_DU D$ 1D$T$E$S[]US^ED$ D$ E D$E$[]US ^̑ED$E D$E$І []USv^ÛED$ ED$E D$E$8[]UWVS<^auD$4$.nx$P8D$4$7[^_]É4$US ]ED$E D$E$v []US]ՐED$ ED$E D$E$`[]UWVS,v]ÛEt8uj}ԉ;($#FFF )t$|$$,[^_]ÉEԉ$"E؍cEEu}uw끋,uU\ЏEx9(]Ë,]Í]UWVSTo\ÔuE }}Ǡ1}U1҉ tP9utLD$2@D$u4$4$!PEu5ME+ЃT[^_]Áuqp4$!PEtˉUED$t$E$FU뭋@E 7tSED$G$n%ut$ L$ /D$D$2u4$+4$!P7'bffffUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UE@)@3U u@ @]1]USEU ]xuQwLHtCu?HH LZYZYR Q X SP ҍ1[]øUExuxw E ]ø]UExu@ u<.w]ø]UUM zuB u<.w~ 9| D ]1]UEU xu@ u<.wx 9]ø]UEu E D]1]UWVS X͋uU }EuEE 8tr@‹Mϋu sptftuM)ȍx)lj;>M)C E [^_]EE [^_]ø‹Mϋu ru!u)wsyPfUWVS]M}4{ 9)1UD!ЉEUE)‹E1UU֋E M )Q)ʉUEUE)C [^_]1[^_]ÍsmUVSU] z)uGB1w<v5J q 9r#L tH8tP9r P9s[^]ú9r9s)8tP9rP B9[^]UVSU] z)uGB1w<v5J q 9r#L t^8tP9r P9s[^]ú9r9s00;ut.tP9rP9rغB뮉1UUE ttuB]ø]UWVSmREEEuM<vwwٸu[^_]9rE|0tG)ϋU t9} rˋEtɋUUu_B]ZU [^_]ËE t9} r]tEMDċMnE]D몍BtYZUYM\$D$$]MUʍBjUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVS]U Et9u4څt89stEt+p9r xD89s2E[^_]ÍCōH9rHD9r밃뫋U U:}7)[^_]UWVS}M UEEt7u2t99st1B9rr9s+E[^_]ÍWĸ9r:]t뫃M1u)UWVS] UЋ}uރstft[^_]uuBfUSNˁD$D$ED$ ED$E D$E$![]fffffUWVSPNNsƉ1E1ƅD$D$D$D$ D$T$4$t1U+P[^_]Í1ɉ  rFDžDžD$ T$D$<$#utjƅD$D$D$D$ t$GD$G$ut$$tu<$V" $C""UWVSTLƉ1E1ƃ J ƅD$D$D$D$  J D$T$4$D$D$D$D$ L$|$4$;DžDžDžDžDžVDžDžDžT$ D$D$$'!tjƅD$D$D$D$ t$GD$G$ut$$!thuGtLD$ D$@.D$$6J$3 1U+u)T[^_]Ë묋$ UWVSJí}EE uEǠ1E1D$D$ D$D$$!PBD$ D$D$$,Kt6D$ D$D$$ï$yD$$3{D$$_$1D$-$+$$f$^$躵t$袵D$D$$}U+Ā[^_]Í# @$8^D$<$u D$$DD$/$Pt4D$3D$!$%8PD$D$|$D$ D$T$$CD$ D$$$@D$ D$s$օ$$ D$Z$螅$L@$8u ]D$/$6D$|$ T$D$$=D$D$|$D$D$ OD$T$$D$D$|$D$D$ n볋D$ D$-$t D$B$Gэ D$Q$-芭 D$c$$ UWVS E/xElƠ1E1rf|tffDžpD$D$$DžxkfDžrpD$<$x*rflE+u6Ĕ[^_]l<$[l|UWVS DEwEhUƠ1E1pl } t2} [/E+Ę[^_]ƅpt BtE qD$D$E $ެDžxfDžrlD$<$xIrfhoƅptBxB |BEBEml<$ wl.U D$E D$E$]UWVSBuƉtE|E xE1E1貫DžDžDžDžT$D$$>SDžDžDž&D$FD$${DžD$D$<$9FD$FD$<$cc<$s80.t&8=~4$@Dž)o8#tf$vD$D$$E+Ĝ[^_]Ãh.$[똋F?ƅD$D$D$D$ |$FD$F$|$$~vƅD$D$D$D$ |$FD$F$Ou!|$D$$D$}D$<$D$}D$<$A$=D$ @D$?D$&$ 8D$FD$$DžD$$D$ D$D$4$l4$FD$t$<$MƋ$9fDžfDžD$D$$D$L$$Ƌ$貪0<<4$7D$t$<$D|4$D$t$<$#x4$D$t$<$D$D$<$ D$D$$D$D$D$D$ D$D$ $(u(4$&\=4$\=.$/D$ D$<$Dž Ƣ$z$<$!D$t$$触 tD$t$<$芧tƋt$뉍.$Ez$ahtD$ $z뛍.$Vޢ$yUWVSl:nuEEEEEEEEǠ1E1E fD$ D$D$ UЉ$U|EEEEEEM MEEML$ D$UT$$ukEPt%D$T$,N $UUEML$ML$M $M'ƋE$6E+u1l[^_]É$D$D$.$UD$ED$ED$ED$ ED$E D$E$h]UWVSlN9sluEEEEEEEEǠ1E1E fD$ D$D$ UЉ$UEEEEEEM MEEML$ D$UT$$7E@t"D$D$,O $UUtD$$ tM 9Ht?ED$ED$E$MEcƋE$r E+uhl[^_]Í$D$ ED$ED$E$ME 8뭉$ D$D$.$ UD$ED$ED$ED$ ED$E D$E$ ]UWVSX7ujlEdE TEPEX1@E1D$pD$DžHDžLph&` &\dD$ D$D$h$l% D$ h4$l9p< `\?.< t.cЍLDSt< A< u< t< t< u< t< tuh9>uPp<+<-hq<@oHLDD$ D$LD$r$l ؉DžH<+ti<-,t$X$lPH:f41@U+}[^_]ÉFg<@qs<@PHLDL$ D$D$r$l#DžH hUTd \4$l uDF)<@t$X$l DD$ XD$D$4$lXtthLqUTqUT؉DD$ XD$D$4$lADžHDžL1cUTLUTLƅpl虚UWVS=2beE,E(E<Ǡ1E1ǃI U@D$D$ D$DD$<$@D$@ D$4$9D$QD$4$E84@@ $@P T$$l@@$9D$4$~0t$D$4$3q0|%=I $F8$(4$:E+O[^_]þō9D$@$…tG(D$E]Xω]ߋu1!1߉EyZϋMTω1׋u!u1EyZlju}l1u1u1Ɖ׉]1!1׉u]yZ߉uMu}1|1u1ljMϋ]1!1ωuyZ׋Ul}1x1u1lj1Nj]!ߋ]1߉uyZM]h1ދt1ދ]1މÉƉM1!1Ɖ]M yZΉ]d1ދp1ދ]1މËu11]nƉlh`1NjE1Nj]1lj׋l11ωE]n߉d}1NjE1NjE1ljl11En׉h`|1NjE1Nju1ljϋh11߉ulnljl}x1u1u1ljh11׉unϋlh|t1u1u1lj1׋l1׉|nllxp1u1u1ljhl11ωxn߉Љt}1u1u1ljl11׉thn׉p}1u1|1ljωd11߉plnlj}u1u1x1ljd11׉lnωU}u1U1׋t1׉‰ߋu11ljhd2n}U1׋U1׋p1lj}11ωdn߉M}U1׋M1ϋl1ωNjU11`Un׉}M1ϋ|1ϋh1lj}11߉\nlj]}M1ϋx1ߋd1߉ÉM11׉XM nωU}]1ߋt1׋`1lj}]11ljT2n‹}]1ߋp1Nj\1lj}U11ωP]n߉M}U1׋l1NjX1ljMϋE11LEn׉uE1Ƌh1ƋT1Ɖu11މHnƉ]|1d1P1ÉމM11ӉDMnىMx1ً`1ًL1M щˋM!ˉ! ً];ܼى|t1\1H1M !׉! M}MܼMωuxp1X1D1Ɖuu !! }ܼ։׋tl1ڋT1ڋ]1‰U ӋU!Ӊ! ڋ]ܼЉˋph1ȋP1ȋM1E ؉!! ȉEEMܼEuld1L1u1MM !! u>ܼΉ׋h`1H1u1‰U ֋U!։! uܼӉƋd\1؋D1؋]1E !! ؉EE]ܼEÉM`X1ً]1ً]1MM !! ً];ܼˉى\T1ڋ]1ڋ]1‰U ӋU!Ӊ! ڋ]3ܼӉƋXP1É؋]1؋]1E !! ؉|E]ܼ|É|TL1ً]1ً]1M| !! ً];ܼˉىxPH1ڋ]1ڋ]1‰׉‹x ډӋ|!Ӊt‹x!ڋt ډt7ܼӉډLD1؋]1؋]1؉Ɖ Ëx!É! ؉p|ܼÉ΋H]1ً]1ً]1| ։l!! ً|x;ܼˉىD]1ڋ]1ڋt1‰x Ӊh!! ڋxlܼӉƋE]1؋]1؋p1E !! ؉lEhܼlÉlM]1ً]1ً|1Ml !! ً];ܼˉ]}1}1x1lj} ׋l!߉! }7ܼމu}1}1}1Ɖu Ɖ!׉! hul>ܼhlh}u1t1u1Ɖ11߉ublUu1p1u1‰֋h11ʉub‰Uu1|1u1‰։ډd11lhbщMu1x1u1΋d11ubˉhEu1]1؋]1Éh11Љ]d3bƉ֋U]1ڋ]1ڋl1‰Ӌh11ʉ];bdUt1ڋM1ʋM1‰щd11‰MhbӉEEp1ȋM1ȋM1hd؋M11hM1bt|1ȋM1ȋM1E11ЉtbӋpx1ʋM1ʋM1‰щh11p]bډ|M1ʋl1ʋM1‰ыh11‰|9b׉}xM1ȋM1ȋt111؉xh9bȉߋE]1؋]1؋p1ËE11Љh3bƉu]1ދ]1ދ|1Ɖ}11Ήd};bM}]1ߋ]1ߋx1lj11lj]M b߉ ;E]1؋]1؋h1ËE11]bЉЉEEl1؋t1Ћd1Љ‰1M1ȉUM bȋMUUEU1Ћp1ЋU1bʉU1ЋU1E1؋|1؋]1bʋE11E]1؋x1؋]1<bʋ]É11؉؋]83uF,lj~@ F 0A41M+u [^_]ÉoUE#Eg@@ܺ@ vT2@@@]UWVS UJEˉZs Zȃ?H]Ã?@)É]< u EEuzEJL$$UPE);MU֋} T$4$&ڃ@;Ur)]] E< u sHtft [^_]äfEwu^uDMEMuPuX] uD0Ezfmu KMfUWVS$8Eu] 1ENjE1U1Ƀωу| uىUD$}䍇D$$C%=Ut,D$|$$C%=u݋UD$T$$t!1уuuE+u$[^_]Ë]lUWVS(7E؋}u 1EԉËE1tX|$}܉<$]o1 F TFuF(}ԋE+u!([^_]$)]ƅuՋ]ElUWVS7EE EEu}1U1ҍ $sD$@$o \19ȋ})׉ 9}PD$T$$n~3D$T$ $319|vj90$o$0t 140$o0D$ $U+uw[^_]D$ D$L$$3$o1몍D$$!tыptv jUD$D$D$D$ E D$E$]UWVStð4UUEEǠ1M1ɍu4$BM L$UT$4$ED$4$U+ut[^_]siffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8puX]H MPUHMX]HMX ]P$UH(Mp,uX0]H4MP8|@yZ<3 h Ӊ 1Ή\uh3n\  1Ӊh]nh  h׉ ؋h1|9n ׉ 1}:nh \ 1ڋ}h;n ҉ 1Njxn \ P҉։h 1΋}\;n <P hӉ\ 1Ӌu0nˋh Nj\ 1u1nЋ\ \1u2n 1ڋt7n \ h҉׉ 1Nju\0n ҉ 1΋Unhމ \1ӋUhn  h ҉Ћh 1Un\ h 1Unh 1!1‰hUܼh  ωh1!1ω}>ܼ<2  h1!΋h1֋UܼƋh 1\!1Uܼ h1!1tܼ\ 1!1ًUܼh 1!1‰\Uܼ\  1׉h!1ω}>ܼ<0 1!1֋Eܼ h 1!1h]ܼh 1!1hEܼh 1!1ىhx ܼh h1ˉڋh!1‹|ܼ 1Ӊ!1ȉËEܼ3h 1É!1։\uh3ܼ\ 1!1Éh]ܼh  1߉h}9NSh  h։ 1t2NS ։ 1ʋu0NSh4h ։ ʋh1u0NS  ֋h ։\1ƋUNS>h Ћ\ 1؋UNSȋ\ \׉ 1‹}9NS 2 h׉ 1ʋ}>NS \ډ ׉ 1Ћ|;NShlj ׉ Љ\1؋}h;NS  Ӌ\ 1Ë}>NS ˋ\ Ɖh1u1NS4  Ӊًh 1]NS h PӉ 1ʋ]NS< @։ ʉL1x0NSPӉH pm h T։\ 1׋]h>pmNjT \Ӊ 1]>pmы\ 1؉hE>pmh‰ 0 1hE>pmh 1Ήh|3>pmhh ։h 1Ӌu7>pm h 1Nju1>pm׋h 1hM >pmh  1ډhU>pmh  1hE>pmh 1Ήhu3>pmh \҉ \1ӋU>pm  h 1Njt>pm \ ׉ 1U>pmh \׉ 1ڋ}8>pm\ 1!1hEvmzh 1!1Ήhu3vmzh 1!1Ӊh]vmzh 1ljh!1Nj]vmz  h1!1]vmzh h1߉!1ڋ}8vmzh h1!1xvmz؋h Ήщ\1!Ƌ\1΋t vmz 1щ!1ӋMvmz\ h1!1NjM\vmz  1!1M vmz  h \1!1ڋ}h8vmz \ 1!1hEvmzh  1!1Ήhu3vmzh 1!1Ӊh]vmzh 1!1ljh|9vmzh 11hMʋh 1ډM1ʋx M1ωx1׋U ߋM x1ʉ1U Ƌx ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11EE 11؉E|ME 1M1ȋt U11‹M UM 1ʉ׋U1׋U U L ׋XUzp4 <UrU1ЋU1Ћu l@؋uF ЋL ȋH1P]NSdыUȋUBU `HEĸ[^_]UWVSE}O_M]ʃ?@)Ӎ41u}Mqy9rdun?v91۾@ω؋]E D$<$Ov@9s]ËE19s-)] }|u s~tft[^_]19rӃ[^_]Ë}}]}|u skEu[EuREUED$E$U)֋E9r{}؋]HuVu=ffEtuVuMMMEM <wE)Ѓ9uEEED$D$|$ ED$D$4$?؃,[^_]8 uEƀUGffffUWVSNs} Ơ1E1D$D$HtHE$ t=ED$D$<$裔;Es1U+[^_]ø"㍅D$E$tt@D$E$~u[ED$p3D$<$3;EsED$|$ H%D$`d$T$aUȬ.t&DCUWVS /LD$P \$E$Ɖ؅u [^_]Éo01UWVSh T ut$$T @B1E}E1uNjU:ME1uEHt$$xxT @B1Ƌ}E1NjExME1EH D$E$@.u(T ]ٸ@B1E1؃h[^_]øh[^_]$'k2T UVS  uED$D$D$D$ ED$E D$E$XU [^]UWVSQv D$_DD$E$^uE&@t&tD$E$`u܉[^_]D$ܣD$E$X^t 1[^_]ËEpD$D$4$(^E@<-u?EP&DPtEPD$ ED$$UgMU9p9g^My+th)ƍF߃1BD$D$4$z]E@t<+ !M?!U E?w&t u]Ë u@u1]Ux EP>w &]1]UWVS(8] u}܉|$D$4$ xINE uG>wl41EظE! EED$|$4$輟([^_]Ã>w241EظE E UWVSpÕ u@D$ toOD$D$T <$)y)T &t@T [^_]ÍU T$ t$)‰T$$螒뵍 D$D$T <$躒fffffUVSX=v^ot.&vnuucts Ƀ E u p}+t}}-t}=uP[^]Ã+t-uuPU #UP[^]ÃXtguu-tH@+؉M @ @+؃밉M 뫃P묃PUWVSEu gt,C-X.t&u!E I@t pguԉ%+t[^_]ÀouuPӃt>Mt }#x!t }#x!t }#x!rt #X t #X ރI#H ΃?lP!փ&EjUWVS\u>;EEEE}|$EԉD$$>$wi$EliD$|$$d>E詤D$D$Ẻ$觐腤MẺE0EU&DPuHщMEE1EEUM]L$\$ $T$](9tu׉EUM]ىeщٸ9и| E ;ED$ExD$E܉D$ˉу2΁ȉ%ƉƸQ)1ʉ)i)\i(\ø)\ƋE؉E]ʋUʉD$ T$]D$E D$E$ ~9} P[^_]ÍEEEEEE E [^_]ËE$]蚨EUMtMUt$D$E$]>qMUJ2DrUWVS¹DdhpE\} uElEX1<E1f9r9f>*uf~*u1f~*@DFP9\XD$lD$ PD$|$\$phd…hfDžHdf8,D$DsrD$$`q`l@ @$TP `T`l@ @D)>Tt4p8`$TЅlS t%XYLYL! x . h9pHfKfu9p}H@u5l4d76|%= P\hS89sfC/fXD$lD$4$pd}hfDžPDž@DžHdf8tld[u|%=@tp1ҋf?f[uZp!!f90f[ʃfu‹ffP uO f?ʃFW Ӏ_ Y9t fx*f*ʉك |$|$<$jU+*D[^_]ÍJfzuf[Qy f2f]u답f[!u pf@!Wf]tI׉΍Nf%ff-uGf]HfF-Nf%fF_Wf]uH Af]O9]D$D$ D$D$$L|nP f 99sWfPfu9t.P9fx*P9fx*ʉW 9= T$ D$)L$pP$62I$(R…AD$D$ D$D$$Z@u\1W-f[!ʉfH98MUWVS Ӊ9x)ڍωރ׉HPftPΉ1ff}t[Fftf[tYf{uFfu勝M E1 [^_]ÅtJF뜍~Ff]fu{rZf]tFr^9r1=f[uSf]zfً9@S{f{f,uu91ҋLf fuM A}1xDf5f}4vd!qQf]tyىC)D‹΃s tfFu@ύSً{ fsJfPUWVSƉ׉MB tA PQ wif>{tBEEft>f{uED$E$ZuۋE[^_]f~}uf~uM[^_]xUWVSU}DžDžDžDžE uGE E G EGG؍uE uM}fH9z مtz\uJtE@̓fH9tiJufE tc[^_]É\@[^_]G4}뫋}UWVS+EPtF@E䍃E7~fu6~fu0NUDJ@uu\ *ƀ8t;>otĀ>ouw~nuqNUDJ@uu]\ ƀ8uŀ}#] >D] D$ 4$W3t\ ([^_]D$ED$4$ juNUDJ@u;t7D$ED$4$iu,NUDJ@t\  \ tD$ED$4$iu2NUDJ@tz\    uD$CD$4$BiuDNUDJ@\ @k$1f|D$D$4$hueNUDJ@tQ\  F$6OvƉ\ 8ǃ\ ftD$ED$4$]hu NUDJ@t \ tD$ D$4$hu'~=u!D$=4$%1] AD$ȠD$4$gu~=tUt$] D$ FD$D$$/$FsivffD$=4$0] UWVS 0}F$D$<$gt ƅu㋃] t$TUǃ] [^_]U蠝F$V]US聝æ] u []É$Tǃ] []fffUWVS.S}M |u1t‹E1t E]ƅsM\L$$ @uIEL|sxED$D$<$S|1EEċEEȋEE̋EEЋEEԋEE؋EE܋EEEEEEEEe0fEEĉD$D$$OIƅrt<$aD$|$F$||EEdDžhƅxE`ElUEEAdD$D$`$ttu{l<r:sDžllE$(ul0lLEDll2D$lD$$xEUJv9|UJv9UJv9JUJu92UJg9UJY9UJv9wUJv9^UJv9UJ9jUJ9aUJ9+UJ9UJx9=UJ9UJv 9h;MExQhEtEEt3ЍLX& DQt &XЈUEt3ЍLX& DQt&XЈUxtOE@u,E tC&DB4DD$D$D$F$EƅxnƅxDžltiE\D$D$$KEhDihxEs^tE+VĨ[^_]EEEEEEEEEEEƅr|4UEh Qx9rsD$1ɉL$ $M<$y1EID$@a$EE EƅsuPgE$1ug0yD$D$F$J$RDž E|ƅxDžll$']g1E`DžhECD$D$F$7E!EEE1ƅsu3ƅxqFTbp~EL$X<$c…EhxhXM >l/hHhωxD$xD$F$%sދhEDžhEeY1lrs2lƅxrhu"E ?ƅxDžlƒhE`D$T$F$RE<Džl|DžlmDžl^qsƅx1l31lEƅx1lEUD$D$D$ ED$E D$E$[]UVS艒î ] t<] D$D$D$ t$D$E$ t2[^]$FƉ] t$葀 ] u] [^]UWVS ,] (] $] ,] (] $] R9rVt $藈 (] 4$$] t } |$t$$詘‰,] u1҉Ѓ [^_]ËEЃ [^_]ËE D$|$ $D$D$$U,] "UWVS`<$vD] t%0] u1<$Y[^_]Í0] D$0] $(x ǃD] 뵉<$1UWVSr×`4$D] tL0] <$V9E s"4$[^_]Åt10] } 9r1D$0] <$S(x ǃD] _a84$hUSŏE$&ǃD] []UWVS8蓏øD$$D$D$D$$D$ |$(|$D$$tIM w:E t(D$411\$t$l$Uƒ9r؋E e[^_]ùE ffffUWVS $4tƀ8u^ UD$L$ [D$D$H] 4$nKUE tE 8 [^_]D$ ED$4$lxT}untHuG<&wt$+$bD$A$bt$$bH] Wu @9|w뵍>9,s@뽍AЉED$A $3bEEUD$A $ bMEbffffUWVS8#1E11҉la rl] w._a D$ D$D$$$aa T$$ xD$\|$4$A08t߉la 8#mD$\|$4$@t8t㉃pa D$\|$4$@t8t㉃ta D$\|$4$@8t߉xa ǃa ǃa D$\|$4$Q@t>8t$+a D$\|$4$&@t8t$a D$xa D$4$CbD$\D$$?ƅ8tщ4$Puċ|t| >t|$$Tuቻ|a ?xuxu U+8[^_]Í|D$\|$4$?.8t߉la 8#kD$\|$4$>t8t㉃pa D$\|$4$>8t߉|a 8xuxxu x xa 8sxwxta D$\|$4$B>tM8t$a D$\|$4$>t"8t$a |a uea D$D$h$]Qǃla BzT1mǃxa ǃ|a /T$$RuUVS虈þa tutKla [^]ǃa 9D$._4$Ia ut$$1[^]UWVSCuǃa a t-$`t$la $QtEu1>9D$._<$"Ia uщ|$$1la [^_]UWVS耇åuǃa a t-$_t$pa $HQtE/u1>9D$._<$Ha uщ|$$1la [^_]UVSǃa a t$O_[^]Í9D$._4$Ha u҉t$$h1USqÖa t$=ǃa []fffffUVS2WEu tt#W[^]Åt u 1[^]Íw$[^]UWVS…}u D$<$Ot*wD$<$Ou t1[^_]ÅtVUWVS8Gl1‹E1D$ D$ED$E$KE…uZDžDž${${E+0Ё8[^_]É$s T$ D$ED$E$ƒ$rnEDžDž9~&t$$wt$|$ D$ML$U$HƃD$|$ D$ED$E $Y9D89trtftƄD$D$ D$ED$E$rƃ9T1҃8-DžDž1Dž1UWVS@X}UE 1ƋE1D$ D$ED$$-Q…uZDžDž$x$xE+<Ё@[^_]É$ pT$ D$ED$$ƒ$owBDžDž9~&t$$tt$|$ D$ML$$$ƃD$|$ D$ED$$29D89trtftƄD$D$ D$ED$$Hƃ/Q1҃8-DžDž1Dž1vUWVS@NsUE 1ƋE1D$ D$ED$$Q…uZDžDž$u$uE+<Ё@[^_]É$mT$ D$ED$$[ƒ$lwBDžDž9~&t$$qt$|$ D$ML$$ƃD$|$ D$ED$$9D89trtftƄD$D$ D$ED$$ƃ%N1҃8-DžDž1Dž1vUWVS G|l}"D$E D$<$ututf [^_]UWVS { }"D$E D$<$SutuFtf [^_]UWVS {ì}"D$E D$<$ututf [^_]US ){N1D$E D$E$ []UWVSz}U Ơ1E1EteMyu )čD$UPtMP}y:u}D$<$X{U+ue[^_]øUWVSRzwEEM Ơ1E1EtgEǺu )ԍT$ MJtJx9uD$T$E$vU+ue[^_]úEUSyҬED$ ED$E D$E$EUS {yàED$E D$E$;US PyuED$E D$E$H<fUWVS !yFƉUt/ t"D$4$^0uM) [^_]&DPu 1 [^_]É4$s [^_]UxҫEt8t 1]ø]UWVSX|xá1EEED$D$Ẻ$-la }e1󫍃a EЋM̍a |t:tEЃ9s EЄua t$D$Ẻ$pFD$D$Ẻ$pEЉED$D$Ẻ$epx,uЍ$D$4$Ab 4$gnD$:VD$Ẻ$_tb EԉEȉD$(WD$Ẻ$jsDEԉa EȉD$fD$Ẻ$t}4$6T9u f9t]:/t9r 9֍vtJ:/u9u .t&8:/u9r)vLc 9u(ƄLc [^_]Éր>/t>srLc ǃstftƄLc [^_]ÉڍgffffUWVS1pVE$5}|L&DB &fkfbfg@?AD$ ED$E$CEUE8E9t8u|@8"tQ]ڋEƍ EʋM Q1[^_]fmuAxn1bM]9ȸs @[^_]þUSnD$ E$m[]fffUWVSnơ}tz?tu<$X4D9u p9ti8/t9t`sc~/t9u)=vLg ׃rtftƄLg Ѓ[^_]øsr€8/t Ƹ봸gUS}Ѝ~}E@}GEЅ>MUЅM E؍E&D$ ED$T$<$ƉEMEU$c1ɉpƉEE M]ȅt)ExQ)؍)MEH}eMEoMMЅGEP$1ɉƉEM =MEU$nƉEE}GEЅMMU$5xƉEMwu?%}ЅMEU$ ,ƉEE}GEtYMUЅKEP$ ƉEEx @uMEЅM E؍uЅETMEЅE؍M$=1ɋU[ƉEEMEP$1ɉ.ƉEE gMU$ƉEM踓$I )؍))ыEHEMPЀ E MEEЅMU$c1ɉoƉEEȅmEHQ)ȍEE}GMEP$;1MEP$ EEЃ} uG' MEP$1ɉƉEEUMuDBuMU$c1ɉwƉEMEMpMElU$'1ɉ5ƉEE-l}G}eMvMEMEЅ7E؍:%]ЅE ,}tz]ԋEpE@El‹}̉)ЍH$I )Ѝ))ыUčD)֍D)}G؃Eԃك}}}Gw}Dy@&V؃DY@u] utU܋DB@UЃ@)FUDBb3v%ME)EERUЃAD$1$E؍lډ[t"UB M)i]D$1<$E$&ډM]K U¤1cULOu&D$ ED$E D$E$b]UWVSDO;Eu lk 9PMP M܋HP UPUPUElS *H/T$$ML$ ML$ML$ML$M܉L$ML$ D$|$4$0 9D[^_]ÍMP MMIH??? F??? F?? ?F ?:??F:?? F????fF M늍h/9gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ /D$|$4$A 9T1D[^_]U&MOlk D$E$]US8M%EЉD$E D$E$tUT$$8[]US4LEЉD$E$tU T$$m4[]USLäE$Ctlk T$$4[]fUVS{E 0E,}14‹E1}~D$D$E$rS9hDžDžD$$ιD$h8$蛺hǀPǀTǀX84$8Dž@fDžDUfFHDžLTDž\jdDž`DžX|$ ,D$0D$4$qDžx 4$Su%4E+u,[^_]藮U=FfyUT$ U T$&D$E$]US F.yED$E D$E$O []USExED$ ED$E D$E$N[]ffffffUWVSEöxu}}t}D$4$h4$F0tN@9t $;EFt$8V tQFtB1ɉωMT:0$8V T:($8V D: $8M;NV r$8F,t$}8F4t -$i8F8t$Z84$R8[^_]UVS?Adt4$k D$E$LJ4$裳[^]UVS@t4${k $3J4$e[^]UWVS@s<$rU&E܍uu<0 )E1M؋MLYtyu 8<|EuȋM؋uԍE99)11 ؃9ruuTM؋ut}u9tvwn<.uQy<0#BÃ߀XtXtbEf)Ǎ|&uԄIEDX@; [^_]BuԍE9t1 1UWVS T=yp聧D$OD$&<$$E tED$E D$<$hD$$ E$US<pTUT$ U T$D$E$qqffUWS<oLl 1󫋃Tn t D$ D$D$$H[_]UWSM<roLl 1󫋃Tn t$ǃTn ǃPn [_]UWVS;oTn tELl D$ D$D$4$x;Č[^_]ÍդD$4$Tn ($SxT$$pTn E Et[T$ D$D$Ll 4$uLl utmp Tn $1Č[^_]ÍLl fǃm Ll Pl Sl T$ D$D$4${Rl 0Tn n n  n $n ٤D$4$Tn 9D$4$Tn t:ǃPn Pl xfm _Ll Ll UWVS9lufFt%=Ll FftFfwfu1[^_]f9t'wufwwF 9ll uٍLl UWVSH9ml5Ll E$Epl FwD$ ED$<$Gtũ[^_]ÍG܃[^_]UWVS88ku1‹E1D$ݤ$󥋳Tn O$D$ D$D$Tn $D'DžTn D$ D$D$$31t7Tn $D$D$ D$$hE+I8[^_]LqTn t7Pn mLl $ǃTn ǃPn Tn tPn 1]Tn $Ll NjLl 󫋃Tn t D$ D$D$$C$ƅTn $GD$D$ D$$ >D$ D$D$Tn $B<DžTn t"Pn uhD$ @D$t$<$"tcD$T$$j}ԃ iLl 2芝1D$ |$D$ $/6$UWVS 5+h}D$@<$t=D$E D$4$4$ϡ؃ [^_]D$D$!@<$ĠƃtqLl 1fǃm Ll Pl Sl D$T$4$+K84$38^UWVS 4(gu4$=w|xt 1 [^_]D$t$$fLl 1󫋃Tn t$.ǃTn ǃPn  [^_]UVSUE HJH J$J(HrDprHprLpZPXH X$[^]UWSEU H H JJ$HJ(xzDxzHxzLXZPH X$ǂP1u>uDtftǂDǂHǂL[_]êtfUWVS(e2ÊeD$D$ D$D$@E$+E EED$ ED$ED$$UR Uu^}uGEtR}u츬u`umtftu$R([^_]$OU1މU$EUu11ExfUVS$A1fdD$D$ D$D$"@E$tKÍE EEEEED$ ED$ED$$S$S$[^]þfffffUWVS0c}Et5[^_]à M M E} #>E11} ;cg,EEE}u#Ћu0}91dtt<u|7u9tȋ}*E T&U &DPttE 7] Ј} #} U &DPTu Vɨ=E bE 0<KE] DЋuQ} -} ^E nLE T&3E 0EEu } \JEt } %EEt } &=Et } =]E E+E} ?gU  Ћu9E T&7E 0] E } = ]E E 0<E] DЋuuE } ;U &DP"EDBE ]=&u DpuE /E 0uE E EEEE\EoE zE iE XE G}d}uf3EcmduE 0 E P] &WE &W ti1WL AUWVS,*]} EEEP]tsMM؍MM܉UE< )؉EED$ E؉D$ED$E܉$wAMEE@uEYYυtl+E,[^_]É{MAt>U9t-ECR uEyt E됉UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$^]UWVS)*\utn />3)Ѝ)Ѝ:~ 9w$&|n um"U$Ѓ|n U4$Ѕt?w$WD$ D$$UUЃ[^_]É4$uw$Wt$ z=D$D$ $UE Ut1҉Ѓ[^_]Ë|n t;U$(NNjU4$CЃ[^_]Ëǃ|n 뫋U tuW3ǃ|n dn ^D$$=tn Jǃdn 1+1UWVS '/Zupn ))Љ):~ 9w$&xn um"U$Ѓxn U4$Ѕt?w$WD$ D$$UUЃ[^_]É4$uw$Wt$ z=D$D$ $UE Ut1҉Ѓ[^_]Ëxn t;U$(RNjU4$CЃ[^_]Ëǃxn 뫋U tuW3ǃxn `n ^D$$pn Iǃ`n 1+1UWVS%3X}E$Džln fE|81ɃP9u/>3)Ѝ)<7ɉM~=~}|$E$}MAF$U 1[^_]Ë|n VD$ ED$$E$@F$맋|n u$Ѓ|n $(KƉuE$@O|n at $Ѓ|n @~u㋳\n uED$$=Ɖln lǃ\n ǃ|n IUWVS#4V}E$Džhn gE|81ɃP9u𸿿)))<7ɉM~=~}|$E$}MAF$U 1[^_]Ëxn VD$ ED$$E$ @F$맋xn u$Ѓxn $(KƉuE$ @Oxn at $Ѓxn @~u㋳Xn uED$$Ɖhn kǃXn ǃxn IUWVS!4TUEtЋtn t'Ǎt$9uǃtn ǃdn ln t'Ǎt$9uǃln ǃ\n ǃ|n EE EE1[^_]øUWVS$ ISUEtЋpn t'Ǎt$9uǃpn ǃ`n hn t'Ǎt$9uǃhn ǃXn ǃxn EE E E1[^_]øffffUVS$2WRM EEEUEUfE4tvu} fUUT$D$E$肋$[^]ÃuMfEED$D$E$Vt3f}t u9u61$[^]ú땺l#fffffUWVS*SQpUE DžXE/tBD$E $p8%E $uv E t E tDž`Dždxhً]/]=Ut Ѓ/u.t+M L +Mkt/l+]utftl+EthD$E $p])%=l /=@_Ot/t?+Mu~.׉ڋt9E щ`p\`d 5lD$D$E $p荇Dž`&$`pcD=`=A߉փsetftdl /tf\`Ut9E etE Ĩ[^_]Étzu \`l5p=?t9E tX$p1nىf t~uf.륃8/utщ$pE tE XfE pHE /t/tp p?p>1UWVS"GL}E ttrD$<$c xX[^_]Et$<$}| DžMtAt$$# ymt 58"tƉ<$1[^_]1fffffUWVSqÖK}<$)n $n ǃn 7ty&E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEuE1[^_]Ën t$ǃn ǃn  yEUVSE] :tu1҉[^] 8ut$8tù@tσ}:t$ u}:t;MuPx@t[^]Ät:u‰[^]UIU]UWVS}u 8u u|t1:t,t(9s:t|tu[^_]1UWVSlWtI] 1‹E1}! Mu$n t\$4$,$ADž  DžUD$ lD$D$4$DD$D$ D$D$@4$$D$D$@$0E<DžDžƉ1ҋ9slpȀ ':Dž\1҃ t t DžO9ϋ9rD$D$E$@؉؍pȀ Mx@<#D$$ߍAbDžέD$=D$<$… <:<uz)ED$T$E$qƋtg<:tu))|:t:Ћ)ȉ)9 )؉D$\$ $vT$t$<$`$y@E<$Dž:ύO9))|$$)ljx1kO1tCȋ)Љ)Ћ))ӉL$$ÉNjÉC:{DžtE$})P9rg8E+l[^_]D$ D$D$E$DžD$<$ xn $Džqt$$"DcƋ40<$%0Džu*$rE$^{ËE$K{jnƉ<$$D$ \$|$4$V tBt(Pu2Dž4$VDž$EH $DžL$T$${4$Vf18Dž<$tE$y/ <$ 4$Vċ$fu/$I {tE$0yUUD$ED$$M E]US ?n t$\ǃn ǃn ǃn ǃn 1[]UWVS, ï>EE 1E1Džn n &9n tn D$n $j6D0Dq@:#n ux|\u ǃn ׍:\tWut$n $5lDҀ|\tǃn ǃn n $AƋn $^ǃn n Pn @L$$n dǃn ǃn ǃn f:wu<:tAt<|uD$t$$ƍ@E+/,[^_]Ën $uhn $*ǃn +n n 09D$n $n Kn t$贿ǃn ǃn ǃn ǃn ǃn Zǃn ǃn ǃn -$?ǃn oUWVSñ:u} n t$ǃn ǃn ǃn ǃn } u[^_]UWVS &K:]D$=E D$E$$dbDž<:}dUN<\Έmt>}<:tk_]J<^uF<:mu‹]U)ӉߍCdD$$],ljEEd<:uU_F<:PЀvH2Mɋ]PFE1U]ND9ut 0vU] :U]؋})ptD$<$]EtcE] [^_]ËU }1볾ʋE$]뵋] <$]UWVS 8]D$=E D$E$e$d$ƅ<:d <:t?Ytru)Cd]D$4$]Mtƺd<:uȉƍX)ˍ{t7Ή\$4$]u 4$]@ȉ)ˍ{uɋE[^_]1밿4$]ы]B UVS D$#E D$E$6tv80tP 1F<w1F9~ƒ1F< w9E1 [^]ÍF<wF@ctftƄ//DžDž)S$J9>:7 81Ƀ4uA )čD$]pxr󥋵t$D$$lD$rD$$j|$t$$jD${D$$judursr1srrBvBDžfzngU =21D$E D$E$]UWVS2}U Ơ1E1EtqMyu )čD$UPtMP}y:u}1T$D$<$2kU+ue[^_]øffffUS3X1D$$Lr D$ $kHr []UWVSH1u} }ԋEE1EЉE1D$,$Jsr u}MfMUT$U܉T$ D$ UT$$buM vU܋9Eo} ur t%9r t1uЋE+H[^_]Á} u r uD$D$$UE؅tEċE؉$YKfxHuPPM3J$z 1 uԋM3JʀuNjPD$EĉD$$UDžuED$UȃT$Ẻ$;EsE؉$X % ЉD$D$ D$ED$Ẻ$߸;E1B9EBf9EwB U؍yM|$D$Eȉ$EċMQUUȍD 9E89}r5M̉ωփs1tft1HE؉$7W3")UuuB r EfFcUS.D$n \$ ED$EU $T$u؃[]1[]ffffffUVS<÷-M uEEEQEUAEt8MEȉD$L$E$)uUȋM̉NU܃V<[^]ÍuD$t$E$<[^]ÅuUS, -EEEEE܍ED$E܉D$$duE,[]US,÷,EEEEE܍ED$E܉D$$duE,[]US>c,EEEEEE$#d[]ffffff=̀rS[,0[ḽ̀rS[+0[̀rS[+0[(̀rS[ô+0[L$S[Ú+@&[t'L$̀rS[q+@&[ US (M+D$E D$E$^ []US +D$E D$E$Gl []US*D$ ED$E D$E$][]1UWVSè*}E 4M0M( 1E1,hEED$E$ziD$h8$FjhdžPdžTdžXfDžD8H<$蓼L$8<$褔L$8l9t$LbYD$<`T$u%f贌 (fqX1U11҉#UVSʺEEà1EE EEEMED$ UT$UT$$1{xEU+u [^]1"UWVSOhEEà1EEEEEMU ED$ }|$}|$$xEU+u [^_]1"UVSǹu t44$D$ UT$UT$$1ҍE[^]1UVSuÚut54$1U D$ ML$ML$$ED[^]1UD$ ED$ED$E$M 1ҍE ]UU D$ ED$ED$E$ME]UU E D$ ED$ED$E$ME]UVS舸íEEƠ1EE EEEMED$ T$UT$$1BxEU+u [^]1e UWVS 1EEƠ1EEEEEMU ED$ |$}|$$xEU+u [^_]1UVS菷ôu t74$K}D$ T$UT$$1ҍE\[^]1UVS:_ut84$|U D$ L$ML$$E[^]1UWVS}u t74$|D$ T$UT$$1҉[^_]1U胶D$ D$ED$E$M 1ҍE`]UClU D$ D$ED$E$ME]U+U ML$ D$ED$E$ME]US ŵEEEEED$E$!E []UWVS$äDžE = t߆Iƍ̔D$D$ t$|$$ tyDž 9AD$E$~uƋI} t9rcJ8 uv9t<$Y$¢Dž谅9t4$Ё$[^_]ÉUE D$E$K]fffUWVSƃ ‰ ‰ ‰ ‰ z|$F$'tF~1[^_]øUWVSY~9H rn~t PRuF$D$ D$L$M<$=^ڋM΃tyE:BGuETB[^_]ÉUy(MRED$|$F$SpM.Uu ~ MLЃ[^_]ÉUWVSyÞljօxlxD$$UtE3G4U3W0 u|3G}/Ef@H!V(EċHDhUWVS$@E} bD$,$]艙ƅ EF$~(E }1҉u׉$]{l9sǃuuV(F$} }܉Eq@DEE1}EC]E  $M]kÅMV(F$ÅP@DECCTCF(fufCHEwCMEX]E e}}UtEv NjV(F$MtKxf@H F(E$[^_]Ë}]v$]uE$]ڛF$]̛4$]1뤃&]]v1s}D$D$@]sr$F6N(-E$]C%V(F$M71EUWVS*}tH@JHDy$֚VDxpup$軚VDy4$謚wtv$蘚uGt$腚G$zG(t&<$l1[^_]Ë@$$hdG$ ƃtG$D뻉ttEG$&<$ EttUUWVS}7QG(EVLfFLNHtlfv$芙VDFLf97tȍD$ 4D$D$$iQffu@tUV8N<3O3W tEFJ Gt uƉv$uuGfFHuE[^_]ËOMt+tKG(uΉv$谘uuGEGu0G)tE뛨uNjGEGGMIQ(rI|/u/uV,UT$VTT$$v7E[^_]Ã1ɉCfFHpu$ؗ~DWMA(AD]uFJF$G(u$F$$ My fAHG(uG$F,F(NTD$ML$G$D$/M $At;9EP$Ue@MD$UT$E$HMN,GFFF8Ve[^_]D$rD$,D$,DL$8D$0T$4D$T$ $D$\$(WD$$T$ D$0T$4D$T$ $D$ D$L$8D$9\$(=h"D$8D$@fFE܋UVtfNȃ8[^]FfF1E@EÿE?EEURҸFfFFfFs1]ffff̀rS[ä0[UWVS E<؉EUt`ME9UsH߉։]EƋE D$\$4$U~" HS9uE)9ur‹]ڃmu [^_]UE]UWVSTΊEU }+ &E EẺ׉U }G$]yEȅU Eȍ 8MЃƃЃ)UӋMщMԋUT$U$M‹EUȍD]Љ]\$EED$]$U1ɅMM9MXEEUȉUEEE؉E܉}ĉuEM4u}ԉ9du E9s#ED$ED$4$U9Etщu؃9M؋]U+uED$T$U4$U}9NjUt +EMC6ˉUE‹E9r]U}M9MrED$ED$+E$UEEE‹E+EMȉEuM9M}ċu]9.EEE}}čGU9 Eщ}U܉EA‹M)ʋ}č M9~ȋU)Ћ}lj}ԋE9E9EM]ED$}|$]$U}]UEE؅?U!ED$\$<$UU9~]E9rՋE9M̅qU܋E 9r}G9C)EE܋M܋E}89uM܉E}9}M9M M]E̅{U܋E}Ћ029r}GU9IЃ)E܋}EԉE9JEԉEG׋E9EEĉ$]}1T[^_]ËED$E$MEEЉEȉEċEE뱉ˋ}M 9sWEƉ}Q+ME }uڋEE‰]M؉EE HZ9Eu]M9r}M3E}ljMU]XJM9uˉM]9sMˋMUzUuދM9U]ۍuM9ƋED$t$<$UM9Ӊً]19ME9Ms?}u}9us'<3ED$|$E$UU9~؉9urً}uE9Yu̅U܋E 9rUB9)ӍCEE܋M܋EU‹9uM܉E}9}ZM]U9UU̅U܋E}ԋ029rUB}9G)WUE9}܋u9rUB9)]E؉ËuEߤ9uu]]U+]9UED$\$<$UU9ЋUlM9se}؉ߋ]M ֍E9}s8)1ÍED$T$UE؉$UM9ȋU‰9}rȉ}EE'}܋u9r}G9r))]E؉ËuEߤ9uu]]Ҹ}܋uEԤ9r}GU9s/}܋uEФ9r}GU9rщ)EMċU9EȋMĉMȉEU9UlEЉE}ċuEMЉvE؋MuuEU)ЉE؉ڋE]XJ9u]uE}9EŃ}tu|$}ȉ|$$]} SUnUT$AD$ ED$E D$E$c]UWVS -VEuNt4~^ȉMtH1ًP1 uN9H u [^_]ËMM$]Not"N^HXVP MF [^_]ÃUWVS蠀ųu91uu[^_]=F$$4$*NjF$$[^_]UWVSDi}E wuq6tk9uFNW9V uW1ʉUW1 UtGD$ D$L$$6GWG1D$<$tG9F [^_]fffUWVSƲuQ8F}9FiF FD$ D$D$$d6FVFD$F D$$FtotfxWFvthV uAzN)91FJ u M ]z u F MЃ[^_]KP1}9P81F u1UWVS~ý}91t2G$$ D$<$ƋG$$[^_]D$<$Ɖ[^_]UWVS '~LOEO910E@$$D$E$,ƅ@ ‹} >HE@$$OtlEM 1 [^_]D$E$ƅt[P } uuuFNuN}8눋E@$$oNuJdN}8E YMNIf뱤&fvftN [^_]E xDE xfffffff̀rS[D0[ḃ̀rS[$0[UWVS${EEE EDM8D$D$ED$ ED$D$E$0wt 1$[^_]ÉL8 uL8US]{ÂEy "9~)ML$&D$E $31[]ÉD$ 2D$ED$E $A1[]UVSz Ey ";}.D$@&D$r 4$R3[^]ÉD$ 2D$D$@r 4$@[^]UWVShzÍEU MtF &;4ut/M9t(\_rtwf9t)[^_]1[^_]fffK̀rS[0[UVSytu,imNA90%[^]Ë40(9r,40[^]9r싋,UWVS]yz},p^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓l40419|[^_]Ë]싃l40u޾ UVS@xe 4$tu,U4$[^]ËE4$[^]UWVS w,E 4$Xt,@}C}wSǃtǃpǃlE ,(E MH1} 4$E [^_]Ã}?vB}<6,0)ȉЉAUtplE P,щU쉋(EU0U)Љ?}҃?}}}Ƀခr4$EUWVS9v^,EẺEыE)ȉE䍃 E$tɋU,@tplEH,t)̋Eʉ014(E$E[^_]Ë,0)ȉGfUWVS/uT <$7Ɖ<$[^_]US tED$E D$E$ []UStE$g[]fffffffUWVStöƍ\ Dh̀rS[ô0[UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS cCu}F9r+)F|$E D$F $Q~  [^_]1 [^_]UWVS bu}F9r+)F|$F D$E $~  [^_]1 [^_]USbEU ]tHPP UP[]Í fUWVS1bV}u t$<$t t&t 1[^_]Ãt$<$À[^_]ÍFD$<$}t̃t$<$l}[^_]UWVSa֔}u t$<$ku 1[^_]D$ FD$FD$<$ntԍF D$<$,tF t6u$FD$<$|tt$<$|듸[^_]ËFE }F[^_]UWVS`}u t$<$u[^_]D$ FD$t$<$赀[^_]US `œD$E D$E$ []UWVSl`Ñ}u t$<${u 1[^_]ÍFD$<$ t~uD$0D$ F D$t$<$tUWVS_}u FFt 1[^_]Ét$<$d{tFD$<$~~tӍFD$<$>{tF D$<$+{tt$<${USh_ÍUE JttH[]ËJuL[]ËJ t't@H[]RP[]JHRP[]ÃwJX JHR P[] | q f[@HFfffffffìrS[Ô0[v̀rS[t0[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^UWVSEu MtXMX89t=JuMtBu {U tr9uu 1ۉ[^_]ÉCu1[^_]1fffffUWVS(]CƉ1NjE1D$ |$T$$er<$"@9EZUT$|$$<Fu1U+([^_]E @NteulN u`L$$j '$!HN tD$ D$D$ $4t9urD΃sztft%D D$ D$D$ $ _u-ujFfUWVSZ͍ƉЉU Ǡ1M1Ʌt=~t3E+ȁĈ[^_]ù۹Dž9Ff tvEtoEfD$ D$D$<$<$v9EXED$|$$&Vu5F~uN uF=tu ~tMEEcED$ t$|$$a4$9ExED$t$$F1@FȉC:9<W<DžEtL$ L$D$$8<$9EED$|$$d$ a+D$D$D$D$ D$؍ DD$<$Stk0$`ED$E$F <tt oEu̓t,ED$ D$|$$_t14ED$E$B1襾UWVS|tƋ@tt 1([^_]ËFy ([^_]Ãu ӉM܉ЉU(UMx3=fuVtftafLJ fu>FtPtC1M]\$ ]\$D$$>t@M똸DD8D4$DDD8,D$|$D<$8ЉD1<$(\w1Lu .8t189 u拽,t t҉11蝞UWVSpA6fiƉ1NjE1>$$$e$11 rFFtGGFEN]1ɀ.уu9`d9@ HDPDDžDžDžDž<$p#8=R7\3G u$1ҋ$`{[$ +$*1xƋND$F D$F$Ƌ@ut2OD$G D$G$tF$X*$J*U+Rp[^_]Ë넅tJPd9\.$1ҋD$ D$D$$Hu~d@}뎃1@<tE12Dž$1ҋ Yu@ WY81.늋$1ҋ^Y@u2u9,XGHDPDLE%$'X1)UWVS0cEhpPt%={DžthE11҉ rMd11҉`d r`VtA<$vWWt[^_]ËhMEEdUMEE$lu`11 rU؅tkhd<$hE[^_]ËhMEE뀋hMEEd<$hЉd|diX\P}`1}dX  r| LOTdDpPHXLƋX9H`D$ PD$D$L$$hL$P T$ D$HD$l$&3xWE11҉ rlUEE!$\Xvl$$9T#X\dwc\$U`U؉h<$h(‹dG뎋DA‹@uDFEu11 rE@t`EEEE<$ML$ML$D$ |$D$E$ttwEЅUp[^_]É<$MML$UUT$D$ |$ګD$E$tt?E$ _p[^_]ËUE/tFE$b gMEԋAE܋A EAEAEAEAEEUԋE{EЉƋ@uj9UWVS\ Elj 1EwD$ D$ D$ $ƅ8#3D$4$D$4$xDž< < D$4$苑xt$$t띋AAA AAAADžD$ D$D$4$~#|$$Lu@9D$$*1U+u\ [^_]Ët܉ljtHt$GxGu܋vGt$@<$8utlwUWVS48BEȋE0xU11  rŰ]ȍ9D$$9EЋ]̍EЉẺEtCË@uEuEЅt $]EU4[^_]UVSaÆAuD$F $tP PH p[^]UWVS@:AljE1EG ut$kt$$gtӋD$$tD$F $kue$!@=wI$‰@=wЋЉ==1U+@[^_]Ë~D$<$tu狵1DžЍtftȍtftD$D$ GD$D$@$&9OtD9AD$D$G$Kt<0L9_YB 9@3t9'9uۉD$D$ $jKut$ D$D$$A+u9u [u3fvfvBrUVS 1 V=ut$F $LE $MUF t [^]ÉE4$(E [^]fUVSÉ1   lLLLL9r[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UE@@#Eg@@ܺ@ vT2]UWVSEP?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPEE);UEމE} ]7Et@9rE)uu U<u sCtft[^_]äftu^uE[uOuW] ]u\3]|fu SfUWVS -R4EE} Ơ1E1WEEG?7w}8)‰T$ D$<$D$ED$<$EX1u4u:tftE+u& [^_]úx)끪WtfhUWVS$Jg3}Ћ]E E1EƋE13&8}DGt`EE؉<01E 1҉M܉MLAt;}t^}׍T3y1]E+$[^_]Ã}u-t( fɃa) 3믍NȀw볋M܉<.u9twQ3ЋEDP{<0#s߀XtXEE1҉3)AtstEt)Eԅʉ s1EE EM M 뗁EM tEF]Ds@9o]VfU ED$E$u ]ËE]ø ̀rS[00[UWVS00uE 1M̋U1xu1 t8t)űU+u0[^_]ÍMЉM11ɉEċEȉ rEč, ۃTЃut( tۃ\"u|1w eUWVS/E4M 0u,}Ơ1E1hEED$E$nD$h8$ohǀPǀTǀXDžDB$8HDž@DžL|$ ,|$0L$8$ǃt>8GD$H$Bt4E+u=[^_]ËHt$i4 cU9b.UT$ U T$&D$E$@]UED$ ED$E D$E$]U.UT$ U T$&D$E$]UWVS$-u4$buE荓UEEEEED$&xX<$ZE؉D$<$`D$<$b $[^_]UWVS /-EX1TE1D$D$$+cƍ`$1D$XD$$P4PT$D$i4$e4$t'xfpTU+İ[^_]Qf\$c\t~։P6tN~ tu틅XD$F$uԋPGX$XcP$v11A$X`UVSç+uF tF 1[^]ËF0$VF0F($DF(F,F$+FFN D$$:FtF 뇍9D$֬$Dt F ^YUVS*uF uu,F [^]ËF$FF F tԋ$F F [^]UVSFk*uF uetaF0$%F0F u9D$D$ D$D$$ F0[^]Ë$ef 뷸US] $)1U C []UVSý)u4$F$zFFF0$aF0F($OF(F,[^]UWVS.S)E@0} wML$$vop< t< tD$4$v?x4$pfM Ay EpE pED$<$HvtbP1tJ< t`< t\E@H9tTE xFE7ED$$utgPuuE @4E [^_]Ã됉U }OD$G$DžUtBExE xzt7@ D$$ NƋEp0E$ 01jUWVS$p'EuUE@ u*x(9P,ӃCtftEp(ff} GуbF9SNO F|>L)/9!A)‰UtEHE HU1EE.E HFD)ЍtEx9EEPB9uҋEPU@E]ED$UT$E܉$誰MuTMEHE Hb@ ]\D$D$ E$W5]#0E$E@$E@@@0$hE@0@($SE@(@,01$[^_]ÉT$<$]DžqEx(UP,ӃuCu*E $[^_]ËEH!fZUVS$u F tcu.tR4$(tEED$4$+tE[^]èu?V$ED$ ED$T$F$ t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$b[^]fffffffUWVSh#]D$D$}Љ|$ D$D$4 4$$3EЉ$EąD$D$|$ ljD$D$4$}9E1E1Exu0P!uftf9XP 9rEMȃVUEЉỦ$]UAEET$D$ $M]æMMUfEMzu7Ju%uftf;rɐz }p 9rMM̋Eĉ$]uFM9qFE1h[^_]@t`X Eua M̍LM9Bu7fE 9_19Wr fuu11ɉ ruu؋JM]΃vEtfEtu|}}̉}و]vtft}kKu̍\]r!󥍳u 9)jE $]lEEĉ$]PfH MEM1f]uutSXރ u]uE1f]] t]uӃ̋M؋}OM܉OGJOr u1ɋ}tރ uE1ۉU‹Et-EtMtkE uЋU}O M 9t"vtZ붻u}̉~ utftuN yu M}OElu}̉~utft֤ӻ]9(bM΃EMu}̉~utftEEEủp1MrEtfEt}}̃Eju]]]Lu'u MmfmKM뿋Eĉ$]FYUS2WE$[]US4ED$E $)[]UWVS E}} 'v?NBCDt]D1 [^_]ÁB u$<ƋEEFGEFWUV O MN$W$=WV(F,}E=V-~U V O(N1t)NEȉF99U9} 9U4E E= =w=w=?w=ED$D$ 11 +D$$D$]JWF4N:V;m]衹4$P]ۃV(F,}EF-~E F O(NEEfE= =w=w=?w=ED$D$ 11 +D$$D$]dIPGV0N8F9/r<11͸11UWVSD$E$RƍxD$4$赉}и9ED$D$t$D$ D$|$$Tt4$2SttFD$D$ E D$|$$t Ĝ[^_]É|$t$%1߉4$RA1ȉ4$R1UE@ ]UWVSEEU ;P snH,X<3t;t-?19r09Pr+HE)E1[^_]?SӋ?̋]螶Ӌ]艶UWVS$uF$ED$ F(D$ED$E $N~;N:]f4)ЉMЉF$)É]]]f4)MЉF$)É]Ef4E)MЉF$})lj}F-VMуtitT <ωf0ED$ ED$)N8N9^ )߉|$4$K$[^_]Z cD$ D$E$<" []ffffUWVS &Ë&8DG1]ҍDBD_u]E.tE1E; rc uE ʚ; E1 ~  [^_]ADGt4ЍEADGu-EE늉E 롃tEcЋEDЋ}ENUWVSIuEϹ̉)) Q)Ɖt$T$D$ D$ D$}<$by[^_]UWVSUnuEU&]|Yc1tX|Yu]@t|Y@u]|YX1uEtX|YuEu؋u@t|Y@u]DY 1E|XDYuE}}.WDAE}@u DA@tDY@u]}EX2wۋEl 1EE<2w}8 1}BRDQ@u DQ@tDQ@uM[^_]EEx}))u؍4)u)؉\)E؍4)EE܍*EEE"BDAuE1ۍEBDAt6Í}܍GEBDAu(GE3EË}܍DЉEBDA UWVS9ljE 1E`M!t0ܡ$*D$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,odlLDžD$ D$D$$e uet[atL$pr r; ut$"D$$qu f})ܡD$|$D$ D$D$$b)t$$$t$$ W8HI$iD$D$$螙$E+Ĉ[^_]}n p;8u}n  P;8udt$T$ D$AD$$b8 <$ܡ=!ܡ$$D$ D$D$$j|$D$ D$D$ $Ir|$2D$ D$D$$ 4$r|$D$ D$D$  $q|$:D$ D$D$8 <$qsr D$D$ D$D$4$tq}艽EЉT$UT$ D$1D$$-A&9vD$$)Ѓuf~fffrD$ftD$$腖1p׋D0D$D$$?9|ҋD$ D$D$[$Ph1D0 DAu.L$$۬9|ȉD$ D$D$&l$gaD$$ 0D$ D$D$_$UgfD$ u;D$D$h$"g D$D$$f1pD>D$D$$e9ԋD$ D$D$[$rf1&D>DBu.L$$9ċK$kD$D$$蠓:UWVSíEĉED$ED$E $>]&D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,+\D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[ẺEEfEEEfEEEfEEEfEEE`t2 u&F UgLU x;uED$|$ &D$1D$E$ˑE`t jED$$;E`FED$ D$D$$cD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,bWu Wz?uED$ T$t$E$E`t tED$$ ED$$1ɋuEED$$ EED$$@EbED$$EEEf Ef Ef EĈ[^_]Í T$D$ D$D$<$f D$D$ D$D$$UeU D$D$ D$D$4$e D$D$ D$D$$UveUP D$D$ D$D$4$>eK赛$D$D$E$ Ĉ[^_]ËED$ D$D$$)]ED$ D$D$ݭ$\ED$ D$D$٭$\ED$ D$D$խ$\ED$ D$D$ѭ$\dED$ D$D$ͭ$W\ED$ D$D$ɭ$-\@ED$ D$D$ŭ$\ED$$ IUWVS$ñuE }Ǡ1U1D$L$ t$U‰T$$xVD$t# $U+u#$[^_]$.1%0UED$ D$E D$E$]UWVS}ED$|$ ED$ED$E $x8Ɖ<$7uH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$BEƠ1E1D$|$ D$E D$E$&…tD$<$qE+u Ё$[^_].UWVSï}u Gu 4 Gt*D$4$}uUt E[^_]ËEtE[^_]UWVS>ut\~M u ( ~t9uUt E[^_]Í L$D$ D$D$<$`EtËE[^_]UWVSèu} [Vu + Vt!9>uMt Ev[^_]Í|$D$ D$D$4$`EtËE[^_]UVSuF[ Bt ;2u[^]Ét$D$ D$D$ $_v [^]Ét$:D$ D$D$8 4$L_[^]UWVS4YU} tdLUZ~U ~t;u[^_]Í T$D$ D$D$<$^[^_]Í UVSuZ Bt ;2u[^]Ét$D$ D$D$ $N^v [^]Ét$2D$ D$D$$ 4$ ^[^]UWVSuPYw$ wWvK B  v|@vF[^_]ÁvfH[^_]Á x[^_]Á v,s낃@t9u~:jtuccOYD39~.A#m̨ e1t$D$ D$(D$<$S\-/OUWVS"}XWYD$t$<$Wx [^_]É|$D$ D$(D$4$[[^_]UWVSî}VL rt;:u[^_]Í |$D$ D$D$4$*[[^_]UWVSL6Ơ1E1E <tmD$D$ D$.D$M‰ $MZMt#PT$UL$<$RU0E+u4L[^_]D$ .M‰L$ME D$$sM'UWVS4FkEEEE$E܍U}}؉EUEEU t 14[^_]Ã?uuU<-E<+u JMB&DK~r1ɍ LH>vD{uU 4u<.}DCuuŰMэMܨ@uM1ҋMDK@u49rMԄMDC@&E DS@tc9rEu ]Ԉ^^FEȉFEȉFEȉF EuuEE9sEiEԋ}DC@u>1ɋUDS@u%9rUȄQUDC@NE9>DS@uE9&ENjUDC@ub1ɉUЋUDS@uF9rUċUЄEĉEDC@Eu9sEDS@t|9rz}BDCz}4BDCu;uJMBEcEE]z}DEBDC1.t&FUWVSEM HMHMHMXˁHɁ@ =+-E E-ENMb֍)É]؉л))Ɖuԉމػ))ƉuЉ]̅EEMbӍ)Mȹ))Ɖ))MUĺQEM)U)MEJ$#EE4$ #EE $"EUM^]EaE}d\$DD$@ED$<]\$8T$4]\$0]\$,]ȉ\$(t$$L$ uĉt$ut$u؉t$uԉt$uЉt$ ủt$1D$u 4$RE$bEt $QEt $@E Ĉ[^_]ú)‰U:EESEW)̐ u RE ; er@ror:@ unk@ nown@ LOC@ RR @vers@ionE Ĉ[^_]Í4DE4D}\$DD$@4DD$t?1ɀ:.u9u*u|.t A[^_]Éȃ[^_]1[^_]UWVS0膷ëME荰EEEE$RhPlPHH8|$ x|$x|$@ D$L$T$ D$D$4$s~ Eƀ0[^_]UWVSu Gt-D$4$nu?E tE [^_]Ë?D$D$4$fF@먋FuxUVS`1Fu t$&XD$ D$ED$4$[^]UVS蘲ý`1Fu tE D$ D$ED$4$[^]UVSJo`1Fu wtED$ E D$ED$4$x[^]UVS,"`1Fu *tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$k,[^]ÉED$4$:EUVSnÓ`1Fu t2ED$ED$ED$ E D$ED$4$[^]ÉED$4$EU%`1U]Uް`1U]USED$`1$r[]UVS蒰÷`1Fu t$ED$ED$ E D$ED$4$9[^]US?d`1$[]UVS=`1Fu Et2ED$ED$ED$ E D$ED$4$Y[^]ÉED$4$qEUVS 襯`1Fu t9ED$ED$ED$ED$ E D$ED$4$t [^]ÉED$4$EUS,QED$ED$ E D$ED$`1$[]UVS`1Fu t4$[^]谀D$$cUS薮ûD$ L D$ED$`1$@[]ffUWVS QvE8tj׉ƅt|$4$rHt@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS(辭]Uϋu U MUL$T$ L$U‰T$$EU ;tMUuE@@P]]]])ˋ}([^_]ËUt M t.t?Myt6:u1|.t'PM9r$H.ȋʋ]]돍눋]2~EE}8wUWVS般íƉЋ};stʉË9s/u!uuÉ)1[^_]äftuuXf}UWVS(E׉΋UU؋UԋU$MEM9L9MyE荃EEuuE9D$E$=t4$MEx4$Myu|EԉEu؉0([^_]Ë}E$E}9}uAP9s:)؃UvM {9Cs1[^_]É4$Ewx+[^_]ÉM]{EEMUWVS+ EuE(},M }0tǠ1xU1҉M$tt$$Cƀ?vE4$t^򋅤t)t"<.g]<0M|0.7b0J1U4T$L$E$?ƅ)‰U4E$kE$T$D$8D$ D$dD$$C‹ $a{t$ $ K}Mt}w} M$4U$ D$T$L$D$ D$dD$<$DB‹$9p|&f @)ȉ~ DžƋD$D$<$W9u׋)$$|}|$ $1ɺ0-kf; F01x JDNu.9uҋ‹)‹ $9Vt)ЋxU+.Ġ+[^_]Á}o}$M$$U$e[`E4$srx.D$$1ɺDž@f; @E4$j벍D$D$$U &yt)}$<$WD$D$ D$dD$<$>‹4$t$D$E|$D$$U O<$wg|$L$$D$t$ D$dD$$=‹ $ GGD$t$ D$dD$$I=‹ $G$D$t$ D$dD$4$<‹$E_wG9D$|$ D$dD$$l< $y}$C4$ fN~F$$T$|$L$D$ԵD$ D$dD$$;‹ $$n9%4$N $D$|$ D$dD$$;‹ $o4$$GD$|$ D$dD$<$:‹ $ $4$kD$D$ D$dD$<$V:‹4$t$D$$U >)D$ *@t$L$$ /&w1E)0~0 $09t4$d‹$y}$!<$WIL$T$D$D$ D$dD$4$8‹$.E$HD$ *@t$L$<$-B$$$#w1E)0~0 $w09"4$b‹$@yY$ƅ-lj$w}u9e$>7M$)$<$WD$t$ D$dD$<$6‹$4D$t$ D$dD$$w6‹ $GD$t$ D$dD$4$)6‹$}99D$|$ D$dD$$5 $yw9u$VƉ9?$wy}+}$=|$D$$U 6<$w|$L$$U <$g)ƒ|э$}$ }4|$ t$D$$4$^Ɖ)lj}4GD$D$ D$dD$4$3‹$G9!Dž1pƀu1$TnDž |$D$ D$dD$$2‹ $QP9 ~F$B= $I^|$t$$U %<$w4$L~$D$D$ D$dD$$1‹ $m<$ݽ~$KD$T$ D$dD$$0‹ $<$efF $SF $ED$|$D$D$ D$dD$<$!0‹$u}$<$G$購D$t$D$ D$2D$@4$/‹$4$flj4$w$}lj$,F$"_lj<$|$D$$U kE<$G$QT$D$t$D$ D$(D$4$-‹$7U$r VUUU)ʉЃ=J$n}$S4$F$$QD$t$|$D$ D$2D$@4$,‹<$"<|$D$D$D$$U )1LM9/t؉4$D$D$ D$dD$$+‹ $y6$~@t$D$E$$%4$V‹$C}$.t&#E4D$ t$D$$4$UE$ VUUU)ȃ=Y $  E$ $D$ D$D$D$ D$dD$<$C*$|$t$$U p<$w9SF$葶t 4$肶4$wD$D$4$]4$CTD$D$$U n94MF9Gt1Gt`$D$D$ D$dD$$y(‹ $uPED$RD$ D$dD$<$ (}$@<w}$iD$t$ D$dD$$'‹ $ GGD$t$ D$dD$$H'‹ $GD$t$ D$dD$4$&‹$NhGG<A}4|$ t$D$$螔4$RQƉ)lj}49a)=$w}$E4D$ t$D$$4$P@t$$K}$<$fWD$D$ D$dD$4$Q%‹<$<a}$@$[t9$:"<}3$w xYG GGDž====Dž$1lj9Mw>9Gt1Gt`$D$D$ D$dD$$"‹ $-GuP5G GGG GG GGƅ=G GGG GfDž==ƅ=W GGW GW GGW G$ Dž====fDž==e)$3|$D$ D$dD$<$‹$9SD9D$|$ D$dD$$^ $yD$ @t$L$<$T o w1E)0~0 $+094$VI‹$yD$ @t$E$D$$=q .w1E)0~0 $E_094$H‹$y'D$D$ D$dD$4$d‹$?9@Dž@DžDDžHDžL@)‰t(19rU4T$ D$t$$}4$+G)ʉU4@9<$w^x|$t$$,4$|ljF$|$z=D$ D$dD$<$$Nj$rD$ $1ɺ%c$ k"<<$茧Nj$M4L$T$<$d‰)M4|$ $1ɺI<$ uF`$谦NjB $M4L$T$<$‰)M4|$ $1ɺm<$j$ԥNjB$"Ɖ)lj}4S$[ $$srD$ @t$L$$Rw1E)0~0 $-094$X=‹$y|79S$[ +$D$[D$L$D$ D$d1ɉL$<$‹$"7$ UWVS8qvǎE  U8usrE}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]UuM8E#,0]UWVSuèu})R|EtG9E r'Gf|t+E D$<$膚yF([^_]9} r+E[^_]UWVSu?EEu} lj~P9rCffVP9r1PffV 9r1Xff\V t9s]2F(?1ۉ}D^ fu61ɉLu}9uF$F(F,1[^_]ÉD$ \$ED$<$xUWVS)tREu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$uF,F,^(NMD$]\$ D$ED$$] 7F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~GF$gF(F,bCM]C]C(UWVS qEu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$F,F,^(NM]T$D$\$ D$ED$$]蚣;F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9ErgMF,F(F(T~ 9~GF$hF(F,cuAN]]A]MA(ffUWVSo֢EM} QyYm M0ȈE<ƒ?ك}Cu썶,ULWm ]0وM<O ]O?9E]U\]\U]TT} uU u;Eu[^_]} Oσ7M)11}U+u\[^_]ø'UWVShEE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EEu}: w( ]u#M EÉ$SrE}~=Ut3}& &w\DAtu܋E })[^_]ÍM U$WE6M E$DxgEEM E$HEx>EM EÉ$MM|xEM?fffffUWVSfu4$,H9MX} slu^uVt}} Tр:.utgz\t,р:.tU ƒ.} 1[^_]Ãt=z\tפftu?u&xU 몋E Pf} O7(qUWVSeјE Ơ1E1D$|$E$xFD$T$$zxT$<$U+u [^_]XfffffffUVSdEuUMx#L$ T$t$$y!x9s[^]ÉL$T$$+[^]fffffffUWVS dæutcEt\E $F&ljD$4$'u?|$4$#u%džt$|$E$D [^_]É4$#f5UWVS cutcEt\E $%ljD$4$V'u?|$4$"u%džt$|$E$ [^_]É4$"4UWVS _cÄu t\E$+%ljD$4$&u?|$4$f"u%džt$|$E$  [^_]É4$!s4UVS buD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVSobÔu} tAv-u3D$4$$tD$4$`%F1[^_]3USb(EU tttu P1[]V3UWVSaޔ}u t' t:@trt0 wvONuI2[^_]D$<$ $tD$<$y$wFw71[^_]D$<$#tD$<$<$71UWVS`}u tPD$<$#tWD$H$%D$@t*\$t=b= ==?D$Xݜ$D$h|$`ÉD$|-wыt$t\$T|$`D$D0D$<щӋD$TD$`11/f|SЃD$|ىڃ/~I9D~كڋL$`LSЉL$`Ƀ]\$`D$ptt$h0D$`e[^_]Ë\$H8 Ct$HD$8D$PD$0eED$,\$HD$,T$0)ЉD$D$$D$,\ZЃL$|P/~ȃ9~D$$)D$,ND$(\$,eED$8D$< D$P!L$8iDI4N\$t1D$t$|4$bD$|8(D$tـ\$`D$XD$XD$XD$(D$0D$8D$< D$P݄$\$`.D$(FT$H)‹D$<ЉD$PD$X~T$D D$XD$P/bD$P؉ƒtL$t@"݄$4ݜ$D$P-otj݄$D$tl1ҋ\$Ptut ݜ$؅ D$P݄$ݜ$|$Xu DŽ$\$tn("݄$\$`$n݄$\$`t$TFD$`ƒߍFXj‰D$|@H0tT$TD$</[|$PT$8T$H 8t|$PT$8}D$hD$|D$,$x D$D$5$<$\$t$$Mt$ $D$|$$$\$t ݄$\$`t$ptD$|L$DD$`\$`D$`e[^_]Ë|$PȉD$|t^t$HD$PD$0JЃ w(D$PL$8\$| CD$|SJЃ vD$8D$H-0t ˃L$|0t)ÍCD$PBσ\$|BЉD$8D$PD$0\$TD$H|$8\$,Nq$$\$tD$`$D$h${D$8$oD$T$c\$P0D$tـ܌$T$`ݜ$D$d\$t;"݄$\$`\$HuD$P$%k)~&U1҉$4DŽ$pD$Pj؋D$tـ\$HL$H\$LـpOD$,D$H$%u=D$0[D$H#$$T$P=܄$ݜ$m1ҋD$t@"C$D$\$tDD$4$h$ $$$1D$XD$\𿃼$us$ue|$Pt%=/D$D$T$\$tD$T4D$hD$D$T$\$t1D$XD$\࿋|$P$$\$tL$X܄$ݜ$$C $/$%= D$Txu xD$D$T$\$tD$T|$h|$$$ځ$|$P3'p$\$tD$`$D$h$D$8$D$T$$v|$0$T$Pܬ$ٞwq؋$ݜ$!$1D$XD$\?6$%=+|$\)‰T$\K)!؉$^$DŽ$M9D$0tS$$|$PtN%=w@k)9t:D$0ut$HSD$H#$u΁tz%$1ۉ$$D$Hqݜ$$DŽ$DŽ$$hD$,LDŽ$1ɉ$ÊqMA=w$ʋ]Z ] Z]ZA1[] UEt u]ø]UUt< t< u u]UVS=pu>t'4$D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]US=BpEM t.9t*$D$ DD$D$p3$=[]US<oM E%t.9t*$D$ DD$D$p3$[]UEt t]ËE ]1} ]US$<IoUE ~;u;t5$D$ DD$D$p3$<[]ǂ[]Ãwǂ[]US;nEU tt 1[] UWVSZ;n$ )Etc@@ D$D$4$ u E[^_]q 84$1b 8EE[^_]UWVS:muF~O9tHNM 1[^_]ÉU ED$|$E$U uFUF맸UWVS8:]m}t;t-M tWt1$1;wr$0<$0[^_]UWVS9lEPt7E1U9}t#E4E D$4$u߉[^_]1[^_]UWVSy9ÞlE@EEE19ut|E}1thMB|$ D$t$E D$L$T$ 4D$D$4$@D$t$$ ljUED$ D$E D$E$4UWVS87jEu}1E1>'MBT$ t$D$E D$D$|$ 4D$D$$Iu(u~E+8[^_].|$D$ ?D$D$4$uD$t$$蜡tlH󥋅D$ D$D$$5: ǃO$S…1A<+wuىD9u˃u뷃z럃b뇃Jl蔝UED$ D$E D$E$R]US5:hUM˃w<BtJ[]ËE E @%]3 ؉BtBt븋E E @BtBtUVS8e4ÊgEtyE5EEEEEUT$u܉t$U؉T$ D$E D$E$T=tD$ E؉D$t$E$؃8[^]ÍXUE@%-@~1҉D$$$]؉=?w1҉D$$$]Ã1D$$$]ú1UWVSut%ӃKE tx9uu 1ۉ[^_]CfffffUWVS$ 3&f}EU܉Mtȃ"uFEML$$](u]-K+EE0YEE E 1009]~Dx99Mع_SЀ vȍSW9]]؅t U܅t}܋u7$[^_]ExEFuu1UGM9\]"LSc7؋M܅u}bxEE܅t}818A V1ҍ=tftH<@ lj)99_ ΃r뀃< t< tD$4$ߤ1Ҁ8 Ht$$t9$7%$< tW< tS< 9szwD$ $H< u땸1$@ z)׃ (D$$stljKD004$^@9]‹tft‰)‰ DžNtftR :)944$p@9o‹fBf 0mDž1 P$uTfF()׃ (D$$ Tlj$Pdf\UWVS` >SEEEǠ1U1ҋ@E` D$ .u‰t$L$E$(}lEE4$pML$ML$D$ t$ED$` $ot\E$cE@ U+u_`[^_]ÉM` $辀MB΍_EfMUEFƋE$u4UWVS(RE8@E苳` }teUE<$oML$ML$D$ |$UT$4$tt,E$hE@ ([^_]Íګ뙋MUE{ƋE$,t([^_]Í` $t ` DUWVSxugx ua@@ HtHӋ}‰t"ƃ))u)9|[^_]UWVS\jÏPEuE 1NjE1Pt/1Dž9E3wG D$.$&8tGt3W\_u<.uuy.u}fD$:$肮'tOfu:t .\uـx.H}OAuVGq ExA9t$D$$!q@0@Ɖ $@)9P‰ȉ@ M:E<$t$D$|$D${D$ D$LD$$jU+,\[^_]Dž9E1D$ D$D$$6/sfcui=x.Af~D$:$LZ1flUWVS\ëK׉E UEE1E1} t>M1U+ \[^_]$(L 9ƉyfQffQ 9>f4ED$D$ T$t$ $;@ u1$ЅD 9MPPHDžPGO9=uDž Dž)D$t$ D$D$$:Dž@ u4$Ѕ{8L8 9v<$9=fG$!=Nj$=Ћ9f}}$} - t$$}D$t$ L$D$$u9Džz@  99uQd 04$Z=$: 8CGvT'tO<$ONjE$N$+P|$t$D$ D$(0D$$% 1t9s;)d}dDž1 019tl!9hu狍Ƌf4JutJ9}A9p@ &‰))9V׋{z$<))9zrtft1iX@t$$9P Y}u,04$tx9_9v8Љ΃tft4$=Љ>9}űD$|$ L$D$$n4…s@ 89F9EP04$7=+Ɖ<$P)9| Yt$ D$lD$$%;,4$p)9g[T$T$<$A8f~<$Ѕ)"Dž${1΋_9S GƋȉfpfJ2r 9t H0f9ًF9랉t$ FD$|$ L$D$$1…@ 9<$P9_SD$|$4$M1@ yyy G7)ʉ (D$ $‰pX<$2\D$|$4$.0111fR9s<0t4$`01*s)׃ (D$$`ljUWVS$ ú=}EM@Bt $[^_]øEB $E-ƅD$ED$ED$ D$ED$4$!…xkG D$GD$GD$ D$t$E$ME2EE$4$Et;$[^_]øE9E$4$G tE$GG UWVS@= R<}E 1֋UHJ @BPƋ}ۉ\$D$ D$)D$4$W~HƋ9sED$ ED$ED$E $Elj4$[^_]ËED$ ED$ED$E $EDžt뼋E1UWVS:W7t@ËED$ ED$ED$E$ًU E|Ɖ$)[^_]ËE1[^_]UVS06Eu t"/10[^]Ã} u{MMUUUUuD$E D$ED$D$D$ D$ D$E$SuE0[^]Ã} t`M9tPMZQOQt, t4#ffffUWVS qÖ.ƉU&8DGtrUU]]܉U؀0tr\G0 1 4H\Gu2.utE]9tEprBDGu1 [^_]Ã0 vNȃ)ЋU9t|~&učDUM؉E 9uuM؋EEAEAEA EM.u&UȍrUU9rM؋UMn1et$ $M衊tM:fuM܅tRM؀9t‹uȍFU9rUffMEEEx:uPU؃:IUąmE؉EEȉEuȍEE_E91ffUWVS8æ*։MǠ1M1HL$HL$HL$D$ D$D$M $MU9ЋMs!T$L$4$趯U+u8[^_]|16_UWVS)Eu uu|}}Ơ1uU1҃t+tO/1uU+Č[^_]Ë}E+M|EČ[^_]M11rEEM Tu11MUut&tt}t~U9wuڋUuu}t 9|uU}E1E‰xEEB:u}tA}u}XǾL9}}t}u>Pu9:x)‹u9$t$D$|<$o-"uE1E‰xEEE)ЉNjMD$ ,D$|$$Ua9UЃ7}Mt9 U9}P}9sm:u}yEttq}b}UM)ыE UOtU$蠹UPu9r81u:}뚉}f[UWVSiÎ&c1qD$E$KE@(t}}tlpdh9Ɖ|X1lp9cE@Lؙdh!l!D$ L$t$E@$t!Ѓ\E@@}G0tO@9t$E@0Ef` ߋdl)‰lt1E$E@l9})ЉGD$E$|1TE$yE@ 6D$ D$D$E@$tЉlp!ЃE@ E@)lplpE@0tE@<)׉lplpE UucEEPd$͋dE@fu`xT$$LE UEUԉdh`}wPTlp6E)}+GlpE@0LP}OtșX\GM8E8y}u]9s@zM 9hPEM8HuUЋM؅tJEԉ9rAE9EEt(9%BEԉE:BEuEЉUԉ9sM)M6uD$E$\EE}D$<$\|uu܋}}ԉu}U؋M܉A8uMFEM8M88MuEuuȉMBEBE؉M܋uEB]ωE$EE E ]E4[^_]ËM؅t$E9r9M1EUE<}܍DUԉD$E$LUVMUωuszEudEuH}8}EEE)9EM7E#E\E\Zuऋ}8}ErufuEtfUыuuZE8EtS8MuTu8MCE9EM܃9uu8ME}}ǃs)EtfEtEUuuauGM뽋MufumuumfmmffffffUVSuF0t$ UT$T$$*tM F0[^]ËE F @u1ķ8Tu躷1fffffffU EE D$E$U]øU Ut+tAt1]ËE EBML$$P]ËBML$$tˋEM ]U Ut+tAt1]ËE EBML$$P]ËBML$$tˋEM ]UUM ttt1]ø]ËBM U]BM U@]UUM ttt1]ø]ËBM U]BM U@]U Ut)t?t1E EBML$$P]ËBML$$t͋EM ]U Ut*t@t1E EBML$$P]ËBML$$t̋EM ]U Ut,tCt1]ËE EBML$$P]ËBML$$tʋEM f]U Ut,tCt1]ËE EBML$$P]ËBML$$tʋEM f]U Ut+tBt1E EBML$$P]ËBML$$tˋEM f]U Ut+tBt1E EBML$$P]ËBML$$tˋEM f]UWVS U} tt%t01 [^_]ËBML$$t] [^_]ÉEBut$$Pu1UWVS U} tt%t01 [^_]ËBML$$t] [^_]ÉEBut$$Pu1U Ut2tOt1]ËE 1EBML$$P]ËBML$$t1UM ]U Ut-tCt1t&E EBML$$P]ËBML$$tɋEM ]UWVS ]M Eƃt )֋t4utSD$L$$R totNCuU ]@ .SD$L$$Rt?tCud U ]@ [^_] [^_]1 [^_]1 [^_]UWVSuE 8t8tZt 1[^_]ËEEFUT$4$PtڋMFUT$4$tUE9Us!ut<$oE 됃tQtڅuET$|$4$o>bZ}N<$E 8tuT$U$NjE 8Ut E덍D$a$UE D$ D$D$E$]UWVSu} EE]EE|$4$ot2Cu Ct9 uUU u[^_]Eu1[^_]UWVS>uEE 8t uto<$辣EED$4$BtU9UrtOt,t1ET$|$4$>t>[^_]É<$E [^_]ÉЃtt,E뭅u}u<$ME 1룉UD$$NjE 8Ut E뱍D$a$1ZU D$(#E D$E$]US]tPt1[]ËE M QUECUT$$PtӋCUT$$P[]ËCUT$$tCUT$$tE1҉¸M1 ڋM Q[]US]tPt1[]ËE M QUECUT$$PtӋCUT$$P[]ËCUT$$tCUT$$tE1҉¸M1 ڋM Q[]G=UVSV{uED$t$ ED$E D$E$~>.t[^][^]US(ED$ED$ ED$E D$E$[]UVS uE D$E$tE)[^]UVSEPtY.J.tQ.t&.tPÃ߃Aubv-0 [^]ÉÃ߃AvXЃ wrÉȅu[^]û.HvHw@B.̃v XЃ v-u(rÉȉdJ[0 v1nUE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]US E D$E$[]US E D$E$[]USû E$r[]USsØ E$@[]S| `1UBc E M91]UEf]UE]UEfU f]UEȋU ]fffUWVS( u}E EEGE؋U uу"E E1ɍEM[<U|$M $eUt~UM)ȍ<FD$ $eUUM)ȍE(\.uЋM)ȃE%E}9}EM؈vM؅<.U܃uwUD$]E$dUEE})C~x9F&}ȋ?DG~ruE9E9EEEE1ȉU}f]tEEwUD$ED$ED$ ED$E D$E$]UWVS46_ E܋EEpu؋EkE@u8uEU1Ã}@9؍sL^uʋE EEEEȋ} EEEċEOuE;EU}ԋ M]È}?wxEËu)?fpхt@}E]Љˁ?@ ‹EЍpхuEEuEuẼ;E]U}ԈU]7UEFFEE]k+E fEp}1EpBfUWVS$rƋ Eà1E1D$D$|$ ED$E D$E$t>ED$D$<$tE+uЁ$[^_]ú.UWVS$ E MUà1E1D$ D$|$E$t-T$L$ ED$D$<$U+u $[^_]Éb-US]E M9r 9s9su[][]UWVS EU} E9slUP0ك@t$tNt<]([^_]9sAAu@u;!E!29rUUX9r1[^_]ËE؃EȉӋUUWVS4 uE t*X?w#9r6 )ЍXt9Aхu)[^_]ÉK[^_]É4()[^_]UWVS EEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]HuU270:ۅt9u1[^_]Ë]j[^_]Ë]O(1[^_]UWVS  u}E9E |2&6D$D$$HumtF;Gt1 [^_]ø [^_]UWVSEb U2E uuW1[^_]É?wZ9rBZML$ ML$)D$D2$x(9E~9}ljr[^_]ÉG(뗉3$?UWVSǴ EU t_Z1?w%9r8D)ӍV[t9хuލF[^_]Éɒ[^_]É貒(F[^_]øUS 2 E D$E$c[]UVS uD$D$$tD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]UWVS$Xq uE܉U؅t A"}܉MGEML$$]uu]NjM-+E0 EEډU1709~Kt$EU9)ߋE^SЀ vSW9U؅ttFE܋E؋u܉0$[^_]ErEJ0AL$ D$D$ ${oGEME썃E荃;Dž|Em2mDž|EnnlwVwgED$ ED$t$$ڋp4Dp4D_4D4Dl)Љ$I)ЃJEED$ ED$t$$1ɉڋpD$ElD$ ED$D$ Uډ$UTE]9M 9Pu1D$E$Dfe\$ED$ ED$D$ Eډ$ T-UWVS Uh0E] ]ED$ ED$\$E $MUEy9tEh0E+E [^_]Ég"1[^_]UW &D$ED$ED$ ED$E D$E$7]UWVS8 &<$d D&D$ED$ED$ E D$ED$1$Ɖ<$ [^_]UWVS袕 &<$ DED$ED$ED$ E D$ED$1$hƉ<$ [^_]fUWVS=V uU΋}JЀ wK1ZЀ w( 0ҍ J9~]mfT1[^_]9| u[^_]Ë]DfUWVS-tX+tL1u$1ɉN…M)::t#tЃ[^_]Ã1믃륍B$;1ɉ…t4M)::uB$<1ɉ…tE1҉Ѓ[^_]USJMt50 wsS$m1ttX8/t}C []S $ At%8.u S$!t8.t:1[]S$mzS[]cS$1QUWVS uÉ։M uXi)\P=(\_NQDDD);QEN My *)R)ǃQ))|gfff)DQ)))Љ$I)))GF)4V}Ou} }싌)Ӎ\9K@9|)}] [U썒Ӎ | )Ѓ9uF}[^_]øQ))ƒt1EUV)F}[^_]ËFPLLD)F}[^_]ÃF)XENYDDD)sB9At DËA+BuA +B uA+Bu A+Bu+UWVS֏ |$@ƉD$T$`L$D} L$t@^~ VT$8VT$(V T$$v$t$$D$XD$\}t34 )Ɖt$XT$\))L$t\$0\$4L$X\$\ ʁыT$\))șL$ T$$L$X\$\)iiƸD$P%D$TD$PT$TyD$PT$Td$PD$ yމ\$0t$4\$Xt$\y<\$Xt$\D$x|$P|$TL$X\$\ʁ??ыT$\)уș׉L$0T$4D$XT$\)iʫiЪD$XӋD$XÉȃD$H%D$LD$HT$LyD$HT$Lt$H|$LD$XD$0yt$P|$T߅y D$|L$(*D$8D$8)‰T$XЙӋT$XRT$8)‰ЉT$0y D$0T$0$19>kL$X\$\1ҹ1)ӉL$H\$LD$@D$ D$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$ ׋D$XT$\19|ID$XT$\D$HT$LD$XT$\m1뷸n1뮁lL$X\$\n9>|$0L$X\$\L$X\$\1҃D$HT$LD$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$@)׋D$XT$\n9}8D$XT$\D$HT$LD$XT$\ m1미n1릉$D$PD$@D$8t$X|$\؃!|$\֋T$\ƸQ)ƃt$X|$\)i)\i(\ø)\ykddڋt$X|$\)׋T$\i)\iD$X(\ø)\d$XQ֣p=T$L9ø ףD$LD$H\$XD$0 |$8-9R9~&)уD$P t1ҍR9ڀ|$Pt$$D$XT$\D$XT$\ƋD$XT$\9L$X$uD$t;ÉD$(t$,EaŃ\$(t$,D$t;D$PD$T1$D$HD$dD$8D$tD$0t$X|$\9}Éщ\$dL$hD$HD$ ED$D$8D$D$D$D$`Љ/T$0D$H]D$dT$h\$\1Ӊߋ\$X1 t$P|$T11 7D$PT$T|$X9Ɖ׉ӋD$\D$dT$h D$XT$\D$PT$Tt$X|$\1Ӌt$P|$T1ڋ\$X9؉ӋL$\D$XT$\T$HD$XT$\D$0D$(D$,bT$4L$8\$KS\$T$4L$8\$$@+7Љʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$81ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0>$@L$ @D$ D$49t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Lщ€|$?ED$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G D$ 9tG +t$\$49t$ \$QT\$P\$UWVS b }썙]| uu [^_]Ë}|:dNu쉼0uMTډ ?-00tċu! [^_]UWVSt~ \$XT$T˅. 0xt$\|$`IXPL$d\$<É s {9 l$dyD$<D$dD$<D$ t$lt$D$QD$ D$\T$`$T$\$X}D$\T$`E.‹D$T|$T:)؍))׉|$d)À\$l|$<ljύ))É\$$t$D$:D$ D$\T$`$T$\$XD$dT$ht$lt7k9)ʍJ)Љ)))șD$dT$hi"D$dT$ht$l7_u)Љ))щL$\D$XD$(iT$h)\iD$d(\ )\d$dQ\D$dFEVED$ ED$ED$<$HƅL@U܋M;WW+EỦ9‰FA1EdF1Xn]؉0E܋؉ }<$11ƅE؍hF(EỦ9sUWVSPsoØ \$|ljD$xT$pL$P1D$TƋ$L1fBZ<:\$t\$X4\$x0>D$DD$\$|$ljt$ȃ|$dw|$H1 ڃ9t$xuD$hT$l|$HyD$hT$l\$tCL$\qY؋T$p\D$HTT$8D$h9ËD$l!΋D$HD$\L$pD$hT$lDT\$d߃D$tD$t\$x9D$D#|$t$D$p>11ۉD$x":tt$p>t$x9Kp9|ѿBG|$xkfat&Dߍ$D$xD$|D$xD$P{D$D$x$\$|L-[\$|;8T$4<L$@kD$0. \$X))D$Ft>8t$|$pG$D$\t$pD$`k XPD$H1$$D$P\$xD$X($\$HL$`t$t ;C suyt$tD$tT$hFP~L\$t9\\$h}4=}H\$t\\$h\\$PL$x ;>VD$\9]\$x|$dD$d|$pdF$ tftD$dËD$pXT$`D$x$\$|N(ËT$`<|$`1>|$t @ϋt$xs&tftt$`D$x D$hu+uċ\$|Xf1D$ht$t IlPӉȉnu6u\$xD$p@f$ $ f |$pdNeND$@1ɉL$8~$D$xUWVSa% \$dD$tT$pω<<FD$tp@u1e[^_]Ãt>u)D$lJD$ht$t|$hwǍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdP`tftߤ1eD@t$p`Pp@D$HD$pf@D$`<9PHЅu>u)Ӊ\$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$ttftt$l0e[^_]~~1D$HD$`*t -~0 wËL$`)ˉ\$LL$LY\$4\$X\D$x-D$|"D$d$|$$58,,$|$8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$dD$D\$@t$8ti)\‰(\= ף|$D4)D$XT$\9D$Tt$PtD$XL$\t뺨1ɋt$pD$dtlD$TD$P11D$Hy,;T$|| ,;_D$pD$TD$P|$pwt$dD$xD$T>7> 9iFuD$pD؉D$X1\$Pt$p>iF>kFuL$T\$X)ىL\dFuډT$X|$d9u\$PD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pX dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0ɨ뀋|$xT$|1{2D$Xf ndPt$pdPePeP@f2|$pdNeNT$hfM|$pdNeNT$h"fQyT$4\$\$@t$8D$XL$\D$DD$dD$8L$\$0t$,ri)\P(\wf= ףt$8)D$XT$\p:σ|$@p/|$T9׋t$P}D$X\$\L$@t3빉L$\$0t$,D$,|$,9|$|$D$(D$d$\$t$i)\P(\= ף$)D$0\$@D$d9)؋L$09ȋL$d؋\$(T$DЙD$XT$\D$8T$<D$ D$8T$CD$(D$DșD$XT$\D$8T$<‹t$FD$(șt$9Ћt$H}D$,D$Dt$0D$XT$\D$XT$\puD$DD$,9}bL$T$$D$@L$T$D$dD$03UL$@D$drD$0;L$dJ\$t$pD$(Fu=|$plFpFdFhFG\$\$@t$Dt$8t$)=D$pf@D$,:D$,D$p1҉PyUWVSUΈ }ƅӀ:tyɉ‰Džt;:1ɉUF E荈M1= ||9}~z>dN$]=v޿T[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]ËE~퍖dNE荄dNNjEL49tUD$4$]Uu_ɉ1DžuUWVSfT Nj U$=EU~|$ $ 5}# l40dž _y>u E [^_]ÅxE P$RAÉ 2h40dž 1뒋WZytىugb1ɍ `dN}D$|$ $LUVSRî 4$ uƃ 4$[^]UWVSDRm EuM V~6hFhF1P9u dN9ut [^_]Ë]w#1[^_]UWVSQ UM Z~/dFdFP9u09ut[^_]É#[^_]UVSpQÕ 4$$o4$[^]UVS-QR 4$~14$o[^]USP $[]qUWVSP $R,?t6ÉǹUu [^_]ÉE$G"U1USmPÒ E$ZG[]UED$ D$E D$E$1]UWVSPB <$n$ D$ D$ED$ $Ɖ<$*[^_]UWVSO҂ <$ u$E D$ D$ED$ $ZƉ<$[^_]US8O] E $11ҋE3t hP([]USN! [ $11ҋEt hP([]UVSN u  $1ɉEt tlP([^]ÍhUVSxNƑ ] E$1ɉڋEdt tlP([^]ÍhUWVSNC D$$k$ t1$YEgƉ׋D$$)[^_]$1ɍYE/ƉUSMï ME tEY[]$E1ɍY$[]US3MX ME t@ tEY[]$cE1ɍY$[]pUEt@ E]UWVSL ]} tC }1ɍY[^_]UVS0Lƞ ]D$CD$CD$ C D$CD$CD$C$D$(D$D$$D$$1ɍYL$xLL$ L$KL$ KL$K L$KL$KL$KL$ KL$$K L$(K$L$,K(0[^]UWVS]u } IXP ;r B}y[^_]ÍIlP)׉[^_]UWVS ZK~ u} D$$衿 t[ t$RXPL$ ;p H}yD$$] [^_]ËL$RlP)Ӎ$\UWVSET$RuXP$M ] ;H pDyE U $\$ ;A yyƉ;u ]|o9u ] $\$ ;A qyƉ9u ]|͋M ]11 1ڃ[^_]ÉƉ;u ]}# $\$ ;A y}'yϋM ]11 1)ڃ[^_]Í [ulPƉ)뗍 [ulPƉ)J [ulPƉ)RUlPE UUWVSIA| D$ $i t< tOUM T$L$$Ɖ׋D$ $/[^_]Í$C uu} UWVSH{ UE &9t%\_ptwf9t)[^_]1[^_]US9H^{  u#$ tЋE$UWVSG{ e=t:F$V FtD$$%4$>uƃ[^_]UWVSGðz }ƃ $5tCƉxtD$<$l%E FEF e1[^_]ÃUWVS]t1U׋u ։t$E$Ut!~uu u1[^_]É뻉[^_]UWVS Fy EU΍, <$1t?$5tYMHMHp L L <$1 [^_]Íl 1 #txu8u막<$輸UMU E]HUWVS F%y }, E$yH L 1ɍl E0EMt"L Ct\9S t~ߋuMMH E$H uMtω?$\r ED$E D$E$i []US>q ED$ ED$E D$E$i[]UWVS>ñq ED$E $%ƅD$ED$E$r=ifFf~ vjF$jF,kF(lF Eu [^_]D$ D$D$4$[^_]É$Ҫ>fF 1[^_]UWVS=ûp }D$<$w fD$<$[^_]ffffUWVSA=fp u 4$9EU9s 9ru׃s$u8u:Ѓ[^_]Í 9rU9tՉ׃ru$u,tftƤЃ[^_] zfϤUS <õo E9ErD$E D$E$ͪ []蔤f!̀rS[to 0[UWVS1<Vo u F0u ǀFFF tBNt;})9F~JnJM 9FtHF t t=[^_]É4$u:N})9F4$bu뤉4$Mt  UWVSm;Ɔn Ӊʋ} MM tau!ƒuމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]{} x|1utv҉)Ѓ0CUtʋE9ut OsECExtE1뙸)0KыEÿEX0C[^_]UWVS :-m UM9 ?p9s΃ttUU^ ED$t$E$_M: U)UD$D$$E}E01 [^_]ÉUE ED$t$E$M uUEU JHJHJ H JHJHJHRPVU{ 0U$/i 0`UWVSL8k ljT$ L$L$,11 rL$$D$(D$ D$D$L$uct_GЃ%uD$wPZw01ҍTPЃFHЃ v$uЉT$…L$t$$|$9|$  |$bD$D$tZFT$| |$t$L$8w%0L$1L$ 9<΃t$  9D$uʋt$L$9t4$v.1e[^_]Ët$6뼋L$1L$ 9<qt$ 붋L$1L$ 9<IL$ 랋L$ t$ ~64|t$ t$ xL$1L$ 9<y|$ ]t$뽋L$1|$ ?<L$ y|$ 6t$ t$6t$ t$ t$ .t$6<t$ t$ L$D$D@$$L$L$'~D$|$UUU>D$;D$(` D$9D$sD$D$$L$D$ AD$L$D$|$UUUD$;D$(\D$9D$sD$D$$L$D$ AD$'L$D$K|$UUU D$;D$(D$9D$D$$L$D$ AD$L$D$|$UUUL D$;D$(BL$(T$$D$(OHЃ  1t$|PЃpЃ vt$L$<$|$UUU D$;D$(rL$(T$$D$~D$9D$sD$D$$L$D$ AD$L$~*C PЉ FPЃ vD$|$UUU D$;D$(D$9D$ D$$L$D$ AD$ED$cD$|$UUUD$;D$(rL$(T$$D$iD$9D$sD$D$$L$ D$ AD$D$ D$L$L$D$tL|$UUUs D$;D$(D$9D$D$$L$D$ AD$9|$UUU D$;D$(D$9D$D$$L$D$ AD$L$ |$UUU D$;D$(FD$9D$QD$$L$D$ AD$D$@࿀ D$|$UUU D$;D$(D$9D$eD$$L$D$ AD$,L$FD$D$f|$UUU D$;D$(L$(T$$D$@D$L|$UUUDD$;D$(hD$9D$sD$D$$L$ D$ AD$oD$D$c|$UUUJ D$;D$(D$9D$sD$D$$L$ D$ AD$|$UUU D$;D$(`D$9D$sD$D$$L$D$ AD$|$UUU D$;D$(D$9D$sD$D$$L$D$ AD$oD$|$UUU D$;D$(L$(T$$D$*|$UUU D$;D$(fL$(T$$D$]L뾉D$L$|$UUU D$;D$(rL$(T$$D$wD$9D$sD$D$$L$D$ AD$rL$@D$D$D$D$3D$OL$(T$$D$L$(T$$D$rL$(T$$D$SL$(T$$D$4fL$(T$$D$.sL$(T$$D$TL$(T$$D$5UUU< ;|$(rL$(T$$ 9|$s|$D$$D$ t$4D$|$UUU D$;D$(rL$(T$$D$@D$9D$sD$D$$L$D$ AD$D$ |$UUUD$;D$(D$9D$sD$D$$L$ D$ AD$GD$ |$UUUD$;D$(CD$9D$sD$D$$L$D$ AD$D$ |$UUUvD$;D$(RL$(T$$D$!8L$(T$$D$`L$(T$$D$A994$"+L$(T$$D$ L$(T$$D$~D$ v|$UUUD$;D$(rL$(T$$D$JD$9D$sD$D$$L$ D$ AD$D$_|$UUUD$;D$(D$9D$sD$D$$L$D$ AD$QD$|$UUUD$;D$(lD$9D$sD$D$$L$D$ AD$D$Y|$UUU!D$;D$(rL$(T$$D$/u<$vt$1UL$(T$$D$X_|$UUUD$;D$(`D$9D$sD$D$$L$D$ AD$>|$UUUSD$;D$(L$(T$$D$zD$|$UUUD$;D$(rL$(T$$D$8D$9D$sD$D$$L$D$ AD$|$UUUD$;D$( L$(T$$D$0L$D$$9 $L$D$$9$L$D$$9$L$D$$9$iD$@tb|$UUUD$;D$(rL$(T$$D$ D$9D$sD$D$$L$D$ AD$~D$ |$UUUD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$(T$$D$fL$D$$9$TL$D$$9$7L$D$$9z$mL$D$$9]$PVJЃ |$1tBЃD$D$JЃ v$q|$UUUD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$(T$$D$5L$(T$$D$ztL$(T$$D$UL$(T$$D$6L$D$$9&$L$D$$9 $L$D$$9$L$D$$9$oL$D$$9$RUUUwF;t$(rL$(T$$9t$st$D$$D$ t$L$D$$9G$:$f|$1늋L$D$$9$ L$D$$9$L$D$$9$}L$D$$9$`L$D$$9$C4$6L$D$$9y$lL$D$$9\$OL$D$$9?$2L$D$$9"$L$D$$9$L$D$$9$L$D$$9$kL$D$$9$NL$D$$9$1L$D$$9t$gL$D$$9W$J|$UUUwTD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$D$$9$|L$D$$9$_L$D$$9$BL$D$$9$%xL$D$$9h$[L$D$$9K$>L$D$$9.$!UWVSX!T $]$U T$D}|$4UT$L1D$0Nj$TC0u ǀƄ$D$D$$D$,$C Sf DŽ$D$LD$$$$$DŽ$DŽ$\$4$D$PDŽ$$D$HD$(D$tDŽ$$D$@$D$<$8e$%$)tc$1$$ C$$$${$$~Ƅ$Ƅ$FDŽ$DŽ$DŽ$FZwF$`1ۍFЍPwFЃ v$ H$FZv$J$Ƅ$$$DŽ$1$$D$xDŽ$D$pD$XD$\D$c$t$$$9}ڋ$T$TI0$$L$du$$)tE$$A$$$9$$tJƄ$0$D$<B$$$ $|$dK$D$x)Dž^$$$T$xPӉ$$$$$t$$)ƅD$T$DŽ$$$$8$b:t$PtD$P$$$$@ @ft DŽ$t$09t$$\$0$T+G$e[^_]Ë$<$$]DEG f /$fx$$DŽ$DŽ$ D$$$$JD$$8$$ǁPǁTǁXy 1AAtft$A f$f$Af$A$A,$AD$$T$$DŽ$DŽ$DŽ$D$LD$ D$4D$D$DD$$$ $P:$@%$fH @>;$)@uDŽ$$$m$$D$$$$ZDŽ$DŽ$$t"$D$c$2.D$d$$Z$$/R,ۼ$D$c$T$$T$$T$ \$d\$D$$$$KDž=$)D$HD$Pt$$7<$$D$P=<$"~$$$tƄ$-$D$\=$$߃G|$c-$\$\\$xD$xt$d Ɖ$$L$t)T$\}.|$x$)\$P$DŽ$D$pD$XD$c<$8$FD$c$D$d$al0X$LD$cP$$=$$$y$$)u9 I,ۼ$$D$$D$$D$$D$T$ <$$FDžx;$)D$H$yD$HD$d$uƄ$D$Pt$$ <$$D$P3;<$${$$$D$c$,D$d$$$N$ '7v4\$$ $$$$$1۹ $ $$G.$t _5$DŽ$$X$D$xDŽ$D$pD$XD$\D$cDŽ$&$@.'ʃ⿀ $y$f$S$) $.$$$$$Q$$T$ 3$ [L$DL$ T$D$$4$$ o=D$x$y DŽ$$$Ƅ$1$$$$$K$ `'4[R$$$ Ƅ$1ۋ$DŽ$$$}$ $DŽ$DŽ$$$$y$$`32$[$$$$$DŽ$D$x${$$$$$$D$xD$Pt$$Q $0$@$$!$J4$p.$$$$W‰D$Pw4$$$T L$DL$$TD$ $D$$D$$ 9L$PD$x$$i$$$Ƅ$ y$it$D4$$\@$4$G@D$t$8$Ѓ01 4 4Jу0 vꋔ$$$)$K0[$$$ۉ$$Ƅ$+mW7*A9FЉ1҃  4PwFЃ v뉔$3$$ $$$$K$ 5"0[R$$$$$$$S$ "0 [$8x$i$$$O-1҉$$$ƁƄ$x% À߉$$\DŽ$Ƅ$$g $$$$XT$tT$$T$ $T$\$$${$$)lj|$xd$$$9}$$$D$pD$XD$\D$cT$ $$$$D$x$-$+$@$D$x$$$$s$ |$D$$4$$ $)$9~$Ƅ$$D$x1$$L$$$$ʃT$x 4ʍRR$$$$$ DŽ$$w$$$$$$\T$LBJ$$$҉D$LaDŽ$$D$x$Ƅ$D$tu|$c$ D$PL$HȉD$xƋ$)ƋD$\9~ƅ~@$$q$$$$y1t$\)ƅ6L$\$$D$t$ $D$,$$$0@$$$$t$x$)Ƌ$9~ƅ~@$$q$$$$y1$)ƅ*$/$8$$$$Jƒ~I$G$B$vDž11ۋ$$$$8p$$w$XDŽ$$b$$$'$$)ƅ$@,$8$$|$d$Jƒ~E$G$B$vDžuZ11ۋ$$$$p$$t$D$dD$$$$虛DŽ$DŽ$jd$ $8$$$$Jƒ~E$F$B$vDžuZ11ۋ$$$$x$$$$D$$$$胚DŽ$DŽ$gN$D$$$$?DŽ$DŽ$ yDŽ$1ۋ$$DŽ$1ۋ$$$$$8p$$:t?$D$$$$tDŽ$DŽ$DD$T$$y$P$$p$$D$,$$$0@C$$$F|$HGF D$$ 11$$\$H)ޅ1$ \$(ZÉ$$gB$$D$$$$DŽ$DŽ$$|%$H$D$8$$Jƒ~E$G$B$vDžub11ۋ$$$$8p$$$$D$8D$$$$DŽ$DŽ$b$D$$$$贖DŽ$DŽ$$$$H$$$$Jƒv$G$B$vÅu11ۋ$뵋$D$$$$DŽ$DŽ$t?DŽ$1ۋ$$$D$$$$zDŽ$DŽ$SE$D$$$$6DŽ$DŽ$7$$1۹ $ $$‰%D$p$DŽ$DŽ$$XD$tD$T$ D$pD$\$$$$$$$$X$8$$B$$$u$$ $tB$D$,B$$$$$$D$PL$HȉD$xi$Y$$0@C$$~ yt?$D$$$$DŽ$DŽ$$$D$H$$yPm$ݔ$D$c$T$$T$$T$T$dT$ D$$$k1ǁ$'DŽ$$|$\ t$d9})t$d|$xD$xD$d|$x\8\$x$D$$D$c$ǁ|$p$$! j$X^$3$$$$ $u$$$3D$P8N$`R$$$$|$d$DŽ$D$xDŽ$D$pD$XD$\b< DŽ$$$$$D$$$$[DŽ$DŽ$&$"$8$$$$ك~D:B$Y$uDžuUDŽ$11$$$r$$$D$$$$XDŽ$DŽ$l#$$$0 u䉴$$$t&0t!F0$$C$$$c$R$$$Ƅ$$11DŽ$DŽ$ @  !$[$$$ q$ $$y$Ƅ$-$$$$$1۹ $ $@$ h  $R$$g $DŽ$DŽ$$t$X|$p{l$pL$@@$$$L$t |$x)9~υ~2x$$$L$t y1)@ʋt$XVL$pV$$D$x9$x$$$8$$$$$у~D8@$Q$vDžu[DŽ$11ۋ$$8p$$$SL$t $D$$$$ DŽ$DŽ$fu;DŽ$1ۋ$.u{DŽ$D$t$U$$D$$$$聊DŽ$DŽ$$tIl$tl$X{$$D$$$$$DŽ$DŽ$D$t1ۋ$$DŽ$$L$t ~$$$Z$$$Ƅ$-$=$D$c$%D$p$$F$$$$$$ DŽ$$X$D$tD$d|$\'L$x\$|$$ $$$ʁы$)уș׉L$xT$|$$)ii̍$ȿƉ׋$ljD$h%D$lD$hT$lyD$hT$lT$hD$x1L$x\$|$W0G$$D$pD$d<9 $$9r$PD$cCD$dxtD$d\$xt$|$$DŽ$G$|$\$$$$$蒸$1it?$D$$$$詆DŽ$DŽ$y$$D$(É$$DŽ$$DŽ$1ۋ$$ADŽ$1ۋ$$>$$D$$$$څDŽ$DŽ$1ۋ$L$t $ZDŽ$1ۋ$$m$$8$$$$JƒE$G$B$vÅu11ۋ$뵋$D$$$$DŽDŽ$DŽ$tD$x$$$t$D$$$$cDŽ$DŽ$.|$ct&RD$c$D$\)-ODŽ$1ۋ$$#$R$$DŽ$DŽ$"$[$$$ $D$$$$EDŽ$DŽ$$1ۋ$$vDŽ$1ۋ$$.$$$8p$$$L$x$DŽ$ DŽ$[$| O$$$$@R$$$R$$$?$ ݔ$$D$$D$$D$$D$ T$$$$[1҉$$$$Z$$2+$ $$3$@3$ +$[$$[1҉$$$$ @* .$[$$$$$D$dD$c$+L$\$ /$Z$4)0ȉуcڋ$C0O$9$\)ډщ$$Nj$$X)Ћ$8D$(t$dD$( L$x$ D$xL$x$y DŽ$\$P$L$d$DŽ$D$pD$XD$\7_DŽ$$$7D$LD$L$`s$Ƅ$1D$L( D$L,\$t,11L$\ 9 )Su߃݋$$D$d$؃$$$1۹ ($D$$$$R}DŽ$DŽ$$D$$$$}DŽ$DŽ$$D$$$$|DŽ$DŽ$!D$HD$d|$c%D$HD$dD$cދ$$|$x$Jƒ^$G$B$vÅ11ۋ$뱍J$8$p$D$$$$.zDŽ$DŽ$^ $$$$aG $[ $$$$ . $[$ $ In $$$$ 3 $R1҉$$$]$u $vnWE $[ $$$$ $R$$$$$$$1۹ 5$D$$$$wDŽ$DŽ$1ۋ$$q$$T$ 󥋌$1$$9$rC$ǍA$D$DD$ $D$D$4$$Pv$L$Ht$\)L$dAD$d4f$D$$$$vDŽ$DŽ$$D$$$$vxƄ$0$! 9D$c$D$HD$d,$0$$T$$D$4,Q$D$L8$D$LJ$$8p$$E$$ D$xD$$$$uDŽ$DŽ$^D$L$D$LD$L$D$LD$L1$$D$LQL$Ly|$Lp\$L\$L$t$\$y DŽ$L$P$DŽ$D$pD$XL$d$O$$-{DŽ$$t$p$$Q$$$8L$\\$tt$X|$p7T$x\$x$y DŽ$L$P$DŽ$D$cL$\\$tt$X|$pT$x묋$$t$L$t$L$$$D$LX$$D$L$$}D$L0X$$D$LD$L8$D$L$$vD$LX$$D$L$$ T$LB$$҉D$LvD$L8$D$L$$ J$HL$LL$LD$LD$L{D$L( D$L\$L$st$LAJ$H*$$$T$ D$DD$$TD$ D$$D$$$b$$fH @DŽ$$4\$$;$[RW$$[R |$L$_\$L$$ $X$DŽ$$$$$[RJ$8$(1fDŽ$9ƃ$$$ 1D$c‹$$# DŽ$陾$ DŽ$钾D$L1ۉ$$D$L$$ \$L${|$L~D$L1ۉ$$D$L$$H|$L$$GD$LT$LB1*T$LB$$҉D$LD$L8t$Lt$LD$L8$D$$$$ZnDŽ$DŽ$*$1ۋ$${fg P$8$I$|$LOL$LJ$8$D$(J$8$D$L8hT$L$rt$LT$L $$BD$L$$jt$L$$t$LFD$L$@6$ $f$*\$LKL$LT$LB$$҉D$LpD$L8T$L $$BD$L$$ D$LP$$$$$$T$Lw$$D$P$$$WD$pD$X$ (1k$ $$֋$UB$鏷$D$L+Sf$$ލQ$膨 DŽ$ZL$LL$L_$fH @ٹOȃ0 [14ttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVSX} }ED$E D$EE$ulE܋T\$D$D$D$D$%-uMAU$T$ 7ƅXT$ DV 9‰T$ s )HFL$D$$މD$ NT$99sH\$T$9rڃ9uT$9Ѓ9uU@]} ;tL$E$UE tE C9rwN9ue[^_]ËD$%-uMEED$E D$Ϸ$5Ɖe[^_]ËED$E D$Ʒ$5Ɖe[^_]ËED$E D$$5Ɖe[^_]úT$U~ t^E|tEXrUWVS,î }m|$D$%U <$U:ue[^_]ø랸뗸1ffffffUWVSx t&=E= =D$TEU D$HT$Lu 1ҋE%=D$HT$XzD$T~D$TD$pD$ D$tD$D$X$D$DD$pD$PD$\% ?D$X\$`t$`D$$t$`D$dD$`أ܋\܃d݃lT$`L$`|$nD$n fD$ll$lT$hl$n؋|$P)׉T$h<@"\$X,D$(D$4D$hljD$@D$,} <$@/D$`D$tD$ D$PEExD$0|$@t$0L$$ 3t$4$uD$8xD$0L$4ȅt~9 ))D$4)NjD$,tXT$0D$D$8$vD$8"T$DT$$AuD$XT$D$drD$XD$D$tD$XD$h }~D$0t |$TD$,D$h   )ƒ& <)t$LE'E D$E D$Ϸ$-D$`D$`e[^_]D$( D$4L$hD$h)D$4މt$,D$@D$h} }~1|$Tƃ}B }}}D$0UD$@‰T$ MDD$P$,D$`O}F|$T;|$PwHL$t |$@ @"D$@ƋE D$HD$`P|$P|$nD$n fD$l9 ؋Ƀl$l\$hl$nL$h‰L$XL$Xv ɃL$hɉD$hH0Jڞzu؋D$D$oD$`9D$@}U E 0D$`e[^_]ËD$,D$D$D$sD$DD$`D$`e[^_]Ë|$P|$t2} x )D$`D$dl$`\$`t$`D$d-D$$D$TD$T1|$TD$TDD$T@)捊 ym1}} }t=ED$0T$hD$()ȉD$41D$0EED$ D$P_D$hzIl$h?ED$E D$$ *D$`D$`e[^_]úT$4ׅMt$(vT$PD$0t$`L$D%D$D$ $nD$XD$ $L$h)*0FL$hQu y 9|$P‰L$D1ɉT$hD$Tt@L$TD$D$D$gsD$D|$X|$$ptL$T6|$`94 vP9t|$8L$8=D$`0D$E D$Ʒ$(D$`|$PwuD$t(.D$0L$@@"ȃƉDD$XD$t"@"T$t Ƀ ɃuT$\$8D$8T$ D$PD$4D$,T|$8D$`D$4t$PD0D$(t$DD$XD$4$q&D$,0L$hT$8T$4$qD$P|$D$X$Bq…@ fT$T$04$pD$DT$0$4iD$Dy}T$HL$T T$PN~}~L$TT$ht$D~HD$4$oD$D1t$Xt$$pT$hV9zT$,1t$4FD$hD$X$VhD$h L$8tt$89tD$h4$.hD$hƉ|$8D$8$hF(MZD$PD$D$D$X$hD$XD$D$D$WoD$`p1D$@D$X$gD$8lD$hD$D$X$kD$X86+D$p[T$XBD$i¸ )6D$XD$D$D$nnl$@D$D$ D$D$ hD$DL$0D$ D$P8D$0~)T$4D$HD$`DD$8|$nD$n fD$lt$0l$lT$Hl$nd$HT$H0qٞىt$Ht$0T$Hكpڞ.D$XT$\D$HT$LD$tx |$@t$4D$0D$8@"D$Xr D$D$D$8$lD$81fu T$hvx0t|$8L$8 t$8F$Jd…Fz tftD$$kDžYD$PD$4HL$PD$h9L$("D$D$ 4$eƅ`D$8D$D$ 9D$8$eD$8,D$D$ <$eDž D$PD$4D$8L$؃\$HD$HT$LD$-@D$D$8أD$|؋t$`D$XD$8EЉD$@A$cD$Px}ND$H D$P=N)ȉD$41D$(D$HiD$LZOD$,DD$@@"ƒD$X T$T$L$T$HL$L?@"\$81tD$8 \$8uT$D$8T$0t}D$`D$D$D$t$OD$tD$D$h$V|D$lP1D$DD$d T$`D$t$BND$HT$`L$`A|$49g)lj|$t|$8D$`)DŽ$D$\D$D$t$@RD$t}t$tFD$OƋD$dD$\rD$0=P}ST$LD$4D$tD$8ЉD$8|$PE@9E  D$8D$LD$\D$0D$`u؋\$TKD$tD$HEЉD$DT$lD$d)D$8D$LD$,‹|$4)T$\t$`$t$LD$tL$8Ήt$8D$4t$tt$D$H$PD$H#L$hL$$OD$tL$h $3LD$tD$h)t$4t$D$H$zRD$H+L$l95vB<9tD$< |$PE@9E D$8D$LD$d|$HG$rJKWx q tftD$$QD$d~D$<؋t$lL$dD$D$h$vQD$hL$tL$$RuL$dfD$hx,D$<D$DD$l1D$< ezfu D$tSD$dƒ80tND$<؃\$TD$TT$XD$$-@D$(D$<أD$$wi؋D$8XVH؄tJuU tu ؃[^_]11US EHP$/C[]UWVSD譚 Eċ] CE}9G{}ELM܋uűUDE0EH1EЉE9uEEEEEgEU؉Ӊ1ۉMԉ]؋1ۉEE+M]+M]؃EEN9}s] }uAG9Es0uV+E)‰؍M9tFE4$J7E$&6ƅ@1랹fUWVS袎 $}<$04$QTD$tDŽ$ݜ$DŽ$E$E$}$-wӋ$ L$|$}D$p0D$dE@D$DӉыD$|DŽ$/1t$x1 tQЃ$ˉʃ/~J9E~փ؋$LQЉ$} tE }8e[^_]Ãt$Xt$x8|$xD$hD$TD$`eED$HD$xDŽ$D$Ht$T)D$`E@ D$h]cD$Lu|$xD$xƃ~D$XD$hD$ll$hݔ$|$x '؃$5XD$` x|$`7%T$x)ЋL$`95)4$$-\$x$E$EP+ -D$PE$EPZЃ Q$0u&Hȉ$I0tJσ|ZЍH$P΃/ \$HN eFE=D$`D$d D$hD$`uFi GI Nu($1D$$4$M/ DŽ$E$$M t $} D$pt$t0T$$D$E$$%/$$2$e[^_]ËL$|A$ƒߍAX2‰$@X0tT$|t|D$d0D$PED$TD$`D$d D$h D$xD$Pn@$$@["$^^T$xA8tT$x,E$D$HK$@"LDŽ$߬$ݜ$$5 |$xT$`$$D$x)4t$@"݄$ ݜ$ m$@"@ 1ۋ$ % ?$݄$ݜ$؉$?$G ݄$$@"1ɨt uݔ$؍$D$ $D$$$K;$ $$$֋$)ޅ~1t$ $$p-$$$$ ΋$)Ήt$(MI$9MIL$P9w)΅xt:։$$DŽ$BBt$P$D$DtD$(9D$PD$(D$hD$tD$D$XD$ D$xD$|$D$|$$)D$@|$`D$Tt$H)!ЉD$d|$HyD$HDŽ$D$@ D$,t$@F$$u-D$t P F׋t$,) tft$@$$)-D$x $H Bύr  tft$$)D$X$։T$T$$q0D$|4 T$T2 D$dƋD$HD$T$CL$X))ߋT$P9~)|$Tlj9~9~~)))ƋD$dDЋ$)ȅ[ D$` ~#t$D$|$$3D$|yD$tD$D$x$$4DžTx p w $G D$|D$<$$A4L$Lw D$|D$<$$'كB؋$ T$XD$8\$0D$$ DŽ$D$T$$Ɖt$<\$hu 9$ $D$ $D$D$X$$6…E$2 N $L$TT$ FD$$-T$ T$$$X3$^T$hҋT$ u*K9H L$P9L$($D$TD$h$$(+4$ +$Z $$t$<9؋D$hD$x$$*D$t$*D$|$*<$* $|$xD$hD$TJЃ w.D$hL$`$C$SJЃ vD$`\ZЃ$V/~΃9~).D$HNL$P\$Hy0j˃$0t)ÍCD$hBσ$BЉD$`D$hD$T\$|D$xD$Xt$`FD$XD$h$}D$pP$XoT$|$}D$p͍$$T$ T$LT$D$U$MUZ$$1t$D$$4$$g$$D$4$$u$DŽ$E@}$1DŽ$E@$}$8(|E@$$D$h$$ӍrD ~N9r1BBDŽ$$t$PD0$DŽ$!$$)Ɖt$h $D$hD$$$-$$t$h)$D$huD$x$$ 'D$t$'D$|$&D$@$&<$&E$9x@ $n$$$&DŽ$DŽ$E@}EPu9us#T$D$E$$ 5Et )n$|$hЋt$Dt0@DŽ$P$O"$1Z$ ȃ0y$jT$T$T4$$$HY9^T$T L$h$$$9D$huT$TD$D$|$$c)D$|tfT$xT$$'D$Gz q s7u/u(UE$]UBEUE다fuuJ z Mq ffUWVSE)Ɖ9ME܉pE)E؉p$] )ƋE 9m1E ]9XE pE9)9E @ E؉$]S ]c4"P0[^_]Ë](EbNF10[^_]ʋu< ǀ0^0tʋu<ɉMEJE?$]j E@@E}؉8E @}]o3"b?)։Ut$E؉$]DžUt(N}#bUt$E؉$]puU3]K 8 t 9u~2U)49t$W0T$D$ $Du1[^_]Í~ u u 9}t$O0L$D$ $u뺋}}z1HUWVS0a\Æ }u D$(D$<$\$ D$ T$$D$T$D$,D$4$c\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVSX[ EM]E TsCD9sϥ9r)؃L9s&)D$D$ $]G[^_]UVSEPXM 9} u#9r1[^]Í~M t09tݸ[^]UVSZ· >0)ˉލ u썊ӷa)ˉލ u썊}A)ˉލ u[^]UWVSU} EZ]9BB[^_]ÍBEuLMuttb )E^M9uUM ЉFCU9rߋUM})}Lt% 9bE9rEu)} ȋ})B9>[^_]ÉB$MUVSY& UBJT19r & 9st9sEE$Ɖ[^]ffffUWVS XƋ 91} w+ M4tetB`&$2E$FƋEFEFuFF [^_]úMU`E )ȉE w`|`&$G"t`&$0|UWVSWí ut"F w"91u& 4[^_]É4$GN[^_]`&$UN? 4tU$[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɉu}u܋EDEd}EUƉ׉1u}D9Mlj t"E9C~$E}|C؃[^_]É؃[^_]ËC$2tKSx s stftE$]u2uʉE$Efx s UE=w5=w=w=?v=]1x@u ]Ã]Ã]U$7t UP@]UWVSM CFM9r}ыU܋]9rB+M uUEPE$E$[^_]å9sܥ9rչUWVS}u F_)u)ODT9s290tۃ[^_]UWVS0u] C~)u:NDT9x9t] sމÿx1F$E؅3x F~}ЍUȍtu܍suStuquԉu}11Ẻ] E]EEK1ۋ@1))ڃ1EEʉHM9MrÉu}E̋] {}̉)ك9 }ω}uΉuu9]Mu}EA1)EU1USE9r׋EM܃})}ωuʋ}) t}؉GE؃0[^_]$UE؅t@@E؃0[^_]ù9u9ur }ω1UWVSEx|$Pt~^$2 )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS $ƅtc] %t D$ED$uDD$$&T$V ~tbM5)NjE8e[^_]ÍD$$T$tI ) |$T$~V~u-2MD$=)딋|$UEM Q tJu]UWVSYK~~ }tD$E $ƅD$D$E$轷Džtt ʃ9t-xD$E$t|E%=t`fp ttu ffp MfH@ŸjP$jP,©kP(lP Č[^_]1Č[^_]1O1USJ7} E UD$T$ D$E$[]UWVSI| uD$4$nx$P8D$4$[^_]É4$mUS|Iá| UjxH []É$6[]UVSEIj| UF0$>F0ǀǀD$4$FFF [^_]ÿF tF$p>p4$D ffffff̀rS[Tz 0[UVSG7z uF0u ǀ4$cunP[^]øfffffUSFy MQ 1f t[]É $[]UWVS yFÞy uc1FF uafF FF uwFVT$D$F$V$FV fV 1 [^_]ËF0tN@9t $ωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$se=<1ɋ8tBD$D$ N|$\$4$薽 y8t6D$D$ ~D$L$4$LW8t6D$D$ VL$\$4$W8t6D$D$ V\$D$4$ļ?O8t6D$D$ NT$D$4$耼_8t6D$D$ ^D$L$4$<W8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$踻u7O1$[^_]ËpOe8,UVS =p EU uMtTp4u 1 [^]D$D$4$#+u"udž0UWVSJ=op Ƌ4D$D$4$*EtE$3Gu͋$3tMtf~ 18t$39⋎t $萩4$u3uu&E[^_] U9 8} ]EUWVS1<No ]tCƉ$3[^_]þUWVS;o ljUD$@$g.:ƋUu 1[^_]ËOD$M$(.…1]~˃Mt|tatOt=t+tt9EGX<tE[^]},[^]^UWVS2e } D$$$%ƅǀM]8bL$ ED$|$]$ mF8FF F FFFF4& ~D1 󫍾󫍕xT$E$Iq]~^ $iF]Um]StV4EHt }Gu]Stt LV1v4s$≕@DDDHN F$D$ D$ IL$4$膰BF0F(LN,NV<~$]9~s~G]WEP IT$4$i0}M1Q\$E$oKT$ ML$|$}<$ÉX TUMQ D$t$$@ËVnNNFVnNNFV n N N F V nNNFVnNNFVnNNFVnNNFVnNN F V!n"N#N$F$V%n&N'N(F(V)n*N+N,F,V-n.N/N0F0V1n2N3N4F4V5n6N7N8F8V9n:N;N<F<V=n>N?N@F@VAnBNCFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Z1=x>alV]D$ ڷ<$ ;F@7NF(șdž‰<Dž=N V DDTNꉖD$ T$D$8$]EP D$4$0}4dž$$$>pXPx MH XuPp[^_]ÿO$4$!p81Ë&fLT$ ML$|$}<$ 8녋8"8F8FF F FFFF4ǘ& ~D1 󫍾f1$F~ j%8118ED$4$dž0881UWVS$)*\ uF(x~(V0!UN9F9MUD$N $JMUF($N 9} TDTDF F,9sF0 F,|$}|$4$_$[^_]ÉUUE$EEtlE܋UT$ML$E$_ME)UЉL$D$$.M $EUVU(_US]ED$U $ #C,9C(}#C0[]fffffffUVS b'ÇZ EpFtD$D$$˸F u  [^]UWVS&Z ETPLx PpXxHPTt=kbPKҐ"DHD$$$ƅǀHDǀ$$jljFHt dž wңGGlG ؝G GGGE U%tAtCFt$Rt$R4$71 xD$ ED$E D$E$HE EXuEX=DžX T dždž XTLtt!ȍDLX1PfffXL9aTȋX1D$ L$HD$$踰w 3D$D$$Qfxuu fx D$D$$E t @E@t Ey [^_]Á1DžPDžX&DžLDžT''DžP^&KVp t$ ̠T$T$$1D$$+8D$\T$X$TD$XT$$ѯ…\}@@f@fBB PD$D$T $XD$XL$$D$PT$$xD$$H XADžX2D$`D$H$Œf` =b1`abcddefghhijkllmnoppqrsttuvw `b1uedu\hX=wCu>t_u1 ȉ lpHO ''&FUWVS$R EpFtD$D$$RFUED$E D$4$XDžEtwD$D$ED$D$ D$|$4$蹅!@uFЃ$[^_]ÉED$D$$误UЃ$[^_]D$D$$芯Ѓ$[^_]fUWVSEU M wHpPPHHpPPHH p P P H H pPPpPPpPPH t tZ[^_]ftHҍtP1Q‹ˉZˉZBtZ ˉZ Z ˉZ 9uȃ[^_]ftxҍtPu,r utu΋ʉVʉVu9c7W‹ ɉ ZˉZZttr Ήr r ur Ήr ʉPʉPPʉPP ʉP PʉPPʉP[^_]UWVSEU U P׃X ރ HpPPHHpPPHH p P ˉX ffxPpP[^_]fzHҍtP‹ˉZˉZBtZ ˉZ Z ˉZ 1Q9uȋX x)ʉPʉPPʉPP ʉP PʉPPʉP[^_]fxҍLPM2r utu΋ʉVʉV7W9}q‹ ˉZˉZZttr Ήr r ur Ήr UWVS(9M EpFtD$D$$}FE  D$D$$٨Eb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$辪$"u 1([^_]UWVSL }wFtD$D$$XFD$<$tr$StcFt$t$xt$fE4$U<$ME$U[^_]øUS %JK E9ErD$E D$E$R [])UEtu]11ɍT9r]1]fffffffUVSJ UE Xt"1rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS4I }E@Et M 9H 1uEEEEEEU@}WQ  R 2fuft trfu#tPMy MIыURU܃! M0u Uzu@G GGBPWxG8GsBW]O ME9KOft DAfEtD$D$ E܉D$L$4$贒VEE@#E UJU ыU M׃}׃}uYM0ɉMuFBEFEEF0E4[^_]ED$$E6E@ D$$‹EPpt EME A AEuth}OAMOEG8D$ED$D$ E D$T$E$艎E4[^_]Ë}GMOEG8D$ED$D$ E D$T$E$&!E ]M؉EEPD$D$ |$T$E$xE@R$ USEP M TH}[]UWVSPyE E}9UNFt%O L$D$$]XF$FA4$]E9t-F uFtUt NuM u6E9u1[^_]D$L$ D$FD$<$] tUSUE @@ @HKYXBP[]fffffffUWVS 6D }ED$E @D$E$}t7ƅt|$$t [^_]A84$}28UWVSDûC uE 1‹E1[t$D$ D$D$<$#=5DžDžDžDžD$D$$ {<$ƃtI<$D$D$4$T|tntD$4$蹲tSD$D$$zE+uqD[^_]ÍvW$^8D$D$$;z4$|8q?-wfUWVStA ]u EE1EEExGtD$D$$G %}(Et)]uU+t[^_]ËV]ċK9 E.D$D$$]&Gf_ @EQ)‹Eċ@F 9AfMGED$t$<$]vMefLJO fMEG(V]ċK9EM9r\L$MEĉD$<$]xEEEEȉEEċ@EME؉EċF9‹Ms]L$Mt$<$]Qx8EEEEȉEFEMEċ@Eu9‹MG},D$GD$$]cGfEEA!LJD$L$$]qẺD$t$<$]E‰EeEJfMM }.EEFE]C EYf]QfU)Ӄ9f9UsCҋE)҉T$DAD$DQM$]yMAfEAfEFEUfQEf+EfAUfDQȉMMMċQP]XP FD$D$$U]yMċAD$D$UV$xG(Mtu 9Gt1D$L$$]}  1Q$Au9uLJEf  _EED$ L$Mt$<$]M91t$L$$]GYED$ED$ED$EĉD$ t$L$<$]1'vD$L$$]EuFD$D$<$]BAf}LJfLJjӋE9MGED$t$<$]qMO fMt fMfO Mf&Gf;EfGLJt]]pffffUWVS0!F; }E@(tEEEtG 7AuQ O)Ήt$D$ЉU$vUfWE\GGMQft3ʍTOU‰EMMf9sf9uEMDHWуf+Uft"ҍ PPf9sf9uOfOE@(u 10[^_]èuE?9xuP9Us݃}fGыu9NV;UF(  }EfEED$D$D$D$ D$ED$E$mPD MD$E$+stۋMfA MD$E$stMA6E EuuKGfGG}EfEEEH(}EfEut$E D$E$nG9E49Eu녉}EfEEE D$D$D$D$ D$ED$E$lE}fEED$E D$E$=nGGV1҉T$D$E$ƅ5EfEED$E D$E$mE@(EMA(1D$t$$EuFEfF7}EfEt$E D$E$hm6EH(D$D$E$&ƅtE@fEED$E D$E$mtD1ɉL$t$E$/EH(81҉T$t$E$E@(EUWVS Pu6 }u FuIFu 1 [^_]D$D$$NtYVPD$D$$舔D$D$$t!VPD$D$$P|{UWVS,5 ljU,E싗E9BD$BUD$$蒑ƅUtZBPUTFEDuIFfur>t$<$ut$<$谁g,[^_]ÉU܉M D$<$nMUuD$t$$F뻉ME EF )‰T$ȉL$Mȉ$oMfMfNEDFfENMMAftHЍDVEEufMډUUuf9sfMf9uuMڋUԋEDPEFƒ)ft;MAȉuu}}Hf9sf9uu}VfVD$t$$8E8tRED$<$1t#fFfFF 묋ED$<$ ZD$D$$ȑ1=UWVS0!F3 uExGtD$D$$臑G t>tU0[^_]G(tި0[^_]EEEED$E D$<$9ƅEMu@E@  Nf9sit$E D$<$zhu@FD$ ED$E D$<$tD$ED$$}NE@AfFfzfMfUt$E D$<$gJFD$ ED$E D$<$TvFHfu9fFE@4UtEfNpD$GD$$K…<@fGD$ T$UD$<$ƋUBuQD$T$$8fU 10[^_]ÅuD$T$$MUE@fUMD$ED$$譎MUf9D$T$$膎GEԍUUT$D$<$60O9fEW,Uʉ׋9AE؅mD$L$M$E9}Mu25D$L$M$ߍE9}MGD$GD$$M>GNjEA9Etf}ދ98}fxXDy|8f@D$L$$&D$|$$越1mЃ}uf}D$L$$ތD$E؉D$$k\~rD$ED$$蘌D$ED$$z]D$t$$[D$GD$$… v}]D$D$$}t&bD$L$$褋ED$EԉD$4$4'0G,EJ9NMUD$t$$JU싺1M9(/D$T$U<$E9}U8EGD$GD$$肈…sG>ft׉EfMދ?9}fyHUމMDFDED$t$$aD$ED$$ƅ@PMfPMsfUމ1D$t$U$1҉T$ED$U$聇ƅURjщEΉU*;fffff1̀ffff ̀rS[+ 0[US* D$D$ D$ED$E$t E[]øUWVS~ã* EpM dE 1l֋U1҅tUuMxIEGu@p:^)‰ЉhRp9\rD$/$[t)s1lU+Ĭ[^_]Ã"`\%$>O`9;π?Xt։D$ h)ЉD$T$`\$d`p9r9>/u`tD$p$5/|%=@`tOVp:uыp)~"?MMXdD$E  D$p$a8PXh9<Ƌ\"`)@u08p9hD$`$.uFEt)D$p$4JtD$p$4.8m`\ffUWVS4Y' Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xf[fUVS ÷& 4$fD$$D$F $3 [^]UWVS Ns& }$K$K#1$KD$$D$<$X3t$<$2 [^_]US% $Xe[]US,% EEVEEED$D$ED$ ED$D$E$t}u E,[]ø,[]US,Q% $d[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EU܉EEE̋UUUUĉM؋EEȋMMЉ}MUE te kE2-byEnd 3Eexpau֋Uĉ|]11 É]1uM1EMEu1]1 M1ΉMˉ]1uԋM1]1 Ήu1U1ىu؋uU1M1 }11Ήu11 Ɖu1UډU1ЉUE]؍E11 4u11E1]؋Eԍ8M1щM1 :]1؉]1ωE̋E}NjU1]1 1Ӊ]1m}uuUċ|UexpaUnd 3SUԁ2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C9x@f;ErfGf;EE̋MAEHEUJ}}?]fC]f9]u]fCẼ@[^_]fEEMf9C1뿋M }Of+EfG1fE.&{UWVSlÑ ƉUMED$4$S]ǍED$4$:]ÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS }lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]JMUBfFF F D$t$$]m1[^_]Ã}Qʋ]C ^)fFfF] H@ L$J UL$ $]IUBeD$B D$$]jtH D$D$$l&KUWVS,(M Ɖ׉M܍ED$4$[,UUԉf@UfPWPM؉EH}O M}O }G} f9ED$$/EUE؉EB}GBfBEfBG EB ED$E D$E$M}S‹utftE9UE$E܋u0E]UЃ,[^_]ÉUԋED$$aEUME؉EA}GAfAEfAG EA D$T$$hUPD$D$$ju UuEԉFEf@f]܉3u‰Ѓ,[^_]D$ED$$jj1E$1}kfcUWVS Ƭ uE]u BEfAȉE{S ts׋}GEfAfA~V tj׉CfAA A D$L$E$]{i1 [^_]ftC|{M 9uMfftF|~]9u]oUWVSpy E̋}u]E fEڋE M܃8M\$EډED$EE$U …B)fBMfDJ MQVP]XP AD$D$$Uԋ]1EFD$D$uEF$EuE܉EԋE 8 G,E9EEEEEEEBD$BUD$$]xeEЅUBfEfEڋN C<FE EËUBR)9UЋE:D$ED$E$MUЉrEЉE EF  Q])fQEfTAʉM\$ED$$UЋ]CUЉBE܉EЋMEEEIE 8u4 ML$MЉ $M Su[D$EԉD$$]TfD$t$$>f9UuEЉE'E܉EЋEED$EԉD$$]eD$t$$euEЉED$EԉD$$]eD$t$$eG$p[^_]ËV]XVT$T$$]8B u EAf+EfAUfDQЍ\ UUċPURUЃPUċMD$Eă D$$]AM܉MЋE@MD$@ D$$]HbM|MH D$D$$]wdMEEED$L$$]JduEЉED$EԉD$$]%dD$t$$d1p[^_]ÃB]ڋU܉UfTYʋE@%EԋBAf+EfAfDYVP]f9s/)D$]ЍDSD$DS$]/@]KEfHEF #]ډ]U܉UfDYȉE]CCҍ\S1҉Muu9uMu]EԋCAf+EfA]fDYȉEFFҍ\V1҉M9uM]CFEċB Et{MAurMЋIMu f};]KLً] MUMčQ UML$M $ЉE M9s HˉELEE8E$MЋU c$RUPURPE{]C%D؉E6UB%TEMa u>4$MԋU 1~1E^t$Mԉ $M 1qt&(q.&vqfffffUWVS  ƉUMED$T$4$RNjE  EED$T$$`EGfEf}MA U9tD$ML$$_MAD$D$$[]…@UfG|$ED$4$A7U9;GfEf}VE붋Hf9OtWuV1 [^_]ËPUD$D$$_UuV [^_]ËE}?98tD$D$$^Eu0ufp1뒋E}?98t.D$T$$B\tfGID$ED$$r^UWVS0 }EpFtD$D$$6^F w8t<Jut(F(G Z#Gv՝Ѓ0[^_]F(ǀF,}`H8J@ TPTU䋖:fJD$D$$H]D$ED$$ZuGF,TP\@ P| fBD$D$$\D$|$$RZuME}}8FtM$F FMF(~fNF(D$D$ED$D$ E D$ED$4$1!@EFЃ0[^_]ËE @EEE$U D…ME)tPEEVE$ƒMtEVUfVD$D$$k[D$FD$$Xk V(Nf\VxD$D$$ZtRD$|$$sXHEfM}}D$D$$ZU1뾉ED$ED$$[ZUyV(ENfM}}EfE1ɍ}}V(uNPf9Fǀ<xD$D$$YDD$|$$eW1EfEN,MMOD$D$$zYD$GD$$WzOf9}uD$D$$+Y8:fJTH|D$D$$XD$|$$}VH@ tEfMN,MUOD$D$$XD$GD$$VOPf9ukM9u:fJTH|D$D$$ XD$|$$U1Ʌ 8@ t%UVS?d uFt$%F FF(U VUfVF([^]UWVS, }G,EԉGED$t$$T…G@fEEfEU܉GfEfft?fE<Ufy ED$E D$ $M.MUt(fuU܉B EftcU܉}B ueE苇20fHEDBtD$T$$UVB E1뭉ȃ,[^_]ËEMȃ,[^_]É  u$f}t3Af9EuAM]EEfG M뛋BtƉMD$D$$ZSEM]@fEED$E D$<$>-EMD$ L$M$YUEUGW E9uԋMu7?D$L$M$UE9uԋMEFD$FD$$RFfEftfm10ufpEpЉ&D$D$$REfEED$E D$<$,EMD$L$M$)TEUGW E9uԋMuUKFƋEA9ECD$L$M$SE9uԋMFD$FD$$5QuэGE  uKBfEeED$$LSMfE7ED$$-S>fE31mЃ}tYDqt0f@D$L$$RD$t$$iP1uD$L$$Rfu10ufp[u‹Uutqt1D$L$$CRD$t$$OJ@fE苇0fPUBuD$L$$Qfff̀rS[T 0[ÌrS[4 0[Ḉ̀rS[ 0[̀rS[ 0[ḹ̀rS[ 0[薿 UWVSEU Mwv9tt*<9t!Xr8t)[^_]1[^_]ÐUWSUtmg jBgBrn(8w68)|>)1ɃtfTȪLB@t@L>))t 19r\$4$)ߺ81tfff녪gf uhuW6ЃE1U U9rU6DfFf\7Ef렉ȪUWVSӉMp x$?tn@)։u|(9uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$G W$@9ue?Mt)ʍx(5tftM1H X$[^_]Ã}?$x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S+B,hB0kAB4كB8y!~B<[zP1uUuFu-u%BHBLB@BD[_]êftэt&f볪UWVSUr \uFPEVẺUЋFV EԉU؋FVEUFVTXF V$N(^,M]N0^4x|N8^<`d^PP#}܃L}쉽HEĉUH]ux|]ċuȉ]u]u]ĉuȋ]ԋu؉]u]̋uЉ]ԉu؉ẺUЋE HE @GEU$T$\ Ɖ׋PSE EċUȉEUMċ]ȉEU11ډEUMċ]ȉEU11ڋ]3{Mыx|!ω}M!Ήuu}]!ىMu!MM]3M3]`dEUű}Љ11ڋM̋]Љ11ډ`dEԋU3E3UM̋]Љ!Ɖp!։tEԋU؉ƋM]!Ήh!ډlpt3h3l`dTXu}M]PE}܋M]TXx|`d9LE܉UEPpp)|>Q1tft:7~Qo1uDuQ1s^tft\$4$;ߺp1uwuh"t䪃ުn.f0uGu8rуM1ɉUU9rUif둪ofUWVS ÉT$ʋp@xD)L$|P9L$t$KD$-D$/|$41s@{Ds@{DsCHSLTT$T$T$CPD$$T$D$,CPD$B|$D$؃D$T$ |$ָL$F&tftT$D$D$$is@{Ds@{D9T$rCHSLꀋD$9wT$ ovjBL$D$1T$L$L$$C@SDC@SD9ƉыL$rCHSL逋D$9uT$t<Ѝ{Pt$tft1C@SDC@SDsCHSLe[^_]frЋt$ru^zfD$u[u@L$D$tCP{QBffl$L$L$BKUMt U E]UWVS訩 } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E"]UWVS, } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUUʋE ]fffffffUVSOt EDžDž<|<sL'z DE5N@(=' ==D$D$D$D$ D$t$$%D$D$D$ 0D$T$4$tp0[^]=t*=uy늸۸ [^]ÍHúSu,t돃DuD$p3$?o&w̸ XNDd :0&iDžDžDž D$D$D$ 0D$D$$蕠 D$D$ 04$T$z1vpDžDžDžD$D$D$ 0D$D$$yPD$D$D$ 0D$T$4$p0[^]ødj낺FsGdD$D$D$D$ D$t$$"`&C0D$$0D$$ah ~ m ^O@E3D$+*)(&%DžDžRDžDžm G6D$D$D$D$ D$t$5$^ /D$D$D$D$ D$t$&$ D$D$D$D$ D$t$ $D$D$D$D$ D$t$$qBBp DžDž DžD$D$D$ 0D$D$$/t0p ><S,BD$D$D$D$ D$t$e$`1D$D$D$D$ D$t$M$up3@@fED$D$EЉD$ D$D$)$赕u}u tTE E E Dt DUWVS 賙 <$4 Dt V6u֐k$Et+辐<t V6u<$ E [^_]蔐4t V6uD$<${ E [^_]US$ . , t$[]EEED$D$ED$ , D$D$E$Kt, $[]UWVS苘ð E U}0@DFƅtIFEM 9GJUD$F D$ $UBUtRFE VJE}9OT$T T$$:F]CE1[^_]ËM!@`B~ :MtEuVMQlj9~ MQT$L$ MQT$lj|$E$u;E]넍GD$|$ BD$F D$E$UME!@~ `UD$ $萊tljGUL$$otMVJ}OUWVS袖 uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9rt% 9t 8t)؃[^_]ËE)[^_]UWVS]E xS9sHы0t/}U x9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS 1Z E}E pE0EEE90EuNEU9sщL$MFD$E$]0D$t$$K&M)Mt2MVD$T$$]#ƅu [^_]1 [^_]ÉUt$E$]Et͋]E0U=UWVS(9^ E }}8}xEEE3UHD$D$E$}%U)MMuE؉D$E$ƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$$1([^_]ø([^_]UWVS< }E pD$D$$("tW@ u^JM"D$ED$$!t&M)΋PUD$<$U9ur1[^_]ø[^_]D$D$$$ѐ̀rS[Ä 0[̀rS[d 0[US #H EU D$T$D$ED$ED$ ED$E D$E$a []fffffS[ 0[.&f̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVS% tMƋuA~8t:F4@9s3`V8F4@9r$讇F8[^_]ÉUWVS舐 E}}u1ENjE1txF8t1ɋ}E+wȁĘ[^_]ËF4E@E$]~F88]E F4F0E|U1E} OxD$`|D$}|$ F8D$L$$]2UF8)UV4V0];D$ D$`T$ $~4V81}׍ @rPu B8~8BX]9uEl~t$]…F8]R9Ëtt]`8 t5UF8M]_8F8$Z_8F8M$]|F8tgD$`|T$|$ D$xD$E$覉uUN8]n_t?]U_{]UWVS<謍 EE M1‹E1%;E = l9ƅDƅdD$$ BƅC8DžD > BD$4$)D$ |$t$$Ƅ=D]D$D$$`IƉ׉t]g 8X9;-D$BD$d$ D$D$$  {tD$D$$Ct I\"U+ <[^_]Á}l@ Džh1Dždd <$xD$`D$D$ t$D$$s~ 9WǸ։;D$ D$`T$ $9_Q((1ɋx9zz11ɋ)Y99vЋu@8RщT9PuQ(9P(\n$tD$D$$@tYR etD$dD$ $s@tUt=6tftt\1Džp8H41`9t9F@FD$$Pu9;dt9FD$FD$$F D$ t$D$> tD$t$ $>9eu d3D$BD$d$5D$D$$@p8/tD$D$$=tVBDž.D$BD$d4$g89:y``9_${}d$?J4$T{9U8 t릃O4H4W0P0W8׉P8|tP ILP`9uM$I|tD$DD$$<tT?I‹uB8`9r勅9s$4`9u닅$y'$wHgtStD$D$ $:D$G$`_pNj@8@P1f^$]GFU$=G=D$G,tLtD$D$ $9+_t΋$FUWVS蠀ų L<$!E D$ ED$ED$E$MU EƉ<$[^_]US Ch EU BJ  D$T$$ []UVS  utEىM)E}|$t$lj$UED$}|$4$UE<ML$|$E$UwED$\$<$UED$\$E$UpED$|$E$UU؋M܉]ZGu]E؋}7ED$ED$ ED$1uD$E)ȉ$LMED$ED$ ED$E1uD$E$}MƋE]XQu]E)ًU)+U9sʅWE)Ӌ0wPu3U܋>xNuML$\$<$UXML$\$}<$U<5ML$ED$4$U ut$ED$<$UuUT$ML$E$UUT$ED$E$UxIEEYU܉u 0sHuuML$ED$E$UxEEED$|$E$UNu7};Uuu UT$ OD$ ED$E D$E$]fffUVS 2uW EU M9Mr/9r 4 9r$9fu49rL$T$$ [^]fffffUWVS$t lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$BM1 ЋMu`EUD$ T$L$FD$$i;u<tVT$VT$$$Ѐf1$[^_]EUWVSs Ƌ; rEu =[t6CuudKStqPCS t[P ؃[^_]ËD$$ fÅt@C؃[^_]Éډiu1V룃T UWVSs@ u xD$4$1E%=D$($meDžts@@@9uE ED$D$ EЋUԉ$T$UEČ[^_]C1Č[^_]UEU U U$]UVS%r> ]ts tWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D &D$ D$%D$4${U D$E D$E$]UWVS.qS E HMxPpt)rP@t3B E$g1[^_]ÃMt P@u͋MAUWVS,pߣ }u ;VЃEljE@uyts;puXY LADTPPX Z O@H PWEuH@,[^_]ÉKE苏M1҉E܉UL$D$ $T$1 ЋME܋UD$ T$ED$AMD$$9‹Mt+AMT$D$$&MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA,[^_]É\ LoD i=@1o$@1~BEH M?O1WUE PMt ʈP1]UVS@ne ut PtH J H $eu4$e1[^]UWVSm uu #[tCtډu[^_]Ë$?[^_]fVSD$ L$t 8trtl@͉ .&vލ1΁ €t8u.t(8u!t8ut 8uHu1[^UVS m- U Et7Mt.ZYutD$D$ $$E [^]UWVS lΟ } uw vtօu 1 [^_]ËEEUUU܍EEED$E$HED$E$Ku#ED$E$CE܃ [^_]ËE+E1u=TEfH @jUWVS$k E܋E XE@ S]KE] :}Z]ru}_]ϋUfBfBKMʋE9s‰EЋutftE])XEUEUE @E)Ћ] Ct8E@ MY ]ϋUlu>}~}uC1$[^_]É؁vD$|$$х~~)ËM IM)‹E PtEH,Pu>^E$]GnE@ 9E\$ED$E@$EP,…EfH @HE1E‹]9sڋE@][}9Os9~‰ÉϋutftU]$]GUq)UU)UE @E)Ћ] CE[UJЃtUMEED$D$ }<$]k)EE9xsNMʋE9sBȋutftUE}8$]w)}UEHE9m1)yD$ED$E@$EP,…K)EMu9EPp)׋E 86p9rD$$][]+SSUSCslj;C ЉϋutftE)P)UKUE$]m1ɋU-Q]؋usStft]E)C=EE\D1.fvBvBAf9vEBf:X9f1vE3f+]]7]J7 UWVS }G tPwtI)7tI1Gu-)t'\$t$G$W,fO @ [^_]ËGDu1 [^_]ËG봋WU [^_]UWVS-eR utLD$4$F t$4$ED$4$$[^_]c6 @&4$+g$"Plj4$[^_]ffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSc uc1t\F t4VtCF uuIFF1[^_]FF؉Ft^u$VfF u4$볐1붋V0 t~@9t $ZZV0F FV멸{ffUVScD uFft]|T$$+xGE%1= ‹MUtJM VL=u,k9F(u!Ą[^]ËEE Ą[^]ËE UWVS|ubÚ uǠ1E1F t)fF FCFFE+|[^_]ÍED$ED$4$EF u9vtlEE$qP*1¸$UWVSK`p Ɖ׋@0$F0PEB9EED$$F0Pt$T$8$F0PuD$E$]V0UU쉂PF0ǀTu Xt$[^_]ǀX\D$$F0NjF0TXtXU,_U M91u]1҉]UWVS_' u918u [^_]ËF0$hF0PV09t'Pt($6[^_]ÃT1݉UUPV0ǂT1UVS]^ u91u[^]ËF0$F0Tt$[^]ǀP8$F0U] MU 91u]É]sUVS] u91u[^]ËF0$(F0U t XtTt/$[^]D$\$F0ǀP8$"F0UVS8]D Ơ1E1EȉD$E$KU+u 8[^])fffffff̀rS[ 0[US \ȏ E D$D$t,@E$t []UWVS4o\Ô D$$΋ED$ E D$ED$ED$O׋U6Et F"-D$-ED$ t$|$D$$$mD$(_-8Q-L$EuKD$$9t:D$(T$ 9ЉT$9D$D$8tEVtEWL$ 9L$(L$ET$(9T$L$tD$(4[^_],UOED$$D$(1D$(4[^_]ÍD$0E|$,E"D$ D$(t$D$(4[^_]ÅtD$D$(t$먋E"UWVSZǻ EU uM] $\$M] &}}$}M] $\$M] e[^_]UWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]lfffffUWVSY }D$<$`t(tt$<$#[^_]1[^_]UWVS rY× uD$4$tfUtf|$4${t>UT$D$E $;Es1 [^_]*"y*l*UE U9r 9]ø]UU E9r 9]ø]UWVSXõ 0 0 u0 1E1ɍt-ωD$4$u t 0 PEu׉MD$D$4$ MtMljMuD$|$E$ 0 8Ftt$E$. 4$NuME8 9t$$Nǃ8 ǃ4 [^_]É4 TD$D$$[^_]UWVSJWo u} t%eD$4$tt=t1[^_]À=t[^_]UWVSV ED$<$tƉD$<$* 4$M[^_]UWVSVʉ }G$Eƅtx @D$$[^_]USYV~ ED$$mtU 9P []1[]UWVS V: U1E8s7i1}ƉUE D$ED$<$u E <=,EV FfV fuUT$U T$$C[^]ø"8u V F본UVSQ> uFftAȋED$ E UD$T$ $!уN tFPVTfN [^]ù뻀fN [^]USPɃ E@fu$蕽[]UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu#B[^_]ÃHPtJ ȃB[^_]UWVSӉ΋t B SuUtBu{QtBunQu Q9tW[u믉 St2tAu(t@uAt@uSI[^_]ËtBuBB[^_]uUEU P@@ ]UWVSEpVUu 3t)+~E D$|$F $EЅu׉[^_]1[^_]UWVSExOtX1҉UM~]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSExOtX1҉UMy]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSEpEFM ]M19MƃU;\tkCEZE [^_]UE [^_]L돋 u{Etu>E닉Lt9ur 눋}bM υtIMyED1uLC yvyEE)뵸6̀rS[$| 0[USH| ED$E UD$T$ D$E$f[]ËL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffUWVS0MHv{ ƉE̋]E Ơ1U1xu2  t8u)؋U+0[^_]Í}1 r}̍)]ȉT=Ѓu]t; t\="t]y$]E k1d]̍襯UVSu] U؅tHNtuxu)؃[^]UWVSHG-z |$4D$ T$L$@utȃ"=D$ uƉFD$8ML$$\$4 u܉t$DL$8D$-+|D$0|$@0D$8 D$<D$@ \$0ۈL$D$8T$r UM B=w B[]Í*[] U>q UB=w&B]Í*]USw>Üq UM B=w B[]Í*[]UF>[q UB=w&B]Í*]WUS="q UM B=w B[]Í|*[]U=p UB=w&B%]Ít*]US=æp UM B=w B%[]Íh*[]UN=cp UB=w&B ]Í`*]_US=*p UM B=w B []ÍT*[]U<o UB=w&B@]ÍL*]US<ðo UM B=w B@[]Í@*[]UZ<oo UB=w&B%]Í8*]iUS<4o UM B=w B%[]Í,*[]%U;n UB=w&B%]Í *]US;ön UM B=w B%[]Í*[]U^;sn UB=w&B]Í *]rUS;=n UM B=w B[]Í*[]3U:m UB=w &B]Í)]US:m UM B=w B[]Í)[]UE ]UE ]ffff̀rS[dm 0[D$t8t9@€tuuuuH+D$US9l ED$ ED$E D$E$[]UVS<9l uE EEEEEEN>wN#@ t$ED$EȉD$4$+xE<[^]EӸ<[^] UVS<8"l uE EEEEEEN>w@ D̍ED$EȉD$4$x E<[^]ø<[^] USj8Ïk UT$$![]UWVS,<8ak 1EԉE1ELIBCE_ALLEOWCTEYPEAEBUSEfE=18t=u tD$t$$ u߸MԋU+u ,[^_]1US7j D$E $t []ËU$ []ø̀ffff7̀rS[dj 0[>̀rS[Dj 0[US7(j D$D$ ED$E D$E$[]ffffffSD$L$ T$.&&@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8tt& )[Í1[ffffffVS\$ t$tCFtU8tOu9vCV9u !€t.&CFt8t)[^fffUE1]øUE tUt1ɀ81U ]11U ]ùUU ]UE t&Ut1Ҁ8‹E1]úE1]1ҋE1]UE1]UWVSU ]E8tOt(G1Ht*t-Gu߉E8E1[^_]Ät1ݻ뮉E1[^_]UWVSU MuEEtxtAE1}EXt?:tWEt uԋutE}8E 01[^_]Ät)Etփ뢾u1ЋuE뼋u1UU Et$Mt!tȉ U1]1U]UU E=wMt1]ËEU]UWVSU ]Etttw1=w%tQzt.t&=vۋEUU2[^_]1ɅtE1U2[^_]Åt1뷻1UWVSU }uEt^tgtc1tt+9t#t=vٹUU [^_]1ۅtE1U [^_]þ1Ʌu1UE Utw1U ]11U ]ùUU ]UE =vU1]UE@E@1]1UEt2Ut/u }wE UM 1]øU]1E ]UEt7Mt"U tЋM 1҄‹E1]úE1]1ҋE1]UU E=wMt#Mt1]ËEU]ËE]UE1]UEu E1]ø-]UEUt(U JU1҅‹E 1]úE 1]UEt7Mt#U tЋM M1]ËE1]ËE1]UE =vU1]UWVSU }]tbtC1ɋ=w#tArt)t"=vݹUU [^_]11U [^_]Åt1ǻUWVSE ]tEt)uV1Jt%8tuE1[^_]Ätǻffff.&&$D$4̀D$̀fffffffT̀rS[a 0[PS[ýa [USu.Úa 91u P1[]&[]f̀rS[da 0[US#.Ha $1[]UVS-!a l t t [^]É4$}fupU1fUVSÉ1   lLLLL9r[^]UWVSTE8}x}x}@ EM]Br 2 r 9u֋EE}M1ˋu!1Eȉ1!1E1!1 u1!1 ]ĉ1!1Mȉω1!1֍ >Ủ׉1ډ!1ƍ> }lj1!1ލ> ]ԉ߉1Ӊ!1΍>M؉ω1!1֍ >U܉׉1ډ!1ƍ> }lj1!1ލ> ]1!1M1!1U1!1 E1!1 }7yZ !Љ! učyZ !É! uԍyZ !ى!  u䍴yZ !ʉ!  uyZ !Љ! uȍyZ !É! u؍yZ !ى!  u荴yZ !ʉ!  uyZ !Љ! u̍yZ !É! u܍yZ !ى!  u썴yZ !ʉ!  uyZ !Љ! uЍyZ !É! uyZ !ى!  uyZ !ʉ!  un11uԍn11 učn11 u䍴n11un11}܍n11 }̍n11 M썔n11U2n11U؍n11 ]ȍn11 }荄n11}7n11un11 uЍn11 un11}lj}uO}FEЉF T[^_]UE@@#Eg@@ܺ@ vT2]UWVSEP?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPEE);UEމE} ]7Ey@9rE)uu U<u sCtft[^_]äftu^uE[uOuW] ]u\3]|fu SfUWVS '7Z EE} Ơ1E1WEE$G?7w}8)‰T$2D$<$D$ED$<$EX1u4u:tftE+u& [^_]úx)끪Wtf耎fffUWVS&FY uN^~2S C1ЈC01 2 Ƀ9u߉u)1^]^D2VVҋM]2ӈ]9u҃t[^_]UWSUBBB Bz10u7u=˃1҉9ruu[_]ê[_]ft/tfUWVSE1 tftu؉ tO;Us]E )])9sˋu|}M щ؉΃ru.u<똉U4$MU;Ur[^_]CtfUVS :$[W u] +D$LD$$D$CD$$SSVSVC F ] [^]D1ø11#V ة1øUWVSH#ýV ` ts胸}1f1҉9r׃uFh E̋d Eb fE؋l EЋE D$D$(Ẻ$UH[^_]f불U U 1EEEu AfEEt%uыqEuۉt Eĉl }t Efb }d }t Eh t3b 9s#M>u +N 9rth Cƃ` =@AEĿ0AEE!d td xUWVS!T \$(ED$XE }|$8}|$,à1\$$1҅ \$X؉D$DD$D$$D$(H5D$D$8<%t2XD$$\$X|$D9s CD$XD$8D$8<%u΋D$8P@D$71D$Tt$\HZw|$(3D$ \$0T$8D$`1D$HD$LD$\|$`D$T7D$\t$\T$09}L$$L$TL$<2L$D9L$Xs'L$Xq0T$D9 L$ Nt$X|$<T$L~-|$L|$DT$HL$X9s0r|$LL$Xt \$DT$X9s  sT$XD$TpT$0D$\)B[L$DT$X9s sT$X;1ۍHЋt$\ABHЃ vwD$ \$0T$8D$TcD$TuD$T|$,؃|$,mك۸D$7-t$\L$Tt$\L$TD$ \$0T$8D$,X\$<8 t$\t$D$<$\$()9؉D$L҉T$HCt$$覊T$ 9~D$dD$<$$$D$ D$5D$&$ff -$u\=$-D$ _D$5D$&$SD$$j<$rdHf+f)fffv҉T$t$$aDžT$t$$5xDDu<$/Y?&XD$ D$D$k$HDž@<g@8MDž&XT$ D$"D$7$T$ 9~ȉD$dD$<$!+&XD$ D$D$V$mMDž]WSq@dW0G$gD$ R)+t .0G]$D$ *GG<$Dž@(@t$D $GJ<$Rtvl8e0@1<$uD$ *D$5D$&$蛳Z<$f6D$ 뿋D$D$&BX$Vff̀rS[d% 0[UEU UP]UEU MHUP]UWVMu}u }E E=ɚ;~ -ʚ;1yA^_]UVSUEu M ]+M]9|) ZB[^])ʚ; ZB[^]UEU +EU uE+Ex]ø]É]UVS 1V$ uED$$6uEEFEF [^]D$E$Ex(E EUVN [^]FF [^]UVS ï# uED$$菡uEEFEF [^]D$E$lDx(E EUVN [^]FF [^]USMEE UQY[]UVSMuMb)E UQY[^]ffUWVSL~ã" }E E1‹E{0W`D$$D$ D$D$D$ED$ED$ D$D$<$ ƅIu G$@ED$D$ t$D$<$XƅZWу @ 1 $aED$ ED$D$$#ED$D$ D$t$<$ ƅ~QG D$D$D$D$D$ T$t$<$sƅGD$<$E+RL[^_]ËD$<$‹Pu@fffuGtwp fHfHff$,t$ɉL$ T$D$7$贪PtGtftPD$<$$$sD$<$D$<$D$<$.TUWVS, }U MEƠ1E1GED$ED$ L$T$7$訩L$T$ D$D$$ =E D$D$ED$ ED$T$<$fU+,[^_]Åx$蚰=wttH|.uT$L$ D$D$$oUD$T$7$萨qD$<$9tRUWVS(= E E1‹EE@ I<$&9T$$E&D$ D$D$4$ DA@tD$4$[uDJ@utSFNu tDJ@tEpt$|$<${7$:$(1U+u ([^_]PUWVSLgÌ }u E1E1费D$<$11Ҁ.փu9rMd9G GDGDDžDž\x.uED$D$ED$ED$ D$D$<$zU+L[^_]DžD$ D$D$<$dt9^G#GDGD}1DžED$D$ED$ED$ D$D$<$+GGDGD1DžDžDžDž.UT$T$UT$ML$ D$D$<$tN8=^G1҃‹Otth uAED$D$ED$ED$ D$D$<$RtD$<$ ED$D$ED$ED$ D$D$<$PG tD$<$6 낀xbV1@<t 1ut$t$ut$ ut$D$<$moGDGDDž0ED$D$ED$ED$ D$D$<$)Dž;D$<$ eDžDžDžKfffUWVSl!F u} FM(}, E(@@4$ fF@fM(fV  ЋM(qfuf fAMEtXl[^_]ËE$fEE$UT$D$ ED$&D$8$`},~q EEML$D$ E,D$t$E$mƉt$E$ EEFD$ $ E(f@UE(E,) }|$}|$ D$t$E$VƉt$$ D FD$E$2 FD$$2 FD$$ E(f@  +E(l[^_]ËE P E, 9pE(@ D$E$E(D$E$E(D$$E(D$E $E t*E(PE ׋us-tftu ։+E(}(fGl[^_]uu#}(GE(xE fUWVS  U }E@4E)Ѓ FD$$)FD$E=b$VfFE@ uH1T$$mF D$$ZG fffG F ) [^_]ø뗨u믍$qU >U$XU͸UWVS M uU E@}ω}EE‰EPE)9UB9E9}}|$4${GD$u4$iW׋u$sBu3u,u֋ED$+E$1+E[^_]äftˍvu4uC먉U$FUM MAyEfffffffUWVS( ljUM܋EGlE8u䍃E0E썃HE< t< tD$ED$4$pD$ED$4$QD$ ED$4$2/D$eD$4$Gb$u< tt < u>:([^_]ÍF$.~d ʈdGtD$#$y닍F$~GjD$9$DSD$ kD$4$)tD$ D$4$ uEO F $e~GGD$R$ÙD$̨D$4$訤tjD$xD$4$芤uXO@E܉D$ED$X8$ZOWL$T$48$;yO >D$D$4$t*D$ D$4$ugOD$mD$4$u O@D$xD$4$薣u OD$D$4$luZUmwD$4$訑ƒ?v?T$U؉t$E$lEUƄD$D$4$uZEwD$4$0ƒ?v?T$U؉t$E($SlEUƄ(D$ D$4$| D$D$4$Wu OWD$D$4$-5g)UVST $@XtA|xEEE%EEEEX5D$D$D$ D$ED$t$]stT[^]UVS"G Et4D$E$-,EEFEF7AfF [^]Íp UWVSx  1EEtbUD$E$+Ef3EfF}<$D$t$<$|$4$ FUM+ ux[^_]Íp ?UWVS*O }x$ DLJft/1t$CDŽ9Ӄ[^_]UWVS u4$`t&tuOxu:<$vdžt$Zdžf[^_]É$OC뼋|E?9Eut$,CU6 Et]Í]U Et(]Í]UWVSu] }4$sfdž1҅~1u{t뀃9uuV [^_]ËMt31sqsqs q M31sqsqs q 뀃9tuUWVS 1 uD1 E1D$4$F u uD@@$D4$^4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$ WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$$yw`D$D$4$,fƇ_WHwDG` \Dž01'< t/t 201Ƀt&9n< [< uuDž(9D$$ 8Dž4DžHT,8D$ D$D$H$j<;t<#tH8domaH8searH8nameH8sortH8optigxionsZ< t< G؄D+<< ~< ufxinM< t< L( t t Dw`D$D$4$cƇ_D$4$QtDž0ft DF 4DdLʃ Јd8$fD$D$ $=x8$,D$x$isDt6hlp Dx`0DpHH`HD@H@`t_<.ǃu~DD$. $aDFH.D$.$aDqPALD@$Nutǰ‹DgDH U+![^_]Áxservfxer< t< 9< t< tD$4$%< X11rDž\DžTD$5D$ D$ D$<$iPD$ ,D$|$4$萣PB=kDt/RωփtftPB@D<ЉT$L@$]Lt׋$ˆL,D$ $L)&D$M7D$4$:5 D$.4$8]D$D`$ȟDǀtǀxDž0Dž(|8$D@Dt$D~DD$4${u덃$w< tt< uDž0<4,LTDD|$@$ \<NFVe9xDw@ut;u㈕$<,t$$<$t]TDLD 44 $4,LTDDDLD<ȅy_%=tdwL$,D$ $DL{;$1!$tDž0pvLusL@DDu|uc'0D$D$s1ɉfLu LVfqUD$E$#]UWVSX.S }u hl3 3 t;D$<$t  F FX[^_]Ë 9puttl|E/9EttIX5D$D$ED$ D$D$t$oaBt  F F1X[^_]UWVSU E@ E~tE~mEX1&<1|1t_Bꀃ9E~E9Et=}ù{u֋ KJKJK J uv uꀃ9EE[^_]Ë OJOJO J uv uf̀rS[t 0[UWVSd.S 9D$$d(@$NiDžDžDžDžDžx@ N L$T$ VT$D$$ZT$${@ 9@ωփsUtfth@ lj)#Pb덋ptŋ t|$$zu똋P04$و@9‹(tft‰)@0DžuY tftlj)@4#tF4$@9r1‹rf$y@ $_1d[^_]U[‹);Wh@ 3ffk$fx0P@~~ <9V) 9kVʉ)ȉQ1ҋ;tftH<@ lj)9ts9h΃rE@ $,w4$R@9q‹ytft‰)‰DžHtftR<lj)944$t@9‹yUffR 3PD$umuTk@ $諴f+ f넋$t@ iUVS3X 1t$觕[^]Í9D$$`~[^]UVS 1t$[t[^]U豼 U]UVS蘼ý ut$[^]Í9D$$}[^]UVSLq ut$s[^]UEPM¸t]ËE@ ]UWVS }E0upq @A9D$$}ƅu!yH L$UT$@$tEG D$GD$ GD$D$4$۸u4$rG [^_]É4$r[^_]ËG [^_]UWVS 0 E18 &:)lj}싓 u2E D$ $ [^_]Íbt$E$qt$ $qt{ t1= ;txED$D$quًED$D$ED$ D$8D$$R [^_]Í8D$ED$ D$8D$$ [^_]ËED$+UWVS 袹 ''w} )ƉT$U$tn  UT$ $ҬtG  D 1 [^_]ÿ'y qUWVS(ո LJ LJ LJ  11ҍL=EE5 )Ћ  ڍAw l5D>ЉD>]T>ӉT>=MHL>@CD> C k <;E֋ xzt =w ;5Et =w ;5 tH~k LJ yM !؉ MeM썇G$  MLJ  M싗 1ɍ5]MEUtwM<9ErMtu艷 Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>=L;<;D> rU7UsD>HL>PD>HL> H<7Ë ; e8H P H HLJ < MULJ D> UMD>ЉD>]T>=L;]ف958LJ 롋 LJ LJ D>ЉD>]T>=oMU&E1E䍇 $<UM8D$1ۀ} ËE)؉D$ D$8D$$PUMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@pUM^D>E싟 ]X] É %LJ 8 f gUUxz Mt ; r tX8 H P H H< Ћ]!LJ  D$.fffffffUWVS0-V EЋ u䋸 }9E,Buԍ@>u썰L?u؍,Au̍AEE]]EfL?M܍AuE苈 UȉUE}uufUE7 >Eǀ  u ǀ E苈 E苐 U苂 t> t1P}艗 P  5R}苗 D$ $ 돋 uЋ Eԋu؋  À8 u }胇9u}U & E苐 &X U苂 }]苃 D$ D$ D$ $R=  >E苀 P[^_]ø]苃 $$E{o…MtO1E&} &E7LEDXtE7<$].oƒ9r̉E1R1KU} MԈ }ԋ EU}ԉ+ E Ћ U }Uċ:O, OŰU苂 U9E2\9ËU)Ӊ]W(EUȉ XND]荃KD$$h!_E艘 G,+UU]ȋU̍<Q9uUċ:,^MO uquF_ u؉G D$ $]&Gt/U艂 Uċ:MO u#O)ȉƋ_uGE荀91uȉMȁ vE W18 M苹 MċKщˋMD9UUċ]苃 $\UuUȋ]苃 $ iUE苸 } M< ЋAE̅+}苇 $  <EU‰ŰY9Q MỦ @D@Eȉ EăU2ŰEȋUЉEu艆 EȋU}̋UUu艾 fEЋ }ԋUM‰T$Uȉ$]MAYۋUBA ,Eǀ GEU<A,E苀 E]vC]苃 $Wg]mv8B_v $}苇 D$ EȉD$D$ UP$@c tU苚 <AEE苐 U }< Mč[^] 6 %  ڟ ɟ U赟 U]U蝟 U ]U腟 U ]p U\ U ]UWVSJg u"$ uމ4$LJ LJLJ LJ LJ LJ LJ LJ LJ 1[^_]US蔞ù E$[]USqÖ E D$E$[]USGl E$4[]øUSC D$ED$D$ D$:D$$/[]UVSʝ uD$4$?ff D$4$?[^]fffUVS 肝ç EpFtD$D$$.F!u  [^]nUWVS> uM.D$ ED$E D$E$ŋTe>EDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$AuDžH V€ʀ UTPzmD$ D$D$T$RыU !ȃP{vmm0<$舂T$l01[^_]À Vll0<$0  PxD$T$1>P^E E DžTED$D$ D$D$$sDžt HƁ Zkk0Ek0 x1G<.GL/G 0&G E[G0$G /GD$D$L$$)PLPP LЃHtfD$PD$L$)+H  D$ $PP D$돉Lj8PLen  PD$T$~MP@ ƒ@ u(bb'fffUWVS葘ö }EpFtD$D$$)F B  D$4$u_  t$ur  T$U4$Džu=U9B0E  i[^_]1UD$D$4$ot̀N(UV$ED$E D$ T$L$M4$ !@MukF[^_]ËX[^_]F(V$tߋ9F(F$PD$D$$;([^_]UWVS虖Ƕ EpFtD$D$$'FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$e !@MuFЃ[^_]úЃ[^_]ÉED$D$$ 'UЃ[^_]ÉfUWVS$_Ä }9EUEEEE;E MmG$Ku݋M…tUL$D$<$LUUD$ ED$}|$4$/u7}UcE;E sQ $[^_]Ɉ뤸$[^_]ÉT$$t㉇1UWVS(D uE䋆EMM܉;E E苷EHMU$IƃUtY9Euȋ})lj}苊U|$$!U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$5.u@EE9E 1([^_]D$ ED$ED$4$-l([^_]UWVS(葒 EU9}] E苊;M 9EE܋E9t<)t29ut&M\$U\$$]LIMUD$ E܉D$L$M$U]-M9M Ut%E9s.E9hw1([^_]Á ([^_]É\$<$DžUt([^_]UWVS("K EE] ;M sf]]9suE19r 9t[:u)ÈU]D$ E܉D$L$ME$]+uEFM9M Uu]1([^_]É)맋E ([^_]ø([^_]UWVSFk M EEEtA<1D1?QM )։t$D$$YM fyE\AA}?zft-}|y‰Ef9sf9uE}DxQ׃T)ft"ҍ]uU|$ $|tUx?UWVS EE,E}1EED$ED$$]ƅ@ wXf]1 9M rTVÃf9EuUMUfY]][]]}tH}t8M[DF,D$t$$]E.D$DFD$Nj]NYE}E9}twu})D$D$$]9utAFD$FD$$]tVTP‹}u뙋u]X}8[^_]ËEpE )}fG w[^_]fUWVS ƉU׃ VU)D$ED$M$GMf FE@)D$ED$M$UҋMf f>\?)fDfL[^_]UWVSFk E xfEEETf}tU)ƋUJ;MLW)ȉD$T$ΉMщ $7E9EU|6DU+UU\WPHftffP9uEftWf4T]TfTEfEh8E H1[^_]ËUƉE봋uv %E D$E$P[^_]UWVS$$ E}EW u}EGft;f~su f ljEfGfEnMfyvE̍DTQ9>ED$E$E@EM $M̋UEHfEEf;EЃ<fD M)‰UύU)ȉEEċỦT$MȉL$E$L9E U/MfyvE̍DTQ9ED$E$E!@EM $M̋U+EHfEEf;/]tED$E$f1E$M̋UȋEE$M̋UȋEf9MsFfED$E D$}G D$|$ ED$ED$E$ uOEEtE@EEEt5@EEEIpEE@ =]c]cx[^_]|Af+EfTM)fLFMfLFD$ ED$ljD$E$[EtpE@ =tGNjUt(ED$E$f}EEEfEEEEMt봋EEfEE1UWVS$r; Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$hED$$FdEu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$,Z…t EME$EPEwD$ |$UDBD$4$Y tʋ@f8 $dž  BUWVS(mp EE} w8}PUEEE@E|FBU M9sωU DF)fEȉ|$UT$M؉$]V)}}C}ffE‹M9sfUM9L>f+MT$U܋ED$M$]UU)UMfL>fD>}f)|FfLFE pH|FU҉׋]9s߉]9TF)ʉU|$ED$M$]}CUfFfۍD\M)f fTN)}uefDE H14rJ|F E9PfD>([^_]ËU9ZC8fDE D$E$]E tpHTFUWVSmܠ EE @u E1Oft{DXND$ t$D$E$]Vƅt|$E$Ff]PMuJfwfuf|Xu E녋U R1M AMf E@ =fEɍ\)fDJMfLBE Ht$E$]t9t|$E$Eh81[^_]DXfBfBFi[^_]fEqUWVSGll U EzMq uf+4GMM9U t$ED$DM$\u)uD$ U T$MDD$E$T…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$ƫUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS k6 Eu} 'D$ D$DJD$4$]StDPfzuft,ˍ< fD$ t$MDD$<$R aLJ(@f8u$LJ 1;D$ t$DHD$<$dR…@ fEB@fE1fEE$MAE9F ED$EFD$$3M1U)fUN fMD$ t$MDD$<$Q…ZM_LJ $LJ(149UWVS(;h` E։Mz@ =uW)ЉEN MMȉEGfEt$^ED$$gZUE D$ED$ D$t$$E9F ED$GFD$}E$E([^_]D$ t$DGD$E$PP…t#M L$M $MEEvEz8UVSu]ED$E$1ɋU Ct1[^]øUWVS(f EuD$E$1ɉE--D$ED$E$]>EED$E$} fG fE @}E;EEHp@ˍQU40fUt0UfHUff]f\ftPE ]M HwOfw]E;EE t81([^_]ËE jx}D$ |$D$E$]oN] C$NfMЍLLXffFfLF|$E$]DžtMfNKf̀rS[ 0[UWVSTd֗ E؋}u1EĉËE1;FEE 9b}}TD$E D$<$]A@fEҋ9E E҉EBFEȃEYf]YfU])Ӄ9f9UsAҋ])҉T$DYD$DYMԉ$]MAfEAfEԋFEUЃfQEf+EfA]fDYȉMԋMȉ]XVT$T$$] D$MԉL$$1uċU+T[^_]D$E D$<$]M@fE҃}t>}ED$E D$<$] @fEfEEE܉D$t$<$]1EEEE܉EFEEuẺD$ED$ED$t$ D$L$<$]茊D$E D$<$]tK@fE҉ED$L$Mԉ<$]iM1D$L$$],s]UWVS(|aá }EpFtD$D$$FG!9t~rd94D$D$ $jG)‰T$T$$2E䋆E} v&F2([^_]ËUE} wڋMBE 8t9  u|$4$tH9s`!EEUU,D$ UT$D$4$VOH9r!<ED$ ED$GD$4$u@}} u~$ D$E D$ |$D$4$"([^_]F(~$E 8EE 89뤋$UME\UUT$L$$NH(T$ $RGE$U]]US^î ]}]ufffffe`[T$Hfffffff50+&!fff] ]UVS] EEEEjuVj < uǃ< 1tj%jj#jVjj$j%UWVSEE] }3t>u4j/VZYtp`t0MPV'ZYMu}] EEAe[^_]VhhUhp&q4UWVS]u 6=_hVS" tfu91&ۋ=&)u4=&u hZt& &hj5&}& @u5&hjhoXu4'hjMUW6&ZYMtUBk @u6h/jPVKSWHPUWVS] 32hjVhSu @t h&DP @ě&Zuě&T1ț&ԛ&@5ԛ&@jjPnț& y 5ě&&B&B=0%v&u hjm&u#&&)&@&@&%H%hPR& yT&P&%H%hP5&ң& & y5&hj`&A`&1A&u-x&u&HA&uj`&D&&9ӡ&&sZA&táx&EA`&t&&`&d&Л& ̛&tH& &ttI&%h=`u; & x&|&&x&%&RP5&&P &t h jh@&0hjGhūj;1=Ě&=Ț&=̚&&h 0%P0%T5&t'& &&&;&&ss && u15&5&5ț&ԛ&P$ u15&5&\ě& rPPhۖ DY[&u5j5&5&5ț&ԛ&P  t5ě&h蘖XZ&&&&&&&K&]&]&] &&9Uu/9Eu*&&ڣ&&&&6esEUӣ&& &&& &&t1&&h&l&j*?1=&=&XsE&&EUMt(&,&EU&uRRA &&&&=٢u<=u==u,=&t=h& x&9ȋl&|&s")1=d&x&|&h&l&l& h&t j0>[Z&5& tH x&1=`&x&|&h&l& `& d&)։&5& u&=&ujPY@u&8th#5&&PZ@u hjj UWVSX ] 3~hjPj軷hSu\ G-$l<&1,&&8&4&1,&&@0&z&,&1=&Y(&J15,&&3$&$ &1ɉ ,&&&&&& &=&th~=91tu hj1nuou&j,PYZFt@jVE&^Zu hW8pj,WZYt x>1>8Phhp&j 0&&=4&t t9h/Buu/ (&t'hY&=(&th&&jWl&ZYu hy;O<&=$&t11X=&uمtՋ=&jWY[^t' 9=<&tЃ=$&t ]tljlLti ȉ=&\t 1Z01C PYjZP0P蔑t 1B"&~h u)VC_Zu hjt15&DRPrZYyKƅu(3%=`uJƅu3i& PV+XY_=&i = &t9PV(YZt=&Vh$}=$&t%" r=&ughf3h$ QJu =&u7hfV3h/$ G=&=&u3hkXZ=8&t4011Dž8hhNP &58&8i& 192t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t =4&u1&4&&=8&t508?";&si ?C1e[^_]USEEE EE0[1҃vU|r҉&UEhRPz tvpt.Et?SuF&Ƀstxu0S̟&볡91x&&&۶Ph@hp& jDE&EE)ЉEEt9E8-u/&EH~&)EEEHEje1ۉ$ZuYh]jdXZjjYY[hjKXZh& lYt1hp&h#菗XZh'Yh$j [X?M&Et^E8tTE0xYtEEj0\YZyj?Z,E8!tYEh0h& @Et9hp&h$YXE8tjZuhC-Xx*x&tPh$ Y[h&X_y"=ȟ&th`&h9hp& uY=&=&hp&h$>ZYh1裋1ۉ$BZ&f%̐&1&냋؟&| thhXf%̐&^1&_hx(yx&PRRd tt 1j1ɉ &hp&h$~[Xh11$d=ȟ&ujpjqZuh`&5|&hHhp&{ h`&h9hp&b hp&h$ Y[jZn=ȟ&ujJh`&5|&hHhp& UWVSXu} 7{rheCYZu fu91hWV= utt &)Nv8E8}WgZE1 tAB9EsEUPQMW UuMt6QWhjփ빅u WhAE@t1j URP>E ;F|E8tEph.jsE1~PS虈YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmW菍 UWEffEERhm+fEEERhmWL 1!EPhm8@W0 x E6Sh"jf9tfuPh@EPsh]KU9裙K Uy蒙 Duuuuuh}$uuuuuhuh uhXZQURPWV x%uSh[ ,URPW1 yShjPhjjUWVShu E1E1ۃ}~F8-tEh_th'PZYu &h+_th'PsZYu h5IXjh'h+EP5uhQd0E_t<1ɉMMMMMMJha91PuZYhljBEhWE)P$E @}w}c}6to)}4E뷋Ed$(}8tEKwn뎡91Ehh591EXZj91E]EQEE&&}uC&Eu蝗&4>tj@u)Y[t8P}t Uxu)NjMMU9rxtEE xt}t1ۋtPE Z\tS1XIEt'U)RPSS Ã~t C}u"hhhEZYu h"}uEEuh&WuuEpEPu9 yj=&y h}tLjuVjhSy hZXjVjh5&y h3Xhh7juVjpSjVjw5&,u1ɉM̉MЉMԉM_1xH>v m DGu΍EPEPj =&t}t.D1}tEmjEP4xz Gu踧Ey h'j Vh~f5&FVh~fS:SMUE藕}u j u蘭XZjUE 0j轫jhUVSEU J &uc1E1ۋ4Vh0uU# &H &Y^yh&j UXZ&P& Cu 1e[^]ÍL$qUWVSQxq1&&&& &&&&&&DžDžDž1|hVI @I&/0$S'$1%%%s%d&jP591 :uy591h%& &&&&&&144hC u &w&l&91j/SY_Džu ;C3@;tGt@:t%t@tj/$[ZÅt8@tYt@t3tu@tij/ZYDžt+{tQt.@tUt/{t@t)tG|hO&Ph&h&h&h591}u91<t h*j=&u&fPh &Ph$&hG591~!91<u &$&9shQ뉅 &91j/S=Y_t6PS{_Zu#91%=@u %91, &&%%91&}591[%[=~ PZPhnj&)ѡ&=&t & &  & &tW^=&t t$h4t= &t=&uh=&t=%uh I&u %iDžtDžxjjVjjtS5@t,(YtjjVPjS5@t=%%=&u/RPy_Zu%=u && & &1  &t1=&%=&uRjhh&PR-%y' 8uh&h_tFh&hd[^h1hXh&jdh&6hۋuw1ۉ& &u %4=&=&%u Ã=&uMhzYtpjhXZؙjjjjjщڸh@tt Sh^_1&@u &&  & &1=&&Džt~ Džh*0&Y=tk jhjjjщ¸-ƒti¶ f&j&DPXZh\/Fjhk& 11"&tJ?tEWhU.&&1ҋΉT 9u9u @u&1;=& &؀tet\PhU; &1Ӌ Ɖ\ 9u9uGtDžDž19~JCWSh)މD 9u9uG뮋y1RPjjjʉٸ TƉV^f=&?&tu ù19rGD8&G&`&11ۀt,&t#u;u u@ $ut&u돋5&&19}{.tK;tFȉ0C219u9t&A뢡 & & & &=&uYh/,^= &t/& ,&t h,[hwYtM&s &i2&]~ h_Z &D~ hFX2j 񋅀Ɖ1ƃu hϡ&11;&ÍPPZYx+=w;)uv8&=4&50&jStP 1eY[^_]aUWVS}] 1ɉ1Dž1h@SW rfq1stwU1҉j P591e91 8t :tPh&8"[N591h jDž-Dž&)Ot1jhP6P2Ãy2 h&hedAP y hG=*&9 @f*&1ɋN1Xu uXhQ4jh&h&{94  tȸuPhu|ZYDžf(&h&4f(&h&-k~PSyhju"PhwdS h(XSˏ1e[^_]US] 3#LSu :US] 3 LSu#M 08=&j/WӰZYu]Whd#hj#hh&AxPh&^@u"5&hd#h hh& &&=&hj5& à (tPyphh5&à x29=&~hPS薈G jjjS!y 0-P5&h"oj5&葉YXy 0P5&h"foxPW\YZy 0P5&h"3o%= t^=t5&hp#oXZhPYXu1RVy=&u0@&PDP5&W5&@u5&hj迢 u00h#QnXZ@,t*uLq5%&1&hRZYtRh00h#mt5% &@t[5%@t&1& &,t-hPl&ZYt4#tș;s <u9ʋ<Dž<@rL@< uA9ʺs19ʹs h#j.h$XDž< 8u^%= t5&hO$\ZY1801RV|4щ‰o8X<5&5&5&$ 45&5&85&5&5%PVS?Ã@(trSUWVS1~}9Dž ~1}}}~~~11hE p55~Ph+r "~ڋ ~ ~P~< ~ ~~8iDRP@Shp8H$hd`\XTSh8H 119t T@ܸt.PVSh8=|&~yhgX1 =TRPh8G u"j Xt-hgg_ 9rj uYSh8FXZh9~Ph&r@ ~ ~5u  5;[u jjSXG1ɉHwvtj9uPhY=6BW$Zp- HWP!_Xu-FFDžBUt Y@Cu担)s &hF>WV P5vR$&j P591TE& :t591h{=h=Y591) 'Zu591h=&Q&B9121ۉ%%&tRPh=j&1ɉ %&h 591&[Z591h=j؈j P591?D% :t591h >jtth#>A&^&O&@&&u h^>j=&ufj^_=&th&h> LY[hdjjhgbPgW=&th&h>KXZj&jk^_=&th&h>KY[hdjjhgbh>}"j+XZ=&t0=&th&h?QK^_hɷjjhgb:jh> Y[.h>z9h>jjh>Ajj.XZhVs+VOG th?RPVOu u &=%tWKZhRPWDNt(hWsWF uj X=&tjUWVS] }SC2'S2'jhh2'jP6'@u@m8u$jhh2'j52']6'@u52'hjT2'2'h2'hQ@56'肴 %y@%2't1MPRUdZY UMu܃ SEPQjY@%uRPh[ej蝃pUWVSXu] 3&Ӹ_tjPhjb91t8'hSVF Dtb$<'<'<'<'<'<'<'{<'l<']<'N<'?&9o=<'t<' <'u <'=<'t=<'thn=<'t,=<'t#=<'tȩPhn4EP:h߁S u$1ۉ<'<'EU<'<'ڀ;+u[CK&DJPk<<'<'EU<'<'Y}Qȋ=&DOt Bu/<:0RUZUBBBBhvEP~1Sn  $D0k SDЍ~=Pd80k SDkd-lGS0k KT ЉGW0k SDωG0k SDЉG 0k SDЉG0k SDЉGW蝫<'<'_u ul+EU<'<'y hjFh*PxY[u~tO8't5P#Z)ǃv%8't CRU6SgUӃ f @8'h&<')PS t!;t ~<'sC~<'uf~<' h8'裾[<'<' <'th<'*Ph hYg<'u(PtZt<'jjjE =<'u6^uh jtPh,kjÎj jhb ,;<'<'| XZjpjO^_=|'uh*5#&׸Y[uZz1~jhj謡5|'Ztj萡LB'PB'Bu@t$~'TB'6Tu΃=X~'t$1H~ 1X~'=~'u 0 B'=~'~jh觗%j 貓 j耓!jUWVS]u 6o蚃L'H'vT'蜩P'WhP跷 u4'VSv[^~jZY1uh;j9~!vu0p'hbVSʊ u%/~k |Љ=8'vhOXZš&)Kutm&DPu^SӲ_=vhhnhSh'聥 ;tCP''58'hj ]S蜩h%jh%jh%jڲh%jβ S^u hgjr@uhvjh&ha u '&D'hc[=,'t"5\'&`Yt5\'&hjmrt Phj=,'u5\'&"Zu€='t8jj5d'aX y h*Pj5d'?X xh'j̎ '' '%,'% '%$'f@'' f>'8'hx'Thp'Jhh'@hjG.=4't"Ph QX'^_C6f=\(&t j4[E8'&utEڃ=4'u*t{8,(&u1f=(&(&< t< uG< t< uMjEP5d' f=)&{} uqPS_8'&unEE5'&PZYf=(&tCۡ&t &fEjEP5d' f=)&uEPXh)jpUWVS E 0'W1'4'hKY[t tDh&!ZtT*MBug918tpjRPz :uS1ҋ 'buV'' 'hQu uà uC$`. 591h>'ė'먃 '륃 '뜃 '듺X91낃 'v91u#h[h/ h0W 'hjS ^_À;1hnShZYƿ / t&VRS( u <2t&hVyS(^_SPhq` ' G'O3u8=eRh 8=tRh Y[\3hVyS踞^ZƋtt ug(SYSOZho_4jPSi‹ 3 9r(<,tuxG 'QRhSV7h^u591uhh. hKh諭1k$'t!VP2ZYu''yGh(Vh+j軝91 'I=&u)' u~='u,P'Y@u hcj7ls''Z!Ãt~ / t%Ft!á'0Rh{+  s'0h XZ s'0h_Xt Sh޹[^j uh tth.諹jxE uC'3hRǃ u R3h"xPhP tlj=''t [1 ȗ'hPWVP' uR5'hdjjh'P%ZY@u5'h't&h'P_u_'05'hj)j'='t8'8th'PY'u$߃8u5'hji='uhh/ h0hjsfO4' u shh8'PA_Z@u sh!@'%=tE'Bt,=@t shB\54'O4'Y shm7C0''5'h'_Ztpp 0h裠 'uB@'%=@uu0'uRPhV 't Ph?Y[''th'P Z8th'P_#Nu@u h j/hh'P^"hu Rh5('%=u5'N[@u5'hS@L5'mNY@u 5'hr4'tPLNZ@u50'hjgj٘UWVS}u 1ۃ~^;-t&11ɉ<8Dž4h!VWB~ it1҉4)&t+:t!;B uBu91B뵃Pr5σitot8DuFDž<늅u 91{ShBh- cDž8Tu dx1jSVrCtjjjPIǃuhVhiPÖ @u h9jdfWLY)&7tvFtjNt^HuTItBQ4 Z.0Q!Xɋ0u hHje 돃넃8t 4tC<t j輖UWVS$u] 3lhj hSVC| Btb$$1 jj591 L'\'l'P'h'd'`'s\'dX'UP'T'@tM&DXt^"@t1?t ؃@@tfHxF @t!5D'hH'ff [X$&@c&t V聒Yf%̐&?h&ZZ%H'e[^_]UWVS] 3hj 1ptd`l11jh,&hFSu#pR,LtzH1벃Ptxe~3HuNhDždgXt(dDž`J91p: &hL9-uEQ9u=yu7hJ&(DžlDžt&E)tHuEpu+lttu7uHt-lt)tt hWjM_-t'tu -  ,puDJhRpX1\phuTRh8 ,hxPpZY@huphj^E\1jWQ0h 1pu-hw Pwh"軬Džph4XGHHf wT$x1 luAjWh9 .w %Pwh"RDžp tt\tGPpVdZY`t OP9A_PwZYOdBwhZY$r8t hj]p菎UWVS]u 6<hj1҉'''' hVSs >vBeR0G.f"$1 H $1 a'''G'1''a'1' '?'1'1'"''1''1='''''&)Ӄ5'='t*th' ' 'tbh jk[t3='||='t=||)='||| Dž|4+j'jj'PjCx<hSh-&=v ShO<h-&Y-&-&X/tK-&-&1hj]XZ='t.Ph-&.,x/uP-&@-&= -&wPh-&Y_@u78Uxt)o%=@xtbK='u='t' 't P6 P6_Z@u6hjY%=@t /t 1ɉt4h-&hajvY' 'tDžt Džtt$P蝘ZPvЀ8/uj|Vw+x 1lpupCpQh-&b^Zh-&CHfuFs Psh"pDžlpx/Xu$wfushwЦY[ftf tt)-&C,--&=~TSh-&h艦 o{DsC(huTttCpj/V1sYZpt)xphM>PLYZphp>h)8/t z/t/Bс-&vPh-&hե VPRp<p-& -&= -&vx/uP-&@ߋp='xt Ph-& Ph-&7^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh-&hCP@% =@B%=@t,M1@ush-&h1Jp΁@tpw `~||t {DPSZY/sH ' 'u&fNush1Y^jSxC1*f5'V''lhQh$2 h6tCPph-&u?^X='h-&shV E%=@t %fuL='u%'H''yhyh2 h?jR6ZYhd莕shZY='t'PR='tPR PSA|W8t hjhTx)liUWVS|]u >j/WVoYZtxh/W肗_Zu^hVSj @ui&)Ãu]p0a7hߋ^Xt!DžtpSZY_yɾߋuڋtV茀UWVS}] 39hj hSWf tUit)ft5huP(σvu?(1((15((뗡&)ǃ.4jj(h# jh =(tuϋV 0PFTtP2lpY[uNj|%=@luh2lQDà =lv2hjMltx/tlƄ/CGh>WZD>8/u 9tH@j/WhZYtPRdY dvWhٛXZ"@PRlA5. t Džphfpc~UWVS@] 3Z)p&Su]Sj(4uEUEUSj]^_Sj4ZYuEUEUSj\^_Sj3ZYuEUEUSj\_XSj3Y^uEUEUSj\XZhI lZ)Z)1=Z)=Z)=Z)Z)P]1E؍}ȹE? uVSj舎xVSjx x"}ujVj_ y}tVSjD xjVj1 y}tVSj xjVj y{}tVSj xjVj؍ yP}tEVSj 蹍 y1jVj覍 yVSj蔍 xy y hQ 0j0 ^=5&tUjhgb05&[^y Еhq 0jZ) #=5&u=x5&t )Q@hjG,jYt8uVʼnZÅt @|/tCPOZ)_uh jZ)ZYtlj؍PZ)/hȭ(h`: jމ5& t! ttBGuB>Z@*S9=Э(t h jI;X=5&u5&YNQt Z)Z)e[^_]UWVS]u 6phj 1hVSE` tLtPt9&thSh_8/u|hP~Y^ukh S~_ZuZPSY^@tHxPhgb_Z@t2|9u;xuM9 u;EtjjӨY^uj SAh&\XZ$&@t h)jtHjyUWVS}] 31hj跼 1hPSW_ ft]/WPtwR)d[)벃vtbit6rtxu{[)[)1[)p1[)[)Z[)K[)<[)-&9=[)+zu8QuthZXt[)؋Ht ʉA?jb[)[[) [)u t1=[)t =[)t@jPWVǃ uhzC =[)t.u)W[XCHHf $8 PDs ӽPsh"jE=[)tC ?ƒuts 蒽Psh"迓[)k=[)^KPSCDHjSW C 1ɉK +C  Cu>S=[)tCHSftYwifu`KPCusUZ=[)u&sh[)Y[R+z8XC=[)usZuH1tm=[)t<8V.8?H 8r5[) [)$1[)sX8t hjCW;[hxVS|ZYu8=[)tCjѻPSh"[)_u=[)EE%=@uB=[)uSh譑[)Y[묃=[)t'E%=u,Sk*B=[)u=tىډuh=@uS(T=[)u SWZtX=t1=[)uSh^衍8 蓍8?腍8u=[)S6X5[)s1e[^_]UVS@jj^X1EĉEȉEEjEPj& 2Q;QTw¸9u Q9Eb)j j(Y[b)H b)jb)$jaV7&1ۉ]$hc)3^Z\)tt3Hu:\).&$=j)tzj:WEYZt@0j.WTYZlt!hj)W_Z@lu B/>t0<#uN/j)hj)W賍ZY@u ۉ/8xPWpZY@u WhjA9=j)tEj)Ej)jSVR ǃ 1uh>pu jSWz WQX CHHf wg$T s аPsh"Džl`-=s 覰Psh"ӆttDžl, Džl`-j)ht)KPt;Quj)t;Au A<5j)RslЃ t"`ushEY[ds荶Z贂8t hj7VhUWVSu {f)()G{ ) ʈ)$) |) ʈ) )z)%j)f))hV[t1/hKAVYV t7GtPSWzYZu .Shy@Wh@j61h@VuM A6$T L)%j)<) H)D)8)=91hWyYZuh@WyYZ;-=91..j j591~ǃ u軀8"u 591h@D=$)j j591~ǃ t =()u8"u591h@j5j j591w~ǃ u@8"t=j)591h@뺸Y5915Z@u^PA4)I )=1 )4@)(0) 9tt20؉ j)v jhAuh$A )tt hXAjP4j))ǃ;= )u/;$)u");()u)9rt1= 8&D)H)  8&&=4)tZDP U)4uE=<)t=8)?8)4=8)tt  1Ljhh)PQ6PLy h)t=H)uJLxPPOZYLu&%=uD)H)w($|U J<)P7JPChjG R^uhjAPh)hShS߳ǃuShY[hEP-`XZthWh)h`)VT5j)h`)VY VbX1\`dDžXhVXPjW ]Džy0|8#tjVj5h'j_jVj @Pi@PCAh`Pƃum@SVh(TP谯Tu hajjPhhQhQh/ÃuVYSxTPZ9ujVjbTH h݁VokLY_uVhXZ`)e׋H󫋅L+6LPaXtPoBDžu V褱[ehwAgh&NDĐ&HĐ&ZYyh&ObX&P&0 t+@t( Đ&y h&b_&P&Ѓ߃NP^ JP@=)u ) =)u ) Ph`)NY[J}L),)Pl@=,)X=@)t `)+,h)h`)h&Q5j)h`)h& Vh`)-Zxdh݁vi[_uvhj(c41JPhmdP`? hK@jR.m^~W /Yu Wh>P`)eȺx)t jSRF: h`)-ZIP?W^UWVSjj]Sjjh^ 财@u hLj-unYtjjSPjh^ 聢@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQMQhdU1G맅u) &yh&j jXZ&P& 1e[^_]UWVS ƅ]-ƅ_1ۉ) ))15)))1=)))1hlMu uLC ycPtJTtgxPl$ ^  )뫃 )q ) e )Y )M591)Ye591>Vj:V7[Zuh6MSH)t)XV3 oZYXu C[Ӊ)=)t h~jI+91tuh1Ҁnuxou8&hVyP&q^_t)U֋=91u )i91)UOkh^ PhLMhp&ej[^])U)t))t )&M Tu)tP1ۉXhn h`m 5)R]XRrRhRLqmZYTLSZjjLRPV4U9X}XTPT0VhPcgà uj/SDZYuShd#h hS_V6Xu"VXu9Sv^ty2LhVfà LVhjuhLRUlZYhLLR:lZYSh}MjjhVjS~ǃu VhMj(h )hzd@PX uWXБ)`PhedAWX @uVhMWVhgH__9~VhM( z2OBt4FT)뾃P*$`` )럋591hVJjYZu,)yh@V*j^Z,)UD)j 91wbW)PhX^ D)591hYViZYuh)hXViZYud)j Yc߯^ t)t)jhY;tS|)D)j 91m良(9&Y=v Ph;Yj%PhNY<]XZ=))+X) @)@))=91))x)E t==)t)=)u &U 4)u%觮EhY2sX1E1̃=|)t1@)jj|dZYHth& jkdYX=X)th& jTdXZhX jFd]Y[1ۃ}=T)uPPEXZ PEX}u6hY YXE tKEPjW6Py6hYdXZ6Eu/U Y9ËM}Qg ZU܉9}u9MXDH)t؍e[^_]UWVSu1ɉpE 0w)Ph&Pf uH~>NE X&e'XZ^)_)`)}u >&x;&1ƅhB&u u4ǃ zI`Ntu&At/CcG6$y WBh l_ͨ)̨)w˨)ka)@&Z`)Nʨ)@& 6ɨ)*_)Ȩ)Pjhjjj j591;Ĩ) 6Pjhjjj j591;) 591hm^)_ t9ƀ )xt!ƀ )l\m uƀ )Ct_L1>&%=&>&`;&@&ƅ>&@&@&=&=a)uu =Ȩ)Wjm0^G=_):=^)-=a)uu =Ȩ)tEjLY=a)t=Ȩ)=Ȩ)t Dž PPtVSE PE)P"薳Džuhy hPV" @u h6t*HkttWP'XZuhy h GSzS]YXuV&Z@u hy hSfYuhy hjZVZuhy h)j@ uh=hy h*WSй%1󫍅PhYS\Auh*Sq_XuzkhsS\ZYuhhy hqPƍH_v󤍅PhiS( @uhdYS7jJViZ ththty hihZVlƹ󥍅Phui S$(@uhhUjmZt h jh78 hШ)4hШ) UhC&h)h)hN h)hM h)h)% h)3XUh`D&h)h)hW h)hU h)h) h)XUh`F&h@)AhF&hH)2h@)`hH)Vhv] h`)+ hX hP) h`] hX)h`)RhP)-hX)YUVS8ujh)&[Zt\bjjoÃt hj,O'y hYhZy h/mXjhwTZYu[jj5*hAK* u=jhSY[ujh#hFPhhQj :jURP` @t-Et PhJXZjhwqSZYtj dXhaj SXj jh#芎 hJu V- t1ftsuG&h )PhwADYX95&t h+DZjj hw Bjjjj j jjjhw B0jjjjh6p Bjjhyp BEEEE jjjjjjjj j j jjjuVJ8jVj1EEEEEEjuVjyWjVjoW$jj~jwJEE EjjEPEPjEP։$@u _1ۃ8É)G&t*GI G&;IjF G&Ӊָe[^]UWVS]} DžhDžT1L11PXDžD hWS* u~fFt/RkDžPgS$ 591ZDYu591hXu918#t591c_Zu[ j dR@P d:u&hRP_NZYPu7uR\uQ\tً\w_G PRhP[Hƒ uPhjjjPXTK6hPHǃ tPh`6DZYjWYXT8t WhMj hWS;j/S$tXSHZPP1ɉrQ19rPR9rS)PCrjPÃh)hzd@S9 SX)=)NjjjjXTQǃLÅshV6LZYt"hV%LZYthLVLY^uPsZ^ZuC RPu3hVKZYu%CO\u shkVhPEƒ KCjjHVs XTyP Lj\P@^_1u?hji P\PYZYu \!WF9|1n\PhedAS7 @uS[ u hX P>GhWEYZut)XhWE_Zu 1ɉ t):h,hCh(Q=91hWeEYZu @)heWHEYZu @)WheDjj591: 591h{Phjhj91$|}))=91W"RZu&DPuWh@=W<_+=91=H)j:W ZYuj/W ZYth ?u hj D)&=LH&=)u=))p1󫍅l`)AuVE)Ћ)~DžMDž>=@)qh5r@`)jxlP5`)phG@uph"b)@th4K7 jr HM1󫍝`4󫋅 =)u )tJ) )PH[^@=)))s=)u;))}hR_ @uhGP1ZY@uhZ=)h0V<à uVh"j>Ph0PW ujhh@)jPSyh@)hp!Pn^_@tڋ%=`uh@)h1=)jjh@)- yh@)hjPY[uh@)hjh@)hd#? E)t#@)VRW@^ZtN xRjVhd#? u ƃrVW<@YZuSh@)hj=P)u@P)`PP5P)h@)菴@uh@)h 1=P)L)=)u) hYtc uh@)hhfSd?ZYu&D)uhfS@?^_t t Dž@)?=D)th_ h"S?Y[thh@)h Džt')RP5)5)))5)=)19|Y<@ t )SQRPI  5)=)19| ht5 ))9sSQRPh5jtd) )ˋ)%)RP) @u+5)5)hxj?'0Pm{_Z@uhA[^  ^L躱.8LtkXDX 뵃`uvhu[i`uPHxhfXfu(TPW<tj GPhj}tVS׶hmj}(DžuP _t8=+tj jhzFWh=+t j jh^FWhjG8j jhmF tVWhjFWh jF hhbh;Gjjhhbh;G }ujj jj jj jj jjx jj o jj胳@u hjjjhZY@uo8th(=j X}uj_j j)ZY@u08t+h>膅Y2 u hTtZ W賐XVSh{T 0 EjjIJƒ BuSPh jUWVSDu]  '+h$ SVz v~j cStITtbLu+뼃dw$ ++++z+k+\+M+>&)ƍ蓮+=+tjjhQW+ >Ejjj"k+jURh@hPp @u hƃY=+y hjm;u=+3 @ WZ) (    mt /  =+t1ɉڸM1ɉMhj6E؉Ehj6E܉Ehj6EȉEhj6EĉE hj6EEhjy6ljEhjh6EMU ʃ} ʃ} у} хuu hE1҉+8gtj5+t_X1ɉMEEFEȅ"CEċS:-0BRUZH3U$H +"0V&+0V&+0V&+0V& +uj+[+L+A91&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸduCEċSEP1ucCEċSEPM̸޾ECEu/CEċSEP1ɸ諾X+uCEċCUfEuKMċs t^P+hw$ ]1RX+F`+:h+ .p+@"x++ H+  + + +t# @+ D+@+D+t1+jjV1C R+u#EPM̉UrEXUUuEPM̉URe_^uChs ZY=+uhhhRg] +CHw)=+uhhhRg+ 1+SEP1ɸ軼X]ċu+Muh5u>au uh0"+Eġ+}tuȉuthNj@Mu}t }EEă=+uMEȉE10E18+1atctguIE+E+++@+++++@+ ++U9sHxt)Ј+t]E؊Hw uF:T80D019r)19r)1ELE؃9sIJ ++tMutHXSVh+螫 =+t =+t+fZ+tE}tHpVWSL =+t =+ts +tE}tHpVWS =+t =+t辱+tE}tHpVWS谪 =+t =+tp+tE}tHpVWSb =+t =+t"+ tE}tHpVWS =+t =+t԰+f+=+t!=+u=+t衱+1=+Sh+5+( u( 87t PhXZ9~kPhY[]p 83u =+tH[ 8t+ + + +PSV 11ɉډe[^_]sWɶe[^_]UWVS } 芣hPFZY…UhOWu Ut.at"t=4+914+뽺붡&])Åt>um4+t&heuS^_th(SZYCt/=4+u&4 +hujRKuEVh hp&]Vh*hp&Mj=D+u.D+h@Wu t@A3w$ z=D+uD+먃=D+uD+듃=D+uD+{=D+uD+c=D+zD+ G,+8@+)<+@+ =D+"D+@@+$+(+8+591V +X=D+D+=D+D+j=4+914+hPY[>0+/=D+FD+D+)&E)tH:Eu5=8+=,+t =(+=4+]=,+t =(+=4+txt4heuWYZ!h(WYZu/ heuWsYZ7h(W^YZ"hWI_Z,@JK EÀ5<+jj58+5@+5 +\t5<+jj58+5@+5 +3;E5 +Sj 0Shj +E  =0+mEjEPj? @u hVrEUuuhp"9[Jh`RP8ht S8YyE  1SQ%1RPhG1=0+t5vXh3SN_Zt#hS=ZYt苪ujVhVj VhGjUWVS u] 1hSVV tRtfu2h+ֿϡ&9td1ɉ`TlPVF[ZjxPP)rZY%=`=@uxhuxPh[^Dž`ddPhVB YZu,)~3ltXnuzh,!VW du,׃Vt1PσwB0^&뾃cu3,,h h9hp&j`h h9hp&Sh hp&~j5&9u,=,t 1躹x1Jppt8-u ƀxu t1L=,t 1^x1pp8u;J5^&ƍxPV}b_Zti=,tSuO&8uCVj ^&Dhl$Ylhuha]1thtt1oj5,/h& t h)j5d,UWVSP}1ɉMM1h)u W蛼 t3gt!utGu.91E91;u91E85&9t3S=Zt@E%UMM@uSh)j 1}1ɉM}t EUE1}t6hVyEPYZt"8tu h)jӤGDʋE 46BZ@u6hjӤhgb薎Y@ttEPWt_Z@uh)}tu*Y@u h)j荤tu^Z@uh8FtVRPvhjVh#XuQjh)SS菢Shj%UWVS$uE E1҉U0FYth`0#1ɉMMMMEPj[_@u hx0j̣jҋZth0511E؉Eh0uVi C3$Ա _Uq591t,뙺 %591H.PZYU915@ukYPS'}_&1}591E591-PPS/'Ã591-P%YZPCP&XZK,}uZ591]EX_&} EK],RFo&)ƋMԍ}uE}uEEt1Hvh08=,u9UЉEh0XEԋU =,tHvh1 $ jSRV6 jjRVs2UW,YUu#BUE@uh&1QYEC SZ,tCW&X'V YuVSV\%Í@P!C u:{ts s _Zt/hc17j} C^u=,t"P="=,tsS!YSzZh1N?2U &XtdCU܅t#tuh1?V:@0ًFttۃt֋@0UVYUu2h1XZN Vj1F3)s)6)v)CF C FC{uFCV^Xt\WI%YtPEqZUuR7Wh.h eSR#Í@PC uLWhA17{t'Ss s =,t6s#jCYu=,tPz ZK Sj1Cjyvs*GWCP"Suh2XE؉E ]e[^_]&YI Bщ؍e[^_]e[^_]1Nh2ht* "E܍e[^_]h#2j蝝e[^_]UWVS 1EwU1E111E1҉UhZu uZ UtZn`~3a w+$ ƒwt,=91볻1E1=EE눡&E؋EM)ȉEEt HtZD}~t*Ut#}~ t[ׄUt8[˅t&uZa&EE Eza&`t&uZr&EE:DEBs&6}t&uZ`&EEE7`& 1ɉMM1ۉUuSLjW輁ƃUy jW訁XZUy WhjtuC 1ɋ}9}uAVEY1E9C tUPURPRhZ[%=u uSSXZG벃}^E M؍}1}܋;j=WZYu h[j19s x+u@UU؍HM3NNjH XUt 3h[ujuW W  8u 3h[O VEЁg juWӢW W VEЁg E܃XM9M/~2U賞@ _ǃUt 2h[GA EM9MuVEYs uSXZGE9}"C t3h[jV艀1\V|1e[^_]ÍL$qUWVSQ@Y1ɉP.1󫺬.1,0<48h5pS@[ ,H01$ 0%0591f.1Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @f.F누0f.%1҉Lj LP591ƉPp 8u!918tL8u ;PhYnpj LP591S ~91:t L:t591htn4.z 0@nthnj 0jh& 1ɉ Dy& Hy&Ly&^_91< 0j LP591SPy&91 :t L9t Rhnj0@=Rhn914 0 0LP591 91_Z8tL:t Pv)ݝ ۥ݅ tjPhn!v591hoAٽFfF fD٭D߽ ٭F $Dy&Hy&߭ ٭D۝ ٭F Ly&xy591hn uh4oJLy&^ 0SthWoj LP5919Q8 x918tL8591hto&,%0 0 0 0 915&tDFu ho1B卅(R$R RRRRR RRRRRRRRPh|QƃH1Ʌ~ )10hY1X.@9u919~X.PhhGXZj 0t1DžtDžxDž|Dž:h0Vj591tPXPho0P0rJBL0RQ 0@Yj LP591NXy& x91:t L:t591ho=hho0% - 0k0%0% 0CLP591.XZL8u591h28LP591._XL8u591hp&@)Ht"0j.SY^u SGZ)؉@?wPSPC@Ƅ t@ &t &fBۍ1V@KjKPV+@SVVdP $TVh\pj Hd`hSVjSgsX0t=Xy& hnpCXt1DžtDžxDž|Dž:h0VjStP7Phjm0BtÉD.ru hpl0Jr rrsH0 y h<0@t"5L0hP0P t hp<1DžDžDž:PtPj<tPEP ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgfsckfsck_ffsgptifconfigmknodmount_cd9660mount_ffsmount_msdosmount_tmpfsnewfsmount_mfsnewfs_ext2fsswapctlgzipgzcatgunzipchrootcgdconfigwsconsctlping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %stotalcannot seek temp filecannot read temp fileinvalid addressline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark charactered.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicmbr_bootselmbr_extInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. Explicitly specify beg/end address?The bootselect code is not installed, do you want to install it now?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedasyncgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizefragment sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -An < LFS_MAXNUMSBnblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpare%d %d START disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered newNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCAN%8u %4u entire track defective%10u SCIOCDEBUGSCIOCRESETSCBUSIORESETvpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]releasepreventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParameters%s, %sError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENALIAS, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexINTSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGTERMhcxndaNR@8MOUSE_STARTMOUSE_ENDcmsobc|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done_(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%c-c%s %s %slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshiftquotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] /bin/sh~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberhddvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratedialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftprawhdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymappasswordresetvideosunsummodulesbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x invalid console name, valid names are:Boot options: timeout %d, flags %x, speed %d, ioaddr %x, console %s console %d keymap %s Patch area in stage1 bootstrap is too small/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0com1com2com3com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... m:pusage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: not found%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil done; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %struePScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalchdirletfalsefdflagsgetoptsfcinputrcprintfsetvartestulimitumaskunaliaswordexpPPID20220122 BUILD:20260404060856Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-extproc-parmrk-onlret-cread-parenb-cdtrctsispeed %d baud; ospeed %d baud;lflags %d rows; %d columns; queue = %d; line = %s;-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfoiflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignparoflags-opost-onlcr-ocrnl-oxtabs-onocrcflags-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrqfsck_%s-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbinv7fs** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Read failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %juPri%s GPT at sector %juSecGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableCreating new secondary GPT headerMoving secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]%d%sGPT part %lsUnknown %#x %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressvltimeinet6 address lifetime not allowed for the AFpltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEinetnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedmetricSIOCSIFMETRICmtuSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:N%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics 2easector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkexpirehopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesSO_RERRORassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen%s/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab MBytesGBytesKBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetformidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandLPSVEPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVncan't stat: %s%s is a directoryopen: %s%s is not a regular file.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-ifailed to read passphrasepflag set inappropriately? (echo)%s's passphrase%s:failed to generate Argon2id key, error code %dfailed to generate PKCS#5 PBKDF2 keyusage: %s [-enpv] [-V vmeth] cgd dev [paramsfile] %s -C [-enpv] [-f configfile] %s -G [-enpSv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] paramsfile %s -g [-Sv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] alg [keylen] %s -l [-v[v]] [cgd] %s -s [-nv] [-i ivmeth] cgd dev alg [keylen] %s -t paramsfile %s -T [-f configfile] %s -U [-nv] [-f configfile] %s -u [-nv] cgd with alg %s keylen %zu blocksize %zu ivmethod %s can't open cgd "%s", "%s"%s (%s): clearing opendisk_werror(%s, %s, %zu) called. getfsspecname failed: %sfailed to parse key lengthfailed to read key from stdin/etc/cgd/cgd.confcould not open config file "%s"\\#action failed on "%s" line %luencblkno8encblkno1CGDIOCGETnot in usedev %llu,%llu keylen %d blksize %zd opendir: %srcgdbad name %sgetkey("%s", %p, %zu) called command failedcommand output too shortcommand failed with status %dunrecognised keygen method %d in getkey()failed to derive HKDF-HMAC-SHA256 subkeyunrecognised shared key derivation method %dinvalid parameters file "%s"nbits <= INT_MAX - 7/usr/src/sbin/cgdconfig/cgdconfig.cret == (int)nb64flags == CONFIG_FLAGS_FROMALLwrong number of argsdevice %s already in useparams invalidcan't read disklabel areapread: incomplete blockre-enter devicecan't read mbr areacan't read gpt areaunimplemented verification methodverification failed permanentlyverification failed, please reenter passphraseCrypto self-test failedCan't disable coresCan't lock memoryCGP:STUV:b:ef:gi:k:lno:sptuv-P is only for use with -g/-G action-P only makes sense with -S flag-S is only for use with -g/-G actionFailed to parse key lengthno keygen in parameters file "%s"Failed to generate defaults for keygeninvalid parameters generatedcan't preserve randomly generated keyinvalid old parameters file "%s"old filenew filecan't generate new parameters fileundefined actionout of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_create_buffer()fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedout of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundout of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()foo%s line %d: %s at '%s'yacc stack overflow%s: failed to parse parameters file tmplen == PRF_BLOCKLEN/usr/src/sbin/cgdconfig/pkcs5_pbkdf2.cpkcs5_pbkdf2: calibrating iterations...%s %s; %*sshared "%s" \ %*salgorithm %s \ could not determine key length for unknown algorithm "%s"re-enterparams_setverify_method: unrecognized verify method "%s"keygen argon2id must provide `iterations'keygen argon2id must provide `memory'keygen argon2id must provide `parallelism'keygen argon2id must provide `version'keygen argon2id does not need a `cmd'keygen argon2id does not need a `key'keygen argon2id must provide a saltkeygen pkcs5_pbkdf2 must provide `iterations'keygen pkcs5_pbkdf2 does not need a `key'keygen pkcs5_pbkdf2 must provide a saltkeygen pkcs5_pbkdf2 does not need a `cmd'keygen pkcs5_pbkdf2/sha1 must provide `iterations'keygen pkcs5_pbkdf2/sha1 does not need a `key'keygen pkcs5_pbkdf2/sha1 must provide a saltkeygen pkcs5_pbkdf2/sha1 does not need a `cmd'keygen storedkey does not need `iterations'keygen storedkey must provide a keykeygen storedkey does not need `salt'keygen storedkey does not need `cmd'keygen [u]randomkey does not need `iterations'keygen [u]randomkey does not need `key'keygen [u]randomkey does not need `salt'keygen [u]randomkey does not need `cmd'keygen [u]randomkey makes no sense sharedkeygen shell_cmd does not need `iterations'keygen shell_cmd does not need `key'keygen shell_cmd does not need `salt'keygen shell_cmd must provide a `cmd'unspecified algorithmunknown algorithm "%s"(warning)unspecified IV methodunknown IV method "%s" (warning)unspecified key lengthcould not calibrate pkcs5_pbkdf2can't generate random bits for storedkey(u)randomkey keygen cannot be sharedstoredkey does not make sense as sharedkeygen already shareduuidgenuuid_to_string: %ukeygen not sharedargon2idpkcs5_pbkdf2/sha1urandomkeyshell_cmdunrecognized key generation method "%s"hkdf-hmac-sha256unrecognized shared key derivation algorithm "%s"/etc/cgdfailed to open params file "%s"keygen storedkey urandomkey; argon2id { iterationsparallelism}; pkcs5_pbkdf2 { pkcs5_pbkdf2/sha1 { keygen_fput: %d not a valid methodiv-methodkeylengthverify_methodunsupported verify_method (%d)could not open outfile "%s"encblknobits_decode: mangled base64 stream %sbits_decode: encoded bits claim to be longer than they are (nbits=%zu, stream len=%zu bytes)/dev/randomcalibrating argon2id parameters... failed to calculate Argon2 hash, error code %d failed to calibrate hash parameters: broken monotonic clock? failed to calibrate hash parametersargon2dargon2iArgon2idArgon2iArgon2dUnknown error codeThe password does not match the supplied hashSome of encoded parameters are too long or too shortThreading failureDecoding failedEncoding failedMissing argumentsToo many threadsNot enough threadsOutput pointer mismatchThere is no such version of Argon2Argon2_Context context is NULLThe allocate memory callback is NULLThe free memory callback is NULLMemory allocation errorAssociated data pointer is NULL, but ad length is not 0Secret pointer is NULL, but secret length is not 0Salt pointer is NULL, but salt length is not 0Password pointer is NULL, but password length is not 0Too many lanesToo few lanesMemory cost is too largeMemory cost is too smallTime cost is too largeTime cost is too smallSecret is too longSecret is too shortAssociated data is too longAssociated data is too shortSalt is too longSalt is too shortPassword is too longPassword is too shortOutput is too longOutput is too shortOutput pointer is NULL$v=$m=,t=,p=WSDISPLAYIO_GTYPEWSDISPLAYIO_SFONTWSDISPLAYIO_SBORDERWSDISPLAYIO_PARAM_BACKLIGHTWSDISPLAYIO_PARAM_BRIGHTNESSWSDISPLAYIO_PARAM_CONTRASTWSDISPLAYIO_SSPLASHWSDISPLAYIO_SPROGRESSWSDISPLAYIO_GMSGATTRSWSDISPLAYIO_SMSGATTRSWSDISPLAYIO_DSSCROLLborderfontbacklightbrightnesscontrastscroll.fastlinesscroll.slowlinesedidmsg.default.attrsmsg.default.bgmsg.default.fgmsg.kernel.attrsmsg.kernel.bgmsg.kernel.fgsplash.enablesplash.progressWSKBDIO_GTYPEWSKBDIO_GETBELLWSKBDIO_GETDEFAULTBELLWSKBDIO_GETMAPWSKBDIO_GETKEYREPEATWSKBDIO_GETLEDSWSKBDIO_GETENCODINGWSKBDIO_GETSCROLLWSKBDIO_SETMODEWSKBDIO_SETBELLWSKBDIO_SETDEFAULTBELLWSKBDIO_SETMAP +> WSKBDIO_SETKEYREPEATWSKBDIO_SETDEFAULTKEYREPEATWSKBDIO_SETLEDSWSKBDIO_SETENCODINGWSKBDIO_SETKEYCLICKWSKBDIO_SETSCROLLscrolling is not supported by this kernelbell.pitchbell.periodbell.volumebell.pitch.defaultbell.period.defaultbell.volume.defaultrepeat.del1repeat.delnrepeat.del1.defaultrepeat.deln.defaultledstatekeyclickscroll.modescroll.modifierunknown_%dBackSpaceLinefeedEscapeexclamquotedblnumbersigndollarampersandapostropheparenleftparenrightasteriskcommasemicolonequalgreaterquestionbracketleftbracketrightasciicircumunderscorebraceleftbracerightasciitildenobreakspaceexclamdownsterlingcurrencyyenbrokenbarsectioncopyrightordfeminineguillemotleftnotsignhyphenregisteredmacrondegreeplusminustwosuperiorthreesuperiormuparagraphperiodcenteredonesuperiormasculineguillemotrightonequarteronehalfthreequartersquestiondownAgraveAacuteAcircumflexAtildeAdiaeresisAringAECcedillaEgraveEacuteEcircumflexEdiaeresisIgraveIacuteIcircumflexIdiaeresisETHNtildeOgraveOacuteOcircumflexOtildeOdiaeresismultiplyOobliqueUgraveUacuteUcircumflexUdiaeresisYacuteTHORNssharpagraveaacuteacircumflexatildeadiaeresisaeccedillaegraveecircumflexediaeresisigraveiacuteicircumflexidiaeresisethntildeograveoacuteocircumflexotildeodiaeresisdivisionoslashugraveuacuteucircumflexudiaeresisyacutethornydiaeresisAbreveabreveAogonekaogonekCacutecacuteCcaronccaronDcarondcaronDstrokedstrokeEogonekeogonekEcaronecaronLacutelacuteLcaronlcaronLstrokelstrokeNacutenacuteNcaronncaronOdoubleacuteodoubleacuteRacuteracuteRcaronrcaronSacutesacuteScaronscaronTcedillatcedillaTcarontcaronUaboveringuaboveringUdoubleacuteudoubleacuteZacutezacuteZabovedotzabovedotZcaronzcarondead_gravedead_acutedead_circumflexdead_tildedead_brevedead_diaeresisdead_aboveringdead_carondead_dotaccentdead_hungarumlautdead_ogonekdead_slashdead_cedilladead_semidead_colongr_Atgr_Etgr_Htgr_Itgr_Otgr_Ytgr_Vtgr_itdgr_Agr_Bgr_Ggr_Dgr_Egr_Zgr_Hgr_Ugr_Igr_Kgr_Lgr_Mgr_Ngr_Jgr_Ogr_Pgr_Rgr_Sgr_Tgr_Ygr_Fgr_Xgr_Cgr_Vgr_Idgr_Ydgr_atgr_etgr_htgr_itgr_ytdgr_agr_bgr_ggr_dgr_egr_zgr_hgr_ugr_igr_kgr_lgr_mgr_ngr_jgr_ogr_pgr_rgr_teliko_sgr_sgr_tgr_ygr_fgr_xgr_cgr_vgr_idgr_ydgr_otgr_ytgr_vtShift_LShift_RControl_LControl_RCaps_LockShift_LockAlt_LAlt_RMulti_keyMode_switchNum_LockHold_ScreenCmdCmd1Cmd2Meta_LMeta_RZenkaku_HankakuHiragana_KatakanaHenkan_ModeHenkanMuhenkanKP_F1KP_F2KP_F3KP_F4KP_HomeKP_LeftKP_UpKP_RightKP_DownKP_PriorKP_NextKP_EndKP_BeginKP_InsertKP_DeleteKP_SpaceKP_TabKP_EnterKP_EqualKP_NumbersignKP_MultiplyKP_AddKP_SeparatorKP_SubtractKP_DecimalKP_DivideKP_0KP_1KP_2KP_3KP_4KP_5KP_6KP_7KP_8KP_9f3f4f5f6f7f9f10f11f12f13f14f15f16f17f18f19f20F5F6F7F9F10F11F12F13F14F15F16F17F18F19F20PowerHelpExecuteFindSelectAgainPropsUndoFrontCopyOpenPasteCutStopMenuPausePrint_ScreenCmd_Screen0Cmd_Screen1Cmd_Screen2Cmd_Screen3Cmd_Screen4Cmd_Screen5Cmd_Screen6Cmd_Screen7Cmd_Screen8Cmd_Screen9Cmd_DebuggerCmd_ResetEmulCmd_ResetCloseCmd_BacklightOnCmd_BacklightOffCmd_BacklightToggleCmd_BrightnessUpCmd_BrightnessDownCmd_BrightnessRotateCmd_ContrastUpCmd_ContrastDownCmd_ContrastRotateCmd_ScrollFastUpCmd_ScrollFastDownCmd_ScrollSlowUpCmd_ScrollSlowDownCmd_VolumeUpCmd_VolumeDownCmd_VolumeTogglevoidSymbolL5_GbreveL5_IdotaboveL5_ScedillaL5_gbreveL5_idotlessL5_scedillaparse: %s [%.*s]keysym %s not found%d: keycode too largekeysym expected%s: not a keysym%c: illegal character in input%03o: illegal character in inputcould not list calibration samples%s%d,%d,%d,%dWSMOUSEIO_GCALIBCOORDS%s: invalid calibration dataWSMOUSEIO_SCALIBCOORDSWSMOUSEIO_GTYPEWSMOUSEIO_GETREPEATWSMOUSEIO_SRESWSMOUSEIO_SRATEWSMOUSEIO_SETREPEATresolutionsampleratescroll.reversescroll.distance.xscroll.distance.ycalibration.minxcalibration.minycalibration.maxxcalibration.maxycalibration.samplesrepeat.buttonsrepeat.delay.firstrepeat.delay.decrementrepeat.delay.minimuminternal error: field_by_value: not foundkeycode %u =internal error: pr_field: no format %d%s: not a valid number list%ld: number out of range%s: not a valid encoding%s: not a valid variant%s: not a valid color%s: not a valid attributeinternal error: rd_field: no format %dhilitblinkunderlineblackbrownbluemagentacyanwhitenodeaddeclklk401swapctrlcapsdvorakmetaesciopenermachdepcolemakukczbeponeouadec-pm-monodec-pm-colordec-cfbdec-xcfbdec-mfbdec-sfbvga-isavga-pcidec-tga-pcidec-sfb+generic-pcinext-monodec-pxdec-pxgdec-txgeneric-hpcarm-vidcdec-spxdec-gpxdec-lcgdec-vax-monosparcbook-p9100egadreamcast-pvrhp-gatorhp-topcathp-renaissancehp-catseyehp-davincihp-tigerhp-hyperionamiga-ccsun24sgi-newportsgi-gr2suncg12suncg14suntcxsunffbhp-stihd44780vesaxilinxsgi-lightgenfbsgi-o2pxafujitsu-ag10displaylinksun-xvr1000omron-lunagrfvncapple-valkyrieimx-ipuvideocore4omap3530windermereclps-711xallwinnerssb-mgxamlogc-mesonnvidia-tegraplatinumprimcell-pl11xssdfbvideocore6dec-tcps2usblogitech-busms-inporttouch-panelarchimedeshildec-maxinemaplebluetoothlk201pc-xtpc-athpc-kbdhpc-btnriscpcadbsunsun-type5sgimatrix-keypad%s: %s Usage: %s [-kmd] [-f file] [-n] name ... -or- %s [-kmd] [-f file] [-n] -w name=value ... -or- %s [-kmd] [-f file] [-n] -w name+=value ... -or- %s [-kmd] [-f file] [-n] -a /dev/wskbd/dev/wsmouse/dev/ttyE0adf:kmnwonly one of -k, -d or -m may be givenexcess arguments after -aonly one of -a or -w may be given"%s" not shown with -a; use "%s %s" to view.'=' not found%s: read only%s: can only be set%s: write only%s: no kernel support%dx%dx%dIVMVendor: [%s] %s Product: [%04X] %s Serial number: %s Manufactured %d Week %d EDID Version %d.%d EDID Comment: %s Video Input: %x Digital (DFP 1.x compatible) Analog -0.7, 0.3V -0.714, 0.286V -1.0, 0.4V -0.7, 0.0V Blank-to-black setup Separate syncs Composite sync Sync on green Serration vsyncGamma: %d.%02d Max Size: %d cm x %d cm Features: %x DPMS standby DPMS suspend DPMS active-off Monochrome RGB Multicolor Undefined monitor type Standard color space Preferred timing Default GTF supportedChroma Info: Red X: 0.%03d Red Y: 0.%03d Grn X: 0.%03d Grn Y: 0.%03d Blu X: 0.%03d Blu Y: 0.%03d Wht X: 0.%03d Wht Y: 0.%03d Horizontal: %d - %d kHz Vertical: %d - %d Hz Max Dot Clock: %d MHz GTF2 hfreq: %d GTF2 C: %d GTF2 M: %d GTF2 J: %d GTF2 K: %d Video modes: %dx%d @ %dHz (%d %d %d %d %d %d %d %s%sH %s%sV) Preferred mode: %dx%d @ %dHz Number of extension blocks: %d %08xDELUltrascan 14XEVSC17GS17PSAACAcerViewAPPApple ComputerAST ResearchCPLCompalCPQCompaqCTXDellDPCDeltaDWEDaewooEIZEIZOELSAEPIEnvisionFCMFunaiFUJFujitsuGSMLG ElectronicsGWYGateway 2000HEIHyundaiHITHitachiHSLHansolHTCHitachi/NisseiHWPHPIBMFujitsu ICLIiyamaKDSKorea Data SystemsMEIPanasonicMELMitsubishi ElectronicsNANNanaoNECNOKNokia DataPHLPhilipsRELRelisysSAMSGISNYSonySRCShamrockSUNSun MicrosystemsTatungToshibaTSBViewSonicZCMZenith1280x1024x751024x768x751024x768x701024x768x601024x768x87i832x624x74800x600x75800x600x72800x600x60800x600x56640x480x75640x480x72640x480x67640x480x60720x400x87720x400x70640x350x85640x400x85720x400x85640x480x85800x600x851024x768x851024x768x891152x864x751280x768x751280x960x601280x960x851280x1024x601280x1024x701280x1024x851600x1200x601600x1200x651600x1200x701600x1200x751600x1200x851680x1050x601792x1344x601792x1344x751856x1392x601856x1392x751920x1440x601920x1440x751152x768x541400x1050x601400x1050x741152x900x661152x900x76320x175x85320x200x85360x200x70360x200x85360x200x87320x240x60320x240x72320x240x75320x240x85400x300x56400x300x60400x300x72400x300x75400x300x85512x384x87i512x384x60512x384x70512x384x75512x384x85512x384x89576x432x75640x384x75640x512x60640x512x70640x512x75640x512x85800x600x65800x600x70840x525x60896x672x60896x672x75928x696x60928x696x75960x720x60960x720x75416x312x74576x384x54700x525x60700x525x74576x450x66576x450x76-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype truncated no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedIPv6 addressIPv4 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signleft-parenthesisright-parenthesisplus-signhyphen-minusfull-stoptwothreefourfiveseveneightless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflex-accentlow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Alink#%hu%d:[%d,%d]%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaymondaymotuesdaytueswednesdaywedneswedswethursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselectmanual10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.NAME=sysctl hw.disknames failed/rdk/rno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format stringsysvv71kv8otherhpfshfsraidframejfs2minixfs3vmwresv%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%s^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*12aargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$acosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llx%llirpn == pn!((*cp) == '\0')?xml !DOCTYPE plist