'VAy iЪ0;fUNetBSD/earmv6hfeb ramdisk 08iЪ<  iЪ\0et tiЪ@@<@T 08iЪ<  iЪ\0et tiЪ@@<@T UiЪtXX`AiЪiЪiЪ$ hiЪiЪiЪAiЪiЪiЪA.iЪiЪiЪAiЪiЪiЪAiЪiЪiЪAiЪiЪiЪAiЪiЪiЪHAiЪiЪiЪIAiЪiЪiЪJmD!8iЪiЪiЪ (08@HPX`hpx$[iЪiЪiЪN$iЪiЪiЪ (08@HPX`K$6iЪiЪiЪhpxcM$3iЪiЪiЪFAiЪiЪiЪLCiЪiЪiЪMAiЪiЪiЪNAiЪiЪiЪT!iЪiЪiЪ aiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪ!iЪiЪiЪ4!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ B!iЪiЪiЪ B!iЪiЪiЪ!iЪiЪiЪ"!iЪiЪiЪ"!iЪiЪiЪ"aiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ\?!iЪiЪiЪ\>!iЪiЪiЪ\=!iЪiЪiЪ\<!iЪiЪiЪ\;!iЪiЪiЪ\:!iЪiЪiЪ\9!iЪiЪiЪ\8!iЪiЪiЪ\?!iЪiЪiЪ\>!iЪiЪiЪ\=!iЪiЪiЪ\<!iЪiЪiЪ\;!iЪiЪiЪ\:!iЪiЪiЪ\9!iЪiЪiЪ\8!iЪiЪiЪ\:!iЪiЪiЪ\7!iЪiЪiЪ\6!iЪiЪiЪ\5!iЪiЪiЪ\4!iЪiЪiЪ\3!iЪiЪiЪ\2!iЪiЪiЪ\1!iЪiЪiЪ\0!iЪiЪiЪ\7!iЪiЪiЪ\6!iЪiЪiЪ\5!iЪiЪiЪ\4!iЪiЪiЪ\3!iЪiЪiЪ\2!iЪiЪiЪ\1!iЪiЪiЪ\0!iЪiЪiЪ\2!iЪiЪiЪ\/!iЪiЪiЪ\.!iЪiЪiЪ\-!iЪiЪiЪ\,!iЪiЪiЪ\+!iЪiЪiЪ\*!iЪiЪiЪ\)!iЪiЪiЪ\(!iЪiЪiЪ\/!iЪiЪiЪ\.!iЪiЪiЪ\-!iЪiЪiЪ\,!iЪiЪiЪ\+!iЪiЪiЪ\*!iЪiЪiЪ\)!iЪiЪiЪ\(!iЪiЪiЪ\*!iЪiЪiЪ\'!iЪiЪiЪ\&!iЪiЪiЪ\%!iЪiЪiЪ\$!iЪiЪiЪ\#!iЪiЪiЪ\"!iЪiЪiЪ\!!iЪiЪiЪ\ !iЪiЪiЪ\'!iЪiЪiЪ\&!iЪiЪiЪ\%!iЪiЪiЪ\$!iЪiЪiЪ\#!iЪiЪiЪ\"!iЪiЪiЪ\!!iЪiЪiЪ\ !iЪiЪiЪ\"!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\ !iЪiЪiЪ\ !iЪiЪiЪ\ !iЪiЪiЪ\ !iЪiЪiЪ\ !iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\ !iЪiЪiЪ\ !iЪiЪiЪ\ !iЪiЪiЪ\ !iЪiЪiЪ\ !iЪiЪiЪ\!iЪiЪiЪ\ !iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ\!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!$iЪiЪiЪ4!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ !iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪaiЪiЪiЪaiЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪaiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪ\?aiЪiЪiЪ\>aiЪiЪiЪ\=aiЪiЪiЪ\<aiЪiЪiЪ\;aiЪiЪiЪ\:aiЪiЪiЪ\9aiЪiЪiЪ\8aiЪiЪiЪ\?aiЪiЪiЪ\>aiЪiЪiЪ\=aiЪiЪiЪ\<aiЪiЪiЪ\;aiЪiЪiЪ\:aiЪiЪiЪ\9aiЪiЪiЪ\8aiЪiЪiЪ\:aiЪiЪiЪ\7aiЪiЪiЪ\6aiЪiЪiЪ\5aiЪiЪiЪ\4aiЪiЪiЪ\3aiЪiЪiЪ\2aiЪiЪiЪ\1aiЪiЪiЪ\0aiЪiЪiЪ\7aiЪiЪiЪ\6aiЪiЪiЪ\5aiЪiЪiЪ\4aiЪiЪiЪ\3aiЪiЪiЪ\2aiЪiЪiЪ\1aiЪiЪiЪ\0aiЪiЪiЪ\2aiЪiЪiЪ\/aiЪiЪiЪ\.aiЪiЪiЪ\-aiЪiЪiЪ\,aiЪiЪiЪ\+aiЪiЪiЪ\*aiЪiЪiЪ\)aiЪiЪiЪ\(aiЪiЪiЪ\/aiЪiЪiЪ\.aiЪiЪiЪ\-aiЪiЪiЪ\,aiЪiЪiЪ\+aiЪiЪiЪ\*aiЪiЪiЪ\)aiЪiЪiЪ\(aiЪiЪiЪ\*aiЪiЪiЪ\'aiЪiЪiЪ\&aiЪiЪiЪ\%aiЪiЪiЪ\$aiЪiЪiЪ\#aiЪiЪiЪ\"aiЪiЪiЪ\!aiЪiЪiЪ\ aiЪiЪiЪ\'aiЪiЪiЪ\&aiЪiЪiЪ\%aiЪiЪiЪ\$aiЪiЪiЪ\#aiЪiЪiЪ\"aiЪiЪiЪ\!aiЪiЪiЪ\ aiЪiЪiЪ\"aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\ aiЪiЪiЪ\ aiЪiЪiЪ\ aiЪiЪiЪ\ aiЪiЪiЪ\ aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\ aiЪiЪiЪ\ aiЪiЪiЪ\ aiЪiЪiЪ\ aiЪiЪiЪ\ aiЪiЪiЪ\aiЪiЪiЪ\ aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\aiЪiЪiЪ\! iЪiЪiЪi!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ aiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪaiЪiЪiЪaiЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪ B!iЪiЪiЪ B!iЪiЪiЪ!iЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪaiЪiЪiЪ!iЪiЪiЪ!iЪiЪiЪaiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪ aiЪiЪiЪaiЪiЪiЪaiЪiЪiЪiЪiЪiЪbpf!iЪiЪiЪ $iЪiЪiЪ$iЪiЪiЪ$>iЪiЪiЪ$iЪiЪiЪ$siЪiЪiЪ$iЪiЪiЪ AiЪiЪiЪ"m iЪiЪiЪ(0$iЪiЪiЪ8# $iЪiЪiЪ@AiЪiЪiЪOAiЪiЪiЪPAiЪiЪiЪQAiЪiЪiЪRAiЪiЪiЪSAiЪiЪiЪUAiЪiЪiЪVAiЪiЪiЪWAiЪiЪiЪXAiЪiЪiЪYB@Mkx~c+'HlC:;߻W!x+xq.(|Z,[/dy{vo(/@`4grnekP[m'ed@FU:>~y9K. cMeӼl Q 'Iwyï3ʎQu5^C'QHU + [B8wbjBrѮU &P,a0U ʎ<!/.$'s'/S?tza%.3LWy 3(5t'D~uISAO_<߄eHB\r5t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4!54 ( V V b\$\$\LL b\$\$\NetBSDAPaX NetBSDearmv6hfeb4p@-D0D 0@`Qp(@P`F`F&a03/T@p##PA-`0`` 0PpU(pGpG@Pq`P03/T@0US ~#x\@-lPQMK \!\1 P`0 0R0819  0S  /S 0S10S8 0p ZpG2 pG0@3'q1*03/T@Y p0pWH2H0@3(1*03/X@ ~d 0 P0 0"#d#D#$_ a@@-t ttPl@dphP LíL`POU 㹭P @%Z`P@-@~O-`00R@,2t(Mt@0[m NPp@tt@( R R  G@PpT0: S M`0SЍ +@P0`0vw9 0wpS0SP0 S0 [ P  Ƭ 0S;00 0   P 0s s0T TH8#T   P R%Y%b|g ,8O%bңH0`  BR` pRp RX Xp/%Y%Z@@-0 ˰%Z 000/%fpC-؀-`P p0M @)'{@ (#'@{{z`P$0  Ѝp@Y%f$TΈ%Z@- M @00@  P q ЍίA- l1X0Zp 03 @P MP0S@ ((U@0X;0% P- G U @0`V/P/PX`! p&P0-S /@|m@PhkP ULP@ U(p0SX $Tμ%fO-6M@T K 9@P Ѝ  p` @5Xp0S 5%0 0 |5X 0S_d50S&<0,pP(@0SN50S0 p pPJ400<T$尠E00CS0 Pᐔ Pp  PYU 0 P00CS0 0 X80: S  + +gpP p  Qt X0 0( 0X3,$05x000 00 Q00SD 0 0 `3p8  tT 0Y 1(#00 H  0P '@wP㴂~ t0S@z)K"I R0  [0YY]820#0 p00 R0S 100S 0 7( Pʨ0S;a@T c@P@0 ?oR20S 0  H1 0R0-P( @P @0S "P 0S  P XTy P0Rt00!P %f$Tg%f%f%f%f%f.%f%Z%Y%f%f%v%f%f0@-MM@P  Xp  ;0U$C dP TTSۍЍ08 sP ,(0P X$T)%fQ@-@ TP DD0,dP $ 0P@$T5%fQ@-@ XdP HH0"P $ 0P@$T@%f@-0 VJ%Z0$/&w0$/&w@-* @-% @- @- K@-0! 0 < 0 Ѝ(&w@-0! 0 - 0 Ѝ8&w@-0! 0  0 ЍD&w@-0! 0  0 ЍP&w@-0  0  0 Ѝ\&w@-0  0 00 Ѝ&w&w<00/@-0  0 0 Ѝ&w@s&w<00/@-0  0 0 Ѝ&w@Ѕ&w0 @- 00 $0Q@CLЍЖ$X< C-`A!圁!ᘑMpW0 |! R0B=00 B  TӨ0L 8 R<B 8!4100!0ЍPP F=:P 0p00S  0 PG0P      0 3/R ! 7000@080LD0&w&w@&w=#+E&xСc0p@-@PP0 00R00 p800 p0  B0Sqs &x&w&w0 0 0 /&w&w@- g@-@- g@-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/pq:L0S 00g@8m@-@Z/PЍ@ PЍp@-(`Vp80@  03/PPk8003/(Ppѿ@-@P`P 80 (0(3/@K P KPЍp&vO-2 PM`P(`,PB  0S9P06 I0S +%0 % 0 R,P0(`R0 *0 Aj0 000+ |tpx F0x ЍO0 P % pHp 81/pq4  |?P p 4 TK0S4 < p0 )0 )"F)0 )'0 '0 %)0 VU)(0, SR '0 ''0 ''0 [X'y 00 0S04H0004 4pX TЍ&v&wg"R/ R 0 0 /\\CC  B0R00!/0"SSS S S S S SSS SS SS SSAQA0/C-hBM 0  P 0  4 &$0 0!( Ÿ}/LB/DPN#b`0@ R%H }//@#b`_`SP0!!!! d 4 !P`/4 F4 " C\\ T!d44E4 |" C  !d4 4E4 i# C  d44E4 V? E8<@p 0 Ed  dp@44E4 8Ѝ&wFlbM&wPҰ0V@-@SvG-A  `004P#"6P8P ( 1/pq $ |㰀娐pUЍ0S0C080 $0(3/P 0 `V`PE@T0  Z  $ &wg&w@$XY@-XAM P!#"18 P (5/pq$ 2P< 0080 0( 3/PЍ80 $0(3/P`P4 00V0:0p080 p0l( 3/pPp 4 00V0* 0`/PRP `&wgm0P@-@ P M4 bЍ&xrO-騇IM0@SpM. 8S+ #=|'|00S( 000 PA" ! <!:x000# #3|0 .& %(IލЍ&? 0 W0 pS 0E0VS06  S  S $0S0 600000Sl60 0\60 00 H6RDnD 0Rr0C0C00Q0 0S. ,B< L5R0P` U,  ( , (0S$0$ ,0`040(0000 0S~ $ R# `5`%``J(0SP%0 H%00   0 (5(,0S 5%0 0r[ʑ4$pWH ? W08 3* @E08 C 08 PC /E8 0$Cp#0T 0040 0@"D@ 0@p R(  EU,0吉((0吓) E$0吳v'P00S0 ,0S#$P0U $   40S \&S S *D 0$dC 0D$03&"  0$p[XR3  0 0, ( y0$   r#0T 0040@ 0D"81,0S 4UՁ\ՏQժ`ղ@-pPP`@@ DP Ѝ`3MU@p@-XP8@T`@D p oDP<opQ<Pp&xA-AP 0 P 00$SQ ( 0$咣P Gh d`P, 0R1@a@qU`0``00PF d00CS000    0,`0CS0000 (00/U R F8 45D$0 00 $0 &x`/D%Z&z`&yT0 S 0SP/P/S/@- `&x`p@-XAXT0040S+@! PPP P`04 0PV R@40P 0SU40 ^*00"  `0PEP P0P4  S U 4 P0CSR40PP 0 > p&z`&x`$d&y&yp@-8 4000CS010 SdAPT 0@@00S _ Pg P @ P 0@0CS0`00@  :&zXFl&y&{h%Y؂&y&z`/D%Z&yؙ؜p@-Pd`d@000 PPPP0P0CS0p(00 p&z`&y&yG-@0` V V~Ѝp$PP 0崀 尐R`00@`0SrP 0S 0 i0  0?o2S @`tP&zXذ&y&y&yP `00CS`0p S00 P0S X0X /X_%YO-p`㴢B崲0S@ CpPG0`F [stlV000?PXDCG4 0,00C0Cf 100CS010:uPU 0P1` 00CS0e0 P U Rp0V00PB  i00C0S"10 00CS000 U0P 0@ B |A V 0 00 0 @00S 0S YI&|&y&z`/D%Z&y&yO-XRML` 000002000 20S z@0r`0#0P 00%0J?oT20SS SR9 =}0S 0E  0 IP000CS0l10 Ѝ XS Q0P  BR   @0S 0 0 0S  R Z@T    0S Z dl|T  Z    00 00S@@&y&y&y&|&y&z`%Z&yA-0P!S`6P@A 0eu?pP0!S P A 0HHIH<00S ,=$0@G:%Z&|4&yA-P@lp`V0S P A, ($k@&|/D%Z9O-`@ ؀P0S vp0 T T R R k0pMP Ѝ PP P   P Pp@&|&y&y&yA-p0`!SPP@MAP 0 @U PP0!S !P .A1 0HHH3<00S ,UpGP:%ZKc&|4O-@P b 00CS0Rp0@h @ g 0`001 pUpP@0 儱p W1pQpTP0PP00P@8 ;, 00CS010 x 0P0CS000x0 S0 0 @ X 000 0 P0 `0U0 0T p 0 %Y&{h|%Zه&zX&|&z`/D&y&y&|O-PpP0 SPEUP ЍE P 0C0 X1 Ub000MPR@U  00C0S 20  60 0CS0L200 #7 Z0 P CPE P 000S S  `V$ V000P @x tlp 00C00 0CS0@100 06X 0PFP 0Z0 CPF V&P嬀VP0PP00P ?t p+l} 00C0m0 P0CS0<00jl00`6&zX&y&z`/D%Z&y&{h؂O-P@`p tP`T  0PS >zP 0@^S00\P0S @\[ \2-P X0 @P+0P00ٙ$lٞ%Z@hG٧@-T @000 <P 0S( 0C00S 0C0 Ѝ&y@th$hL0 R QQP0R/@- &yG-QpP@ `V 0S0S  @Ѝ0S V 0S@@T0S VT@T0S @MP 0S 0 0 RP 0S&yٰG-@P tp0S&`#PUP 0 @P @P&yX0000@-@a 40aA R    0/%aٹ&y40000 01h@-B %a&yٹG-R肟@p0 0S0 "3( 0`?VJV$ V00 0 0S0 =D U> \&1@s4K>0"S04 @pp FQvP,RRRQRxRRTRRRP,RxP,QRQQQQQQQQQQRRxRRRR^V ^V-Vi @ 0s000@^V-V00@R$>0 0б1@s@=0"SR 0.V@0 @R T /Fo@P0 R00R  G@PR 00;V0 00 W@| T0Sw&y%a&zX0@-@00 005P 0S  S   0 0 0 ,Q;Q S  S   Pp000;S&y p@-PD0QS@@R0p`VP 0C&yp@-P@P d=g, ($ p 00/D%ZQ 0Q\S@-Ao/`@-0S*  0@000S! PZ/pP 8PP @P 0 S</R/     0 &y( Q 0@30/@-&y00@- R 0C30&yA-ppA1SPS a00S S P4!`0`00`0S00 S@P0.S0 S 0P00`P 00CS0#0 m W  U0100CS00 pP&y%YG-AP pRpGWR0`0`0` 001S 0100CS0H89 ^P00CS0' 0S  NP 0Sp`0 0`0R00 00C0p00  %`p&yG-P4Ap  QR`X0A EP0A0S6PC000P 00CS0'0  W  pP 0圑0CS00PU`*<0`&yG-A 0`0P0 P 00CS0-0 o& 0FSp 1S 0PEP0Cp00100CS0&yO-LB`0pSP UA!0SR0XPPP00`PD 0Q0CS00KM!1  P[00`F`0#P/  B P) 0100CS0G'(P; 0堑0 S, S  P ;# 00CS00  0堑0CS00  10P{&yFl/D%ZA-A`qW ڬQ1ECe R0 0 C0|00PP: 800CS00 v 0q0CSQ00 \R `R `&y/D%Z0O-D0!10Pp Ѝ0S/  $SPPPPsPx:{\ XT400CS00   _0Q0CS00! P1̃أؓ 0 S)"Rʜc0U```005P 0b0CS00 '1 1Q !@o!S/ %S !`V U 00 0P 0帱0CS000!000\Q00`PR# !RU``0``00Pc 0a0CS00jl0` 1 1S 0S11a0S S`l  P6 0a0CS00=?10`! S:`Fp00  1S p4a0S `10 BRpE` S`l   jP 0a0CS00   &y/D%Z&{؜( Q 0@30/@-G&y`01S @-0@!S @~6P /'P /&yI7@-A00 S1 RUVʐ0\00PB9 00CS00- 000 @ R, R xP Ѝ00!S HP b0 Sڰ 0R0CS0000 0 Q  tP   &y%a/D%Z(?A-O0 R ,Sp WR ! GrYQYYRV{|||||||||||||||||||||||||||{|||||||j|lm|||||||r0r||||lx|||||||||h|i\ijklmdn\nohophqP|qrs(t0wxlxzD|zPP00 nR pR lR 00 S  PP1S )PPPP0 nR pR lR 00 S1S 1PP0PPPP0 nR pR lR 00 S1S P!S00P0PP!R "R  RP 000@8 `PP 0 nR* pR# lR$ 00 S~Ps "PPPು0S!S  .0S 1Sk aP0PPvPcN 010<+08+0[ R000@ ?PO 0!SP ;P00 nR pR lR 00 S+0S - a*a1PPQUt P#G@ouG`GooPbVWP101 P00 nR pR lR 00 S PP0SPNʈ0 nR pR lR 00 St)0S hh mP0PP0SP.ʈ0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Sz1SqP ~P0PP  PP` 0 nR pR lR 00 SV_P0PPBP T0nQ pQ lQ 00 S 7PPB@ 0  !P4p PP/0S `Vn0VkV PPPVPUXp 0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SPʈ0 nR pR lR 00 S2S040S402P0PP0S 0l0Cs0S 030 S1S 2SqW P000@ 0S0 0m`PP| 0 nR- pR& lR' 00 S`1SW!0R!S +0S1S dc hPUU 0S0Q 1OP0PPP`s0 gRG  R7 0 B RT5 `%@p?J50"S; b(pR1 rR1 U0 R 0 S\ 0U0b0 * `P'00CS0 0 P00 S2S 02P00PP2P02 P P N0b200CS00U.4VP!2R002 0nSS pSH lSL PP0 nRL pRE lRF 00 S1S"!2R000#2 0# 0%a&y:Qd$x$t~ڒ&|/D%Zڮ,q4ذ&|&{J&zX$h:820 2 2020P0PPKP^p PPY0S) `V0V PpPӔʈ0 nR pR lR 00 S11S(67P0PP0SPӆʈ0 nR pR lR 00 S|P0PP QR000P0P00@j `P 00 00 P0 nR+ pR$ lR% 00 S!0R!S do*0S1So bWW P0S0P0PP1S 2SqXP0S 0l0Cs0S 030 S8 P0010CS 0nQ( pQ! lQ" 00 S3 00SF3` `vS@p30"SY`x 0  PP00 nR pR lR 00 SQ0pS YZPP0SPPN0 nR pR lR 00 S2P 5]'2S7P0PPP&  \-@- 00 ЍЍ/'&|-0^S0]S0]S S]S[S .0Ls0S^30   Q  ]Q RoG-鐁`P@0 SS&tPD(!,RF`a`qU`0``00P,2( $O 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a ) L0 0@S G 0m&zX&|&z`/D%Z&y-d&yp@- !0 P< P@01SE0p0S S u`Pp@0P 00SP0P00 P l0X 0&010QP0S2V0 ,(&zXذ&|{&|&|'/D%ZO-|b|B0 %Q + PXrX00 SM Y< U 000P "$2 00CS010  Q0R0 00CS0000 S0&0Q@0C0RapU`0``00P 0A0CS000 0P \S0P 0 S 0t00S|hhP 000S Sq 0`00 Pk&zX&~&z`&y/D%Z&{d&{h%Y0A-P0 0p@ W 0 `BP! 0 R00R000 1BQp1@ @P@@pe10"S,$@gR000&zX&~O-@SMpcȳ00 0GS TcsT`0``00.P316` \X00C0+0&SK   BR  D R: XJ@p RP1  p00C0S @Ѝh20    BR   0 \SH 1B\C00 BR?"p L\ DR-WppB@ \ p P 0D @<h00C0 AQ 0 T0 Tpppp  wPu p BR   @W0 `0CS0(00oq 0 b&~&z`&y/D%ZO-M!@0P 0k 40S 0 0 00 0(0pPP `Cij0 S pSP,0Y01 Y  $ P$0X TP  B R+830 #   BR 200S 0 4 &0 0(PP0 ߍ40Y0 Y H $ P$  BR 200S 0  & P4 00Q' 0 p1pG Y<xxZ  P@1 /0 ,(I00C0StX 000 "2 0 0(0P< 00CS000\^W#00 |wP00S 0  D&< 0 X db&y&~&z`/D%Z&yۏFlO-pᬡA0M0CQ` 01 00C S00`NlЍ|  0P5 =P!` 00000`P00CS000  [  O0S00CS0x00` P  P&y&y&z`&yٰ&~&yO-RB0M00bsp 0srЍؑ0ЁS 1    000P@ 0.#⩟ɐ Y Fp10S 0p0000000CS0C01; 1 \" \ 0 0#0L\ 0C000@00000000 0C LN 6&y$t&y۪&~&z`&{l&{d&yA- `P 0 0Cs 0x 0 p0 l   AC^  00@pT @ 0&~&y$t&yG-@p0 PR` 0 PW(S%R0  d &P 0 ,H(&~/D%Z@-0 4ۺ%ZO-dGM0PS@pM$Q403/P 幠0: S-00W +$ P9:-?0P0: S 0SP0: S 0S 0S 0/S&ԳP3ٳP0S*P( (P 0p#־ PN+#0P 0#P]ž]⠳P  J/?P/?Pppk*P! 0S0S rzXG X⋿00CS0kbpl Pph pYWr TTg\H Z0Sh0S0c ?o2500??G YU.<.0 #G=0J@PT.<.0 #G=0IN.P8!<0Q\ LH1RPX0S 0SP#0S(GݍЍX0 X p00CS0 0 0S 0: SLP 0S 0 8d&~(clc<gtܙi܍%Z@%Y%Z\\)0\\)X X0p@-DPD@@@T ` U H H0Rp@\\)ppX 0Xp@-DPD@@@T ` U HH Qp@\\y)ppX X0p@-4P4@00T ` U 8 80Rp@\\_)ppX 0Xp@-4P4@00T ` U 88 Qp@\\D)ppX X0p@-TPT@PPT ` U X X0Rp@\\*)ppX 0Xp@-TPT@PPT ` U XX Qp@\\)ppX X@-p0tp t\@ ^0@\\(X0X@-p tpt\@ ^ @\\(5S %R R S R SSh -^L^S R 0/0/0000&~PO-QMTf @ `u @ 0 @0L0@@@ @@D@H@<@@@4@8@,@0@5 SS$S\ 0 !00`V0S8 0 0刐0L0St ,0D0000$0S00(0@ C</W&$p⣼p&,0S `4 @?C000<$0D0p0H0D0劼pf&0 $p₼p^&$0S0040080#0prpN&,0S 3 @?CZ㸰张 0t#p\p8& 0X#pTp0&0 \ 0C0CQ0B003/0400S 厽YT R~S0 00 R0! 0L0S XP@ |0xR< H  <@0\DD5H 5 8P ! t p\48  4 * R," $\  " &p P 0 0,  "0Sb Q? 0 !XX0$0 Q9 0 l!dۻd0(0$%[(% 0R  P ,P0@%0S00P00P00෺PP\0.S0S0 !z 0P$00P(0 $嵽 (尽 R P0姽P000Ѝ&~PKUUUV_ ,O-@a!80S s,PP! .tpW  ЍO-<0匑SB儱|L-@P )@,)@)0SL H#50CSTTT\₅ $幾 y00L0S \0.S0S a.@0S40S z`.<0?oQ20S X e040 Ѝ&~P8K̘OG-`L㕽P04FL0 $P0S&00D0H0P0pP蕟0 pN5T H0 `F0P 0 jP :Y5X0 s0X0d 0t000|00PP' S'Q 'R0 S" S# S5 L0S5 T0S40S4P$Q40V  00Ѝ10@GS444444444444444 4444444x4444,44444444 44,dD4PX 4  0$00H00P0L00T0QX0s0X000P0L0T0H0F000P0L0T0H00X0<0P00L00T00P0L00,(0d0%PP"0<0080 P0 D0h l00D0h000000 0p0p$0,p0$00,0000@00 00p00t00D00h00x00|000000000D0@PHD @区9\0 SPWo( ?R004(0\ SR PPP00`0S0\0S00S S S0|0`0Sp0\0Sd0d0r&~P@th$|4%S4x$h$%Z&~xL x80p@-@PT @@\p&~D80p@-@PT @@\p&~D-L MRM\0 + ␬p'卼0 ލЍ 00 >04@pVl0l 0 0  L00S   @gX%Zie&~&~&~$0\ 0S .+&~ig0L0S/0 0 0/@-00 SM 0 0$0+4pp}hЍ\0\@ X0R@P00C/8" 0Ѝ@&~X&~`&~tr݃ݓ&~|wj&~xP `00CS`0p S00 P0S X0X /X߹%Y: S@-  S  S/ I* S  S%|@=A-t1`@pTXPM !T奸@L10S @10S- ,10';p ⊸@0 0 0( 0@0S00S 0: S@Ѝ0l 0R00C/!0 [T00S &~\ݥ&~`&~tr݃[B&~&~&~&~&~|ݝ&~x&~s@- P@@P `RU00S @IT EЍpx p Q \0 \@1T ,P@(Uݬ&~&~p@-P@Tp!0C0  $F @G-@0M%$3 30S`V0Ѝ!0C0{ 0XPS !$ӷ0S 20Sm 0$ 2+04hp|2t ֹⷷ0 ( p宷H20S 04妷 $墷 20S   嚷0 : SK ,0s# 8#44凷10S10S91!0 0H 10S|10S : S0: S z`y81p 01Rp(10C/ 0 K'Q p| , p7P^ ,.00S &~&~&~\&~`ݥ&~tr݃[B&~&~p &~&~&~&~&~&~&~|ݝ&~x&~1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ0P 0 `0SpPQPU% Ѝ  B 10`    0S[  L0  $R,   V &~\&~`&~t&~&~$|$&~010G-S$0@010S 10S,0000 0 0PF0`VGbHDpP倠UG s!0C0 W kp0S$,  `YpP [`&~\&~`&~t&~&~$|0G-@0T$@0@SP 00S,000@p0`0堀S㠐@VG 4!0C0 W ,,p0 00 S #p0S$,  Np` &~\&~`&~t&~$|@- M @ np ЍT  P  T0ݷP 00 0S@SQ 0  0%Z@0p@-0PS``>@P { P P'AO@P4 "P娵ᘶp&~'gC-CM@ `h# d#PȐ`T *F 0pPPCߍw ? P@E#w0S ?@ᳶP?lP@%^@- 㐳%Z 000/&~@-0 ѵ~%Z@- MR0P!00A00P!0 0S˩ pI Ѝ "$ '0P @000 h0h bpX   DH~"$  (0~&~ej_hbgr~ޝO--Xe@PQM 8Pn "0Sr  p:P 0S 3P  Gt00CS01p0pЍ0S P PP pPX ⹶) 84 Rl,p0 ! 0 X 00CS0p YX 0 P 0S  |bPP X0: S /P@ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxPר P $¨X0: SiPX cpPaqb0S 㟛 ጲ J P> 廲PFU  R ,7შP 00 ¯S ,!0 0 @!@ ({{ z0 sp 00@0 JP @p lGP !0S X0;X0X;P ߔ6P !0-S  ҔPUpPt0S  H啳Op @Y&~%Z%YrhGgΈ!5Bs@-@ `PၧP{0P Ui囦噦ЍpU _\\@卦勦0 ;P4KH@ߋ$ߚ߄ߩ߇A-A~M0pSM P0` 0`ŧP?!p! p~,<P 2!@!1P~܍Ѝ0 0`奧P! ~,PP! ~,P `0 0凧P!x W Q \00 00oP 0$ >1$m߸*S00CS0 ȳ0 /O- U`DMp 000D$000 0000S@ȔV"4`0p Q 30Sa4PZ|PZ 0`$0履000 0K4$哥P 0$0V 0030p Q  #vP0 0d 0#0V0030d#_PO 0X#0L3000DЍp(0: S 90 S" ⱦP 000 S|2"00"00 0R  Rz2`2Vn `i S0% 00 0qpq 0S 0㐐唠0 0p) W W)2`V% 0 /010 0R  S0R 0!CQ:++R:0'WW~Ta0@  0 T04[@T ;0W ` W00l W~,0 ~l0`Z BP* BP*Q*S  Q T0`$&&$$'+<&($$@8m&&$}D00S/@-4@~M0S~, eP~܍&$0@-p@$0l00S Ѝ00 0 P0C, /P$&HL0@- R81/P 0 0 %/&h',$&A-p`P@ 0PPEU`@T@A-p`P@ 0PPEU`@T@p@-P@T0` Q@P 0 Q @;;S p٣@P00T@ (0(  /( .$&&@-,BPU` V0bP$00 p?W0 pGWhPh0 SV.00P ЍP#ڀ;;S 00 0 P0Q/PppD1$p0pQ cQ(% 00$0SP ( f.`0S00Z0ES00S0S O0ES $0SJ.D0S @0S <0SPU 3(0( .$&',Dyp1 RW@-`QM R P!  BR@.Ѝ R RR.  6 R R  -R R @pT pR0 LOPo 0p0T D0 L 0TP000S$ʳ/&$$cm3G-0 Q@ ,pPP"ڴAQ"P`0 Q Q 0PD -ЍQ 0S$&@-xaPMP d1@0S2 SQPD;00Q0pp 0 P^ -Ѝ0Q R(0S 0PE 0Pڌ T0 /f0 d4-0 L 0᫣P% 0, z-$&#H&SmiO-rM R4M0`RX0E@FP" F園 0S 0  F0S(0S h  X"sT2p0 004"f>00"#_Tp" #>E܍4ЍT 䁟0S =! !G!0`#A## 㡡10 00Sx1pp10 000!%>08!000$q0 10`(0尐C     ,0 ( $0$0 t  00 0 `### LT$%Z&',&',$K&&h&$C-LRLb0HBS0000 Ѝ((0 0 0S  2 r0S T1 囮  0S 壢pP (0: S)0u p10S10S P)P E0 0 0S q4V 1 L 00 0S000p000 S(00(000 P@0S 000S x0 P 0 0t;P 0X, $&&'+',P'+'+',$*&($',lZ',a&&fA-MM, ⏠P#+H ⃠P"+RB$0`SF 0`CĂ0S2T+pP} Px 0 u S( .p@+l>+h2Lr0`0CSXX5+2+H0+D.+@,+<:+P,P000 0+ 2 `ލЍ+0S  R  sS SS YSUP*yS*$qx*l*<*P,JP 0S8 4AP( \1P *0S(*PP P0000**',s$&',',$$$$Flq /'+&G=\zI, Ml00@-@FpQp`$O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S {*@DT  A0d#0UPTPd*PV0S pW*@X`ꓢ" @2/PL0 !ᓢ#, 0+$$&$&',O-Q0@`p@F T[ PppWPH* ЍPT10S   *p@ 0 $03/P$ 0 R T @ A  80 3/PxP\\00Sd \) Q < 02/P " "',&$:&&`@-AMP/M1,@P+ p`pP/0P0 Uh0h )AލЍT0_"/0P0 0@0 `)&&00CS0 r0 /0O-S$M00`Y P$Ѝ P0,03/P00tL30S,0@Pz=0 Ckz Jލ Ѝ  ȑ Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40 Pz ᰒP#ŒPV  0 `0 + H`\ QX00O0S0(4 008 00',$',X',8',<$$',@a/O-pPM W 0EQ 0S08 0<000S@@0C080pG0S 0`S : 08 0 x! x3  P< @0  0R X2P0P/EP* @0 ,0嘰 R ᾝP` dЍTT 7  ` `PJ,',',<',',Rs@-Ѝp@0 @`PP 08  qP 0 b'*J0@-@MPPᙐ00800S =J"Ѝ0'+G-`QM MJP㠔@ Y #p ZP 0p 0PP=! RS J(Bݍ ЍⷑPJ3 8 = $LH0RP J(L0 00PJ 8 PTyG- QP 4000aq@T+00CS0CpT0 0S0T@ 0 S@ 0 [ P 0S@ 0S0 0 S P '*'+$\%Y 0 0 S00@-@R00000S0@000S `#P LP40P',X',\'*',L '+p@-PP 0S|p `@P` @P0/S000000f PR @@@p'*h0 RX R  H R/< R/ $R/Q/ '*',l',T',|l0A-0S X0XP@0P`PpT R S, 唜0@'+'*/D%Z:C-b@ 0,MS0S.,Ѝ0 0P50C S="T""h"!"""""t20S 0X0 00!P! " V PPP  0!$)$!$ 0!0 㓝 Iz X B(4 : S>  S8  S%  S04 0L! 0 J $! 1P6 S  S0  S04=! 0400S -ЁЂ ;Ѓ"040+04 pPj 0P 00   0 P'*'+g ',$ap@-8M@  VD 0`P`^|U`$ $ @ 0▇P8ЍpA-t1hM0@S T噛hЍA`Z(&="(<p@1WpP0 0000p084 u40CSL$0r"60"$g0( b4 CR+x YAhЍB>'PPS+<  e'+/DrH%G@-@XM="p:(Ŝ0 XЍ-7@-@PppBP Q Ѝ0 0 eC Ѝ0@_C0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Ppp@-PP,@0CQ0#S : P$B0WN%R0CBSB 3b 30PpA0NQC S*p@-@P0*Q@H? $0S\?:! 0S* Q R T 0 Br\  0B~ \! AB~\ " !. Ta Br\ ! p@-@0CQP0#S : P$B02W"N%R0CBPBb 0{@pA0NQC S*80P @-  //',d6A-@8q8`Q PC-PQPUPQ S AsAŢ<:UP0 ddי? 0:S@ 0S000 ,q4'+ %Sq%Z/s@- `0QP@ Q10*P@Ѝp0S mR! bR kR%$+ 0*S xS SwR!$/QP0P@0$+*$& QPP@0PA- 0Sѳ`PpP f0P# X p R 000R p0000S ,P0=0@Pᓙ'+(s@-@n`P0C30 0  R R00P%@P0@( 0ЍpPE 00'+(@-  TA㮖%Z0 Rr @-/$@-4@4AA(>A ;A8A㒖%Z|)O-px j/@ \Pp`W0, [/00 `DO-lM/PPO[`P `0@p/小0/ `0@ ?/@|p??A0s S  R`?`/0X CRSE <&zP񟗳684x14x604x4x4x4x4x6`4x6p6H6P6X4x4x4x4x6x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x4x554x4x66 4x66$4x4x4x4x4x4x4x4x4x15(4x4x4x4x5D5L54x4x4x4x654x4x15L4x54x54x54x4x4x4x4x4x4x334x334x4$4x404@4H4P4x4X444444455 4x5`N>4=Q $,PMP>@J >0 -R,Q0 00 0;= =, 4<=(?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$BB?$BC?$CTCp?$?$?$CCCCC?$?$?$CCC?$DD$D8?$?$?$?$?$?$>0>8>l>?$>?$?$>>>>?$>? ?(?$@@ @(@<@P@d@l?$BR@P꼃@2QH |- 3@ > 2@ 9`3@ <2 3 T2 @ .83" * 2@@ % 2@  2L 2LP 20A00㬁堑 RK aR eBp Q P???????????? !00000 00K1]PJ `1J  P1I  0I Hꈁ 0 010L0㴒1Pd H',$',4'+(',$ %S$%Z'+%Z@&&',t$',8',<$',l'+',xZ$.$$$$$$',|$ ,',, 8%YGe$`Ǜn}',',p$'+',h,`%ZwK',d&+',`QV',\y&',X',P',L',H',D$', ,q4& b',G 0 .',$%S',($ <#EL#A<'0   0G 5가z0Q , G# 01F  1@ P00F 1P`1'PE 1E  1D s1 1C1TPC1PB $2B  42A  D2A  T2` `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C 睓0 0S3# C*SS8C0U Pg000Sv|30UӈePE3PlPN0000S 3 Y0P  /'+(l0P/`0p@-0 PL@LPP@0@P6 8B'+(',I%Z',$A-`  @PA?\+ \ *\.  Q R( [\SPQU !\@@]^.!Lo \0S8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ ',|p@-@@0/SN00N P\IpPQP`Q*C0CT030@"L00Q*pQc@-1MP MAaqUP/RP m0P0Sۍ Ѝ.S@T|`l @ @U',$ Pr I{ O-cM M33 "@p43]PW0`0 00S 0f0 0 0.P``$00 ;RSVz @0 0;T*Q`DV:  cݍ Ѝ&Q) \Q$ 1B\ 0 BQ "P P BRCR0 匒 0@&R\R ,0 0CP;T+ 0S( `0V"p0S 0 0S 嬑0S s  0l 0 x囑@T *0S0T00  R S 0 '+ [%Zq8C-`PMM RP p\SP RT P0S #  0S9ố\S R. gS PS$ SS GS $ᦑ 0 0=pS sS0S00 R @@@(PP叫P z@P p "P ; [0 0a ۍЍ{'+A-PP 0Sp{`p@PL P40  R p`@@ @1F'+X0A-@0LPL`LpT  SL 崐0@'+/D%Zs`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0  04P  0S/  00p0S/  0`0T @0/S000 0D  /'+',l',|'+0A-j40@TPp 00S0o`0 00/S @Tx0T0oP0 SD fP04'+',l',2A-0@SP' 0`.S0.S0S/S X@SP 0 Q CR S.R  S.R0S/S r 10S410S 4P:4 CSR ! Q`V 0/S0S.00 p 00C0V0<0< `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0 0A0 B!"00@%aA-Q@pW :Lp@-`0Sp@e\ 1e #6@ 2P嘈000p 0@-W500S/',0-h0^0 SQ0Q00P', Q#p@-0PSp  lP`0 r   Hv @Tp /$A-`p娀o@PPP@P 0 \IH0@ LD00CS0 $ 0 $',M-`PPЍ8":0J840K0CS 2  `70 01 .  db (l[ <tV @ |pq}  F=/$4  0 =C@2Q! 1Q) ($5Q/^)040)($84K ARKQ  $@ q++@@04(4 :(40/S0004084(49)($ q++ k$', ',G-z4@0CMS*wwxx`xDx$x4xDxD30SPP ލJ(nJ(J(J(',Dm' '+H// Qp@-(0PS$ l` @P|t 0000X0 `%V0  y@pL',TO-P`P Ѝ#:0J84YqW V#/00p0K0CS`3X IPk0<0043  a  d ( |pq  }? 0$00004JH1P tn@0 B(1< P l`<0 㓍 H K06S 0S 3 CRR~~~~|gSt K CRW0 40r;; (49 xS!04(4:(404(49(408400C /Q000S($4S::  $ R(4 @0&"**40 p0 2S($0 *4($040)($84  R KS 0 0 40r;; 0KS8  0w( $ ',',',O-j4@SM- S pcW:ڬ60WS0dpGp0PS/SpS 0EoᨂSXA T0CSPP J0xğs# W/0p -P 0p %P04 T 0 !.00 S~ .4 0pp0(p Pw J60000 0 P JS20 SK010d 043 00 0P J4 S&L p "p Pp e++ 0S  Q0 ^q @ P0 c0C 03 30P J( S0070 0=Pp0u;; A 0  0S  Q0 ^q @  2.0 0~p0<x P J7p0@ P J,1  = 0qpP J<@g\YE    XM  } 0 KpP J} 1P LP$PP P P $p px 0q0cRa1P', {   N 3'+H 7r =0@-PMM@ ` @=XX  0P U;@ 00$0$0<00 0ݍЍ0$ ',p@-@ PP ip@# DA-0p-S0S' ۂ@P#RU 0O0` S0 DPPP40TЍ@`9G Z%Y m-@-0@P   ڕsЍ@Ѝ/',p@-@ATp@0 R PKP ` `P`p',-P@- 00|0 x0x 0 0 h@0S X-L00L0L <O ,嚕$ L Ѝ@ Ѝ/',',P'+'+%Z',$&p@-xt@PlhPP XP pƭt000S  p ',G',x -P7@- 000@ 0 0 0 P0S xK00l0l h XCTᅄD 80 K Ѝ0@Ѝ/',',P'+'+%Z@',$&%Z }@-钜 ց %Z@-M@P@ލ0/S EPtEP up Tup  0RP 0RP  t  000/',@-O 品@ %ZA-q`@ MT tt儁lAPDj00CS0?W@@P hDP0P 0@00aT8@pJ'6A-ppP`0006@(60 0#6000@0CS000SA'-'-p@-P`@T PV 0@p@@-PG-Q=0@T: 0S W@0 Y =P P0 V VX00CS00 wV 0 0 0{@p`'6 $  $C-3sPc 0 p3@0! 0  0004 B @3 3 00`D5蒟 0@ Ѝ/R@R R@ u&@ B&Q  L8< @0=S0  "?R 9R:BP(t0LD|R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R'0o  -R(0h )d%b#`0 ]%a'-F'- '-'- I0@- '- y0s@-0P`0*Z0`0@S P 0R@P@  P@0S00S 0ST P000 R  Ѝp'-'9$ tkF @-L ^$0`|xlHh` @@~8 \  " Q?0 CàΌ c1Œ? l1 0\PQP̠Q  S  S Q PQ PQ!    O-`py딠P @%R=W &R X%1! -[00 @P@ P@ Ѝ'- @-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F/P@$ P@l{ W'-p@-@P0)Sp'-O-@p`@4MTY T\ T( T* #T! @$TX "T 0P#S@    4Ѝ'0DSYJ P@V'0I SP@ 0 0PS@'Y`000`!`0z W! mz! g0  P@@! Z0  @PQVG'T`@@@P, P@z '- /  O-p`M8P谟蠟-!@ )0 N@ 0DS U# 0 U 00S^^ :U 00SY` p PU @ 0DS Ѝ'-C-Pp 0BS00`S@! @ 00 TP`@@ Ѝ'-G-`dP0@S! p0 00P@@'-@-@MP2`PLm0P  IR NRpp ^PpEp@@0PS@ $s2Ѝ'- APG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P22Sp0@1PH0@P4 0S@2r$$'4'9g@P/-0 /RRR00'-@-@PMލ0/S \pnp knp  0RP 0RPp@-`\1@P 1D0p@110"SP Vp|'- ]p@-T` RpH0@Q 8 PP k1pp@'-$8 tO-p/WR 0S)P zB000000000CS020S 3@T  U tU`W61{828b0400@/Sp?DpPI0S0/p0CS0oppW002000pA0P00 -z000 hZU \VU00CS0810S 00CS0 0W00 pR0S/S0@D001@ gP  R*0000t/S0S UP 0/0CS0 pG0S 00CS0001@1@1@'-'-'- q t$'4$IA-`p0@00lP 00CS000S q0P0CS0d00S b%@ HW 406 R0S 0Q'-'- x$'-/DG-2BM8)r0@T%U@P' 0.S00.S000/SSJX20Pp  `PF { ePZ( `V+&<PP "` 0` EV0Ey7z@0-S0SH1@T@<UP"0lPw10S -/pP0: S W }/pPXQP PW 0S| `/pPsЍ$ '6  '-   @-$0Q @ S @'- t p@-L@QM70P000S LTPP 0S}s@@P 101mP00CS00  P 0 O0pzTd'6 ('- <$ ]G-pPp@R` V101 Pp Pp `b\TQ @0T! \0DsQS񟗀4444@H44444444 44444$@0 0BP!0 BS@@00CS00 O 0@0 @T0S 00CS00 tO 0 0SY00CS00 _O 0 AO 1 0d1@ @ @ @ @ @\@@$S hA-@ ` PR 0R 0S SOp0S0 R O0S  OU  pOT{Oy xuOʑ Td@00CS00 N 0 AN$'-'.8&$_g$ 0@-Pu 0X'-@-@(0Q "P'-@-x0@T   @@@@ @Hi@00S 4060S Ѝ'-'4$-$0@- R    '.@-@-   0p@-'.@-@-0@0# H@-P@` =@-@-   3@-@--@-00 " ЍЍ/p@-P@ p@-@-   ЍЍ/ 0H P @-4 4N,P /  t'-0/'.p@-@iPPPP hp` h`P hp` h`ps@-P50@T t0t`6 N (2h0@T POT0 0@ P@DЍp'6r$ B'.';8s@-`P0@S'L<0`%kG{{'jfk[P[x t06S 00S TЍp @0t0S0T.S @N'. 0    /'.@-@TЍ0Ѝ0CSPPPPPpp  000 P v0  6@ 00 0@-@M PU PP 0Fwp ,P   PPP 07wp 8 0  Ѝ0 u0 0'.$<"V$D@-@P 0S0S 5P 00 0A Ѝ';8G-`0S q0P00#@儡T0SX^'@d1$@00CS0D10S )Ѝ00S P Ug}w4  R *P00CS00S UC0S~gCUPsg@ lg0Sl#'-'-'.C-c@PP^0M& S'/,똓sQ8`¸Œ,00TxLLÜLLLLLLLLLLS#$0@30S (K0S 2$P@@T K^0S 0S@+T ^0S$0 0 @^0S 0S$0S 20S 9H+ @@$@++10S #H0S Ho^0S 0S$0S @TM$@P10S H,10S G 10S G00S G  0$ 6 $0?o2$0-0$ R  h00S G 5@4L<K_+  Ѝ$'7X'.'9`$G-PMp@;+0 `㠀堐堠sAPP _+Vx0$`W U ^0S W P 0`S+Ѝ'9$$'.P8PG-P* `0@00 0R0Cp0W S `S0p 00 P++S p0@*PD0(00$+ 0$ 0$/$$'4'.A-Pp`@䀟000{^0S 0S 0S00CS00 0S  BR0 00CS$`0$`0C0 $0 R SP 0$`S S'.$G-P䑟 M^`AV $`v*pWT0尡p0p00WZ 0S- |1|a|4KlK K00CS00 J 0= L00CS00 J 0 J  BN^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 <* Ѝ$'.'9';$(A-@ M p) 0 0P_@T/ 0S0$`V@ 000P 0`@0T$0 R ^ R 0 R 0$0 $0) Ѝ`0'9'.$G-`倂Fo@p0媢S' 0S$ L2LRH23bJ8`JY8([JVWJ00CS00 I 0 IQV000  'P7 V a< 0$000CS0l10SG  D EPq P00CS010S B00CS0 VVp00S #0$0CS0|00S 0S0S000093I8IG 0bI$';$'9(7'-'.'-;p@-42M000000 20S 00S 1 `1 3II0Q@TI1-I⾕PP& |1  1@?0S @T H1宕 >D@I8I$1 I0S  1$ ލpA 0 000 0[BP00CS0 0@ a0 00x0 ?00CS0 0S MIlKIL0HX00S @00S '-$';'9$L'-S'.'-]'-0 @-`o 0 00^0$MSP4P @X(000P p_&P 00S dc?\c0 p000CS0(00S \($Ѝ$'-e'-C-@?mM000@H0?_00?0 0P@,@ (0@ ? `0d00@T 0PPdo0 `0c@T pd0hP 0$o 0lP@T 000P0l $00`0S$'`0 S 0D0>60S >0S$0S 00D0$ 01C 0d>0S$0S ph@DnT@ xP H047S 7S) >0S*00S5 -0000,0(00 0p(0P =&0S(7S%00S 0 0Sd= 8  ,=, jcp@ P 0 ,= M8 = <, R , ,( j%P000<<0S @A @X$ 0 $ ` 0bh<<<K1Gh@T: =p<P`P H00CS00 wG 0PppH@T4`@T @ [00CS00 \G 0 H@`@T0Hk PU#00CS00 @G 0 :!G00CS00 ,G 0  7BP @P07:0P PP@HPP: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP0077S 0Cs0S0TT)SS B70s0SBP0 Q AqQ8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  p8 @  (00(00@070040! 8<000LP7 7H 00R}0( ?$0SP007pGQhJ 0'000 000 7 0|'0x'00$(0h7  10103/$0 7 G474' 6,' EL0S L8 6 6 @ R] 4 0  X $E&@00CS0 ps`60S J⋒P x60S%,0-bS5T6$5D h0 L5,,0( V0000+,0( O#0hE$0(0S,< $ \5 d50S $5,0S p`t<%050S 0 @0 AP0ET?0 000$0 0C0 000|D000t4 8\XQ00CS0D40S P) `40S*T0SXQ^K8 3 3 3 \ 4 03Cg*00!<p3 0 0S '|0R#C#0 0 3 BxhL00S0\P0"0C0000QK8 2C  |2  t2 \ 2 *00 0`2 T0S@"00CS0 2 R   01D0S$mߍ;10S ,0,!SS{1 08 L0H@0DS'.<KA- @PM`Rk4l1000  8p"XZU hBB Q PBLBQ8B 00AS 00CS00 XB 0* 00CS00 HB 0 ЍQ PBB000M x00CS0 TBBHD00S Y,y';8 g$'- &'-*p@-P@@Pp 0S%SpP @p@-P8@Pp 0RPp@P- @0@ R0S P P\ 0$h'.DG-`P@唀0吐00|Up00CS0h00SG0S0 S 0S00%jPPp'-'.D$h'-A-`pP0@00 Q Q:R@ @:QR@P0SwppR %Rw@/%Ppp0V:SP0@w@';8'$hIA-`P倀000|Vp00CS0T00SA0Sp00Mi@T`'-'.D'-0A-pPS R+ƒ`a@T"W p000$[ 0 @0 0 Rj00CS0H00S F`P `@'.<'-'-p@-P$@Pp0P0@P@-L@000@00 [i00CS000S@'-'.<'-O-PM/`@ 0;P @@@ (\P000 _0S [0S W000Ѝ#   P@ |,P @bPR R R R 0S 0   " R0""  " /R0 dpP>Z0 R"00ㄲ0  pPZ m P2 @ 08@00Q  0S/R10SZ #P %pP A0000S R  pJt#P R  R (\P0 * R; R 60@@DL P R  IV T@0000S R    BR =D R9 7 a';8H$h'.<$:I'-Q$V'-O-@`pM&PP'0S*[ 000`0p0Sw|2!| S6hB{?01 P?PЍbPEUh|hhhhhhhhhhh00p`@[ Q ,$V  0P!0X ZWYV M1 00 _0S& 0s1TP P*X 00SW0 0 S0 P 0S4YT 0s P kX@Tk'6'.D$u'.';8$hp@-`P0000S S@RK000 00 00000CS0p00Spp@ '-'-0@-x@M0 0000\0P>00J 00CS0$00S Ѝ0@Ѝ0'-$'-@-gP 0SKO-@p`SM%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩|P`p00S"" 0R"PW>= >0 @ TW 8L> P 4|>>0 R @ T Ѝk>>A00CS00 > 0 00  x100/XPXP!  eZZW YM>J>TYPW@>W~`F_bhWxWtWq ~W 0` @ p`=`''6/D4r'5E$';8KYR0Rh}O- MLBLRp0@0`V' VV:V  VF /V   BR 7` F R! R  |a[  0000SH B@P   ~p[/R 0/S }0TX|\P ЍG\ @TW 0 BR r R  BR    BR  I D $'.'4$JA-(A0S 0PS0 0aqP0S00 P000De00CS00S P 0SRh`hp0P RP000 e000CS00S '.'-'-'.s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `E@ 0S00S=STL00 <0 R0AD1U0 S 0S$'6'6A-dp`0PS@  R Rt00PH @'.O-rPԂ0M00B00 00$`0040Ce ?4`PP00CS0E0S00CS020S - HVP+0S 000PVP Vd P <10S 0EC0P0CS0X10S Ѝ000 @H[ [` V (Q P PAP 0 SR BR r R  B ~  ` B `FAQV  RP P'.$'-'4'-'.J1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xqQBP  `V' Q`:00Q@  @% Y0S" S凾P 傾P@zP Pu DoQP @@` '.';L'.$"HA-XPX@X`P0p00\c0p0CS00S '.'-'-p@-P$@ d0@ p'.@-QP`p0G0S `*00E@P`P P `R@ Ѝ0P@@0`SP0S0O-@ Y X0 S@0 S@HY" \YX0 S@0 x0s0S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x r SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x~^\| ]\Q000``S XSQ0 0 @ 0000xqQuS^ P[Sc:Q! P-Qe]Qb  \QQ PP$"`( xP1 0$0 $`( xP%H0 %PP0 QPQ P !$ P80QP*0$0bP b`0]S0 S 0p@Y(\PP  8QP4\SSPP0 SP0S  @p4FO- P@M0?S*S3 [S;0^S!S00x|\/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xpPS@0/SR"@ R0A$x r RP R  \$$ЍTPX9$P| 0U0/Sd 00EpP $0S/00E0S``0` xqQP 0S tV/00D0x r RP0  Q: 0 R /00@>0P .Z. B/o" R  P V0 a$'.D'-0 q Q0@-0 @\C\0CC/x~^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S3 P i$$$`0$000CS0H00S V 0S ~0P'.'-'-p@-@ PTp 0@ @@'.G-p 0s0 S QA0P 耟`V ?`R`F@ V PPLX@S`` S =QQ RU  0P   PF0G-p@ Mo oF0P 6z8a000e U00SW-00E@`PIPE@T Ѝ00CS0@'4O- R@@0`-SPM S! C RtlD?So @Sy 00C Sh0 0 @`0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P@7@p<(W@A0S 0g0CS00  P6FBЍ666=0000Q00S h6h pR\&TV(0S 0 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 R I 0  U  R~ȣ0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   K ~ E   0S q QAQ$AQ!   Q R V  BR + `w ~  0 BR儡  BR  ~ ~  `K E~paQ 00S T 0s0 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00'6'6J'4'.$'4'.,$';L$O-$M000 Z0 0H'0=ᓸ,W0Jp00 0 7'0` 0`F#ZGF@Y0/ 0p@P`6 Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG (A;9 6`0P`F 0 0S Z?0Y : @5% @AQ TK[Y0I Y@i ZD5  A0B F0  %T5  0 Z@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R%p#t#X$$#####%l%l%l%l$3  AQ AQ~00AQ ~ K R  BR ~0 0  BR f~0 0` @0RP[ 22 0AT[ @T 000S[@Zp  Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0 0000P  00B 0C 0000000T0 00qP 000l0 GR00#S00 B00S0p0 G0 B0 [m$Ѝ|0s0S[0000p0SQF'.':$$'4'6J'9O-0M Pp0 5 500 E 00B 00~S P0 0`Z Z":Z =Z Z! Z     BR  W wPR 0 AAK J R񟗋*,'h*L*L*p'h'(((Y 0S`Ѝ0S 0S0@S0=S( ( # #00CS00 w 00w00  4#00CS0 0 u #000P00u00"00CS00 00 00(0S 0  CR  SR`0C 0 Y 0"00CS00 v 00v000aS00s0 S 00CS00 ~  BR   Zl!`00000~00  `  000{  BR !  匵P  AA ^  ~R[=Z0SV 00}U P ` ';L$'.$'9'4G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S#000`0`0CS0!0 0@p  H 0  X 0  R 000 0p $'.$'4$'9'. @-0 @$O-XAX`0$M`F*h$'4Ei0S/p@-@PP1PL1DP0a 0(00R 0S"00D05#0s  0C?o2^0SP㙘pP VyP p0C Ao PQP0S*00CS0p,00Spp@8'3<Or5'-'-p@-@\P0P00 dT@00CS0p00Spp@'-'-O-@`LM R0 LЍO>,ؐY) PPY   0SPs  0 S S S PQ 00SЀ0S@LЍ0S}22 F!0R+  p  !R -  x" ,p 0 0H"+ sp0 sT T0gp+ 00CS0Z+0p W +㴱p^ Z 00CS0C+0 00CS07+0 | 00CS0++0  Ѐ YZ +000u + #40  + +P S#4sU 0 0p@ gd `+pZ*0㓉#ЀC:'3<$tOr5&E8 @- 0 S  .^\Q0  p@ S0C  C/o "P R pO-PP10 0%SW P Y0@S!!Q@ C$0S 0S  R-S %S +S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  P T"@` P+P \0@00SJ R Q !" R @$t,K'3<;[G-$a$50S Qq0m0@Sk @ *Р㼐0Sʰ00CS00 ) 0 D+0 R  0 S !U*'3<r'6Or5yi&$A-p@`QP00Sxt10P 0S XjPp pP@ gP`WP P11@*@V Q@ T0`p0S0 *@00CS0|)0S 0 0 00SJ 0 S 0 0'6'30 000E000PS V 00CS0l00SG E  P0(` o0`00'-$'4'-T 000@0A00CS0/00S/'-$'-p@-$@P0 0C0C0p$'4p@-(P(`@0@D00C0p$'4( A00C 00 0C0/$'4-A-@P(MHp@`DpPVP u sT(01 0P @ @`@DPpU(ЍAЍ/T (01 p@H0 P Hpw T4O-` 0$^ 00\%P0@-]$0S/p@-@PPEPp@gCfCA-@1S`p@DPU 0@P00` P'6O-@P0q儑0`0S -R  RF -R0SF P +R: `cP Z TPoP0S TP T``T |0|0T0rP0S \HT PT<0@@T0SOz'6'6  -$P0A-B00`0Q 0S 00S0S006X pWrP nP6p60S0S60N0S60N0F0 0C?oR20S  0-S0F01P0CSQC0SQ0 0SeP   000S 0 0^0 PA! R   R0 0'6$?'.8P0 b@-\@000D00S 00CS000S '-'6'-000C S/ @-##P 0 '6G-0p RP 0S5Q 0S @0?` 0CC10@ !,a``@ `Y@j `` -R \ -Q0S 0`@T0:SF 0R@1T0:Y " @`'@ `0 T 0:S  @`@?:\00|@Y00  T@0 CB!0 4$@ ЍhMT$rP@-H[D0P  Q 000CH Ѝ'6'6 $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ HPP0 @:T  ($'6G-tR@ 0S PP -R`@@$0P 0S 0S@0-S ;@T 0T T@/@DSq0`000@@CA!0S:0\:0l0@#1 T030V:0 000CS0 10S t3  0 #@0S`p0C 0 XZ0Oa0C R 0 0CS0H00S C@0S y@'6'-'- p@-H@HP080Sp0u`0CS0` 800C805$'4 0R @-@T P@0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @$ 0S/xqQS  0s0 S/00 0/0S/0/F08 0/=P/P/0/F0 0@-0$p@-`R`@P:P t0 0Ppd0 Pp0-S0S0 0pV ($00080@p'3'3$O-RM0 p0pᔒb"%Q  X @  [c { R00CS0`S``@520`0@Ѝ X @ ,\[8R /x P0  BR (000kp 0 S B R { [000Xp X R  [R. @@  B@;0  / Q P Pp P  Q  R P000@00 w 0 C$p$'4$$0-0@ P RDM`j0 Ph h "  aU0L T<0< 1 0 01 0 $/D!@-P@M0 D 0P0S3p`@T*vpPT @T=PLP @0 ᶢPЍ@$$'7Tbl000S p@-XP@T T D0T@p8040@p 0 /$'/4vr':$p';$@-0@?'/4p@-d@dPl\Ppi P 00008  P8 S Xp@T$p$٥A-DR0@T @ B 0S 0 @ 0r8 0 00CS0!0`)V*V V v va A ` 0F S V@0000 @\V. |V ;V&P @0 ;P @0 @0 Ppx&P@0 @0o|P@0 @0@0@0p P  00P000K 0 $$p'.'.NG-pc0@0 T T+P,0S)㰀" CPP @  @@`P  0RקP `FFa@@T 0 $4p@-`0$P P g 0R$, (@R   RP3Pf    Q D 00000S@p 0 BRp@ Q080@ p$@-y0 000$@-@oPp@-+ @fP P @0 000p` P @`@`$ O-С`P0 $ @CPp/0 CR00SY%3PB%V 0 H100SD (100S @ 0YP@0@Y PX @PW W! V! u000 @(pGWoVP0V      000$O-PKM 0 5@00 04 P00400D$0d``P  0S T< 40  |4 R`t$0000 `SH4 ` ^,4$ ($00CS0c 0Sf@pW 0䃟RPp *p0PC0pC0 Sڈ#sV@0  *0 0C0Ps000;0 000CS0030S0@2 0 2 0 02 P B1 2R z0u`B0PUZKߍ20S d2h@d2d0p@00 0S V 0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PR@0000 H@!00CS0 0000DP3: 1.3@@*pb0PC2P \00:0-,M00CS0`fR {00^$'-$'-$p$'4'-0O-鸯帿pM0ϟ  Q"/O/0 0202280 `00P/20S0S 2Y Hd8|T</Q00S: P.Q00S1 0P0C0p0000PbP.00CS0)<.0p210SxPpNTP"Pg KPEpE U0@#S?8,LDp6p P00@ S0P@ A0@S7P@a0@SdWP@ W_ P H'P 0p@Wn00@S"cwWf'PG\p0000Pgw<0 0CS00C0~00P00C0l0P@E00@S0P@8u Y p0P0C0t0E4`0@?o? @2;R0S 6\P'\Pp ?PPpppWppUpW 6;E S8 5:0 S0 U0C *0?0%3?P00q Q~  B  PA0U!*00%60%3?00q Q~  B  ?PA00q QPA~P•3U5*00%90%6?00q Q~  B  A0%3?00q Q~A• ?P B 00 r R P B ~ P  B u300%<0%9?00q Q~  B  A0%6?00q Q~A•  B 0%3?00 r R~   B  U?p00%?0%WUT@>P0 |P0 &PU000@$P 0Ѝ $$pL$H'.'.M2iv'3'3$%aF'7'4$'4NJP"0 ,  0@ 0 0 S0Q >W @<P >P" &P0000000p0p0((0 P -P 0(0  pO0ZP0  0{P BP 10 }0 01{W00E000C00R#PpIN}PP 1 " )00 0: =}P,p @R<2 3 wp BR *p* p|2  BR P=  ŤM= P2 Y%W :W5 #Wg}w 0P 0 xl10G P wp BR pYpT3 0 @ R  B 0p3p&P3?  BR 4p02!R1S $HQ x0H@ 00 X"0`0001BP11=tP|4  wp BR pPP4HW I/o}W" R #p BR p P 0X0 'P02`5Qw0  0y0"0 `! $0  0G-`̠̀0@T@@0PU @ 0S 40 0  B/o"`f0p 0S 0 R U0 0 0i$L@-P0@-2aM0$ 0 10< 010@051|0000UYPI@1| 1Q @@00W d 0S $Q. 4QG Q ,4  8000<  ,000 0 0 >0 0 0 S00aߍ0  p0 `0 %H0 D0 H00SXS,0㏽ 0'-$'-$L$'-r G-Vp0 004 P" 000-P6pppppppƔppp|l00|<0$00pK@P 0 R |0f` p    Q0@0S 0 00}Wx P0, R_P}1 000@ 00 00 R, R孞P4 00300 0000    BR   00` P 0000 CR Sm 0 tP P`  ``s 0 0008 @0C 0 00`0 SlVP XC0 R   L000`0S.0 R Ӻ00 P 0 R000 0  P 0@S P 000 x`@`0P0|0` P/ 00000PU# T 0S U0@P0@00S0P0S0S 000@Ѝ0$00p$$$A-Q@`Q` @ p0 P0 0X@p 0HP Q$@@`Q < W R    0 00 00 @ 0p0 `4 P  /`P l0 08 00C004`ЍRQ$$p A-P0 5P@. 000`+P p@``@@P 0`0 U000 PPe``PP0S $$p@-@|PP ,0 @P P 00000Sp ]pp$ P/0S/80 P/0S Q/0'7HA-@Pp`00p` P@-` a%P&0@ pT@š PP  z$ Ѝ d@Po$ʚǚĚ 㾚 d %e$ 0P/'7HRQA-`Pp%%pWpPpW@ U >$`0 R@%P P4 0ź)$0 $A-`P@xpT@Q00C0U U 1@P0 P#'7Hp@-X@X`0P0000100CS0p00Spp@Z'-'7H'-p@-PX0@TpU@PU@TpP#P'7H|0p@- PR @RP #0 _P `#3 Ap$p@-@tP0 S000C T  D#P 0S#,03O@dA T @0@p@$fffg'7Hp@-`P0 Sڜ S  f#@P t0 R@U e#pA0S 0 S N#@30S '7H'3$p@-P @0Pp @  0p'7H@0@-@ P  Q 0@0#0'7H 0 P/ R/'7HC-LsP0 U00000@0CMS񟗮Ӭ$Ӽ԰԰` "@P@2@ٝ 厹"@P2 R@Ux20S Tq " "`<"<"@P2V0S' `"p@!  $pP"뙝P 1 唝峹 0: S"놝00`l!x`\!l `V'jPP s2 0(% V U0S000  (P @VY2 0o"00CS000S ܸЍ@p8T 0P472 DZC"'-'.@ Z$$  2'-VRp@-@P PP Up 2 |¸"p`U "p0U 1 ppO-P `ppW@p  0Ù`ȐȠȰ0S UT  O   0@  U  }T 0S@@ `U $rjm{aFlp@-P  @!p R  !p d0 Rp  !p !p !p''7H$p@-@PpD0 0RPPp03/u!Pp'7HO-@$M0@000`p@A p2@ ̒V 0S"2 0S2" $Ѝ2@0Sڐ2 R@00CS 0SP P 1 8ʷ#!PzsPP jT !0S_ ZPPZ!봡P000P000 S`|1 0R  pP\Hԛ B R% ͛0 ( C  PP  R   PP UP  ꬛ R rP0 00CS0t00S .T0 00`Q RP'7H$$$'3'3('-$+'-O-`0Pd#dCM`s`` `00 6p(V( PEWUCc 0 pW` w@p00S0SᩖP20SU0SRp0sS vS V`p0+S -S X @ᄖ @Q0 @R: GP     /PU 0 P0SA<0OЍVF p p0 %  " Q  %5S' p"Κ/ Q  0p0T ʷ00崚/ j X0 M IU00 DZ,q,%S-,q4m{'3'3e2W$A-PQU 00CSQHq10SL R@ 0r`0CS00 `01L00<S0S  50qL0S 0CS>S0SSxh R 00CS00 - Ip@-@)0TP R R R& 1S# 0 PpR!Q QT " "D0600S0T0S 00S0'7X'-'-$@-@1P @!.PRRP@-@P RP0  R+ '9d QA-@ 00CS00 P `tpt ?U UH?U!P0P0CS00 `gFlG-@Pp000 T` 0000CS0H00SG0S 00S K,@'-'7X'-P P0  /\ Q0 S//'7X@-b@0pSM910S5 0SPPT,2C 02S cp? 0Sl UX U` Pᯔp2 W`RU-R0@D>T000 0i00 10S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ '7X'4$'6PO-`@TޕP P@ؕP ,ӕP0FpS`@ PCPBPᾕP34 尕PP`tDa0S! 0008+U 00CS0 PT40S 00CS0 40S ݳP@U00P@`s䃟1 R 0PU TgO@`@VT @c儃Q0S 00S 3@@TP@P @=PP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X P̱̑@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR ;*pVP 00CS0\00S 0U00 Ph BC $ ,'7X'-'-` .Fl 9 $$ /DA-@P P0` pUTA0S 00S Do0@0@000CS0 00S P'7X'7\'-'-p@-H@P02`S@20CSptV02p'7X40T0P?o20S 0S//'7XC-p@`1010r!Q0@S10C1 ЍqXPU X2ePs)ԼP 0S ׼'7X'.,@ 0P/!!R /'7Xp@-8P\2Sp@?<9\Bp'7X0-MM01`"R !R X"R   1 1d"1!d2S ,MMPl1, ,DMP L!0,00;M@P$1, @T0d`0P, U @T 0S P00CS0 ! ᮑ00 0$0(00D>S &00 /"!031'7X'.,'-'- 0@-`"dy'7Xp@-L@'P̃0PPp0C/U00pLp@-T@TP0 0P0 (0 0000CS0p00Spp@q'-$'-A-@R`P  0PPEU`pp WD軕0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000 0 000CS0h00S sDP`000 0 0C0'9'-'-p@-@P@0SH00Spp@00CS00  $0$0$@-@P(Ѝ -@-   Ѝ Ѝ/-@- 0  ЍЍ/$ -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`ὂP$ 0S! lu0S00CS0>0 "  u00CS0/0 " 0S ȽpW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' !L$0Q$@-@@$@-0rS!!80G-p0 P0R(0帐@0=00=``F@VPpPER000 S=S B`` R`ĥ`PG褙@$'4$0@- 4@ 00C00 0 0k%Ѝ'9!]0P P PR00/0@-HP@^ ^ R0L00FA-鸀(  R i(p`@pW p0S 0QPU  0S 0S   3/P@P00'90SfA-@PU p`pp0S'STP@DAM';PP(  EB 6!e!!}ghA-P0`Sp@    3/@PP@X #W p0@=S0U0 0 00CS00  0 00CS00 x 0 T $0O-@00Sp 00P㼀✠Z  0~@PU* Ѝ`V Y   [ Qʁ~aP`0p'9'90@ R P=R/=R/A-`P0S=SPERPU@'\0\p!0qV@pT 0S !nPVpp@'9'9@-1`0@S @  PPV 0 `N% Z h.  `R Ѝ@@%Dq   R <0 2/0`+% 0R , R  00 0000@!L@0P U U0 e00CS0`00S Ѝ@Y0#L 00P P Ѝ$!'-'9'--p0GM00`000HP  80  00 Gߍ0  0 g'-'-A-`p= P 墭@VPp ?PuP0D @S= O 0V  @e%`ЍA70C!-GMP00 0HP00$0 0  Gߍ'-p@->X@P0`s$@0U<z> 0U`00 0p@'9!!q!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    \$Ѝ'6!'6'.8$'3p@-@`TP000T 00CS0p,00Spp@̬@'-'-s@-P@T@ bPP0 P00Ѝp@n` PP 0 @=00000 00PЍp'9!A-PpU`A0  #0#@TP@ 0@00`'9 @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =_~@@'. C-pP@0聟rS``PW! 100S T! 0  ЍC^nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000  h5@0 L -@   W P ƫ/t'6!!s@- P`@@P 0 Q   00 00CS000S ~ЍpQ     R T0000   " 0 "'-'-A-`pĀ@TP0U0  ᧆ ">|"0S R   0 02/0 d"00 0000'9$$A-p`P@P 0`0PPEPvT` eTp` fTxTp`X @V R@" '6PP@-  V"C-ܑp000P0`-S㴁@TQ ,@ 0@00`0CS0Uh10SQ ЍC趪 Z@P=|P 0 @0 0  0 00 00000  0  RP 00 00=S Vt0T 10=S010C0 0P00 Ѝ'-'9$$'-  ':p@-@PTpu@p@-ѴP@`P \oNP@ xP@ IP@P(P0 P pV"@".'600@/ 0S0@/s@-@቎0 0`Pဎ0S |0"S U1r0!l%*0S`0T&000 @0C?o2R0SЍp"%a"@-M@ P ލP@ D0RQH0PP0@-M@ P ލP@0D SPH0PP0@-M@ mP ލeP 0RP 0RPA-@`PI0 0SC PUA PPPspPJ! 0RA @- 0-RS# 0S0 00t# Ѝ0SX0 0P0S00 040,P$P<d,"40@-0P!S@M0SPЍ0P| 0SyPUo U U Po U P? PPEUR`8HT| O  P  P  P  P  P  P P t0Sp00@T @50(S0)S0 0pnp@-@`P'P} 0Sz00CSt\|Htoop PP.@`*TV#`@VT@`V@ @` Q@`Q@`V@'Dal0S0!SPpp(S0)S0S pp@-@P哉PPE獉P.U)PP0op=Pp0 \0!S0P p(S0)S0S ֧p![""@-#0B٧#$@-$0$0 00 ˧'.8$#?@- @ᰄ R0Q0\ * ѧЍ#O-@`@M T0pD P-R lRC 5R -R| `8D@P{2 000E @PppGWP PW pGP〢倲PE0%S``PX寧pW ;sR R`6pTP`2垧PU W@1 000 PPP@U _DP@ 1 GDp ]DP lKh7)X嗈@P C@P0S0Sp@$DpA0 0  0X` R Q!q *S0* 0R dS 2-pv   TTTsor%ah#5$#$#/Dtk1$#H0@-DM[0   0@@DPU#@0 k   v0P x, pp LdDЍ0=xP '.'/<-t$$b?q$ hp@-y00S 0| 0x 0p0p p@0   PU P@P0P H0H P pg Pp'-'.'.'7 $'7H$$$$$p@-@0@r 0 0@0PU@0000A d0 R 00CS0H00S p@[@C0PC'.,$'3D$'-'9p'-P/p@-@PTp000@p@-@P: 6$A 1|@  < S S  SP  L6 CVyP   $W        @u̅0ST  ␪l⎪ X@ |@W ht @ Lx@l 4`(TL@ 44,@   T4 @KV ` X@H~x<z 4hv `$r Pn Dj<<f0b(^Z3U@V LHD @>|<@l 0@4TY Vt,<*8 $"H@V S  W  2VxApr`VЍ00 d @V   Q   0넑0l  @ TYlW@ p)^)~)))))))))))** ***$*,*7*?*F*N*U*[*b*h*o*y*x*********))N******)V+ )o))))))))))))** ***#*+)-*>*G*M*T*\*a*i*p***)6*****)?)G*)>)F) )) ******)U*+@-4, x%+%Z@-,0, P 0 0 h';2+%Z+s@-@`~000 #S@xP~0S  06Q00S 0 &QЍpg,0S/#Sp@-@,P$p0P 00p';2{@-PRP@ p`@p 0R" Ѝ~0"S0SO 00SS  00@O%a@-TpPL0 p@{~0"SPЍ,g';,w@-TpPL0 p@`~0"SPЍ,';,p@-d@P0S 0S 0SS 888 U   S$Pp';Q6,p@-Px@Q d|Pf{P L0    P    pp@ @H,';0@-@PPM 0SLD00Ѝ000 0?P0 0 ,'<-@-}0S S S8 4 ЍS$ Ѝ-g-o-(-0/O- pPMPa  R <$,. P R ߍꃿ Q R c@sQ Q@ Q@ YT WpZ: R DA 03/PUPP';.1.GU.h.7@-lP$ R\O@4 H$0S p (O O Ѝ0';.'A..p@-@P 0Sp@t0PS 0P0300Sp/0@-N*PD@D D`DpD0S: 00 H/3/:%ZVC-P`PM 0S00(p/p0 @P" @/Q `0p0@0P T0p &PH$0@@ 00Ѝ ,'<';/HG-@0X T3 HRD2D1H#<*( 4 &, ("0 8 4 #4R!  !4S !4S !4S h!4S Lp!P0S t0T!T0S \p(HP8W ЍGk0S. a`v`  0 0 0US !S|  !3 \0US:3  U02,   0tpP/e%Z@Hp0//////`/r//////BB//hZ00hi(O-Qx ,@QdP0QL 4QP8PQ$80S,00 80<0S#<0P;PP;P1 QB"8`㠱8X0apS wpR   <0RTP)0< S4}P0S9`(xQ p(xQ i@P0S0 BS `a 0pWh R  R* P*da D(Z00*0;0N0`00';11|1100192O-4+M p* bP 0$S ^ߍS P@T[D@lP 늤 40ਫR ZS$ "$0f0Qf/jr,2!S!R !SS0С1,21S ?1P P @ P0 0ꌡ1P#>00 P,2 S,% P 0 @p#>00?s0 R* 0S 0pj5 P 0S 0 p1Sw j  P@ 1S j+ f/jq01P P%DP 'A';2&2MWEV}}2VEWr2u223 '=%Z@A-P@p+P` %R 0R000005Sw D $0f0Q $L  ';'A3)'<p@-0@P  P$p@`x$0@-0S ,P';@-P  '<O-@:P,kCM M00 8P( 8cP008$80p0SP :gP  @00  Y x @wP 1(p Xep p@ 2wP$4 X p: 0 $0,P$0S  $02P P pGGqrwP,圙圩$ pW 0S$00s  P$00  P$00$0  P$00   d@vP pWa 0SY] 0 0$0P J@: 8$ 1\ t$ XP( $0S  S;Ƒ8@.0;RZ(( vP  y %vP v P0 0$0P$0S ++RP0 0  |mv P 0 0$0nP$0T0 <\v P 0 0$0]P$0`0 Kv P 0 0$0LP$0X0 :v P 0 0$0;P$0\0 |)vP l$vP 0 0$0$P$0d0 (vP  50$0P$07 v P  l50$0P$07 {u P  (50$0P$07r jdu P  40$0P$07a Y$u P 0 0$0P$0x0P Hu P 0 0$0P$0|0? 780aJx0S0S  |*P0X: `X0 H0I0?0t 0 ST 7 6 2Z/ \@0S 1 #0Գ000S05 0  3000"0$0 0 0 $0dP @$0!S D@0$0|2$ 2 ,@pCލ Ѝ0S 0Rs  QP0 qSP0!A"A] ';3Z/0-3^ǘCCC333'<33A'<C'<(334 44*]R4:4H4U4Y4d4n4{4444'<%a45%,s@-`0PU V  Pp@P hЍp`PD!n 00"c0@V 5TN$00S @-w00$,p@-@5S4 0PSP p@<$Pp0S 5S 1S 2I|Pp5S T \Pp< HPp(( PpI';'<`5~AdeAdr5s@- 1 AP(000(`;a5 S4 5S Pv0S v0S005S  Pt p0pP"5S ЍpH DlP8 VEW';聘df5dm5$,pL'<dg5@-@P f/[m@'< 0 I$,'A܀dm0S/!  -3@-P)T P 0S S@@ ᩈP@Ѝ0@ Ѝ/%Yp@-4@4PQa=p@`  @$4 0S6 TQ+BQQ+PK10S+ 8@ 0pp 000 C0ASuduDuDuDuuDuDuDuxuDuuDuDuDuDuDtuc0As Rxt Ѝ0zg{{'P{ zg{{{ { { @'a=Y=h@-\@\0MQP  HP 0nS yS0 $Ğ00ۍ'aKPp==P `00CS`0p S00 P0S X0X /X%YG-P 0p`0m@P GpG pT@Y @ 0@`Hf<Pp E;qp〠 0  aP U o`V `` XPЍ=s$%Z@O-@M MhP`JX%XTuTT0S0#!pD P qP P'p0 p( P ] nTt`(p P  HSP `ZP<08 Tt`( p P  $SP 0(0Ss`, p P   SP 0,0xSXs`0 p P  RP 4000$Sr`8 }p P  RP 080Rr`4 fp P  RP l040xRDr`< Op~ P  RP o0<0 Rq`$8pg P  RP X04Qq`$!pP P  RP A04xQ`$ p: P  mRP 8+04(Qp`P p# P  VRP 0P0P|p`T P  @RP 0T0ۍ Ѝ='=%Z@=>>;>N_>j>%>>>>??*?I?k????@@6@V@y@@@@O-M@ M0˜(p PT `V:0S0`S:P`P8apEbWWnF `F`0E8ġ0 0S0A"S0#1` lop P( APoP@#" 44n oP0S  3/ PA P ,ࠐ异Rx%.A 5p P" 4SA4`S>94`P92a0C" 20< S :A$E"YA=x5|%.A  pY P0 <x5 0AApqAA0 P<0QADx[0x5< 0RA| MP 0 000S P0`p尀(V R s S 0 0)0`PXލ ЍAA#$4A.,AEAAAaABAB#'A%Z@'aB; - BR0 R A-P@( R1!  00 fX0 `X0 pZX0 \T ( H, <0 08 $4 < $$$$P T 0p 1R0S*0X`p\PQ Vl A`CzHSCCCCCCCCCCCDD#D6D?DOD^DpDDT%O-pᔀ 2MSR R@`aW 8QT ,[Q 0Zn0 Tn  m0@"  8 En,  ?n m`@04" o $ 0W !R21` N 0S 0Cs RjSg  1 0 02 p&8QI SmT <0P+8mQ* 8 0A0;m @2<0P+8mQ *ЍOD0 0 02  02 p d8 T ЍOЍDDDDDrDEGETtE EE-E?A-@Pp(D< `8SA_ 0`EZEj0/p/0p@-  R( R((,,004488<<DDPPT@TXPl XRl@PUt @ 0T0p  Q CQCQ}C'<@-@t40Pt08Zf/fVEW0H @-P \PY Q@5VEW'<80@-0@S K08f/tf'= 0PQ0//@-L0 D<<!8@8P(` Ru 0E%ZE$IP7@-@ PTlP0 08P8 0p0 A Ѝ00'advK0@?o2P0S@- p`P\l@P WlP RlP MlP@V@lDlPH@T@T ~p0 4OA@@ ЍQGE'aduK0@-PM xdP@` ^p D0A 0 400+ +Ѝ0'a@dzEFFs@-@ >p A0  0 0`P   0   z0  hs0  Pl0  8eЍp'a@dtF=FJFaFyF8rFFFG G9( p@-@PM`Pn p  ( nV V d8PЍp (dH( p 0@ 0#'a@(d}Gg:(d~GyG0@-PM @ dP 8{@4P 0p0 v@Ѝ0G'ad{KC-`0@Pp!匁匑,M00 W p0SP@TTA  zp  0L@eP qP p` $0Q 00S*@P *@QVW V 0Y R00tP 0S,Ѝ00* *  `@,q,%SG'ad|GGH r$H%H6@-P$M /@P p p?Ll  0P0`S >l0"S U1r0%*V1l  &0p0S #l 0"Rspo>PdPd `尀pp0 8f>0ЍIIJJ.JHJbJz'adyKJC-p`@P Q B>,iP 03/ ЍC@@ R; B8p *>$J'ag 0@- >'aKP7@- UP@ThP DhP804 /p Ѝ0pKP'adwP7@- 34P@, ps Ѝ0'a@dJ@-(0   K%ZO-p0$M@QP`H0 00000X$Ѝ a p= P p 0 S 0T@0Sxt ZV XW 0  @DLSdL^hp@-@P7P1P' 0P, 8>0P  X=0P 0P 0Pp@Д8p@ 0x@dp@qU@@幔PpdictarayLnmbrstng$W*ggL 213/P/'eA-PT0p`g@g,0T@@DA??@'e?0@-0@ 202 0e0Q!Q3'e> 0R//G-`pB 0PeE g@PPXW 20CS20CS GI0'eMM@-@p 2SM"n#^ 7 2"0 E 2")HЍ@$""2d` E"2@ X"\4Ѝ@'e$MMN#NJNXNbNNOOYs@-P`j  0SЍp00S@i0"S1Ds@-$M@Qe00  0 0UrO%ZA-`P 0p @Tʬ%< /, q0d / 01`pq  RЍAL`0S`@D@,` Ѝ$R$R:'eA-0ppP@`ph!14P S H d" R S R 0 L 9fRWU'eRup@-4@PL2S0H( ##i0B1p'e0/p@-P@ŽQUp@(Q B?   ^ L043c 0PpQ B?   P Ƞ̌ Č @'eX0P@-<8B 0"@@$18<4@'eO-PLMx0 $0|0#(0p0@00030儠s,4000S9 230( `0$ 0c  0/c0   0c 000  0 c#,bd"}P : 0,0 "囑 0 RD0 $R0 S p2000#1-R0" 4DD`P@0`p0P00S tP  tP  tP% D`a0D00 S> c0g24 p3lU$[EL10?$S%\2 ncP@\2CP0p0PXBp0 X20@Pp0 X20T@Pp0 X20T@P`D`(0T$0000Z 00S $0 0(00 0h @ PLЍ P @XR'e$R'hX%Yw5R/0%a"HS|;SS S(-s@-@00CS0 &&P` Pp pp!:0 P00CS0&0 Y@oЍp@Ѝ/%YSLw5O-a@ p9Pp?C$0e@O 0^pq Ѝ  R ЍOrt`0S 0 ]pq `BE,q^ Y0S $SR'e0p@-"@R  lP"n/Y^0!!UU08 T0p@@PB @f@Tp'e'oh'gG-HbpH@,#"`PPH 9 P UW0剔LI J$ K0,fU 02U!U !" +I s?@sό0QlX2 G    <1 81 41#(,$#(,sO$@tr ,! (! $!0000 0 8< 4^0 p 0 8< 4P0 @H20H2'e='h p@-d@0P01ps/Ġ2P@ `^`H"̌ B B$ ?KH20CH2p'eO-Q04 ЍQ\l hX0)S  FZ0)S  ?R0  6Q !P500 0a 0<  P2S8#'eUat°UjrUy$UUUUUWW>V"UTU@V<VDVdUVVVVTVVA-x RUP@P@aЍPP0RB1P@4a4aTSp ЍA 0p p 11!1<0  11 ?01!1<0d  1P 1@?0ЍA'eϯrWFWVWeWvWWWWWWWO-- 2S "$, 00S1 1S. 0W , Q  RW !(,$!(,0$0W0,,0`L$@hd0S, 21S( 02 (, $W P,$ QW  0 W@T0,0`@ pp3"Rk2S |m200 0 0 P D00 0 0 PWK (0pD <0 8 0 4 0  < 0 8 0 400 %tb0 @2S` BT$0`pPX " 1 B<0 0@@2 0C00 @@pn2 0?0 @@pGq"??pp1 B<p0 @@2 0C0 0h@@p2 0H@@?0pGq?p?pp$0S 2SHB @TJ0241S$0Sd 0s XPX2<8"0 RS 0 0RT0 SR ⵺0PT 9YY'eY0A-da0 0XAP d2SD P4C!p" 2SPqH2U 00"$lpㅄ"& Rp\EU$\p0 00P d2SX PHЍ0"P 18<4$'edm5Z7'h Zn'ohZYA-@T2 @P[P [P [P@ `p@T 00S p`V@ZPD00S @@Z@P En'h$A-Pp`%@t%q%000 0@@@A-@pT` XXPP%0@ @N%@lG-M d4 P@TPD ZP @ 0ZP(4 00(0 4QT(0 ,0H%4@ 0#0@,0S @@((@`@,0s0000CP倃0P>PP0 !01P,30  ,3Q #  c0T0< p@8 PA ,0S ,< 00S< 00@ $1WP&0FSʆ`%P0S -S@= JP00@@P,0S ,^A0 SLP Y8800  0 R00S' +410XAXQXa400C0 C].\0S0S\0S0S C 0S C C|Cw$0#4 ܍p PSh P'hrV^Rqm{nKPn`vn)n/$injwK0/'\0/'\0/'\-@-$@   oE%ZG-P`p \@0S  0S X| U TY0S 0S @ '\&o }o-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @PPݍ Ѝp!rp@P=0PPD@rOP00: S0 RP00 0(PP P81: S  S U r(PP))&)P%PPPU rq!PP @P'\Do'lgoopp4@-80P  0 00$Ѝ  pQ'lp`0@-4S 3/ '\@-"[0 @( 0$V[@'\@-[@VZVV[@@-p PL`@@0 7/P0 S Ѝ 9Z00'O- MM06@  @  @ 0p$000 (0(P(DD嘶@ ܍Ѝp 03/0P0   P @$0PS (0SDUI(`P 0 W xU euX0YpY 0 `  W p[ 0S P%5 e@ u UT \ 0@W0SU 000 qWFlp@dz%apqepp@-O @qt%Z-p@-QCM0S 0P?o20S@@Cߍp@ Ѝ/<>!0r0S# 0S,aQNH00CS0";@ T 00CS0!1 P @YT Y@DOoB 0Q   @OoB\ 0 @0  0 0 SNT'qq%Y%Z@KPpq0@-M 03s0c00@S oPP* R!PP<c 00@  % 0PS PW `Ѝ0S 0S 0S\0S>\  0/@ v\0Sp 0@0 @vp 0S0S @g0S  @"  @0St @D HP@ @0 @ `!0xP|"%#   T`    P @@``a5 ] x Zp h 0 @`'''qrrr5rKrmrrrss/s|rsaG-0@ < 0-P 0S< 0  Q*g  ;PP`   0`P l apЍ!URQ H l /W0H00 p?s0W0p _P D2 0?s0Q(0  1!?/s0r 0 1!?/s0r $0 0 02/1( ?s02/0, X0`P  Pd 0SD00D0Dpp $0"3?X0(0R+* 0H0p$,0#3?803?/s0r 004  pyM00 PQ  y   0P 2P y|2pP1S1S1US1S 3S3S3US3S,  pP0p- p202 12 1300p-M00 PQ  '   0Pp00S 13?<013?@040  M40  PQ   0PA0O A0  2P 4J С 0R  A eYIGEX`V P0ES 06#++R`DX4 $0S,0,  RT0CRD0"P#10P 0 # 0QL \0  0P 0PdP@ds<ssstt5tWtstxt}]RRaArrAaUtttu u/uRujuuu@-p@`P P00 PWL 00PQ  Ѝ 0P< 02/!@ 2/! P7L 00PQ 4 0P<tWt@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  ] ,fP000$vvXG-X` p@PI Ѝ0PZ%V0 0KVU D8 -X0 VX0 PvavO-@,M0p@l@$0`P PprP$P @,Ѝ T0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 S 0 Q q ,  L 2/Q0r 2 q 2/"  @ "  p@*"*  P0@ S  2"!"0  0@pvvvw&wv0P s s// /w.w2vO-`@PpMP0S Ѝ X  H r0A D00 s/ r qh  \P0p@P q x0 ` P 0 00 P 0 00 ` P s0 `P pP0 0 P`8P w9]wmwwwx x*x>xxxR0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0yvXO- p`0P\PPX $P  qQ0 0\Q@T(2 R@0 P" R S C0BTX t0D s  ( 0 TX  R 0  0 p p P YP  L BPTR2 Q PEy#y]yyyO-X`0pM@PPdЍ R0Yl08L0  S 0    s   00 P䑟P#б 0 STS sH 0/MP I  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 )"03 0H0 PQ P RPvazG-@P`p,P0S 00S <0s+@qa$0S  0S 0S,0 ( 0  `0SP  R`pl S HDpP@ q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hPP0P Wp0RQ@0z$zYz_]rROz@-?`XP\@#@3P@T@TpW @@T`L' O-`@@M18 00TP0S<0T D0S Ѝ1@ 00 `P0DS%0 ᕈ0 0GPQ P0 Y:0 0 0GPQ PLF 0 GP<0T 0B' zzO-M@L0Sp<`@DH SP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:z{G{{u' A-@/pp0%B?[`0S aL0ES PC Gp@@0T?  C0' 0 PKf %/' O-pcMW , 0 [P0 S@0Pp(0@@D0 0$04@TD0' R$ X0`1#b3<0#0000 0,<0G<00 PQ cߍ0P@4p(0@pD0 0$0``0 K2#  ,PV002800aL0`F08 0L0SD00S   800 2800,0<0F<00 PQ (1 0H 0  RR R0(10D40L0 `0L0C >p h)P.  (10(11  , B 4 0B0 D0P D0[140S  QI@(1  0I0@;+ 啨 P(10(10@4 40 0S\ 0@ F /o@0(0"s R$ 00, P 0O0p(0@0$S@0! 0C@0 0@ 㓢#X0X 0 PP :X R: U$0p 00pP01So | U)0 pPf(@\Q UpW$ P   pPK/\^O g0x!P0p00pq P$ b QQ#hQh  0 U P p$pu00000 ,p$@Pp0S*0  Q .b A0 b @ @ bρ LG?@@0Cs PQ*W u0!L0/r s|!0<80|10W03?1t0U`0 0\|xQ1PP|!R \P PPL0sPP|!=0I|1@|Qx1U0P U* SR   1S \XPP@ 0I 0000@1 h)LPP 1|!RH PP 1@_3s00 0Qs (0R~ U$0p 00pPv, u,E000U\`0( 0$ (\T P000 0T 0P0 00 , M@W $0[g1Sd Ia1 S0(0ZRhKP0S 0Sm \llNR P0S02S 0S0SW 0\2SR\M|!.xQP 4PPy 00I@ s 9 |1P /@P PPPPPPL0Is0PP@1@S"U @ZSh[KP<PU p|1WS P@ |qppL0Ispp@P !RP d,PP 0 1|10|1#40L0s_?00|10PP+ K/\DPP05LP 5P0h00h0Jd 0ES:\P P|!d1HrH"HP :0 @0|12PPp?18 ,{80P$I0 [P0 S0 U$0 P 0o00 0000 0,@ D00S0 0,<0C<00 PQ80,R0 ?PI Pd01S\70!X P %4QIP0%8%\0 P@l' zz{|{{{vX' {{||1|w&}I|I||]{u||}0}]}}}~}G- p@r W pP\aPP }Pp $PK/LD08QP0Q:" 0PS00  Q pUxPh`P 80"8 R 00 05 !$x' ~~C~g~~~<p@-@5%SQ%  5%QPR 5UUdbQQp  0Q   0Q0  ' A-lP`5p@ @ 0% Ņw@ŕ\' O-POMp*P* b5S 5唢@TE  yIP@ ET XT 5d 50 1 S$52S$5P ROߍdP  RR @` d0C## 0 jB0 PQ d d0P Eh0K/0h0 K0 8!e,qr0d  01(B  j K  K,10,1#40L0sK?00,1001001#40>00010 00 000T0 CB(5,%PQ Hd d0P @' }'P^Jn_@-@ P d0 5' 0/'P0/'P0/'P-@-$@  5 㺧%ZG-P`pkK@0S E 0S X|< <U UT1Y0S 0Sj@ !Z'P&o }o-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  +C-@M Mq` @bPPݍ Ѝp!rp@P=0PPD@rOHP00: S0 RP00 0PP +P81: S  S U rPPtqP%PPPU rPP @P'PDo'`goopp4@-+(0P  0 00$Ѝ  pQ'`p`0@-4S 3/ 'P@-mJ0 @(P 0$EaJ@'P@-[J@IEEQJ@G-`MMP@p`PR0 `: SW/\0P  rR 4J00A 0C @L#@ V& 0S UP0P`弐0uPPJ0: S,^0"@PTP&PY 7GP  QPP @v3M`@ S @ S@PWPZ P Po UE f-@0 S R UU9PXt5p1 "GPU00`P00D!% @P2  PI0S`X nP P0 PP LW80% ܍ЍCmAPUy e9Uu TqU  F F@F0/p/p@-P@MC $( $(0XRX0X00\00`0ddhhllppttpp@-@ P  CCCDDB@@BHHBLLPPTTXX\~`\`0p Qp` ?P0@ S p@-0@"!Rc0p@-@PBBBBpA-0@PJ04S->CB->C?XB9>:>CB?n:>CFB 0? AC>B}C>G~BmFzBEnFvBE~GrBX J.X R  $$((,S>,RB}S>GMBmFIBHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqxA1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,0,2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+M>000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@  TB PP1+\#F0A0 0 00L B 00 00 00000u0#$ 0 ',"'("&8'$"2&,&42r"bJ 40Ѝ@-@0S6'00S/0/'p@-@PD @ )"P ,00S *70 0pp' 00S/@'00S/p/'O-l2M 0 00<2P0pS@ 020S 0`0 `X#3WQI 0?KW0A? R! R   X %|10SI p10SET@Z000@S0@0@ a``0@S.T0  0'W ,(PSQ RЍT /T AAV@Td00S X00S0S@ FP( 0 'x'''`'''4p2O-0@4p 0 L0PQ7, (0R000U00S,  7`P%0SP Ѝ5  prX001P``` 0,00(0S/", (R00Z P000 `0` R0(0, 0 aQ 0R000V00S  P0P`I"`F0S/"0PS0P X5 P PpX00 0'<'x'G-@PD@@ppT@@@@   0@S)st h` 紐pX 5pD )T 8 0 0 00Sp'''A-P`( p@5p0S |50S"0 SRpp5p0S j50S 0 SRP@P@A-P`p@ `$P`P00@AO-HMQM &#0@20 C_ `P/?0VP(P,00 0PFSſ P 0 Z>U0` 0 pt 3PTZp` p P0 c1C CN0L0 T0Z 0000 0 860 0 0  0 0( (P 0 B b"$ l$8ɯX,0 !{0 僁{G C @=496$0 R ,0  0S崳 9 0  R 9 lr000  S:0 0P0( C c9à20S0 0 S<%0D%0L   0Sq ' 4$20Sa @l0 00 000$?0 '60p|tP 0 e=U 01S 040(!( y( hp4m h(i$0 R ,0 V<L D  O &! 0h/P000 ʏR0T 1A^ Q[XQU8 2 t0 o1( @( E QBh@h'`4''x'<$F'0Zf'O-M@ `) PQ0H:0 @040$?00  52  BQ p{r q s Q<042,0 S000#000 oD2p R 04  0R  P@Ѝ( 0& r0 4 Y: |10S<000D0`10`  0% 010S 10S 0N` $`110010S yp1p1000 hpeY'<'x$'''O-@PFM M X `@pK: 0 p5 Rllh"0TSe 0S00  000S Fލ Ѝj00 A1000t 0{4 H0T00X0400S> \`" :lO"0S1 P L000 0$t  HP' $0000S @j0 0 Q.P 3 p\tD.Pt3 0"0J 0 3 @p | 0 0S r  P1 !.P Ѐᰢ L000S0 H \ t 0D0X0x2 0J0  000r00S 2j0 0H 0Hh [ Z0# 030C  4 S 0040FP!it1 0 : 0 :000kI000C0 0 S 8   0 0001   p"0000 0 L!0sv  0\ 00S “m'0'w'$e8'''`0FlIXoG-P`J@pXpAZ x10S l10S 00 0T P4ЍG&@PEU<  1 QP0H 0  P `% H0S"00S U  0S h0S GprpЍGcX,P H0 ЍU'8'0'D'$“'0/p@-TP@081 00 @ 00 .0@0 w>p'<00S/p/' 00S/' 00S/8'Q000R0SO-@<"P0 `RMhD R0R0aď080S  C/ S ! R 0C00 0@Yἰ? 0 09\5p!pS 0 00Ϯ0 ?@U '  ϬR8 R  00' \5S0 0/070/  0Ѝ  [ X R  00L0 0<00/'h'<'4T !AZQ0O-`@:!0 R0* 0p딑唡 Tp3Qx 0 T B:\5 009P/<# P 1R 0 0/."<0 P 08`0 C c 10P0S   0 -0 x080T 0x0 84 , R Ѝ'`''<T''O- x3MPQ P*0<PX k:$ ` \5 0 08@/<#| @2R 0 0/."<0p @x0 o8`0 C c10d0@@b CC c@31B $0Q,040(p0pPßPp0 8+10S 18P0YC9 P XEʰp 08I,80<01h!0<S0<0<0Ѝ U6 p P\E7EE6k6 U0 06 0 S0TP0S<0а(? 0 XTEU p P 0R0SE ?Z0:P00EU S''<T''''''G-1 `pP070  00@ 0S !0 80`S P`P  R. `@|!\! 0 S P  P  (    . #0 @#`P0 P 0 $90 S` @00 R0 SR Q\ 0'('0B'|'tW'X'qN'@00S/p/'00S/0/' 00S/+'O-M,MG@g" pW+# p000SPEW ` pA P' ; PUP!00 0؍,Ѝp000 L($ P  8X PUPh0S ! L P }0S, z( : : j  W 0%4500! ?0S S :00/0S 0 S :U00#03  R00S <:0S7 0( -2 : 0S R 8P40@S0y4Pş 4 Q)Q90000C/J,Pp`#p90S 0p !h 0 0P 080S, 'mT09 S`p0 SUR680S2 U0;Q0-*h0S* 8(d03 (P xK@80S (00X P! @((j70S0 h0!&77(%RS?U0O:7<U0030#\00SDRQ7 !0? , V0$00(p ^47 V`Q0tX ZuVPk 8' 0 0pPP6.cPK"h0S`p&ao'qQ `panq V0 Fp`Q `pt A?7#bp 10S0A[p0 ` Z$0S 1000S 50S $0S 04  p`t0/A+$0S 1000S 50S $0S  , 10S0ꊡ  0a000 04 0 S0 0  P00 0!$0000 #600S<40S `4 PP @ p t3000 00S0 LPX00H00SS7 0S 30S0 \P$ !D7@lP  2 pLtPd\2 0\00Q&&0: @000S82<`040T/806#e PR8P<`@hX0@\ SP 10H0K00A+Pa`ppPU 0 \;<5 D5@0LT 0 b32 R p'@ `글0d$\5S b5 " XD0/0 %,40S$40V SV 4t`V0`@0x@S vd0,*0 g0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0D30qA101XS>  0A00Ϡ% 0 S  s0S\00 0T@T` VT0?  `@@T` 1 0D20qA000P 0P0E㡽!4-00pQ :*p VT0S0@  QX`` @W0`3Vŀ T 1,0`7: @T @0  00   ^ RT 1VSd #0P   W *  A 0, 00''<T'|@'X'P''''''pO%Z'0'D U'w'O-` @ 0MpԐ԰ 0 0  BRЍ :PP U  QP p@` {{p @Q RP Q @p''t0/O-@dMX g,0pP0P1P 0L1L H1 0,0SdЍ0S Pd0,`7)0 `00 Pట 0E RpU0 :u`P 0RA0 S0T TX0S P@Spt0'<'@'p'%Z'' 0440@/00S/p/'00S/0/' 00S/H&'O-TM`PV`@@M4:0S P *0 Q0*`00#010S y0 J)P0 X P )K P9 `0S 0S \)8L P00 49 < 80R0p00S0100,08"0S80S1?10000#0%n 0P @pdy _ 0#a70 @0C0P K+100S 0y (P 0sF0 S$ 0S '00qP7}`{ /00S0100,<0!0S870S1?1$'p 0pp00ppP*0S  ;P^ 0 1`V/PR @p` xp #0 #0@0C0Ɵ 0 00 0Q,*0S  P 0 "pWQލЍ0S #0 #|50S pT0 00$001 b,P 0S #0 # 50S T`0 $00 `S!  Br p bx ᴑ\Q@6#0 #=00C008S< .PRS8$ 0.S ($PPP3P` < 8<#0 R0 *3 00hP2 0 0v<X P0Sp0AS񟗳S$3 00V20S400005P 2 B< 80R0؀"0  < 80R0xQ' |20Sp20Sd"؀0  (P  : S000! *!0 < 80R0 Q   0FQF?h!h  D10 S' PS< 80R0 š!ɡ0S  0R ؠ{P!0   0p0P``0P00C0X9P2]  '''`'~'I' .?N'4-<L]ls'0'Dh`O-WM M0AS}$X$ YP 7 >wl hLP P7 00A , 7 7P 70S 60V6 6X (0`06`00Ħ100V0:6 R`0S:`@aVxPV~Wލ ЍT P@P   ]d 0S X @ F  Lq0 G00@(0S S㜕u%p &`pG(pP) 5 /  B+ !D ]g850ST 0$0(0 ]/g 0S R(0pAp%0pGS(pE p(P@S,p=(40xpS@09Y(0G7 @,0 S1 # (R' S000000Y!"!"9 dxhp:  (  0]/   ,0 S1 #( R S),)-*-{ {d ` p0S(0S , '2(p2W ,@R@ )' 0x AT!W"!"dh 0R@ )' 0 AT dx@0 (0S 0$P Q 0  s00 \"0p10S t10!h10!/00C0H10!P0 800000C0!" |p(0S{@0z !0C0v 00@q' N'''|'p'0'7Pl%Z''x'D9''4I00S/0/'O-В"0`1CĢMa2@Tߍ0S Pdp@FDAG@D0 ddp培00@00C0 00 R2PU 2PU0p 0S0S)@P@R1PPUPRPU Q0:0000S 00"P D1y00C,(P X P&0P0!!0` 000pSL" gTdXHw!Pe 0 07 ;000pDTt'''p%Z'0'8't'D'd'FeO-䳟P3张pM/`@ 0!\1P 0/ |0/ G0 ^T30SL30U SU <0 S 3 S  @ 00000CSGTYr! P 80R000303L32   0/]!` R b3",Q Q0|`B* P2020S oP PA PЍS   OPe?00 1>!  R1W 10SF0T!  0 S01`00/ !  030!ܰ 0S H0S 0 04040c/ $ 80QT $00$0 40 4L3 2   ^[0{ {<0 hPpC'<'T''' Un'''|'@'X00S/0/'O-plMX )%2吒吢00,0SlЍ0S @d0,P"0 <<Pȷ000P㸀 @1 0 0D RpT0<:9`1 PQ@ \`X00X00@SQ\(\D`p\t`d`V %P 10S  0@P%P 00S  0 0S  Q\ {{00康 xK0Q! 0 P  H 08G'<'p%Z'''4'p O-oMM@PL00 d$0|2?0SX0S $5Sڔ0SXPYX0S $XmX S RLfH?`0Vd2 P\20+! `" d" B/$00!X d"B1h21$\Pl2ڼΟ\0C00p21`t2QB1l2 ?V 2l20CL0=SLq Q\20B <80S 0 ㌎$5> *t>h>0S 00 0S0 $5B111`R B- 100 S ` $|00S% @ 0帀- 00$%BR0Ө`S<B11D%L0ܵPP  Y PN 0S  <P| *堀y<<0S !0 00\0 bA?L0<5A?X0 =<0T0.H0c#; 0VHRQX0h0@ @0O#8 <48ϠQ b{ S W,0 Sa?^ @ PC ;0S @ A>+@B@  CK(P4;"  @0\ 0 000D:J*::0S E0 0؍ߍ0<00<`/  `!.0i0S pd,  0  儵000y;!"\Q 0 i0/H 0ЈSh90m Sm X90S 0`)S 3S 0S ( X0 0h80S 8 0S8`0`80`M 880;."\^ `0 0/dh pN.' `n3&>8+?ᛓ)T<D  0PRT%ͱ|7DpP0W`C ?Q `,00C[sqS  Y0;!"\Q 0 h0/D0刖S  70S P#@6z0堦h 60S 0p&\Q`\uT6PD60S6<650;."\^ `0 0/dh pN.' `n3&>N `$5S8x( 0R #0", 2R #,2$24"00 (2S W08" x S0! 2! 2@%S\2/< ! 2%Sd2/?L !W=SL5s45p`Ḡ? ?`00SE[ 2$Sd2?/0?  (2h$0C(2 2Sd2?/0?  (20C(2`D0P ST003^0 `0 D0d]"{ "{ `,00C[F@p ?! |"l 0ASh0$$$0 20 2(2@#0C(2 2Sd2`0/0!!!p`Z0: 0`P   Phdqzq08PPN$20$2<0S4 d 2,"S\2/0?! ! 2"S?ԀP5/`20PZdEpA0 0 ;000$5S `0t63 03080D ` ßD =R ,20,2! 2`Sh2/0^>0^00/\N'<'''0Cf''Z=t''|v'p%ZT'''''8:d' 8''4''<'''''D[' U<$5St2 ` 0h pp WS $%S0! !,r  $ t p (t | px  | l L3xh  bhl  "D0P3 00p`Y7 0$S0\000S7呫!"pW`嵏X7 0 %S 0\000S7呫!PpWO-P`@DDT(p  W @ðA-Q0 % C@*r`!00" q0SU 10aO0  a*1t10S N0 0T 0@# 03A0S4 H@ 5*< 5~000S &0 0u@rTP/UA*t0Tp Pd0 0S L P<0 0S '<'0$''''00/'0/'0/'-@-$@  = z㘮%ZG-P`ps@0S M 0S X|D DU ]T9Y0S 0Sr@ )b'&o }o-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  3C-@M Mq` @jPPݍ Ѝp!rp@P=0PPD@rOPP00: S0 RP00 0 PP 3P81: S  S U r PP|yP%PPPU rPP @P'Do'goopp4@-30P  0 00$Ѝ  pQ'p`0@-4S 3/ '@-u0 @(X 0$i@8'@-c@Y@P/00@-0@S /@'0&W0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPP  hP R 8 4 Q  0/TTT 8'''''T8 t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/''T 8T8 'p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0[H3H3L3u/L3P3P3T3T3O Kh p@$p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0!H3H3L3u/L3P3P3T3T3 EEP  4K44K44h 4 5- 5d0Bd00000P5P5H5H5=CS>S>h p@0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//'O-t4M X `D``t`Apv@L:8D80_ 0 P\lP TЍ0/0 Pp P\QP0S 30S30S tl3l#0Sd `#SXq P L0S @=0bS  s*0S @"\5S 2 2\5\5" 0C?o"20Rh [řT"40Q%㓈Pd0$"0/f:010S?,0A1(Ÿ "\ P 0 B0/ 0Sf0S k0āh 0S _|!\5St1\5P l10S(` XA L!0 0@! 0 * 0S 30 0 00PD@hPİPPHT* 0R A ᘬ'p'''l''0''' '< 8'T'"'8''4<''''y 8O- 0x*MM08PpP}倯 [80S {:Pjm h0: S P SPލЍ,8H0$hSO 0)00S (00 70 7 9   帯` 㳯8 㭯8 㧯[V``Z`P`D7V< M7P Q P @8P0 0ի86 R>0 0p 0<&0|&0P7p0p 60pw>0 P0p 2S # *P *P *.rVXZ hY 4[ 0S[?관X V. 0  / <0\9P$$V Q2C/iPPe 2S|3%8 S20#"20$#20PC 2SB4$040404/`02P&V20A2\02@2 00C`r `Fb 0| PH 0/`0PpT#0`P\`Q=S/0P 5` ( 2RV0 S,S,c 5*< 53 30S 70 0`20S 0尪|#0 0R V 10S \2RXX0S@}2؂= C ,0x" t`06 Bq'/ 0 >#a0 `0S10S!0 R=S0S lG $000/ p 0L%000P%X30,q * 10S W0 0''''''x''(!''M^z$KTz )F_T'4 q+'Fl'0Di''h'|X'}'`'''''''P5e\''''''<'''8''''@N=SZ0SR  0\p<<00P%X30*{0 |00S #0 00S5 0 >0S wPq 5*N> 0:#: 5R(1_ 10S 0 000S(SP0q0*21? 10S 0 00<cQ3,hP 0r<0*(2 20S `0 0倂0 RL%r0L%r0H00q" T 000cH00SP4Pr*220S .0$# 0 00L40q"  400cL00S Ps*330S `0# 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*d4\40S +0$ 0 04t R,5S0%45 RS! t004e0SP*S$5`50S 0X% 0 00刅(0S xQ$ Y0S< x 0(%0S8zPȅ*&5350S t0 & 0 08%<5HRS$ + H00<508S_LP*660S F0& 0 0܆@%D5LRS$  L00D50@S6P<*L7D70S q0' 0 0 7 70S ,帇 0R" 0Rz7 0SQ `@|PLX p @ Tʰ8  @@/  @!. A@O@@YP 4  {,@b()P4 ' <) QHI ϠR 5l)p) x)D)p>PW)pp _ 9 r3 P. ~P)Qڨ0Q, G 0 0S kPz*:$ :0S e0H* 0 00S 3?0S0QQ 0 0S 9Pz*::0S 30+ 0 0P ?0Sh >0S >0S^Q  "Q  >0S&! >0SQL<Qk >0Svq >0S0 >0SH00<5L080D5h<@ ,5S0SP ,000<0,5<0(5H04e0/<5L0l08%/@%D5*0f<s<0S 0 - 0 08=0S 4=L=0SHm*GT=TL=0S 0Mh 6=c |P'L5s0SB E-000=0L50P5?T5V>X50$E- 0 0B0T ӣ1`R.B!!DtN00 00L 00*>>0S C0. 0 0.P0 @DT@8LH$d0/ C#Lc c,1 0@ `3P Z( \?0S  Q8L4H$0/d@ A! a,3 1=?0S  60p00PX6@ j<6P0E V0$& 500060S 1S  P 5 5 @Q U0@ `P @@0 8< 4 0h%S L50S PZLP 0  0  `` 400 0 0 8< 4Q Д A0SXhPY 04 S 20S^YP_ 04 Xh$0Sd<KPe0 $V:PP/PQ  0Sd2Pe000 400Ry c0ScPd0 0 0ip<0S 00 0 0 00 40 <0S 0 0 00 400 0<0S 0  0 000 g 400 0l<0S 0`v``&$` 00Q 400 0`q<0S 0@00> 400 0 1 1Q1Q,+ 0S 僤A 5< 0!00|!0x!0(pCSq #0p R0 !80Bs00WP [P0S0@ PT0  Qt \  (E/ !0!XD H!]'''D'z''''LABL'0Ecy)l\'4'x'''H'FrFl00S q: S *C   S D00S @-4 * R  S//''4m|1A-0`S hd<@ 㛣TL! 0S<10S,У$11 00 ģ00Sp@ṣ-00CS0pP U 00CS0 P PYU ]0 P0  0 0 SNU I'0N'''8'q%Y%Z@p@-PD0@0`S 2 0LPp㤡'0NO-01 (1$100 P 1 P 0P  PP"Ppp(ա @ ܦPT`00 XT V p WP @@ 00p'''<'''`O-@10$MϠ,"4H`  00哢P p0 <v (P U 㧢 0~pP$Ѝ? 000/  k0P0 000? 00QS / Ϡ/ 0  8尢p0P 娢''O-`M0P8 0Đp@/2#@ #Z 0 Ѝ 0|x偢PZ ЍO8 0/  P Q0/ j0Pp''xM#C-P`U@ (1: U -P0 PP0 0T2`p܀*0 L@D0T@S   8L4H$0/d@ A! a,3 l1 ~0S   x0P00`0@T Ѝ'OrZ''<'' 0S/A-@p da Al a3`Q0 000SR P00@00 0` PЍ'<'<''@-0P@T@T^d pA `anj3ƌ` VW @ 0 0 0P0@0@00 Ѝ'`'<p@-`P@XMX  k `P @%XЍp @-Q $  \ H0@S X00S Lw9004^,P00'0gp@-<`# $  $0 \# 4$$ 0<$( 8D$ @HL$C0 5L5s0P500ߍT'4''0 \P/Q/ Lœ4|    ,PŒPŃ ,TPH40S/<$0G-4DP,4$ 40S2 40S. T0SD #3 `3R0B-R? S*3`30S 80P 0U`dSTS塠Ps因PUU00Q A2P 0S ?/@|zP`"hR0"00S8 pr003Pb0S* xZ0S* 0R0E>0*X4) 2p510S v0 00SD7[P10S 87 1TQ d1*X1`H10S I0 0H10S <7 (1P 0*0`00S '0t 000S d0P` 0{ 0)G&''''''''0K''<''''''`i''sas''''4'<O-@PMp8 R3B\? 02 ? Q00PaV`` 0[ΑYP {l"0\P  0@" 40/ ~0  2 r0S0a Sa 0!S 3S H0r? 0!0! !0!S`0 0 0` Td!Ϡ 0 8 L3R 24  B # R#  B ` 0Q" @*0`0S `A ` `Ѝ0jS  $  B$ $ R $  B '<'h'|T'''' Un'X''A-Pph0``ATR @P<u0S @  1p0A'80 0 1S/ 0S/'d0 5 /L0P 3 SP 3:.  SR///' 00A 0C @L#ⵚ@ V& 0S UP0P`弐0PPJ0: S,^0"ᕚ@PTP&Pc AP  [PP ˛@v3M`@ S @ S@PaPZ P Po UE f-ڍ@0 S R U_PXt5p1 "QPU00`P00D!/ ⵍ@P2  'P0SὍ`X xPPᬍ0 PP VW80% ܍ЍMmKPUy eCUu ƎTqU 忎 F F@F00S/p/'00S/0/'O-pT1PL1@00ʟ 0c X 3#ˠ121` S`0 UQ䐟a00!R00S 1% 0 %#s(0! RXh000R T00 pp8P,0''<'P*'0\'@' 00S/'O-,Mp0`@Pᄡ0V000,Ѝ00 ?U0$p$00 0000P$00S 000/$ P0 0 0 410S t.$0 S0   /000P+ 0(P0$00 00{0$ 0 { 0  0S     `@`00S 2'<QL' '0Cc'F^^F'''P(\ O-1APQ P1a`3$MS0_ 1P11r00`g00 0p000P0@T <{PXpXT 000/ 0cP'0Ġ[@  0S .  OP PD0$Ѝ2'<QL''H'+;'0}p'p@-P0 % .  @Q 0S pP# #30l0# #:>00@0SpP p'UM 1!}[0@`Spp$`J0 U  0 0n7Π ^ÌVQ 0V>   P" G Pa b72 R0 V1Q0V"   P 0$P ` U `P`PЍ< J 0A-1àQ`P x0x xx)[0@Sp$P࠱ ` p@QL ࠁ PQ L } p@-@PaSl0l llZ0C800S   0P0080P4 PR*Sp0 )_ , ? 2,0S/`0@-0@  L8,,.0,0080S 0  Z0@'TV?s  ,0@-S ,0, ,,Z@TP @o͆  O--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D5@D0  0 00P U0#03?W[[USy @0P$0,5Q $ϓO0$0 ὔ9D 0XR @~"!H08pp(0

]{ G-@Pp 0P`6oW  <40 040G 040p040O-0` mM$0P@t004080 0 |p40S+ mߍbP AP LP X84cP iP07 p8~ 4@L0 0H4: S@ @0(0D04,0008`0^P PP 0! tTT` Vp 0Q= $0 ! $∑匱.@P 0V$0 0/Sᓩ<<`V $)pP*px<v0"<e&P0<0㞁`P< Xv ᩁHp< , +n?C0 n?< n/y0P < ኁ<=!$_7 0#$0@0P!S `V|t 0S `0S  R$ R Z m0$H 8 HyPp`G0$pS 0$ pL ~pCZ 0 PQPQ0 S R `TWt%S4~@dzF_ir.]zO-P-@p`,M,$P 1p($0S0$020S'$p; P V 001 0P0Nd0 ; /fP AP PP \pP$p,Ѝ`P0 `P ,A ?o  0S0 00 ` p 0Ppq 0p U,p`%S H!U3G-@pP` ᘖp`:D10S:  p o09 6X $$ }p+ P%W00S $$ mp YPPU `fV rV GTP$$  Qp$l%S[x\Ͱp/0/ @- ioA-@P`pP hhA X匠U  AD<64  . AV&%Z@- 0R0Ѝp` P@5V0Q  R SR  R $$00BR R qP0 ,q4 (P/00#s01"$#pO-`p  @W@ @T  WP00 Ѝpꄀn>6 \  dp7 P Q*" ?    PQ* @ P*Q*? #? O-@`P0LLp@P T \0᳠ 0S@P 0S@P 0S@ 0PP 0T# ?@TSU:[*%@@6 p0 7 0Pu R0Q @@ 0B R ! 3OG-(`$p@>PP 0㘤I$0 0 P Q ᆌPЍ ~PC-(p$$ 啒S%p@ 0 `P Q Ѝ t~P404-@-0  Ѝ Ѝ/-@-00@tw 0 Ѝ@ Ѝ/-@-P 4(D D Ѝ Ѝ/&O-MP`p@P(Ѝ 0PW0 SP 4S  0P@T=$gQ. 0MP 0S 4S 0 40XS$ R  0  ɋRG20 0 !|0`!u0 0 0  @ 0P 0  Pw < t0T됩'P*``4`VS ڴ 0 ` -0  p`P@ 00PY: YBie~gO-,MX`\@P$_ 3R 4S 0(,Ѝ0 P P0   RSRQ" "S 0 d000 00 @0 QP4S0 S: 00 000 @0 10P 0 oO0@$00SS P %XPp'xp   0(X$0@S4S 0g$R  pP[0 RS  0   pPN P0P 00000 0 P(p6U!G-`pHMP)@P(j@TC^t# E@0$4$ 0840 ;p+p |0}p H4$$: S R B.\ }pL $4S@ ($,40-B.( }p E0"dR04<($$4,4$t0K>Ѐ 0 M0E  00`d$t؀E0 9PQ0`0 Dw4S  0  Pp 0p 0 p pmp| p0 ppt P AP 0 0 SPp5:Ѝ0Z hpW"QfLr@d~@d#@-@P 4B BRP }p 84  'Ѝ@{Ѝ@dYx@-@Pp P P4PS 4 A- @PPvTr 0pl`X` gcp0 p*@$$ @-@@T@RT ńCs9 #600<0$0@000< 0 0 @-T$0    O-`P@p M6!`W3P̀PP `00000R따 V:Ѝ 1 00 0P0A`P1 0 07P UPsZXrb%Zw-C$4 A@-Q@- `S@l)ЍpP P < 0R00  ,q4O-P_o 0R0`@tMR(0S00S $ 0R0oU tЍP PU 0SIpWF (0WSB 0RSR8$ 0R SR.pG-0[ KP# 9/p  9/p 40 P m0 $8  NP P  P A-@pP`sP 5/p 4 5/p 4 zC-(00PS4pR Ѝ$d@ 0 0 0d`> 00  0 `WP 0O-0 0P壈p@᐀删T Ѝ` P `V Hp  0 @,q4m{pdA-P@$`$p0 @PTpO-Pp$M `@Ȁ뼰0     Q  x0 p `p X0 X p`⽅00P0  $Ѝrp>O-PQ@04 p 00` ЍP P(U0 E `P0  t  0 4   04 p #00 #p  k0s@-SX`@ PYN0 ?o2R0S  <Ѝp,q4@- iR sR aR p`  p@-P@P (`Pp p,q4(p@-@T 40`P\Ppp,q4CiR@-- 0 aR bR LR( sR% tR@sP 0P0S`00p`(j0 g,q4Up@-@ M\P`ᰱP0 0͵0,0S  㶄Ѝpr }G-Q@PM Q  |ЍA~␀ p$噄`P pxhB~0 00 ` 0PP aᰅ 9TO-$M@p;P tB p $Ѝ-PP0  0 7 0` H0$0V!<#P0*Q P`0 0?V `S 0S PV0P `E0t PU0 op $P< 000 00 `P = 4! `00004k g4a0W0000S0W8pu N$$5 3 M0KH R*F0P01 T0P=Z-:L0SX 0 pO L004 0 00P0!9P= 4$$   4 P4 4 - p〰%  (F`Y10S 0@-@C^M E$巃E$4 0 4PЍ0 @1q !ᜃ0 p0 \zX 80 D刃P<1愃%S&DXk}0$ 8fO-`DMPp4 72<0 ͌p 0S8 ! R4!DЍLRd a0BS)S&|D10S  0P ȃ@P   7 @ 㱁Pట  T 40 )0@  T "@0  @P@p%St,q4 ,Gr%YCA-p`(P@ዂP0 p!`P @00 0$0@-@P$0S 嫃@訃O-pP 0 `0Q 0`0P0@SP 8@4(P<ЍN(5?O-4Md@`P 0\0T$00X,% 0  0 0 004 0  0$ 0 $0 04 $0,0tWH 0Sg   R  _ = R  X 00S(00 0( `S$0 0 $0V0EV0B$00$` T0  00dP  ( 0,0     ` p4ЍT0 0 (0 0(00 0 `0 0`V00V(00ppO-M8pP <EJ`@QU`@0S @ `00 0 0 0 0000SpQ `@Ѝ 0 UX 0ZX X0 0 @X` 0  @S` @@`000Sp ` )0 @ ` 0 @T` T#U` @ Q 0S P ZUpP 0S 0 SU Q 0T P fP00  T 00S0p` @k /PjP/0S//P/0P/A-AP  `pSP  0@W S Q@-@,MP@p`ZP8,Ѝ $ p`P @-^X@sP HHH0H圀@@(@8P8`@ T=~sZn%ZLR R R @-@R R/////Hp/0/ Rp@-0@P! R!x Rp pp B R"Sh 1@\ \ET0 L8 ppppppppӬg'\lO-0M `@P "PЍ"0PP `8PP( p0Y:4S 0t $48PLgY:5P `PP04S ڠ0"S1@ ~0   <03/p! 8 H0 ;0(8$0P  0S  07(0 Q-PEpVEWӬg'\O-0P`p4M8,0  Pp@30S,`;^P 0! b pT AT fT @4ЍsT0 0,p00 00@!pq 4 `0}p0 00$04S 0Q41!0 6 R? 2R502F. YpWp Vp 0oo`@ 5!Lp@ R@ }0R R 0S 0S0  00` 0` 8 H00 X$F C0 QL`F%S 8LӬ%8XZg'>`A-@ĔQP MP  An``llph`p>P LЍ^p ( 0 T 9G-@Pp* U$4 d& A~ĐĀ p$$  0 P`` 1L0#p  H= 0`$0B~ 0 KT 9Q O-M@`Ph  4PS 4S ЍtW P tWnP 0 Z 0PQ  WFU 4S 0dp pP30   0 yPP , ?o  0p0 00 PWpU 0V p 4S 4S 0 P3f !U3@-x0S8 1B7B3xB 0x.x $$ 02P"ɤP%$ 01 "Xx m0 $84x0 x#$ b@Bw 0Bw w   0S 0CS 080  w 0aaa11b?] E7wg'Jr#G-0p P`@M!| P p`20S$0P@@6 lP`Pa@ PT|8888\8d88uP xP @ЍPP pPPP0S00 P 0S 0S P\^ 0 Q  Gw Cw;0p帠W 2w .w Q %w   p w$%S.X] E9XA-HM@Pp4  `41 0S1D0 Zp T  P 00S0 liR TR a0BLR lR s0BST mpLlHЍT4pu%Sl0 Q /0@-$M` 0 0@P!!`q p#0S00 P 0SB0S? P\^; 0T 00S! 0 `*a@ P  $<TtppT T   $Ѝ%Sڀp/-0,M$00 0 00 00 00 00 0 00000000 u,Ѝ/0 1@-  RC-@MP1`  000sS 0lSp` ဿP$0㓆( \p lp jP 0㓗) Fp ЍpW`VpڔC-`P؀C$TP W ЍPP WPl|:PQc0Ph0 `aPT00 $4VP,la`P aP 8 VPk8 GP $8  pUQ< pIP <X8 P < hwPr0 &Q00000[00$0000S 000(0daP `a0P,0 kjPP ؈ؘبl`P l$lqPP0L< EIP <hP hAP H GPn DP |GPh L0 SH00T0 RP0( 0`0 pq 0S$$03"pq 0`~ad$4P p`$$Vd$4P` V<``P! ,`P d'V `P i0P$0+800 $Xl`P$Xl&? `0 pqx GP 4xo h #GP  P GP 8 GP    GP   GP   GP q FP   FP q/  FP q?Kr?t 40FP r?1S 0Rr/0s/0{0r?0,s?xr?  FP s/ FP sa$$c$4Pk,9iPc k`P k$4` 0pq\8 x8CD HPR DxP D p D GPB DPH {FP7 ~ (rFP. u diFP% lD DGP $ D(@ ,FP @ Y* 0C$ Bx 5$ cP$$03`"pq$ cX$ 0P"]  $p ( 8X0$08$Y1T0P mR\XhM` $4Npq|_$$b$4Pp`\K0$$;`"/pq@$$b$4P ` ,ij%SX,q4ķĨÙ%t?H+ēĉ]eNőŷũZi5Uåðý -Y}"Y@_0@-@M P )  0 0S[p< <帯 4cp$尯0Ѝ0pƑi'Ɲ@-SM@P, 0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`p D Sߍ@iƭiƹi!@-@   Ѝ10S/p@-!MPM@P% PA. (01GP A!PAnP7 0`0?oS c`1 06P- 0H,n0 0A. 00P0P A !An 0  咨nލЍp`n0 0A. 00PH0P A4 4A@knv`'o'r)Ms@-6PP ʮP î -`@T ЍpP  00SRV   m@~30 R !;O-M@ Pxp.p"㋮`P"    ]P- La]P:]pP @apx]P 9a \{CP 0"h 0R00  p!  bCPr 0SohQl @ bbpal  a! R R RZ  0PW l Z XX (s< W 0j0S, @ h,bP@ `&bpd HQ L 40R !01Sp0S 3/p\ U 8 Xbp \ [ 5@ `ap Ѝ݈Ƒ3BAI$SgǞbǂǴA-pa\@P@\PPh\ ^] P+gZh(]P Nh`PNh@- DP ЍAPA-MP p9C@P00 p`ЍpP  ⾢0 ap 1  0xDZi@-@p @A-P`z\pP00`P@?0`  FA-P`\\pP00_P@:?0_  Fw@-( BP00 Ѝ;ip@-8M@ P{BP 1 ! 3#\P _  Q0s0S00Y_PP  d\@^fDp d  A_< PM\`GfV8Ѝpǻ^ݘi0@-@BM M   <p 0S 7  /  (OP(@0S700$0/ (d AdP(@0S Bލ Ѝ0l@l@iEZ0@-MP[@P 9_P Vl0l l2;_ 0 0S ,pQЍ0jݥĀiȌ@-@M   pЍi@-M @APC0 L2x p 1Q0r R0s04 1p`ЍȻ^`iis@-`Pp@ @@rAP0 2I@Ph`^ P@ L@h[P 4 WlЍp^k"A<7@- P@:pT TūLZ P@00 <<10400:[@ Ѝ0zST^AB7@- P@p\ \垫0H呫@Z P40 001[@ Ѝ0މShI^p@-M`ZP0P0Ѝp=^P@Uxi@Pdg0 D(p<V8 P@ PP kєh}ɖiɭ@-$MpmZP00$Ѝ^`^i@Pp 0 XpL&P@ P`@ p$ kɺπi@-Cj Ѝ$r0@-M00 0  P#_p `i@P ` @_pp P0 `pR00bS "jTkhU jYjP ix@gs@-@`+PP  .p 幪m0vhYp@-` MP@YP }] Ѝp P)    ]  PZ@ dD iv0@-,M@ P?P0 0 p,Ѝ0 R0 s0S 0  "\PP  (Y@cDi^ޘf p@-P,p@`@@hYPH0H HHZ0]Q P /jp^ޢ@-T @?P00Ѝ  p  Joެg@-x@-M T@t?PD0D DD008 0 p$JЍ^޺€iʯ@-M T@S?PD0D DD/08 0` p$JЍ[^€iʽ0-M $00J P  嶩Ѝ䀐iɭ@-@0X P$0$ $$/*Y@T^A00@ P/a CRWC/A CR=C/@-100@- M@ 0( 0 pv Ѝi@-PM `@@▕!s{G 8 8 hЍ$$= ?r$>@-@WPP BmpPL``P00 00Dit0@`Vm`` PT0d0X @ @@@@0ibf03/`$r%Z˨////0 L0L0/$0 T0T0/$0 \0\0/$0 D0D0/$0 d00d0/$p@-@p?P p00p00D S 0A0CSd0$P>P\ 0@p$@-p0' 0`P/ R/$0 O-4M@@!2T0-  DPq\pğo㈨(p"WD@P`T `P 1sexT6| P`P`@ <p00KTp R  P Q R07 0TS $P\(P  1/P Z@0S  \p 0$ SR(0S` \ 2/P X0 [ B e'  ;.O-MMPp  X p`$ pP$ 1  $w-ng . \pH !t [p Q XRg g8 p$0Q Bg$_ X@T X00@0 0[P)g@U 0 0 ,0@4@[p 0e0Pl0q 0X 40,@[pDg 4<gg0H0S 'P31fH0S=I0S:Z`@T 0 3/@: " 렒M0S:00 % p"pM0S  f<@ f4@03/@r JoI0J/D[pNI 1Ra`"%J` 1 0 d1 T|p 1 d\!1 Huf`@#%Js!1 @ t1 x!|1  fP@Tf 03/@ 03/ݍЍƑDRii~$iζi' `  ΗΩiӸ8#>-8P[O-@PpP  p 処T T@TPT!sUF`P \pPPU D1O0S e__!dW <P.Z  5P' =P! K0S 0 L0S 0M0S 0 N0SO0`S PPV ge Ye' AP%Z@@-,MP@vpP 1UP`( ^ p0S h H!;P00< <0 $ݥ,Ѝ7҂'(i8ҌXҙҶ@-P@᎗0 PɥG-@TPP0 +`@ Y㔀XpXPP  pp H H@@@f@k2's@-@{T@P000Ѝp[XPMX@P <` Peu +'(s@-@QT@P|0| |}+2XP$X@P T` ٗPeu( iЍpAx'(A-@"\TPP0 N+`@XWPPp ᎗p< >FJN@'6@-@ \w:PP0P PP+L 0 S@@00 >00Ѝ>^'H %ZH0@-M@TPSP SPpSP d0P P P P 4PGp 峤Ѝ0A+'i7ӑs@-@yh,d P L$dHPH`⬖ P! ,dЍpd@gӞam{ӧG-M`@PK _ppP"q(    ᶙ Xp% (( px" <@T t8Pcl2P\c UR TЍ0 P-yc@P/ $@RXp ݕct 0R ck)[c Yc` `pctQp R%P\c GcmLP;ЍGsdQ\ 0Q    1 0PlcP0 RS᎕ \cZc # c0` R P U 0pD` P\\\7pƑ(i8iӴ6Ҍhlr>a Pp@-P`@RP V  S`P ]`]1 00pQTp]A-@T 00`PpW0 p `@@-MPP00Ѝ`0 00p0@ 0 P U0P 0 p 0 `P0G-@(P00!`( p Q1r0P*0X 0U0$ 0R0 "00"SЍ|D0P 0 , Yp 0 @0@-@P r\@ DO-`@pP,(0V0S 8`P$P$P 40S 04S 0S(0p(`8P0S$0(P,cO-M00 X$0K00Ѝ 0Q`?  0Q> 00 8PP; X}pP ,,p*,4@[T /@P00 D0800 0STz 2PP]0"ԡ8!10#R0 q0l8[?bP Z@  0YPH@T 0CS 0 0r xC0X0^ :T 0CS wR0xL  @0aD\W@DAD\ 7@Dt@S 2s0@0t@0@Dt@ T130S@aTp tp PPZ@ HZ0 0 0`0;im{tkxԀ" b0 ԟA-`p$P@_P0`0P 0@A-`p@P_P0` P@A-@p`PPPU0S0P`O^0PPP ! P000S0P`A-`(pPQ_@P @0 00  0pPv`@ C-P,`p4_P X0 (0$ (0,0 0(000@pT` ЍO-pP`@M8U[ DB! R: a p DB!U R:@DDA< @Ѝ  0 0Wg?^O-PMM@ 40L00h4 T4PLE4'S$0P0@ 0 0 @PE( 0RtP 0S0'U 09 0909 09帰090909W(@!!0 P m0 /C BRZ      -BX9$ B2"! 0P PE ^r PE0y900IppcppCppPpp Spp@BppA`8 0PP0` VW!0tX@"0(0(0S@ W0$ 0B'S$0؍Ѝ 0 0 (S   BS>C0C''S Q:ǟ"!! CR   ##9C0C<"!% 'S>C'>C2"" N=C0C Q 0*S ;S. RU 0C'S񟗸;<,<4;;<,<,<,<,<,<,<,<,<,;<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,;;;;;<< <<<$S6\65,745,5,5,7P2S# St 0S R S8Z 4&S0U 0R  t t0V0( 0 B( @U0S 0S `pV븅帕帥pW>OV 0R 0V`|0Sl V0S `p0H00 <rV45H3,,娀XP0  @ `Vp` ZV0S Z0$3?S Z^0S  -P?V0S xq7V`2V`ov`pDW1qv `pov`J, zX4,003c1s0Sa|q Vw ,, V3pGx#0P# P# ß P# hU`HH#S0S TU0S0  8U+S U0S#  Us匢 `0VV /r  !"   0UV" U0S HqUw0U` pov`X1pwp 0J,0Y 20, `&#Squ ,Q, U1H!0P! P|! x Pt! TjULI  plhd`\XTPLHD@P4i@ڄz5ډ[ڍھ'ڒ'h $,ٹ1ڽق{grm{骪Pۂي٦P ajُٜP֬,1J٫Xۇٰپ #7p@-P M@` QP0 aPp@@ 6 Ѝpiی@-< @h*P$0$ $d Ѝۗ^@-< @R*P$0$ $N Ѝ^0@-MP "MI@PۍЍ0@5 P+ GP@5ۍЍ0@G0S0S1iS۠ۺ0@-M TPp@@5Ѝ01 ۔z@i@-T @=*P@0@ @@I \p ĔЍ^ A@-T @*PM<0< <  >p妔ЍN^# 0 /$ɜ/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0E-@-  6W2W ЍЍ/@-@WSHܚ 0S/@-'D-@-  WW= ЍЍ/-@-  WW ЍЍ/@-\00S 0  0000 0 'VpЍ'Dܫ@-@GHFFp0AH믅pp@-pMPP2 P0S 0@P 0 0 00 0XUp DlP@@ ((@,P0P4P8PS00!031 0@-Mt 0U@P \ =QLPP @ (@@ 0UP 020Ѝ0$ɠJs'L6@-m@0P ,S _ SP%Z4нP@-d0 !T| T@0!6q0\ (0000/ 5JP@-`0` X| TD0!6q0\ ,00 00/ 5JP-4s00#p^0<\ 0000/ 5JP 4ps00#\,s0P00/00 5JPH- 0:# ^4 0P$0000/ 5JPH- 09# ^4 0P$0000/ 5JP 4 <# \,4P00/00 5JP- 0:# ^ 0P0P@d|0:0# PDD#^<s0\ ,00$00 5 J@- 0 00OP ЍGp$ɨA-P;p`@WЍ ⰼP ᪼3MP@ p7@-P@U0  (Ƈ.R Ѝ0,jA-0@nS0oSp@ pP``ASPR0nS0oSnSPPiSPP'm{@-Ml0 Qr$'XagtFlp@-PQ@@pQ(0op᥹P0p'8PA- 0nS0oS 0 4i@P0Dt[/P,WpWLPP`8K/Op@,@P@'8^6@-Si NDLe%ZO-@PM pͻ0`"P0"儒 P0x"[Wp/\2 00CS20%|000& 0|0`P0 +0000 0p00*0ZVj=Bpg 2rPdPMP* UP? GP e@ PZZZZZ[4ZZ[ Z[@ZZ[p 00 0 00 0< 0x`|P 00  0>P/ 00 0< 0mtyAp [,0t0Z00x0V0;;0|0ЍZ00x0,q,%S,q4O-BMMI^@0 P@:00 X 0Ap0 <嫍0 0/  /"aKʫ07@-@P /0Lo SϜ 0  Ѝ0(@-@C0P@2@-@D0P@@-@ .0S 00S0?  SЍ:p@-@P̡P (M0/Spp@Pe~@- h OMJ%ZO-p0000@P`ᜐ (,唰00 Vp0@DTq oP0 P]P<N9 O4%S,q,,q4et@-M@A>0 0D@00 l0V@p0S SH O 00,00 όJS p@-@PDP (Ō0/Sp-p@)Pe~@-g LtJ%ZO-p0000@P`ᜐ (,唰00 Up0@DTq oP0 PP<册9 O4%S,q,,q4e@-M@A>0 0D@00 l0?p0S SH O 00,00 GJ^ p@-@PἠP (=0/Spp@Pe~@-  I%Z)O-`0@P(,p娐娠娰0 Up00@DT oP0 TPPE  IA+ Oe,q4%S@-MM0An H 0P0 $@G?p ًI]p@-@PJP (ˋ0/Sp3p@/Pe~@-f KzIj%ZO-P@M P0`r"Tp)20 R. +x   &  x `!p 0 *00)0`Vp~?pz suPfPMP9 9P$ GP g@Pf0eeeeffDefleeeeffUP|0 0|00|0|00|00|00pt`x0 s~P$d~~Py?p Z,0p0Y00t0V0;;0x0U+F$00|00|000ЍY00t0,q4%SO-MMJNP0 @P300 x0I>p0 \ڊ0 0N/ 8 ]000 0@(OJHʐ47@-@P 5,0Lo SϜ 0 奊 Ѝ0(@-@C@0P@2@-@A0P@@-@ ,0S 00S0?  yЍ:p@-@PP (s0/Spp@Pe~@-[@-,e40 0,0,0(0(0$00 0gJHp%Z:7@-P @+P00S\ 0 . Ѝ0p@-@ PX0 シ0(pdPP(PGp@J'@^O-@H pbH 8奮444f Rp60pGWQq 2@FPllkPkPkPkPkPkPkPkPkPkPkPkPkPlkPmm$kPkPkPkPmpkPkPk kPkPkPp@kPpXkPpq kPkPpkPkPkPkPkPkPkPkPllm m@kPkPmLkPmkPkPmkPkPmpLlppppqkPpp40S = 4 40S 4 0<007aE08:h$0000000D30@90;g)P04P 0I 0(80@008 0|PPV0       +  @   ' B ,# R#  # R" , @ ( "  )            |20  x{0$000 T{0 000 0{0$800  {0<:00 {08:00 {0@900 {0,000 |{000000{0909Rf01r`0$000 0 0tS0,0wL0 0xE00007000+0呬40 E Ѝ$4}$ʀ,q4%S'l'd'pi'hw`AGPZdou$ʄA-RMMI>0PC@P@(0L AH`q儁( `L0;p0KSh0  R < (Lh0I&E0 .( h0N/@  封PP ` p,P.`0TP P T0G0\ $00X 00@00\0|00x00t0 0p00l00d0~GRݍЍXm'd<p@-@P^P (߇0/SpGp@CPe~ R R @-‡/0@-@MP`p 0:000 ;PPЍ0P0 0 0;0 a:0P Dbs@-0`08/00@P 7:P0 STЍps@-`P@00!  PT0 0R0S PU @@ 0FЍp'(002P0/0S" -CM001010 000000 0 0P ۴I, (FԴH00Cߍo/ KO-MpP8@@`p+ p Dj0 $00 00<0040D0(P080,0|0PF0<0lP<0< Dp PH00Ѝ0S R@ iF'u(t O-$MP 0'p@` PPW V0i<00$Ѝ 03/ Y0p P$ 0P-: Pp ` @P LH03/pCPY'0 0Q pW@ P  ?aH'Q Q Pp `0  F A-PMM`p/dzp P@1L# N4AD0@@ 0@00 0p@/pߍPHڀ@T ,'G-P[ 0M@C@១0P` :E0P`PU u 00X 0 >P " 8{0, 0pp00S0 W0S00S0 p p`  oP 00P0S`0vD0D00W 0 0000P0P0Ѝ 000<0'(XmU'--0M 00H0 @ӹP (嫅b zg Ѝx@-k` E\C%ZO-P@M$  00p 0@"b0"@0@ "pNp20a0CS g@P}}d}d}d}d}d}}~}d}d}d~D}dh0p00@0܇p G! 0 xP:zx  P _0S Q |  dKz \!! 8P =0S Q   -z ' ⃇p l+8p t 0[4S08pS @p @Ѝ?B,q,,q4%S("'R@-MMCN@800 0@(00 08p 妄 0 )D"&D!#D(; P(0lD,U: P ,0TD0LDލЍ4 D(D+8HYwi7@-@P %0Lo SϜ 0 X Ѝ0(@-@90P@2@-@x;0P@@-@ %0S 00S0?  ,Ѝ:p@-@PᥘP (&0/Sp p@ Pe~0/p/p@-P@ừ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P wtqDDk@@eHH_LLPPTTXX\~`\`0p Qp` .P0@ S p@-0@"!Rc0p@-@P-*'$pA-0@PJ04S->C->C?X9>:>C?n:>CF 0? AC>}C>GmFEnFE~GX J.X R  $$((,S>,}S>GỪmFᷪHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqx@1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,➔2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+Ủ000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@  ~"ª PP1+\#0A0 0 00L B 00 00 00000u0#$ 0 aB',"'("&8'$"2&,&42r"bJ 40Ѝ0S/!  O-,Mp0`PTXP $  $ 0P. @T 0 TbP BPG@U   P$HHHHHHHHHT@ @ @ @g@p \0TU @ T0 0D dS1R ˮ"P  T8 DR0UQUDTP 0  @@@0X R    0l Z0 p00 S   T^ ,Ѝ0 00 $݀0 'x6@-[@ PU xx@pp50h`SPP\@Lp0S>D0D,@  @@'xi%Z/C h00S/@-i>'x0/s@-P0@0S 00S Ѝp@0001!Ѝp@ڒl0`1#ā0P0?V "C 0$?"5>Ѝp'|''''R/s@-@00S#000S 0 Ѝp@裒?.ă\0P`e?V B 0$?$=Ѝp'''|''?A-Po10MSP8MU`aO0@OS@ 0 402#0, pu!?P0< ??. U00S1UN@@Dfu 0ݍ8ЍA[u0*Gx0 R `\ : V 001Bu0*jݍ8Ѝ'''' O-C ` d 0A axS0 <0S  0Ds0S 8+0  B  R\ ?0!.0S   d 0A a 0< 0$ R$  B ,0X0: 0P> p 02ἠ/<#\P2[ 0  ?>#‚ 0Px0 `0報 C c à01d0 P CS cQ%ZO-uM  d 0A a 0<H50S  0( R 0S[`PЍ P` ` b5BL RV@QVR4XPP. Rpp P D "r PD1  2D1# "r P 1 21T>0 8 Po U `P000 0$5S ? 00l1>0@D@ @00C030S300C00  0#0030 #300020SNd 0A0 a/5 æ0 ST0T00  B 0Pu SX00԰W,ڨ0d0? 0 0A0 a5 /ᠦ0 囦Ϡ Ϡ,,3 0劦Ϡ ,0/Ⴆ00C000 \qS T10S   d 0A a 0<'0! 20Z=V40Ar8 0 B0 080 $0C  $@$  $ 40040 08 R R` /  1> ( '' Uf%Z$ʈ2p@-P   @ ڡ@00Sp0?0 00Sp0?0p'$ʈd0p@-0@SklP t00000B0F0p'O-MMℵp,@W `51n_R0PPCSyq451+10@ ?F 0SB ?2?F4$Q/NFp؍ߍ @D@Œ@2L 0@?DKd04 0BT0 0 SC0ISyq$410w0@/0p22220B'oF0k?0 0 40 @DŒ@ @0L0 @?DdK40 0L l104 @0#p R0Cs000 2s000p`20S7w 2࢟ 0 000p0u   `  Z XZ0 ``a ,y 2\0Q0@/,040<010(08? 0$UQ `@0 0D@ő L00 /4;050/ 0@d0 0o 0  1r 0aW /p`| 0"/\0X0`0d01{0?{{{{(0, ` D@őL0 0/4;$!// 0 dhl 0A a 0<$ʈ'|'A$$''TO--)MM,0=0?0(8$0~/D0D`0S> 80pW:,0 0  0 ;9'|''''AP@P`P @4屍 P@  4姍p\/ 3E⚍p@ d3T@  r>SPp *㕨 g>P tC(㋨0S0,5 Sx0<0(5002 0,%S0022Q04:e 0Q:]xx" 0 04 0A X:O 040A 8}:F 0 4Qt:= 00 Q*k:4 00Q(b:+ 004 QY:"1 p00W00G-\3Sr1\s(pXX\1X0SH:: X0SS0$50 40bH00aL00BϠ<50A8ŀϠ@ŀD50\P00\T0R380^S`R001 : p4oP 0d0 a 31 Q$ ''$ʌ$ʐPw''-X'''5Ti''$ʈT'$ʔ'''0RC00#!3x000<44$0<0t D0p@po0|00pXsL5P5 P4H 0/8@`D0/ p?po`Tt00F,o! L ϧ !>  <4 04%8$Sb9+22 p<4800x 0 08`S¯PN @ P@0? 0 0P@QQ* 0 /Ⴂ@QP(5#R0:P@0$- 00Z00 1`%"0 ?001>0Z`0 c2# S,[!Q [300 !1 00^00CC +Q`0?#"4 0/V`1V`#T0`10F 0I  0/  B@TP 0ἐ둈! 00B1  BZ1 ` Y"B !!0 R0C1I C0/ 0`ԡ둈!0  B!Zӡ!` S1B0 S w8@u @P`x1+ F0<48ĔCP`0S8Ą<4-0$5BPS,`QɑRBDL0 0 0000|60S|0` ?H4L04P@0 @6p;' ,Kp00R  QD|xP7\5?>C00!#4t x0Yt7 8!"T a31< A202!0 0;P@ 04 ` ᳥ 0L$4  E$ ( B, D%LV.  R*h 0(b < <( X D( \ L( ?.@Xd@+@B@A.@B -< He `qx @40K `m0 ,p B A YZQ !rm0 XZ R  ŵ{A/ 8pW $?. t{ 0Ąß Rï<0\@D$44 0L4( 0ĀpH2 R 5#< 5,23lr0S*{됺 z'z'zz {' 000d0 CSQ c6Rc(;R`47 @ z犸 z'(Ȋ0 (08 m;R,t"7 0  R0:1P000\tP2#00@Q@0 0ɉp00 R00&$0 Ƥ0Sc@ S6 QQ0 뀠@t9 j0JF 0QK0`0S>'F^''B 'Z%Y@th%Z@'T' UrhTI''|'$ʈ'' 8' `00S^ 0 #$A vl$0+V. 墛00S  0=S,K0S$o0S0$0! , 0 B2\,,^   00/d A! a,3 1 !5$1H pp*PP04SP0 0R0 S00C0 S 0,00P0B 0,0ST囓 p开<ȿ 0ᘥ+" 8 Q \%p#R!0@ (0 0 @DU`@4Ak20 @R40 `0```0T00(s 0 嶣` pL3$,X0`0 I9pQ㸐 P#(x0t0 Sx0x0 B\0X1`01Q0C00h0`0lR#00B1 d0R*,%u U0   (0 0C0D(0( 0 R R` ` + 0$5S  l01` p0000S3d10%ST0T00! !04%SP5X0`0`P5S00d0 0帠 嵠   ௠0000080` FP@Q k+H0H (qP+H kH000-ᴰR㰱 ,  BU 00P0000T0 10X0岑0; R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4400CS ~T00C@ 0`w`d4  80Q~T:  $5SʨG $`$`(0wV0S ,4  d,04  0,4 $r 00`  Vjఙ0S   0帀0 X#` x0x 0X\%Ϡ  R     d 0L  l!1v L9\%R Xi0SP.pi\`/ `ƌ$  $ m0`S` 0$5S  l01` 0000S1d04*ST0T00! !0X*SP5X  ``S 0dr먐 n   h 0ྞ00080@&0C 400400T%*$ Q`?0@$00$0l0`0@hppT:S $S0ppS $S00S0`@Rqtl倐H)ktP00@i8p`0x1\@pY70IX!@@Qtl00@0T: 0 @%A$\Q  @08( 03 0( Od@ 0LLC l 01sp0SH=0S0 000S.308C|M = R0/5,\%R    0 d0/ @ `.3,0 $ *30000S0S 0,00C0S0 X>0S l30S 2>0S 0h 200|:x*,8gP>0ScN C>`>?.0S003040 4004 pCVW*DGsV.P\oV.GV⟠0S  ?0 PS?\5=S,⋠??^0E/0 0S 04  dHLĒ 0A a04 <,$0S0S 04 d ,04 0' 04&)ݍЍSmfG-`RM@Xr sPP drP`T `P P8  ,&p q0S  zߍ<08 0(0`0,0 000040!04 04$0D0(0P /,W[  &pU p&p* dr`!` 8  < 05 $1 -  ) 0,0#0  ɟ q&p 4`?`a8SڒmPb 0  00*0P0 h `0 *0 L@dAdec@dzK7{A-PMPp`;@ >lp@P  P03P$U 02 " ݍp@-@PቆP ( r0/Sprp@nPe~R/G-P $` 0pỚV@`0 㴚@`` V`@&!D( `G-@P4S p`$X30剑zuP| | 0 0! ##P 0p`/Ѝ_ uP : F^ :^Fp@-@P`    pp@-`P@ ((UX0 3?X0pA-$P0 U PP(`,0@4p*^ :^ *^*X@O-4MX0p0\00``P0 0,t, 0Q% P 0 *qmQ;aQMQAQBA0|bA Qό΄΄΄΄`΄΄΄τ΄|SQU @  DT dR$0 9Q嫞"P T U8$0UQUDT P 0 sQ @ @ @U  @@@ X 00 ` p0S000 00  0$04Ѝ6@-K,@ (0 w.%Z, 0/p/p@-P@    ApO-@0p Pp`G0 00000ZI00SB_: W `B?F ᴐ'@'P0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p'@0P  C @- (p co`/ s@-@PH` 008;/V  P@pЍp''@ s@-@X00SPH0`ă5#40</V  P@oЍp'''@ h10 PS/C-TQ@@MPM`6`@f$q !`0 P08 0 T:@6S/O@ ᫚ DD6ۍЍC 0+0 R  Q\ Q 0`;Pd 0+ۍЍ''@''0' O-BM p`-PPp"puo F (0< A06# R 0 "_o0 40C 0 !Ko00060 &806 0@p00C0(0&V :D!Pp``Vp 03 r(o$6/ 6   C c1 0 &$6/җ `V&L0S% 0: S$0$ ` :oB0d  &ЍOc/6X'@ @i$A-a00S FT:p,PP  0 0A1S0S4/ P @D A01 S  n0S @21060&/06@p  p 00C 00'@ O-@PGM@X`"``?P>U㰐Y  0@00D @/60d& 6F H c T4> S`$m h3 XRQ 0@H0?̭0D9 0 R (cR 5-0 (0)0Dp9 $0U C 0 fP0  0 00CR0 00,0    (pF0L0 06 0 6< 01200UD  ,000$P`%($0\ $(p,,|<d0c0@LP!R! 0T0;0Lh5,L0Sf h+;PU pPZ  v L f[ $ ' \p$  0A! \ 11 C V0E0%QPffC0CP!Pp\p : R+PP0  〚 0 0d00,0\0000<402802@p$0 0Cs0<000C(00SEi/0p @X0L 0S @Ӊ LP os0 @ʼna ^PP#\#Zp P (SWH0aS 1XL : SRQp9   `@P@0j V@r@DOoB@b } |KP pY00S  LP@  pAP 3m`PUb$0 p00D0\$PQ @ ⚒80S}0t S 10S10S00S11021x0 0180SK0 RS00 R0 R0S= /0P; 0@S 00 T^Y0Si 1Sf 1Sc 0 ʍ1C0S [  [ *0SR3#:\00<0S @!0S ?P@ T <0 0P U8 PDJp8眏P@@0111e000Y0`S`St0S4X0L 0H =0 0Mp+ p`PlC0S)7p3 p1S?V?`#)+p' a 1Sp)!p Q1SAf1S Y}p( r 2"OKK@0DP?`|KL0OKX0K@L0 0Z0T0Q0S<P[# [ [ F [h0S h480S h0S`0d 000@0D0 *d0S %`0S  T*,800S0 [0S0S"  0C 0T 0#Sx{"0S0\0S S <k(0S ( 0C(00\00h0S0x0  |0S|010S1d0S 1`0S$140S /40P$0&9"9!>0P$0 $Epl$ P1: SRb0WV000S(dR0$0S00[X1` 00PV`5U0,00Aࠍ,0Y ,`'H넵U p⌍ 0 pSf:Yf,0{p`uU ?q 0`SM: !DR&0S $1 S+40$00l000 [ 0R5 R4*P !RP5P"S4U  R$1SPP$Q$1t SR U HSRQ SP" 00S<0 P3P%P5 0CP0쐝Y [  0D0P,00pP1+!`G00b#02b#b& 0X 0S쀍 [( Y&: [֌,0"P!,"00 S :0㈀ 0[Œ,0P!("廌,0"P!0 Y` ,00 0!030q W5o:0+a&0G 00+10000 [\Q [PQRU10A+!0 Y0 0@c&0p0 +1G0A 0m0S1!YV*<0T 4hygn%a34 f>Gs/?  2 v L     Mr$          $ 5_ < Ch K%Z( offfg8 U RRaArrAa [0 [00S 0( S00R 0( p  [0 [00 bU*3!A$$1QR0X@!Q5?01SU001 [0XS 03 !p515!000 ,0!P0S  0S0  1L0 Y  1X0 1X\0\ 0 1?Q0 8 Y!L P ,r \b\RQ l $Q  ~ H0S yލЍS03150p5 [1 1Sx0 ] #>H02`6PP  aH#>CY18800 8,02#|H0 [00H <0(0$4s0`0,0#4s0d0P0#4s0h00#4s0p0)4s0x0X0#4s0|0\0#4s00@0$0Q $$   T  00D4Q0T0(0 S \40S d( (0 0 0 0$040S& ["$q4 0W0W03 W00S pZ$lp处0S  l6p T  $< p ׍Z [$1l C/oS" R `0 @ 0 0 0,0 [0d00000P00h0000p00L00x00X00|00\0000000 013?$00(013?,0 100#410$120#430)001t 02@100 0$2?@1c4 04v 08#$0 #(#< 0 0'94 9>Q T0Q40S0000o0 00 R  ST T卄'?  rp@ TU z !R R S 0 S7071011H0, RZ*8JொQL0 [0 0+ S  R   0S* 0H0< 0J?oR20S ?(0 00 25 0?10 0P B24 0?180Sn0   k B*{@-S-c@ 8 / Ae@00@- 44@4P\P 0B"" (@-'B=(͸@-: a %ZG-`@ P p嗌00@P U0 0  P@ G70P`0w+ 0P_ R 4 _ U   (,q8 j s@-pP@ 0  5X 0TTLЍp SP `50  (g( @-0S 0  ^ Ѝ g@-@p$M0 0S ` P?1 00P 0! 0:))41 l/5\*5L%@DpQUVPE:$Ѝ     $?^0@-4M@ 0P0S Q 0  R0  2  0$4Ѝ0@R  #  0$R 0S 0S  0!( 4Ѝ0@4Ѝ0( + L m @-p ^(¸ D@-0 L@ R0* 4s# p(ͰP `00CS`0p S00 P0S X0X /X%Yp@-`ᕋ@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hzdz`0nPp <10C <1$0 810S81($8%Z@%Z(0@--@4MT 1A`-d*hQ %`"R d2RK d2SA = hk0:{PPS['ΞkHk?[E{7<1 = > * + (;R  PPP 0 @@@ ! zj{ k{[;R[4Ѝ00B:k{{'*k{h;R ?@@?6C-@Y( (    $8@((8x-o@-Ci0d2S(@0@-0S0@d2S-`2"R2$8(@-@ 081P 0S~0,3,00,30S3S0/4PXl\O P|P nH Vv 00 3 S O@@ 0T S S00 0K#=PCAP0S+K K_40S3/S9+K &K @0 K@PH[K>D 0't,  t  t  l0S (8xS`S)?S DS . x000Lz*P0C K+ C (K0C+ |00CS00Ka0CS0T/L01`1/L/L2(/L/L/L2/L/L/L808x/L9/L/L89H8 ⶁ  ⅃PK @0P* 0A0 9 90Sx9 00K  K F ␁ 8 _PK 0 V PK. K  s  BPpK P 0K. 80  Y p (@PV P80S 7  A  P>8(<08808407007,07(07$07 0707070707 07070707%   PK  PP ,70St'0 0C!0R3z T70S0Ss K 2 @P PQKh ?PK t0@Pp] K> 0 pԀt`@@hP0V#T00  HT\HX0Qt0pW p`R000QSL00D0QDD0@ M0 `X\0X0S 0PV)PP PP K 0P@0 K. K>x%x 0  `@씟D@pP @ VG| O 0S$0 0C!0R3 0S0S 0`0+P `0%P c=0,C 0  R+ .t C 6n0  d0d0`@ 4pL Rp 1 1 S 01 \Q \HHB/p@!bK L0 S1P00P0P D0S( X3 R  h  X   `DH0 S   \0T0 S `,@0SJ @DUYF    ⎁P0S|& x 1  ` |PcݍЍ 4    iPPA0S, P    UP y  HPv m x <PPj@d0SXT000+ bzO\L*<D\( )P)@))%Z"?P+ ixN)$\<;`u> )͔$@`w9YA{))ͨfffgcI *0 !i" '/D.6 * < M V [ a u@-<00iS03S !:KP)͘)@ l0@-h@'   Lo @0j 0e `)X     )Y@-@`| |0 P0D!0PUR3P T0p0S @0R<< 0,$p Ѝ)$X)ͨ ;g%Z@ C-P`@!@1 0E!YR!tM@p  10S  tЍ000iS00S 00S d `P W @ 0  P + BP000 p 0pi W@000)$X)͔!%Z@)͘)ͨ$\!` @-@X 0C @T!0R3@ 0P   0S $X)O-xQ0S ll兽T @P 0S @Dz@a@qP0 0@0C!R! 1S1 < T`PpԀܐ 0U0(' @P 0E!0R3x0S   0Se @TP`3# 00 @$ )ͨ%Z@!!:))))͔!L)XO-M 0% 0Cq0WsP88 P p Pp0  @P ``G FRBTBBEB<AC [ R  R  R* T Y   ```_ @$ R 3  y V 00030S3Ѝ  R  R  `& "  V P \Y F 0 F X@00020S 3`%0 .X0000  000S 0`` 0  0@0020S `0 Ya  k 00 0 X@V0000Sp X     Rd @ 0 0 8T R$q0S 1 @T 0 @g 0 @$ 0 @Wh00S 0 tL} 0 `D0 D$)!X)͔!p%Z@"r!!%Z!!!)X""2"Up1G-0S ``幻`@TqT 0T0 :@18a P8qU @T+$PtP@`0S 0D !0R3 PȐ尠U 0S 0S   .'P0S0S \0S  @)ͨ%Z@"))͔)X")"Ŕ0A-0S RP `p @T V @\PT$@ 0S$p$00a`@)ͨ%Z@")X"O-!1 RR0娑S  @Pq倡 0 P0: ЍS DP `P 0 #^ 000] @QP:RS  0n Q yq`P0p[0 o000%`000)͘)ͨ)%Z@#))#:#O#_%Z#v##(2O-0S 姺0b0- 7f 1QpԡP@p0Q00]: 0Q0 *@@ > 0X0: 0R0*0 S( -0 R S  T0:X00#03RQ00S !Pq 0000 S  Ph] \ X000P@ Ѝ)ͨ%Z@#)))!X#_%ZC-MM@P Q 0S  0 iJ000@T0S p@ 0T0:ۍЍ`PP@p0 C Y ;  000PU/ )ͨ%Z@##)М0A-0S 弹`P p 0U0(@TP`0  RF000S ,@)ͨ%Z@#)$A-p`P@P 8Xp0S 0X0 0C?oR20S ,DoS 0$'%Z$U$Ap@-? @Py$ Pp0 SRp)|@-8~0S$0$ 0 0$j$)̀$$%ZA-@0`0/0000 SPڤ/0>+b T0 P<VlP0? 4 c00?)|)t$f0@-@0 0t0AЍs@-@P`P @TZ TT ?0 0/t+"+R  + 'Ѝp$%Z$0L<S/ @- lP)t$f@-<p @,P#0@0$f O-2@`pVCMy Qp@0DWCߍ`TV B/ } 0R ?s0 06y U@\1P0 S8Q 0S>(h X:0000[3*0S p0 0S g0 000R*Q 0S x`WQ0/3?0 S 00000S  `)͌)H%Z@%#%7%Q*)ͨO-X3p0]MS DD&@c@C 800#000RS #0Kp"& :RPP "OW 0"00RS[ 0"xKph"lL_:PP"L  PpDDB@@r0PSY : SVH`P؀? #x!aL<S $ 8 <8  @ ( D `  P  `\  T  ؂X  HjP ,@ U8!88hN/0>+b  P<jP P \0?0H @P :PPD | L P :P1Q|]ߍ)ͨ%Z@%y))̀)͘%$f%)t%%$f&%D )&)|&;qQHQ)$&Z%Z$f&k@- @ 00: S)G-@q `0S+dP 00S P0 S00P R HRڀ00S |p Y \tyP Y00:$00S $))͔%Z&&D&O-AMM`P@opP8 0 840 AލЍO/0 009/P6 0p!p {  Ww`Q D D @P <*yPD {@P@ O J EyPD c@D }`ḰTAލЍA> B   R ; 0 0t$D G@D a`4 e 0  D `c)t'%Z&I':A-MM*00 /R @`㨀pyPP 0S P@ۍЍ0 D /v`D @P 0V xP`D)tp@-0@ @P BP @ p@-@h@O-3tM0 S ppl00RS\3 P3P#0L HC4#S<88tЍO, $PL  {   + p0@`00آزL<`  L\0@ 幵WI < h`VV#W  e @Pp WL<0@'pm0PxSiSbP 0'0@$ 000  L<0@ |y ``pT|mL 8tЍ0 0C0\10S 0`S$0` S\Xh0SS   1810S d00X00%90P!Td0 < d)ͨ%Z@'W)͘))̀%$f$f'~%Z'G)t'')͜)͠''((0(A(^)F(q((A-MpM`@PP 0ppd!d;@P TT Li&z)< 0 ۍЍ aD D< pPU., U`k p0P i y xb  0S p T0TP 8 P y8 [E(&%Z6)t)͜)().?@-&P@-L@4#S 0  3  0#S0 * @ $f0A-@P` 0 Q0: 0xtp0/t @$aL00S$`@pV0 SR$`)))4)͔)9 0S 0 0/ R  /0S)H0 h p@-0 @Q0P*H`0/t Pp0 TUp$/p))40p@-P@ 0 Q0: 0|$x`0/]t!1S 0p@D $P\P@@p$ 0))i)4)A-PM@T 0``p/VVP   @vP @T@ۍVP @p@-/Pf@P@p00/00@P 0S )A-P/p\0@oC 0T@@Dq]XU pDP@D)8)G-pPt`04PSp) @P`0PP0C0 T`4 $0 D@))4)Ͱ)G-頁P6pS`  @Ptf0&(0C0T%Q&F( $06"x00vPPEPP Es @$  (@/s 00 @ pP`0` P0@0 P $ )4)Ͱ)**.*I@-@ys00$D )40@-S@ \0S 0S S 0S M0 PDA T` R 2bD0&F$ ЀP 0S00*Z*m***)4p@-@`PP0S = 0P0 @/,P sLt0P 0 0s00p*O-2lM0pS W2YIp PP w X T Lj0`000@0 Q 0*`  0R 0?*A0 Sg @018 $1 %1 00`0801=1S1~WA$h1)͈)͔1%Z@11))͸2+2D2P))$r2u2O-C匃5)S+0`V3pRXie0S, q 0PS, 9RP=0S  U)5=0+5 %+ U909909 Ѝ02 ?oW20SPR P `FVpZZ4 P0P5 +"+REUYQ! R  E5U9k1 R, R" R# `10S&HP"T10S 8`N0S6P!90\,P $ 0 !p R  Pcpf  t 0/fpq;#;S <%1B+XTH)@)͈)͔%Z@2$h)ͨ2%Z2)3 )ͬ 3z)3!3:3H3a)p@- 7@0MS&6PP iP P ۍpV0S60S Ϊ00UP 60Sf KHE B ?<960hihi0)04&48#8< <HHLLiii xx|]|i9^EiEi:^EiET0AS c Pn 4PD PgpT0Sd40S XX900 40((,,TTXX\\``+n0 #  1 0002#22 02 0 (0#/",0H0T0d/%X0/&`0,0 f20q000%60, (0x2-02R0J "S " .x30=00 2R 00#| # #/%80/&0 %0L0<040h00S!1#3 *x l1S 0ST! Ha! AQ`DT]9-0CS   R0 R R 0N\ \0Xx0=0- 90 n)͌lT)@)ͨ%Z@3k)͔3jE3%Z3$h(44 4744L4nC-,2,B P000000 MRbM0S q=0= P 0RP 0AS_x<\l=0p㄁0W`lq P 0RP 0!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$ 0 @-RڌL0=ۍЍt0 h0P0`0\0S H,@冨.))T)@)h))΋5%Z)44445O-AM0J(0 "S $`;q (CA#͡ 5/0(0#S00 #0Q0У0d[ (0S $<(0C5/0(0,0S3,0P0?0!#0,0@ $P Aۍ<ЍP(0S  ;q( AC#͡5/0(0;q ;#͡$ 0$0  BRʠ0@SP (0S 1 P@0S& 0$00S  BU0S 8#S 0SR 00S \0l 9P tl<x3  P8P0S)T5T)@)΋$h5?)5)͔5p%Z@5 0 )q@-@0SS)0O-wM< 00 0 80 4 @؂ P 0 @00L0@0HP0D`PP:P S  S  S;  S 0 PPp SK  S"  S,60S  60S 6v0S-WPGlJ 050S  Ѝ50S P 0 p<50S  ,, 000 %p\0S40S  t40S Z P 0 89#6# 99V0 00T40S 0 < %30S  530S30S 0/{Pk 0? V 0 8""H30S_ H [D 0 .(#p0 0020S  20S8x20S Pfki 0 V 0 8""20S 0 o"p0 00r 10S 403/ !LhV00 0NT10S00S 0 8a^00S 0 4\  03/`V 4   00N` B)5%Z)ͨ6%Z@)ͤ)͜)@65$\6qss60)\)͠/F6Y6r0q666)͐)`tv8B6A-1, 0  S !@ 1 1R 4S8 !4|q04@0t\a00S/ P0S  R+* RS-RP- !0 010  QP 0PU 0$N H!P ЍPC/0P;C0P|90S050 00;0 0 @ 00 0))T5T)@6)75?7@-|cM0S llhChS0S Y^Pj0#0,,/ R0 2r  0500K Pr5"0C590C990C9000Ph|n x塤0S \2d"`2Q090 9P 0S 0@TP0@-@2  y0  xhs0 dPm0 P8g0 < a0@ ([ * 999 9)9.94*p@-P@P @0 4 0D !0R3 p)9=%ZA-Pp` W00CS0&p@ T 00CS0& P yTnTyDo0 @00  0 0 S%Z)q-@- T L00S @P@0PЍ@Ѝ/%Z)ͬv9TR7@-P@00S##P g0 R Ѝ0R00S&Pg0 l`X00SD 0@P<.$00S $ )͜9l%Z99)ͨ9^9%Z@9g@-@   P   P  P  h$P l H\0QX X ( H@0R%Z9:!: ::+:@:T$P:m:}:0@-@MPPPP8  P$0$ $Ѝ0P:::*@-0@ M \0 00U  kbH ۍ:p@-0@S g9t0P0SdrP 0@00g  p@044n000Sp p@e:)͜:%Z)ͨ;%Z@A-/`T@Pp/@DЍ/SpPP B 0  EP0000S@-0@S  0S 0 000h0@0S mPf @044000S @ ;;%)͜:%Z)ͨ;E%Z@@-0@S 0 000d0@0S P~f @000,00S @;U)͜:%Z)ͨ;l%Z@@-0@S 0 000d0@0S PPfS @000,00S @;|)͜;%Z)ͨ;%Z@C-0M.S`p4P4A0/SS 0  0U ! ٠  Ӡ  z  t  n  hp  xbX  d\ 000@ <=8Ѝ)͠;r;;m{<< <<<$<+/@-"8<4A-@P`App` P L80 S000ЍU00*<4Q -CM0(  Cߍ/=+=3p@-`P10 R  @  0!S TPw6 c80 T0 D00o d10p* >=p@-P@U U  0<F  $p@QS  >/>%Z@>!P 7P P / //>J>W>=-M M? 0/┞ۍ Ѝ%Z@4`00CS`0 XX0 X /%YO-pQDMDЍOS@x`lP !W200 u00020PS00C00@@ Rp@T3 W+X( U U L   1c  tZ 0.    !c  dZ.0X   Dp8I <p W%Z@>n t* `g* 3<0S/@-@QPM PЍ@# p31Q``X00CS(((((((((((`("0PЍ@L !0S SL   d0AS&@HXhPpH 0S0PЍ@輌$    0Y1hS fS501 0400030020j0CS PЍ@N=01 (0<00$0;0d 0:0090080070060 050040030020u1jS$ $miQ Q b_!XS,N xVPЍ* >{ t&>>r> > >>?3>???4^?$?,D?@?c??D#? @ @ O-@`pR X1L0 S |p   ЍO>2A/00 ҈P*'Ap`-P `V64P5 00 E ᴈP ApP ᩈP X L0S` Py : P Ѝ@p` X- w2* $4A>p@-P(@P V]Pp@$ތ0S $  R RQ0@- {D* h@- (0 0 0 0 0ЍE#BEE P P PEBE/E8E)@-(M0@ #\S@3@#:@ (Ѝ  EX7@-P|  i@P .rMPP @\PQ,V Ѝ0* h* h0@-QPM @T 0d@Oo@' T%<%(Tr + U  @ @%< P Q ,UЍ0U P Q%Tq @ 0u  @Ef* hEiEcE` Q@-.@h0 \!@@QR  0* h *h0s@- @R`  6 P.LP ,gU0S ,`U|Ѝp l0!PU U 0< 4aЍp@!Ѝp@$@* h* hEo@-@T T 0( (E ЍЍ@,Ѝ@Ew* h"!Q p@-@P T p@<  p@0 p@|g ժO-@"PTMA@ p` @@0@$(@P PUTЍPP0 @@0Pt@?lT:TЍO/0 EW y R@x   ;y0P ayL  ,\100 0 S00C00  Q,4P `0 m0 0`g M` `X`00CS`0 X0@X0 X @EE$@ ,E%Y@-00C Ѝ@-0  ; ЍO-@p P7 aTAD -QP  P PPP@D`FRPP00SP ЍE@-@0 0 0 Ѝ@?@-  E%Z@-jE@-QAM`p0V@ M0d aXQX!0T L0P 0 0 ,Aލ ЍP0001!! ?t0; !R  0GUKE@PX2 E2X<T0 <%<@D@ \0D0X @ DD*XFFF%F rF>Fn*t$FFF@-#*t0@-6S z:*XF@-sXXXxXm/l`@P" XT:  <4UX, @F(F*h*t@-  QI%Z0@-h@  0@ 0\0CS @C%a00S/p@-A-Q@1(pS1S` W 1SQU(W1S WЍWx1x QU ЍA <1ЍAHW(QU0S) S S QU    QU  WЍA   Q U P DD ЍA_*$$Pa%Z@&_JeJ?4 0Q 000/ *$$PJA-|AJM1MSh=`p[H0 `P>Z c40`0 Cp0S JލЍ;T P0 ZA7J.H0 0A1$HpL  $`0P0p0 PpSZV Li0S8b1!0 !*$JJK:G-xAp1 `S1SP V1S \$V1S VG 1 HV 0 \ GV\\0  嘠EPe0SVGx1S Q 1S  0 Gx*$%Z@$Pa&?^Ke DA-a0 MSP@0@-P@0,M08PP0 p,Ѝ0 R  '0 01SL& zZ{e[jKZfke[KK{K;RK*$&McO-bp0MSP@M BT S P4"4o'J@ T  X:0@8 0 Pp2o3ٍЍT ၯp T "R x6' X R TX PR*1 21 0T 1S1!T0 0*T 1!0 0*uopP0 < eq _@O 0 < T`*$ gm{MsMO-{JM M`@PO3 pP@ @WX0!03W00 SE00CSO H  =>P@8P3NP p0800,0(NP8@ T@pNP4Y =y-  0S qߍ,>0P 0 0T P 8M80S \ 0SP0SpMPY@MP,T MP MP040 MP040 MP MP040 xMP  d \M PT  bP 8 804S  0SQP0S M P#T  DP 8 ϫ80 Sp  a0 S1P0S 1!R00:qzPaMP8TY 0`080 Rk aBQ# L                  ikklgjx p \ 642O 8 f8 0W  R0O R0!1S00: <04140k0S0<2   0H0`9XP) t O 8 08 0W @ R0O R0Q0* 0%0%04140k0S0404@T4qJ4JT:k gO 8 8 W P RVO R `0 41 40kS0 S41X40Sx   0H0 4@Tq@{pk4@TgXaX41ShZ4@Ti{@p80P.&9008DA|aP8 BjE804@U08080S@00 @ c/4 4 6@ @ 86p8 80 @ Y@0-1 `0400<0,0@!p$N X0H?oT20S 0H?oT20S0H?oT20X0Ss1!0 x5x1"~04 @1@SP] co p0 @NdtD`\5p`H 7pH0SX Z(NH-0A1 ^d! `0 D00P0`qp^Na p1!0`100CS8$D$1"< =<@P qߍOdoob4S w043 (04c0(0003, pI7p;WO,lH RT=00D@ dEK`P0=S "8 R0  07KP 0=Sf h"8 R @b  )KP 0=S 0"8 R  qߍO( TV0@40,00@pQVD@0S 1SL X* CPP `V-,  0 0(0 0,003Ap06/00`8T"XH(D,PX\0,S(` T'&M Xpq zM0"S vMy 0 SX0T R: *$$PNO NNO O; ұ)O=NOBO`\KO~ǘOOP PP+PIPPPQBQ Q]Q) XQxQQٺQ$~QQQR*hRHR6:N*800S, S S0h0l $0Cs"  `B0P T0LP0PT0pbpWD5h0l PK000&00' T00.T0hPL0S @@T T T0P 00,0@L D @' 0`@0 K000.000h 00APP \0p p WqߍOL0S \0,`i0 0 0Lb0( 00,00p @-@P   x l ` T H < ,%ZVVVW W,WGWZW{Wt0p@-@PT`I P  p@0Tp@h  *QWW@-M @ GP   PCۍgp@-IMM @`/P"IލЍp lP0 ͧ0 lǧhP 0S 0S0 0S  PgWX*@-M @ PDۍ00 R   aPg*H-p`3M|M/PPWZ@PHP <HP@ P孾04HPV 7 HP00S , >P   5PPi P tHP ,;9[ J, P U(AP0S !,V! J1!@ J P RB PQ f 0 UxtJ|!|1h@  R$BP< I @4S J P ڦpRlPh 0R :CoP᫲ =H > 7HP00 S5VP0 xxWp 0 `XOp*X9TgX<XFN<XPXaXXqHXXY/XX%ZYO-pMM`;p.(p P@@ p 4p p0Wp㼱0Z:y0S ލЍ0 0W@P\ @PLqLL?HGP  1pZV㟉 1Z SP Z.RpZP Z.20Sa00 0Z0V9 Z-P t\Z.,@)0T:Z^P eZ. d|aAdenYm*iYAX@-0`0 0PPP 0@PT PP Ѝp@0(PP D Ѝp @hO--tM< 8@40PPstЍBm0P(0  (P< U  夥T T T;P0t4tT$0.ET6P0X4XT$01P0H4HT$00SZPT(4TP$004 0S0R0S00 0 0 (0 @` 0 0@TF*3#03  0303P0T0yP؋@(0P`,PY6*40S 0TS0[tDd  p 0`pt 0+Xpl X `J(:m0P02R$0D 0BnS01 0<0S 08 S@ p?@0?D000S+ 竸z0相S 0P0/iD T08  GP/0 L YD?L 0H QD {{'0{H 0,00@ ,0 0D0 @ PBn| 001 00Xp`?$ 0\`0 +4zp  0G$/$+4hkp X0 0T0 {{'0{0h `Pȟ 0 C` 0C $0pT @YZ6ZZZ}ZԡZԫ[Z[OZ9[^[[$݃[=[G[pr[[0SQ0兤d4 00kS& Lp p4Xp p+4` p}  0[ $+p4hpp h0` XPp ǟ 0C 0C$0`00[ 0 C$000$ T,,0S0gd0kS㋤8 q 0pXp2 $``p+4p'  0[ $h+ p4p @ @{ {'{X0@0 T0 @ @{ {'0[PpǏ 0 {C 0 C 0 CT0 @Yr[[\ @- >\)%ZA-@`4Sp  }PɺT0DPEE$UX DP00DP 0-80 P $3MDPE@D* y gp@-P@Q0  0 pDP @0S \0$Pp H=0@ 0< 0p R$$$*J\*\|***\@-3400S (0 0 pp- "*J*JFl*0O-\M0 MS1 HpW-Q`@`((Q(0 ~6+ 0-=P 0 0 ۍ Ѝ0 000nS ?S aS ppS qS x0  h0 d0a0L0宁0 8U*J*J\*J%Y\*e\%a\\] A-X`0S L00S 08P8@p0Pp00*e*J*J*J@-@L0@3@00S$',0, 0S00'*J*J*J** 4C-RP`tM  ,,E P RQ ğE R`S A0t`FQ ğR   TDR 7 4* CR ` 0S $ LF ,4\ P20@04ßQ [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+"<`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0100,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊ%a%a*****J]PA-@@P@T -@ P`p0Sl d0 @ P ,0< 8(0@A$h*Jaة**]A-@P@pP0`S00|0 R dJ R 0L 0S @!P@`T !**J*O@$^*\|\P@-x- 0 D*^*P@-l- 0 8*%P@-`- 0 ,*^1P@- T- 0 0 **J*$^7P@- B- 0 0 **J*H^XP@- 0- 0 0 **J*l^{P0p@-AM 00@0 0@S- P1 PS" 0S00!C:P 0S09>PP 0T00aS0` 00S0``0 C:PaS` 0` 0R`0 0@0S0@T@ @0 Q000S05'Aލp*^^*^^^**G-1MMP, 84 1ݍЍP0$CO:P @4@T0 PZ30S Scs 5@PQ >0 3@cs0S0S PU~\30S5 0P/ P30 043 0 $3$ 3Q0RQ300?o2&Q20S  2 0[P0002@0 0R R00 R ?P 02D"000 H 2 2QT100?o2|& Qy10Su 1@P0001@h, C 0PQ0S0T,PU Q 0S 0S0 0P+ 0! 0 00} 00QQ000?o2%&Q|00S  d0 0P000<0P*^*e ,h*0*J*J**J**^^*J*J*^PC-p0JM M 00@0 0@Sw+ 1 @Jލ ЍS2 0S! 9P 0S0<PP T0  t1t p1 R0 0S0QY`% 41 0S (1([}! 8PY#P0͡ B0S 叵@$00 R   R 0 'l00Q5pq T0SP00@-*^*****J^^*o_0 0 0 0\*_$J0 0 0 0R*_$C-KM MP* x2 Kލ ЍP0\"Cu8P @<2@82000(R?P 2 0S@2|d. P0 "aQq0S 0S 00 3@P F.`1@0S p5PH1 \F0P 818!00,1 0&0S P+ 00 000T   /o" 'l0 Q00S 0@YP0 00`0@\坴*_'*e*_4**J^ ,h*0*J*J*_;***_$*J_*Jo@-PAMM * 0 @PP0 ` pF 7|0p 0pppp0+]7PZAލЍ0S 0 `X*G*J_`_7*_$ 0P/^P@-)0$ 00 0**J_{__Pp@-@P U?o20#pP `DP t?P )p0U0P0 <0 @bU,0 00R^*J_0@- 0_*J*P@-v) $0 00S/0{**J*J_0@- 0_*OP*Pp@-1 R   1( @0PS 0 `{0S P 7)0 0p`PPl@ \0 t LP 5P80 @0**J`*K`+gY*J*^_0@- E 0`A*J*0@- ; 0`N*Od*@-(@(0 0 00S 0 *J`d**0@- 0`q*J*P00P0SA- (0 !0ЍPAaq0S000+0S 0S1z000PPDP00<P ,c67`0H L0<\04S **J*O0*J`^*!8*J``0@- 0`*J*0@- 0`*J*P00P0Sp@- [(0!0pP@/`PP0 0  00S00P|0x0 0l 40P T400?o2$ S0 **J^*O@*O<a"aP00P0@-S ( 0 ЍP  5P 0Pd00}S`00S T0Tz0HP 40 0, 0( 0*a<ax*J*JaMaw***0p@-PP00008@Pp p d&p@P p@'}2@ 0S80 0w00y**Ola**JaaP00P0@-S ' L0 ЍP 4 75P 0 P 0*^a*@-M Pp' D1 ЍP0! 5P @1@+P0P`p M0@P+0@0 S0 0S WP QP l0 Q 0S H0@AP000$0@*_'*e ,h*0a*J**J@-P ' 0 ЍP 0S t 4P 0S0TP0@ P ,0 $ 4P*aaa*aG-@`pFoᨂ@o;P 10S 1ЍGxY(& 1 ЍYPq YP4Y! YUQR 7@P dPPPA @1 ЍG05;,1PP(qPp5U@0 000G#T5U@ pV(PPP 0RP+9`5|0@0 -4000 L0# 80#ir**Jb*ab;b/a ,b5A- MP>& 2 ЍPO0S!3P 0 1C:P 00|S W7P 3P 0t:@h1d@) P>P!@4Q#p`1`t0S@1D0 0S 1(P[&Pm0 0S 0@T 0t_G&`m1@P =5 d@ 0@ >00 @ 0@3/H0T 00S008 &*c*Jd)d>dQ* 4 .*Jdj*/0*0@- 0dz**0@- 0d*O`*PA-PPPPU㈀ 6"00P@lph0hPJt00`0 @00/T,0P A/***Jd**7@-PA 0P00"t00 Ѝ0P!0P%0S0P 00'0@0S 0 S  @ '@00+T/0 S +</ 0 ~/P**d*J*J*J**dP@- !0S000 005 0P !0 0@@P  0 0 00el00h-PL0H0D0H!P0 0 00 *J*J*J*^dT000 0@-S$00 00 *J*Kd**K000 0@-S$00 00 *J*Ke**K p@-@Pp@0@- 0e**0@- z 0e!**PG-R@Pp P&!ЍP`P? P< P`TP5 ,PT. ,@PP$$`. U(1$1@W 10SV U00@ $ $``PK0 0  S  V Up0l0@W T00S H0H 0 @@ S8  4zX_7iH*K*K*J*K *K^*Je0el @-j0*P@- x0 pP \00}ST00S H0Hr@P 00 0( 0$ 0*e*J*Jee***P00P0Ss@- a 0 Ѝp0` 0S P@P :P00S  L 0Ѝp@Yr$Ѝp@***J^*eefp@-4@PP' 0 p00<Pp*J*fFA-P 0$"0Ѝr0S 2 'rP80S10S 1r@a0 ` -0崁S Cb"c! !    c#A P0U0CtQ00CS0< P?00CS0@x P7 (!x-PS0jp00 p P 0c" R  c&0P UR PE 00P0 0 Sp(0L0 0 S**Px*JfK*Jf*d*d*T%YfzffP00P00@-SM  o0| 0Ѝ0Ph  -P 0)@tqP @0( $0U@00*^g*JP00P00@-SM =0 0Ѝ0P | ,P 06)pq L0@0Pq) 0, 0S0000*^*JgP@-  0 P"*gg#@- (0@pP0 @*Jg+P00P0A-S쀟 00ЍP  ,P 00`P PPP 0RP1@1@@.p , D| x00*^b5hP00P0O-SM   0 ЍP  ?,P @P@ 0R@>1`-|0P 0B,0hph`h@Р0000 0<0 8%*^b5***J_$_Pp@- P0 0p`@PP xP hP@*p H H080 00@*g\gc*OT*OX*JgkA-p`P8 @Pd0 A\P ?00m-4 0 RU A*Jg*Jg A-PP   R ЍAP  R  @0S00Ѝ@`p*$P*Jrg0A-p`P0 AP@PLp @AP 00 |00**Jggp@-X@PP D0 p<00Sp@,0,o0 0Pp*J***Jgh p@-0@p@SP \0 pT00Sp@D0Do0P0,Pp*J***Jhh<hAp@- @x@RP[ d0 p\ Rp@L0Lno P0 ,cPp ^*J***JhIhvh~O-MMPQ / 3 ٍЍP0 #C*P S@p3`X 3 | 1PP@)L*0`t' P00S 0P @B0S0i00jp@I2o2@0SP$S \S0P0" 0   0  P#"00B   BR 0 D )b*0 o/@0SPiR0PS 0 D)bk*0[/@P1n d1 0S x10SL1h`10S ,0n00CS0.  ;*0 03/00S 0S 000CS0 S0  )t*00000i0 X 0`S8 *fz*d*Px*Ji*%a*Jd)d>*Jdj*J*J*J@-@P V00P P00PJ00 -d0lM T00S D 0d P,00pp?4*J*Ji*J*"8-lMP00S n@ 0d P(00pp  *Jj *J*"8A-@.P` p0 0Cs0SQ3  t?PP 0 B RQP  00 0Cs0SP3 p@-`P@: P , 0S1PS !x,p@l,*`(P % P00 0,S!0Rj%n3[j.p@-@P 00PU . i2Pp00p@-`Pp@0P<0 r.0Sp 0h R00X Ѝ0 0S0C Br RQ"  *OHj9P/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  Br%aG-`P(P @ >P  >PU0 00}P0 10S / Pe "*P@P 0pS 02P p*:PP p *P :PQ p000 SP⁌0S 00S1 @RđU0 p奍 `1>P0 0 U ))) 0 011 再2Ѝ @p) P( 0S000)0S 0PS S St0 0S 0`S@)H0pW ),pjRjjZ*O8jjj*JE*Jr - BR0 R  P R WO-0@!M M P<@8@4@@0D@@@=Pm4` 0p 0S 0S 40S 0S H@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /CTpKX`V y'5PUp@ @l0S ;wC@P d9P T4P D/P8嶌 (屌000@0(@P4P 4@P@(4:4P 00(<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU &PPP @ @ PpW pPp3 Q  `3  +& =0 080( S, $#(0 00 0$)0"0 0R S"  c`pPR  0X(P0 Z , l0%T00S9 llX% 0S1  + &=0 00 (00$@0S0S20}Sj3 @/P00Y@VN 0SK U +H\&+ HS+HOH` +@N&=0 00P$` Q(0 A `00+S:&=0  0`0@@DcT@@0P/0BP0,00(S  ai@pjmjD*Jjjjjk*O8k3*J*Jk:;**%Zka_7*J*J_4i5*JO-iM Mh8dLlOpt͍40,xHD@|0 <0PL0.600K/p% ,AX'@0U'4QDQ'8aO?ⰐV=HLa少'TU01d 0S TpPD d0sh0sl0sp0s0St0s t:U 0S V|V?0S  '?0S0 /rAP&&D?0S 00SV( 0 ^ 0 .<0S ~4P' Vh<, Y)0S ~O>)?P$.T>PN 0 /)00 %PL /=0S-`= <`R($` (`,`-0 R+P;0 00|S} h,0S;0o ∡JDM <= = 届XP[,$@;P0S00(  V :+ 0S 00S 0Px 0Su I&p) -PPP 0S :@PQ)X :H:PPW xPx0SV x0SY ; 0 P$P %P  0`!U/1\1X1T100p `10T1S 0S \AT! 0S x$+P h 娉UV0 0j0S 00S P P%\Ko*o`$@%aoqUooooo^*op0p8p[popuqppp1pq q7*JqtqJr {*OXqqqqrfr**KB@*"8r$3[rF*J*KA*Jrs***J*JP? P_ 0*S0 ❆P,T0-SP 呆0P($0G(0, S$0 0A0 0/R< *R0 y`P<0000S+ 1 0 夆5P 0, sT0*TsP 010Ss⺹@P "P`P p~P uvPmT}W sUmZk Z000]P XP P Z "$KPY Y W_ X9T B@U"9K/IR032 U 0S|,3 0vl#2S T$W $3Y0SK?00 T| W 3 l啼~SKP|84 儼څT0SJh4 0B ($0000Q$00S,0{s0Q 0 00& \50S0|05xd<0vs,5<`,0 RQ ?Q0S50Gp5d2S & R 5 P 86P P P 4F!  6@6`l0Əs l0l0@T? V  $PIQ~)0 0 N 2 @R q)0"0C?o2? j)"0 "0A@r4000 R ;R H&P |000 R RT 0S?0S40?'"4 00#.0S ?0.T .͡@!͡!..S l0"R0.͡ 0#PP#PP0S0S80S#PP BQ(L 0 .S0D@0$.0 pww0PppP0 PXЭpX \(\P #P U ` ]pWx90S l90S p9dy P $0S @DT90S pYF 1!0S  PZ0S= S E#"4: 4:` T00R0SE uPtJ  #P  %P Ue g:0Sg*0P a** ϠP 0; T# <;R0 sr ZOᜮ.!0Q3/P֭p;@/u ᨺ+0 R0;Q;C ; 0 S dyh ulqpm"0S,p< 0R.Kx v530S ʺ000S ú000S 强000S 嵺00|iލ Ѝ0S 03/0S 壺00s@- P@4P  4P0P )Ѝpk}`P  4P 0 FUpfP Ѝp@7 0S S0S  30PPjRjjjrh0@-Mh 00VP P10S 0S00 0 Ѝ qQa @T0 S 00S 0s 0 :P 0 S000Bp@ T dt$P 0|S 00 0S00 0000*Ot*J  *"8*O8*J ,@-`$MpP ~0000000@e"0P/S:S y@P@tQV͹P ɹ$ЍUL"PΌ@ O  F F0/0L9PP":G9pP哂@P/000 09@P006`0@@DcT@@00@0CcS1S@iG*DiHjPP00/@-& (0@  000&@*J*$H@-}& p0@ `00S T0 0LppS<0000S A`&@*J*J*JFl*$H@-W&@\00S P0 0Hpp08 10 10S =&@*J*JFl*$H d0@- T00S H0 0@pp 00 101000*J*J*JFl*$H*e -X0lM@ ^d @v80 00ssU *Jr*J*%\@-0lM@A0 0 00 0rS sS l5d dJd XAP0 00ss,d $*J*e*$H*rrs*J*%\r@-PP`@ @0@ss00V 0ss0000@? (P UV 0A0T0Ѝp00CS0 Sp0 S 0 /zO-pTM|0x0?X0 "?0p 0⾫n%0P`0V0X B@⯫4 D000S@ H 8PZ0S= S D\V0  K@P+B%0S >%0#S :%|0pS d!0 R LaR 0# |!%tp uTЍ  ?$0 0   PP%0S %0#S@DT|0S ld@"\G$0 V `~#O" 00 "B@*J*JO-@BM MU@$@ A.*?0a>0 @@@0`p5(`5夵P<$6 PP)|50S5W h% 0\U  0X,U S00H00S 0S  0S 0 S  R 0 00U!$PP$p 0㤴 @P$p 0\u`8 4 ap0TS 00   00Bލ Ѝ@3@30S VW@@c3!塶3 0  U@ L30S.;50G?oV20S4 30S0#3 RJuTN20 CRk2000/ U)U00e@ 0B>W0pXP44220S V: V `2KV"h2000; "00ET1#0 CR5@V-U 0S 1  00 0V &T V00T0ST dT(U@ 1 p1L10 CRVT$10S@d@0 @SP405+( 10S (3/1W 0    0QR\@\0 RZ P :/ 10 YS P 9/0G *$H T**OH*P*J*OL*J*P|*O\ TsB*%a*p*P*K$-A-` @T ~ 0 ЍAЍ/0p0$ P x]w h0h W o:0@S uP 5/h*P|sb**$H 3[*O\dO-@sFM M`  @" " 0"0$0`30(0$ 0,@dA0P S"ݷ0 ~ 3 Fލ Ѝ7A0 @,Q(.2@@Ȳ@aGT  ~~ 2 (A 0 PD0P|2d 7P `"`d  L0S 00S , 0(d  ިPP d⒕@0S00?o2 Pᔧ j0@6@6 D01@塨p  dj 01 wD0(66S0d00 0d0~A0`PS ~P BP >00S t0 |0唴HP@ 0 @0O0,`@I0?**X*K(s***JnV*Jnn"**hsG*P*P|ss0O-VJMMsn0p̖FXv600S00p  90PtX \6  T60 9P,ӔJލЍ60 0 0097S 50Sa5n\ʦ005ĥ0S# 0S5 Q S 5R "P 0S d500CS05PB\00@;0S P97S, 44 % ڳ0S 400CSX0$000(00000 tPF h4l0000S\40܀C XSX 4T00$ 0C h00d00`0( CLP 3x4\ 0k0$<` ((0d $r 0+ <7$ &S \3]0 R0S R|3(0008'P 2X 0097S0000 00S  x 0 pޓ8'P420 00 0 0 k  pL 087%P,嵓 97R_ S㴁 0S [10S. 0S* ,0< 1, 4P8!81 R  t 0 4 1Z&P 0S 0097S;7(0:70?70>7='<0S P0s00`X0 帲0S [X  U*$H*J*J*Od**hs*O<*J*JtP*K*J*K*O@*Jt*t$tKtg*P/Du#*&`u.tttu**`u<ufuuuu@- 2 Bp`WLM LЍ@K pPl  pf 0001F1 0S<0 ?|q0 (8,00 Q 00SZ=9Q ='/?@#b!"/Yp80S 0#S 0(60 8pp 0S 0#S ŒԤ pƤp 90S0 00 0 0ץLЍP4`{嶤00*J*J*OHbMv:*$Hvu0A-H`D0 82Vp  R`RBR RB`2b  Q  ,00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 p0@-PQM0MS <Hz811S (1 ۍЍ0@ @ Pp0 oP s а 0 PP  c01S |0 T  +pp HPdP000S\ZۍЍ0*P|v*$H*vv*P00@-$M00D 0^P@`4`$\4Q00P4@T D40S@ 440S@@$40SPr40S3Xh 3 3X$Ѝ030SCP NPDh, `3 0 HP@-10003 & pP@#R000 00 0SP  tKP dc@P  H 2@,2P0 S R0S S @T% 1Ao0S3 1o10S 1 P5kiX10S  P01S 0 0S PU P 0S 0S h01Sa| 40 _*^^****tK*J*Jw*v*$Hw& *Hw8w.*%\ d*J*O\*PwNA-M t  XX0 8 4 @(4(0( $ (( RS 8Q  Ѝ 00-S0S 7  7 770SK0<00@0D07 0v@PP|GAxph@ PXT7,07P1 \PP(7`@0 P P6Qu AQ ,0 p,0000Pn g Jy0S 6 @0srD0ssdFPc00<0Sm40Sq5$  0  q 00|S  0DPY,,0S+d5@5<0 噮,,0S  5P<0,0p,0PX0: S 4 Pi4 n0 0,0f4 P5 00S,  P 4 440S!@@/X4@@0Sl4@y dTP@40S 4040 4 q@q841S ,$ R 4P y4P P P CD0s D30SP 30S 30S2P 30S Br,0p`\ VvUR J0CS,0#p,040q402P001!P a<0S <0,3/0,0@4T4@h!0 R0%P60 SX1# 0 ? 0!$$P 48 pU(,00@ 00 0400@ 800400@ 0 48 p 400@ 0 q$\0 G#D@5D 1,0S <0,3/4*K*<*J**J*J*J*JwBwk***%\*O\  ,%Y*^^m4**JGbUA|rAwvw._$H*g*D@*OT**K ww@-GM , 0 0PO$(000EP@+,0+40@P@L0;@; 00;00oDD0S?;0SW 080< @ x+ RD00S0\ H09PPLKNH<41<S$$P $00|S $唠P/$,@;0SR 70 SN $ @): 01RS 41S $00-S0S |: x勬d:$ d公D0S $ Gߍ/0S : <0s]@0s^JP0080SX00S\9 9 d9T$ 9R .P90S 0 S $P$00$0T( $/000 S$.P$80SD8Q0SPx`P=D0S!0S' Y+x80S h(P  7L( 80sS|r$8  7Pq00S  ,PfP000Sl>P 7 4'0 R0R?O41S$,P_l74!(06 6 (0p(0p 0: S 0&0&0 71S ' R 6P 6P P P F60S` 60S 50S5`<60S 0CSXD0S9 $6 5 (p(\P+$$00|S E@$((0S$q(54! 5 580$ Q((0S5$x00L%p00(0q(0H5`001!+PM0 SFh480S 80(3/0(000L0S$0 SDQ  40S 8 x4R- pqx `Ȟ%'0$`x0pl3X@$P]  0 ժ`qP$kD0S s 0 P0 (PP@[ 0T0(0 00PNr],pH P @P@#0 ? 0!% S0 04  P@ H0S @(, p% (, pV7000@ 4000 S<1(00@H ,00(00@T\! 0 t 04_p@ TL0Q0L0 T V @%\1 (#%\Ȋ@L P#DsR , 00S 0B<@ (0S 80(3/0*K*i*J*_*J*J*J*O`*%\*O\  ,v[*J*JwBwk**JD*w*g**w.HG%Z@*D@*OX*m4bUA|Ar*Kx1wrwx d/0R*Jx\oQP@-X@ L0 l P M@ 0 *P*xi@-@Z0 ᜩЍx0 Qp@-P,@P@pWP @$P@-T@0SHP0Z0 0R  *Bzz*B@-T@4SHP0=4 0R  *Bhzr*F0P @- Pp@T Wp`W VL\ P  R/$O-@p`MT oTP ЍOCT <<@DT#Ѝa 1 !Q@ QPt ЍOn 8S 0S uP pP 0 ڨP 0 X   03/0 00$忨i*B{T{{ ${8gÈ8($\!\R% R 8( -0 \ \ \; (R ( R 8( "\  \  0 ( ( !R0/\\\0^ (80\ "\0 0(88S08 S 0808*B$Dp@-H0H@8D0 (8080$8P  Up$80**B*e@-AaM(8S P0 S % 0) P p p $8S 80pP\ UP 0S ,8S0OP (8S 00CS0 s"0 0p 08  8$ 0p3/48S 0S 00CS0 S0  P0R H@ Ѝ=*B*%Y{nd)d>dj  P/@-@P$P  }}@-<@0s|(00pp0Co$H*Jp4p$0 00/O--KMU@t Q 0 0SZQ=9 =:k{@8`V0 @P {@{P@P0F 03 3# ( `#0P{p`Z T <#[030(0 0f$#8` y [ (f 0"'`< h(00< 0f0" 0` U  S  RS0( `"1f 0;#;Z0S;#;0d ƒ>#/+"+ 0"%+?;#;0@#5;DE @!0X@\ P`U0WTڬ1PP1 Q IQ@@k{H{7{Z%(0`0!dಥYP (e 0 婥P<(0@< e0  ᘥ 00S @ P0S S (0dt 僥@(0h d}X A.*J*J**Jr$*~Q~0~:~? `~J**~^~f~pFl*J 00pp(⿘Kߍ@P%U[0DE:@-X @0 R0 @00S 40 0,pp@*J*J*JFl-$M ?0 0 Q$Ѝ0-4M 00 000P4ЍO--pMM$E$љ "  ș4P p !PUp0( RPUp4$ 0R 0d*pğ^P $0S 0sX0S P 40ݦ,40S` $1⼤` $[ 07 ]{@0 (@{{:?dSd0 0#f3` 3R - BP  o BRڛ \3\図"B P#0 f<#2~` 0 $ß S#3RPR  !00f "e $` Q(0 0SZQ=9 =:k{hH2@Q09@ {P!5 Q; %#3\PO  d! !00f!&1@Q0G10 S`dQ 1*!3^4?^030l!P0`1 000ss`(P0S #5; !jUp; ٣@0S00d У@0 00pp-Mߍ@YA.***J*OH*J*( $H+*g*~*Qr |~ `~~~~|*J*Ot~Fl~@~:~h Q!0 @@ k{I{7{z`0Wy0P  僣P@<00`<pe0 n@  h@-@R@p@-Bd00` pd00CS01p ,P P00 @R0S"P8d`Qd00CS0+p "P \Pd00CS0p000S 8A0QPA p0 0 `VXmp0 c`Pd00CS0p 0@S P,P \Pd00CS0p `V0 0 Pp@*@$L%*AA-pp@`ብP@ .PP @P PE P@OoB@*@O-$U0mMS p᪣DPd 0S (mߍD0P.0͵14PPd'0P0S SUpF P`4P PP P0CS ,  , p, P P P0 PsdJ P P P d0pp<P 0? d~l`|ldp P 0Sd0ppP0? _lp P 0S0S dh0 P P d00CS0p\2\1K P Q4280 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0\S81Pd00CS0lp0 dL\0\p 0 p P`, ^0#S^0C0 dkPXX *K)G*@>r*d*}jNw*JfK%a*T*dE)*J*Px@-0 @0SP  P  0 00@ x0 lP T0 LP 00 ,أP 0 %akh<*p+n|00CS0 Sp0 Sw0 p/1A-0aS0P02P3U P 00.S Ppd1l͡ `LX1P@  H,P10T0!0!00 (1( U 0 ! 嬡0Aq000 00000P0 0 0pS000P0T h0h0 @U t0E P$0`I*O@*JfF*P*P*J*J@**^***]**K$ h p@-@P 0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p*P|*J****O8*J*K*K *J*Px H0@- 800S ,0 0$pp*J*J*JFl*OtA-@Qp0S `0S ppΓ00`Pē媓00000S p`0S pp000080xT  ep*J*P|*J*O-P"2 AM MR0xB p" R S4 P V04 S` 4S4P  $Aލ Ѝ4Sg1+;004P/S ++P%5pUp儑0倁 00g000000000S L1or81Z$1 R100CcSppW100S 0oU 000000\04SU00i$@iPPTy P00*e*J**J*O,D)*J**J*JJa**PGNA-Q0qS0`00@S Q`Ѝ0OHHP OP  i0 R 0000@ Pl00}S0s00T 0S$@,"H *O@*J**Jn*P%a*O-쁟a0AS000qSP4M Q 1G4ЍPF P0.0lP00XP" H@Q P$,!0冟20$A$000 0}@,  fP 0 o@ P 0$0pq00P0}S0s00U 0S(@<G F*O@*J***J*P*P#;@-,@02 P*HbA-`Pנ`pӠ L@P  8@P $@㿠@-@-P* 0A- 0@0PS0p`09P㬀" ?P 0S 0"S0x R S  p`"R"^ 0 00**O@*J* t**P0@-M M P  @{ Pۍ Ѝ0Ph;4/S @ S P;0@TP/PO-@P`pW 1@@Pp3:pF`ܰ0X1 0NT@1`0 10S 0 SY J0F Q0-0S*00 050 Ѝ**J@- L0@0 <pp6pP0 0SP0 0 @Ѝ*J@th*P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C*K *K*K*K@-0 000$ @0S" R 0S0000S b0Cs R S             Ѝ %a%a7@-@P0S 0t 0p0gp\:~X@0S 00@ 0,Wp( Ѝ0@(~ Ѝ0*OT**OXGC-@\ᄐpA`\P ^T1:00"\ \ L|9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR%0R0PMU20S2 2"0S0 C0GQ .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10Ns[00N B B ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0SP ^*0SPZ*@P0LG RX QP 0TJ*/0SE*<0 RS=*9 0S  7*+0S2*> @ S,*0 0 0GS$0P(0&*J ,**r**/A-p`P @eP0  T  `00T  50@ R   `FVp`00CS0 X PpTD000`000 T00dr%YC-pP`@0尐T^D  00@)ax0@P`0 \L00D P 0 Ѝ*?*J%Y*J*JG-M@ `' 04P0 03`PT P #T 20S+ ` Q `V` sp< 0@00E.002 P Eh"h( E@T2|ލ 4p`0$T #| 'p T|0q10@S M$0 0/" pO0$S*F>C0S  3\4$`$Q(00SZ=9Q =(/?@#b!"/0 0׍p40S 0#S Z0AS  T0 0000 0p 0S 0 0 ᶍpx0LT P<00*Oh*OHbMnVp@-@PCp@誎ꄍp@-@`00CS0pP0 @ h0S0`00`0#S V Z00p0 PA-p@`pP0 @ A0S0`0090#S V 300p@-@PP`hP 8cPp0Sp({ptkM@-@ᏘP eq@-_P]@-@_p SP@-EҴPF0@-PlMQ@00 00 T  40S P 00 P 0 0 0 PACcpW' 30S @ @@`  L P m`SPJ P Vc0 S8 0P 00P02  2 PP E00 @T   P 60 0@T   P 'lЍ弙P 0S @P@E    P@ T T0S @P@&{ 0S @P@m Tw 11@T  0P }0p`V2PP)X 000MQ0 0 0PhQ XP@*O8}jh*Op*J*JbM2%YF*Abbbb**J*J*d*PxnP**J*J**7@-PQ 1 Ѝ0Q0S 1 1P !0 CRhA R S0T!L1P 0S0,!S {P 0S 10S 0 0ۘ@ @0 @0@0 @0 @0 @ 0 00S 0U**J*Z*J>*J*J*O0*J*J%****H*D*$* B*l*h***JА00S#@-@0M,  0JP0S8a@0Ѝ0@~*J^-A- 0  >+@- 0尹+*P `00CS`0p S00 P0S X0X /X⏕%YC-Pp@  l1s0S `l 切0S t 0\`V   Ѝ+$x+t*@-E, Pp( P@ ◹P 1,ЍX0/LAP 00<,<$x%Z3[0s@-@  1`s0S P0S v  H@0 0nS Ѝp+$xF+Fl+@-PMP T` P H00S@0\A PЍ @ׇPƓ++@$x@-@80T 屓+1 +D0@-|AT 0S  0 垆$x+@07@-LAP/!0P00 x Ѝ0$x߄ @-@0S S S 0\ \ \R@ R0 RG-P0@/00圀/0p0/x` 0@D QT@D0 DЍG1+s0 3@T*Qs00!$gG-AMMP`PxB  d2d `2 T2 P/ 0 04R 0 0 " 0R  0 S!`"tpP@D✡0S1  1 0S00SR&@@T  ͅT @*<1<1s0S s0Q \!w 1 嵅IAލЍP0S S  S00<1s0S 咒p 0圠0CZ 包Z <~* 0 @++֧++++<+T* >$x+D+0@-EM,P tPn@PW*Eߍ0 ,PP  卅 {ꈅ x0 <  ♷TP@r )*h*@M >$xnO-`h3MP@ pPPL`<#03 ,.UPE =s`S00CS0%dp00 R0ScP1s0S7 `$jP22l1s0S  <0 0 Pp`1 Ps0S 0 ` 0D PVS,1s0S 8 ` 0 S 1s0S <1s0S 夑l1s0S 0|0Fd1 ⸄ RGL1P) 8 V 11s0S WpG'r`Pᦽ<1s0S0 r +ЍS R   RWP00Uq QLLDC)++֧ >+T++$x+++<++D|p@-BM,\PP3L1 D-$!1 <&@P)`0<1s0S Cr0Q 0  Bߍp +rP`LTPp0K|J<ܐ+֧+T++@$x++D+p@-BM5,hNPP3X1 PÃWT0!v(1 $҃@P(`1<1s0S q0Q A0 垃 W.+Bߍp qP`TP|P刄兄<oᨎ+֧+T++@$x++D+0@-@pP4M#\0PP <<0000<<0  4Ѝ0+^+D0@-@DP4M0 0P88 04Ѝ0+^@-M, ,PF A f 0 001 1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍$x+^+@-(@ $g+ @`+ t{ tz@-@>Tk@1p@-@PPpP p0@-AM MPAލ Ѝ0⧃Pp0!,뢃PPl1LAd1T@㿂廂㹂0!P0jup嫂婂奂+冂@垂 ⺴U0S S 000 28Typ   T lЏt  10D0 S B/o" R  0C$xS߄G*%Z.*@-MP Pppp p=l@PL\܍@ , HP }܍,0 < ++.M$x0@-MP MuP%@e0@SۍЍ0@&P551d dPPTۍЍ0@Ύ@ 5g , ۍЍ0+D*L.eqp@-"P dd;@PpPPOPp@4<姎8P L|l1s0Sp0p@嵏+IGs$x+p@-P MP(P @R0ۍp@z&Sp`@P\ۍp@rP l! r R< < 5 ,=ۍp+*Gs$x@-  37㍌%ZO-P4M$`5~`=@Pu`0 `4$$Mp0Z$ dQ Y  Q$0 |P0$404th 0X$X复P0PH} p@z <"U, U$$t @DOo0B$10<13 B0lS010S 0P  G R6 tS)`S FSI (9S /S 00C6&`a0CS [ Z [ Z \| \ Z \l Z Z Z [ Z Z \ [ Z Z \ \hES 0ScTPS2PPy Pc PPO 2PBd2 @dPV  LPR @P/ ,2!00(1 1 0 0!0S1/ =P @6%,00 1 0 xs,0P p刲 01 U PUP0 0  0@@@P 0 T0@0?o2VP0SVP%4Ѝ+++D+$%S+PF++H+ fx+ %Z@Qp*$x+%ZP,q49gp(4h@-+,@-@M hh \0P0 0D0@10S X 10S0S@ЍⴱP  X00S0@LPm 0 00SӀ0S 00QP0P@0 S090= , ]+,+P++g t A-U0S7P@@P0Px% /Q4 ~ \`PPeDpMHu0S+ 85  05@,5 $5 5 R- + 5 400000@T ,P004@Ѝ0400/S@儀P v v vldUBXU 0SuQd0S %p=0c p;0cs0S000S K: }0P0 0R P T3Q |30S p : h}PX30S 2Q P o2: @}P 2 : }P 2l!: }P 2 : }P 2 : }P t2!: ~}P T2h,!: v}P 42L}P T1 "1 R|! x1 Rp! l1Q `!\1Q PL1Q @<1Q 0,A, Dp00A <p00@ 4p 00+0(-?$$++++P++D+FRbk+Hed+=$xQ)R_j/JE߈+8+$\+$g+Ҙ+6++^+++_8@-@$P I E%Z @-0S KO+8tT@-00CS0 p0 00S00%Y+8P@-@$P" ❯+8H+ >+D 9+p0@-M0Q00@ 0 a bP 0 @P00CS0ἶp 0  h00S0@oЍ00 p0 P 0S*000+8 g g%Y0Aq P/P//0@-^@\P0 R NQ | 0\ P0\R@ @ 0$R ^ ?+EPP 80 dÅe"Å^ P?d" @pef"/+8+A-|щx@xPx`xp 0TS 0T `0h2Soᾉ T 0T * 0崉 @R$$xW[+80@-P@4MloŊƊ 0<, p"lR < 0 2  s0-  ,S 0"!8 0r 0R><r> 0<4Ѝ0+8$x@-`0S@ s|P0S 0000q20\ @j+8jx87@-0Pl000p@h R R  l R  R4:03/ Ѝ0Q P$x$+8gp@-$A`1QS 0SP ArP00p00h0P aP0 ZP0 tSP  dd}\e0H@H  "  \ p$x+8Q* 3px%Z$L+,0@-1s0S 0P $x+@-(0(@ {0@ {+++p@-`BM P{@0 S0`01s0ST01y0 =0Pn00x0 {BߍpB/ BR 0{00P y0001+$xJ++ 0?o2 0/$x@-AMR 0b0000@000  u{Pڶ0 q h{P 0SS WS BSs0 +U{P  VtE0S 1@0S0 pW {1s0S ؀0S R     |P W 0@^S00CS00  S00 P0S+ m+++<$x+p@-PH@P@p&P P P @$x 0/@-[{o/A-@PP" p00CS" r s\ sL s< sL sL sL s| `V PPဈኢP0 P00TA} 0S P0000 !0S0R 00 ETA-AP00C!SaXp `0000CSP t t` u( u u( u( u( uH`00CS`0p S X0 X 0 "S  L0S`00CS`0p SX0 X ! $X!10 0P0 P000 `0"S0L0A00 0P0 p +%Yg aH+@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 iG-@ P2 pqp =`P`PP2 00PF 0P $ V @P @0S@0Sx00@PP?TP PPP P 0!SPRXt2+H+$xA-@MPP\1 ݅ ކ@P `p崀  #PPZu00u0ۍ0 lP 0@ 0000S   P00 Z$xG+@p@-`@.PP 0 $Hp$QPI@p2s@-@P` xF |z R uz qz@T|΅Ѝp(R( dx0PP O<P K(P +@fz tx ty~+0@-@M@@0(@,0 0 塪@P 4Ѝ00,>x0 x7PPPP0S p00@SP {+$x+@-o (,K+@-@ z y\lP T Qx0P3P xFtDh y X>x8 ylxЍ+ tx ty@f0@-4MP4PW 1<1s0S A 0 9 0  LxDS<Q8 w,0E Rp w w<P! 81PP 0(0S$4Ѝ0=RԄ00ES ~ ~X ~8 ~@ ~H ~PtȄhƄ`\XT H帄M$x+%Z@+H+16+Rz<GVc@-0 w@4+H+-@-g΂-@-g0 R   ЍЍ/+ -@-N0 R   ЍЍ/+ A-ARp`P@1T hwpPu`@DO-dM@P0P00P0 0 8`800,@400(P@pP@ `0`,0SW ,0S5TppW $ @@[ W  ( 0 0 ( (c.wpt T+o,00,00r0o0T񟗾 l 0 P ` 4 ( Q 0S0TȄƄ 0S ` dЍE 3  ( 0C,0;N@ @( QQ h, 0C@( ,0t( Q< 0C@( ,0i( 0CP@( ,0aU@^ ( PE  ( 0CP@( ,0Q( 0C@T( ,0IU@E @B ( Q @0C( ,0: @7 ( Q @ @P /U @+80 "( 3P5 (x30S! , | `8 R/ W (b0R040880(9Z|xp8 8 (b0R  "M $0 P 8 Ï0000S(9@SW ( 1P0C S,0( W@S( 1Pl0C,00 S( L+ ,2HZl,O-lM($ \PYPU``8@ p00Ÿ   0<02@02 @0` 00J@P dᇃᅃ@   M`@0S( P @lj` $0PlЍh@e?@d @00 S @. @ C< "0ЍC葁0$%Z@A-MpvP`ЍAj0@: SPPT@ `P00S 0 00gQTP1 ytp P PU0DsLS<(    \'6+ O-0]M-SP MP @p<uP3 00S0W0S( 80S#` pPq40S ]ލ ЍO~v/8]ލ Ѝ  @pl]0* RT < RP  tPP$Iu truP t;0v: S+ N ?뤳 0P@`Pk  sP pd ` 0 0L0 00" 0S0S`- sP`t`sv `0S 0 sP |V sP `{z R t8MRK |spP \ tP x!1[Z  0zs t.t[\sp`l< 0S'HQ0|!0v0 P: v?b 2 0S-v;spP vy6W ]ލ ЍOP-6:s 0S5sp`P P : R S00 R0S  sPPdVT}+ $6(7IuW aH%Ydm0 R R /0@-@P0R0  APCU 0APLU aC\ACP 0^0\0R0 0 0@-@P@@ [!P U8IP00S D00S  40 #/+I#NN[}+ +FH+|%@-JA'@- Pp@-P@p 000/+ Pp@-@P0-S@@p IP0Tpp0p@-0@S`@MP0@ ~ P@ЍpPU P a0P0$+ P|kO@-@P @00S@+ Pp@-@PPp00Spp@ + PA- `pP@P000 PP0 09rr@-@P P0P00S@+ P@-`dMqPU< 0S9 |BP0 @@?T-   `00@ C G@ I  0*R /D/ZP10.HH>_P !dЍ 0@-/p@-P4@Pp@B0S +S:0+Sp@p@@-@@@    0 0+ P 00@`/$8p@-@lP     <00S   4u @p  + P+FdD0@-0S 00 @T@JF@+F+ P@-@0 0 0@+ P@- Bo 00S C0 $I+ PA-PRp@ FpqADFpq PP JPp P`UX@DTUtl@8/pXVt @W@T*U A  )Nby $0 0) 0 00S/+pp@-@ P 0s  hD@p$O-`0S P p0崠9 00 ?990 FI†U00S[   RP kP  .D$+P 0S  R 9  (0///+ O-M`V 0IS(,   RQ0 R005s: 4) "P  2"RgpV  rq$ L$Q  4Q Q 0/x$P 0 {   {`  @`   0 PP 0 @@0(p,`vyf`pzVX!RSB 0?  0pq2CЍ QP$0 0@R*20 R    @ @  " @@900 SP05:Pi09p`2 q4   10SP  09ϬRXW a0SGnC002gAT10SK d10SGPD  H1 09 0( 00*b=@p 098p<`yp  RB 0P  j l00St0PR8p<`0SH00SY K++H+F$ + g+F+"< $+T800S 900 //+@-`@0Sp <)00S000,0(0,0(0+p@-@0Sp Q hj00h@x00p098@00ps000B(Pp 0 $++ 4 +TG- q`V= P@7U000Q00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00S II(, 0@++T@-P \00S @T  S 9(,0 +p0@-@TI0 pq0@ @}00p++Tl0@-^ 9 @!@&)60 Q@ ^@U+0 R$ 0@-00S0C0@ S 0S!‚"\0PQU 0000@/+P00010 0/$7@-P R I00 #0 Ѝ00R50 @!"0@@pq Ѝ0@[A+0@- 00{ Ѝ80098<@ q|/ 00\ /+A-p`!PP"@i9  @0@  P09   !09 r`A+ D+@@A-p`VY@  @ @ 0 vP0 0o0 hT 0 0sv0@AN!++ D0P /+\ -P0S0@  P2:1S0BS /O-@8QM44@`@|0S!U  BЍO bS6 .S5 00C S 0/QP @cS@U:y@0@0CS000 00 B/1QP @@+;++p@-@P 0S`PpPQ GP@dPQVL>@H6P0S  p P$$<SA-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SxP@u0C?o2+@-dMvX*@PPLPHPDPT 8S8c(s0S3(3(!4!!!8!! 0 -R  UR +R  >Q @u?0:S m?w0cS .S bS S@ @0,S@pS wS ,YP ( QP 37vP@P@P@P0 0  Sx7P7P 7P7P hP ^r++++t+h$8++%a 0p/+@-p  01SP R t0 T!WP R HH%u@08 ,s@"P0 ++aH# 0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aqR R S R0/0 R /!0 R0S //@- @P | Ŕ ż ,0#-?003&?=r 0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P pq!l? pPpĕ ?`llp@@`@@+0p@-P@P QT4@pTT@DQ0`VC@S@ T0CQ @6@+@-l@PXPHP <00S,P++$<+G$D@-l@PXPHP <00S,P++$L+G$D Q p0/+P@-sЍP@EP @ $@P r0 jq0tT! _P P0X!P80T@ 00 0 +#+@-,@2P-P+$T00PbA@0CQP//DA-RPp `@X@@Ѝ`>P@\@P, PP@@+(A-P` @P lpP ` L@P  A< $@+rT p@-Pl@P TPpD{Ppp@U p@Pp ,JYO-MM`p 0@P |eP0: SXqqX  :P  8@P> ލЍ R R R00 1P P@ *P @P #PP 0"SU T 0S0C0 6/ :P 0mS PG%H%4P P / +!(s@-P@` "0 00 BЍpA-@Pp4` R 0S pp@@-P`( @p0` G Ѝ+(@-`@ (8R808Ѝ 8 0 CS  8 0C 8+(+!0p@-`Q@PRpP0S  p$0Sp pp@0S S D0V@ ` 0V, pU  p@p%4/D $0 (((( 80( /+(%4 0( (( 0( /+(%4C-@\㼀`p0S Ѝ @oP0S 0S 0 ( ((089P 0 PP 0++(7@-D@P@"@00S Ѝ0 7P+(@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08~9 80 8 00S08p9+(+ 0@-AM0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS ڨ 0`+(+ @-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00+(+ s@-@8 R 0R0` (0 RP08 80 8880S Ѝp0CR80S 00S808+(+ p@-p@XU N8PE`V` D0(  p8Soppp+(%4(080S @-/+(p@-D@0S PX* 8P 0( pp+(%4p@-|P`@l0 R(0p0CR0R: $0( ip00+(%47@-@@P@P  AP Ѝ00P$ /+(0S/0G-0PS`p@U @0 pP0@@@ X kP00nn @ \P00+FP R/-@-4@$P(0,0P  $8 +(%47O-0PSGp` 8(hS?Pp $8SDG(R008(h8! 0S0S ^ Ѝ0S08R00(hkP080h88S 08 ЍO`0F?oP20S `&0 S PpP0@S 8 ܼ \ ܀ ܜ l h h h ݴ eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)0$h48VL"3P( 圓R( B( ( W(PV  PPl?@unH80S 48PS8P m088'80X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 0P0J``` P Q`*ZXP@$ 0P++(+!P%4+!( D0 pC-@P M!00 0 B R   0.S 3 `! P`;HP P 7 Ѝp0 P`000C/ !GP00+(0(8R/+(0$P00 /+(00S/ +  `O-鬡MX[$ 00! 0S S`PO P0m@0HQSQ0Z00l@P7 pp`P0: Spp^ P)dp0 R'0 Y& k@Y  K0H3  x*c^%l#lЍG pP00+ %4+E*/D d800S ,00S 00Co//+ |+ x+ p@-|PPF@T p@``kT0S S VS 7Sg@ @+!pp@-@0S00S 00SP8P p@0pq  00S Rpll0P@ eP0PL0@p88 SP@3d$+F+ 0+ +"<+G+@-?=@Q4G-@" e`T00P  00pတ倀 00ST  0W0 000S T28  +#p++TA-pPC @`0000  :P0;0 A9 D A0PP     P  5X A< +!p7p@-}@Pp$R0%S!S0C Sp S} x  x0C Sn 8  7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP j0S0pwp 0p@` 000Sp p@B0!S $P j$t00Sp$dP`p@&L00Sp7D00`Vp(m'p@4p+!p+ L+ IrOUp@-`@P 0p@N+!pA-`P0@@@p0P/00,0S W HT T A,0, +!pt ,[+"4j8p@-AM0 70000^0  d0  _0  Z0 U0  P0  KP`0S1 0 h=PU0 D<<2 40 Ѝp+!p_jvD+"4@-@0%d0PiP/+!p< S /@-0 0J4 Ѝ%y@-@{0@ +!pp@-x0@M@T 0S P0`P V@Ѝp`F0PS + @-@M0$ 00@S 0+!p@-@@P@-@0G--e`㊋,B,r0(2(0@M0?000S0S  A10S z0S 0S4&5\0P P 1Pd0S P 1rP$0SX80S! vH2U80SeV}Z0PS0S\ /S US S S U U#38>P h#2Z 0S H:1' "1 +!p+ <+ p+T+ +F+"4+!+Fh%\$+ >/c+F+Fx+Fg+FD +#x+G+F4%`"+ + D ,8S%l8+ ~r+F7S< iS0S P0 P P P 00[`P iV 0FcS񟗧 h , 4 `  T p   p 4 H   x  (   T  x \     <   H 0   (   t <                                          T00E.U S``dP ePdP= R0S`Fc 0SP0@_U0q ,0Sl U U000#=U00S `J V P+U@  U !UQ0-UQ00  z@0#0P MP 0 a0CS00 0`/P  _ 00P 0Sa0@S @P000S BV!P '2,00 @0S 0|$ -P 0S.P ,Ta0ES000,P ,0 /UPmUU0ESe ` t *U( @U6 !U[ Pq 0S US'T60S# PP pf0SL`960S 60S0 97R0<  J60S07S ;07S 00#0'eD/J10@S0 @007S9 :<#0CSdP J=P 0 i0S e`p!S '0 0R0*?0G$80S  !S d(0 0R0*?0-  0R00 !ı 80S 0R0T  0R0 0!ı  (9 @9 0R00 !ıl90S  0R0) 0R0 0!ı  0R0*?090S  :0S `!S 0P:0S s!S 0 ~ "r L8G 0`jR00 !0060S0 !0<0!eSd0C0<0S d0 !0<0w<1rQ0kQ0 ~ b0S0 !ıd; T5 *N;0S0SSl @ 8< D @< H H< P ?<00 00R00 !ı<00<0 0 00R00 !ıJ 0< `0 0000R00 !ı4 ` `<02C!O?P`~ 0R00 !ıP? ,,P P  0R0>>0_?PZ 0R00 !ı P  0R0(?(?(0E 0R00 !ı?`P`8 \P?pq ?  0R00 !ı?`P 0R00 !ıP ^D3`P?P 0`0,`9P?)P 00,00  20S8V"  *0 P~P U U ?V"H0> <PkP U U -"80 P[Px U Uu M"q10S %PGPd U U.P!0P]l!% X(P0d  0R0L1 0S<10գ?0/!(!0 S00C0 0 4 0R00 0S00գ?0/! 00 0 00iS 0 dv,T00S0802+ Dj+ 8q%l +F+ +#x+"<h+F00S/+p@-@P/!pO-S`PpM`P`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0T80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 10P R* 06P0   80 cP d [0J0C+0   /G-pȀWY+p S@0!PPP @ ZPPE0S`0S P B0 0R R@0`p@-`R P@ a0P @@@ 0ppM-@Pp M@(p00`Cv RT0Ѝ0 p/e>P0/D p/>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#:  0 +F|+ p+"p@. 0@-M +0 x@sr  * PP  000Ѝ0+ D+"400S/@-$@P P@+F8+ D@-@P  + DP/ @-p@''0@-M@')QP;Q00S@)PaP DP OP AP )dP oPiڢ|0t00SЍ0 P0LP 00VpqQ00@#)+ 8$$O-(M0S 0S 60@S Q v P 4X ЍM 5@k Pp 00o pPPP`TP DP  PPpP0S P``30STPQPN ((@(!P3`00P0`0 pP0`0 3P T ( -^0 bZPPl& 20SP `JP   @( YP QPY |2 pd T2 D2p@20WF0b,2P 0S @P ([QP11P +&0S )/ 1X P DP Pd1 ]L10S P] 010 (0 yq 000Sp 0 g P  0 R  [ R 0 0P: l X + D+ @9 ,+F}+"gQ+ + H+H$+F<+ + 4+ L+#x%`+F`+T%TP@- 0@+ D00@-P '@+" ,A-P`XpVWPU@JTXlP0+T 0 + D@-zP@ @0 + D 0 + D 0 + Dp@-P@@P Pp@7pp@-@`P*PpVU p@K Pp PpA-@Q`Pp f\\U(G-@@` PР @PUЍp pP\7CP }\8p0SkЍG+ D@-W0@0S @y+ D0 R/%R %R0 sR0/@-(@0SP00+"$G-`dd@p00CS0 ᤇp PP 000 P U 0D IS  \\p@P@- 0P٥A-@0 0pR`@0S00 R0S@00h`P0S U  1P@00%h%iO-M@`ODPp!Q Z]`@pW*p%pP` P` X 噶P UpV`!P:`00@0H0L 0`5ZЍ8yP B\@00%h%i*@-@*pEPPP Ѝ@ƅ@@@`H0H 0P0ZR[ ᯅ@L[ Ѝ'G߄A-PPЍ0S `p@@@YPP D00< 0`YW XMP[gMD@-@@ A-p@`P@0S P@0S0# CV* UR@ R %S0P p@# CV* WR   R %S8 P0[T@+ @+ DC-EMPPEߍ@0 @Lpq `,LPڬ嬐P ` P:T0S EmP @  =0pSC`P  P@++FA-kX1@0SGk @1RpP? ,$? 1P````P0p000 0`00XLZ밀P@pW ;p;ZW PN0S/ZЍ ;&Z@+  ,:1%i%hCZ'O0A-0S@`@P0L X@pm`PY@YY+ b@-@@\P ,WP Ro ,9@-M@P խPۍ@} {ۍ1O-0S# 10SPptP 0 `|R@0 -R` dP JP @$@ Ѝ%P "PP : 0 :X Y P YU @T ` vv`KP ᒄT@@P@T 000d0@`P<`$@x0SYY+F+ u ,f90A-`V8@PBpP0 PЍA#nPk`@@@@0 `W!YY@YT ЍA.Ѝ+ -M LP  @oЍ0@-@P0MSP @YY sLP2!@Ѝ0@T@0: S a*{@Y+F%h%x@-M@qLP͡0 00SЍ0@-Mb0@Pw  ЍO} *O-@P4M(0X0 ,0utP @4Ѝ40SX4  0/Q)(P@PpLd00$0<p P:C   `V0/ ;3p` P PP00@ἳ弃0v V ` VP@,0S4 x3X4 P @6L)X30pW0 0 `P20S Y Y` P P `V@Y*.P `@T_P @0S x20S 0Q (0 S 9 8&PI 20S 0   P @1 0R00S7 P Pc p 4ЍO V0000Q h 0P@ R ~LA0 Pp``rP@,1` !X$0e$0@Q_ V V]P@k P P Pe PQP@ut$0H$0@Q_{( 0S V V0$0$0S 5P@ B`0 +F(+"++T+F+#x+F+F+F+F7@-P@{P ,0 R  000 Ѝ0+#xO-p`4MV0 ?  4Ѝ p`30S3V0V0 00B(4(t30V8PT30S @ T T,CF $C0 PG0000PO00 0 P @,0p 200(00P P@0% 0P,0\" ,00H" RF0 0Rï[0 P P p| p}z0Q Z 0PO,0P!,0 R 1 P 0$00(0 ( $P\L10ST 0  $P @H X XX P P@P PO P@P@P P T0'I r0Bz{0 00S X X0,0,0S0S0b0 P$0 P$@+F(+"+F+F+T+#x+F+Fpqp@-P@ SPpp P PL0L`P@0SV3 @TP@P0P@p$$O-PM@`<P!@@T 0000 00V `F@P0 @Y20S1 ЍO~#pP ЍOd 0s00 T 0Sq G W0!pF0x!0h!0 0@0Ѝ00[ 00S 1 0000@0@ 0UPuq@ p6Puq@ %P Q0@` 000CSed00S`H0`0 0`0@+F+ p+"0+"<+G@-p` Puq @uP 00S h0 Ѝ@2V0 @P80 (, Ѝ@ p` Ѝ+F+F%@- Ppq   Ѝp@-P p@`@P@PQp@0pq  Bp@@PQpp@C+ pp@-P@` P P pP@000S  p@+F@-|P @,SQ00Q  B@^+ pA-pPpq\u>`vq@A410 `Q0T0A |+F0 R R /p@-h@M0M0P`0H MO P*`0 EO000nۍЍp+"D0+p@-P@@Ppp@-@P \R ^R3 R    0tR'jRbR< 0BP @R00 SH# 0 Q' !kB P T S S T S S S T S TeR 00@! 0@PS RQ0 p2 p@@p x2@@ @h@p@\@p@P@pQ 0xSQS DSo LS 0F ! 00 0R0S@@@p1S] BS03 C^R!NR C&R Vh U< U< V U< U< V U< U< U< U< U< U< U< U< U< V U< V V U< U< VH VP U< U< VX U< U< U< U< U< V` U< Vp Vx U< U< V0 @@ 0000 0000 00 000 0000 0 00000 R      R .+"D%+"PI9FlH+rO-`PAM@ M\`p㼕Up!`*(p*0,p<00}*pQp `T忹PLuK DNpPF!0 0$0墹P0  ⛹P  ┹P ,00 ,PczAލ Ѝ ‹Pg ttP \0`=V* !V' <V 0F^S0`͕0͕0$ML>V =R+` =R-`8 { Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =ᡩPV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` 厸P `` e0Sv} p0Ps {L %+"D%y ,%YG r4`$0 RP  /+"`0 14/+"`0 Q/P/%@-04 ,    00++++G-P㌐剀zL@vLPT`ppP MT M ῱ ! ằ M M @`匀+"`A-8p@0PS` 0P0aP +"`@-@$ 0 @z+"`P 0 R   /+Fdp00S/p@-`@m@PPPpP 0S8@pPp  +F+"`){@-@P00Pl0 0  ;D01(</(8-(4+(0)(00+"`@+"+#+#+# +#,P/0/+"`0p@-@00P0 0R0 .PPPPPPPPPQQPQ(H(D(@(<'Pp P0 Q00+"`+"+#+#+# +#,C-頁@0PSpM`Mp`tt!0 0!0S0@ 0  ,@P$a00CS9 `P U9 0 Ѝ P -0!0S @P 0R 0 0rq U l Q H S  yPuP+F+F+F\+Fp+"`+Fl$$,0P$0 00S000/+F+Fl+F+Fpp@-L@P`0S0000p01S 0v'P+"`Pp@-`0 p@訴X10S |P@@p(1@0PSP5pP/i`P0@@S  1CP0 1C#@)P 0S"000|  0p  0d  0@@PC 1CPP ++"`+ +++O-M@pD`C00wvP1S{0\P1 0S M 0 S1C10p&QH   0   PP20SK 1SH P"1 sr R0x2q`01UPX20SGXR 1R 0 sr0`pS`K e`0F[K 1RLЍ1S [e 0A# R Y1S1S  p` 0gP  00KO1 0[0 `0S3& UzH& 0R 0çQ0pP 0C001萄 S lI  0+"`+F\+#p+F+ +"+FA-pP`Wp00S HP `P 80@0@D@ 0@0TЍ+F+"`+ p@-P@) 02PpA-`p@@PGE$1S 0P $@@+#|7@-PPP0 0 B01S0R4ABb@D`  pP@DT0CR0S*A8A@D00SV0S P  0 7D00S p9+F+"`+#+#+"+#+"x+F4+G++F0%h+#rHA-(BP`Pp P U = ClP  U@10S ! RS0QS 0`E0 0S$ l10S 0SB0$1 01 08P@0$1Q 0S&0S# 0`00S R 0S$1R0$QʜPP E E 00WT$@0O0$10P0 00S $+"`+F,+G+%++#|@-(@0S =500+"`G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000X0 0C0S )10S0 0S  G 8Y 0 0R  x00S U d00SX00S D00SX   +"`+ +F+F+F\+++F<-0 R!  ^ !0+"`04/+"`0 R 00S P@0~0/0P 0/\!4 0 / B  0/+"`+F 0 /+"`pq/G-p` @PpP 儐u U 0 0W 00V@00CS1P Q 0P@P+"`+TQG-P0Q`PpЀ@ 0@Dt P kV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB+"`+TG-p`P@0@@0W  S #R0C00C0Ѝ #,P  j oF 0 ?pGA-0PP@q1e`EP q0 P 10+"`G-1@`p`P0LL0 rS00TD`0PT@+ + p+"`p@-@PPpᬮ P0S0Fp P%@-0P %0 P/0S/  0S !/+%00 0S/$0$ R T+%+F+"+E+Eh.Pp@-: $P# 'P> P 0 srp7 p^P 0 &- &P B06 p"Ptd0`TP@\0 L0Af&P,@m006p5+ D+>C+ p+EG-@p`dP4T#0 5T Ta0'0s000Pp0 uB@6T` P'0+>@-o0@-MPg@P   rsЍ08!P MB0 00&+ D+>@-GP0 sr@0 ! 0&+>@- w rs @@@60P&6 B0606Ѝ+>+ DG-4@PP`j>T6k.sq 00P6 A06PU p)`AP0PPЁ G-P +>+ D+F@-P ,0 0R 9 + DBl0@-0`  ^ @^TSa04S '0s05S #+ D+>0@- P@0 QA6R 00+>G-[pP@P P`PA`Ap6W @+>00S/G- M`p A@吠吐pqp6W @ Ѝ 0 ~ PU!P P P 0 @+Ft/D+> ,[@-000mS Ѝ 0 Q0 <@P 0 S#  PPP0`0 S  P0 R pV`PPp Ap00+ p17@-PU0P( P@ P0 Ѝ000S/@PP @]P@ Ѝ0@H00S< Ѝ0@6 0 0$00 + j+ 4$ 0 + 8<00S/7@-@( (P/@ 0 Ѝ0%8+ pB@+F@-P M# @0.S [00S Ѝ .0S 00 00S000 l ?P0@  0R 000@0,0%8+F#*<00S/7@-@( (P/@0 Ѝ0%4+ B@+F@-P M# @0.S 00S Ѝ 0S 00 00S000q l >⇨P0@  0R 000@0,0q%4Ph+F~#@-@PP  @D Ѝ@-@PXP  @5 Ѝ0Sp@- Sp00S p@t# al0p`vP p@Puq@ 0p@ j+ +E+FP07@- S S8l0 Ѝ0ҾXP@T0PP ?@y Ѝ0@v?0 00 %p%tP/L0@-0@S 00 $0$ @+F$+ L+F DP7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P-?׾ Ѝ04@P,0  0 10 %`%\+TX%d+Gg0/0+FP/MP @P/"@-@| pl ~@0TxSPLHD@<8@X%y,l2IrBv@-V0dSK@S!1 CRJT" R&0CO  R < H D@P3 @.A C#R 4 $ \ t Dk Cr \ ,0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~+FdO--@N<M`00PP*0 S 000C S0/   00 Bp/=pU:Y U :TЍ D0!R1@0P S 0,ST00( @0D@D1!0C 0 +#%%C-PMP M 0-@Tݍ ЍC` @>0Sڐp吀吐A 30PU7`n>2P0P # @@ ݍ Ѝ >%8+#m{C%NgP@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000%i%h^@-PM 0  0 x0  @l᳧d P 0S>000D ;0Ѝ,0P  ,+F+FP @P/ 0 /+ P/00S+F|0/@-@0S+Fx0/@-,@0S0 0j00Ѝ+Fp0/@-,@0S0 0X00Ѝ+Fl0/400S/(00S/@-pq@+F`+ DP@- 00@ ^S00S00 Ѝ0@ (%0p@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0SX 0Ѝp40@0000$ /; @+FX+FT+Cu]P@-P A7 ЍRS+DSSS 0e C R X ` h p xE C CS -S 1 CR 0CrS dSWS ^S0SM0wS     0  E000 0 FK N R WR Q S-00 0  z+FD800S ,00S 0P//+F+FT+FX$0P/0 0 0C/+F+ p+FX@-PU  @; Ѝp`@QkPppQ 00S0\Q0S 0S@V ᥖP 00$Q00+F@-0 S 0*( (D: Ѝ * <:+E@- @ +EP/0S/P 0  //oP@-/ 0LP/+E 0@-L   Ѝ+E@-`MP@ᗺ0-S0p00Cp S T 00ЍU TP PTU $PT00W`O-P$M cLP 00S S03/0L0$ЍeL0 @PpXX 0 R @@-PD &$PP 0@s093@!+P0P0U0 P @0+S3P :{:9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P aK[  0 p0 @ =RP   R R tq000SPP000p00CS D 0U?o 200@S 3/TWU 0 [ 0S00S0000SL@40 S 0_P&00S +E+F$+ Lk2@-@PM @PU@`p0@ mPzPU   c(A R  u 000CSc P  RyV)00SS# P|U  U Uc0?o20RP 2/ 0RP0 VW 0 {Ѝ 0?o2RP0U U U6W0 0S00S00W 0 0S00S000ESX RU U U , 0 S0R  c R U2/U~00SS 00S000 S000;S U000 0  0+"04S S S ὦ0S  0 [Q0嫦0S 0  C 0Q/ 0   ^R000 Q\ S$R 0C 0 N0P0000\\   0C R 0 C%hG+TO-pQpPpMW My@xcPJTpd3dC  \\Ls PZ PUA (3T Rۍ ЍpPS@DT2Pl@ if @@~ 0 QX &| *Q@ &T@"0S000DP ;04P ST@  2 Pp 0Q 1T QP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S n Pj0/ T0p0000,+T%h%Y+T%aD NSG0@-@ᏐP刐P |僐P l~P \yP @PR%h^dkq ,@-@P @P P P(@SwĄĝO-|1M0S" @`0 ЍO^pP400 0 Ppyx@`00S 000S  0P Ѝ 60 000 { % % 0S @`+T+TĮ+F+F0@- LLPR^0S @T 0 B+T%h0@- LLPR^0S @T 0L B+T%h0/+T0/+T00S /+T@-`JP [PVP @-0+T//@-L@ p0 P~S0PЍ+T\ QS *0/QR QQ*/0000/@-@P $000000/0S0C 0//@-0 #3P Ѝ@- R@PS/ P >B`Q  廈$` PЍpA-`pP@T@  A-P`"F$@p PQ ,0 0(000ePЍFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0P00`a0C@S L 0 0 < 0 l 0 0 0 0 0 0 0 t  0 0 | 0  0  0 D PЍp  000@@0 0 0 0 0 0\/\\A-1!0 Nc \[Pa@1!0 Cc[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CqQV 0p@]^S @p^404 0 4bp\00+g+gļo$p@-0Pt @R RP D D <2@D@ p@ u @%a+g+gFC-1`pMQp@P0᠁ `0Y 0 .PR l1@d1`0 Lb\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . Cr R 8" [T \[R@]S  000TT[T@  \T  \R(0 R Ѝ+f+g+gc+o`00@-00M/SP M $S+ +S00+ 0 0 9S#\S @P0 0  b0IS@P R00ۍ Ѝ00@00 S00.@+g+gŢyO-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S 0QU t0t Pp0 `ab`0V 唌P0 0#"P+T+o+g+gO-`M@@_.0 0\0.> 0ga S \|.t>0 xXa Q  $ (  8 p  x p 0S 00@0!000 0S 00@`0`S 0S @p#S ;S 0 p00@\ |P  P 0S| @,Sv p0S 00@P 0S  00@[VXp T H1H!0 10S"000 S 0Q 0Sh @;S }S 0 0 Xg$ 0 0$ (0 0B >@p000@ TH 0S  p0 U]+V%a+V+g+g%0QƌƢ?+f gIdbC+TqdžǤ+^n'9ȥ Uɝ%^, $ p@YP  0$ 0     呻!1 !  00 $@$( 0 0 0$00$0 :00܍<ЍG-@`@lp圀P䘐U@T00S Gl0h0@X0 0S0 0  P+T+g+gi+o+oL+o`+o\p@-P @"000P @p%@-@ 0  @0%܈0p@-P`PUp-@P 00CS0Hp ςHp0 H+fGA-p`hB R4 RR R P$0SV0(  R R kP$0, \P000 P0!PQ$00P0PT0, PP (00S(0 #R nR0V ,0020#00$0,0$0@H( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0S $v (0V0(0 00  T0(0V0(0+fGg+g f@-@X0  0S 0S00CS0!Hp X0 o+fO-DMX0`SpM00S 0S \3#X0X0\030 `00d0尓XSXP 00CS0Gp XʁX &pP0 `[0 X PލЍP2 Gp0S 0P 0P yp4S 0p0p4S \PP hGP d00\0Plp0`0d 0R00d000S 00Sd P00 2 01[00S ++r P0 n[+0+0J]JU^ 0h! P*]\PP G8~P\e ( p$pR\0pp!M 0`PS(00dPX70000t0\`0P l000S S P@ /o"0 l 9(00(08+fl%Yң+kH+g@g+gHː˙ˢ˸'G@-@$P ZP@-@@P Zp@-@P+Pp0 Z@-T`@PP Q 0?'p0 7' Ѝ+oH@-`MQqM0S000@03 0@Y0S TW 0Z 0 0S S ` 02vl@P *0 ; P=F 0v00ڍЍ+oL+g4+g8KG@-@P  0SxeZ p`\0 `  60P S w KZЍЀ+oLlG-pA嘁!0`PU , R:(,>0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P     pr  Ppu PE ,  R:(,0(0   6l 0 +oL%aA-@P p0R`*W00 l 0P P 0O-ؿMO00PЍ080?PU 0PH0 \ R0S40P 0!Q0Q0 0\1SP R 0SO00C SQ0 0Q0=0C>S =d - - - - - - 0 - - 1, 1\ - - - - - 5( - 5 - - - - - - - - - - - - - - - - / : 0( 0 - - 1 1H 1x - - 1 - 4 - 5X 6, 6x 6 :t - - : ; ;t - :S4 0 PS0@oP1  Q Q* S  H ~S 0Ri 1cQl0Si0H0Rl0S 4 0 q1S Ps ^S0@oPfQL0 R: L `0pȁ0080S8<;8 00 \04 0Dt<0S H0S[P80S4PU 0`  EuP0800A E4 j0T P 0  004 0 0  0;00z040 0:倚R <00sd $x0P 0S 0S 0,( m P2S 0 H╅` 0S0`V: $ 00@ 9@ȅ0S Å 0X H0$P x0 0H$0a$0 S9`0V: c$ `000 00C 00P0 m8 0R:D`8 0os `S p L;s,8 P0   R:' ` 8B 8` '1 01S:` 007 0 S0``78 00 g04 0*s<0S v gPF0800 WP80Sg04 0s<0S  P80S0p4  Ht`P <000F400<0嘆04 r<0S 1V 0400<058 00 8V04 0r<0S fL0 R: L ' `0pQ00pY R  Q \5 0LV4000  P 04`Z Z 0Z000 G 00 0 0 VrX4Z 0 Q\ 0t 0 |0  0RQ7 p0V`XCcH0p0<Hp<(0000S s04 03r<0S p PA #000Q 0 D00 p0V`0  `0P   P\  p0VX`0 0 P[80S0s T"Tp0 8 0#<000p00007< <0 0B15s?0 0@_+p1@-01\ @T P#OoB\@T P P P QQ Rr P\ p\ P P Q qR  ,m+pԄ0@-  `Ğ\ @ T\    %R    +p,mA-pA0 5S$\! R  (P 8!勢0  ,P !傢0  4PP6 9pA%<0S 00 <hP`p夀0U00S 000\P #P D N000 HPpS,m+q, A%Z+q0E6p@-@0` T  tod l`P`PT p NnP000ST: @%Y%Z̓+ǫs@-@P rPr8@P @0?SP@P` yp Ѝp/ĒP@eHP 0S S @40S000RzL̸@-M- >%Z@-0@<TQ T00 }0001S R0Slp@TX` T@0$ @H4aT(8  @,X+pf:A%Z,mHT]pz@-- G)%Z7@-@P  0S 0@T 00 Ѝ00"S p`@-@P  p QЍp<0p@-XPP%0ATp0 "R   DS " @D/dAp% 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,{0P01p++01//00/00/00/00/00/ 0  /+hʐ 0  /+h^00/S00/00/00/v00/00/@-@|+Ô00/@-@{+Ӽ 0  /+ҔS 0  /+Ҕ 0  /+Ҕ/00/00/00/00/00/ 00/00/!00/+00/500/G00/T00/_00/^00/i00/Q00/ 700/j00/sZ00/^00/ss O /gb@-0  0Ѝ@-@ +@-  +(r 5@-0S04c  +@-  +(k @- 0+ֹ+Ӽ @-+ɼ( 5@-0S04c+Ӽ @-| @- 0+Ƒ+Ô M@-+“ @-  +Œ ( 5@-0S04cy+Ô < @-  p+t< @-  g+q < C@-^+< @-  V+s @-  M+s  q@-D+Ҝ e@-<+ e@-4+ e@-,+ @-  $+t @-  +Һ @-  +r @- 0+5+8 @-  +t @-  +q C@-+ @-  +6 $0Qa @-+8 @-@D4zP d 0  @r 0@-0 |1ӈ+ p@-P' dP% <P  SuP5P 0CP  @@PV 400C`F V$P P P0S p400C`W_}m1ST !0C B/!?15E_xP00 S11X@zP`PxP@a@1S50200D(PZ) @@P z ~ ~40@S ~ y  y | y y y z y y y y y ~4 y y y y ~L3P#0CP?P* <P >P P10!1 NSPNQ0^ B жr0s0Ɣ P P?@ "0C S񟗊 z z | ~@ | zYvPr P1aD P w2|1S'ʰ1 D P w#|P c00P1 RE40S 3/Pg PP g P,ЍPR0j ^ 0Sp0W 0] 3/pW P `ZD P Aw g `{g00x00A>0 b02P 00P000;b{tg+q80%ZЖ,hRS%a,h %a 001/+q8P0 R0//+q8O-p`*@PP [ ! 0P @ Ѝ0q00 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @+q85P/D0 R/0@-A1 P f@< Wq+q8O-Bp0  W i0p 000C Ѝ`((0S 0S MpP Y000 @  S! S0 30S 2pP hY eY 0 0 0 R @ S 0 pP JY0S DY0 00` S P0PS PH0SPPo0 00o0S ot0#?C S YPU  Yl0X!0Cs0S;3PP0 PEY+qL%a@ UUUVO-$MHZS  R0P 0L`gDp{@ =0Y0 0S 0g >gh,lPooo@`0l@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C 0DS0  0'izoX 2 h0  B్?V P0{ P>  PN P P!VUA`E DU@DP`0h ~h{h@`"PD P AP;  JR !   ` D0T0@0!P`1 V0p00@  \x`E\z`F`FV0p00@  DPET@DU`E¨` Y @ |fmk@T`— R    BW0S 000 0 0[f$ЍO0Y S +qL_j![%a%ZA-lP`Pp `n@n@0T G`P@ P P+qL@-P@p 00T0) p@Ѝp0 00 f0 h` 0@ jP 0 Q0 0P rۍЍ0P 0 0  0 CD,00S/ 0P C@-++\@-T^P P <AE(@"Pq@DA-@M @Yl0S0|3%P,  LlX0S#X|P  b0Sl Y0] y)Pe-B@PaD'D*&B^&'ЍP@RV>XP'P'20S %AP'.eAp 0$!P,>. X $P 0)AT 2PP ~AP p`PP 0q+Q Sp 06&V`T(p`AT-~@p0T-:W?Q  R@4Q p0Q  R@AP`003/P 00  h0S  R l 10!@@P+++ɴg@-MM+@(b+( UB+( bB+U(4@PލЍB+@P 0 T @@@@@ @@@@0'B(?HFjD-MM+ a+L T+ a+0T ?P  >ۍЍHFjD0@-@M k1@@$#P @  qP A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$}*@P3&P/[P+W@P'@P# 0P} !<}  0S 0_ Z'P @P4o0m &(Y*00++bHMHX,h,h @-@M j0@@ ?X#P* ?@d  q}P 00*!R00$Q *@P  |0S 0` 'P%(*Ѝ++O-`M!  0X#*0S ` 0 SS 0ep0 S00C `@e0 S:gPP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 `%a7@-@ PU H! X'00 Ѝ0llP Xp 0!L j Xi( 0$[++CHcHsH~HaQp@-P @<00S   0 p@?7 0@+K+l7@-@ lPU  XT'00 Ѝ0PP | Xd00S +i.L 0H["i%0 ,9+lCJHH+ʼaH%Zs@-8Q`@;kY{ ?ae|aex 4ae6e`o7{g 0 Al@Pxx圣v6녁P AA6`9` y{Ѝp,h g%ZHO--{MpP`^Z 06p F 0S  P R q 0S  됵P W뀥P WbKp@T Pe DqOxT0B? 0EF,P "U&@P "L&00xePseP_; P  lZ; ;0S ;P ; 4*00{4"0{ߍ4U3 ,g0z"!`׋؋ 031,0l0,0L,0   L 0P600Pz?"!!0 #  PV  YP*U l @2 0S h2P 9g0S hPU gL P0  |T 0  SR 1P V 1 3V 0I2_z?0YCQ0P0SP @ 0V0 R0SQ  V0S/ P L_yk  PS 2  +%6tptbI8@f+l+JYI;/D;IJ+rIMII'I_+\.IIiIp3[0@-0,MP0 00 0\PPP@P DD嬡@0Q ,妡,Ѝ0@# %6%ZI+l -O-piMs?!0<W&P 00iߍOЍ/l|?@PX1P L!L00#@P jZ`  PPW0FSV030#Z0S c00W"$!` zP Pp0W0$U80P , 00T$PQ$G+l QII--O-p0MT@X   p$p `V X @M'U`  TPPaP-@P 8H E0߻PU 0'SP0U*S/ xP 6m [ ma0@ 0 0H0 qP11Z k0p`PUQT ( r2S022SP0220C2   S`` x$00 00( 0p|W  @0   (PU dd(c0U 2 ]W 0X0C?o20S ]Bb$]^bdx@0Uk]]x00CS0000#=T0U Z$0S  r}7U(hexi 0%S @SJ B* BeD0 0l/00L 0.RP 0 0bPH00ZpA@P 0A0 0X 3 4Q<7g@U$x00X (Sc@$0U Pdxz  0UX ~a]awSdS PPW  WK0ЍO Ѝ/IJ  DJ"h@th,h %YFlJ%0@-CMlPP 0S .QR@P 4A[Cߍ0 P:[ +qt+rsG-p@ 堀堐PB`AT:00Z W ,/Z 000 rRP EQ 0 @J,%aA-`Pp p@ d0 @YT400^0 ,`P40,   -8 4d0 w=C$ C><TrP, 0.̟ Q(<P 00 ( 0 0uPPPPP:@<,`0tD0D,Dq,x `<I /  0p>0a XvY  I`PP\  C`PP;U 1sS 1lS;"000 RP p@ v b! HbhH Qp0TKT[T{1D+0~, `P `P `P  `P `P `P _P0:4: @p A*10p 0HA'ip H0St:t*10ll N'P 0H0 H0Aip 0 APPH , X$U Q RPPP@;_P@- ,X)0xW)0wR_P\8 0\8UXLy0 y@T. 0)0z9 ;_@PEPSPN X0 #\6SE p0 7@P: 5 |t h[7S'  PH@ 07@ P 0(AoAP\XP@Ps:4S 0 zP 0'APxQP 6P'`0b@Pal\80<'8\8P,W 8X8 rOP0&08P 8X8m `OP0060&S\880\8P 8 W8U0S d&8P 8W8F 9OP000S\80\8P0S\80\8P@sT %0}D\8%0|<5T$A Q0:$R$ Q9ğP \8şWt^ H4   44SP  0@?S @P sW4{ 0Q0:$R##\ğR#$R#W%HR($ 3 ( Ts0S1 ^`P 2@T QᑛMHHj#00S "0S <#|P3S3 TE 8"DC?00N?C0C ,>$0P0  0@F0@P^{CP$A?jp@Px080Ca@,0,mP pBN0S ,[ X >0S@0 <JX+4AS< ". 0 0S D[DW5S !#o0 0S $[qX~OXz+qtJE+lJc%ZJqJJ%a%6 u+sp+dJ7J3Di+uJ;KK~QhJ Q +sra-JNXm+rs+ur+vJ+wJKJK'K+K(KFKQK]KxKKKKLyKhKL"LL+vM+MN+v+uNNN+uNNNOO7OB+yOQOqOOOOPOP 01/ Q rC-鿏P@,Mp\P3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ߍ@P+P2P:@-p`CM|@\PlP#d0RXPP @ W<0080 `0(PCߍ@rPG+p+tPK +Ӽ@-@ @+8@-0  0 P @0@ 28 0/P $  Ѝ+p +r+i0@-0@XMP0  0@ P x x0 t0Ep@1P0/Q   LL n1 0/R@, ,@dЍ0+qt +p+8+r+pi+ȴ-MMlNP \P  3U /U0 00SލЍ\0\ \TP L0 (0< '0, "+Xm+p+q+ȴ+t+ҺPb+ҘP@-RCMX6S P \8lP XoT20S H2\6S 81020"(62`Pr\8. T^Y10 A>:4S !74\@C10 +:4!SO *00 0 B ptt1@P) *1d TL < 0S ,!,$!$0S   DP\6S V NMCߍ 0 B+qtP+NK+srP+spQVQbP+uPK+uPJPQK(K++rsQ+urQ2/DQ6+vQCQyQP@-@T^ S C @TR00S\0\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-p@PhM 0S'phЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/ 0PQ0//!01000/ 00#0//O-`$MPA@T X pQZP00 0S 0S0S$ЍP P00 S =ZS, R ,0S R : 8 80R:P#3///@-@MP Mp" :  *`Op Wd5\\ SS=S 8 d3R 0 ,b0 ]ڍ ЍTTRIR]@-`QM p@ sP PP tPЍYPTP0 p0P@$U@@ZT @ @0 @a PRk^RyO-Pp0@0Mw'PP `ĐĠ0 R * PЍ 0L03/P  0sW놁 0 mW  @$0S P @E @E`+Rp@-P`o0@0S 0p@)K@-0MQ!p0`L0 3/P< 0t@T 4/@0 p0(W 0#W 0@n$0S @ME$0 @HET `@BE @>E@4W0S0C@ ,f$@ )Ѝ+Rh_Ig0S/p@-P@J 0000p@O-p@P|M YE0P,0+`u,sP|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U/0 0L1<00 00PpP ,0<<0@D(@0S =P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0 h Ը@-Z P 0P 0Pp PQ` QTyPQH "P <080P/,/(// Q<RO?p@-8@Q0@P@DPp *Pp%6p@-P@P  ,Q #D00ppJ@-  p%6@- { p%6G-@PMP N/OZ Q0 0 s0S1 0S XP a,P ލxZ0S tZ0S1S P ,WP @l0 1h0$1d0(1`0,1>1S nP >$0`>@pKpԠ( `p$p ` X  D$0@Y 4 P 3S4 c Y Y0000? `䀍0Px Ru'R 076`>0`N C(Q0Bn Q? C0^P ZP UP  ,4101PŸ "O` U2P  @000@A0"10N?P0(S  0C Q 0 >0 C,4101P吀 "0!`9J` 1YKR *Y000`811!$10 100-!(, X<@ax1|P,a( {1S%4 ␐0! 0A 0{ ,001 "P `0  ,001P "`0\ n^RLLMMM!D}M@+zQMMRr%aRR'`QR @-PM`p PP 0Op u@P  xPP 0Bp P@PQ 7/PЍ Qh@-0 0P Ѝ ތ@-0 0PЍ O-aM,MQ 0`aݍ,Ѝ@P`P UPK pUP0 QpL4PpUu80$P 00S 3/p0$Qrbb>0Eo`YG_FPEUP 0000!(9PP 00S 3/pO003/No,P4UP (S("+"A b+bA`SP@``VBsaV>+"A+bA3\QQ0QUh $P 00S 3/p $QUY ` p0 `` pxb.;8/ 0 ``px`;".6/0S3   NA ON0 0j`PxqxxU" b +`P  P|_P"]+"'AbV+ "`P TP# TP TP TP TP TP VxT @  @` (0jPTD Q+`+lunRm{En gX9TeR00A-p$0p@` PAP0 @ p> C 0 1/@P00pЍpP@00003/003/$AmRO-PUMM.dh,@4PV.zVQ_$x(-Gj U`V`(0$S^ 0(0(UݍЍT  n? 0.07 00P00@P#Ppύ`40z(Y^ 4S =$7h400C27\4=1 V =V?h400C26\4=1 0 000000000 00pp`\ , Y0440|40s -1yv0 00 00000 0zp` 0440Z40s -1ଔV3 `v00. ndE "LT5@0Y^ =2XL=1pP0Nόeph \  v00$? 000*0(0S00Ӧ?"N?@/&#` C6$1^(1)041 $,!0 (q,! 48qHL1$Q pz \w^u 2Ÿ@p"F0Ÿ$1H0!$+ 48p2P p>ؠCT $100$10 0: z0G80 ,! ,6$H,@JS  GPq<PK ;ISG 0.$10B04!8C0(1}1S0}1$1S `4@@+,h %Y Zg%6++`++r+lS:_PP$030/0@o//BO-@P MMA E0*!Rp0)Q`U0 $0 g  /P s Pp ,{*'0$0 M|$(pP d4\,G ܍Ѝp 84@0Spp0 @0 4p0SW00_ , R\  000x;8,9/PI 0  x8;,;/ 0 x8;,9/T08SS0CS񟗕 $ d d d d d d d d d d <Sn "Se S P0~  R{ <pWv  &P d0S P"8H8 }8Rd0S $"8\0S  "8`0S !8X0S! S! 80}L0@ \Q\0S ` R !8zx8 }lQlh}`Q`\}TQTP}HQHX @1R<}0Q0}P00P0)0YP0 U @& 'pPv 0Q  c+S^fSDp(S ՜HTT STT"T)$cT0STITOSYTbSʐTtSTTSTSStSS+O-UM0M*a8V"e&A'@n& pepV pW e&0 T0T @Q ,!ލЍ9 )qWd ^P FP' P # @{P @p`H吴 XBT0SXd \ T 0S 0$< 0P00,0P FYP14s10#5:# (&&&$&0S && KB ,PP0Z@DPa@  pg `V  H `p80  P 00 ,0ST0 S00 P0p800SS 04  0x; 8:/P00400ST0(ll S S @ Sc  SV 0 <0OP<0PL!@  PP ,0$  40x( P2 } ,1PP OP 0005S0+4^H 14  u 0R0s  jF%а 0İ 0+Tpf+lTUUU7rUi+VLVeVVVqVVVWW WKUT!ٺDTTTTTTTTV$Y^TUUUVTʐO-@AMT MXp P`L 0@P`T $%P```fPP@Aލ Ѝԃ̓C̳ @3 (4@$80DP@<@T@X P \u430$3 00 g2 $02(408@Y P M딢娂  t20?8@d2@DDAT P2P"PPȩ#P <2 8%PI,2 $ *20)ATp !0 yP&!,%0 Z@0S k#P 0St H0@4 000@0x;8 8/P6  %P !^%@P 0  p @$$0 K@pW:p@ QWTnW(^ {W:WLWRWdWx mW QW+HT+gp(rGbpf0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P   PB+z+| $0@-@"!Q(@+z@-$@2S 02+zO- @P@B`P@   PP@ K@p0Ec#రPU* ЍI +P  +P @BI    R0S p%an@-@00 TP Q P 0<Ѝ ԀC-`PJMM⼂```p 8O@4PT_H)PeP8_ Yo`GFWI MP 0 000!00P < 8<1P#<@XNo<0S0 0< 8 `PV 40,0G1@ 01A010000 l@@@@,x@s0S7 0S(8kJݍЍAT+P0 8`$!QQ@0RT<0P 0 003/@#S0 S(0S 0S83(0S003/@#S@+`  ڸ%8 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-Pp@`4M0S4Ѝ0 0L03/P 0 0@P`180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> oW 0@o/b0 !!/+10/Lp@-@4P0 `%E1111p+O-P@p`ԐԠ԰0/ C !  !0  PNN00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ+ "  L <0@-P@M/.N1, 00 0d0@00 0T0@@@@1 0 000@BP, ߍ0 8+O-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+ { 0 Q{ 0S  mD0 0P  P 0 0H  R,  4@T  8X $ T\ ( p` , d A- 0R 0  DQHa@1QRpB   !LAPAPE0 \A0Q     TTAU @@+XO-`BpX1MSL2=X\1S,2\X1S \QUЍ0C`1^`1ST`H1PS \1 XX1! 0`1V$ 1x C H0C 0YP 0 S 0.S  Cp `Z!XDP bR0X`0 0H9X"L\.P \!L000: SX1x 2 \1` 0 0 X1 ` SX10 2 $ ev6+%8 h+  * Dp@-MMP)?PKoۍЍpP@`+VC P*+pK6 P*+E6 P**PĦP /cDp@-&M@(x(K`P7 i<0 0H P ()7() iG_ <@P oލpaXb+ʼ Q[ @-X@01SP@0S01S0  +  O-p@MrP! c0   0`崢Y Gp` 0 0P0SMߍP X%]P0UIP0 a0CS0S  P/U`08Sڠ0S) R& S^0  0 a00M p 0h1劅00 0s0Z+ @Yp P` \'0P!h!R( 00@(O  00O0 0S* ?0!C  0 00t00 00S 0vUa0 40XWp( @dAde+@Xb+f C-L1 @1 R0   A h9'Q   R 0<1LPDTPapHFLP FU `1DP1 FU `1TP1 FUP1 `1FUp!00, p@ ЍC Q R+ R$rX@-M@ P @oЍ@-| 0S lP \0 T0T 0PP0L004 80<( Ѝ Ѝ+Xh+Ҙ+i+pZ+q+ȴ@-p@Mp)t90 0 0T00.00 01t9$ p0#:! Ѝ+ RLp@-Lh2@0P cp@X-?@-P @ `t R ,0$@FuЍ0@ Ѝ/XX@-0  0l P L0L L@ 0< <@|0 $@Ѝ+p - +ri+p+ȴ-3M M T :P0  4GP Go3ݍ ЍDʫP-3M M 9P3ݍ ЍD00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PD@00( (0P,++ҜX+Ҙ+s+YZ+p+q+ȴ@-0  0 P <08 0440000 0 Ѝ+Y+p+s+q+ȴ0$ 0!S/ /+0$ 0 S/ /+ 0( 0S0 10 1/++11<0@ Q !@-0 " !/+0 10 1/+@-M/.ZI, 0l0d 060 P000@ 0@,bߍ%8 8+0D D /Q/QQ Q/+%8@-@0@ 0 0OPЍY @- @0S00+ҘY 0@-pAMihPN @?  BP<04Px9/70Aߍ0Y7+Y3YF+$@-P@ 0P  Ѝ+-@-   Ѝ Ѝ/-@-\0X0@P D   Ѝ@Ѝ/JYOY\K-@-\0X0@P D  Ѝ@Ѝ/JYxYKYYO@-4P P PYYY@-@DP@ 9$o@-4@EP 0 P 4++q+ɼ@-4@EP 0 P 4+p+ȴ+QA-@@1@#PP1P#Ttpt` &aP t ubK!H!??n8l8[A[,h +ʼ7@-@%P @QHT0  Ѝ0Z%ZY0@-EMY.P@ > 5P0000U ($$0x:@9Eߍ0+$+@-pM6hA >pCH1^ P0x ,! 5&yC<0P H ` p 0000`0 0PP`Po\Cߍpb02_LCx:X JJP (/>((JZ-++$aG +ZB %8ZiY7@-@P !0`RxzDP PP txZP`h 1  T %01I@0Pt@T 78Z Ѝ+J%G%8@-@<0@- 0E Ѝ0@- 0; Ѝ@-0@M00  0%Ѝp@-P<@0/SpQ |DPp@%8@- 0P+t+pO-$M@p`P 0 P( 0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ$ЍZ3r+ha+Z+Ҙ+rZO--,M`3B$4@op[FpPd $4P@bcT00S@ NBPPEUM P1P!PP$$00  @+$0VSS00Y00S A 0 C H C$X40 0$0  0  $ VRR   Q # 2R @D k=0@QA `P$ .4@,ЍZ RT ZA-`pP@P!C= gPP 6/ApO-@ M$4`P Ѝp0P 0`VPPTP$3-@- 00Ѝ Ѝ/ 0-@- 00Ѝ Ѝ/ XA-p`PMMP\' pqp@u@ F>V ,(($$cpv&  0Su 0CS2PJS0)  0 0S8 0S r0S 0S QN@|GP$ 0 \0 L@nD2P 00b0C?o270 姏0\(G`0SލЍ!7SBP1Q! F?p@Foh!H1Pg0  0M(%' ) 0S q0Sv 0Sr 0So QN@KP  0ኹ0 @PYF? Q. QFHn[q[%[A[4+(o[L[t++Ҝ[i[+w%8m@PGr[+Һ+t[aa-MM P  FP  ۍЍ[-MM P  1P  ~ۍЍ[s@-fP' PbP l%P0S 7 6 6 6P @D`HP C@TTNЍp\x0|+R/ @-d|+\0XT0PL0HD0@<0840+\ +\(+,\2++(sZ+ +0P@-@ MF @0W+ʼp@-@M L(@H@D0 #,0H ,0@@08hPp0: S HzAP : :܍p,C 8CQ @P0@Pڨa <'PT81!唜|8<DQi T1 08808PP oQ P00S ny < R t00 00000 00l0p@ m(t(0S!++p+q+ȴ+X \< Rb'Z \++Ҙ+h O- 0CMSP3q ` @j0!`7+0`SPW!000 @ US@3/@P CߍW! 000Z 0S X 0 @K/T W  00 0  0S l00S \  P0W0 ! !  000+p+rPZ+\M\ug\+X\+7@-PQ@0 SS 8=0 000] Ѝ02S  \\DO-(UMp !f4Q } B#ß0/SCP3c0ЃC0P/UE=# 0SPBW|C1 dq` (PL"P$ 0RP GP U?^ 0 10S 0S6 0 1S20S lP`F $l2l8E27UP"!0 a4'0 0J 0R RP 10 1000`zRP 1R QA  1S Q00R /RSR UߍP 1 0000$0000 Q1 PKP 1 =T1 3P Z+\+%8+\D]]]]^?,h,h +p\\]]Q]]\p@-Ph`@TUapUP`FP  xp%@lgO-`MMp\` `P kPP0P  Y/@ڍЍ fkP ^kP 8PPP .PTt@PI@ <" pj0< >P0=S`  > )P`^V PP  Phx@   D$P@YOg3^Q^i_$2/00p@-4 P@@0 Pp@@-G-`P4 @@T$ `V! p0F&04 p0RSP pPp Pp40Su p 7Pp@T/0 R/@-p`0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ PI@P  p@J@-@ ]([@XA-P@p`p0S 0pp RHAE05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-8DpЍP@` zp lp   0u`-VN t@ l1=P\yP LuP @T LLMMM!D}M@r^MM^p@-PMM`; A p  @Rp ?P?PۍЍpA-@P m?pP` P  0QPyd| @dz@-PM Mp;P ` p  @0PQPU?Pۍ Ѝ Ade! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPD600/00/40@-\80S0 S0010\80S  0\\@!SR0(SS QU S!0$0S\  0 Rx1Sp@- l@$\ 0P!QS:pQQ   P \ Q0\" 0 ,04S008 0803/P,000403/,, H0 , 4 T 8 X  Rx40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 Br Rt01 408 00803/P,000403/,, H0 , 4 T 8 X  Rx000/O-0@p 4MPPp`104ЍO$0 L03/P# Ѐ0 \ p!ФZ ["H* 0*P T P , [p 058``pp 0S0P 004Ѝ0+dO-P@4`崁崑崡 Q 1SQ " 010 r 2 R  R V V $R RR 0S 1R",0S 0S0 0 0S 0`0 K3/P p  0!"0 0  `0RPH P00P0 < Q Q  Q R ^l c$ L _ LH L4 O-0c(0M<00PSp@p`00 $ 80s!3 08h0@l0 S@3` 0H@X  83rR0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00D0@00t2 p 00q8HL 0i8  (, 00  0]8Q23U 40p0P<0SOP0 L T00SH0Sj000q p0 x0 0 000000  P0 x0 00000PX 00808/D80 PpQXQ Q(00,0p 0# ^p a X0S h^ 0$0p0 0(00,0  0#0p =0++_n+_r_C-F`0pSPlM^t70S 70 S870S 70Sk70SG70SH70SI70SJ70S|70Sa70SH70S000$ R(000 "0A W(40S  0$S $SS $S)4 00$0 40F70D( m70SL4 LQQ004Q00S $4Q $4 lЍC W2W/ Z Z\ Z Y0P Q Q_0 L3 003070  lЍX3 00L3060 0HS(0p`@ 10  SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@0 8", P0 @ 3 R>0 5 H0L0 . H0L0 ' H0L0  H0L0  H0L0 h H0L0  P H0L0@ 8 H0L0U lЍC!SH000050PpG0  d 9/ 000(0}0+ ^l c$ +ɸ+r___ L4 L LH n_ n `___````"`*`2`7 _C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``u0 0pp07/@-M0@ 03/P 0 004000 V003/ލ@-`,MHP 0@0 0 0PP@900 RS THP pW 7P00P00P0,Ѝ @T@0/W/0  00H P00P0%a ,0@-$M@D0X  0P 00 00,0P0H0Dd$Ѝ0_G-%p(M@PV Xa `P`DP08 ,`SS0 Q "S `P  P !X$U0X$U ` 0 H0 00 00 0% 0MPP(Ѝ M Rx`@ S`K LC-40PS,M80S,ЍS S S !S S )@P `p䐟`u`X 0 e000 00t 000 0 00 0 0MM`P*# S O, ap NO-P@0p(AMP U  0唂0 `!"00(p1 "UP 4P /00 P P s"00P0[@!} 0` 0 @ABqA0  0|!jCg @0  T!`-] P0  ,!VDS`Pp,4P@!@3Q@%4T -`q8T@D@`0@@< 0 0K-c80 0@`0P (ت.$l 00@p `HAߍ #"0P0RPPr+ɸ +``O--t5AM0DpP$sPN G@`PD X- @D0 ,`4 S00,0ñXT, 0 $0p0pC0@ :x  Q * Bq Bq BQ B` B  06 0@ X@@p0 0,(0 @@@@@ p@@0`PUߍ 06'0J pD`∀ K400*8b0A-0<0@SH0`4 pK3V09C3?V090VP:0A!s0S/A-@P0\03/0 0    `0V R!  B B" 10C)Rp0!YP! 0 `OPPp !@` B"00080000$0 01P0100Au wDqO-P@OM H(5a1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,pP5Oߍş[@P LşT0@0C0p0NC2 VH0 0$ 0 RĴ V 80L0TX 3/P10 00H03/ 0T 0000 3/P#%#& 00t80x 3/0lPp ,̍X 0 0t30l3700F00, d@B= 01 SH0 V p .4tM` PP00P00X00 3/088q0X 0L03/l 0 , t T x X h H !0T`X 006/P d0 !Q`0 00 !s"D  V p0 BD!2 B"1ᴡ0C100C0 + `V`s`V T00 03/P0 0D 2#4`0Z3 P0a d!0` !p D00CoD!2 B"e10C10 0?o2100C0> !V +d S0 S ^l S W8 Q0A-Pp`@f!0P  p0Q p0p 54s`P !@ B"  4T0 01`0(`10q0000ᙾ" p 0S/ LP0 05/0P0 8

0=C0D00 ,$x]U 0S  T0PZ0 000D0P0 F0PT0S x-P 0S00Q00`Q0S 0L0 aA3/P 0̀`0`0 &003/dP`p E 0 g&` @o/+X` X 0 Z0R0 ` <0@ 000R<  0S8X) a`v0"$0$0,0.0,0$0'$0倒 D嫤0 +0 px⢤ 00 t+0 8┤0 k+Ȑ0  ኤx0h00l010h Ht0pM+D+ L L0` S*pV 0 TYU 00 0`TY0 8TYT0P0'$0, Q030#Q0S $0( A(0b2F_p0 ` &?00`P3/ ``0``P.VLPZ0G X 0@4`8T(Oލ Ѝ+aAaFaK+ɸaQadhaaaT@-@! "  0 Q0 "ġ0S "O-Mp P$ @ `|1/0PU0@5@[0Z@0 0* pP 0*PUp TZpP 0 * X00(@400,80(,U00%000004p8P 0` r S00 $g00$DD0\00`04O0d0娿\ I PU P㟿\ @PQ㙿\ :UpH 0 XHXp4P0PT0"0h00<040080#0htX, 0S)  H0LX0 0<0倀L0 F0LH0P h,PHЍXDd0 <HXH0L0 0S! 0S00Q00`Q0S 0L0 aA3/Pu 0PpPU0 p0%PUp@g^pL0 Tp P%@\003/%C^0 0 $ PY [c$ S \$0X 0$ 0R 0XH3$0 S 0 00(0,0 $00S,0 00(0y00P3/0 PP0PT P0pXQWc㰾20S00 + L)X0Iÿ 0/B)0X XS 0$Q 9"+aAaF+ɸaaadh0@-@M0@L0 3/P" ! !DP 00!SS@Ѝp@-`MMMP;` *@P m- !$ 3ϲMލЍpd{@-@P D*P 4*P $*oDG9akp@-0@ 8M! 0`P@@ 0 P8Ѝp*PUJ0 00  0 P@oA-P1MMPL 8a0P *1SC$A T )1S ݍЍ Q 0 1/PPP@ 0S0L0 3/P ,0pW0wP 0pxp;H 7/P H}@++@- 0P+Hr@-0 /PR ЍP/R0 R/R  g0ia+@-@@@-@@ uat@-@ỲPQaPp50S  ,00 Ѝ,pP#0S  W  X @PP  4e㬼 +l+a/D%Za@-@ @0a@-@P@@-M@  "  " <܍a0@-MP@q  "k  " ᗲ0TsP <ߍ0a@-@R@趾A-pP'`⦼@P P  #0! 0PP Ѝ0$D a+p@-@P4Sp@Tp$ @PpоDp+aG-pt`DTP ')PP@ 0 0PP$0R04+aA-TP4SAp`4e@ 4 0," (" D+A-@4S0tp4TU TU T`040 Ds0 4k+ap@-@P0 p@gp@-@PP@ _opa   @-o@-o@-o 0P/+0@-PM  0xPP壿 ˻@  0PPP噿@P,P0Ѝ0@ Tpb&b3+@-P@qA-A0J?`V=p$X"0 >PPЍ p> C 0 1/P  0R$LH R>0$0 R 0S P P 0$003/0$a+$0pQ@-s㴻㭵 #"T R0//s@-(@T@ЍpH>0P:0 w003/@P刻ふ/@-tM`P @P0 p@@#P  30@Tp@tЍT0 @T|0t dl0l p u`P L @=6+pbGDbPb_+bubYb+Hbb/@-x 8@5bQV///@-0@Q s@o?0 \ 0P000@-P4M0 )T0@T & 0 ! @4Ѝ0&@0+//G-pP@`㈐VT0S0S ,'P$1L0PU&0 0X |&0 `p@bY+\R0  /p@-P@$<0Q"4` 6D0# A@$!9p++ɸA-<`P@&Pp(   A+@-pϣ@-p@-@M @C)0 h卺0S Y`L0LP0VV 44 0 ܍pc+Ҕbbc1G-1`PM@1P1!!  xxaxattٻ@Pl7TmPL)OP0 [ߍ B@RB?$ g&pP0=SB$?q@ B?`⥺@/P b BPt@t P 0 Tt\D nV:9YOlEG/0ac+lgc4c-c;1A-1P@,dp1P1X X T`T`  P  @F. 00c+l:9cVc`cxcc@-0M02000`00Pp0@P @T 1\ 1TO/11 +PO/11 Ѝ4cR; 0@- P +wC-`CM P@ `1(P pܐ܀0 `0`F0SO/11 Cߍ5S  xl lPX \\T0S  <41, 1+Ôc+“+3cd ddAd^M;Jp@-P@1 1  p+$1p@-P`垸@P嚸0 p@dp@-P@P PN/1 1 pdVp@-P@1Ͳ1(1 P1 1 pdV@-㿸@dC-@aM.p'T[BP`᠂rU U.z20P$0 _PZ `"0(@80UPW @",PU , # 0,P@#PKt1PL0P P110PU)!,`pApP0S7 S1  @2' 0` 0P@P`1\3PP aߍ@[0!TPR0 ,}(N?P0@9 kDF9 0 0 0F& 000 p %@p%@+l++$ddeJ=9:+“+Ô+3+5de,h,h ,K A-P$p+吹@P a-@T   mP( 0  JP  0V> P $@ᲹoЍW\\a P?< 0 ex+lef;fKEeeff1h//O-0p4`@T Ѝ@T@T' ^% L U[Z [ԡБ YZ PUPE P$P P@B0"/+4O-4Mp(t$ \ ZX0,@P @ PR00d``p ͱV0 0x!0 0VP @ 0m!PU@U0@P!00000 00$ U0 000Q0#02S 4Ѝ; 00 0S  R% S    0@   00@VP00VP @ 0$!PU@U0@P RG RD RA ,( ZQRZ3UU  Z 0S0 0P@V00VP @ 0 PU@U0P@0U00P@U Q Q0   .0@-4MP!!0  P P!P@4Ѝ0@/@-@ #@QfYp@-P@/7P `@ H"0P P `Ra BQQ pQQ 0@S:p @-Ho0RH #@-0@-P@04MSz1$! PP Q*   P +U 0@S Q 0S4Ѝ0+<0p@-@ ^T00PUPU' \$ST sp 2@Q.^U@P@$ @  $  0 00C 0p0 fi~p@-,@P{$0P ;pA-@p```P匀0ST 0@P"Rp@P Tx+ 00S@- /++C-麋X@(p,P3`$ 0АYĐY T  T: X0WaU|U VP P 0U Ѝ V0  ffXWX\@-@P 0  |!@! U!fp@-P@0S|T0p 0 Tsp0"S @0<00Rp( T4p0 ++4+8G-lP0`SRp@;S S 2@1+1:X 側p  QBp\T.@T&RQ00 00(Q $} p Q 0S T v; 0@1 00 0TRT0T"1+<{p@-P@q@op1O-0@Sp`P 0 PQQQS SK0UȰБ r0 $0 ^ 0 "90(Q $ p0, 1QX#  E vQ 00  R [ R pR H0H H{ R# Ѝ 0W1Q:P +f U0fp@-P@P0St!U 0E p(0"PE0U055403 0(2#p++4+840@-0@SZDP0@0ӕ+ TxA-AP0`SH!U 0E p0耟@SV Ѝ 4 U(@0`P `4p00 0@0"Pp0P ZH pV `00 PP0'p(0,0`++8+4_sgC1A-0PSp@` 0 PQQM SE0 Z" 2  0 !Rv?0r00  (0V$0X3,0R 1RP0 0000 1Q\00R00S 0W1S` +D@- @|00S T ]ʲЍ1O-X0MSM2"z\0@S2"`0Sb2|"d0S2d"|h0Sl2H"hH 0S@娵80S 8( SRM80S !, 70pHPASTPPDP剨 @C@p`P- @ \00`0d .0xh X hd;S XH!H@0dP@_oRݍЍ 0:S 000a 1 0 0 0 0C0 x;0CS||qPpgK UNfgcg|ggg%ahiggghh.h? TxKhqhhJhbhGFlp@-\P@0S 0R;)r00 S0@0 N Dp+4&"R p 0`P0+"R p0 d00\ `0h0x00XA `$P`Pt0 (04Hr000 00 00p; Uhg@-`X0Sg0 x\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP S0 06Z ЍgK VPfgcg|ggO-Ѐ0TM00 0$ 400 ,00P(0 0`800!0 @ @|P$0SSDp@p Q 0U U L0!<01PSPpPU<0pDPH PU@p p0S $Pp40S0000p$4P S 0  S PS p0S ;S S 21+1:$0S D$0,  QB\X:X2RQ2ȠP,$0.$0(Q $ p(0 S  0S H (v80ƀ1 00 0"S 00S " TЍXRX0H"1+<{O-P0M@GTЍp`ȠȰ@D0S W0@  0 0 `P1/Y  S      Q R  0@0Q0 0`Pp1/P +D UhA-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-?@P`p1S 3/P @`VTd0@@(T0P0S@000S4000S(0000Aj Vh+@+D Uh Z a(p@-@4`4P0Sp@Z10S 3/@+D+@0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp `^$ 4R R0 0`40$ Rp `083/< 0 2 P   ` 000 0S0\000 00//00/00/00/10/Q@-@@L 0A0003/P@(f @ gC-B`0SPEM;0N+0pSF#0 St> 0S 70S@0 0S()0Sk"0S00$ R!000V F 3 \ &>0!C> f` 0 010@0`r++hgO-PM 0@0` P(" `b0  `000 p!0 00@!ޭ0g0p@׬ x@x%ttl@dȬ 0 L!­H忬 @p0 $!席$嵬!p 0⯭`쀟P0 R  PBЍ 0p!唬0i `⏭ `qOT 0-00@p NR S3#:@`0r+ɸ+_h+hh+!hA-@0`\03/ pPW@@P@uP< 0쀟DW  \-W0 U  0  !   0 00$ 1     t   Ch  0SJCT T0T TTt0B@@ $r+q  ܸu шh Vyi-s@-P,`@U01Ѝp+p@-0(M0P,03/` 0@ S:0 00 0 0 0 Kp` '0A0ᒩ(Ѝp0 D O--PM4,@ 1PЍ #pP 0p @r @<  PZ0H03/0S`@G`@@00壬`P p" 0Q!d2A 2I0C 00000008"  0$0ߨ彥*ᶭ0S ("0 L0P 3/P \0T@P`@X0`0 S8bPZ 80 S ,1 0, S001{40P ≡0L0 3/00 P0uF 00% $ d 00qp`@囧0,嗧0唧p呧` ㄤ8 x44@`1  `40 000 f0,0p ӧ0$10h0\$10b`\0@ pd000S< p0 PÁp ,h3 000000 000 0 040p⤤p` 3d,0|l0S= S@: SM`p$P H3/P 0p0072 |000L0p 3/P '0 00S 00CS`p 0SV 0GP2Q #QЍ:P00SZ 3/@@OoBS o@0 0610@!Rx!@!x@|@pPpt@ t0S|0X*@MP PQ 0! @x 0T:x0S@ Nڨt@OoB@|0xT:Ψ@+il Vi-++ XR |r80 Ѥ Ѵ+@ u q ј+li>O-S[?UM< 00<48@`D jP epPᗨ UߍZ0P40 P,Pረ3, 080S 0R? <0S5(1SK!L ,LH S!C <H@$+4 0@P҉P\ @T "2B 40P 0S 3/P,00,02, 0SU@`PD`D@t w T2RΥ. Y0N ǥ ĥ ,!L12HPH@"`P`T@尥P Q` @ ,,00 0000囥 @᳨ w   , 娨 l, ⟨٧a00P1:1!smx @0 000000 0000 00ޢp` D⺟D0U4 Q[T Y ᧧ᥧᣧ4塧v `䘧+@+Dri noi Vi-O-/<@JM M`0嶙PP+ P) 0S% 0l"`!`\r\/'0P T  0CT *0C/Q 00lPy@ᓚm+  P:n?0  ԚP+0: S `V_>00ꨰ  ZPJ>0@0/SE 0ɥ+   S -P+   P*P 0/S`0oo`bS p0&000 SV+t} P*+w P*(P@&@]!Jލ ЍiaD@-M @RP(0  @P  P ЍP0p@o O-M` PPp X`p㴠崰aPЍ0S @ P0  y=pL帆P Xp0  @@oji<i@-㭣*G-|M `P`P PP<+ ݙ@P@ 0  @ Gř⻙@PX+J QJ.0I+J BJ.0TT:X ٬PP~D14 ЬPPu$F+J "0J.PPe6+J  J8`  ᩬPPN+Ji tpll40 0J>pP 0 .⊬P UT gލ7P@Y+J: J6PPp0J.e@+&  ZP h lJ>SPR iiiijjij=jjjIj\Tjijzjy%Bi+ijj'ayj1/00/00/00/00/0@-@0!$Q4M0 P\ P0T0670 P @P 04Ѝ0++ɸ+O-AAd2M(0!0PB(0 0000= 80s#0(0p`\05 0` %500%`⧣0$0 0$0S000a5`` @@`@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ `0d P[ T0 SW`vp 0 ` L$`J0$00  0 0 0#94P00 0`0000 0峢$0Sr D⛨ 3D0Sa @Z%S[eQ*%0C?o2 00;0, 0H03/$0pS`, LH0I #"0V 0   Y 00;000P0 pX00 00 (00 P0 0 0S { (0 7DP0v1$ 0;$1 ,1+ɸa%a+\DC-pQ|MW0PSSp` 00  Q 02 0 " 0@T0 S>X2@t&L"@(@@,0S:((0"P@P  00+0@080s=0 0( <T -W|Ѝ#Р!@&(ʡ00T1 0p X!00 , kLkT0@-)M@Ṡ0p \*3 +R@,OP0 J嘠*EP 呠-> 0 F  7.40 0.Ѝ0!0P8q0 S+P ,P zBFl+ɸ Vkj+A-@  "(0M7( 0PdQ1\2 5  D! `V`P p0r   008,0,p(p<0yS 0| 1/0 0Q  RS 0 ሰ 08;/`0P0H03/ps0D08P 0@00Z}*p0 0 `<080s`00] <0 0RW04 pD R@ 000 H3/PB $ <0 %Q 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/008 000` `0W `0 0V400000Pmk Y]k+d 0 4 0Q0 0p0 P80s00  h0S~ l Yz* 0L03/Pm !0 儐X09/Pc 雟00040$0(00$0 00 0S(  0H3/P, X$ 0 03/p7  0L03/ 0pP$0( 0S pP( $00W40000 00040(0(00$0 00c<#$‚0  0 00 H3/P0`r 0R04($ R ( 000 H3/P* $ %Q 0 0X 0T80,3/00T00X S \ $ ` ( d , ,0S~ P0 P  R0P0v 00040(0(00$0 00c<#$‚0  0 00 H3/PP80sc 00` Q [ 0 SX 0 SL0  3/P @0D RP0 RP0{0 80X T,3/00T00X0 0\0 $0`0(0d0,00S` 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQ@Pp`,0 0U?:8尚p" 0S p ! Q\pj`P p0Pi"0R[p Z[ Yl:PpW00 U0#S~ p`Ѝ茀 8/ #"08,00,L0 3/P 00p开8S  8y\  WX08P@DH0P00 00 80sp8Hp0!8p 40X 00 0S 0P*p ` H80s0 L0 3/P 08400H0, 00,0+$0T00X0pPq 00 80sh p Php@-@P(M(0S⯘(`,`~0 00P0F0 P P`0(PP,(ș(P(Ѝp000Ñ,0(弙0,`(P,h  4R+O-|X`M)1$qS W W (!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1S<1@1> x.؀BCPp C( ,H3"0@ 78  7 0 W &%, 080000, 0 J0ܖ0ؖ80000  0'DP10Ȗ0HĖLH0P (P0W0 000p8500 %  % %P,  (P 0 %<  |5| 000000 000 000pp 45P,0А=XpW* 0GSC0.(>P C$ 00S H @3/Wv@DpH L0] ZYX03/ 0' 05@ 0L0 3/P 00S 0SpW+ WP0pH03/0 ! P7/P%$%$)@0 Q1TYK@1003/Q  01/ 0S 2"]$Є  0 <P 0 7 Hp0  @D@0 ᄀX80X> Pmn,0S npP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,p\ 0,QQTQ D@ pP Q Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 0000++r4p80 p +@ |u qDk Yk0 @-@P`#}4Mp@0S $ 0dL03/P #` 0 #8PUV`4Ѝ 0R00S0 //O-Yp@P` 0< # 80s#   002   0 S R( 0S%   吁( R Q0 2T 0 < {+800 s"000S   t 1 SR0r01/+!0 /+$1p@-S@ x1SP $003/p@Ֆx1ҖP$1 0SO-@0`PKMM0((0DpH0S >I @0 0<0o- %#{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,ⲑppK܍Ѝ(⊎(0S*< o #8 ;c&@@ u-O-`0@PMM,0d1d0p 0S (0 S> 9 H< 00 0 <0.%#@~40kP`0V,p0U 0000000 0 0000000 00Yp`ލЍ,1ទ,0S*< #, 00A"X R00C0C0000S0 0,0A$P+ u@-@-0 !<$10(10,1P001.@-@0 0! 0O-,MTTpPP`0 R㑾,Ѝ "P9 @@5/ᗔP`K ` V`G2  0" ( 00 0Ȑ`ᦍ៕0,ЍO/@[;p@-@Q->???<?T?lP3 0 P,40 Pl& <0`p@PP80 P<,0 P00 p'k)l *+p@-PBMH`@  V@ @0@\@@@ATAA,AlAAAP 0DP :Bߍp`ՒP00Sϒ0`ʒ40Pl`Ē80PS<80  0X0S,!ⴓ@ 尒 0P娒\0 `0S ➓ @`嗒d0Ph0S ⎓@l0S ℓ@|p0SD z@P`st0P^9l:l;=>?l)l3ABCE@-PAMH`@X  @V(BBC$CLCt0D`qK0 @0S  &  "8`V@5 0 #P- 0Aߍ(0S l @d,0S D @@00S ( @ ^h/l12l330@-AMP@0Q*DDEE8EPEhEEE   q0`N 0S (0S    ,`V D+Aߍ4Ǒ   q0`N 0S (0S    ,`VP姑 $0P垑 0 P㘑0 Pp咑0 P\匑0 PH冑0 P】 0 _hgl7   60S O-@MV M>Po 00x R# S `^嬵嬅adDp80  @Q D0 Pd  _PD  H  `V8p00(0S%"$B00,0S$$B0000S$$B0+ 0 p0B/PpὠlYltl|lllllEGa~lLcllllllll C-GMN`RP@ |Ï0Al ⾐@Y 0 PGߍ 80$0+4⳽ 0mrm<0G-0@`80P0CpMS񟗢MMOO0PP8QdR1S |1S0 " ߍG0xX(⋒0L0 3/x1S 1S 0S~`@ѣ00`S $@FT00" F/&0 00 00/8/P P     > C"U0S1 `F` r됣0p⇞ 0S  `,pYV o$ <r4` ❷0`0"  "Cߍ@ 0  0S  r `pV Ԏ 0  1 PS0N  TŽ0   0S @0S@峎 ߍG <0040!00⥏@0Fo$ 0DL03/00 Gppqr0S !0⋏PD` 0S f bp8` V0(a xQ0W < 8 RFO \ 0@ /.@Q 0  f 0R0Wx 0B  m" ,m3ln5h_m>&gmDmRwmZ.h@-x @S ; @0p0Qdㅪ @qmd@-D @@000(0,0000<dp @qmmp@-XQ`0@sJM@!   0[1S:TXTpTUUU .Jߍp0 00@ @@0P(@0 (0 0(0000 0(/-P(+-4P,@,P0@00%C(u5670p@-QPM,0$0`s@|!   0($1 SIUVVV8VHVVVVV 1$ ƇPЍp 0 ,⽇,0S$0gP@0 0W0 000000 0坎0,P0,!^@HP@@P@8P @00%C(u+ O-P`00@-1EM S$XLX|XXXY YYtYYYYYY0 00 0# p1,1<\ 00?o200Eߍ040?o2400 008 0PX@0 ⦍0 00000 0,P,P\@P`@d0?o2d0_h@\Pl@p00 S0p0t0?o2t00 F+GIJKM0@-1@EM S=ZXZZ[0[D[d[\\,\P0 00 P0 "PP堍 0/S  3!0C@ 0/S0 0Eߍ01?o21!RX1NP,1@< 1?o211S 1?o2 1 1S 1SPIO0  0 00000 0Px+Pt+ 1S 1SpPJO 1S 1S_KO 1S 1S,PN 00P+!"#%O-,MbPp@X  㔲XZY ]]@]l]]^D^^_@Pp婋0 @Pe@ ,ЍPp囋1`SPe !R 1N0<!ሌ@p@d₋ 0PPpz1`SPe s01S  1Sh0I1P/S \(ⶊ0(0 00L0SvU ( 0S `PpG S  1!5:% 0p FP p Q 0, ($!p p $ 2P] 00 8a4Q101S/+,+t+`irGnDj\nhn0S@0@-S@00 0S/+x;0O-P̲EM 02@T PP0 2P |1S$ $P| 003/P `2P X ⣈@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 娏pPP2@0S- $P* 0 x0D 0 o@-08 S $0 0 0(Ѝ+x o>10@-2cA80!0CSM PU 1S {㺭P 01h1Pd1P X ↇ8 0 BR uuuuv,uv8vlЍ0 0  00 0 0 0  00 0 0 0  00 00 000t 00l000`00\0+++lo+=$ULg0C+X<ZlH\x+<Sx7 SB@+W?S,7@-P@ML d`PX<2P0S%  (P2 00 BP P< "0 4 P 0! ЍH0S10S-  PP'a000C R  R41"$0  000xpP0` 87/0P0 00 !`0΅] U00S-  rP'000AC, ^ ^ 0!P^ X^ ,0SP\ $0➅ ">S+;+o+,<0+tR++oA-$A0MT@ QP` 0p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T  @TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 +++++(+8\0p@-T00P PDPPp0AS@  1SAA+++`0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^ @^ T 0S"+Hp0\ Q0/\ P@ ^U Q0000@-+H0O-`GMM40X2@TL2V 00 0 0000000@@@@ 0hɀp@c<   G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K),0h 0 x0@W 47 `4A}ᮀ4 VL0 <0G, ,,L+`u +0@-PDM@S P08 @\ 0@  Dd  0 0DЍ00S+0@-@DMP. P0, P\ 0P  0T   R X  v0S0000000 0DЍ000S+p@-@Q`P@M<n@P   T0 0SP@Ѝp@譄0 @00 D0<U@Ѝp+17@-@SWX Ѝ0!|P4PP<<0P0<0P0<0P0<04PP<0 S, 0<0P<0 S@  0"W|080#Q|0,0$K|00000 @-@PD x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍp5 7!@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P 0 $<  <Uͺ v0$嫼P 0|! ぬ|Ѝ0+a@-80@SP`4Mc00 0eP 003/00$1U Ut  4ЍS0 000 0xp 7/( (0c XWpW0p@-PQ0M0@$ 0x`0 6/8 D`Px1px1a1S0C€10Ѝppp@-@P 0P  )Pp0S@}p P Pp0S 4! B! P  Pp0S hP R 0L  4Ppp;p0<0p@pPK1p^psO-uM Mp, Z-H0cS_ C傫0SSzB0S 㸁PBԒ0SzIJB0Sz2 P     P x2@    PP2 HD     P0x0001 @@K @P @ PHPP< ,wh@ ,D@,1K 01R010|100P P 0}p@  Pvz} 0S10$1S 10 0Suݍ Ѝ&PaHPkPj1S |!R IP %C(++++,+t+++(+8++X+x+<+9hM@9<++`@-@ᨪ00S @P+0p@-@PЍp$QU0 Y`P PP> C 0 1/P ,0 0L$H R>+80S @-0 G/$W ZH mpG-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  T P $Q$00S U 0 |1 08Ѝp`P P P Q Ꮽ  P ̭  ᓭP +A-M|P8 DU`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 p`XEH2 08 8/PD?0 !! `b7#Hp0  3/P"#"#00 03/p p0` L03/  x♭` 0SWp`?`B414!44F0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 0 `04dRP  v00`p 0Sv ſ 0 |1 0? Y$W ZV p+G-`RM@Xr LPP d P`T `TP P8  ,)tp 0S  `ߍ<08 0(0`0,0 000040!04 04$0D0(0P ayW[  tpU psp* d̿`n` 8  <5U 0gU $cU _U  [U 0,0UU0 QU  sp 4`?`a8SĺPb 0  00*0P0  0 *0 L@dAdec@dzK7{A-PMPp`;@ pp@P  P03PrU 02 " ݍ /O-T  0 Y Y 0 0<S, S 0Xpp ͱ @PS ( P#2Q<ЍR <00$Q*P$X( Q   T0pTp 0pW W0 0Q4<0p8 P 0,4 W\,Z7 SS  Z" 0 S 000 TpTp 0XpW W00 S 0 S\p\࠱ ؀0@-4MP!!0  P PP@4Ѝ000P/S 0/D0S D/0- 0S^ 0@0P00@0$^ (( P@  @ \/A-` \0@-M  "Pڔ{ $P p@tP{PzzЍ0A0S 0 (fqFl ]o/0O-@M M@P;B/$@-`P!$ ?np l00@QD0S.8 R( ([0( FP0D0 ܍ Ѝ y P P    0xP 4@cT4@0@T0@袟brT{0  j00#p6z@0T  00# p#0000D (`(00#?P X \004RP` d80<RP,z0( S 0`0#ȀPDpl]P `p#庀Pu@ph W #WX`孀Ph@4nP_ pp#fPV0'% D0S(0 D (=[0{S  0 ( 0 0{{@0 0#?@#000@T(0 0 0{c@dqqqArrrqrr7rTrj0@-M 0Jw 0@S|( uyPXwx0L @8x8 P 0  ?Ѝ ,s J ]p@-w0SЍ@-@M wT0  CR$00S ЍwA-pP@0ST 0S` @PtC `tp@-`P Q@@d`Q8M2"€ 0)r000% 0S 0L0 3/P 0  ** +"+s  S   "S2006 ְ8Ѝp+p@-@^P8Q @ 12"p282w@-00 S` 0!0Q "<0?020 2l0t0 2埚P 02020200A<ЍsJ at a(>p@-tP@0S0S 0DHSTPSD  p# @0p+<+08S^)/,, p@-@ 0(  P0R0PS 00Sfj NppC-@`PNMM< Ѐu0 ` P `PFk000 ;(@PD :`p^NލЍ^ q8dyG-xM` @pᜐ壠KP! |!0@P 0S PU 0 R<D1D!DD100S 00" !P@&P0 0S0L0H 3/P H L0RPP T 0$RP0 0   x@ 04/@xЍY Y ZL   YZ( ( j\t[ b tp(lkSO-`p@BMMP/0;@ ∥0P0p X@+4  j P* '^z BލЍ}iP (0  h 0  kj0/SX k0H, k!14"?s0So[ 1 SR 1S  RS1S1Sr`2pB@?↯0Q g0ZTm "0Si[@AjpPc P 0 8< 4V , ( $ 0 (,$E , ( $  QR@ Q  A R !Q Q Q  "r    0  峥6垥00 " "No@ U01U0190.UXRA-00MH`LPp t1t!tt0Pi@PP0ЍT000 S` 0!?020 20:02p04 pj 0PS"$ 0Q00 L03/P Q P0Q    R D0QR003/sJ b$t>+P/A-2u_Svwo10000B“TBpLҁ B D',pA- @P^U PP0 8^ @T hP ` ` `b` ` ppS` 2 q!aPaa Cj00`U08eRfP08}/ ^Q 0Sp`82S011111111108 p2aq40S0Sp  P P2S222*040UP 2SXtmO-bM M 00 QP $00/;pP`bލ Ѝ$ }]p y?`00@ 2,(00S 2S 1SP2P"PPW/0@?0 Ẁᾠ        @T!? 0 Up㣫ჄG (1hPgbV [q ( l (P T&RQ 0 0 pD  W p!p'q ?p? @p  W p!p'q??p0f@P#  0He   g?WU E ,(V  g(i?W U `@d$W b7tUs@-RU0 .@`d0T `Š#+ Q H Y`04 oЍpt bA tt@-@ T  ^@ @Pp` ^PPVPU Sx   D L"<0"8 0"4 0$< 0$8 0$400 0<<@0++dO-P@dM0p400 5Q 0 }Q Xg QP08B^  RW* 40'D0Q   R0RS 0}υ^ @^TX 0SQQY WpdЍb400@F@  0@TT0 @04@P SD 0`P P\ X 0`VBT`@00T04R21 SR8080<0 0Q80$02ơ 02< 02S01  (, ,(0 PH W2r`!R   R 2S SX 2Ƒ1 0 Y   ZW1Kt "QR 0S1!i-02#38P0WZ ceV,0$ S <02o(0 0804pPC @0 Ă2Z02HY PY g ᜁL0S 1P0S`10T08<  01Z o 0  RP   0SH0\ \2 P H+tu$W bSTt@ bclO-@|MHX0(S S|ЍS S7 |( [h8h(hh,D S0@ }(0$00,,QT@ R4   (R$  Q000S 0[SX770QP241(0$0(00) 0P00U00( 00 0$000 0 U00040 04 800,00 0, S0 08B4X6u?v? ( $R BT@200q? r?`h0 s?` 080S000T0S,0S0w < NepP< =X50C\0o_P0"H``V PV jft0( 8 @0o/O @0S U SQ0/  T0 000?01o?0R㴲<0$ 0 ,0S00AQ0P0T00S@ P0b P0c#0@SP0 0LH S  0/ D0/A/Z[d0Q @10`d! ἐ 09/0P@\Ѝ+G-` p0P@LHR0418 S ^ ?Y R  `0 X0?Qࠡ࠱000^ 0 G/+>0@-@0M 410810!]a0 P0u0L ba0 I0PU ! 5/8Ѝ0+\@- HW@ U@-}@ 0  b`rvh%Z@-<@0sU(00pp;c0Co%Ct,5-$M ?0 0 U$Ѝ0-4M 00 000fP4ЍO--pKMDTV " vVh4`p p!`V0 R`V$ 0R 0*`ğ $pS0S 0s 0SKߍ0S P (c30SP #)haP|#[ 07  {@0 (m@{{:?dSd( 0#eIa 3P 2R - BP   BRڛ 2図"B "( e"2*aP  0Ÿ R#3SPfS0\10(0eL"a PQ 0 0SZQ=9 =:pk{1@Q08ڜ@{P젾!5 Q; %#3\P/  d! !(0eP!`$1@Q0& d( [P Q * 4"%+0!V5 `@0S(0d `@0 0(ppS@YA.,5,4,5(,5H+,4g,4~,5Qr b~~~~~Fl,5,5~@~:~h 0 Q 0@ }@k{H{7{j`0V᠖0P  U`P{@<ᒖ(0`<p{e0 @`@  :`@-@v@SRG-@  700pP ąP:<`X:00X 0 `P@-P@`pP0S -S :S S  000`  0 i0P0 ЍU0S T  .BP%ap@-@P[Sp  `OS@gSUC700@pp@-P 4`DSp@  SPPS@p@-M@ Tp$ ЍG-`p@T2 P  ᔽP0IPE ዽPP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M up 3ݍ ЍDp@-P R`@0 @ S 00S g UP3PE Ѝpp@-P@@TpPppA-@Pp p` j F0W0 |0WxX Uh0X`0 P  0h0H ^ЍU0 P 0 r|gwww@-`0tM0F?oP2p @pS SpkRS@Rp h2SiSp L0V#4 - tЍSh"Rpp@-@0   <P  0 !   HQp`0 S \09S 0Ѝp0 S   000 00P0 PS @ d0 w pDL  Ѝp@ px c cx4x>p@-@$`P\Pp0 @ `P0 002 0pp@-SP@`xM  Xj0 0Qp@)  Qp'  Qp! Pp  Pp  P  L0  p,4xЍp P cxx>0 0 s@->@P`Mp @ p0 p`` P0:p @ 40 pЍp d x>p@-@PqP  P01pP`qpJ P0#1pp@-pM0 p @ oPpnP@pЍG-QMD700ۍ   Y 1 @`V P@pP`@-`R"00 Ѝ@PTp \@P  Q*@ 0S0S0 S   0 0S0 S*\P ` ]]0ST   00000`0 @@P0   @-@%@ dG-`P0H0$:@0 D  10 D&00 0 sH00"4S4 0>0S0&0 Pp0P W  g>080P040L1p@-S@T1S#d1S.RU9lRUppbV:l@]lbp1C;]L10CL1L1PS3]0P11C-]T10CT1T1XS%]0X11C]d10Cd1d1hS]0h12,P0C2bV ]bp2,P0Cp27@-@0 PP! H10 D18-0@@ CB Ѝ0@ Ѝ0Q@-@  M  bNP p 00`5 Ѝ@ Q @ 00 pЍ@ Ѝx d/"x>Q@-@    NP p 00 Ѝ@w 1S70|\'ZP| 01@ 40pЍ@ Ѝx d@%tx>@-t0M0@Q0$*p Ѝ  dQxR0<1/@-@de'P0S { P 0800L0S S@ L'x~xt?@-p!@RM Qt0 pr Ѝp1Sx0@-800@@@@ P@-@p t10cSt14y Ѝ@ @d 0 Ѝx%Q7@-@  ,,b _ B Np M P4N Ѝ0@ P 11P,|1@ R  |&=AQP |`00CS`0 X[@ T0 p 0< Ѝ0@ X0 X Ѝ0x dc%Z@%Y"x>p@-PDMp44p@ @Np p@MJYxp@-P@ ` 08 l, >U\& 0 0 008 , <1pp@> x(Yxp@-`81P:81x1S0p0@Tp 0S    0@-@T 0S  @@- @T08 0 0 R>  **"X 5 0S .@0 S   000x1  @  0SP P0 0 S   0{#{: eL{C{Y0C-MM000@"0Jp)00/P؁+ HP`pQ v07S 0 S W h0 0\!`1  `Px1 (ލЍ PpP  R쀟쐟PU hVxx x 0 S   x0 npP 0 Px1p  P  0S 0 p0 P ec{m{|{21Q@-@  llE+pM07S@YF0 S B0VS>0S@x ewA-`R@p@M PP U'70l0h @ЍAm"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *↞P 0S( <0 *D  <0: | 0S 0d  r 0S>0 P 0SV>P  *@ЍAŹ eK|| {O-p@`,$MPP   P 00A  $ЍOPy ߿P000 pp X SP     0pG 0pG0 ZppIBU3#pp pp ][p#3s <11<100x1Z* 4GPx1C <11<1kP NP  6Pp4PpUPpP xP nP p 0S 00 [P  YY p 000 0SZ<11<1$Ѝ 9P  YY p 00`` 00T0 :0G [W 0 \00x1 Z R& ` @P `[` @H0` 00 0 W W W 0S 0`0 7 0S [ x6xy0P 0S C[{N0 xr|=|G|N|^|n|w%S f|(Yp@-@>Pp 2R0P0t4(0000> *N> 0Cpǒp@-p1PSM"`! *%@P T 0p1!V  T 30S X\{QP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   0 @ FSP 0  @  B.(0$p ,*l1S .g eHk 0 R/ 1/,5D/A-@P 1 !  5SXpR0 qP 0`0S000S \ \QP0 S   00S000@00P10 paU0 eG0P@-p0p ppq h00P R]0 U   f p@-T`P\@0^0S\*\@\0 0SZ0 5Qk9 <R0p@-`pM@P_F (0l``FSЍ R*p 0  B\  L *R B  ;G-PP $L1L!LLoY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@6P@P0S 0S0 @@ f-;>@-^000 Ѝ ^   ;@-0 Ѝ@-@P`pἼ, 0B0 0p"#k ЍbMB@p@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@  f0P)@-0 0PT0/ fGP@-0 0T0/ fR//P@-$0$ $$#08D0 f^@-,MP` ⳾1U0@0$00 n0p@000 0<0S Cp,Ѝ8010C>Sھ00@( ( 03(00@000 0<0S80 p @Fx frY@-XRP@P DpQ@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0SQPU `0 P  S   p0 C00C0H:Q0HPLPU0 P(P0P0V00 S   0"Q0 S ,  0Q0 S 4  0Q@-@@QC-@PM pbȂT0SY 00C01@0S D3/2"(PU0S Pg0S R=0 S ,  003/00400P4P+1 P0V0U0SH. L0 S* mP& HLH R 0|S0   0    @@U 0 H0O0SPp0S| `Ѝ\r P RUj Yg T0d0S 0S   PE  \P 03/,5D f@-8 0,c(@ p@ t@Ѝ%ZA-`M4PspM C0 Np@ /B@ۍЍ4F P ڣ# "P  RP@@#C 0 ,$@4   CR%C|%Z-@-   Ѝ Ѝ/@-MMP`@p0  {N R 0pۍЍK-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/%C| 0p/Q%C|p@-MM p Ap P@;00 dSV 00@ۍЍp P0 4Od%C|g0/%C|@-$@@~Q4 @xQ%C|p@-dP@J; P剛4 P P  si cQT EV00pp%C|%ZXQ@-@P^:?*@O@-q@ FA01p @A01@!Bp@-PM@` Ļ  x0 TBp 1@ R! 0 p`Ѝpii$0 /L0s P/0  //A->PXMUջV0P0XЍU̻700p@ `Rc0 PU B0>000 <0  ,> Y!PP> *➲W@-@T}>@Q/@-@T>@0P/ R R /0G-`P Mt0(0S @ ױP P бP:*`P 0 01 0   g08S0 J00 Ѝ080 ଱00S # p`P `P@0P 0iS.S  `P004S 040:S%a0@-@PDM QP@T 00p@DЍ0U  1P @0S@-`Pp@MTЍ 0S P 0S Q 0  p=@P @-龺000Q/Px1P/$0/@-@M  X  0 ApЍi~O-YM `F/@H@9X0KpP pYߍ0pJM 0S 0S PP@ Y ⠷P @T0SL0男P 0@S0@S@@T1S X1 PAT1S@\1S`1 P5\1 S S R@L1SP1 ԉP&L1PC_oSRPU@F P0HS 0s0DP8AN@$@P00SLQU KPP6dh1 ┉P Pd1UP \@ ` 8 0[$0C  H/ `0 S 9X001H \05@p X0 nB000S0 35S S  CR0TX X@S y r R 02 > 0*~<1 T48#88 S R p S 0 S T X @@>@0?H0vp 0P0H0}>H0 @J000L0PPP f}iA-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ S @X?@-@Op !p !p`>Ȁ %0R* -  r % A  !  + "*   )  Q%£ £   + "*   )  Q%£ £ /A-`P{e@P─@Ѝ P\[KYKP0 qoP YepP > fA-PR`@ M 0S0T00 Ѝ/(pP P'0 0 0 0  Y0S TT 7PP/00T 7 #O-P@~0"S0Z"SJP Y ppP w 70p0 ЍT WsYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8jkkkkkkkkkkT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: 1+ U*`XJ:0\S 0}   0P0N[ SP0Sl  +PTPp@]p%aP /0 S S /S/P0/S 0 S S/0/O-Pc@P ЍOT=Ф`P hhW ЍOIV U qWIc@P  qP 1 A Ѝ=ᥤ0@S- P'[ c`PI ``HP 0 0 ৭ 0 0 f4p@-@P tI` 0SPmI$` PP(0S $eI0(0$0p,e P,e PO-4M10C`p@XPSTh{X{p{|||}h}|}}}~~r~,r~rrr4$rrssrrstDtttuHruvrvw(wxLxzTrz{(qXr,DPdrtx@@P|dvTw $8pH\xxpHU- `Pp $tP@ iP7 7  '$ !P`0@T\0S @U0 @9 0H050U/ H0?0P H0 @PA t014ЍFP 0 pp 0S 8βP`H01@U  ChUH070 0 JpP! .R 0R77@0U p 0/pPT H RU H0@1S$b@H000{U uP0H0q ,0 00 0 L,0S _ vzU ,0 01 0 %,0 S< I Uz 81C80w40b儒000 0 PPP00 0 P  p@0  @P  UL 8180w40b儒0p00 0 PP00 0 P  0@H0:0H ;P0<0UH& 0S# /gPp؀  #P00<0/U`P 00 /0P0 000H060U ,0 00 0 K,0HS  <h 0A  a,pd  P 4p@AK0  U , U ,P 0S U 0 p H0 50a h050,0 % 00 0 #,00,pYP 7$ UcPPeU700 5$)0 5(@pp 0 '  0 p P H0@40U 0S 4S 04S0:006S 06S090PU- ,0 00 0 7K,0HS 7U H0P SPH0;00H090U ` dh`,OpP߮ C`P 0$'D C]EFH0Q7;0UlQ 塰P0l1 嚰P0l1 哰P0l1 P p@E0P p1tH000zU10H 2tpP0H 2l hP 0H 2d `P [PH V H000PH020KU  0pPl[ H0 S;708H0203H060.H0;0)H080$UV 818b0w4儒00 0 P000 0 P0P0P@U2 818∂04gr000 0 P00 0 PP00 0 Pp@0  @U =TP bp ᲯPWH0p000 SP0<00 ᗯP WH p P  ᇯPWHp   zP  tP  xnP  dhP=WH!  BhP T  ($p 00r ,p 00opPf $ ( H,8  P: B5 \$PWH B$ $op; @pP7 ((o (l H$8h  P  BJ%Cx fJY| R7)L VfeJOQ  -TMC@\v6FloPA%)9L@i,%1f>G(; fH  3M (傮P  <|PW ,0 00 D0 H,0HSr  `P /o"Bb ($Py/P0H (0Pi 7$ ! (0'0D ($P[/ƞP0H  (0}PK 7$ ! (0 '0&UX H0 X UP|eX0 3&70 0 + 0+0 0P7}0P7 A0 000 0@:0030 0 5 Kp n1 ;(0 0 0 |00 + ঢ0 P#Z 1H0E,=P0047s(8⎢P,:t؍<Ѝ80ܔ$080,CP(/p,078247024<7囗 SJp,8>@D7囗 SD@>0H'87l"L'<7@7D7p"H7L7808 p,20!+ ((P ((pW 400000(0 00L"@(0S 0 S S0P\S @p p8000SS 438 P,,00  CP 0}?o20804P0P$0pD((P h((0S0' & 忨 PP(PK Z&d hPP9@?0˦0@(0S 0 S S0P\S 00@0:0P0 {pPpP80,C'P(0)S YL 4:00(hQdqXPpdq P DiP0S (P _ [P 0S (P QpPPz 0)R00S BP W400000(0 0  0y0S D4* D000X m np,5`@ m o/0KS0Q//Q *///G-p0@0P `3P Y 0 0 `R:S@C@3@D"X HGXU( HG蘡A-TpW0 T`@V0 L0LS @sP X X| |00 S HH0P 0RS 9 mM{p@-P @Pp"=@-p@-@Pp P᪞PpT0 p@1@-0@'T 0@0T0S@-0 \ R n-MA-@QX2X"XXNT0p  Q0<1800` ᠝PPW )pb0S^ U @@&P "P @T T0Rt0t 0SP t0+ t0( 88P) W(( tt0 . pz0S po0S@2hPT0$0x x0R lD@ t0 pF0S (e n:;MyqA-`P Pc_ԝ@T ͝T0pS@p@-Q Mz0 T0S0 PU|0h xPc_`ۜ@P Ý0 @ v9  Ѝpf nAMRG-Pp0M 崜ⱜ ⮜  P @<1A0 <1(P  0Ѝ |B ]@T{   VT0 R0 0800+ P T8vp0SS90SSjPT0c b`P| 7 |0   P @T T0R88tPY0Sx x0R , '⍜T W00XXSP  "P T T0R88BP\p20VS t{c_ Ϝ@TG ǜ0`SS-90SS)ޜPT00S8 00 H:* R S  l p 0S 0S =@ⲜT 00,, @P nL m n\ neQA-PP@pQ_` v 0t0cR0a100FS  A!/bP@-;000 0 0S /00 n!P@-Q000 0 0S /00 n!P@-}H0H H0S Soq/00 n!P@-D0D D0S SpU/00 n!P@-H0H H0S S,0@o:/00 n! bp@-@Q0 RP_0 0`S0 SQ 0` 7p@p0 p@WW0 p@y L n{!XD0P@-x0x xxlQih0X  P R !P BR #@a@` n!lp@-@P M0 C0S R 0b0?oScP 05R 0P0 Ѝp该/0Pd`Q Z0000P 0  n!,5hx'A-0S00@Pd` pW z/0000Pp 0 ,5h nn!P@-808 88Qv(0 0000 n!p@-@PQp(7 oC-`TM@ P `ap) 0 a ````a1pWp0`V& a @ 0 *@ {aT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0 e e e e-3@- P Jp@Ѝ0@ Ѝ/@pA-@RP0p`@0S pA-0Pp`@S:0SS 0  RS* R0 `V1S* P a 0@DpR: Q  o0O-ATP` M zyA@PAD@0<1 Z  wp 00啡PȀ 叡P 务P 兡P 倡P {P vP qpPpZ l Dp \61@ R H:p 0<1#?Q0800 00 & &(p L0S% S% p H p P p $  p ? pw P0S t0$0Q0p P pe x0SA0 p@ hPH 00 \d\$kɕP|$| p* .*d p-"p]@x p 0S P Q [ T  5p  #5p圠PO 嗠PJ 咠PE 占P@ 删P 僠P9 X00S 2"Q`` Mp  Gp %P %P0 x1`$@ 2p X00S!XppW" a a!4p%P `V%R  p0S0S"0h 1SPq29p@0&j   epb 0!`pZp  < SpP 08!pGpPA 1 RZ  P4 ЍZ p pk oXNIx~?xtyX{:x` omy*$Wz nL :BghjE(p@-P@pp p@=RRA-P`@@pL0s  S  U@ p@@@dW0S R H R U pxtX?Q p@-P0U@Sd` %00p QP@w@T:kp//%Z@@-P`1pSMAT  p@lEЍ T$PЍ@!R 0$ 0 0 p@ #@aV 0 !p@`P p0S lt00#40  LLD SP 6 0 ( oa49 orKpr o}Nep@-PP 0S @0`0S @@p|00p SU   \@ .S0.Sd0_S-S.00  @RP"0T0 0D0p%a @- @0P P2T00Q  lDP `00CS`0p S00 P0S X0X /X3%Yp@-h1@SP,NPPE @p ^0.SSPP X(P H#P 4P 0  .ᡎPP`lp@-@P'Uc 0 20 t20 d20  T20H/@,8)0& (#@        c20  ^20  Y20 T20 O2 Np@t IPe@$+0(8=FoO%Z@ 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pPtWp000 1QލЍA. !. d0h 1p`0SPE@Ep 0S:0@0D|G!Z`O--,Md`pP. L}`  @P2 0S   P@ fP@,P$ X^P$0X22뽟00,Ѝ P,P, R P,PE0S h R* 0t2띟0 7$ R, R ʜP  7$ R R ,Ph!@P !!! >ov P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  P70 ܕ.0 I@0 0IU:D XӞ0 0 `TT  DSPO-`@P0p 00900W*0S T [700 Ѝ!0 *00@KP  00T [ 00 P     @ \Jo"p  & Z/Z#^T [\*00 0000K@PG\ZT [T [ KP|%a oC-QM MP<p`8p; @H<pE <0p V=Yp ;4 x0pTG    0 Ep P; EcP E/    Qލ Ѝ   P20ٝV0042 0@E p  @pP0P@T*p0S4 p`@tT*T 0 h 0p @ p 0 /pv @    @  F /p^ @  .0E/PS E//pM 0S @00S@%</p=M009gM  _A- PpU@M 夓ЍR` R -00P0S 0 -0 0t0#0Q0 XV 0 00 0.P0S 0 zO-4MX@p 0S\`d` (0S:0 `p20"4ЍO7 0  ,   pp0,0 ,0SPC<! ,4p 0!00,/4ЍP V0 000!0   0,pmp000H!\ `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  0<,P op@-P@`P 0S P$`(0Sp,e P,e P  0u"0@-MMP+ p P0@ۍЍ0;0 Cw@P |,P o@- PΠ R00\L  ^@-Qכ00P`PV0 V=`V xЍp@@T   Ẓ0x@ `DPЍp`Vx1@P 0>0S *-wP PU@oP P~P`ꎛ/0P@-000 00Q$0  @w( y84c@-` ,Mn00<0@SP  '0x Bfp  0pt0 0 01 0 0S0S|0@0|0 0  X40Qx0 xmPT ,Ѝ0 8 0@0S 0xPTR=A-`@VPPFP|P2Xpx`E,P x倂|"x20 V0  |20|2@-`@MpP! ㌚ (√ (<X( 8pM!PU@ Tš700@Ѝ ⴑi///0@-$!M@ 0  #+PPЍ0 3"Qp 000)00 p0000@ 0 plp 00 " 0 p< hp  yBo}p@-QUp@p v)-0x1p@$-p@->`FMV H0P0Fߍp@PF/ 9  0壐t01 0 `)0 HF? P 0> *0 F?  ii@-@MP4@ $HP P@Ѝ yTQ@-<0< <<q0SSP`/// yt4$0 /Lp/@-Q @ p000t0@0Q00@-P@,M(  {  / PA p 0 00S p,Ѝ0(i8p@-@MP W ` R   (P PЍpi:C-PQSM M3#T0S3"`V2"@p@"%0B01801T0t0 H00C@L0@T3H @0H0L00L0 P T0X00L00L0PL0 0L0TH00H0XH0 < 0| H0 x ;H0R `0t 0`00p0H0 L00$L0T@՘120@ 2T@@D@@0@L0 X9   @L0  XH@L0   @L0  XP UPPEPP@ D$r p`Sލ Ѝ A ŏXH@f y4R C-`p"0M` 0$`  0,pP @Ts+Ѝ`*PPA   0,p0 S Z+@ ``T*x0V*y00K+T00V:0 (P|P@ (W ውY 0@P y@-@P`DM p@    ᭎ T0 U134  R2$ (@0 DЍU@ii@-|@QM  ϗ00p |2 0"x2CЍp@-]MP# p PP -R 000S0S S SS wR0S HfpٗVPS CQRS@ 0`  x@P -$0 Bp 0S$ He HhH +p 5 $ L 80St S S00,0S  R000@0S  R00@ H @ 04 H150H \0p[p0S l01S hh0Sc0 0 000 0 0`BTRY>S SM  ]ލpRIx{@P= @9 3P0 0- H)P[%0S" HM P N000Si@i y@-40 000 0R+Ѝ y2S/2S00/@-@@V002@-S0@0 @@ܖV0002S Yr/ yG-PM`p (PwP^(@P0 0TT`0p<00 .( pP0S p p PU0S p a)@! (( p | Pp 7/PP p &P Ѝ@@BqBlBp@BfO-@p`0M00P U R0S9P 0 0 P  R P崡 R V 1!N P    P0 PPP0PU:000y Ѝ@-   ЍBgp@-0M2S`P@x (VP@0 \(`ە00ލp@  yB-$M^ * ! $Ѝ@-@ {(@x(@-@pp p` B~R0-0 P 4s# R0p0p@-A^ Tm00p``0@D^]"000œ\p@Tp0,QRO-M@@0B0`1Q :V00ЍP0p Q :8Q@SH 딂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C &P 0 B0  0 S2Xڔ00cSc@-@ 000P 0S00 Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S00 Ѝ@-@\0S \0\0@-@`q0`0`0@-@08$@0p@-800@P >0S0&0T0 gT0x1 RpR 0S TT0Q  0800 >0S  p@9p@-`PK@%Pp00,000SA/00/0KpcScO-@GM`ḠȐ{p0 mGߍ0RS*R? b8  00K C%PP0 d R FQV (P Q PPh   "  > BQ00 *׊0 2& t QqR) o T  K$$ A\  D^V Vd^ h  \ 0(/$  H\@ ȟ`$\ D\V R < R @HT6    < @ V60HS 800007 S0@0(1S p0 H0S=00(  _(100@R0 F Q&%0 p Fr 7rpVd %Rp#  HR+  %A C000V % @= W`V H %R3Vp p  0 RN  HRp3   000HSf 7000  0@"0,2 S380', 4QnKp     HRB2   W @(1SlVp 000DKP*0W(1S\(, 03s0  PV:0BST   0,00)R\ Q:(,q  P V:@QT ,   D B W   HR9    @ B D $R Y  HRM  $A 0\0 40@(1SWHVwW08 2Sn F( 2S P0Hw 00PQ0 0 2 0000 00@V5 VpWG h 6SC 0HSs^00 &A  60@3W08 2S'V00<1 0 Z00 HRP P0@W 00  ^00HS?t000@0D0D0 HS4<0 0 " ψ 2V0@ W}VzS Q0000 00@ 0 0P0"9 0HQ 0  ᥈ @}0, v$Q_cSc257@-P\ R&@P\0S x0x08  Ѝ0PP @ 40p 0%G ztK?x>@-PR1!`0@ 0p\ 0C R1 0R00  06 30 0 0P0 0:0 00P00;0 00uP0060 00XP00 ЍP 0000000 00=p0 001p0 00 zC-P@UM"P, 0P`00P 01iH00P0 0븀x0`  (#0(10: cV `7!P (8@  ' 0ta&!P( ``(1 (1  0(t!p⒇0 +"70 (P 0 >``v` P( `"(1* (> >Qߍ 0*  x~ z0@-p0i0 MSP`$M i1!ppQp@G0S i p ۍ$Ѝi@ M0 Pp <1Q50 00FpP P(b  -%Y$KD zZ@- 0080PP `V@Ѝp0S t @P  00O-IM Pp$PHLL `PR 9R @P0IߍO"0,0"600 0400` 0 p00,0 PS2 V30a2@0 0 ,0T8`0 rP 8o<@PIߍO@80 Px ZVT` 0X`0T80 4`G8Pr zv@wO-@pP`QP,b尠,`2S$P㘀U`,@ ,%!nP!, Q 0S ,9 ! YP,`0 zRO-00!`p@PT:Vp T  X ⢱00U *"0 Ap Ѝ0R0   @280 U!p (8  L!p`@-RM Mю00@P0BP Pp` 00 pۍ Ѝ` p p @7 !p 0FSg@- 81SsQ S0 00 05PЍ 0SDPD3O-04MS@ h@@ ԁ`P_0 o0 00 00P # 00 y00P|# R @ ^E00T0 @P0g 00 0`P^ 0 $ ( XXVpP 0$,0(,8/P@ Z!\* "0 0pP 0[ $0*(00 0, $0(,8P@0 Rh0` 0h0  0304Ѝ$ Ʉ Z0 j"( !0,  t  00 !0lPu @ q Zp0$00S,0 DpP@,0$ S S S0,00(0R41S 2S00s(00t0$(,8P@00rO-P0M040@p0` `2''pp'ppW9 pW6l0S~,0Sp,0儂0噇 2Sp,0800噇 847Sp,0l0噇 p"R000, 20wS4~47S a6 0P /pߍ00 `2(Dp (r  0 p 00 `2,2p( 86 0 py (,6 0 p, 6 0\ p'0}0,404l0 40po'0n@0!04,0 40p`mp`jpggpn,0 !P ,: 0,00lS  R0 `">pP 000100,0H0 p 0 oY00, }R0S&P 0I p p  00V,0 !P !0 `"P 00 0H0p0  09,p )A@Pp@-PUp@0L0pp@- P# M p 0` 0 ` 0@Qp7@ Ѝp ` 0Cp )X` 0;p  ೋ00D0 U100'p@-p@`PK<1.(080000&0S  0R  @dp`H Ѝ@+@ ,0p Ѝ@ Ѝ zB8x>O-`@p 0帀SP$H` {000 0 0 `00`0! Р20 `  $4 00003H0<1v Hn ЍO:<0 $4 000x3@0Sl3H000s$80404 DS ,00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!x4 00B*S:kG{{'{*zda8 S zkg{{'{* z0S$U4 005H0S0ST h Q 0R<0S 0S11H000s8040 P14 `P18 ZPp10 T#\0@ 0R0i ,0.0 0p  0h` % P0 20S00H A P 0dh0 ЍO Ѝ??bIo.&'L2xA-@PT` R0A h0`  | R 0i0=eP 0S <0S $3  u .p0  p pp 0 00 0ppH0  00 0$0 F3% FAd0h0 O-0R\M@`pP 0$P X0 #3P 0 RT0l 00 p` hPP. aL0S0 0@S@0#/L0}\?H00P X0 "2P 0 Rzgjzzz{T0d0S  $U P $[ <X x$ 8"0 0"  ! ,  0  <  @ , D  <H  $P(P Q48`LPPPTPpX pQ  PPH  q0 0h1v`00s0 10 E000\@0` 0`P10 0\ 0`"v F04S"1S0<10  \ЍOp {  0S @\Ѝ7S Dz z4CDCev %t@-`@pP`0 h0X $7S R @`0k0  `, 02 0 Ѝ@4   Up@-P@ $ 0 00L0p@ &p@-PUp00CSp@0@ J$1  (00-0L0p@& '0 00$0C40 040800 080ꌑ0 S0&@TS 0SP 0p0x0Ѐ60L  NP$ ЍCe`0@l0 $w/  X=0S 0S 0 S&$g/  H0 <`0  @ R h0P ЍC 40PЍ {,BHx>/cSc=yZZv,h20p@-800@P  D$h00h00L0p@ 0[iyS\/ R/ (>0/ Dd0S 0Q/ySO-0M0000PSp0T @R` 0 ЍO> R*aP 0S 07S Ǜ ǛY  S.  !  Q 0 S:500 0p00 0 ( ЍOr Y 0 0Cs0`o0S0 S0L0  p    0P 0 0 X0SY0A060@ 600 0Np0 0  `P  >0 S 0<1vi@x6P `P0S0 0<S<0P0Ѝ 0    0P 06SY700S00YV0S9 0Ul00 0P0 RS0KSK?3050X% 0 Y ,iu0 #4 @0S0  l P   BZ0S Y Y 0  Br.  Br*0 8- $P0 0 0 RY * 0  3@ $ 0P 0  S 0S0@00Y$00D0<0<0<1(?00; P0 P4 000а 00 0 0P00 S*lP *   pz @ 0vЍO!600 0<P0 0S * AP   pz`<1 000H 0 000 `0`0a\0S   0L!*YP 0 8 R @ 1ЍO8Y Y) Rr   0 P0Pd0 Yk 0 6, t ЍOH,<NZrea%uyS {8I%t&h$A-h0PR@y, 0 DA0BS`pbp ׂ0 Ag$pO-`Pp 0x1吠@ T ЍT 0S R T0 S> R *^P 0 9@O-,M@PpP Q0 ,ЍO2PE gUM0@SI 0SF UC:aV?0U<:0 "R3 U0:!DR-   Pp%  R P  0  Q!   p  P +  0,Ѝ J 0  B@ {H@-` MQP\@M  0p000 p 0S TH  ۍЍ 0a`V \@Tx {T$KA- p`@PpAPU{+ 0 HA0S 0A \0S 0A {aA-0 ;M0M`pp@P @ p00<000C$00(00$0C,00@pV004p8  XXPU0`$0 0p 8ݍ0Ѝ {nx  p@-@PT  (@x1S0pSq H02p 02022p R Rp07@-PX0B @P 0S*0>0P 7P7;020C0s0S0270 00,3 Ѝ0@/}T zgjzzP;R, z@ 0 Ѝ0Dz!,p@-@P0( Uph0Spp@`,O-P`@T Q Pd0S  0 t_0`d0P0BQ 0S 0P `*  +0800 |# 0帀8!=0 80 $ 0R0hd`h08 R0 , 00C0 x40800<0  P`00 0 00S $0 pWp1s00 2   0P C @R 00pwpWL0H0Ht0pEySf0P s/0 @Rp@-00p0`PQPE@ `) @d@$,b pP/1S P///P/P/Q 0\R/ 0\/P/ P/00S/x1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ oSQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScG-`x1@PMT. 0S pW$ P yt EuPP@0Sh0S d0S4$_td0 0S PPPЍ|0d 0|0 00d0 00090~  uP] u PU9$0 00 PP 00d8dXO tPP t|0d 0|0XxUtU" 8P|P v |  tPp|0S rP 8 m P  JU` P < 0$Q S "  Q  ztPp h  5< 0   h[pP; t0<0t0Q0 0L0 80GdxQY X= FtP dt  U 5tpP StȐY $0% h  5< 0 A  $0<0| nL {{*>p@-PP1! np`P~01S L~0S H~0S D~0S  0 @T 0Q0 PSP 0U d0S0h0d0p@ {bKp@-@T PP@0Rp {G-Pp`PE@Ѝ0E @P00 4b@P 0P000000 000'>0  L$00 pPP '0 jp}0S p0 CP  0@R 0 0000@@ {I}@-@0T PQ8 :* SP h0S dP Hd` Ѝ$`  Pdp (0Q,0Q  l `P 800000( ,0@P?}0S  0h dW $0Q 0h0d`B0SH*ϼ0S/0S/   O-MH08PR 0` xP}00ЍpP P|0 X@ XP R R R0 00Cs @ЍOP 0S3Y0000000Cs ЍOt46 @PЍO p    @@0 0% 0  S {0S/G-P@M T 0p `x00 0@0 0 @_@ЍP/@-@TP@80S   01p@-@PPP (000pw PE| 00p0000 S0 @00:S 0S @\S000@:S @,5p%a0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/%G 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO4E`VK `0P0E@ 1 PP{ 00pCލ Ѝ@@>;04pW p40(0= zP  0 `R0 :R`00Fd4@0  0(880P4 PF0 {0S G p PP ;000P6p 0S#0 0 0qp8`@[ +  O0P R 0b0SJ ={@9{@ @0P 0S00 `0 SWG p@DW :Sp:SY @\Sp S Spp p00T:C P@D 0SJ G0P0@ 0 Y@S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 P0@DJ`F  0S y z 00,  @ ` P D,0=_  9_,0@PE_ P0S $ D0A00T*q PPJ 0P,5p%GT@-0  0 Ѝ@-(@ P m80 0,5p0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ r0Pv Ps @ 88 Q0 P ލЍ r0P P 0@P80 PP U L P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  ,5p%a@p@-@PDp@NA-`= @P@ d PPd fy 00@^S0S:S_ p0 R0S@Ad{ PJU \Sp0S:SH 0C^ 0@0LT1 0L\s0TSpASBC\ ddcddcccccccdcccdcd0bC|^ 0 0 00:0 0Pd @0:SS0AR0@A  P A-p= `P@ d PPd0`Fy 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P #; P,5GG-Q0S `pʯ tPV00Ѝ  afP00CS06 Pp0  tW00S(@ uP  f , bP P00SW  X  R00S 047σ,P R   S@T PR   R ,5M,8,5@0@-0S yP `P,5,<@-@WP08G,5p@-P@PPp6Pp,5@-@AP M 0@87ST ,5,0t@lTllH0SpW W DeP P 00PpXA C9R񟗈|}@}@}@}@}@}@|$}@|8|`}@}@}@}@||}@|}@|}}@}$}@}8}@}@}@}@}@}@|}@}@}@}@}@}@|}@|,|@}@}@}@}@|t|}@|}@|}}@}}@},0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0A  0  ;/Qs$0`S 30 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 0 00g`| gj,`PPDAލ Ѝ, !ir4P 0H0,A%GO$ud6 {,Ap,A0H0S/,A0Pi /,AA-HAP|0`S@M*0S'0S S f0P 0P@ @Ѝ pW*P 0 000g0ppVr@ m~`0pwX0 T7/0S A0SP 0 P0@ЍAmg,A,A%GFlG-\qPL @0P12C001b5R 0 0&0S  Dh0S*0s0PE`1``d0 R1 *! q ` `  !`` 0Rg00#g0S0PS g&0S,P N,@GH,A-!\  0L0#0,A@-p0M  L0@31 ^AP 0C! 0Ѝlf,A @-L 0 0@11D ^Q       ,AA-@b@0Mu L0 @2# p PW%cP_  Bc p\  Zq$0 HD@,X#10000 2R01   0 0S0" V00 S g ЍA X 1(4/00~X0威0 mSV Q`ЍQ0S FfЍA@f`\c  Zp le@lf%0S Z pb0@0,A {C-Q`0MS 00S` R@P: 0s%@Ѝ wfpᄐW   @nf f0p0|0S0S +@Ppp00FV@@P 00T p@ep\`W 0S:S* 5f Tf0p0pp,A,AO-`HqL1P0SU#,@T,P@P5 &0B1 `P 1eh L0C R P!050%Pd @T: f ve0 p[L0CY1T*Q@@,AG-QT0Si:\0`S& 2 c@Oop @d(0d$00@X1 0S. S0 P B H %Q * RA  o0<408@S1:X 0p@D7C 0p03 c0?o< @@D@  eP  eOP ` @!~o0 a`2!! !00p30P,A%GA-p0@@ `P PP0`0P P@ld%Q *0S  Co,A$00S:@-@@X,A@-PP` U(0SP@P )@T \0@T0T 4/_do 00'0S 0 (( @Ѝp,A%GrZ6O-$M@PpD00T0SdS )@TPY P3@`H3H 4/-Y(0S p0dpY`WT0W$@p pp0Yk0 # 30f*[`C`fQl: L@P7W KL ) D2 10Z 0F30 %0S6*0S  n0@P1'0S 0 0@$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@0 f`[x [`K``fpP @P0p0 KF K0`F@  L @c%Q *0S  @,A%Gr6,Ap@-M@pP,aD(0SWTP )@T: 0@p0 4/=0#880 jP0U: @P  m'0S 0 |( @QЍm@P %Q|0S0S Pn 00,A%Gr6O-@QpL$M(0S@ P x`(W .0PT\\0T**P* 0`0  `?oo 0c `S, `P T 1q*dM'0S l p@`$Ѝ4 T$P030#P0S X 200301S%T#2QZ E*0T00S  DQm`P 00P`P0 0#  0|0S0S @ @pXb,Ac`0<0 0 p`  b`P% 0   b%T#2QZ J*0T00S  DlVvDm 00FP )0S 00@`,0, 4/-`P,A6%G,Apr"@-L0@'0S 0 00 0HT Ѝ@Ѝ,A6J////%G/%G0p00/%a0p00/%a0p00 /%a0p00/%a0p00/%a0p00/%a0p00/%a0p00 /%a0p00 /%a0p00@/%a0p00/%a0p00 /%aQ P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/%^ p0 0CSp0 S PE0 /p@-P@,`iPp@ Tp }l0A S010// }l0P/!R/P/P/Qa/P/0p000 /%aP/ 0S S//@-@!b0p00/%a0p00/%a7@-@PD@P 40R0PPk0 M Ѝ0r_u%ZPQ 0S///%G 03P/9r0 ACP 0ABs0P r CoSPS//O-MX@ @ЍOSQ`p rT} 04S`\xP0@`,S@T~L_Uᚔ!` vb@T`0`PErCT 04SX:`\V0㨱0 kT  Q \ ( Q  afP@PZ P  ?bT0`0S0?oT20S@W-Ѝ @&0R @T`0-@!k@`00P  0S S @0V D X 1bD4@V X*j 00 00S00/!B%a00S00/!0H%T///@-@H@P j( @ @$Z%Z? }-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A mj00ЍQ@P _j@p@-0P `| @P  \*. Q  Rp R  (  p 0 B %a,AqA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00o Ѝ0S/1>3 !/0S 000/,A0S*p@- @PPH P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!N0`0sA-0p0@P`M̂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ00 |R 0S |0 3/000Q R R0SQ|P.00 R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍ,AA-PRp `@P 0!}_000A-@Pp`0 SW' WV00S񟗋LLLLL\XLLLLLL$DV VjpGPX`ч1 X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0PS Hp  B0s  B`NpGP`Fe`AA-`@0PS0<R"*1 21<0S 0R0PP0S*! !x000S(!!!,p (/F0PA , (0 ,P%^%a%aA-Pp0 R*S\ ]\ t`@BX T dPbP`%G R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00,A 8 0 s000/`Q'Q!//%ap@-P@,`PdP@tp Tp `Q 010// `$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0P`%^%a%aO-P 0R@M c P&  c P 000Ѝ 0@  EPP ЍO 0 PS@ /f 0 00<00S*^Q000800R ]R00-R f0S* ]R -RQ\S0]Sg-Rm0 Su:0S0086000S8\ 00000 5^p0a SaR ,0Sf40Sc$0S`<0S](0xY d 0(`c0@`F p@ eUj 00C0e-R [RQ :R =R 0pS:   0Q00`S0`000-S]S0`S0`0p4 R*000pBW R:0`S0`00 S=*R: :R7 ]R400C  \0p pB{P⌳ 0w S0<R$ DP    uP  p$0  0$ 峠0S00`` 0Q00`S0`000-S]S0`S0`0= r R:0`S0`00 S*R =R ]R 0S0 -RC Q@]Q= -Z00  W2 0S- W0`S 0`00S ,Z00W0S Z4 0CP  pwp400!0pᲠ40 P0S 00000 P  P{  [n 0]S S `Q\ r  0  EB#ЍO%^,A%ap@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@%a%a%aC-@PPp\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  vHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB Rt r I 0D OX &(  RPSxPA4#X z 0   000`020+U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP"  B   B0  B0V0\S0{SPP0PS<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S b^0<0S 00$000*Xe .X< 0e,A)>{^ ]%a@-0@``P?Q $0As R Sp^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )y V 1L   0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   000p030` 0V:0S003000 <Q >Q q`x!P  &  R  #+S  *Sg 0S8* *B?RP {R1 Q. 2000' E#,Pt 0S 00h2Q 0   0R  0 `S|* ,Ry  2000< V0 R  !   h0 S*}Q00 0RX}QR  Q +S ( 0  BN  B   B0B  B~?S {Sz   B00  B 0  B%  B  B " A 0000S 00000,A%a^ ]0S C- `M pQpG \pL@P 6W:0 ЍPPP P $PPxP @`P0 uPP 6   00 0  $ ( , 0P4 8 < @ D tg000G R:0S005000 S3:  P 0A0?P  %00Q p0 P>3S! 1St Sq S <0RpQ00< 0o (  {SW S<0RuQp< 000p000Q S S SS8 S S4 +So >SQP>3S S' "S 0SU\ S: ? <0Sg 2H 0@0 @010 0  P0S s@PR, 0E10S*P 08 BB0SE0 1AS*, ^ R0C*@ Q U B!U \1LX0R#3S#^S!7l80SD 0>Q Q QS 00 0R 10C/UUT@H,AEe$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0^P`%^%a%a0p@-0PS0<Q@*@80P p<0S P pH0@0@P(00Ppp@%^%a%aO--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T *P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  K9P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O%aO-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0_0( 0(0 000p 002   0 X @ Q  0 R)  R # `Z X!,    R  $  S  R  V  PP$ X$@1`v X PP@(@ xPPP @(q P  @@ $ X0  QvW PYst va  r _V R  !    _X RG v@(@X 0x  v% YPt P vI_Vxtt xLt v _`V `R`V t@@ v(  P Px Ptv x N_XN 7@Y (@X fY0txPt, xt v  t v  r   _X_V Q ( X 10 _X @jth v xx ,    R (ZS $X $ 0` (ZS  P 00004Ѝ0S0 0x~ @P %aO-P`M80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R >sp0 c800@ 0 ZZR  D>sp 0 L800@ 0 CZH  D>3 1> Q p0p0800@ 0 p'ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  4P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O%aO-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  ;P ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E 0000S0R0SpG pGPx0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-K0 S40 ( 5K0H,0` l$ 0p0S 000S00<Ѝxq P`%aO-P`M80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T ?P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  `-P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O%aO--lM%PQ0t @%Qo ppl        Q 0"RS. 0 YO,Q 4^ 80S 0~ <``F`Z01S` 0s vQR\R 0C1!S` `0L0 Q[0 000,@4H80<@ PP 0 TX\ L0`P Vd 00 S`FY1`0 0 0`,P XD0S 0 0D0,`PD00D0 0R < 0JS : \,P Z Z `p4`XD0S[ 40S,0@7440S pi, 0@ R0%00D ;0$0 0D0,-P5DQ/*0 F00,`P& 0 0D0,WP HP 0000 0D0,DH0SPHDgX 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XP4P HP PR [S. 0 Y),Q~ 4^e 80S 0a <``F`Z#01S` 0s vQR\R 0C1!S` `0fK0eE%^ Q00 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S8 0 0D0,`PD00D0 Z ` 0R< 0JS: =+P Z`XD0Sf 40S,0@440S  p4P lHP hlЍ, 0@ R0%00D ;0$0 0D0,!P5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0SPHD^X 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XPpS4 0 Y,Q 40S 0r 80S$0n <``F`Z#0 1S`0s vQBo \R $0C1 !S` `0HJ0Q0 000,@4H80<@TPP 0T X \ L0`{NV 00S`FY10`0 0 0`,P XD0Sd 0 0D0,`PD00D0 0 S` 0P< JP:$0 *P $0Z`XD0SY 40S,0@440S , 0@ R0%00D ;0$0 0D0,HP5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0SPHuDiX 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XPppq popm-Ѝ///@- // //0p@-8P00@S PpYP p,A7@-4P@0S TP Ѝ0P ,A@-@P 0S %I@P/;P0 0 0/ /0 0 0 0 0/////0P P@-  /,BP P/ /0 S/ 2#0/7dO-$MHpL`@`pS0P *0S  P000` P000T000 R0030#$όZQ^A2 # T P@P U*00 0T 0C2@TPT  # 3S R0 SX00G0S.T0S 0) QX 0[00 0 Sq 1000H R03S XMX 00 $Ѝ P00#03P 03S 0 S: 00[0T #3SQ R[#  ) 00H0K?oP 2R0S 0SX 00HSX0 [ 0 H0X Q 00 0[HEI S 0h 0z0 C R9S? 0 S I0 0CR 0%2 L /10 HY0S100u 0 S 0G !  0 PS @0CX 0SX 0 0$Ѝ 0 Q 3R0C\T00S SC @ PTP>: < D   20x0 R03S= " L KQ0@-M@(,4`0  P"URA\ P0 `U-00ĵЍ~0s \pFW`&RA-M{ { tЍ10Q0@-M`@(,0  P"URA\ P0 `VU-00ĵЍ~0s \pFW`&RA00G-M@0p`W PV P%Y P.X PmZ PNx P4 P 4Wf  4 4V+  4 4Y  4t 4X5Z! L 4< 4;ЍYXZ-  4 4  4 4Ѝ 4 4ZVY  PЍG I, I I H H H H Hx H H H0 G H G GG-PQ00R0p`ᤔ00M 0 @P @0S nS a0CSsNU2  0oSm HPN ЍHPZ V000U000GP[Z V070U070PGPZ V000U000GPZV000U000GPZU000V000zGPZO V080U080i0@q@GPZ: GP GP GP`ZL V080U080?wGPo qGP kGPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000l!GP TGP  Gh F< F E E E E D D D DT Dh D8 C D B B0 A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  p, 0 Fp@ ^Ep@  p@@@dI0 PFIPI0 Pn|IP`ЍwI00@O-1MM @PDX D"$ "4"(0 hp C. `pXr@D;@8 (X0Sl pp  ` ᰑ 00㨱$ %0!`>p@ t0!0 PP @0S RI001ݍЍI0S 0K0S RC P p 08D<4! @ P0 00Z  0&0h,R <`1ݍЍcp A AHHtF A @x @x @htg0@-P@M 0  PLp +p@ P Ѝ00 0Ѝ0@Ѝ0A-@@0s/ 7PP0P 0 ,p` ``0`0H0ppX`p |H``0`0oH 00#p@-@PCM2 /.6P4 ,ipPC ` \@TH000pt3 06{C.@ F {P4D@ @FU:0S VS00 SCލp|@@0ST@d0d 0P@0  P@1:H?00@H00@ pq> D 4p7 ۍЍp)0si/1p0 ++>@0 P@0 4 P@1:G?00 p 04G0#S @G@G@+p@ G00h!`!$ {@% D : :@-qP`O-$p(PW,0-R`@/U'Y1 0/BZ0 0BQ :["J? P5#I x@t4 2px 2@zPYh@sUZ0J[% 0@-DM@ 2P, Ph+ TeT0 0d0?`0t00T0?P0l0D0?@0p0<0?80h0L0?H0?X00\ 0 00#$Q `@0P"R" " #.0\ !#/2x"$0S"x`@y0`@0s `@ 20$P :$(\0<Q0(0 =S%0h00( @D0c0=$0 l!#:6$00 0.$0Ϡ.>D!! 0!!!0C 2^!>0$0.S0( /2"́ ?0 0 #1?B! ,  ,$0 0S (0^ #0`@0]]q\@[ZZDYyHyXl""""'%.Q\(\)(0`@S  R $ R `\I!:6$4&60 Ϡ $0! >0!!!0C 0Q ,"΃0/($0?,0S00#0S<,000, ,00Ϭ8(<00$ 0 #1?B #: 6 4$&60|!$,$0!,>Â!!!0C 0R!,"΃0, #1 (, ͌ , ( 00S$ %0 00D2<Z0`@00V `@h2p0 P :Q00 <S$0h00 0 c0$< 0$"#:6 00 0.$0Ϡ.>#! 0!!!0C 2^!>0 0.SX3($d/2"́ ?0 0 #1?B! ,  , 0 $0S`@ 0 P0Y*0^R*{ r0s{PT 8<0`@0 dS2  Q9 ^ $ Q*&$ 0PT80<`@  P0000  R00SPT8< 0`@D0`@0  0C0  CQ $0 h00$%`@0 @0D 00 h$%s 0Sp 000000i$0`@2t rt p p _`@ 0  S  0 & D%K`@ D SQ#=`@!D SQD# &-`@  SQD#`@D !0 `@ D!0 `@ ! 0S(0Ss `@70P h: c0 $T;$ ',:6$00 0.$0Ϡ.>(! 0!!!0C  0  " R!Ό "$!( h(\ ?x#" ?00 #1?B!  ,,$ 0\ (  R0004  Q#SJN S  PQ%8< &0dQ(00 3)!:60 0 $Ϡ0! >)0!!!0C Q/ 9 #? /" R  " R $!$0  0#1@0L h0 0%HE 0C00000S P 00W CQ 0_$ 0 0 0 C00 00S ^ 0 0 #\ bh+R" suO-M@p$1?0`l0-?0T`0 W0 0 2c1 0008 CPP/ 0v> 0d0?`000T0?P0 0<0?0 80 04$$%"p˟$p 0000  000W 0;0d0PY 0TPL dPJ$`P0Sʼ Rʨ R ʰ R  0 0a 0S0`d@?O$@Tȏ(ET0}N0`d@00>Dp@ 0G0LP\T<00 PR\p|hPv^DR PE pPQI d4 吠lpptxP[@SRZ Z00d@x0Ut0Yp0[l0Wh0 Rd0 Rxt [)[8P0>C 0C 0t00@p0` VP x0S 8>0ptp0 00@ d0 05Pd xH( "ό R t0"! R RWv 1p?'/!! ԧ#./ B pW ?,?.P P00#1 ?Pv.C BL\Sx  Ptp Pp= 0 [zqp 0pq=0S@T` VP|0 ?oR20S=00ߍ 0=d@Zxq@0 Q Q"10!Z@%NS" \TPd0 P0,Pd000 0  ZR 0S 00@ f=0d` 4p\=0S  0X0ZS0 `ddp p0dT0? P00d<0? 800dD0? @00dL0? H0\$XFZP ?@ =0S= C-ßs"bW2&:##c2S P#m8PP 0 hß0dT0=L30@8< 00P` d0@P ?/' Rß&0Q| 0Y/0 #10">/ 0C!a 0C0 0"#0R"P#. W0mpW!10'/ "#Ό Rà3\"= #30, S0AA^ B0 0 0Epq; @(@ᅯAi<#00f<0SA㴰@0d0@괰[@0"c01 2c1@TÏ 0F<0Q  sP8<T005<0S!10'/` "#Ό R#<00@o<T00V<T00clb \)P\( ɚv $I%@-@ LpT taX00 R 0 R 0Q/  /  ,    DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/ p `H  Q j.0 0#  Q/ 00Ɠ\ 0@-pPo> 0@" \ 0 /A-@P `p@P@0% P PPA-\@`@P pjNP@0& |P PPA-\@`@DP pH@P@0& aP PPHO-P M pP9 谟P n `P P @@ % 7P P0S  Ѝz T W A6  0p0S A-pPQ `@Q P 0@DDB(000S   0E@- M`pPPp) : 0 u0@0S :0"S" 0p000S0 7/ Ѝ:0"S1Ds\0pT000S @ Ѝ1Ds$  Q h0 @-@5 3@0O-P`U M PP2SpPK (P@N P K <10`06@P6 0nS# ='PP00Q Q \P R  \0  KB" 0 0Q@00oS@d000S p Ѝ4 G  TB(O-BMM@p9@0  04FP:'PP  (FPn00(5EP PC @@`K0 PP p 00P0 0 PPp \@P! H 0dSPkPU0 Pp` p} ᨾ 06P @PP0 PpS )Q P< :c9 00BލЍP/U ` P \p@M90SQ  /PBލЍ /0H0PP0 p=  "*900 P 0/d! 0 0 090<0  0{/- 9!0  എmK00'800 P 0T/}800  P 0H/q80\0 P 0=/f  At M M@dz  \?D 4 L      -{M 0 { PЍ -{M 0 { PЍ >-{M 0 { PЍ ?0-,M 0 >PЍ --0$ S   0/ 00p@-P.U@pN8?( ( 0P 5/p p@-P!U@p58?( ( 0P 5/p$ @-@P 0003/ @-@P 0003/ p@-P?oU20S@ 0 0 03/pD Xp@-P`UV00P00S@p$ P05/p p@-P?oU20S@ 0 0 03/px p@-P`0@Pp7(@0 p@/( p@-P)@P p 0 0 03/p p-@- M  ?ap@(0(003/ Ѝ@ Ѝ/| 0@-,ap@0003/0 O-`$M ؤP @t)0Sp$ЍS70,P@@  4/$Ѝ XO-`$M ؤP @0Sp$Ѝ(70,P@@  4/$Ѝ !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////   l  D h          p X  0          p ` L 8 (  @$0(- C^ 0CQ$ :$0S3 57 $05, 0(0$00 # 0 $0 0@-@$ MP#055050%A0!0%P$00$0Ѝ0 $0R  S,3 5,07$050$0/S<3 57 $050 0$0/0S/, p@-R@pP$(ASp0$ R>3057$ 5 $ !PpO-`@VPpDM@P؆, 5p0@ U p 0@T UO UK 5,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R#00C R00CT,@DЍF, 0R3057, 5 05 R, S# 0C 0S 0C 0S 0C5$0P$p 0 @V@B 0S1 `@@0 SS( S R 0C#@ =0 R,0 Q ,0 0,0 R<@0S80S ,0 S>3 57,050,0@q`V 0FV")VX* FRTRQPONMLKJIHGFEDBA?>=<;:98bV5?Q2 R/  2! a, A0!  @w 00 Q,  \,  , Q0@0YfV ?R0@SQ  b9@S B88 C c3<21FV ,00 S Q 5075,50,0 5SQ= 305 7,5 0 ,O|0f@ 1$01$0@@@ TR`VE. Z Q X Q=V,0 S 5`7,05 50,000 R,0 Q ,0 0,0 R ;0@Zp  Rm @S@ 0Pb %0@ ?RY0@SV b9 B88b000F@00b%#jo%#jx%ju-M{0{0Ѝp@-P`M0@ 0u 4/ЍpG-PRM[  `TpPC/a@!P @1000< pp. Ѝ80S&  1 000< pp30S0000< @ pp30Sx 30S X 0 < @300300 0 6 8 x@-$$@M Ѝ5xԅO-EM M`X@P+p `E) F0P@'T 0 F0P@T| 0 0EAP  UEލ ЍG300B300 D@-@` pMPf0P& /E 0RP$  rR$   P @0C rR  Ph 0 @Ѝ0 Ѝ@}0rS 2 0 h (A-`@ p 0P/S /\EP @0 Sp 0 S  )p@-IMM@`PP p 0: S X0 0up IލЍp2O00@IލЍp200 p@-IMM@`PP p 0: S X0 0Jp IލЍp2O00@IލЍpy200 0-{M 0 { PЍ 0P 8 Q  8 //p@-@P PP`  PP u !P  p@*PPp--00 M (0  ЍЍ//0P --M  Ѝ Ѝ// -- M O<P 00  0 ЍЍ//`00-@- M@OP  Ѝ@Ѝ/O- q`Pp,M< PR% Ppp0 0CS% P[ P@ 0 @#[P N(!,Ѝ000:Q!0P00,Ѝ.  BfL 0 4z [L 0 '0S 0 B 0 b00'  00 #0p@-@P-Lppp@ 0RS00 /p@-@<0<00P  @Lppp@ "0808 00 Q0R00 /"0p@-@`PKpT T   p@pp@-@P\ \  ` @KpTT  p@p"0O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDA Œ Č Ȍ A`| Bp2  W R ? \ QQ Wt ,0 000IC1100Q0 0, Ѝ000!0 00w0@-@0@ 000 @T :AP80@080p@-@P ,AP80@0800-M  nЍ0-M  ЍO-ϟiM P̑Ёq QP@ P? `K͌U PD? K͌T P? F͌(1S tP> F͌(Y bPl> C͌ X PP$> JB͌8W >P= ̌1S +P= ^B͌``=@ 0S078D H0P `P P  P P Pp PP P, PP( QP PP (P PD PxP'( lQ780H0x100C40S000C,0h0LP 0P( (0Q0Pd  , P `P X hU1q @a0T0 @UT, 0X  p @dQYh`@0`@ P`'  V U `0P1A1S  ,000@!1S 0D 0| 0?piߍ00P,,0`L0!!\\, @  B  $8 P<`@ Y& 00A00@S= 00 1 `V P`ҾV ,PY 000 `,0匰 0[p$0p1`㐀0@@p`_Pp  W 0@0@S  P8<`@P(04 0R(0LPP1@0塿0S@@X!(@L 嘿0S00!$0P 吿[T势0S0 0 傿, 8P 0BX00P0 P< BY 00 O0 T ,q` 0q @PV f`Xp0@  P  U  PAU,0V00@ Pܰ封[ P@0ջPP  U `X0pP @Y 0@X RY0,0P0  0, H V 少[0D|A>`Fp1``  0[`0Lꈰ  0PUMP  0@TPOQ @ 0PUQ @ 0YSJ @ 0XU @ 0pWWQ^ @ 0PUY,  `6,  B 08P< T$,  p , 0 H T0封1D|a!>p@(8P 0<04 ! , B BP   $@ 0[X T[0,p`p0q0 0q08@<X\PV f`Xp1@  P  U  PU,0 V00@ P封Y P@0㌺PP  U `X0p8@ 0<X\P@U.[P,0 CT', 40p! < ,0 H0X 0q1D|a~=p@P 00 0R1 (0SE ,00p W 0g1(0pS3 1@ a! @0T0P0 @lT,00 ` @!(0R1@pPB0P@> T  0Pp 0,0 SR,0, 0B ` p0 W" 0 0B00`S9 0P 0Q!1 @TQ @T,000 @,0,0Q@@ఱ>P`p㧹 PP U  p ` $0S; ,04 1Y 0i1$0 S- L 1Q!qD0 @00T00 @̻T,0 0P @Ta$0V1@V T  0 [0P@,0 SX,0 00C @,p0 [# 0 0 B0!0@SC 0T 0a!H 1 P U a P僻U,000 P,0|!0RP 0P1` @0P`R T  0 @  h50 0R80000S 8O-pYM|Cq0cS@` Q 00L3?K͌ 0 0v0S?H`3K͌ 0H0w0S?pp2F͌( 0p0u0S|?Pl2F͌( 00x0Sp? 2C͌  00z0Sd萍 1?B͌8 00{0SX 1?̌ 011s0SLN 1?41@BM@0810 PYߍ 00v0Sk H`w0Sv ppu0S Px0S z0S 萍 {0S  1s0S N <0@-P@L0MH( 00 ,0 40Ѝ0X00@-P@L0MH( 00 ,0 40Ѝ00\0\ 0 R/D@Q 0Q(00?H/0|$P0P0/ D <  R ,  R$ 00?H/|$0P07 A- D   R'P?UH@0aaS,p10 0D C  (  \@Uw@U(  R 00/|$0 000l P  `0H?30\ -@@  G\,00G//|$O-PP 4M 0pS4Ѝ刺PH D0 0 0L|!0K:|@uP` `0D0ZP`@0PZ0 TP V@``@|c:L ?3Q 4Q<  H0 00DpL |"(0 :9`P0S R@,PR @0P %: R0`S4ЍT `@004  0㠶`Pu @|`|$0 00]0p@-\0\ 00PU 0@S PH~ppl0p@-@P 0PS ͹P1gpp0P0% H -? \0| DR0  0R0 S000 0\$( /|$0 000 00 /O-tRt2P0M`@V0u T":L"@"4"("2 2 $ 2 T 0 01X 0 01\ 1 ` 0 01l  1pmp0p0npp@z20吲0唢園 $TX\0` 0lm0n \1Q0'0 0 0 0 tЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000 h( d0C-餂pP@M 偶PP @@{ d"j =@-ÆBBB {`@C{@@@@<PV Cb pQ 1pL 0p R] @B0 @@@(P: 0 @@@(P/ Wp+ #p' p0 @@p(P  1'h,000S :3S 0ЍP )[B2T @T)'PЍh0S,ppP_ 4 A-Z`pPp ZBx2S @TO.000 R A A @-lQ+ P@E0`XM_  S- <1^p0!!!!v : !' !_ !| !o !* <#>4{!*prQ>{ R 81 R 0SЍQ L0 0 0Dl0T0Ѝ!fTL@0l 0̃ S/O-C@p`ᜣM[ +(p($W 㵷0CS0SL૷3㷷8༷P $3$0/# {% 08:x{rH̲ pŸ夒堂8ırxrhÃqpr(rhrq`r`PrXr弁qPrxrHrÃq@rr8rq0rr,rqps rqrqrqrqrq rrrqrsrq}@s: R 0S 18p10S pWЍQ 1 0 0Dh' Jl`p  \p  00(@T(0Ѝ `a 4! +!,!-%!.%0%#fq&i%"`j#%ok{% |l%m%<ns%t%$u%4v%,w%x~#p#r"dy"ez@>pp<۵^صvյ8#ҵ:ϵ0'̵#ɵz #ŵH#µp-㿵-㼵`_㹵|㶵o㳵p㰵r㭵y㪵z㧵{㤵@|㡵h}㞵6A-``'^` p @ 0^ 0(`V(PO-`ܶ6 6M000ƟJҭp6 0000SVF A p ;p PP[ f p?P4S S S|V0S%pPn 0@l   $ `00 4S 0 0 40 s 00bR$ 4S4 0P%00Ѝp PP 0 04P40 s 00bR4 440P ?21 R R0 ;0ߴ $Q B q 0 ;0 дpP.4 S S040S$ 004 0r0  cR$`S 404 ` pse0  ;0 塴p PP4P0u0PPcRT T4S{0z$0P s 00bRS40 00V0SipP 0@  ^ $@ `00 4S  20 zS 202 `J pt p 0$ $P0 s 00bR40 ; 0<p@ P< pg 40 s 00bR4 4$R2P00$0C?o$ r  aR$2&100#?c p0 p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100#?c0`00$P r  aR$ $ Q 0000 4 00 40 s 00bR 440`00\0\0! 0RzP|\X,QA< 0(  0 + 0040 0/lO-T4P@P0DM+ 8 `$Qi w :Q|#R3Z 300S 8 0 P0@P@P@X@-@P @P +P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o" O-08vSp@`M$f`ZP ;U0 ʍr `r 0I"R 3S(0$00 0PK (TxP  0XSd%$ X% 0"L5`0T <504S0300SL p0SI 4SC 4S 0t24W】匡Tp2 >PN 4p2[  LAT `P P s@ذհoX4Ztx2 PX 04x204Y|2 Pl 4|2hЍH5S4S~ 4S0?o20 D p$l h $ <%$(lY P Z P [ Pp2?;~0p220P_0 rr 0I"R8YD  P[2[x2Y  Px2?;~0x2W  Px278x2Z  PL2|2[  P|2?;~0|2W  P|278|2w1S06 4S2{L%R/q[W]  PXx2!78x2|"[Z[(`1M80<4 |2O[W,  pP'x278x21|29p2[0 S;,0 0D | 0 00P0qipI PX 00C E0HSP 1TX[00CS``[TY0IS`YPY0 0CPYp||0 00l0p@-@PpP`0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/$!O-PP + С1D0, 0 S 1H`?c`` AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CwKk0 00jp0T0 ?o2R0S P (1  //-(^,0R0^Q!R@O-A1@ 0QM4 P`p, @p 0S" Ï#SÏH000C  ```P  (0R0 (00000C00T0 03/p 0PS@  Ѝ(i ((0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0O-`P M@ VU``D0S  00C(00P00 T0P 0 S `&, 0 SPp0SᴀJ`Dp)0 `| 0mpP Ѝ 0 S RQ Ѝ,ᗑP e,0向0P 00X p  ``F , B,(`aaA0  U p0E`4fP  Fp`,004@ 0U` p0EuPT   PB  0SQ 0 0PC 0$ 0\R =PT 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000U1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP c0 PQ8 0 /$ $\/ P/aPQA-a@`ؠ1Pp0$ TZ 10 0 QT$ D 0R U ETpM D10 0 QT$ D 0R U EBp; 0D00  Q P@$ R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q`0 PQA-`0`p0*Â@$ PP q@D00T 0Q^P- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P  0 BS0@( p`0,,0A0C1!0 0L0`S@( X0@-8  PE? J0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M4}ڌ`W@Pv z{툰 {PPp,o jPP0b Y4& 800S0 X0 08` ``$T`L@0< H0|0P08 8!\08 `0d0h0p0l0 Ѝ9P4/ P) 0*Q! Q80 SpG V P  PʪQ Ѝ ;975@1 A-0QM@PP(C p`QAR   B P1 \.X) P$,PAPP H0 DH00R00D p0$`P!b@0SЍPЍX@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI ,L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @V|$ 0@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0T0@-44@M00 MЍT(QP-D00M  ( @05ЍSP8 /00@-MN  P@N000 0E DЍ0QPO-r( P0@0, 0!0 s0PT* H00#D @ t@T,0Q0@t@T4000SH00SZ   R ,  H DS400,01$00Q$0 0P 0qQ 0%, S00,0,1$0000 S 40p0L|@0H00D00ep 0SL01H@400 0,0000,00 0Yl0Y 00S 0` S0F 0R_4000,00 1 1 01IY0CRڸ/o<"L\ Rn Y@L0l00P6P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Xp  0 AS 0 V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s D  RD   00SB 80 S8( 0`V 00P0 0CS 80 @@ NN Œ Č Ȍ N LL\80ɟ`Vpl,8( 00S>0X *1h"0( (80 0 @ `40 , 0W Pp$t00Sz000 @0p_ 1`11qW@7@'@@0 K<00 00S 0X *1h"0b40V @ 60S F6( 0p|Q:0A0 0C0/t 10 0 S' PP 1 11RY@ RRQ 0   S %( R R !%`FPA p0p`P@ !?3 pGWaF`P `/0 < p  L  `P 0P0P00 PP0wP0D0T H00S {080  400 e H(40 p`\Ѝ8 L0j bT<00D RY 0 R PP!Y j [R  c[ $RX  0E0 p0P  0E  <000$R ( 3 H000S2( 0<000h0S0B  0 0zN@t 4000Vg0 0C B!H00 R d1S\Ѝ4080 @0 80-P00C\H00^@0SC T\1( 0, QA@`0`4! ,\@XP ppX@P DP0@, Q J   4p@,@ APWp@PT ``=X | h, pt߬Մ(|l`TPp P @0`, AVXDP q@DH P! R @   \`Q  ABQ`P P4 BQO p @ p   ,@ 0$8 R p P p , [!, !`w @@[`o P p0 WPn $ Q  $P p,@08 P LPA\H0000`, Iy$ @A`0,  \- `@00400   0{8 0%00@ 0C40a0 pWPx p p  P  , BQ 0` W G 4 DP @P | 40@ PL0Y0I D| p~0TpP:W W@ P n@DT GpGGD@`0 0: 40Rpp0,@0C 0B0W,0P 0p p000E,0 PU U R0a R  W R RR.0 S0@^ 0 RAA$8 LD@ , H@X LD 0B0 B$8 B!! 00Cu 0U40P0 P,0a0 0R0h400,@P d1S ( ,7 I <0@00!R 7Q R dP  .@ ``E 0E0p0~ 0E  <000P+ 88(  <0@ C0,0 0000Ss 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  P9( @` 0 ``( <@0 0L0 00 -<000N( l>@ x0 `C0`  <000tW 5 b0 U<`? 0 0LRP6Pj <00 pCU \ʕeH5Sp@TL 0$`P@@U= 8P8P `$=`O-x:xz0t*Mp$P( ,pP @*00\` S@@s  aRXAkHQ00) 4 @Y @B@0@T ROoB@TP `NNQS0)\ 0  |  bR\ L)` R&<) R! CP'I@, 4R S[80S 0P0$  B$ X@0C, 4R CPf S ^\ \( 00Q <80, 004(0RJ0H 0@0( v $P)0S700S00l0S# 0 S , 40R#0l P, 0S P$0CP$D70 RЍ (70( M$(00 SBFf@`- & (00 S4$&P0C (00xP0S  vP$00C$0@d&  X&0 ,@(@ R 50 60, 40Rp F f@` 0 0, $P, 40BR0S(0g 0KQcڤ%%  p p d% 0(@`Vq@nR @D%@ T ,00P0S 0P0$  B$ X``Q 0[^[ $ 0|$0C ,00(@0 K[V p<$ , 4,! ! x D @  ^$ $@$#0 P(0i0 Rv ,,Xqa00P* x# ; l# (0$0@ ?3S0V{( , 3\0$7 (000P )(0$0S p n0P0  G@$(0lP " 20,  , n40 S ^ ) D20$ ,B@0S ?0P0$  B$ $ 00P0 ! 00(@T7ڬa` ! (@00T0!0@Dx P(@0S  0P0$  B$ 0, )a`0S 0P0$  B$ 0, ̤p ˔dh ʰT<,ɔ, ȼ(  TP(ŠŔdĘøà0,xO-hsh3pdC@00 S M ᛕ400040(c`(,P Zm34@ 3`0T&"0C S402PK䢟  50@DS(00S00lP 0S 20 0 204@,P0T0hP XRP0 @P 0( 0CS P 20 0 P1040 ,( Ѝ00S00h0S00~0T100 @P,P  <1(`0 R*T$!P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( l0  04@SSCPE@D4@P,L 00SL004P  <hl< D\L8@- ,(4 00@-  ,(4 00TO-p1p!0 h *⨒YP!P H!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU,@0@DaQaS@00 0 Q  ST 0U0 00 08QD0S0l%R h%R /!R!RtP/P//l 0 000 0P/O- MtuPp) h5` 80s,  S̠DD Pr 0R!1S5@50  50 `\Pᴖ 40 0~0P 40 0s40 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0 $,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q WS~VZ]9 Q oSf2 Q 4SSVi^* Q j^S! Q WSVk^ Q S Q[-S 0Y[=20  0S0*Spt !-=000 0R$"R 2U8Ÿ= @0A004 1aA`PU+ 0S 100S H0 0YH0,N  Z000 0 0 00RY{PU Ѝ0  00!R 0ʀl2 00 !R 0ʀl2 %R t5S 0ʀl2Sw Su Ss Sq So Sm S\jl@,d1P0TX POP# @ QH\F( 00ʃlœ\ 1:t“ @-'@T! tƒ'> 'tƒ /A\  B\  ^tƒ    /1P0A 00` P;ʀ :l“3\0 /@P%0000CS 00000000000000000/`@-@P@M&\\ Y #3t P P 00 C000 0mЍ4l`P -P\P Y͌# /l@-00  |00S d d0 8=0!D00 R 0@-4!41 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ !A\  `0<TP$0 000:h/p@-@0@`P0M*l"R R`   P H00 040@ 0 @ &ЍplX02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R. R !p@ '( V@ Ѝ1=00QM0SJ\1p20P10 0H0剑Q:20t1=00Q!0S0p20l00 0(0剑Q:20h00 00`0pY0!Q 00pM0!Q ll0 000/p@-x0x 000@00CS0 S p0 S P00p/vPp00p@-0CS@0 S p0 S P00zpvPp0p@-,0, 000Pv@fpp@-Pv@\p0 000S  @-@J Q P\,Q    @/400P JP\@-\,AP / P/0S/p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0P`Pp@ W `vP 0 0C S0+,+00GT0 S80  G2 0@C0 @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p wrPP+  U  P `X(0 SCJPC0 0(0C\00CnB`$ЍHz TP P  D0|0ip H0@D002 T `V `ztV `` P| \L0 000p@-@Pppp@p@-@80800P  @ppp@80O-<6dM0@P$0 ^ Q| 0pDu`PyU Pq0P0O W 040P0[000P0@SE:I.A@`0XP0P00PEPUO000 00PS0408 00 0`P0p @R@+40T R80 ) 4000C?00tP`FtPH` t$ \400Pp ۍpG`0 0p`0 PP Y 00 00 E 0 4,QpQpP Qձ,pp( X4 R!p! Bp G" RU     HU pG4 S0 0 P` 4,8p 04,0@,@ 0<8=PU 0 4Q00C  00 Sb 0( 0C0, Q0 00PSl 0002 7t$ 10 P 00  07 0 K00000p0[000C?00tP pGR0H`FKtP 0I pA! Ww 0H 00 0ᰡpG W!D0|0prdЍ004 p` 040T pR0`40 00 0P} 0GPr`dЍ`r0 00 b0p@-`@Ppp p@T R00 J80p@-@Pppp@ =p@-@@ @  `  @Ppp p@'0p@-@<0<00P  @ppp@ x0p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``(O-葟MS D@HP 0X 0p`@ 0 0[  E4/ 0 R < $R0<SP10000#10#.Q00S0> P 0 0@0 0x00 P00 Hr R0S0 0?૦P4/[WЍZ00 Hr R0S@0刀0pP4/pW ۤ 0Q" @-@ RM !R "R pPĜ\  00@]Ѝ/0Q " @-  MS S PpP$R (@4Ѝ/-4M0 Ѝ<@-@000M, @ Ѝpp@- 0B\\@S ^\1  @ % e ,\'\ { d"LA!!A0 4"!! L}0 p%   @ '  pPU< 0 ER3\!@`P    ^0 B! { c\  "0  {  \ @ o% d  + {o\\:\ { c$QO-M  mPP 0  %  0  S  h `\ @u,S 0   @0S *  QS%S +0B GSSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8 0 So 00PЍ%0iR@ 0 `fv`  00#1.R0*R0 S l@0 S[0@@00dR% d 00 @0@00 S0[  00 @@"0 C0 0 S[ 00000 K0`"@ @ 0 @00 S020 0r 0  0@ 00 Ssؑ00s00 00 00 000@ 0TX 0@d0 0 r 00 C C00 0 <0  0 @D@0 @0T0 S\R Z I00 S0   0ot  000S0\S 0 S0 00  %p%c%+%c  Ѵ D$</>p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp04 pA-@0MS0D0@!0@p0S? ` 0 1!1P!1"b2cP@AL0L  00210BP0 pW$P@WP 0fSPЍЍP 0ЍN \gȧA-@0MS0D0@!0@p0S> ` 0T 1 ‚P P@0!0A1 0120B_P0 pW$P@TP 0nSLPЍЍP"0ЍlLk >C-@0MS00! 0p0S2 PC 0 `1H $@0 x 0X1@ $A0!b4!b @1c1c0A 0 00ࣀȈ(!h!bC P㈁ 0tS0cS0S㤠 0 @0Pb 00< ?X 00u k ɤ , NgȧLk `> L?-S* (A-@`p0\ %\0PpS sS lS@ 0\TTW 000P1CP0@CV` 1D!00O-霮pQ qM PP- 00S0406 `$ z 0l@H 0o0S1  RS G\@T l P p 4 @@T %T@%T400 R,:PjP 400P,%0p,00=0,P0 - ͟00:T T) `DV%?#"< / XT c`Dv`Vfz t``` 0`D@lQ 0>T-0p0  Tg@W -@@@C?T@^ >Tp A0Ds =R=S2t 0BXaevV.`^`0^@ C @00! Dr 2\* R:0Z'TOP ͍R'R ͍T0   R'R'Rp@@pI@[hP 00040hP, 000p^ Q1`!RX 0BS11`U PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#y1S 0C-11@ Q 34 00`Q,\*P 0 hp 40P040`OU; 01 1`0@1O1S  0C-11@ST #Q,%*P  4 @@9AT @D=AA0@a DrQA DR3@D1@ؕ& R ?R ;RL  pR 0%R 0@a0Ds RA0DS 13 DOS ͍!!010@Sl00l0 0St00t0QU PE@=1QP OU5 =1 =10@1@10Ds R-1!TORP=1=1 @T!p1S 0C110 S@Rb  ?R ;R QeR  pRT 0%R 0 00000 0 B10 OQj }RR0  R}R}R@@ps!R =1X@ BT! b4 Q`!`10` Q,0*S 0 rgp 40040@M, 40,qߍ! 1J00@QU PE=1@Q@1OU =0@01P@ Q$-1 1OS00PgP 400P,V 2gP 4 `V ቂ``&``VP``P``Ì`@oobP``V =`{`@xu`rQ AQ A QU PE=1!T@QOo1BV 2Hg0PQ 4 0,0S@pE00@@ 0 n;00 @400ʘ '8V }8`'00$0&@DQ0VT&$#"y p ]K5#0@0C!@DOo0B000@00-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/[A-pQ@PM 0S! XB fP V`V! 6 0v0* V Uz ``ЍpP0U0b ``U  0 0 R Ut U\P0S U( | Zp 0S R s0r (0 000SU003P G0 p0(0'P G0 p00TCU@=49 x 0 8 @thY p H T 0R @-MI0@S G ЍA-pPP U) @`TV 0PS |y@P0DV  )P !oA-pR `Q 00@ PP{ % 1P +P H$%0 GS  `eP  ^0 /0r 0 /r 0R0 /r R0 /r R  Ͽ|Q  Aq0 pQ?Us0p pWP·Q| 0?s0S # pP  o   1@pP V0?s0 q%dP v0?s0S  pP  q0Q ?sp!Upps0q@pP 0?spWC 0岀ḏxS$pCPC "~ X9 $ 0?"s0Ž nP6 sPD fP*0pS  U R00000qQ 0:!=dP 6dP" $ pP ce$p_e %dP$0V0 p03?/U  R000000 /r R0U0p0p?s0(C-Pa@|!`pM0 c P K00H0S= PЍy`P  P 0 p R 0S 0PP  VPP004P"Ѝ 01 P @``+n P *6`Ph yg(fO-M M:S&0:SSP 0`S:Spp@F T R!*  @ 0  tDlP 0P:S ۍ ЍPۍ ЍC-pP,Ÿ,M M@`tP) 0/SI ~P5=P 0 ۍЍC0P p! cP20 ۍЍCl0P 0S/S T~pP BdX #09dX P 0 ۍЍC0 PۍЍ p 0dYW L0L 0 $ۍЍ404 0 $ex w8 w$ w v v v|c udc` u8G-p`@P  X0@cT  NP @\PP;P P @T  @0GU-@-@ M00 Ѝ@ Ѝ/- Ѝ@ Ѝ/@-@ccc@cc c0c@cp@-@0 0s0?0 0?0P 000p 0p@-PS@:pS bP!pa@- ^ @fR^ qSnR sRq^r 0  Q A- 0X p`fR0X P@Ot P0  nR sR0?s00X0C 0 R  0PA-P# P /00`pp0,SS00 0\,\@C`P    p`p@ q G-pl@`P<P#;WpWU*nUL sUC fUH0D Y%R> @aPH H0D@ / H0@0 H0H0nUp@0 H P4 sUD fU< L00L0@P @QP00W ,00 ,00 $` 0S0000  0@SH  $03?0H00H0H0@ HH @,0s0?0H0@0, H0(rH0, 0H000$P0s0?0H00H0 `< o oO-@ M PZ p pY ` `(080H0_PS 0  u.Zw /   "v Y/   00 R0 , 0R0 < 0R0 0L0S00@ Ѝ>, R 8< R 02L0S @,@-0 000 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\A-p ``V@PR `P A0u0W00 x /    0 0 0P^ 8  O-`0@ $M 0/P p6aPpUP5  P F`0P  0Ca pP| @P P@@,`Pa $Ѝ #``0,P U 0(0$0,0 @ p @2/Rq 0S00eP^ PU X @/r `0LP@UH0@0D0L0; pfS0  0p 0 @P PU  @Ot@0nS sSqpX @p4Op ` $Ѝ@pOt@ @@@o h gA-` ppW@P R# _P 0uϿ   v0?000 0u  0 P]0A-` pW@PR U_P 0u 00` 00 0P]0O-LM<  <0+, 4 0OpP |@P0|0`PF 00ZPT PE{:PP^PP  PI V 0FT 0:,P `a 0 `10#0 $00 0p0s(0p s (00UPi ,PC 0S@ $ .S  ROSQ = ᝺pP# ᘺ@Pe pp`v , R 0?s0V 0S00 R00 D@D0 0SP PO 0 K 0S% v0 L 000  00 n0P ^_PLЍ0TS 0  0 00 800 S,0&Y0 ,a^0 [  @0@SQ p@t`00 0 0f0 EPdX ,`@V 0 V P ph (\VQZX %P^VPj `@V 0P & 0GSI( r (0tP ,)0 FrQE F/RVTSRQPONMLKJIHGFEDCBA@?>=<;:t76km3210/[-Y+*)glh `V@ V%40`  @ `00@ @%40    `p` `p,$\0 :08 ` Q 0?s0T R0 0P  `p       08 x ?V  #v 0 S00Pd0`@P00 T0@\8 40 08 HX00S0`@ PV```pI 0 00 s0 P ,'@ p@tj p@tG , R 0?s0T 0S00 R00 0S00 @PWAQPOT` 9P0 I 0  ,wP5 P p`v0[ 0@s 0 P0P 0  `n]LЍ 0   pd0 l < (p( PH$ `l _X _ \ ]\ \ \ [ [ [`P/$P00// p@-M@0 a0!1l!1"b2cNL 0@@0#@B!A@C0kPЍN gȧ P0`0K?// @-M@t0 &0 LlB N0"0L 2<@0#AB@C1dK1PЍLk >$0P00?// @-M@80 0L@N $@L0B!b!bN?AA4 1c1cL0P0@$C!d!b8A@C1PЍL?- S* p@-0P0M`2D@P 0Ѝp\, 0 0S Q20Ѝp ҤG-1!0  aP P@4 04 S0p0p2,0ѿPP0  |Qp`  ᾿WPeȄpEQ  ᳿W| 0 ȇ0H00H,pHp@-@P \\\ \$[,[[,00!R  !GL 001/G001P//F @--@ X@X0@0@0s H PJI HH @8PA--(M g7`0@[TpSo[jW4C@-whO<(q*]{b~ y\[9&Eo8k  )SRQPO_LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " k{WF{{!00 (ЍP P 30 00WB0h {kWkc!00 P ~P \# 0W 00 "P  0cP0L30{kWk 0 rP  0cP0I20[DW{ 06{kF{{\Pm  0cP0x20W 0y0 "JP;  0cP0y40 W"  8P:  0cP0}10n[DW!{ 0a2!"SJ P,  n0cP0%ʘ0 W"  R `0cP0$d10W 02P!"P  N0cP0$10W 02!"P  <0cP0@00W 012 "P<  *0cP0@ʜ00W 00 "P  G??P R R RP Q Qd Q PG Pt P, O O Od O,0cP000[D{k{F{W{ 0! P  0cP0tT30{kWk 0 P`  0cP030{kWk 01 sP  0cP0m20W 0^2""aPD  0cP0Kʌ20W 0<2""OPL  0cP0H20W 02(""=P  0cP0D20W 052""+P2  y0cP010e{W{ 0 P  h0cP0ʀ10T{W{ 0  PA  W0cP0@10W 02!"P  E0cP000wWB 0 P9  40cP0jʼ00W 0[2 "P\  "0cP0%x00W 02< "P   N Nl M ML L Lx L K L K L8 K JH IG J JT I0cP0000W 02@ "P  0cP0(t00W 02 "P  0cP0ʴ00 00W", sP  0cP000 00W" aP  0cP0<10{kTF{W{ 0 MPm  0cP0d30W 0r2#";Pc  0cP0 30W 02<#")P  w0cP020W 02""P  e0cP0Xʘ20W 0I2""P/  S0cP0IX20 00W" P  A0cP020 00W" P  /0cP010gk[D{W{ 0x P~  0cP0ʈ10W 02`!"PL  0cP 0<10@W 0% Pa  0cP0Z00W 0K2 "P  0cP0ʸ0 W" 4 P  0cP0qt00 00W" sP  H H HT HG H G G G F\ GT F E E, D E(0cP0_(00W 0P2< "KP  0cP0h00 00W" 9P  3P  00{kF{W{b"00 r3030vx300#W"O"00 _H30@300#W"?"00 O300X#W"2"00 B20{kWk%!00 520200"W">"00 %x200p20c0"W"!00 @20|0p"W""00 20200H"W"!00 1010$0"W"o!00 10a10100!W"H!00 `10:X10l0d!W"!00 (1000!W""00 00000!W"A!00 00300f0 W""00 00  D E D D$ C C Cl Dd C C C B C C Bl C@ B4 Bd B A A| B AT B, A, A( A @( @ @ ? ? ? ?00 W"TP!00 `P00FX00`00-htp00N0| W"7!00 G00{kWk'!00 7300#W""00 *30{kWk !00 P30uH0L#"ZH _H 0#"W"00 20{kWk!00 20{kWk!00 20S"00 "00 d" \20A y PH  T@ "00 "00 !00 !00 kk!00 "00 "00 !00 "00 "00 "00 !00 kky!00 t"00 0Sh l!00 |0S1 d!00 t0S \!00 l0S T!00 dP  ^0S F!00 V0S >!00 N@ !TD- ? ?l ?D ?8 > > >D >\ >h0S '"00 70S !00 /0SO "00 '0S/ !00 0S "00 0S !00 0S !00 0S !00 0S !00 0S !00 0S) !00 0S  !00 0S !00 0S !00 0S !00 0S !00 0S !00 0S~ "00 0S "00 0S !00 0S !00 0S !00 0S w"00 0S o!00 0#[D"xP !H H 0#"0SKU!00 e0S M!00 ]x30cp# vB"00 R="00 M8"00 H3"00 C."00 >)"00 9$"00 4"00 /"00 *"00 %"00 H mH 2x""2l0 02L0 0 2,0 0߮@2 0 0֮\20 0ͮ820 0Į20 0໮10 0ಮ1l0 0੮"1L0 0࠮L1,0 0!00 P10 0T,10 0j10 0x:0 @@?0 kL0l0 0b? 8| 8X 9 8( 8 7 7 8, 8 88 7 8< 7` 7 6 7 7 68 6 4 4 4 6 5 5 5P 5` 4 4x 3@ 4 4x 30 20P0 0240p0 0)2X00 0 |00 0`0 @@0  s0 @@0 100 0u,1P0 0,P1 @@0 ޭo!00 10 0Э!10 0ǭ10 0ྭG2 @@(0 ౭82 @@xX0 भl2t0 020 0+;R\0@-L @AQ MO!Q0P PP 0 0 QȠ\ 0;B{ 7G 0 Ѝ0;B Ѝ03Q Q 0A@@1 0^46 0b0X #6 !k(7(@{6F{7{   ;B Ѝ0 / /P 0S $0S 0S P? @4@P//A-P08pP`& , R0( 4", 0R40G@BT@! V @D 8,0400G0, #@( (8/P840,0S00 40Q 0 @-P0 R 0 I H SpTPo @$ @ < ?40P R $ R  R S /0?0Op\>0U) 0PEt@T7p0pp@$>00Sv ~=0000CS 0S =007s@ Q=0 C0 0,0`S P?N?P[?5 *?M *P?Q?H?A?L (?J '8 %?C $X $ B !?9?:?;?<?8?R?D?7 8?K ?B  t $  ?O ?E?I?6?F  ??  ?GX ʈP ;UT 0PEt@00SQ! Q6;7sD@D  0;=0(000q^ ^  T:PEt@ T*U#   0s 0 @p 13$0 [U ($ ,U 0PEt03>0@\,( @Dʈ+7~M<2q@D0 D0B$0Sp0  0p2@0V'8<#0#w[ 202HL0  200@S2D0x pn 0S 3q0P0;T02@D0 C@3q@D07s0D@C s P7l0{1r0ರ^l[PEt@[UwR!B"0$ 8 S0l00X0S>0p0P0?0X00 p0tP `40s (CP @n 40d@ 0p040H 700p_40R4l 0X[qPEt@[kU 0C00Sq 0 000(1 T*U $((U_ PEt1岐@^ Ԃ 7sQ0D7{D @C7s0D@CqCD6L0$ R'400  0r@6p0> 0sp0@+JP7s@DZ 0ಷ@D'q@p6l0 00` 0 0P00p0P0 Xtp0(0$P$(00 70( 'r0R0S(07@D0dSR: @3 0@|0-8@0F(80v 0s \ p T d \ h tP 80C pC90S800p@-@VPP80S ($03/$0(3/00pPA-@`>PP@p0 QR 408 Bf4 08@`V000PA-@`PpP 0R| S  'P00S  E B0S  00?>?RP 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000P@P`P-@ R2Q <001 0 0S!B<@0 RD R  0cPࠓ^ S R5 0 1 Ra @ <00 R1@ 0 <l0P\p\ G R R0c BP  R S R 00S  0S  pl0Sp0p0Cpp0+x0 00 0NP0,40p0 x0 0 0 30 Ѝ0l0S  pl0@@@ cCx?S??A P 0S $0S 0S P?,A4 BR/ Q /@o/?AA-PXPx@ 0!(`3/PPu 8pWG  ( 0(3/pP00@c  Q 0  \!P S>0R:oRS B P T  B T p W0Bp3  (08#8pPp  BS>00p000@ Q 0  \ ᾬP S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-PM@ @㬰(0ִU 0C0 0$SQ $Cp0`0 sRpW($0p  p0 Ѝ0` R`V40sDJB 0|=J^S30 b6 0s0^0U 0 CP0S 0SCUP!( P 0, ! 1T2 0! T 0SЍ0W0T0S Ѝ0D?o 280%R00S02000@04000408@0D?o2<0,000 0 0 0C$0 0R0pP0 R`0ࠃ40Nࠑ@00t000(@<90C1@ R@P00F3 0S $Q Br R$AVJ  ` V$  \ F C 0 Y( V F(*Q BR  BRW < Q  R^8 %Q  RX,  BB!   S @1P ,01( 0 (08 $ 0 00 40V@ 0O-pX04M3 00C PU?PU@PUAP0UAPR@oPP 0C R R0 PR \:0S@\!v!w|U!1^  RX  `\h$X  `\h, Rl R O- M`0P 0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPH/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S>00000 S *S0SWq00Q 0SD0@S>P0 W0Ss S00W0 00#400 00 0  0#400 0 `0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000. R0f9S H0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E000S ! P B R  PE[ 0 X0 * PH A0 ,0 SR0 B00 0 0 0 0 0 S0 S00ӈ R01q 00 D R}0ES IS= [S8 gS8 40S0CkWi D8 RC0SS@ S   00#  #800#"0   ฟ ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S,  Rg00 0 B000,0g  S  0Q0u0S 000#400q00]0SZt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SWc :W㴖K 6SV \0l S 8 B0 l0\000SDI\ R8 C0 l0\000S7 xZt0(l 8`R B  ^C 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l S/t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [ KoP᫲[@ `P``0P0@&ƅ&s0(!ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0<00S=p#  #800#"0 00]B 070c*W6F &R< \ R80l0 C;0,0|T 0 00 0000 B 0L0DC0C Vt0S*l0\06\0l S 8 B0 l0\000SD10,\ R80l0 C97531/-A-`pPTq@PG Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0 `\p# 0S%t l00\ R6S S L D0 BC ե060@! RppXp@-@.PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ 2)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOzv `fp00$0`(0 } Ѝ8 80  000&Ī-M 0 BЍA-P?PUPr0 `0@ 0S  00 0t!(3/@PU \!@ 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P. @ R+ D SR% , 8 ›, @@ ὛL DD ḛ&!᳛0 0C006& 0&;> 0$0;/ I\O-Q$M R0   0S "r ! "0o P@pLß 0@$0*  ")z0 (ay0qx0t0@Ar0 ! P1:SuPQ`&9SuPQp'8SuPQP+P5S>3s0uP1@$ " "@QP0@R P \!R!!P! \  ++ +P ! @$ @$ $PD!" ,!$Q"0S 4X @RPR@$t@a@R &P%uPQL T%$pAR%D$ pQR$T% pAR%D$ paR$d& pQ@R&T%@$t@\%  C R  00#s01^ #$ЍT 0o""1CBQ) @pm I QH G G GX G( F F EC-PRp ` P  0!\0 0#@B .P@18R0  C @$' E4 C-PRp ` P  0!\0 0#@B .P@18R0  C @$' DX @-@Plp`hPp@` 0!ȑQ0 0#B   C @-@Plp`hPp@` 0!ȑQ0 0#B   B p@-P04`^00# @L P%!p G-pR'wph Q RO SRCW-o`VA0A0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcV V-2Q0 pGN0 Q"R 0pP1W1|G.7&c2pG0N 1pW|GpG1^NNQV=F10C>@AP  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0A0C 00 pP80'7b"c2pGNq%R&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /qR&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /q/TU/0S0`0//ܒ2[46@-S k>@@0 #400k.06S0k. ς 1O- p:PTU0!`Q`+ṐY* V@ : U @0ς!\KU V*  p0Q=0^QQ [ 0O-DM PX%@QX 0F  u pGjP0P4 \AB\S 1vσ p P Q-0[P4尐&G B&Sp  @  ipWPQ=00ද0 K`{P0: `;VT`+0I AX{T4T+ pQ}Qp0W20|q~6x `00[0` IT$P0>0 0@00 0p20 S[0 ⵟ0  !  W X SA ׾ᨦ [㑢* & "& R\+ ೞLY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00U0 0S@\ R @02^02N00 R0@\DЍW@  yP 01LX 1R 6 G2#6pP^p N j p=A-`@PT1R`QPE0+~PT S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O-` MVPPR@ʀk` W !.⾐ἠ i5Rs0( P000P#406IP0cZ3s0V⾐5s0iS0P⸠P0%TPVIPeQq BYr 漖P9s0000P#406cR!0C 6Vj VPT@Q p` 0F?oR20S RV0XW R+}~ʲᰐpj5WPs0pPJs000p0#40vPpgYww0 UVA5Pps0k.00P0p#406VPcQ 0C6PT@ Ѝ Br 9 kV0& PPQ^`徠἖0`j9Ys0`J 0 00#4 0编0iQq0  R0἖`g)0 6b궐pi5Zs0P000P#406I0cW3s0 Y㼖P Ap9s0k.00P0p#406VPcQ 0C6PP) P V# Br 5 yO-ʀ6knS㼖0M #P  #  # #  #  ! A@b9 Ts0@p000@p#406 B0c^~00἖&R @ P$ pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಐApi>Xs0000#406I0cWsw0 0@弖^ `D Br @n9 Ts0=@p000@p#406N0cR#r0&0R἖f b9 ^s0 @Pk`0`00@#4PP0 B0`Qq0 k0&Ѝ0἖=0἖9 Gp Gd GX GL G@00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I, ( &&A-@ k΀`P s0! Qr p p "$  aS2s Ak> ,u 0  u0#Ġ  <##4U0 0 000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ M, R 0p&]P+&(+#0N  q/ ! R7@P j   Q&Q3 "[q6k S ;p3 s0000 #406 cPp 0Ck N.V6 0G. 0R0 0xS0   0LSZ=00IX  &&0 Ѝ  \ R+R +R ,RE R  Q ,_ R3 "&][Pj 0w ЍO R \3 "[k. Z0q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦|qk>0#40缦0j\3s0 J Z㼦syzk>0#40缦0j\3s0 J Z㼦T@|qk>0#40缦0j\3s JpM⼦k> / ! Zq ! 缦jR!r JPἦ L I  Q3 "[F@q:sy:s0:s0 r :s0]q#r 0 ? > ::Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  80S A-P p@0 C`~0@ TUT @&P &/@- MP`p;*@P @u P  p , @P  Ѝ 0@0 Ѝ@ Ѝ0@,T  Ѝp@-P *@P @C@pݙ 00p@-@)0P 02000̙ 00əp@-MP`)@P @ @00 09 p ,@Ѝp譙0@,T @Ѝp0p@-S P@0 C`0@T 0 p&0P@p]%aray0p@-S P@0 C`0@Ti 0 p%0P@p8%dict0S p@-`@0 CP0@T @Cpp/0S p@-P@0 C`y0@Tp%(0P@!p/$aray0S p@-P@0 C`U0@kTp%(0P@p/$dict0@- M P@ rp  @P Ѝ0@ Ѝ0ޘ@ Ѝ00@- M P@ Wp < @P Ѝ0Ș@ Ѝ0Ø@ Ѝ0aray0@- M P@ ;p < n@P Ѝ0謘@ Ѝ0觘@ Ѝ0dict- M} Ѝ- Mv Ѝdictp@-@P"%0PPpdictp@-@P%$0P p600pboolp@-P`@P  L0@E$p@-@@ @-@@ @-@@ @-@@# @-@@9 @-@@I @-@@_ @-@@v @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@~@ @-@x@@-@r@"p@-P` @P  0@#pp@-P` @P  0@#pp@-P` @P  0@#pp@-P` @P  0@#pp@-P0`Pn @P  x0@q#pp@-P`\ @P  f0@_#pp@-P`J @P  T0@M#pp@-P`8 @P  B0@;#pp@-P`& @P  00@)#pp@-P0`P @P  0@#pp@-P` @P   0@#pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P0`P @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  x0@q"pp@-P0`Pr @P  d0@]"pp@-P@ #(0P p$0P 0pstngp@-P`@P  A0@:"pp@-P`@P  00@)"pp@-`P@"<P pmP U [pdatap@-P`@P  0@!pp@-P` @P  0@!pA-P@"X0P p}&`P  P `(stngp@-Pn@~"(0P p0P 0pstngp@-P`!@P  0@!pp@-P`@P  0@!p@-@R 0@!p@-@c P@"$0P p`00pboolp@-P`%@P  t 0@o!pp@-P@P  0@`!p@-@2 @ @-@, @ @-@& @( @-@ @> @-@ @T @-@ @d @-@ @z @-@ @ @-@ @ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@% @-@@2 @-@@= p@-P`@P  0@ pp@-P@P  0@ pp@-P`@P  0@ pp@-P@P 0@ pp@-P`@P  0@ pp@-P@P 0@ pp@-P`p@P  x0@s pp@-P`@P 0@d pp@-P0`PM@P  U0@P pp@-P0P:@P 0@> pp@-P`)@P  10@, pp@-P@P m0@ pp@-P`@P  0@ pp@-P@P L0@pp@-P`@P  0@pp@-P@P +0@pp@-P`@P  0@pp@-P@P  0@pp@-P0`P@P  0@pp@-P0P@P 0@pp@-P`@P  0@pp@-P@P 0@spp@-P`v@P  f0@app@-Pf@P 0@Rpp@-P`U@P  E0@@pp@-PE@P 0@1pp@-P`4@P  $0@pp@-P$@P `0@pp@-P0`P@P  0@pp@-P0P@P :0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  z0@upp@-Pz@P 0@fpp@-P0`Pg@P  W0@Rpp@-P0PT@P 0@@pp@-P@(0P p0P 0pstngp@-P`@P  "0@pp@-P@P ^0@pp@-P`w@P  0@pp@-Pg@P >0@pp@-`P@<P p2P U  pdatap@-P`@P  0@pp@-P`@P  0@pp@-P@P 0@pp@-P@P 0@pA-Pd@AX0P Np""`P  eP `m$stngp@-PF@#(0P p;0P 0pstngp@-P`@P  V0@Qpp@-P@P 0@Bpp@-P`@P  60@1pp@-P@P r0@"p@-@Q h0@@-@R 0@p@-@0 P ##p@PP"0S "pۆ"0h<@-$@@"مgP 0R @-P Q 0o//H<P 0 t@-0 N{ {@-P Q @@ @0@ f0 9( (0( g0 0 {{ {{x 0S p@-\@`@@ PdPpP p@ XA-P`p# !@P  I`P `pp"⤅P` ;" =#" `2#/#K ep@-P @`Pp5P p@L@- @P $ 0 0 0 A-pP @P"  0 0 0 ~P `P  ` P0 000 ,0< @ yDx/@-@P [@ e 0 0X h hxxX}-A-M `V $P0 PM!@PV pP  0PA! ;ЍAЍ/ЍAЍ/ 0 0t 5 x wUpX@-@P @  0 0X  0ww }p@-@P x0 0 0R0 P 0P Q # p@Mpp\p@-@P `0 0 0R P0P Q " p@pP/0 0 0R /PP/<0 0 0R0/P///$0P @-od  QP  QQ "/P/ 0 0 0R/H@-@P \0 0 0R  {0P Q "00`P/00 0 0RP/// A-PPM /o00 0"P R Ѝ R0 p 0 p9`P 0 S  R H  -  pP` {!  00H0$A-@PM 0 0 0R ЍQP 0  0p`P 0S d P  pP` D!000( (0( $0 PT 4rr$; P -/o<0"0 0^ R  RN/LP/D0 0 0R /@-P sodP/D0 0 0R /@-P \oP /ol00 0"\ R RP Q > Q6 /@fP 40 0 0RP $!/4fA-(0`SM.P@U Ѝ P0 P CpP 00  0P* S'P0S0"Q00 $@P X i0 0 0 @Ѝ( P b aP 00#  R0SSQ///@-@ h?\YY|p@-0(MS-"@R{S#  P{ ` `P !P H(Ѝp(ЍpL P { 0  (0( (0 npnn n nH$@-@X\@-(@@ށX,l@- M`p@P0 P0Q!s*0 00 Ѝ0"S@- M@pP܌`0 `#pq 0 00 Ѝnj0"SA-Pa`6Sᐁ@P ~KG('pP  l:w@P e2iW@&, ,0, (0 V< XkkM0P S0 P \0/S 0 P */\03#//2P S0 P \0/S 0 P */\03#//0@- P@M @ aЍ00@- P@M @ UЍ00@- P@M  @ GЍ00@- P@M  @ 9Ѝ0@-@P ,0 0 0R /P/0 0 0R /2S!Q  P*0  S */@/0 SR* R0:/ /P $0 0 0R //P $0 0 0R //P $0 0 0R //P $0 0 0R //hP/`0 0 0R /2 S0  P *s00/S :0P/`0 0 0R /2 S0 P *s00/ S :P/\0 0 0R /"0R 0S/ /R0:HP/\0 0 0R /"0R 0S/ /R0:P/D0 0 0R /2 S0 /RhP/\0 0 0R /"0R 0S/ /R0:P/`0 0 0R /2 S0  P *s00/S :P/`0 0 0R /2 S0 P *s00/ S :,P/\0 0 0R /"0R 0S/ /R0:P/D0 0 0R /2 S0 /RHP/80 0 0R /! S *s00/~P/80 0 0R /!S *s00/~P/00 0 0R /!R0/~XP/00 0 0R /!R0/~P/@0 0 0R /2 S0R /}P/00 0 0R /!R0/}|P/80 0 0R /! S *s00/}8P/80 0 0R /!S *s00/|P/00 0 0R /!R0/|P/@0 0 0R /2 S0R /|\ P -/o<0"0 0^ R  R/{P/P \ /QQP/Z{P/P \ /QQP/Z{HP/P \ /PQRQ\/zP/P \ /PQRQ\/z@-M0 `000 00S ppP Ѝ@( RP +B 0R xR#  P 0S t tP DЍ P PS ^ O-\1MM0(@P00 p$0`0$ 0 0[ Q` $ 0`;/0 `(P Mߍ DdP 03/P 00  $ 0:/P 000 PMߍ]0p@-P2s0AL7@LP@a`Lt0 0LWLV p@|0 T0s0^0ppO-IM袟P @p ` @@@$@@@(@00 S S   0CS R0fSE ;"Sm [SbL20 @3/P 0 0  0S  0/S[ p,p0 S S0` ` S S/S >S S 0 S S0FU0 RbP0/S^ 0(00>Sa S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p0 0 U S =S`B`0"S0S   0"R R  "RC$ >R0 W0(00>S` 0  $ 0Ut UG-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R"@ tR Ѝ mR8 pR oR sR ;R'@ ;R<@ tR ;R>@P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮otfe"R /R@S00S@Ѝ!1 0 h   0OPp 0 +r  RA*0 Rf \Rc  uR_ 9PZ +r PU6I %" 0 )Ό" Ƞ"̌"< 0 Č 0     SPY& Yy  ͕)   0)#<  Y,!*-"-    )&  w DRQG-@`pp W W00 GR0SWL 0<0W0PPF <W0@@j\r\\p 00 S S   CQ R<S+  qP)   kP#  eP-0@S@S -S 0@@-S0>S @ 0@0S>S 0 @>SSS @@ @dP (0SP  R @W' W0S@@m@b`PV` :P @P D /P0SOOONp\MBG--`Md*@PY , ppP  pP 0PH h``S`Hp0"  3iPP u3    p ` IЍ%  iPP u  00 H0hp %`l Ao/A-PP P`p @@P@@@P p4.0,p0P4080<0f4x@-@  4L@-(@@ x4,e52@-@ @O-4@T p`, P @@D¤@`T P礀Qㅑ@0@ @@0 DPZ PZ PJ J @-R 0P< P 4Q ,  D D0D )0 , ,0, (0 dT (IIX II4p@-@M4 00R0SP,0SER 1`V- P` 0 0P 40, 0C40P% @`ЍpS' R.s*Ѝp 0 Z0D p p0p l0D \ \0\ c0D D D0D @0D HH I Gy IG tHhGiA-@`,pPP W 0 ! z,P0`,P0`C-`0@SPpMD  ]P00Ѝ!0 AP ,0SU !0 7P ,0S(0S00  0"P 0S?0S0"S 0:S 0 }R00 "R  0"S P  P @` 0 @P ], ,0, (0\ F`nm  FHD0p@-S `  Q P@0@p 0  0 _@ $DDT0S 40 00$ $0$ @-0 ^ EhC 4 @-R 0, B4 P @ @ @0@ <0 , ,0, (0 `EC <DClO-80M@ Ѝ@p`# PP @ ` @ЍȒ j vPP0 004QY  4 R] ,剱1Qw   P 0YIW  B B!kf,0 P 04 `<0 04 <0 P}P,UN<U8U+'Y& 嘡 @i 5P 4 qvPP) _ ,0,S<SS> \dP\ @ ,0P`<04 0<0x< !f,0P vYP {,x x0x t0F/d d0d W0,L L0L 0 +\* @(@@2 A@ A?p@-@PPH0S L  Q <0 0 p@9 0  0K/Z ?x?Dp@-@P 0`0VPP l l0 0  0@S0<  pPp( (0( $0K/`Y , \>>O-0@SP MR z`40SM x `P@ ЍmP pP 00S 0q 2 00PX 0S. @0R* P# [` 3P 0<P 0S 8P' X D` ЍOQP 0  03/P  40R 1#PP 0 0U/^ 00C 0P `N@zh h0h d0U/T T0T 0]/X^XDWx :<<V ۨ=; ۄ=;d@-@u0,S<SS 0  0 ~$ <;PG-U p`0VRV@P7 404 S `  S` D000,0 100,0$ 100, ,0P ?o  @ 2\0S0S P`P :  404 SS`  `D D0D @0c/0 000 ,0c/ T 0;|9`! ;9<7G-PS @- Y`' T 1p 0R L R P 004 00R% OP ? 0S 0 GU,d d0d `0i/0,S0 000 ,0F/Sp :8(1 ״87 G-PP' 0 0R"A4pP 40S @,0aᄡ1 ,0`儡40@T:8 408 #pR,0P 4  Q@-P80080/Qtp@-@P80080p@p@-@P 80 0R@ pP4@pPp@-@P \0 0R@ pP`00S@#:p@Pp@-@P@pA-PP 0 0R4p`40S @40S ,0 P@b `PA-@P 0`0VpP0S ~P @T @ @0@ 0]/@@sOd 86d4hA-PP /o0`0"Q@@T @0R pX K@P @T M@ 0  0]/N P5|30P \@- ^ 400\@/ 0  0F/~M 33 0P o@-x@ T\ @\400\@/ 0  0F/UMd 032` @-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0Rp@ S*,P$0 B!Pb400C40<00<0{ y h h0h d0s/ T T0T P0s/@ @0@ <0s/L 21<u 31v 3|0w P/?o0 2 R0S/0@ S/K80P -?o82 ^0S 0 SV /JP/0 0@0R/JP/0 0@0R/Jp P -/o<0"0@0^ R  R) /J8 A-`P @PpP (0Sp 0P  pA`Ix `=I\O-0S@9 0@S7  ` P. X8qPp u P o P @i P HXP0UU@U !#10< ,$V P?@O 0 s0 X% XP0@#r 1P7 0 03/P0  40R 1#P' `P 00C 0dP  @ꀐ pG \ \0\ 0 &8 808 0 2h1t1@ 8 X40S 0C40/ 0  @-0 p0p@-S `  Q P@0@p 0  0 0T ip@-@P 0`0VPo0S R <0 0 p@bD D0D @0 0 000 ,0 / |L X(wG-S *X@` V 0P 0R `00p *V` $V 0S  Gr@ @0@ <0F/mA0,S. TH$A-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p-@-P80080p@-@P 80 0R@ pP0@p-p@-@P 80 0R@ pP4@p,p@-@P \0 0R@ pP`00S@#:p@,|p@-@P%@pp@-@Pz80080p@sp@-@Pn8@@@ipp@-@P 0 0RP`[40S ,0AT Rp@p@ 0  0O/+x aA-@P 0P 0R@ p`-8040S ,0X <0, 0Q<0@@>@D D0D @0S/b0 000 ,0S/Y* (0  p@-@P H0 0R@ pP`@p)A-@P1 0RP`4P%80,0!qW&  P  1P ,0P < 0@ 40< AiAD D0D 0W/, ,0, (0W/)D X d40P -?o82 ^0S 0 Sd/(p@-`P pP@eP (0S p@ 'd C 'H0 //@-KP0 p0 P TO-IMP @ @T p `0 R 2/0K\ P Y  9/0  paPV @T!1 0 j003/Y@ 9/T JT T @T@" 000Q 1/0J' P70S+ 03/P. Y 9/J@T 0 0( ( 0 0 Iߍ 0 0(  0 0( Y 9/Z 0 03/X X0X 0(  | X ``, <H P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0BP 0 $ \00 Mߍ0 000 ,0H z R00   # 0/0/@-@@A-PPp`M2 0S/ ?n@0U  UU 0/P B 0CU/PU  U0 0 B/Q h!0C@T@!  i;@04D.< 0 n  R0* 0 0FAp@  ~V r0P@rPۍr?00@ۍS0p ` Hp p ir0P@  p@-R 0@S PR :   PpC0P  , 0`0` `90 L0L L:0 808 8;0 p < D L ` $ , `  p@-@Q PPpQp@-0 MSP@`PA Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPU pp 0 QQ Px, ,0, 0 |D  0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@ s DPD#0p@-S+@PPU Q PpQp<{Pp/tP PQ lP Qp@>c 0 Q0` 6 P\P0p@-SG@`PU Q Q DP<?Pp PU Q 3P QPU Q &P QpPQ P Q/P p@>  0 0| cA-PP4 Qpp0` XpW*@P&  P <V`p p0 8/PP`<``Q# PP P 0S #P P PP@ @ P P 0 p@-P@PP Nk Po0@o@p {z011/A-\@`pP \1S 0 €  P 1<P1 `p P 0808 8A0 $$0$ $B0  0 @-@^ P ^%QRS  T00WNQRS"  TŒ 00 0 Z0  G-@R00QP(M P 0 ` p Pl ` 0T?o20S00(Ѝp`0 0 2/ / /    Q /0 2/ / /    P /0     Q /0     P /p@-@PP`(M/ 0S, R002j$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0M P0V00(Ѝp@ R 0S V000Q000 00/@-@p00T000'@-@T @-@T000 000S/@-,j t000 000S/@-j t000 000S/@- j |t000 000S/@-i <t000 000S/@-it000 000S/@-it000 000S/@-i|t000 000S/@-i<t000 000S/@-it000 000S/@-it @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#۠D 0 01/001/ڠ0 01/ڀ0S@-@1/00/p@-P0P0 0@0PS` XPpdmp&it/000 000S-/@-i-t@-f000 000S/@-iPtAo//0- M 0 Ѝtv- M( Pp Ѝ@tw-Q0 M Q Q m 0 Ѝ 0 Ѝt  t^0($/0(/0$/ 0Y.<+ < 0/(/$/R/-ptx` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@&l P//-ptx` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@Psg80 0 @  0""048# /UUUU3333  ~X: S@-v P Sd0 V Sb0?0 r-w - 0!= S U 7SJ @Sx00 r@-@w- 0`@  RB R7 Rx 0 r-w-! P4 P. P$ P x :0Rs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- - S0S t T A0a0-0O-=^ApP@8 E_P8  v^pP% 00=^` 0@T hP0=S AP` AT BX ! j#_^ 3k00C-@``"`2`M 0P$DT@Pg p`XP `@\@h@d@l@X4hpk p -hp` o{{o{$P  {p[ p0 0S08@R0<@@@@40040J'4''0o'^L1L0 00D000\^:'X  #j0S ep@ g g  ЍoЍ @j0 0 g g g O-p`M@ eP-TPn +T@`0] ? 00e 0e P p   @00Ds \a0DSW0DA0DS70DURY :P Q   S  R 6j "000R00S 0qS 0F0 0 Ѝ0S R0 Ѝ0T W 0p0@0` XR A B0A PR W p p88@ 0`W pp}0@-BR"^L M @000 Ѝ0@E@Pi00TP Ѝ0p@-BR"^p@1@Pi0T0PpO-p`M@2dP-TPn +T@`0] ? 00d 0d P p   @00Ds \a0DSW0DA0DS70DURY :P Q   S  R ^i "000R00S 0qS 0F0 0 Ѝ0S R0 Ѝ0T W 0p0@0` XR A B0A PR W p p88@ 0`W pp}0@-BR"^L M @000 Ѝ0@E@Ph00TP Ѝ0 8p@-BR"^p@1@Ph0T0PpO-MHP@0@Q0@0BU PR"S0`8?/%1R`:*%6R`0$S``  P01!%?R`d 0PT  `P< 0PT  `PX@- M|d"{@{ @ 0S D <0 0 |0 30Ѝ 9$-M{(,{ Ѝ 0 0 9/ANm00/G-pA`BP@Q# Q J.XP 00R B  P1Y O-8H0@p(,M@P R  ( @`Q l( `(``  @0 <YPT0+0CP @ p@ z 0  0 0J D@@Q0 Q?0 0X0-SQTt0 XP0-S`0!000 ,Ѝ$7$070Pt v` 60  `,Ѝ 0 @ @D@B@@0尦 :Q` +@P+T P WV :\ 0S0008Ɵ@ 0~ ~ -Q & % $ QL `=0SP0 AZ pP` P p 0PpU  AcPiaP 2 y  Q Q 0PRUpZ p0Py  B` VwQ| $ R :R t X00 RP$ `0`0+ C% :S& V;\j R  ~X $ # R :R #0 t0W 0 0+ C0:S0:` R :P  X 10H3H0   R   # R :R  ; "0?` FRQA 00 `S``P0S  ,Ѝ p0Ph 0` 0#0" R :R 0 <00 0 ! R :R 00V ! R$  p! R :R x0 0B 000 0 R  W0!0  R :R 0 00+ C@00@tY ` p 0 0D0G0N! 4,((DL4Dt x@ w\8 vt u uP t tdO-2夒0 \p`" P@T60ll R01-[@@P-T@PA T" RPP KRP? -@DR0P  :R7 10 0S! 000PP@:T0S! 000|100S 0:S w\ T0?@0S01 0 0@P 0:S  W $ 00:R@ 0S I 0P00P0 0 Qh0h 0 |P0tL0dP4 㒹@-@-\ \ \  0P01 0  0 0 ?R s 1 0R L^0 s 1# 0^c00404 40 cT00@ p| \ o`G-P @p0#03w0q0W`@DT@!  tZ 0R ! 0 dP   Gc0@ pQP@-pp M P@P `P# +{0 @p{0 PP X Ѝ4c00P/c0`P'c`$c0P`cP|t0 0 X-0   XT0/o" /B0 +B/o"; &B0@-M 0@1PЍ0 Qp@-@ 7T00QUPQ8Tp *T00QUP#T00Q1R ! /A-pR P@a@T T 1 !03/pWG /p@-@PtT 0p@/pA-`Qp@P RpP 0开D00p 00$`,@(P0Rzb00A-P`p@PB 0U0" V W- p`Pp`PpP, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`P.b00|dXp@-0`@1PSM ,0S  Y$0S Y ypЍp0@-S @SS0 P @0P 0 0001 1 00FSa 0 p@-0`@1PS ,0S X$0S X{Appp@-@S00CS00 PSpP--M  @Ѝ Ѝ/ -- M0 07@ ЍЍ/0@-0P$M R0 P0@S&  S$\0  B!  0M$Ѝ00\ L000 0 PS@$  (ɈxP 4000S$/00//DP(A-dd 8MP4`P. <<  Q S  @2 Wv\pU 0 0 40 30.8Ѝ @b\Up  hW@p@ pW /^PX 0 L  @2eA\p(@p@ <ڀ\|,- M ЍC-p`D!D1 !M0M40<80$1 pP4u@P 0 0 <8 303!ݍЍ0 U`  0 @pPP@T Cnt` 0 P8TtP]P @T@~~, L$C-!1 0!MM0<800 Q P00400 x1@`tP@p4 D1pt P4000 $ ( ,  0 0 pp~PP"@T Cnؐ` 0 P8TtPc]P @T@0S  M~d L0 0 <8 30 !ݍЍ800y~( ||O-ğFM M 瘤dčĝZp@TX (` 0F0;d 0?P0S  0FjPU 0 aP(00B`P $PuPp$Ug ,Pg(,BP '$U , Y "2 0 d4 30Fލ Ѝl 0 P1`L\P \P9 / qP @@U  =`W< WH 0!0 0  `+1 ^0 U/PttJ0$0SP / q]P]0#S PU 000C00হ]@p Ph4-rP]@P Pp P4rP 4 $ #T #T0S000C00  0PP400p#h`0 X  pX0X0H@45PP|]0H }Pڶ5 (0pC 0PU0Pq0Sh Sf PX  ; PX  3$PX  + EPo4 R1("1 0 t4 30oGލ Ѝ0@']*0   @ 040040 S   P 0pW 0  0   4`HqP P P৸\0S ,00pl`v TD\DT\$(@C-`@!p<1 TM00!,P@0L00 |0 ptx00000 00  $({P!Q P,P[PRP0 !@z` P0 0 L0 30 TЍ@z (@ ɜ\-MЍO-P`! \M T !4@  pu0戀倐儠0000 0  $(,0zP80Q ,  zR>P 0S 0 @pz 0 0 T0 30\ЍpN0 @@Iz 4ࡷ@, 0-MЍO-$$M  Go g-0\P gIPi 1 S S   #@ # Sa  0s000 S ST S0 R R R R B RQ@  BQRS 0S1 @+S7 -S[QUp @Us0S 0S 0 0_o0p`R0+S4 -SF }XPPUpw[ WPW Pp S 0QUp @U40Sa QT 0 0_o00p+SR0S @S#0 oPP 1_opR0S @S&0 [PP` _opR _op`RU2 0 0 2 30ߍ XPPpPp py S!@=I E _j$ ҐR O-llŸpd2 MM0ȍP`&N 0AM.0; PY \V @ +P+C 0 3 0  0)P@ @@P3H0: S4 d10@\! 6 h  @-@ 0FM M 0 `0d40p~ PPd@"+ P V0@V @R@ 40 0 d4 30Fލ Ѝà@-p`Pp p0dM 0@0\00~ ~s0 (0 0 \0 30dЍu˜T44@-<@<M@ M0 "ЍhP1Spp//0@- 0 0MPQ000@  @@0  @" 0S0(0L @0 0 0 30Ѝ0)PP! ;G- M砐 p@ e$U[P'0G T09pPUo0 ;u0+ A@P   U0 U -V0PJ(VTP "V0@?V@  ~x p0 0 4 30܍ 0sLP%p x`|P0 - M Ѝ@-dM @p`Ph h0 00\00T c?0 (0 0 \0 30dЍO-/? 0M000T@@P 0\@?T P @`DPPX@*p@@$@``@n*g\ !4peq(p` eq'pd(PfQ }adP8`da!<`hda& g! `dl@( " .%pPm` ,* )g  g* gtp捈@$@x@f ,譊h%fQ(! PffQ%|` . Pj(]@$ a,(@jA!@jA$͌@e! j  "+&0p'`) "M)l. '/.e,$ e.d, e ! ]P P!*L  ( !$(*((**( ) ()H' p0p ))''p, pL `&" po&` o&p p`(da `+da&++`pn mg pdq0 *@* O*@,nA!@͌pnA$f!@ M$lnq fq,p?菠 fq'f1/(`/"Ho"_! _%,p% (( P !d!,( 0P "! ;!`$dQ  P%P- n (]d,b!On"@!O O$$ @ $@  ͌O(e"nA 韠@ )..))), le,O@( /aA,e!@$`_@a! P " _%_% ,_%,,0_%M Ph _aQ)_%(!!-_%$dA_%%Ph$_P+❉bQ$齋i P%0韃h P菃b  )]O坉$(((O$O$O$@kA b@$ @/(/" (/" , eQ( (/k% (/k!Mi%_ 䍈 o%dA_%_%i!$ "_% $o&& o PhQ$iaP%Po&o&0*o&-*`&$ha 矃`&]bA `(m@$heQ b%O)@@,捈?b1/"''p . p/".p /"$M/"(  h / f%  &h1f1 ?0dQhQd10_fQ``1d1`QP 0Hp?h1P 0m?#,,p?# ]?#?#0,0n1`1nqp?d1Ϡp,(0@!?!$,,,0fnLf}`efe獈n@gegf(@!!!0@, ,! hghA@e@H`,P!,_,!!!`h`M PgnQ`Qn_͌hQ dQnQdq p_`QLp P++,P   $lQ dQl_nQ _._%_%P0P}.`.aQ.lQaa `_dQgAaA`gQPOmlA(P`AgA` OaAO!O$O$! ]!!f`$f͌菂g''( (''eqfq(e `qlqeqlፈ,fqaalaaqpoea`0p_/l!%)_% ''(0_%_%Ÿ)'0'韌 +4$0 + h1a10h 0m`0韌h! a " =f 韌h!  -c1f#韌( 蟠 )((,돌)돌$)) ppfqb1#o0#0&a''ppꯌo&bqb!! "= `!-!c1``#O @ b1# 韌0#abb!!(p뿌0 "= `!-!o&c1`q `#  b1# 0#abAb!!_0 "=P `! ,p!-c1ό``#b1# 0#0XZyn롏b ao&bpb!! "0= `!-!oc1`a`# 8P͌< @@nDPbb!# "`0 0m0 `0 0 30ЍE0@-((( (@( @00gE#ͫ2TvA-`p100.!0% "q0 ?p0%0?SP@@g ^H0gS@pG"# ` *0S@@:`F AEHp@- ! 1 0M0 00 P@R00 113R0 0~? S `` 0~? S U PE0"0 1<3R08 (0 0 0 30ЍpTp &`\0@- 0 0MPQ000@  @|0  @" 0S0(0L @0 0 0 30Ѝ0)JPP %dG- MM砐 p@(e,UP'0H T0:APUo0 ;u0+ @P   U0 U JP0PPTP P0@{P@  } x0 0 5 30܍Ѝ 0FPPp p`|P80 - M Ѝ@-lM @p`Ph h0 00d00 <0 (0 0 d0 30lЍL 0 {,!0 { / gE#ͫ2TvO-tM, l 03?0\ 0 Pp (0 " 40*i (0 8` h;" 0#0<8i;b iˌ! @D`ah`#h,bhD͠lbˌ Pb+`c! . `P% PH`b,`+` ak,`&iKL` c c;lk"`&0P`;a;abk `&T`lhlˆ`k#`& X`ɠbˌb+ck! `& \`b)`+` ak,`&``c c;lk"`&0d`c=a;ah`e\bhl@` `@$e{@bk `&h`llˆL`Kbhl` `.i pp'`#. 0dkŒȌ̌iˌ pzhlpbb+j{c!, `/&hl̠L`ˌak. `ak&` p@c nk,`nk&c0c=da;lk `lk&aa4n`k#``k&nXlck!`ck&lT`bhl`kk`Hʠi`ˌeka. a)` 8p'⢘⋜搉e pxd[f{l c P(n[,Pn[%c 0\PRX\Pd[@踠jp '<SNzmv3he;#0T0 0g;)0隠l c{0P $h{cp0fa"a(f `hHekb.b(e P]@a[n&an( h4bf%bf! Lp `$ P3 * 0 0 8 30!ލ Ѝ"9p pPT s>P* @D@0*)6G HtHJp@-0@+@PPpG0PpMC-DAP@0lMSG P>qp@qD mD`$0` (`dD0@@P#@XDTD`$0`(`KD0@ @P 0@>D;DlЍlЍ'r'Q|QHB@@- M`Stqt1pP@P`@@T 0Q }P Ѝ$ SP @ Ѝ@ SP"0S- -S?@0 0000 P  U RP +R@@D!0DSX SP0S +S!@?@!@hHhxX ?P L0P00 1 R/@P/!R/(0 @>R0 00//H@-M Pp @D`P`W0D>S 0!3100 0CЍ>SD 0!3100F00F00/-p@-MP@U@0 ` ` /Px0x 08 R;0Ѝp@Ѝ/0 a0( ( LeLKLD@-=Q@B 8XA^^14/.-,+*)('&%$#" R@"    +S@ -S =S  +AR@@@-R@  ++   @      0RuS/WS^0@-X0CSMF <0 à 0R ^ @@PSPQP@^  0  0 uS0WS+S -S00T0 0 +S -S/0 0 @IO-0wSpLM 08@ (P(0,0004086 0 0E @ |>E@TnL7 `0p00000  0a0GS^) $00+W@ 0-S4=W000 0P @X B R f ^XS  "=W  R!   P:0$`E @ >E R$ "@`0   ~ Y 0 S:$`Dp@ =D0S$ 0"0C`ኡ0X  X   pW ,WwpPXS  Z0$`D P $=D R$ "@`0   1 =Wr +0G?oY20S ZlX 00 00X00 Z$`DP =D0Sl$0 ""@` 傡 0T 000 ) HR;%I?#I0!0 HR<IpD0 @@0@0S:dD0"SW  T4* 0 SA*"-+ @ LЍ'pC=W   00$`>DP $ =6D0S  $0""@ `Ⴁ|)D00&D0@!D@`LЍ舁$`D P $<D0S" B`01DsD00 0p{+\-L +B XR R  +B0 -R +R XR 0 -R  X@PPQp~  0{-M  {p`Ѝ  P 0 @-OC/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`1P+1U PU  0  P P8C0@US1C@PPrUP ,000p 00W7(p@-0P@`T .@T0rS &Ppp@P0+Spp@FPp@-@PrQ` "0  P<0P0 `@p0  PEh0@-\A M@0 @f0P0A 0100S6p@& P 6 00 00S00 Ѝ90 0 @d0B@n6`0 00S UzB@ Ѝ4( rLtMTMLMDMH@-0A M@0@  0P00 000S.Gp P 0Y0 00S&0 Ѝ!P2Bt0 @00SHF$B@ Ѝ0$pt@-414!0pP0 MS'1@T0 `0`S$ @0SV+ 000S"PA0S%  '<p  Ѝ|wt0@T0S \mA00@e40 0 oltBAhhAG-HM`0 Pp [p@ HЍ@ <pP 0  p Cp@ `HЍpA0S @W]!0P R)@O-4MX\`@\. `0 Q 00$0Q` 0$0ZMZ0I XG VRQ  0@ p ,0`0t40(0X < Q0P jZ  p@a0P E<Z00U0S` @ p,0(2# I 0Q ` $ X ( 2@0 $*&  # #. B@T#0#"A $1?Ϡ "!,7p# 0OPU4Ѝ<0$0k30$0d30(0 F^ +d0N Q#0N0~20ST  p @P p`!; Q0PU P ` p@{ P|Y $:600"0">0C0T! "1 #1O"!X00$0 0(00/2#D!0 P|Tx0T$Pp /A,0 $10X00dp,00@tdp ,0;00S0@$ੑ9$0APX00A(0儐I P0x 0 P8P8P6 zGGlQ\(\)N 8 iL4SQgK O-p 0࡟MW:Pn @T) QT/ T P" 0 ^_ S^ЍP@T T T@@TBp^ pQTp0 p0@`PV@@@@ @& @V @Pp0 VpP@0`V 0 SV0Sp#P0W p 0`@(pV*?[!]-E@-0M0M040K0s0S0 0@ $03/L D0 0 4 30ۍЍ@Tdd`G-`@``a V00 "5FPP6 pP@ 0S? 0p R0CÐ@P0 T  0s0S0 0  0  ! Y*o`@TipP Y  !>>00O-XXş MMMč<ş尰 TDp`$0>T#*0U@@ R R00C?o2 00⃰0S U0 S0E0 $0Sw0000Sf\0+04 0@ 03/0S| 0@4$ 0000,00F$0(@03/P   0S00*  0.S @ T0S0V:0S 0S  ,P8 * R ZP $0DQ/ 310 D1 0 (0P00 0S  0P80: S 0" $2 MލЍ0S} 0   00s0S0z P@T  0s0S0f=04/P 0 0Ef00m0   0D y 0.Sv0Sa 0. Sp] Rv  @$ 03/0  00.SJ Y P 0 D:P9 @(  2/0B 0@ 03/=0Sx 0 fBQ=0/(0 0@  03/0BB09bbp*$_O-pLLŸ KMMčؔܤ\0 /\@ @`P\/\P  `W!1 0 4 30aKލЍV4/\ T*/  0/\W@P P`P 0   R  ; T/R  * R& R 0 0 0  0/ r R @  (03/0S0: SW/80QK0</8 `0] \O-@ş5M$M 00000~S`P <   pH 0/SS;R 0B0 4ZS 0H*0; P4S 0 0CPR IR*0S0;R 0X @H p S    ᬓ嬣嬳*S1 s00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QT Რ@  P+@PW |"h2 0 0 30ۍ$Ѝ@\0 D Sn 0]S2!^0100]S  s000-S]Q q0]S  0@< 0|10s  0BW 0R S0BW 0R S@b 0 Qy  001A0 'Y0  p:-0PD0H*0 ;FP 0[0!^0  @'Q@f@dSZ?**X [!-]O-QM@`pM  @ |2^ @P}\ @\ [\ {\PU PE0]\\ \8(|PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S00 8(# 0}^S0CV  F B   2  @ ]RR ]RR zA- 0` PpM 0 S #0{S @ 0\ @{\0 pLP Ѝ0}S0S ЍA: 0 @-`M Mp0 00000  , 0 @;S \0 0 ލ Ѝ@\ ; \\@\ɌTD P\ލ Ѝ@\p@-`Pp@0T1@D 0CP@DP @t<000p0 S. *S8 ?0Cs\#S 0 P/0S /Q 0S 0 0/0 S/@-@"S,$ \5 CP   @0S# 00 CR S 00\S 00@0#000"S0 @T0p@-$!$Q$1 P0 QMMR050  0 0 5 30.QލЍp , @ ` 0 p x @EO0  \ PD04 P 01N<!M 1,335C-0$eP`M ;500S xE@ p#S"-V90 #P$ 0S %P @ 0S;90SЍt `p  0@S0 0 40  0Sx t倄倔p 0fS0fS 000#3R0 4$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 6P 000#3R0 p# 000 5P 000#3R0 # 000 5P( 000#3R05 " 000 0#S 20@ R@@d&P00Ѝ0 S S\ 5P 000#3R0 " 0@00q  5P  5P2 000#3R0) ! 0 00T 000#3R0 ! 000ElP XN0@S0 @  c5P =Q% 0P0 0 Q5P =Q% 0P0 0 0 @00 ͓L|/t/x/|$XX-@,,|@, l++T4 Œ++`p@-PP5P f@P$PPP 00p*xT*@-,@@P00O-pQpRpȟ MȟW ` S@P < E)p009 [W @7U ((8 0 0 30Ѝ hs?0t0h ⸨p 00X 2 EUV 0'02f11 0(00pV( A8( ,0Np Pp?7<000S[ 5700'0Q'@.7@Z 09 '700'p %PyZpR '0BqQ #S X BqQ #S Y BqQ #S ^ BqQ #S [ BqQ #Sz Z BqQ #S  Q BqQ #S P BqQ #S O BqQ #S* T BqQ #SE U BqQ #S; V BqQ #S1 W BqQ #S* L BqQ #S M BqQ #S N BqQ #S S:U 0'0S" R! B 0 P 000'0  0'0 F  SS0,'Z *p0S u600 '0'`l6`W 0 \[ c600'0'@\6@p, 06 @n  8# 00  '#   2000s0'0"   2000s0'00'0p#p0840@ 00@0@8040nH  P;00Sr[t+5h500d 1i  ̺'c ú'Z0`000`0 0SpC| `  pG⭺w0'0@0 50SpY00=[" y0S0 Z  '$p&`00C0K  ~'pppC[Z P;0 ;0HEEET$t #@T# ""!0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF1pP P ЍpHA-A@0`S(@@Q0+pPpPP @P  &p0 @BAQA3M@ p0 p0 4p@-p`pP`P@T T0T0 R@@pᮺP00y8 A-P@P`@pk0S |@@'0 R"@`]+@ႺP0040@Jݬ  pd@-T 00  C-`4MP&@P 0S|0V ! UpЍ S0P;  =R6 0Q*G B&R&>$#"M = - Rp㴀Y WꘀqvK SБp0X{FHۏ  08  p7|3L0O-,,% BMM $ %u  %p 000 0000+ 0嚏P 40 4mP P@\ P 0S l400#S \ P 0S 444d0``\ P 0S 4d0``\ P 0S 30   \ 0P 0S c30\ z0P 0S |c`30X3PE0 +)@3@0 0P`\ _@P 0S .PP[[ 0P200xS0xS0Se "P2 0 4 30BލЍlR@P\ *Pq 0S @200#SF \ P 0S 2R0P\  PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ 0P 0S bH10\ 0P 0S b10 ! 10P 0 $0000 0000q/P70 8 4 0  X T  p`D4T `4 T PX4<xh$p@-d@@0S P Hp@P@P 4P p| p@-P@P0 $S ȎpPP/P TPp@`@`P$Tp@( p@-P@P0 $S ᛎpPPl/P 'Pp@`@`P$'p\<t0p@-\PP 4P pp<`<`P@p @-@@P004O-LS$M O @p(60P`U 0E   5000s 0?SO Sm *S00 *Q @S50*QMU 00  q*QA[SU \S0  0 @ Q8 $Ѝ?[ [2 *[ @[[# \[0S @@0S /Sz .Szx 0W s 0W/Sp.Z_ Q /Q $pP } /P P$ЍQ /QV 300000  ^[![00 0 00 @ pp /S \S@ S -RH P0 U@ ᱠ0s0]S^0 p Su tn p) 0Wk  0W/Secp @]U/l2000 /WU0@  0s0U ᾠq]QQ \Q  @P PӢU@  qQ  @@  0\ @@! q p[Q @ 0 @0 C0 0p`@0U0  zZ 0 P/ZY  /( Q /Qf 0000. @0dP@-@ P D0 0 Q 4Q?o2c ( p@-@lPf-P X`-P T00pT 00p0 0 p  O-0p M @ٵp` P 10230Y ߍbPT 0 ẵpI  VP: [ ; 0` 0P P) @@ 0  ᤵp@ 0 創P0P S P & ">0 "C 0 ᄵp@/ -RE'T&O-0p M @Qp` P CA10230Y ߍݿPT 0 2pI  ѿP: [ ; 0` 0P 9P) @@ 0  p@ 0 P0P S P & ">0 "C 0 p@/ -R%@$O-0p M @ɴp` P 10230Y ߍXPT 0 ᪴pI  LP: [ ; 0` 0P P) @@ 0  ᔴp@ 0 yP0P S P % ">0 "C 0 tp@. -R;#,"p@-T@0`P@ e0P0S SP p \p@-T@0`P@ 0P0S SٳP p p@-T@0`P@ =0P0S SP p 0 00 F-H- M 0 S 0  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/0-H- M 0 S 0  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/n@ -- M0 0'--M  --M  A-`hpQpP @Q ᗽPD@(0 0000A{]0P R   0//hO-(ǟ(7 $LM0 0D00P6f/0 -0 0 A0S 0* R 0 :R|R P|F|@  ` P P P4d*PuX00X0 : <P % X00X0$` p<E$0 @(0p$0 00p5$ 0,  pl5$ 04 `E @P)D ? 45 0 ᭿$ p$0% ,00 D@ 80wp840$4 0<jp40 _p40| Tpd40X Ip@404 >p4$0P 3p3$0T (p3$0 3p0`0*S$ 0P3 3 3!t002p|,t6p"t!,̠:p<#tp` t0448",#< Bp0@a@P8 <0@(p ' R E8 @0s@qTP?  A@=@9@5@1@p (   p$   p $ R  , p ,(pE pE  P KE 弾0@1 00Q`BP#$#< \P00 1@p0@$0t@5T0dAd1@00噾L!x0 0 D0 30LЍ hp  1"0 (PX00X0[00Xt0L DXd48  (h\@0 4VEW<\p@-@P> 0S0 &0@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!T0h0p\@@PT '"08@@0/S(@@ @@($dA-M@Pp&Pq0PpC D!0C `0 00   ! 0b0C S0;.-,+0)('0%,p`*0 s0S@ 0S 0S*0"S D8#Ѝ T1r0:*00Ѝqv{pt ͯ@-@P1 0S* &@T. 0T)  /Q0C T !@# *0P@/S x0 B@T@!h0 0!  T <@0@0@/SpdT0{-DM  {000p 804S DЍp@-`PE p' P@ ְp V U ph1UX Fp` "VL@ P?o?o 0C-@c^?c%^& ^ `pCc&Pc2681E270G2&0H 0./ "0;:(0C0 /0 @- /0, 0-;BP @@ 7[D0 0/E0E0C004 0-;BP{$@G{6[D0{7P/ E0E0C0!/0Q Poo G-@a^?a'^( ^ @pAa&`a43V4X4G0Y@000?!1?1>4!50;:(A100 /0 @- / k{0   ;B 0/AC0C0 [k{${@{7P/ AC0C0 Jt@ @-qq@ Ji@ @-fq J3@ @-0q J(@ @-%qPP `:@-&)00 +?0/R//R/?0S/R/P/R/p@-PMP`V ♺@T 00Ѝp{ : {  p@`($ ` H 00 R +,@-(00 0S@蹮H0 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"QI$\)P A-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PBPX `#@ 4PPY  @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍPP @@ @奵0(@$0X4O-\ϟC 0C,0  !/"b!!A0,0 W0 0000 0YWP 0  R0( SP 0 00HWz 0AP(0PW%S(Pk6 ,0 6,0,0 v>C 0CWP0(Z 000"0W0QD6 0 0P( 0, ,04#/A!b!b0C P0( 4 0 Br0 S8P(P1W*p 50 ,P(W0 00W =0 P( WTWp ;0 P 0 0p S0 (0W(Ph 0 P(]c0 , 0PS( 0$0?2c1, 11,0 020 0000 0 ,, ,0 0CP0(J 00000 3 ,, p,0 0CWP0(000c c0 ,_P([(P000yW0T 00. 0 GP(1 u  RO 0s! `p0@@v0 @`   ` @aKal B  0 B0 V PKUS ZSP  @ 0,"P ( $0 0 R0Y R0P ,P\ !/#b!!0"A `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0,04 00N(0~0 S!0 @pAY_"pG@D  W@ 04 0N~ Q @(0,P 0(P00\)P\( p L ~Ql'I$Hn t$ Q(PP @ ACLC|q \^JS S 00#3P0z z H/o"(PzXn|TQ(P7 pp@*CP(!B0pu10 B0,Pp> ( ' Pp#/"b!C;R, a2ba126MP P(P @ @0C2c2c2P$00( (0 00 @ 0 @Q ,0@0S} 00@y0S 0@r r,p0 0P P(00, 0C$0(^3000c^\0M0cP$`jP$`   0P  P(00 , 0Cq$00(06  p  0P( ,  #P ( (0 b$ 00 0M0Ѝ(A-1@0QHPP P MK Q$`10 P1#L@p P@@ (. R! v P`HU Ѝ0 P0  P La@` (U"T 0 Ѝd   0!"00 n n*ِٜوfffg٨\\@-0M@ g0P 00Ѝ@-0M@v0P s00Ѝ@-SP@gp@-0 00M0,00`P @  P00Q Q Q 9" 0 l d0 0 ,0 300Ѝp <婨 ,夨 埨,t,t,t0@P/ P @/G-X# `paV@P0PES  R  D0PEV R  SS0@0D@R@- 0BAs @Q 0CR !@O-` MVP ? @P>  pP9 0p01S Y Ѝ00P@P 0 0P l0 0 =00 y{!00]4RQ@-M S@PЍTT c!@VЍ[! 00O-- M Mōll PMP` @pYpB @\; CX0 ^00pt徲0 O00 T>/ q@0,  (@P i Px d0 0 5 30 ݍ Ѝ 00@ 00 d h0   M Ѝ--M  Ѝ Ѝ/ -- M0 0o ЍЍ/O-R @p` M R00?o00P @ P 00 P! !  3d1XP5   hVP W9 V[XP0Ppp`0 0`f`0` 0 00 Ѝ`pP% PA0XP C0PP00  ЍհpP V ΰpP `P\@-@ M(0S2 h0 `0( `1/pwqP0)  0 0 PUR <0PU ЍPpTP 0S  0CPm 00pPd@-P MT(0S:  0 "p0( p1/`vq@0/  0 0 @ToR <0@To:1`V ЍP`T@ 0S  0C@oT00000 R/p@- @Tp0 Rp0 0R0 o P 0S P0e 0c0(` 0P0 [0 SV,P R4P N8P Jp@GeEp@-@$PP3Jp@P@@- @@0J@ p@-,PP ?K@p@-M 1!00P00S p  0 XRp p 0S= `@@ W8 CR87!0A0 S0Q\.*L\*\ ( L0 s0QW   "Q @\ #R.SA a  00C "\ #R Ѝ`0@04  R  *4 8/Ü 0X\S 040:8 R РS /KBx@-@`PLpL0ppD尀 T  X zᳮT@-P`@0 p@-H @~ \\\%p \!00pq`P\ lrTI`70000E00p400 00p#V00 0@0;V cQƟf `sdQ 1^01 0SS100S0dQ Ul60100 V =V V 0`060000  m 7`Fv`000b`00FQ00100C0z V V 00o 50000  N70Fs0 0^L 0 0   00Fs0(% 0W0Cs0 20L0?Q000C00000=-Q003 ^QU00.00 J 00Fs0p0W0Cs0 000FSE0100C0#Š,\Q \%Ao 00&Ao  00=Ao#` 00. 3010@S#;V d30000 0!00C0`` 0AnSrXGFEDCBA@:gSJIC:-$ 00`F`0]00Z00[00R 00S 00N 00I 00D 00? 00:005000\00+00 cQP_dQw>0`Fv`00Fs00<00@J00 D \< \8 [ XO-` M [P5 p@P@ 0 D\  QA" 00[ @U 00L00 Ѝ0SS0Q00A0 Q0E0500 S 0  00  A-R@P0`Sp ""#b! DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@R00@1003/P(!p0 $@ T0V0 p00 R (CP000P3/P" Up  R  SVp  0ST?P000U H3>/zzz@yy=A-R@P 0`So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@00@10 03/P(!p0 $@ 0V0 p00 R (㯫P00 0P3/P" Up   R  SVp 0S㫬P00 0U 􂌿xphx<w|wxwHG-@P PQ`P (rp^u  0F0\c<!"#b!0CaqV; Y PpY` $00100S p '`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(P`0003/P 0 p 0000SXP00}003>/uu\T<ut=G-@P P`P $rp ^t  0F0\c<!#b!b0CaqV; Y pPpY` $00100S p `1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(iP`0003/P 0 p 000$0SpP0 $0~00ts,rrrTHSR: G-P0`00Sp 3/0Y @IOP x T 00 00 Y @IOP e T P00 D0D 0 p`P/qTDpSR; G-P0`00Sp 3/00 Y @IP 0 T 00 00  Y @IP  T P00 D0D 0 p` P$/ptl4$oO-PPM M Q@ \ /\C "PyvP8p/\ @ @. D\k `P /RR.\' B Rk/0  F0 P 0E PYpE 0: S 9S0/\0Sw@/\` FQ .PQX 0t/S0W0MʨP !P uM  \@  +/\p@` @xލ Ѝ.<0X0/ލ Ѝ @ X 0/ ?   P@Zz00 @u>00 @p?00 @k00 @f00b00p@-@P Q `Pp`\PF0@P QP`V D0"S p<00p@p@-La P`M=  00QP0姨P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P ê 800   0 @P/:P-0SP S:R S 0@S0S S P:P@P :R0P:P 00/i0@-@A R R:\|\00\0S Q0A|R  :RRO-ǟM MtDčpĝ!^ $ 0 ^ |G@PU 0P0  ާpP 00S D  R&' Ψ0 00  PK0K0P000x` @ Z0P@0 S [K :S`\ \S S S`0UD*Z0+ P 0@0 S[BV`P0#SS  [P500PS0O0SE0AU0:$0p%x5 0 D4 30Aݍ Ѝ:SV P0U:H˨PPE" pP`PEV  00 0S gᐩ00@ 3pP  J4@00PS0 00p4 p0040(0,= Pv :SL 0@S t40@0 0(<P<`4 pD pbPX pI  :S2 0S 0IK 00S:S:0 0pK0HW# 0 E 0  / 0PCKPp`$M 00CiR0@0B HPEJ@D0P P @ :00`0000 0 0,S p' 0pS p%0 SRF 0@ި@00`  `3@ɨ 0<40N04P80 0 `6/p P K0C 04 8 0S:S X< H R0 0  Q!000M P@04@@0]  x0:S X 00UOPK0 S:S008$ 0S:S000 8HtsL0 00 -H-M0 S0 00 0 0 0@  00^100M 0 @R0    R L00 @ 00 0 0 30KH Ѝ/᣾4@-@0 @ @0.h`O-`@$MP>l20pW^  0p0 u0?10X@P Zp ,P p J  0J0PH0 S#: % U10 r 1$4S1$ !t@00H H0S "<100S (!0 0 0 306 $Ѝ U r pP Р P 5SX0( ,VT00#    mPH H0S\Xt|QL +ˠ@-(@M@@0=PЍt  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A@{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T P0 0# 00Ѝ 0Ѝ0-$M  00 0uP$Ѝ0-$M  00 0eP$Ѝ0 -M 00 0 TЍ y 〖0x/C-@P sMXp0^pAtAԡ0O0PP P{0`0>TA{ h 0 $@ @ 40 0 1 30sߍؼ P0   M ЍO-ϟ MÍ000PQpZ P   y P0%%Z * 0S0 R ,/$? 0 3 30< ߍ5P0 W P 0C PS !000C 0 `0zSN~|{oyxwvus1jh?*c_^\ `ZEU000 `0CP0PE 0SF0 0C0000 000Sw0  IY 񏐕r<pP0  P 0P0CS0000 @ 0D SB*r? (0R0 (0 , 0C$00 40A@QPVo`^ 0 S0 00 Y8 @@0 J P 0C0@0@ @T  0SP 00 0@0 @0 0CP2 0S0 000$0 $0S0 =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SP P000, 0@C0 <9T@!r?(0@0@ + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0_000@T@09S XRZ    0 ( 0         00 0@0( 0CP000&     ( S@ @x& YʱY  P rP @0vP" P 0 S0 0C0  S KP @00CS0D 0 S0  @$ 00S =P40SZ 40AQ0G 0Yc $ @00ESZ P 0@0CS0O 0 S0 G @0ES$ PS|Z| R0/ 0@0CS0 0 S000K @+ D  @AQ X+ @ P 0@0CS0R000 0XO $ +D @@P 0 R0 @NT9 0Tb@@P9 0 R0 $ @XQ[@@P   R @0 00K꥟? 0r?(00Y D  - 00S0P0SY 00 0(0C@0@00<000jS0,` `01D0(0H@V<  P 0  B0=>J(  r_0  p P p ᾟp 幟=>3PSq $0S0000PS`FP Z,`XT $0S0 00 00;0j0<00000:0^09000X  L THw r  0    0 P P  +" $P0^Z``,40 Z`I` @0&0,(0( =>0#C0,`-QR ]QP @0J Q  ,` 000 0 CP 0 0C P0 SP 000;000;0000900000000l000090 00a0:0[00WqIT  ,@  BR 0 R0 @$P 0 R0k @X;"  R "  R1XX  P BR@ $P$L 0 SI 0iT nT  , BR@ 0Z0K @ R񏐸D" AR>  @ BR  0X0@ NR-  @ BR  0X0\ $@(T  @ BR  0 R0 @)T  @ BR  0 R0 $J$0 S$@5*YY0$ 0(0@T 0V040 (@) p`00 `500S @0S/ 00 0;Zd P 0@0CS0| 0Y0  @d0SNP 0Z 0aP 0 S 0 p00 00W 0*@ =. #RR @R  B   @ 009 @0=>03SS2 0@T0C0000@000& 0SP @X A 00 000P[ 0XX 0@*P? 0 S< 0@@Q=P1 0Y. 0@ 1sPF 0 SC 0 0 (o P?o_T20S  00CS@0 0 S000 ႝ Pi 0 0H0 B=>  @Jr0 1pP P p xP 0Y0C P 00S50@00CS0400 0S0  @0\,p `0$  , BR@ t 0 R0m%00 (@>_00 P Z 0@00N,  ]R$ `ZzPp80$0 0 P80,  4`, rO<`T xP$0 0P(0080<$pPR 0 SO 0NP 0X 0$@4P= 0X: 0@PE 0 SA$P P<vP 0 S4$4I2kP 0Y 0$ @0]P0 0S- 0 @0I$P P GP 0 S 0@X,` @ tT/P 0 ST' @tZ ( S C@ SP 0 S 0 @000< 4P $PP @-P 0 S 0$@   ,$P*, [u5 0S@!0@3ZO 0tP@ P 00 0 {Z  ` `>0$0H00 PE A=>0 $ C> 0r⟛p/ P ZP@D7 0ST `Z   @DP0 T0C 0 p0StP Y ` 0@000 @(XZP@D`A-@P`pP0 0@P@-@`P MDp<@0p0 000@8 Ѝ2p0A-| !P0@0S5 0`1S010e C000PuP! pW@0PA ᘙ`PQ 0 00 @ C PC0000  Q  Q*RQ' <00@8 BP0P00`0s0 ޗP B/0 B0 P`p@-@P  q0@p@- $ M0@4/@PЍ#@Ѝ@-X0 T0M0$@ 4/@PЍ @Ѝ@-0M$̓0 $@ 4/@P Ѝ@ Ѝ@-@0\ \  M $, $@4/@P Ѝ@ Ѝ@-0M$̓0 (@ 4/@P Ѝ@ Ѝ@-@0\ \  M $, (@4/@P Ѝ@ Ѝ@-0M$̓0 4@ 4/@P Ѝ@ Ѝ@-@0\ \  M $, 4@4/@P Ѝd@ ЍO-M@DX@`pP# 0SP 0$,  ;/0$ 0H@ 4/@PЍ3@Ѝ$ @-$$@M Ѝ@- $ M08@4/@PЍ @Ѝ@-X0 T0M0$8@ 4/@PЍ@ЍH03?0/@-@`pPtt0l尀 FT  Ꮻ@0 ͚$ 3~b0rl0㥊O-ğM `@0  H 0P0 pP0ʿ00! B b09<Bp  UQPE @ 04BL3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b GP  00Ds0S0S0 S  \00t0!#300@ 00@00 @0`PUb*Ѝ@\ M00 P-  R^^? @ 0 `0  P 0J ZS0 0 0J ZS,t1 0000 Ѝ0S0 01 0000s00\0`0\00 00 00Cs0S  ``a00\0`0b00\0`0t00\0`0n00\0`0v00\0`0f00\0`0}r00\0`0w0\  @`q~qA- Q@Pp`! ᮗP=0D?o! D2]R0S =h0$"0@ !1 0 V V 0 P0 A p pA-P@`6Pp .T Tp!0D1(0D,TS0 pAl_T %(0$"0@ !1 6I pDO-ǟ UMLǟS @`|  sP㜕0P0 rpᔕ0P0 [00 x190 H@ U1 p00PU`p! X U0 1 #%P00? PP P5%0 4\PU`p0pGGq WP1 P! D `GpP- Ƞ  U0S V D0 G0CSax1  * 50 0  Rx1  ' 40 0  Rx1 00x1 00x1 00x1 "00x1@\00x100Ox1 I` U $`xPUO 0p 9/PM00`#3 0 L1 30Uߍ 0S IP/3#0 [ÔP 1p3p#pz0 [\ T 0 D⅖pk זar$00Ж 0S 0S 0 Y `0$0C04@@ ZP  YP 0S SXP p@Xp0p@/p@-P@YPp >p@Y Y0@- MP@{XP Ѝ0yYP 0S00 #Z0 0 0S /p@-@PWXPpVYP KXP  FXP p@@X0S S  /0S0/ R R 0 /0 0 /0  0/ CR  0  0/ 00/ 00/ 00/0 / @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030< SPE yYPA ~0S !1 0 3 30<ߍ(#@- R R  R pP& O R p  e~ 0S  % 0 0 4 p M~ 0h  O-LLğIM,M IM$J͍$@@Pp P0`S S  #3 I0$ 0 30Iݍ,Ѝ RJ- 岰RW# " " < J=00h#<0I8 00J=00|4 0 hP J- 0SJ=  05"I 0  } J- 0Sv 0S? S" UV J=00 O J=00bX> O<  RPf 0SQ |0S 0S  0S0!S S0S UVJ= 0 0"R #< XS) S LJ͍0 F:01 00000G0 ,0!OP @., 00SLP$ P P J=00X0  2RPJ͍P d, L ,O-\\ğ M@pQ4@0P0C`S,H6)('&%$#"! D QWX00 R04{ 0S SY^\#T3 0 0 30Ѝ4#(3 0 0 300 HD@pЍOQWX00RTVWX " 0 | X%:  0 t" |pP5T30Sy0S D 0" |PTVT00P00Sj!0 w|T@@O 00!0 h|piT 1i #JYyp`1``PP0 ppW 0@D    D|T00? pYp} 0蠟谟 P0 pY 0@Dm    $|T00? D |PTpyX  |Ap lpTG-` 0 FM5 P@pp, FP PV  PV> 0@Sp000 0q: 00  0P 0 0 1 30Fߍ Y:wp0SX 0S P 0 m0Ö A-@P`p 0  0P p@-MP`P@@P@T 0S  R0S ?PV@PЍpPNPЍpp@-@pPpPp0. AASq0C .S .R Q P-S.S S /Q P_S /0@-S GRC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ R 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0S00@-d!$M 0 0 AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S R' 0S  0S0S0S/R /0S S/@-/ 0  00S S/ /0S//0S 0@-P M@P0 PC@0S0S 0S Ѝ0/@-pQM @Q`P Q Ѝ0SS ЍS PPV0S S p  0`00S S<0 r P 00  $O-2MpC `<0 0SP0 03/P 0`&<00&,SS00 80R0SZ  RDp4pՔUH Y E*p0EP0pp (P,@ 0 C 0GS@P0 03/P @S 0P0S`SVx80Sg U" &<00Sj&<00SDv!P` E/o0"SQ[EoᩒRC(0SN0DY@0$P@C<<0D\; Y^7 @0C ,0P3 0P,0(00(0%SC @$4 0, 0 30ݍ4Ѝ[S00&<00Sc &<00Se  E'UR!`w [pG_0p(PW,@C [n H00P0 u!P`'Eo0婒S  R E/o".L2000SwR00VD4Q $0D 0 <0ARC@.@%D0.Jz]00S@@R@1D01z_0 0 Q`PM0 03/PE ;Y 0S=00 `;0D-<0RC.@S&<0`@ 40%`@ y0  0<(5$%0X0 %R (0S ` t 0 | {L1R .R00*R40`z_0 0 Q@P0 !  P` t@P  0 0R4  4 S Q 4S 000@0}QP0000S 0R $ R R $R 0@)O-Pğ SMD`0tpP tP $0  08Y0p00S0  Pz 000 PPv @@PY 0  ?Pvv@d#\3 0 D1 30Sߍ0000~Q @T\ 0 .T0@T RCSQ d!"Sy*0 C DD@Q00 00000000 /Pʦ0=S| NQ0SM SA SB 0S 0 P0sZ0Sa 6Q00\vZv @S @Rd!"S1*.T 0 Pm< D ,0P9d!C   DD@Q0000000  Q000S000.@DOoB0  P:P0T0 0 0s P00 P%0S P000 PP000 DD@QaɏuP00 O-@Z`PM $#  R[ pP 00P0T0X0\0`0d0h00000 00000PS< S5 S P00PP( P& PЍ0 %0 #04`T` 0 0p Pp000 0000 d1]Ѝ0 4`#0 4`# ppP 8 pPE  A\!\ T00 0 00R"  0 P  0 `; P4{004000 {/0P1uY0 RY대xXnd1plXFG00S ! rO-`PH"H2M 0D000 0 p@P0S A@\ ST P>  GP @@`!1 0 0 30\Ѝ0 SRJ !@PF  0 t`P 000S ẎP`P@P ttT ( P X0 SR @P  0 =`P000S`` PQ H 0P001\// 8p@-@P@P UtStTpO--P@M  / x " 8 0 `P   0p X 0S0S $ p 0 . "2 ߍ0S0S;0S PU>35 p p 0 0Q P  >00U  R  A/o"\  P  R R  p P P0 R   L" l1,P0S$`0 RS S0 00 VpP  <p00@(0$pW g972 G520W0 0S   S  R  R Q ^  ^  \/oQ" SS RT0S  0 PxQu +0 0Sn QRj 0pS\ %$0P,0V 5P , 0 B  0P0pW ,00 X,@48P@`@P`pP@P P0U 0P3p R0 PP  'p0P㸠$Pq`$p,Pt K0^. >⡬ 8cP1x00x0 oމp@pPPP @ `0V 00`oT0`oO-ttqLM @ p PP0 00PE ``0S S S T@xP `0S `(0( (`SP00 U `V X 00 ᚉX``VU$@LЍTG-XM`@P pP @I00  0 ʎP 40S0- XЍ qP Lo 0 ୎P ;o8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍjxǷV$ p|G*0FFi؋D\׾k"qyCI!%b@@&^ZQǪ/]DSء!7 EZgoٍ*L9Bqma"8 DKϩK`p(~'09ۙ|ĬVe)"DC*#9e[YÏ ̒}]o~O,CNS~:5*һӑ0-   00gE#ͫ2TvA-`0!ᣁ000?0"@@h>VP0p: Q0hV@Hp` G0S@@:p`F Ap@-@P0M0` 0 00 !? 7R8 bx b  D 80 0 0 30X Ѝp@VY l I4 G-@"@2 0M000(2("00P003  `p0\ @ 0 XS@@|Q0 C" T. .0N|Q0.\'^V*004!$1 0 0 30@ЍT  Aa r  B8 LR\ P 0FS0 S S XQP0@^*0^0 8< 4^*0 8<ƒ Š ŀ Ą- McP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0D`  œ E EtA-@8`4 rMX0P^ppAtAh0OVh0 000TAΌ LfP" 0  opP 0@chP d X0 0 1 30 rߍP .i00U 0P0 B 0   M Ѝ \ -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ p@- M@} Pt00h` 0`0 `P@@X@g.0@iT  Ѝp$ @-TT1 0M` !000@\p @P  L ^\p Z@ 0 0 0 30*ЍZPpW @@T PU 0SP@6T00@-00Z i 0p@-P@0 0p0hh(0Peh(P,Pah 0\0PP 0P 00,,gP 00pH, 0@-@ 0 0o 0 0 0 h 0 00@- 0 MP @0 h 00P 0 >?o20c Ѝ01 00 0p@-@P 0U0 0pp@-@Pg0PPg(0Pg(P,PpG-P0Pi `ाPb 0@00 S S0 S S dpPQ 00pZ p8 (傾@P 0q0p0S S S@ 0A S  Aj@P0  0S 0000fP  SfP0@@8LO-@ 0`p M,0(Sw: (T[0 T0W 00SS 0 RM@D@T0PH 00SD000@D@D0P0S- T0Y  0!0J@0PI 00S$0AX00O0  1G0S000 =   60S& 20p@g0ppf(0pf(p,p!@ ЍfP  (,@(0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0bP Ѝ0Cp 0$  $ 0 2 Ѝ0O-@XULMP$`0 @@hPF$@dpPB 0 @@ hP7$PPW* 0`Q QD QR Q& 0S:00Sz dPb  `00?0 @p R  R/ RY R 0 @T:p Bf 0J[0H 0 LЍ   @QA@ 0S`:   (⼐p 0  ,8  p0p 4`0-W G`@ @T: 0e00e `^ \LQ  QA@ \Y ^ Q\ @  p, 0S QARU  R  PP@T( Q  A X " X. X4 p X@  P@T+:>X X X 0` `Vp  `  Q@` ``  `p`}Res 9MeX'QO-b PPY<b(0p7W `$ :6o@2/0p $` V( ,2(-P W0#03V,0( 0!( -0P }QKU00⛁!Q03SQ: PQ Z5VV030#1! 0 d@ 000V; Sp3 p#P 71S41pG2s2pGs1pGSpG0f0pGwp4:0;p0Z Sp3 p#P 71S41pG2s2pGs1pGSpG 0j0pGwp0809ppp 4`p@-`MVp& @:Xp) P0u0'{0 {@S0@Vt h0 0)P ЍpWV00V / @-\(,\ \  Q:^: A Ͽ|q<Ͽ1\00W00C-P$0@SMT 0( _4p :`I;$880IG81GpB70 B-0P % P 000<890L>1 0 00LЍ 0 /?Ͽr s0|13? <Ͽ2/0 0 0@-S@ 3/@c@-p] Qdc @P 5_2/P ` 0@ PEPET% B B&"@@" PEPEX% B B""@@A PEPEe% B N B ^ w" ^ v N1 $1 0@`@DF$FA!B@  D B &"AA!@@  B B!"AA!@@ a Q@'P 5_2/P `<ϿL,PE PE T% B B&"LL",PE PE X% B B""LLA,PEPEe% B N B ^w" ^ ^ ^ , ($^$^2 ^. ^0 `1@^ ^ N1@N1 `1@}^{ ^ ^ ^ @r<`@^lhdLHD7y -x + +h Cp@-1!00 P@0 00D@1011.T 0@\0 S@ x P pp0  00C1000L  00t@ , *P; )C-P ML뀐pM%ᙞlaapGQQNHH0  @ N 0] Ѝ )`Q@-h4h$00 0`P@  @0C0APP@@ 0P@pP Pp P0pC0QPp@ 0@pwP  0pC0.S 000@000@ 0pp@E0C2S20/.-,+*)|'&%$n"! je \NJ2S2\0/.-,+*)Q'&%$L"! J< 1,*000 @ @  @0BdQReBn`@BdABdBnPh00p00 R 0pGqqp00 H 0pGqp0000pG00  9 TO-`!0@@R@@Ɵ GM MtčƟT ࠤH8(00t6^0P40 0 0T6(`0D0h0,0$&$6 0 < P< 0`P@00 ("P?o0 2R0S 80`1  @0`V 0` 0V X Dz`X/`0S\ ,0Te?pH5`00` 0VH W,0?p 5 0= 0Y& W0 J`@X,0? )R 04pdp`  ( 1P* 4  *X4  p0 84< p0z4 p0p4  p0 `g0Si`P ^0P40[ 0 y#<3 0 t4 30Gލ Ѝo\3` 0<_m0S 00ST80`1   ]`b  _"2 0 t4 304Gލ ЍO`ph,0!(?q0 r _W^t2t"0L0l2 0XP T@\PL _`GpFW.pD `R- V @ L_  _ Y 0 P1H 0 00 .H)Y`G 0 pFWT@X\Pl 0   ߺVL 0 ׺ @ 0 кP   C_Y 0 0H 0 00 .)Ya  %_]ly JX |bl  P,HpL  Dt h|X O-tM@@ `CVPPh0 P p 0 0  0$`14 %S, %ἴ0 徤   (6< 0 V 1P806< 0B>PU  0R40008 ^`1S   ;`1S0 $0  0PJ0  0P7P  PP$0  0P0  0P0  0uP0  0iP0 0^P`1SxYz < Pc0ppW  0R 0&^RpW 0pW  0Rx 0^?pWf 0pWa  0R0 ,0^,pWGpWD 0 PS00 ]`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0001p 0001p 0001p 0xt1p 0[`L ]tЍ tЍ 0 10 0  0 0 ܸ 0ո0 θx0 Ǹ HH |h t( pD `@ @-@`00AMM0 400p00 7PP0S ]D 80 0 4 30AލЍ.Bw  0,@-@ M pp P7`PP 0S <0000 Ѝ00S.S 0S ЍTp@-|0|AMPt 0 ` $ 0 @P  8 00 0 4 30Aލpv Tp@-P@Q`  @Q 2ZPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝp@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00Ѝp0@- MPd0@0@0@T  0U Ѝ0p0 0P|U:L@@ Ѝ0<00@,0 0Pk Ѝ0 |0p@-Q`M x00<@)P 0PU  0VЍp_40P 0`CЍp @@  l0@- MP0@0@=@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@00 0P  Ѝ0 @(0@-@ M T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP$|(PHxdt~~~~~~0@- MP%@O@ YP Ѝ0 0( 0PB Ѝ0y$0@- MP h0h@0@B>@T  0U Ѝ0O,0@ 0P! Ѝ0 ~P|| Mp@-@ML 0 Q0P0<00P@ ` 0. 0T @D Q[000T H0 0 <0 30 @Ѝp@Ѝ/.0 T.t X} O-PM@PP k p|`x0 裟Q  ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0`z 0 T @ P  S#3@ P 0RQ  S # 3!# 0TM 0 T @  P  S#3@  P 0R \  S # 3 # 0T 0 0N 0L0 000J 00  0; 0O-`Q0 dM R R{20\0QS0N0<0l2a!##\B2b1!AP2aL5BX2dD@AEW0E0@02h8's2Q>?2crlqqHL01NਂhL΅ReXT P0HP QNs s s[P0 T XF Z H Y J (0L0$0\04 0@0,0H0 0<0p 0D P40:[ SYZ OYY KYdЍ00N\0`R`(`m  0 0dЍXZ HY  8XgibMӈQw v$vpddd@-@P0D .R\*^QA@0T.S @-$MP`@P`WT0pv> 00pp< pp_p  WPc$ЍuTC-@P@ `p MPOP @U UP@Wt Ѝ @4Pt0 0000 0 P\ @0S0Toᨂ# tr0 tC-@P@ `p MPx@P @U UP@Wt Ѝ @Pt0 0000 0 P @0S0Toᨂ# spz ~sp@-@Pʶ00CS0 S u P `0 PpIX`u0 0CS0pSr P 0 /1X@-M@0  00匶00 !R !N0@㉶Ѝ@-0 S 0@Q0 R  004S k0@l@Q0R Q    R Q  {Lp@-DPD0P`@0pp 00p@,X0; zLp@-@ @ `@0Ppp0p@,% zPLA-DD p@0P`p0 A yLC-P0 `0pMpp@ H 0D @ <8 @Ѝ*2 yLC-tPp0 `0p MFp@ ( 0  @ Ѝ2 xL0 00/ xxL0 00/ xXL 0 00M0Ѝ x8LA-TT p@P`Mp 0 ZЍ xL0 00M0Ѝ wLC-tPp0 `0p Mp@ ( 0  0@ Ѝ1 wlLC-|Px0 `0pMp@ 4 00  6@Ѝ1 vL0@-P@000 00M 0 0Ѝ0 vHLp@-D0D 0@0pP p@YW1p vL((  M  0 ЍS uLzP R) p@-P`@V  P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-M,`(@Pp 0j0PF0 R # P R8@  0  B0 00 ЍW Q ^.Q  Q. 0  .Q P P 00p@-P0@S` 0 0C0p 0 pO-Mp8`P@P*W2*00V-:Y `* 00 p pZ+ `劰P 0 P0 P 0000000Ѝ`<0 PFЍ ` pMpq|qhLhA-PR@`p0ASAA0 0SA0q0@ <0 ePc00`ppO-ΟMM M (0>0h>͍0 @@8,0=͍ 000\0pDL@H 0 P. 0PS  P0⯽80H0P 0 0A Pt000-0` H<  $PPe$0H=0`F(`0 $ 40'40x`0=<;:9876543210/.-,+*)('&%$#"! P3 R 0S .S 0S 0S00S.SP080X$( 8d 0P| 0 P 0D 0 Si7ԇ.4004(00PJ0 0 CY 0040!( !, $ p@B 4[@(p@D0 wPYx(0 mP 0 0pP600#$ #(#<0$0 C0, 600.0 r  .00Q(0 A?P0 0Z0D:0D H;C0&5 0  0 30U ݍЍ5YXp5P0b5XP0_ % ^P0⯽80H00 0 PPi0 q0P00_h50P0\寽80H0 0 0PM08 0 B0PC0H[D0EX~-P4@DKd 0@ 0 P(8 0 B`P H[80P@p<`@C 0POP4 0 P0  ?PeS0Pd 00_ 0 P0p0d 0DM 0 xP4-0d > 0 iP@XDKE Psp0d 00( 0 SP0D[0S3Yk  0 DPDPUD  rp0XE!@HQ_ :!X9, P( ,0 PDR( 2d 0 P 0  Po P: , PD[qd p0  0 PU,PD[0d  0 PC,1@d DK0 0 P p08 0 BhP( 0D @PC 0 PpP20 0 p phnn\i`ijxj@]PiT hff[*gf`fDf ede d cc`bha<U`*`x_x__`^]^<^4 r ߐ ޸======Ypd YtUUUVYnW4WVVtWVdUUTTT0SSRRlEpQlX,#,0@00Td 00DK00% 0 PPPH@ $1K pPW8W# P@᝹ 0 5P0U0 0 D,P00e0S0PEWڴ 0 P1d 0 0  P.qp 0  PPh 04@DK 0P\YT  0  PR 2PH0/ @0ZD: T 0  P= 0 PC20+Y X1B0@d 00 P 0 P" 0 d 0 P 0@T0DK*S pPTDK 0d 00i 0 P=+L0X 10"3$ 0;L0000;L020 20;L00030;L0#100;L0L100;L 0 bP0D 0 S{@pTc P0倠t$@ UpV  R @ Z$ v0d  0 4P@T=+L0X 10"3% 0;L0000;L020 20;L0L000%;L>L C+A0X 10"3& 0;A0000;A0200;A06;+A0XP&1 00`&;A>A Cl6;}X |6P0&@< 0 P6 0 8  BlP,0DK 0T*P\z p$P倠P 0(Wm  R @0 Z$ 0d o 0 P@T0PpO*0'@DK1#0Y 0 }P@ $8!?C0 S< 0 gP 0 8  BP0D{ 0PCUQtڠ@  @Tk1 X2 { 0d  0 9PX  9P0w80P@@d p0DK P 0 P3H[@8 0@ BgP' 0 PPDKv( 0@r(H[o( / PX0S X @_0Pd 00a p 0 P00d 0DO 0 zP 0 d A 0 lP0pD{S 0 vPy?P0X?P0 (P (0p00( D{P?8P0 @ 0 5Pd?PH!?C0 SH 0 %PDX=H[p 00 w0 P0 pG>͍d 0pH[ 0 Pc 0@TDK1*Pီ倞 0@  DpZ X 0  PD 0d P 0 P6HPp 0 Z 0 P#(0d 0=0 0 Pl'0DX=d 0r 0 PX=-P0 X 0 8  B*P0D{ 0S,C1#00 Sڤ 0 rP=PpHK0 0Ŵ=@PE0D{HKP=PpHK0 0 0 IP;P0$P( 0 PU0D[y:Y;P0{;+P0 y;P0q;P0m|;P0i@ !pP-W W8 Dk`P@s 0  Pn0U0 0 DPe00e0S0PEW 0 PU:P03:d 0p 0 PCU hzPp0d 00 0 P00TDK 0 P$ PDK  0 P 0 P0 @iDK80`PC@ P 0@=P0DK 0S 0L  P@ PPUU yp`@۳ 0 sP0V0 0 DjP00f0U0`FUڐ 0 [Pzp8P0d8P0&` &P&``@,8DK@2 P0 P 0 5P8 0 BPH[L0H[=0 0ၳP? 0 Px%dwpP 0 D Ph07d P0P 0 PY 0 aPQ 0 PI%P` 0 D[ P==0H{` 0S2p`F=`H{ 0 05P%, 0 Px%VpP 0  `Dk P=0Hp }0SpG=pH 0 0P| 0 P I% ` 0PD[ P =0H{` O0Sp`F=`H{ 0 0P 0 ^P%@ 0 DK @PP=HkP 0!@P=L0PEP 0`Hk 8P0 P 0 (PW 0 P;0H[=0 0tP23#PH0 Tx3P0Ll3l#PH0 J 0X#PCT3 0CH 0 PU,c`$301 0#PC3 0.@ PpPWW b`P@5 0 P/0U0 0 DP&00e0W0PEWh 0 PH 0 P,f 0PC202"0 2P0 0 Pqp1P01!P0 a`P@߱ 0 vP0U0 0 DmP00e0S0PEWD 0 ^P}OOPdUUUVPOPONfNxMLAMHKKDK0KtKK JKJJ$KLKJJXI8IlHpGGH=@F5FlEEEDpDCCCB7\BBt747BT7B$B6BBA5A@@5@5@@@5DAx@|3,>P>@32=2==2| <1|< 0 P`X``w`0` PH0 =$@ 0@Y0D: 0 PC0 0, 0 P>``0 0 b+J X0X! ##00 +J X   +J XX" !" +J XX  # +J X"!  +J XX! " +J X 0 ;J 0PPUD _91!P0 @- R  MAL  ,@0@(@@; Ĝ0 Ѝ|MM$000 1 2Ѝ/ LA-PS`p@ @W0 V :00@PU u"PJ(00@V:DG-0pW:0P W : 0W : ` SS 0W*%(00@0S X0T0 "$ P0@A-QMup$0PS@` 0! $, (0v(`Vd0S`(0S0! , $P, (0S+p100!PP, 0 Q,0K+,U,(0T0PT(0 S0P$00Q (0, Ѝ0F LP%,  (`, \:,000\,:( ,00(0 SPU$P 0"ꋴ00ꆴ(00A-QMv`$0PS@p 0! $, (0w(pWe0Sa(0S0! , $P, (0S,<0000$PO,0 R,0JU,, (0 Q0QQ(0 S0P$00Q (0, Ѝ0G P%,  (p, \: ,010\, :!( ,00(0 SPU$P 0"00(00QA-X@p0, < S'ÌA$A?pG,aP`@pP0< S'ÌA$A(?p3: @ @Q @ Q Q`a @ <`0T,Q` ==PU*00P O-xPM7 `2`B0P0T200H2`0 0 0@ ,r,p @=QP APT Xt*2Z VI @@QX=ЍZ@ V40@ @T7:P'Z V! 0@Z@ V0@ @T7:P  0  0X XQ  @ QYV0S QQ @=Q 5 x d T 4 0@-0$Q0SPB00XS=@ 0SQ.C+S^2.  ~` `p 0000s0  0C ^7ࠃ0ࠓ`0CVs X00000   0 C R7 0 0C20 2A-Pp;U P@W0``W0 .p H^p @P0070 2000 S037#Q00 ^000x/9o/c9///;@@-` @0 0DM0<000p2 00 RPE 0 0C 0< 00 0 <0 30DЍ^ 00 0O-2rP0੒ 0 M #r ܁rgqC2(0A刀B# C@$AQ i!dP`3 @@C;*TCXKW(Y  @0 SP0[0S   0 0000000S@ Ѝ @0 MnP Y W 0 cPD 0 YPX  @0 HMPWY :$I% /d A-`pP0S-@ ⌨T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@f( 0 p@-M P@ ȍP k`\ POAo4 (0 0 8 30ލp] , ,<0-@- M0@R0  BPP * Ѝ@Ѝ/ Z% Ѝ@Ѝ/]PRp@- `@BPPqP0 ?p@G7_00pPRp@- `@ PzPOP0 ?p@(7=ذ00pp@-@Q `PZP/P0 ?p@7기00pp@-P@6P p@ p@ p@-@P 0PS <0S P  00p茰00pQP@- 0R R  y00p@-PP Q@ @Q Q QT0 D32a00pP T0DS@pP p@-PP @P  T $0S@d<@fP$h@P @hP0 @g0Z@ @TiP@40S00""[$D @ggg gg98iPPrP4 hPPgP of NXH ,3Q 0Y0jQ0S {ǻ {:S03:gXK{ZZ k6CHJ{{ ;R{D30SYj{{L0$&00G;{ǻ]Z@4dgbg`g^g\gТ6{@{7{Jꪻ XK{ZZ H {g[E gk k# 0X:0:g{ { آ 0$0<Ÿ 0 \0p0 0\@0h <D c0@ S$Z==L0S46S`b{ f ^K{^CZ\EjMPzP DP|{p`kP{'P`U{Hq5@H{k{&{VP{XNPpa5d́H[5&BHJؤH {{ ;R00S{ 0R{ 0 $0 00Co00XpT@H?A?5?? ||N{ 0 S0G{0Z1k{&<00;R`@P{ǻJ{ǻtSR0 $4@ ` @ P@ TPR 5de@ef0D HTk 0S3 b0A!Fk{1[{'{'Z<00;Ro5&H [p  $pI(R ⋀RЎR ($ 0W 0 0 R<0<0C<0eP<04"0<00N@4C0Co00~0S40S0SD X@eee ee$0Sq kW{{&;Rp{QcD\ IaP%46H0L $ H X(04 Q SL0 H$ {{7@{pXL0S㐀\H 46SW|0$0jS  Q Rk&BHH{{@{?5?559P ?L004H 46S<00kS~0S0Sxf`P\ .gPoH $0@S00< kS:7Sqae_e]e [eYeg$0S H 00jSQ.LQ S& F H${@{7@{@J {;LL$LQ*p S  c+6C#: :L H0%Y!SL040!@$I1R 6H00L0(jQp82Rxf`P fPpՙ0 $&p!knP0"@$0 00M 0Ѝ5 x2A-PU@`ᝥ0pS  gP 0S UDp@-P@}PyP0 S :pSSp 0R:pp808 8e0 $0$ $f0 w  A-P`H@ET*AP/ =P4 pPW 0P P B $$P W 0 P l l0l C0 4T T0T D0 +< <0< E0 " 8 4 40 0⟕@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-r-w0-x0 00000S wS -S rS  0S /xS  /  p@-^ PB2 pҨ 0 pP P//0S/ S S/0S/0S/@-@0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 / 0  ??SQ $0$ $p@-0 /  P P P`/AQ/Q/Q Q/?0 H0H Hp@-0 Q/?S0?/0?/ H QP0 ?0/@-5 0  A-8P 0`00`@p# P0S0@:@pp@-P0@ ES`M aЍp  0Pݠ0S 0 p@-@PpP Q 0S P:0PS:p@:A-X Pp@PEX `P@``O-` MV " p@IV PP @0SV F!A0 `F`1 Ѝ Ѝ ^:` - BMMRč `` T @P ޢ PM,^   @40@- @-ßs M Mp$ȍP|`@M TF "  r" @$@`p ॢ0 "l2 0 $8 30ލ ЍETB^T"P0 @刢p +0 B^P.!0 @<100A@  0  P0 \ AL+\ -L+*)B'&%$#"   \P  i\\\\\GS  H  8 0͈  0 %\    t 010/C. *     A-RP`p(M @x 0 @0@0 P0 P0T P@ 0 (Ѝ D X00 5CS @/0cS#:3 3Q31:0CS! 2#0@-@P S 0\\0 0NO-P`M p w@P-Y[ +Y @0G ` p"@ 0Iq \ aIQW IAIQ7 IUTPRQ @ 0T  R S` 0J0 0 ЍS T0 Ѝ0Y U Pp`Ppb0 0XQ AA0@ \QUPpbPpb0@-BR"^H M <000 Ѝ0@f@PZ00TP Ѝ0 p@-BR"^p@S@PG0T0PpO-p`M@ŸP-TP0 +Tp S0T W p  S 0 Lj  0?00 : 0 20 P @p Q ; P Q  S  R2  " Q 00Bs ^a0BSW0BA0BS-70BS*| YZ  P Q  S  R " S@` 궤"00ꯤ"00 0S \0F0 0 ЍS@ `?0t0T0i XR A B0A PR W p \p pXp @` QWKppK0@-BR"^L M @000 Ѝ0@@P^00TP Ѝ0 p@-BR"^p@ @PJ0T0Pp | 0 Q?0S @-P-- M[ ЍЍ/G-`P႕00 !PER !U6@  ᕓPG0 PU pWU@dbPp X" 00]  @@pG  p00M  0@00A<A-P@PH`H0``@p 56T  ~I A pp@-@P00CS0 S u P `0 Pp6`u@-@ 0`00@- M 0/ Ѝ0 000 /0O-`MQ 0 Q0 `ߍ0( 03PP 3p000 00` P @P 0 "0 0P @ R R R#Z0P`0S 0@ ET :@D0SZ@DPg @  P[P@DV R5 0 0 00 R R0 S S 4 P@  @DOo  @BP 'P !V_*0`TY ᴱ p  R R R RO V2* XP @ R p~   R @Dঙ0PS C  ᜙ @DZ PT* (4P `F p ` 00X5(v4 P`F m p` p7G5pa p_l,X@-DD @1LM0D`QpP- @.0 P) U) pp0 0娝0  TP 5  0 x0 0 D0 30LЍJTPLpp  @ 4TN 8 A-``@PTpM) W ``00\ 0 7TP 4  0 ЍX`` k@4T ЍSP @ߨ0S/ 0S/p@-0` P@ Q0p0 :00 Rp` FQ`00pO-llß OM4`PQ `Pp@dh Q 00叡/00 Z.` PP 20 00 [ !!.PQP\.Q O :!+!PH [ 00:[.[<##=[0Q.S7 Y_0IS00X00 I Z  0O P00 0J ` `凜0 0C S:: 0  `  C:[ 000(0,$@0h0 0(0 `0 $XP00 0 0 41 30Oߍ Z]0000<4 ✭PPU U.R  :ᜎP M   p O-ʟ UMMLōxŝ| 0`: \0U刕$8 \ \ 0$*0: 0 L5 30xUލЍ)0 0(10P,0 0 XS#``P ,X35 00 @P 00  03/P @ X:0pCorS  R`  忛P$0 `PPP0$,VX00 XD05 @00 0T0R?`FHL@04p< 0\`P0 C0F pP" 00  03/P @ ZR 00  0Sp(0DY (@v T`F:,04p0H00,0D R{ 0 d0L0P R  RK p 0p XPD`BZO[P0 00S 烱 [soQ \ V\pp0ZP &0 01W D0SX0 B@Gq 0P^!P" SPSP@Tp$`0S 00 0`@H @PC0@P0CS`@:Hp$` @凖_2L0X C0 0CS`:y0<0S0 Su  R;  C'SR]0@0P80%P P4J RSN5 0@0g @PC 00  (0@Sx@壚[ 00pW3 @pॕ`p8P&$0:/P$0 0S0S D0S$0P做P0@T`*\0L 0R*   D0`@0(@LD0 R R 80P0?R0 0 @P 00 ? (0@ST H0,1Q?*,PAP P `P:0p CR00SZH04p0,0H00,0C@c PzPp 0`P@ CR00S2@ P`@ 03/P $`,0H(pC 0T000P~  , H00,0,j1듞 0$ 0% 3u  0 Nύ00S1@!ROg ,$0pP`p_8t.P!0 { pPW 00 , (0pSD0S$0,PH0,0ᯙ@T L@,(p80%P y304p08T H0,1Q *,H0P,0` P" ,0H(@C 0T000P  , H0JH00,0 8   gh fTA-0S`@M05 S Ѝ0p 0z.PP4 P/ 80 0P'P  0 0P0U 00S S 0p00 0 G-20BM0400 00`S0. S @ᄒA~ P p0u #0G/P @T *X8 4",2P 0 "1 0 4 30vBލ 0    ! .-@PI PPD 8 0 0@PAP 0 00 00000 00@'0T7 0 p pIP  ;00S 0  0pW&   0 0V 0 / 0 /G 0 @ 00S S 6I 0< \PG-Mp0`@P0P0 0   0 p`?PЍ 0 3PP A-M`pP@P , 0 (   P0@Ѝ0, 0ЍRQ0@-$MP8@'0S9 0S0S9   0 40 0 0P@P 00$Ѝ0R R# / 0 0$Ѝ00S { 0 00S000@ S S 0S  0 Ԡ dO-DDğ DM<h@P 0 (,0P P`sp/0 `PP ͅP ,0  0P0ß RR RR 0 Q Q 0 R R 8 $0姅$0@P`  s p0S S S@ 1Y g*@ᎅ@P 000S 0 R0 ?@B 0I  R06@DQ1 Ғ  @D. T!:  @Dp’0 Sq CF P`0  ᴒ@D q [p>`PT* P`}.{.뤛 0  0d!P1 0 <0 30HDЍ(-PI `  P@ڙ P1 0 0 0墛0 J P`00>.<. 0 0.0 000S00 `H`P ؠH լp@-M`P@),0,0   0sЍp@-M@$$ 9 Ѝ<L@-M`P@(pP0P0 ɠ@0@ 0   @0UP'Ѝ0@-P MP@T 0t  P00 000P 9 @ Ѝ0@T00hP@-h1h!00M@0  p` P 0^! 00 0 N R@0100 N.^Q 00 Ѝ R0XS 00 9^0 ^ @ A Q QV$ (,000 hO-Ÿ2 0,MP0$00@P P _/00p"h2 0 $0 30 ,ЍD"82 0 $0 30,ЍOs0:[000 0< [> 0P P` @q0p P0/ `V* @PUVP A `$pVᰀđ0SM V0F S0 s\b 0:[@  ὇P 0:UV 0S 0$ S @`0S @`$p @.[P `$pVP|FV Ф t V,0p@-@P  (M $  `0 $+P*  L @0 0 $0 30(Ѝp菙 0 BF P ͠O-ß lMPd 0 P t/ 0 #3 0 d0 30lЍd#X3 0 d0 30 lЍO 040 $(,00h1T@ RT@P0 q0S P q u XP 0SP q, u00 X0S PX$Up#P40@ 0b:0@Tp0*PUY 0 SY*  0CR00R:@[{uPp40@` 0b\!J 0 ]*PY9@Tp. U00 S` V,*:0UT0X X- X@P0( R0  JP P RU @Tpu0 S: 0 ': 00@SP FE D @O-XX M@QpPL Չ(Z= U U U m 0 ωЍ0` Rz  ?0Z' + ~PP 0:/pq  00P @ P +00 0 00 嘉Ѝ?p pP0  * R + L UZ pp 0P 00 0SN  00 0:/pq 00 `Q¿^ 0? <`V<X0`w R0߇0 0 jP0 :/{q`0 a 00 0`VÿR <0`VÿpX0PZLS 00 0^O <?` 800C`V 0Y!QD`L0k/  0`:/pq> 00 `P  @ P [*00 0 Y 00 UP'0 S$: 0C ׈=PT` 0S  0C`ÿ00C`V0  Y 0CI 0^ @0^ *00 00 0 ᣈ ៈ5 0 嗈 LS\0O-@ $M  H`p 00#p t0 0@H`# 0 B0S0 Q6  R00S 0B QR `  (PP 00[U X0 00@PL  RWRY 00S ` R00S R Tu*0D0 Sm P^ TP`p^[  C0 P ATq ^a S 0 ` H`@3 QY/ UP+ 0S "  P00S U0S S" S' S- PP000S 0 0弑T $Ѝ`dP`V=W WS SSS垇 )p@-@0P0FG p 00p0 0@p0TS00 -M0 3/Ѝ/@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ R R R //00/00/ R R R //00/00/@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ0@- @RP M R R Ѝ0003/P PP Ѝ00P03/P 0@- @RP M R R Ѝ0003/P PP Ѝ00P03/P @- @RM R R Ѝ003/P 00S00Ѝ 0R0 02/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/ЍR0 p@-@PPeP P0 03/P U 0| p@ 0/003/P U 0@ p@0/@oppp/ >A-P@Qp`M Q Q Ѝ0 03/P V*PX &000  0003/P P P PЍAR X %P` }0SP& <` ;A-pP`@P  R 0 R 0\A/W 0A/0A-M 00@SpP` SV   P RPU U U ЍX&000SP Ѝ VP 0SPU9& $P` b :d #(0@-0@SP M S S Ѝ00 03/P 003/P  Ѝ00 00 0 3/P 003/ Ѝ00@-0@SP M S S Ѝ00 03/P 003/P  Ѝ00 00 0 3/P 003/ Ѝ0@-M@P0.S00Ѝ@-M@p@Ѝ R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 / L0 00/ `8// 40//O-0 MS P`xx RX Q XS@.PL @PO XG@RAS0SI <  cSB!  S   X3`"SpP@@Pᬲ   pGGW`W0P@vWl 8`@FT0S0S V*000F ЍΑ(00AQQ!X@R P\! C]R% X!q#c!! Cr   "!!1Cs0#"1 0@0Ls 0;S!S" Cr 9" X00Ls`@S \S X 0@@XQ P`S pg' 0`0~ pg'!"d0`0qX000X.0`0v 6lhQxPO-Pğ@ $MQ `0Xt P`p)[V> ~P @Qa ~P @Q`P ~P @`VT*` P`Vy [\Vr .V DAv Xt0S Q.Sm @]~Pj `0PCU`PxQM  D P XS  ``/Qj ]QOP R02   0 ]R) PR  "  XSnP   R0 F b"r R` V` v`A ` @R^ .R @㍐@  0D0C  X1(00$Ѝz00P  ` < V    \  PS X R0Q  S0 T 4*@DT[@ XS(@ X000… Q ` T`4*@DT[@S X00` 0 2t /d0G-AQ@=*p0S& R4 @R`P00! 0X+ 0s00眠   r  P 0 Sp00 NAS 0SPQP!00P0Xӏ(00  RO-P3P#RP3 M0U p\` @0I @R: R R& (000 ЍQ*@ ĠS? A @ G0RPR@\ 4 R @4 S0A  Y*@T*0Pv 0A\ R!ɑ" 40S0 4 0- M ЍO-S@,M `0S0g 0S 0S0^P @^Y \S0pS0 0P00C0$PU P0S @Sf  [@U pPU00 S V*0 B>\ A XP00L X 0 Ġ? 0 0P R SAS^01"0!0\WPԎ(00P0S 0 Q*00G S 0S 0 p  0AUn0S"  ! [*@੅X0 `v(  ABQ AA\ Q`E  ` r  0B>S500A S00P0 S 00(00,Ѝ R `0S P\0[ $?0 ,4B0`[0000ZDPQ00{$H p@- M P0 `00jp @ !p < 40 0 1 30ލp@: P A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ: <Q:/R/0S/S:00/@-\@3#* 0^ @R R R Ӎ(000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R00C薍(00/C/A-@P`TP% UVT ԙP @TP 0?Sp i00d(00QSp@-`P@ 娙PP@`V  0R p/pA-PAUQ?UU@A`pP W ځ1AP!(0000?00Q @-A?SSRB 0@S A00(00/-- M  ЍЍ/@-M@ .p TЍR/0S0 \ S 0S0000/O-@P M ` >P-Yh +Ya Q0Yj T@ @Q 9paT`Ppg9pVT`P" [)SQ" K0Iq P0aIQW0IAIQ70IS| V[SQ;+]X0S \0J0 0 ЍQ `Q0YXP  A@0L ^P @T@@0@-BR"^H M <000 Ѝ0@]@P00TP Ѝ0 p@-BR"^p@J@P0T0PpA-@p`P rMX0^pAtAw0O0p`0 TA΀\`L PPl$08 @(0 0 1 30rߍ8  |0   M Ѝ 4 -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ QPO-M@ \ 0S000!pR !01 zPP E`#3`7P*Q30A 0#1#2#4#8 ZP 0   T U 0C  pSIP0 0@pQ 0S  Ѝ;T 0 @00Ѝ2 0 0A-@`Pp|0 0@|$0$ 0 M Ѝ: T p@-0 000St@@@pdPddPsa@Po@P O0000 0 Xt =p@-P@ۊ p@A-@`P7ppp0php 7T  0<0 x  A# xu0L@-@zP0S 3/000S@Š ?DA-pP@`  F 2o000v@P p@-@P崇Ppp@w@-@!1BMM 0`PF040@@@ @@=7xqPpU h10S \!p0@  P8A0@ P< 1 0Bv!0 0 4 300BލЍUP S@P  4/P Q Q 0 0vp0 00P 70 0 2 @W6 , \ =O-qQpMP FAp@e $a` Q00]Z1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W j0@@00塠GQx00p@@ЍPЍ<0 0zu <8 ptܐ8 : :l0@-0@P$M P P0L0 0 P $Ѝ0D G-RPL 81040SA a q@`p #)/0@S-00儑 000S 0 000 00 x0 00 \0 00 @ G(00o,\P@4XA-耟p0S@P$0S!0`PP @0S PU @@P 0U00 ^m4@ 0@ P dجO-dM∀`XSRßQ ! 3000SYC@0S00 h0X#00T3 0  0 00P ZP3s003@0p0VQ QN  QI aP0S_ 3/0 0P U@p@|RP\00SJ`" 00C0T@dЍ8B,@@@$20\r 0,0SO  R10$   @$(00 L00LsP 0S 0 <00@00<00cP 0 S@$0<S(  ( @0P 1S@iPQ 00C0@@00$   @$(0aP< @Z$0S(  ( @0P$  $(0I t 6<׌ 5 58֔X 4 4($ 3 3 3dC-@@Ÿ 8MpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W?!1 0 0 30[ЍU00ì?dPER ?\00S T=*0!0 V5 @0S00L0  0T*0 V @0S00U0Pep 0PT*0@0S00 V@@W <0Pe 0P3 Q z8yyxO-ϟ M|ϟp `0S㨐嬀m  Yt 00 0S` %SP %0BUSZ:(!@jJ.'1 {x\E>`-= 0 |0 30Ѝ dOd @040 $ (P,9h-h##d-cR:\-c2SP=  PP 0 0C@aa0C0C Cr  \\=N>?#c!!"N ,  "bQ0-5:bQ , !(-#c!!2N 0  h\0 S 0!Y&0`0S00 S `0  p`0 S00C`  B2;Q/0A!b0dP  nY0`0S00 S 0  B2D;Q/0A!b0dP  NY0`0S00 Y0 p`0Q0: 00dP *Y0`0S00 YX0 p` 0Q0 : 00dP Y0`0S00 Sa /1 b !Q 9Q00dP  Yj0`0S00c YB0Q0<9 00dP YR0`0S00K Y*0 p`8`p0 w`-8 Q0 0dP  Y0`0S00 Y Q!/ b !Q  '0 dP0  vY0`0S00 Y Q '0 dP0  ]Y0`0S00 S Q 8'(0 dP0  CY0`0S00 SU+P#U'P Q &0 dP0  "Y0`0S00 S 0Q0X6 00dP  Y0`0S00 Sj0 <008@0 0D00dPH00L0080 0X0 % Ym0 `0S00e YD 0E0 S0ڜ0YU I` R  L S`HYE0$ `0S00< S00%1?2c 1 R11Aãd0Sâd0CS0c0h4dP 0Y0`0S00 Y 08  8  p80 S0R`050dP03 0bY0`0S00 Yx0 p`0dPS0083 0>Y0`0S00 YY0" `0S00 Y0 p` 0S 8 @ )pq   Zpq 0AQ 0! S! -Rm Sk! 1Q0!Z0S$)@Ϡl  ^Z R SH*ȟY`` Ји  v@@PPȟ%ȟ堨 ,H)q Z.px hȟ5:ddX@ $ ^, LΌ3# `_ 0RS@wWCYPP  `E@E@ǟ'ǟ|g ,F|t`(ao[.`gl 11 :Hg$@BW@122e3cPL@/ c0 v4#(: 600+$0+>! 0#Â!!!0C0(AX Oÿ2+" ?00 #2>[?W'`F@PG`@2#2:#0D"D "Q0 3 #101`0U15? B4sppp0/S[0 o c0 {v(a!(: 6 o`00+$0+>! 0X!!!!0C0Xÿ41+" ?00 #2>`T[h@t c0 Kv $: 600*$0*.0$1110B@T0 I:#$B0Nm:.EQu_9k"mnܨcSI$ňQ\\(=p pQ\(\)֠s c0 v(a< (: 6 o`00+$0+.d01110BX|0;#(0``0 0 cQ @R0!T BqgqgYpC(1 ?  0c0u0,!(: 600)$0!)>X! 0Â!!!0C0x!Xß)" ?00 #2>r/E B  P2?A1c1c0R0B 0$2!502c4"2c2A" "b1C S/  `008P2P":#"0 όB! TY: 0"#2>"Q0030#0000U  PE0 S0  P P$ 0Ѝ@t)1? 0 c0;u0t#):60 0($0#(>!!!0C#0Y("0 #2>t<0P0@`! 02P"> 0R \   10! S j~y00Ѝ0 S, 0Q0% V 0? VQtŸ0 0#́P0PQ  V0" RR!Y0h&P l6m&N R0 RRR@ČR RP)0OCN  hmN,h 000 R( j0p 4$h`@,P,0^S0 * P4P"<$1PP TZW [[(p W0  @`  0^ ^4$0^$!? K[ ,P04`(0V0F 0 n R !0S ^  0A0B 0(1 0S,pA0o R !0S \ sq 1PpN h m0 P@P0/C0XO0p CU, "/ ppcW  (0" JM @ƨ I<0J|hNhO-0|M<SPM 0@S|Ѝ0S >S`@@0FSHypP Z 0S10ƒ!1 hh "00lY OX10\1 001Y" <Y50 S0S >S@p3S*S0S -S0 C R0`@0F0H0N<)`h0hlpt `l|Ѝ*YY -Y00I S@0IS0   S ,S;SQHAL c ;S,Sb ShH^%- Q 019mPhj`019mo\` @KOh6Pc^`̠L 9 bp&kg.htlw@0 0N\hPk00 @k @ P 1 00 A1 01tP00P 0,Sd0,0P 0S  H LI$ bh& `p&g.tl6w6` p0@ `pĤĄğ@(4$cR0#034 1`002c2c# b?0cY[  Z  R `pJ  ($cR* $L2P 0 S 2J` p0@ 34@0 尃@0 `0pcP0#031`002c2c3?0cP`cs \pP  P003:#cP* 3301c00 `Z00p4@00"0` 8p @@  `p@D 40g p 0HSh0Ű1` p0@ >>D̀\) \({3PA-PQ@D 0S! pN,00 01h6l6h`v`P 0:S fP `VpFPW N hn0PPT`V_pHPNLg@P``PpVE`P 7A-A`P@pP pnPPPWHpPqpATW  P>UH QP |1|!0 t0000`0V m``@ v P =D0C0CS\@0d/@D  w@D0P0T0S00#  1PWPࣶ N0I0Uh,h&P@P0P P0p0 000`$  16S x0@-@ 0 0!R !  @-\F0@L @0 0 1 30ލnT 0 K " !-(0( 00M 00Ѝ !` --8M$ 00  0 0 0ЍЍ/ !0--M0 ЍЍ/p@-0 0@PX_`00CS`0p S u P `X0 X PX_pX1`u \0\ 0 `00CS`0ppSr P X0X /X --00 M (0 X ЍЍ/ --4 M0( 0 XЍ Ѝ/ DG-@0Sp`:Q !SJ Yp>_0"P U U * d0J0`01,P2P d 0 B 0 0$_ P0PU` ``P,P ILjp C000 _mT 0 @00^ I3jp--M  GЍ Ѝ/ -- M0 0W ЍЍ/ @-MP ++p`Pp/ {@P,  s0P$ Sʤ 0`@ 0$  0, 0 (0 0Ѝ0 waЍdBm0000@Ѝ  4p@-P^@$C@^pp@-P`@h R T0U:T0T:p@ dRQ@-00p@-!@R ! 0P0 0S 0BuPQ`0AP R 0 U00Spl\P03\P `-\P0  l 00A- R`#P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ 110L00^ 0A pW \00W00S PA0 SP0Ã@80p@,1! L0  A 0AfC-p@0T@1WP` M ]l @eVl0S* D!l00@ Ѝ00Dl 'e=l0S 0   'l0@"l@O-P4M@p `k0  00ShSf  %R0 0BZSZXWUTSQPM'J?>=<;:97310/.,,+)('%#" vrqp! $9 roR V@7VK 0V & 0 aQ S  T C4ЍPP؀PP؀010 00C0B Q$ROLP00 x3 0S 0V`1!'  x 0SM 0V`1!  x 0S6 0V`1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p V`1 0! xO 0S  0V`1!xX 0S 0V`1!0 *RS 0B Q@ 00B S@@@ x: 0S 0V`1! x  0S 0V`1!    x 0S pD 0V`1!dx$ 0S 0V`1!W V  x 0S] 0V`1!F +  x 0S p (  xz 0S px) 0S 0V`1!x+ 0S 0V`1! x 0S 0V`1!xn 0S px 0S p  0V`1! py xp qp jp& cp \p Up"s R 0Hp0y  V@ `1 | x 0S 0V`1! | xm 0S "pT  0V`1!t ; x 0S4 0V`1!e ; xX 0S p/ T- 9* p# p$ p7 p#l x 0S 0V`1!'P x 0S p[ x 0S 0V`1!  xi 0S p 0V`1!$R 0@C p7 x 0S p  0V`1!x 0S 0V`1!x 0S bpx! 0S Vp@ x 0S Hpz  0V`1!  x  0S 3pe  0V`1! PZ gX PU bS PP ]N pG PD QB P? L= P: G8 0B Q@ 0 B  0B Q$Rh x R 0p0 V`1@b P  p  P  p pO p P  P  P  P  P  P  P  P  P  P 0s 0 S ~p  0V`1@! P $Ry@00 P  P  P  P  P  P ~ P{ y Pv t Pq ~o Pl yj Pg te Pb o` P] j[x 0S pP  0V`1!p PE RC P@ M> P; H9 P6 C4 P1 >/O-ϟ MMƍL0@00\ !TR !0T0D0 ` 0S   R  0, \H /찍  @(嘰d 000D0h0X00PU @%U 0T  `$ J 0 R 00S0(U` P0`~-$P0 0FZSt10BoSU fiMMI}"0XiP1VP,    RZ00sV P>+h1RRhOYh.>TQC9fˠ}P`G0T,\ dDT|8H@L@P@UP@@0@ 0@00'@00F p`A@00F S$V $@GPU" 0T$0S7 D0S D0p0@0S0000WW  +: 0 6 30 ܍ЍKT0P00 P:,0_   S !10R q- 0~  R ,  @TP@@R00SZP}?p@~ 00PP4Pa00~ @P 4 < 8 -1$S0PP00S@0 00`@VR    R ~ Q(-!R 0 ,!   R K/ Q(S @DT 0L0000p0S0`Qm SP@@: 0 $0(PCUV@0Q0(圠D0800S@@0S , 1 0,080S00 0: 7 pR10P3 D0P0CH0 *0PD0B ]0S-0~00s<0  `` P,0p` PW,0L01 000 L000,`S P1 @T"0P }SpP$ pGWp P~ `[B,@ Z : R0g 1 ,k,0`@@ PPV,0L 10ps0L 1,@n`PT@00000 SRX 0S `\` p00F S @@ A@00B S$R0 S,L0 1,  $0, $ L0$0S0c$0P` PP~0`S 0~0~+0`~0z, 0 % S 1,   / G  'X||{{`{ z \ | | X  ` 0,SL , x L0|@@-!J  R ~  T/ 0`Z.0 0,0p`D0S WL0,0PQL0U 0S0S@!D徏  ZN/,`04@0T` P @0  0 g0@s,`@ xPD ?  PYT0 pG 0D ,`00 4 0(0 0 o @?P 0 ZQ`h>0(00000S0;000Q( 0 00 `000000S0Q(@T000$0\ pN0P00H0@C(00 S Rpp@D@@pD00NS `V~ <0000@P@p 0P@4@<@ Q(~ P;N0P00  S4  0K R nRd d!". #2 ` @0!.10 n 0@0P00S0000N0L00T(ژ` ~堀pp`(p 0@DT\Q 0M0P00 hS@. O R ,0, pQx@ t Q ,0P1ss 0 P [@! W R ,0, p14 P`VRӾڀ/ pP  0 lP80 P 0(pXP4VPӣV4`F@400CP QU 8LYY ڜ P = Y@ @@TTڠ0P0E 0P(0@ 7(0@0P(07 W0 <0U    `R$0`0$0000 RP1 01{"" l1[0 k0[R k0{' { {4 R { kkxJ: [k{{{$@[ %A? @;B00S`31[] {+;k{ [Dk6G{5k*00  ʺ+K Q*{'[;k&C{7{*0  JG[2[ZP SS@:k{ [kk  %A{ [;BG{5{>Fk{J @ H 82k0 c01{{&""{ {0 k{{& {0 P{  { x C $00$0XCZJ40S[00SWpP( @PPU 00S0SA UPYH Y @P= (P9W;  W9RpG  Pb8@P&@P [0 (0P(0 ?@?@$@$0SW F 000 0 `0408`(P pP0` PU8$$$$XQP 40SYWQ+ 8` (Z 0SZ  pP`U 00 E0K[ (0(0\PP1 0`00 (0S0P(0 0 <0U  p(0 ! `S;%{K0F[kF{7@{*0 0r  k[3{Ck6{9J\0 0R?0S@ z0$000 P {'{0 {O{;0 Q {'kkKE{{*N{7N BB*N@{*0 r  P`w< `  s0R @0P0`kW~ 00 pS`C  c@P 0Z Z0P0 SP p {0P00W0SpG P)pP   ! ML^PP 0CS{  s9R @ r `  0P0010b$04u(}P]00C 0@P 00SL0SR E0 LMWXt 000pPQQ@0S Y Ys U8` @P (DP9X\ 1 @$?@$@[ LP0: K[{[$kk0kP0C [@0" % %A|0P(00@   1 @Q Y! Y {7{E{ P@e P@ 6W?X 0009 QY8`d 9X a9 pP 0S0$&R !**R Wp@ P `QP `N(0SEP`F 0SrPU1 000P ({0 {!` 00P0 L0S E0LL)P8`9X8` WE 0 L P0D #460/\460//P@-@00 R@KP@Rp@-@`0P0RP*:0PpP R 0 R VpP 0@!nO-0@ MSY@DPqapnPV`q!%:0  &^ ^ W0 * 0S  BX:X@D*0S @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ-0UM 0,@P.0L10fJ {{{ {Sd 0      xPO =@-@-@-Qp@-P` `0E R @P  $J00pQ`0`p@-`zNP@P  Jp-M Ѝp@-@ P` !LNMP !@Ap- M ЍP/D -0")2b3c1@2`M1 ЍCރ0 00/ -{M  0{ p`Ѝ  p@-0@Q r P p0 S P1 p PP   ! I @0O-`MpDw@0D0QP095X! @0S S[ @Q 01 aPp P T@@>  0  "W @TQ @0T020&  0 W` ЍQf@0 R AX0P @0   0`00R.@0QLW 00000`VBQTQCp0 0"!` b  V0 ;T@P@00Q" 0 @000 @ 0Se0T0 2a PPl"! 0#000 ^ @ 0 `@P 0Q/ R  B / 0Rp@-@P*`0B @!S@ *@B@DQ@@@ 2Q0  `f2& pS@ * A BP   Qpb  PPO- -pM@ 0GL 0(l x t0`-P-+*)('&%$ ry000P0 0 00@ S 0 040P@1T00PCT!Ђ0 @t@00@ S0\ @0 EQ#0 00 tp0t00+S -S,0,00t000C ^*0Stt00S 1C\8Q 0l0 08 000AS,g Sa ?o2<0Zg{0T@S{pp S ڐ*5 g{0[1k{{05[S,0S ,0S, %0aS+pAp|0 @0p @pw Px |0p0 pLW|0[ |0p0|0  A R@ Q KpCW@ Qx pqm0p00040 S|  @00S 0@000(0 00T ,00 8S B ۟˟p?H0 0( PT0P@h P|  T ! Gx0] @Pq x   !GpP|`; PE b R(0H0P  C0E(H PP0C PEP`PU00 S 0SPE`FK(0SEQ=s,0SV[  P4 A PP/ 0S0S `  <0 pSp Pp W@ 0Sp# Vb@0 S0l0 x [0[` KQ 0Z00S800X00Mc000p 0#Z00S|0L0I hd `P dQ|~00xS  ! x Px 0 S B\z@0 S.p 00 B0p  W%L0p |000C?o82Q0S )K{8Ik{JZɋO0S    0SpЍ ?@<V? 0NT?00XS `t`0P P0 0x Qt000Sl00l0R x lЍ ZiS IS NSt@rP 0 l0000t00(S  000nS 0x tpl0Pd  ^P00CtT0y 0C Q@0Q0t(0t000C Q0pC,0pW|0@0(W,  @P ftp8000t0PW `00W'"V20{r@HТ*:?C0C0  Jk'AQZH@ rR,zGpGp04656 0 kF H30@{  0QF @0S t00S l 1CQYt`000CQPx0Ct00C YLt00N0C YL\>@8,Q8a8Xx* Pxl p00p0t@P& t00Ct0Pt0 0t0 00000x l0s0pC,0p|0@0pg  5k01{{{p` W'"!@50{Xudd@HТ*:?C0C0  Jk'AQZH@ uR,zGpGp04656 0/ kF 60@{  0I<0 0l00 0 Pw|0@00pCW |6k01{{'{PvV  OV 0I8pX00p Px  B\0S> p 0 0R0p 0P 0P00 00@_ \ Pc HP[xP Px @0| 0C B@0|  xV0p0{k V0 0ƋX00000H^8pU|Zk書<0jSI8s Sb Njepna `P}^{ڂ{I{7{pl0X 0l00Sp0KS0 xPxA  |00C |0  0r pnPlj |0 R# 00S S S[ x[0x00 l0000 "AQ!*mL 000  0c2300x S 40S 0P 0l L"0x 0l0Q000l0x @0l0L"0x 0q `BxPx |0p0C|0??A? NG]000 l0x0 kL"00 0 0000P@i!0!l0 0I8X000,0x00<000c<0 100V000 P00S0 00 0tx0!Pl0x S0tpp@00x@0 |  |  W p00[l K PZpx @0p0C|0 fPxP !\ \ \ \Qu}0P^8|0"S|0|2, 01H0|0@0 0&| H0 `0"k <5S,0Á!{{'l 0 G  {.P p00S800:80X0相00cX000S 0x000 P J@XPX!Ђ X@\00?0S!Ђ ж0 480< k 0  B1{{l00{0 G P ? |4k0<   b{,{' A1k{'l00{0  B+pB0H05 `hS!00pl03 A?Vpk 0S xp0 |Q0x ! 0 00C lp |0Vpa!0Zl0 0@ R0 PPN FP0l0|0  0Cxp|0SPx=0P00l0 1 @ 0 00lx 0S]0SY 0px 000 0|0P0l00Z!05 l000# [00Sx 0 VZ 0l00p 3S 0l00 Px  p`1`f`Pp00p0!0l0@0 xSl !0l00S|0S40040v|0p 0C|0k@-}00hG-` 0Q`ppp@PP  PP`q0s z #8 *8"80 W# G B0W   3`Ea V F A0s#8)8RᶐL0L#Y 0U 0 Q 0SPP   ! A@P@O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WI:Q0 [ \ 5 0QR T0#03\0SuWa*0 GV*0F@S3 F\   >I0WN 06S  ЍW*@DPD@ Q0: Q0Q l  l>P:00XS Q0p O)AoR^" 0[0 k12000 QS0T0l1 c, 0# Q:|00Q )Q  0 DO-M<0 XHX8@`p00S 0 0Pu0@0P0  DB0SG^P0D= PPb P0 Q DS ZH P 0S S SD `Pb@00@0 00Vp@ !lHT 0 PeS5q0 0@00S Z 0 P\Pc R  BPPb SP0E0CSڣ0SPX 0Sa C0 0UX 0p 0 Q U P  U UE^ PLU 0CC10BgP0DSy`0 S0 S C U 0S S S  RP`pn3 ^P 0 W@0 p0U0`PEPU 0 BP @` pV  0 BPp0U`890@-M@Pe a  0 B0C2S  6c@ J@{k Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ F0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/Ҵ҈l\A-@T0000Pb1 !0^2, l!p(  ^2,0D10C#10RA! @^ ^@DA0DC1T0R @@-P@M: Q @ 0 R Q ~@ЍA-$a$1`pP0MS3 U10AT !0S 000B  @T 0 0S00 0Ѝ@0!0D1S<000S 000 ~0tќH +t0p@-@P0p R pPQ`00App@0D `80 0QApp@ |tTH0  0#10/sP30s R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P;pP   ! ;`~P03#01S412s2sS/1J //@-@P0@0O-0Z  @ SMpPA PaU* F B  aD  ^'* 0H0C X000300 ZP@T   `d` X`Z P` @T@T 06S @ЍG-0@pR$A0 QPiV'10SP`P\ 00001010i0S l1 zPP4 @p PU `@00SaPP# 000S 00PU 0C  pPph0iV0S <0 ,0R0i xptq H(ʼG-P0R@T`塢ڃ0TP$ Zp  !pC0   a!  \2)0L0C\0003R @@HpG \ -0P!1^$23\ *G-0@P@DTpD !1PD*32\ ::P @ P@a0 0S 0S Q 0@A@DpQ$A3 ! V @00S 3 #V0`F`F` 02NS @0@PpP 0!Q@3A! p@-@ AP`DD 0` P0R @ *\ l1 0DR%& 501 P%&0;Bp0R `5,#511,?C-` M[Tp>P Đ4$66U0P 0Y0 0 CII50c0 Ѝ 0P c2# R   Y C>C0C012`0S0/0 R /@-010aP`@M4lPP2 pP,0S  Q, p 0: S%PP 0uPP0@ |0$  t0,  l0( 0 0ЍB00Ѝ\PvB00rBO00 r$ 4p@-@300CS00 P3pP  BR  /p@-0rSL wS aSOP 9B 0 pLP0S! e C+Sr ^R)# P0SPPp0KS0LS0DS0ES@P0p@-S4 @G3 P00P! !& 0S 3/PP೼000P @ P 00 `00aa,3@0`` 0p0PA 0P000@-!@R !P 0C 0 0 S /0p@-Q1P0@0S4 0 NL 5000S: 0#$0 3/0P:s00-p00P @ P =00< R 800pnO0PsEn}0P00s0C1  0@000 p:A 0 @00 mt-Ѝ/p@-@P@TS S S A 0 pH0p@3,0p@_0p@=@600 0 00000/<P 0p/@-@/41Su C- Pq M  a 6/p0`@0A/`Kpf APpMOĀmZ@Q 0p/ePU`Q 0p$ePJQ 0peP@ Q 0peP6Q 0peP,Q 0pdP"Q 0pdP@Q 0pdP  T Ѝ/n@Ok@,oTaQ@-P @41S Z P hP0M@A-4!@G pPP/1S 0L1  @P!BPPPUQPMoPP Qp 8W @p_oR @p@pp@-@P 0@@A-@`P] VapPPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V ?0@B?@SSC-`p@ M. Sq$QU$( P 0PM VV0( Rz⁐Q 0(Q^ 0rP  Ѝ0Co$!? R (avP^Y P  PRv0SYR @ pEp( !$ P$$(  Y 0( ^ \ :0  *P ?00,1  Q$.(y( (R"  Q (剐0$ 1 ($!p`0 `jP  QlP$Q|O-,M0 0 S ! rp2/0, (Q0 Pu @`P@P\%$P 0  CZB 0@PUpWW 0 `PM 0@SP㲀1UJ[K ,Ѝ 0 |hPPu/  $`hPB 0 $ `P# 0@SP㲀@1  P\ \4 \  ᰠZ"[ L`PP  aP 0 hdP@00,Ѝ$`p  0phP   aP(q@GT 1S(Q0 @-@ ! \ @,= 0 ,1=0S@-@0@ =00,1R@-@1  @0= ,!=0 0G-ḕ0S MB Ppw`X@P WQ   | =P 0 p P0, eş0  4` 8P  D@=@ <=PP NX PP0U4PS 1P3\ X\\\@4: P3.` ZŠ   0 `$ SbPf33  JF<, 0( PQ>PXIK P  0tp '0~ Xk PUh A/ Qp APW ` VS@ZO2  !2/@PG(P QPC aD0!B1\0 Q!NX QW0 pp$4q$VPx b"0bP  @0B 0!p PpލOp<p| P< 0 p<p<Qo<`V/ P<Ƞ*  008P4` aD5<@ 1<z<PPG R o<l<@pf<pc<pV0|[<@ V<@ ^@Xa`,x,O-(P`P10p5fS@(Pp5 RؑP- ( ,0[ D D S 1"1 O5cꂡ P ر   J; ؑ@-@ 13/, (Q0@-@Q )00 2; 0 O-鐆MS`p & 0Z0 P!U E Q[ [ R Y YYY  ;00 Ѝ P 5%0 㴕 !?@P 0 10$!12P- 0@S0 200P5V00D500<50 0450 0,500$5005000 S S k;00P ;p 5 20 2 80p` *0_UP U\3UX# 2Z 00 20120QSpE  000 E7@pP0!03w/\ 007 0'P0 "  "(P 1S0S1S (0 29 20 29 20S 28 2ER4S " / PP r R < "4 <(P0"<S 04,8<004$`8, 48 |&4 <0&<$0%4<0 %< (0.4<0.<,0,44<0,< $(00*4 ,<0*< 40R$0SO(P 0 <Ͽ0 Tp 013? 00<Ͽ013?0/ 2/QP  0@0\@-s0& \X @@p148\48L'4<0'<0&4 < 0&<0.4 <0|.<,0S 0Cs@0@ > 0 <Ͽ0 ST!CC  013? 00<Ͽ013?0/S 0Cs0PP0>@<   0<Ͽ  <Ͽ  0 <Ͽ0?00QU#0AA x0@-@PMQ ;&00U0 2*(   %P&  1 0 2001 0  0 &*&P 20 2Ѝ0o8001bp@-@PQ %00p %p P (P $P AdP`ppR7@-@-@ / ?!BC4 @P/P/0 00P /Q0*   BR1$%&'()   " "        "P0/  O-RPMe @T Rp ?o2` qAWsp 0R0 \\S 0  0C1"00Q!  pW ` `  0 1 01 p S pr pm Vj0S0`S 0[P @0 0C1"0!0a`oobR@H 0 =0A0@Ѝ@P PB WpGq0X  0 @0 A@`0ZPЍ001 A0@0@ZP0 01S Z 0I`[P0TeA 1Q=00/C-A MT' }TP# `P  6 0 AT R0 X 0V@T Ѝ05[P 0 00 0 1 01 0/p@-Pẻp U@ 'p p60@忻6@@@-!1 0CMM0,40@PP: T10P!,` @ PB*F{0p C{{hp@ ͼp#  Ⴛp U p N 0 0 ,4 30CލЍtw(0PI60 P4b@6P@<6?00 AFF @E4O-@ş` LMQDpP #00 2KU  600$%5 0 D0 30>LЍ w0Q1S4 #P䁄-  00 0!0A0{Q:1S Q[0 0Pʰἰo 0S !\# 0P0 崰0U P 1  AP: C r[ *00C @ I1 Aq010 0601(0  0R 1SP   # U| 20 2^(W U w0S/*S: pG 0000 8000S0,p4040,0 p2 0(00 @000S0$`<0<0$0U4 <"P 0㸱0 R510C0s00C S010{/ⰰ1 2 ] 0 KpV "0 " PPE " 0 { R[q ! {0!j0B0s00CQ0 0P {1 S0"1!N400 ? ?tG-@( P`M A ഑ 0` pU0p pp IS1w 01v0CSxp ^01QA0cs0S 0Cs00Pq SA(0 . Ѝp0Q1S  ( @a% 0  P- p p p 0 0R1S0C1ŁW- V10C0s0S3Q]Q?X@a (00(0pv0I 1@P(00(0> 10C0s00CVU:Vp0 @aNP 0 @1PD Q 10C0s00C P p qP1(00  (0t!0!0!0 Pu 10C00C 1P(00  W! ⴑ@qP(00(0 E!zp@-@PQQp P 0 0/!Q P 0 0"!ppG-Pp,aV0F`  1 @P `Vᆐഡ 010C0s0S0SS PP  p    J1x01FVx 0 R 0 1^1 C`fv`V 0Fs00 \ r S10C1  R jP  0! 0NP O-Pp@QM 00 28T T 200@Ѝ(@ @W @Ѝ  `P RA 2@D@ t@_Z* ~P  0P O Aᴠ@D@t@0JZ0  cPP 0p 0BRs00010C0s0S P@0 `P 10C0s0S4 1 1@0C0s0SP  TPx@ 20 2ЍP 10C0s0S   T     PQ  0S,p_ S\ 0S0{ 뼁W`q 뼁`WY 0H 1)P, 1 X0C0s00CR  1r@ 0 @C11 0@1 @崀01 P@ `Fv 0   P 0  tL oq k `PNBPb T \VTW 0f100  H  P , 0R Y 5qW`9 .q0W `0G 1P WR  B1r@ V @0`F1@1 0p  |P`F~ A1@D@@Dt@ vp@!   ePg0-M 0P ЍQRO-`Ÿ JM Mčpt" R  PRLI@IU/ P #100 "2 0 4 30|Jލ Ѝ >10X0 0TXS 00; Ii0$ U"* 0S @0C/[00KP0: S 000 R I R0?00A@V# 4- صp!00S X  \0 RK [ P000W p P 0@oyR ,@G +4<R Q0P:Q0Q:'@-B@-@@ $ @7 |p@-@VPS#-`MP$ # p@Ŷ 0@-@T M 000 @P 0S  Ѝ x 0O-TM Pp`0H0 @8  8$(4PD 0,0`< @@pLp PP 䢟䒟䂟`p  @$ "dXb`%0# `!,l(a `& `zcna'b(*abf ` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah `猈b,) &`dL(bdl+`|.`lXpp<%cjgpl&`` `ga*aldH(d` &b() `b`j+g .pl\c:%pWpl̠ @s@ T0@P00W@@YZ- 0 0 T0 30&\Ѝ @ 0 0%WY P  %@  Y  0O-00MpD`$ $0(0D0H0,000L0P0T0X0\0`0!0   S P Z@# ㈱CP ^荐 ] Y U 2 @PF $Z3 Z0  D 05F  P  P 00e @@⪿P0 f0`00d X (0 0 0 30Ѝ# #0"  ˈ x T  0@- 04M 0P0,00 @T d 0T T H0 0 ,0 304Ѝ0$ Ѿ  ʜ LA-$!$1 0HM Q0D00@P `^ @T( 0T N p` V 0V   h X0 0 D0 30 HЍ$ $ ꁾ  Ɍ C- 0 04MP`0,00*` @ npW:T p 0T *T H0 0 ,0 304Ѝ$ fD^  t 0@-,M P 0 00$00 @qT ` 0T P D0 0 $0 30,Ѝ0$ 80  Ǭ \p@-(M ` 0 0@P0$00@ AT ` 0T P D0 0 $0 30(Ѝp$   O-1$MH0C0ᰀs\p! 0L 00@`P BrX  BQw    Xl U @pP uP0    r@ RSZ 0 `Uv`:00s0!01(0  0R 1S0"s0&1!U 00C01 VH05H 501 10C0P%01 U* ⋰@ p(b X @Bt@Qf\|{zyxRvutsrqp'XPS* UP X !    z     qL    rP @puP@Wt@0s0 !\0s00s01$Ѝ   r   r`Fv`00s0VO0 ` P0N'XC-Mp`u@P%  pPP 0!0 000 0`r 0@@!! 0 040000 00@PЍЍA-@P` Aq08c8q0P00P 0p0S   L| P00  000 0aS$1  @p  P _0  P 0 0 0;WO-MPp@Pl   0qZ 0!Ჱ0@@p^E  0`P 0I 0 00 00!岱0@0 0D000!0!p[!3WpP@Ѝ 0`P 0 0 00 00 ! 岱0NP 0 0p01@0尠P@Ѝ pA-@AtPQ A @pq  qQ Aq⁀``X  0!0 0E Bq0 @r0 r R  Br `` PPV0P00 0 0 00 0QwO-LMxP0tp`S.400 @p$0  (P_ 1"0Cs0 11 "p q 0]0X00p04PS , X` ``* 0H 1P% X 00x0C⾂S񏐰S 04  p P  eLЍ 1! BR2*0 S00"G X 00 000CSjgfedca`_^]\[71a V0 0% 000XQ @0 0 @8D @<86/ Y``10 00Q!x4 B0001!0C0s001 B 0C s0r 11 0 04S^  0S  2 0pPL [ W뼁[F P p0\!d3 B00010C0s0S 0Cs00P 10C0 s0 @pS  0Cs00\ 0 004S   P p  LЍ1" 0Cs0 1V1  U00000 000p 0 WP 0 0 0b2 @p00  0 R } C rX * A∀H  1010 0 0 pA``00 0000 1 20 p00SG { 0 0i IP0 p00TG- `P@PL `V7 2 < 0 `'  ZpW& Q08 R  K P7 `10C0s00C 0[ P0 0RpW 0 10C0s0R p W0 R  p 0R  zP ` C-@P`Qp$M 00 WW 07J  (0pGWX{V6TS2P0GS7'00$Ѝ(0xW! ,0p110C0s RB  x1p崀 P,0p1! B r R  1p  P弁pP 0 00 P(0r00㸁(0p= `P 2 ^00$Ѝ0S 0S  0X弁  0pt 0S !0!0 5 Pc W: $W7 W"(0&XJWJ p W  PH H⨀Hx弁 <W  3긁0(0弁x⼁s(01ḁ0C0s0xXW$ p W  QP Hx꼁,0WSBq X0G 1 8P꼁,p 1ᴀX0C0xs0X!弁 X0H 1 P1崀ሀ!0  1 P pp z0Cs 0 t각 0H⨀Hxl0!1 p崀 o Pp@-@`PP 0 00(0`00Q(0pO-@pM,0 01 P@ a`F`v`V/ P`rPV @t@ @S 0Fs0P ` 00!01@0 @ 0U @Et@ 00@ 0 Ѝ "  U ! B r RQj0 0P Q _P !@ B  B  PP   a0S0 < a 0R P0F 13P @VT !@Dt@@U `E!`@1 0P  PF A1@D@@Dt@ VP@!  P `  ἀ@P7  v 㼁0S0 11 X0C0s00CRK `뼁0@S& 0H 1P] " PXQPQ \ DPD >H`  5C ` @Dt  1 01`01 P " r R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P L  0 0@ (#0 "dO-@P2M0\0(P 00$` p @ ` pP0%0g#" 0," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00ЍA-@PP $`?(p7 )1#0(0 0`0$0d0N0  Sh # 08R(@R )@ b #08 #)8 b#$0A-1?`@Pp @f(X4 @6$0刁0$0 0@pG0( 0p * ?W9@`G?`@`(`0@ @T 0"< T"?pW (q"0 "?W@`G?`@``"@@< T"`R @-/ Z@-@P P Ό 0 0@ ("0 "R @-{/ 5p@-@P X00m]\`  0 P^"0 $$p~hO- 6LM0^o~?,00p(@ @,@@0@ @4@ $@8@HP $D( @<@P04P@Pp `( ` `@(P@P$` .w0` y  ,`0 .) 'p',') "!p00 "`$   " p 0%/$! p   !p 0 ($~o%arp' +lc  !``&``&!p` 0,p `Y$`3,0~?000@4      ( 0! A"Ġ0̌? 0#P$Ġ_̌#,,0#, ' IG) "@P@P@!W!IYG`%KD "@@Q< ! @@8`a` A0iAqNf`&@4p0yAvN@$"#%C$-Q "P8`ˠČ ,0`P0@0#<`@0@`Q `.0@@4p0 P$ 0 /P)Π+! Œ,+N /)! B(p`@$,#,@$ &` .` ` " ` .0@,b0P PX $ X DP0 0 0 00 000 00000000000$00$0 0,0 0,0(040(084000 000 <0 0< 080LЍ}{Dp@-@PP 0 pRPQp b o Q 0P0L0@H 0D0 0p@SR Q b Ip  D0A-1`@Pp fPX5 $0 #$ L00L0H00H0pGPpP +WF`G```$;  S$P*$0 $UpW Pq$0 #$$0 $W`G``P` $;  S$P*$0 $U`R @-/p@-@PP M0 E8R  pp@-@P X00k]\`  0 P0 $$ptR @-P/p@-@PP 0 E(R p00@-<PM0AP@;P񏐽ndn<840PLHD@<84}yuqmi}yuq<84KJzP;DPnE@5Py|{xsrqponmlkjih{xizQPedMl]\[ZYXWVUTSRQPONMLKJIHGFEl[x5P l5P 0P9@0ĠH 0P%0H ͳp Hߍ0?CP 0P0 !@0 ߍ00= @2S, DP¥Q00  r ,0Ϡ{000H {僳p l0 P@000H Arp DD0/<0 0 !@0H Xp HP ߍ00 d0 F0 y@0Ġ 0 P@0ĠS@0Ġ0 d0 a0 ^0 [ 0 0 0 0 O 0 L0 I0 F0 CE0 D0 C0 HPFL)HP >0 *G0 @0Ġ0 0 x0 u0 r0 o0 l+0 i*0 f)0 c(0 `&0 %0 Z-{ {@ U 0 O0 @0Ġ@0Ġb@0Ġh@0ĠB0 - R@ iDx<<0 $0P P@0H Af`0pH0<0 ,0 @0Ġw@0Ġpj{G-P8M(p` {{q(@U@W@V@Tn 0S?!Q 0S !Q0Sz Q 0{ 02{c"P 0 ! r R  #|:W UQ VPw  ` 0 " Q!W Up& V P`0P( U    V x! 00@` 8ЍV0 `,0S0 0 V0`W Up V P0`000 ⎱P0SQ q0Sj Y @d0`0  V |;;|;D x  t Tl p@-৮0@T 03/@TPP 00@T 03/@T\pܯH00@T 03/@T$jp  \@-\@M@P Ѝ {  0{ pЍ8,O-p@R M ഁУP `A80 S! 0SJ: K 0 Z 0!80S7  0Q?0 6 0 0 Ѝ 2  Z  0  00 0 P 00  }P00 2  MP   FP  000@-0 P R@MPQ ! 0 013/Ѝ0s?0r? <P100@-@P0U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpG-`P @P0Sp:ؑI Y `1`! { b PU p @P᳭pP pPO-Mq0 P0 pG 0 9 PU @P U`1`!   8[ 0PU0  ЍЍ0A- P@P 0 a`F uP@D pV: ΡP/0@ 0A0SJ*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-#81 ,Ġ̌%T\$DL0P  R*0@ :#Ġ01̌  R* R: B0@-#81 ,ȠȌ%XX$HH0P  R*0@ :#Ƞ01Ȍ  R* R: B0@-#81 ,̠Č%\T$LD0P  R*0@ :#̠01Č  R*0@/p@-@Pp00Sp 1` 71!004 4PU 0<  R<<T@P\`0(A@ r0 <01248 Q!:0 S p<0<P[Pp01G0(0 @p0S(00S0!@Q0: Z Y @c/\Kc/G 0p 00S 0 Y@0 SR@T *00 R 00"00t'd7 0 2 30ߍ@2S@70< R,000 4`0`\ b,0(`V4`,0(倀P 0  p (pV:` 76(0_Wࠓࠃ604< X00So  0\ YppW` p``!XY0•2  \<Q(( Q )`p00S 0 SR@T 000S900t<@To 4Xu @ X`@n Z`D 0ST 0 Q\P X^Y@LZ 0S,c/tp* Y3 0 SRb@T ^000S $0S  !0 0S 0@T` % O P0 SRPU 6000S?00 XY@ @c/\+ p <@T0 SR@T 000S00c/\@ @ X `2 `0 R$SY`bp]Y``2 0 R>  "   T0"] \haa0 00000 0#0 0#0000``0000T ^pp@fR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@7Q `T ` R\ ! R00 B-ptx` PP5y  R i  ` RPJPN P?e0 ?o60⃑ i`PI 0 08P?e0 ?oP 0C!P05H RJ@+ IP?e0 ?o5H0 SP RZ 0P@ 4 0S00Y+R03<PR#4@@PPrR PP @0!32P#4@@@ P5`P_eP _oA/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*Ap@-T!T1 @0(MT0$00: 0PS` RT= 0ST@ 0 0 $0 303(Ѝp (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@Դ  O-p`M@P-TP0 +Tp S0T W p  S 0  j  0?00  0 0 P @p Q ; P Q  S  R2  " Q 00Bs ^a0BSW0BA0BS-70BS*| YZ  P Q  S  R " S@` "00"00 0S \0F0 0 ЍS@ `?0t0T0i XR A B0A PR W p \p pXp @` QWKppK0@-BR"^L M @000 Ѝ0@@P200TP Ѝ0 0p@-BR"^p@ @P0T0PpA-@P`UT0p  R*P @p@ҙ@pR T@p@@-0M @ O9 㽋P < 00 0 0 30Ѝ~3 L |80 S( 0 / 00 S 0,/ 00\<0 S, 0 /00 0 S 0,/ 00<0 S, 0  /00(| 0 S 0, / 000kD<0 S, 0 /00<Y 0 S 0,/ 00DH<0 S, 0 /00P6 p0 S 0,/ 00X%,<0 S, 0 /00d x0 S 0,/ 00l<0 S, 0 /00x ~X0 S 0,/ 00<0 S, 0  /00 ~`0 S 0, / 00<0 S, 0 /00 }@0 S 0, / 00 <0 S, 0 @/00 }H 0 S 0,@/ 00v p<0 S, 0 /00d | (0 S 0,/ 00S <0 S, 0  /00A |0 0 S 0, / 000 X80 S( 0 /00 { 0 S 0,/ 00 80 S( 0 /00B {   0 S 0,/ 00 P @/ /H-M 0ЍH-M 0ЍA-`@PpA8#pW 0P@-M?#O0S!/"  QO$!Q Ѝ  0S RP/0?c0 ?oP/ -- M0 0G ЍЍ/0@-0M000 000@>S@P  !0#00  P0Ѝ`000 @-0M000 00@>S@ "0!,03,0  hP0Ѝ<00@-@@p@- MP 0 0000`!@!`0@PP  CP< (0 0 0 30 Ѝp蹰 w w wdG-P@`P pR#W  2` SRR Qa 0Bi ?o/o0CS 10c4ÀWR' /o?o BR 0b14ÀO@ϠU0P0 T R∀ᣟW0 0C W0 0U0e0?oc104/o?o0Cs! R 0b01ÀW W00b0?o0c40@b1C<àQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /p 0@-@$P  000q #\/-$0$0 0M 0dЍ r RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 0000@-Q @% ST 0 C0 P @D^TPPU0N QP Q  00S@R S Q0 S 00 /U/ S R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ ^S QNP  S^ PU@Q @0S Q RU // Q#/   //s R RS0  0/U/00 0/ R S  Q  R  /SR  Q 0/0 U0/0 0/0/R  -/@-\0 @@0Q00R S 0Q00S0 0/0 0/0 // Q#/-Q S  BPQ P0C SP PU0-Q S Q P 0S 00P 0@-M | @!0000 4 ,0 0 0 30Ѝ i h0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/4 40 00S 0M00Ѝ/ g0t@-@p@-0@ ,p=pPm0PpĤĐ////// //O-̱` Pp U4M y02000"0&0*00 ( 06/4ЍF0 S@' (!S0S S7 2S@0SQ00P00^) 00@[0 0 T 00 "R 0SPD @RUl00 \00 S00000@ļĀl<///O-˟ MQ0 ; 000 0%SSSC 0@ p` 0FZSZbXW\UTSRQPQMXJ8}|{zyxwvu?>=<;:9876s43210/.-,+)('&%u#"> TO  VV @ 0$`$P@Xp6 \ [K: Qc ^ [034S0CP Z0Մ0˄ R*f @HT@Db Z 00˄@T*\00F`00F Sbp  z 0 00S r0-p 000 0t' 0ST{00 @ PT@\0N @X [* QHQA Z0˄Q*p0C,=  t QT{@ P0X04h`p`|0PU{ t0I   P0t  BT@0d DF` px`0 p  0t 0ST00@{ X|` > 0 0 000`lV` pp`{@ 0$$P `p`@p+``p\ ` `*VK 00F S@`A@00F S@50 0< 0 0 0 0pt{SR P "2> 0!0e0ND @$ [ 04FHQA0 Z 00˄Q*0\ Z Z 0 Z`˅ P 10e0Q\ 0 0@N EPD @ R00#:P``p⚀*@ RTL!% dV0 ⨀ c/*`@PC0 N CD @ Q  000 0f r 000 0~ @ 0q 000 0< 0 0|0 [0K08"2 0 0 30xЍ0 0 /   ]@0` @100 0 0 | 40 @r ;  @ 0 0 QP00d D0 0@ r 0 I@00r E000 0 0 @r 00`@0O; RT0 0 v d l Z]A-`T0T 0pP@PU J0PES 8/`uX@pW X4x 0SS S 0R / 0R0@o/ @-oO-((@ CM Mp4čP`0@  0 @0 44 30+Cލ Ѝ 0p `0p6P ڐt 0h p:L+   0/s WH W Vg:G-0pS+ S'QU$ X!`@0`S  0P 0#4@0S 0S0S0S%  P V Q@0 R!R  "$0 R R \O-` BMMVčH1 0!Ȁ Pp `V' 0  [hP@P Uhh0 ZPIPH <0 0 4 30BލЍק T SO-<< AM @ MTč1 0Y,:0`x0(SPp2 0S"W0 0@T hh0  P pW p   0gPL @0 0 4 30Aލ Ѝ0x0(Sꁧ S RO-M Mϟt p / 0  @T 1S 6 S `1  0 ?l@X@0 0 p t. @0H0 ^0S3 S90PpP@u` R PP' p 0 ] 0P R!R㇓ :P PpU`@P0ST `u岀0S`V@ 9 S 0S< d - L - @ T p P  Tc0 <0040v?D0\@4 0` S1S < 300S S00X01< 021帑Y[0H0tSp080400SAT <0CP D0PpPPw 0;O8@  P @0P P 4 <0 @4 D 0 T<0D \@0S  H0SQ <002p0^ S00H00SS *pt`P|@600P @9/P"8`0 @~PF 0  P{ e |*: 0 6 30bݍ ЍpW 4@P{D0Ppw} !D0Pp0 e  0 : X0L ED0pd4000S70X08<0PS\0S  P@xU00 `F P/$P0,0 蘰 P(00E0,  ~P [0.(  QO `1  0 P90 X0L@0 Y  @0[,0@0'$0 0 0 SO@0b0!0Tp?A9c!}P 0S @0P 0P(0@' !  ,@0P@01 Q!  (8 0 P0`1  0 70TX0 @00 00r  1 01\ 0@0`1  0 $70X0 @0r0 M 00 X6 PW0&0< h X⿊LP / 00 @q @1W㲐@D0 5`TPv? 0WP G ! 0‹2 0U 000W     ‹0v@1粐0 0 l5H@X0 0@0! }P0D p@0P 0$0@$ G (0d00@0Ќ0$0@D$D 10 AQR `1S9 0   0@ H0@@`Tiʋ |@ A`!!! Q=   30 @| X0Q *0H RC A baV *Pv|@0p t@p6/P񏐠i0+S .0CSb@`0P[PPU a0 2|@X0 A0`!02 @@X௉i S0\01S< 3`0`00S S8P16 `0 o}P00 `.|P101@PDydhP p ` {0PW`0P 0D TP Br R D0DI {P0d0P0@@ d06SH[F  R0 R bbb_ M0^Cރ\d[[lYYpYXXWWVRRTRhR<QRQ$PQOPPNNNNN$MNMlM M 0Rd6pSX06H`s DP TP Br R D0D {Pz0d0w@u0P t0 0@! ՈVW0 0R 0`1 g 0 @1l0XP0 B&0R  )UH0!0@! ੈ 0 P 0 1 X@0&0 R  )h H0S[=00b0H"0l"l {6   & Gr R P T Br R D  R,#zPʎ 0 c0@ 0|P`P 1011S100 0 x30 X00<0d0d000 3@X@0" &0 R  )*0 3 X000m0d0@0P ᑊ0l$0@t$t 0d0|  `0 lr0+S .0CSBk@i0P h0$0@ %  ɇW 0|p0 2(0d0wJIPG0 @ A@r0|5 @Xে90%0% ⚇('P%0 @ #0&0& ℇˡ/0-P@@0/M- 0  0 R1#0e(6,  Ѝ/;M-  0S R B 0S N   Ѝ/;M  0S 0 0 0CSЍ/RЍ/0@-$MP@zP$Ѝ0 zP͡0ıġ0"c110$Ѝ00@-$MP@zP$Ѝ0 zP͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM {0/1A#b{ Ѝ/bMO-@ŸBM M 1Pd$č$p000 S00- 0p t P@QP0L T0l PN0 0A !< S 0 T40 ; P0 0000 ; PP P0. a H010$430CBލ ЍS  a 0S0Q( Q" Q a     K+ l0 da`a]a` 8@$@ 'J 7IIIC-LLP AMM č@`p04" R3 h 0@`  P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R` @@H քD D 2` 5H 5$HPH$O-嬡 AMM  čRypPLpPPG `৅PPB t @+0NP7 0S4 `  0S+ 00@ pAP00@S 0S0S 00@ @K @  @ D ,0 0 4 30AލЍ臟 4( 4 G$ 2O-ß CMM`,č@pPX\@e`0S  .S@0SV :T d1#T#*0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $`000$0D DR @@ 0S+ .S& 0PO0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@1( P/d!"" 0Sx0h 0@$0000]0@P@Tk0!0$  00$0s}0S 0S _V0 tO0  _ꈞ 2L 1XO-p0xŸ\M P@`"T V g0 $  #8 0ŌpU@ S 0 \Ѝ10(('  0 pVX0 0 0 F^P0swp9_6_0SUPPH   B RX00 0 B^P ____ @ຠ\Ѝ0 `F 0S0 s _w_ _0s^0S 0 + @00\Ѝ .PHAXG-@0`P p"@D T@&)^0Wp^뵐0`  ^ ^0 00@$? ? G-@P p嶒b E0S@P0WU! ^@^P ,EGp^E>O-0P䡐 M0S5 @@d@t@`p S S0  P&  P0 PI  P00^ f0  SR 0  SRS Ѝu Pd1 02d1 HOe P0 B  P  P060 F P0 # mP  fP090\  000<i0:0  JP  CP090090| 4P010r  *P020h   0P0Z^ d@n ?R? # 0 2M$ 0P0ZC @S ?R? # 0 (32 P+ @ P010  P010>d>x>>H=h=P=<d= <<<<p< ; $;T;@; @-@HM-vxv% |Ô0{ D   0  x{ 0vxHЍ @-AMT  u0000 00uЍ@@T0@- 0 A0tMT0l00  u 0P0#0% 1\@ 80 0 l0 30tЍ0@@؛ $` #A-@P6t 1!01n0SPpuOPp %tp0Sp@-Q@U x3s|p ǁ01P 01000ptcyuVxsP //$P //7G-P`@>V%0VQ\@ 0\!R p Âp p "p O-PH+H; 0MM050,;@00;\0YT 0 0~01'0`,4" 05@ d!A  d!. 0`11110P  LJ0@ʏ 0(S 0(S 8 R 00sS2 S S 0T( @8 R2 S S0S 00 S S SS@@ P `0̀_A<P@ 0Q.0A#A'S? 7R2 S S00$R00S 0@0 S S00 @PP0S S 50P PPPPP00H00@06w_ 00< 0I Pe1|spA τ0`0S X `0`SH@DH .S0SX P`.HX00V0S 0 0(P % 00%004 0 5 30܍Ѝ4 RB T T [ʬ40`00(0 0嘔0` ,4p T T@ TT  ;T RO@T D$0P ;T 0s000@@T  oPp 00P  @0勁(h1^P @@;TT 3 `0 0s000@@T;T   P @  [l!@c,r3 R2 S S|0Sg 00 S S SS@@\  `Pq _AP@`0DPSH  \R?* S S00 QP0S0003(OTP.P `1=CDQ aD@`}Qt0 SQ`@+SP  @0勁h1h1S$1S1  `mp0 PEaT ` pZp2 0  5  0 0 | 0 ||" 0 v @-<0< 0@P @lF 0 0| d @-$0$ 0@P00  00/ @-@P @FF00]| @-@Pܧ000@- @P  0 p@-@@000M   4|PP0 /P CMP᫧  0 ЍpᣧЍp  0 Ѝp \\@-d1d0\!\Q Pp 0 RpGS` M, ` `p5 Ѝ A@ryP! 0lyP 0S@ R ^yP@  0 `~ Ѝ|| | 0 s~ ЍXX X 0 `f~ TDm8m 0"4""d"4""D0A-0PU" 0U"0PUP!q@@``F{P $zP 0!E`1$(`P 02~Pk''kp O-Ff@0`S M, 0 4 & $0( |V|FP@RB 1ȖqYT0i(1<0 BRQ#)16:  50(< ܅ 1 c0Aş0 p('(p4 < P 0(0 Pz hup40SgX% 1S H 40SkH6S (% 4 0Sup00S S404 RR 4 ,00,000Sğ0( 0 0X B2*3Q Pq Q^P( 0D$ Rp (40$1%40(8(LiP0440^# (0p Ѝ! qQ 0Q*# 0$|3p040(P8p!@(%01Rx$#30<!^ ^ ഇrp S:p 0("< !0(0% P^4+|20(  l20(<  X20(<  D20(< 020(< 20(0 208(  0聟0(0( 10( 긁(0(10(0 R 00! 0t1t00`10^p (4p Ѝ:p N5p 0q^$nqp2  Z 00K q|j jjXiii`Pi8ihhThh$hggLg4fffh`f f eeeeeepeLe8eddD(O-,1M0 X A*1a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y$00 Ѝcbp@-$0 0yv A-@@`V 0 CQPqxP pG AP'xP 0`0b@-@00 R \\  $0!0D0 0@ ($ TaTa@-@PL  0S  T0S@yy@y`P/0-` 00 0Q,000 P0($0 `0p@-@P0`H P 0(S  1T 0$ 000`p_p@-`0Psv@P PnvP 00p.Ȥ A- 0@S  P t00  ( $   PH1H0?:Q@ Q$10 p?  960@`@0O-^< ]dL]\\\[[[[h L[ ZZZ`YY `Y0YXX(WVVVUUU|,S|S`   ( @-@P00Q  P    $00<0 0@ ($ RQp@-l@@`VpPPp"0U1pPE1PSp ( 0$ 0pQlQA-pA@PT`QV0r@P 0 P"P`p p``@TA-p`@rPP T  )000P   li4@-@x@0/ 00(/O000/O004/O00/Ox00/ p00(/OP000/O<008/O(008/OA-``PU 0AP ppT0APt404 0 ,(0NN 8rst/-< <0  M00( $ v ЍN< <t@-@0`00@@-@Q 00 2  0 G-xsPp@M 0pE T 0S0{00 0  0 0$ -0{yPP 0` 2* "Z &= " 2> G0  0 pq~ X X 50020@è Mf+@PЍ <R 2"00@ᮨW 2: 2 (gP)0Z 2< 210 010010 010 0100100x100P 0 R00   0{T 0 2 13/pTd0-00PP 0`2 2u00@Z@0S|X~ 2: 2p Pw 2 @0 2D001800 $8<,C-@`pQP M 000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH FP (0$( p 2P ;00 ЍP Ѝ=00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p  ЍR @-@`pQP M 00U,0`V( 2S * 2 P13/PPF `P 0 pu 2P 00 Ѝ \ Ѝ00PO-1PSM0:00 X1*q`I`[ <p@ p W P0 F P tZ 2< 2ЍЍ{qP O-MXr=*`00A̱PpP W [K DUq@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 Pu 0SЍЍC-"1`S M2:rWB R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍpP"! ЍG-pZ RbM'*Q* U@0U @ RD0 y P X U 2< 2Ѝ@EЍЍG-邀഑@ 0`P9  IpJ1v`wV0`F1v` 0 \ 01^` |0N 0 L|\ L|0Q0s00\2N0C2pp@- @RP ` PP  pPp@-P`@Q 00T T A 0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M 00 Vu 2+ RI 13/p) 0 b! 2$  00 3 p`0 9/P 0 9/P  b0P 4Ѝp$ 0 2 rq0 VP 2: 24Ѝ?p`(0 0,9/P 0 w0pP000E0PG-`@@ pRBZ9 0PS0GPE S0uP 0 B0W G B 0 0 \ q|CC0R0 00000pG000B80p0C80000 PU PuPGC- M(Xy\`? SPp< 55S0@@dZZ0/ A!, a3,1  mpZ P&,0S< X1 R , F $( 4,<0 < Q0 ЍU@,00x H ᴀ0X,,0S0S Q  #00 00R#40A 0S` 0Cs0 Cr  0ⓣ@0@ꎣ@0@O001Sp@-@M P'laP8 \,0_P8Ѝpkn/G-4Ÿ`0 MqMŸY w @P^ 1 R2X< *5S0@ZZZ0/ L,. l3.<  0lpE YO\!L1 0  0 30H؍ЍU80`J8 ᨪ8000S   48"Ġ< "̌Q0 Z  Q"$ Ct|pp@0ۢ@0O00꺇 p ԌdO- P `rk@P H1嫲p0q1  J08 10000N`ⴜAO-40@S`p M0S0040000 PD 0$B1;0C10 X0 M ^ X @[ 0 PU!B! 0SO|   R 0S  "  0!2#$ S C$ U @ US SRMS5sP`Uf 0 ~P 00000 PBA0 ЍX D $ U D E RP1 PD D00CD0 0 10CR? Š B QP"y0 0sPP!@ 0C 0$ 10C0S  0"kZP\1 ^00 n@0B YPUڠ1 0S 0PŠ!D PDp0PU PHDŠAD$1 1  LP  00S 1$10$100O-@P pXpG`wp MX ` p0 Rp1 p!ഀ Hx0~PpPHఀP ഀ 0LPPK` [ [ 0pQ`a Q 1 !rY 0  0Cs0pG0i 0 H0H   A 00@000@pW* P1!0{ P Br  Hx >0 pW r 0s00Hೀ 00ഀ00@000 Ѝ @    Br qQ 0 C 0 CPP 0@000@p ЍA-p`P@0R"  0S00 0[U@ -T8 P0X BPR P Q00S0Ӳ00ô00A0 0qSp 0s0C00000UU800C80O- @T @P@D(0t@S(,W i0PPI# P @T @(0@Dt@T `pV T`  0 EP``p@-P@ 0^\ ^ P0Qᶝ Pp\ p pG-@` 0PS 0S  0Qᕝ@PS"  00S p\: 0 BS P= 0 \yP   00(!S$! 10$1P0 eP @0徐p 0p 0 S ޹10 B\r ᾐDP  $1 0$1(!00 O-\0`0CS0P@Lp M P g fP& 0 0  eP 0z S0  Ѝ0 0S0P 0 0P000@- M@ P p10 Ѝ0O-@M 0p  0@PH`pE ᩘ P1 @D0zY0吺 | Rἰpἰ B0 p0000SD0Y@@Ѝ0 @ ᇜP   Cr 0C 0P00~@P PG-d`Ÿw?`0 (MR$@pi2 S:0JS !P P崀2 S up 1  P ZP崀? Z1L PG: C rX": L|0∀1  p⣸ 20  2 0 0 $0 30/(Ѝ00C @ 1x p 000 p  ` 00 pکP202l d A-@pPQ`M :00 2   Q `:1Q?0" BB1"000 VI VFEXBAF?0PU: Q * 2 13/p1  R* 2<00?0  P  R: 2 E0 EP VP V$P "0* " Ѝ800Ѝ0PU Q:(0 $P0PU`PcP   eP 21 se@--M0  @ Wh hP 0PSP000S 3/c WeY 8 80 $0Q/ $0S/ c LW<<0 0R/$ 0S/ c @TWA-@T 0Sp`/XP0P@Q0@ @@eP 0A/P;%ZO-@$M`fT mpܴ4$$0Rab (  }WpV廤BP b0@SFSChhhhhhhhhhhh$4HX 4F3 3$$ 3$ $ 3  3$$ 3$ 3($ 3$,$$o `3$;d `d$Ѝ $  ( ,  C # PU! 5Pp "Pqd@PD ` RPxB `  p  BR pPG Q]($R0 U tWS UX,$R$ ^p4 Ip0 W$RD $pR $R !d&@ $R $Ѐp P$R& U Q R  T$c&@ @ $D  ` &@ T `   yp Up$R UM㕀p -㑀p P  ^㇀p U?@ Pz^r˚%b|%Sң,q4%Z@h%Z%Y%a ,Gg˫˦O-@`MpPbGe뤳3#@ @jp#x3B RP!GP P( Zf@(hPF  H@ P<`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X @` `Z`r`T PP   (`Pd 0)ȱ0V!Xq``pVpP @ % B R` 0S 2U X @0S X  R 7/ P  R fC$ Xe  ,$ Oe  ,P@0S P㕢X T`r$,,q4%S/_d̏K_ ~g̘O-PyM``Ed0pI00 00 ckp8 PEU( 0R` S 0 0 OvPePRP&GPf0@S                 H0@ S           aP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0Sp 0pSpp#U0-U PE4(U&  P Q6P/[  00010SU0Sppp C C0S S/R 8UpZ0SCUa(0S0S 0 0 Up !坡 0: S UH/[0%㉡ U0: S0( 0 000JPU   0P0 0P 0)r0P @/P050CS" < << << $ `c * * `00]PP0S T:0Sq 00   B R,\ L` V `,Q$ /0 =!P@`0 !P` J/R  S/R/   C  R: |o* ` A 3 0S S/R% 0 SR' T0sX0 0H!LR\0X!\R\ B*X00: S 1h C C `T0: S P1: S ,T : S!  Sn  Sf U~ S_ S L0S !PM,0SL `G0(尥 0Z )Z80 S80p1p!pp&Q {TP!P1: S 00Z0S 80 0CS!800 }PR X0|cS )0S !0S ! ]r%f̡%S̮$L'$T(g9KO̘lI͎ͯG %f)6<Q?\O-@P4a &hp6V@FyP50Pe40S0  PRP 9e4P0805HP40P0x%.,0@>P7şP08 454%HPnRP8P H0 0 %43/00P08004 妟(P 1U0! P ,P 0000/0 $0 9P0; S D0( @, "1H P85/TP0P `S2PP P0*^s0 CS /1#SxP0 0, (S* B"!!0 8PH0U 03/p0S0iH0803/paPPĂ &0 S * X  m0 $03/0 0 -Q0  U 4?봁0  0 -1/ ?P0 0 0 ,&0 &P0$ ,!ዀ0 ,ؠܐPZY0   0 0&0 &  000 R0 0013/w S SBX`\P0R , "PU`!0X`\PC @D\rA%S0&v$X&wYң&wg&w҅&w   &xҝO-M Mp?$`w~H Egp 0 Q 0  s0(0G@-P񟗙0<| DT`p0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S ǝPU RnR oR0P<0,,`P  \P8㮝`P,PPPPoxP L]`[R8S;05PPa4 1S}H @0R. PV`@0S0H0S 0  ЃP P 4R㓥' FM  P3mY`, 0X ,0SH 8 RS P0SP⮕P4PD0S #: `rE%Sg,q4dDO-JM MP^C[@rb fbp1 PEU㝸0 AS U  WiP fP hP vP00@0@ 0E BMpP0: S(! E P` !%0P 0Y/S / J>00$C`İPE@D0p/SP/*P 0 S: n"p  I☣PPUr]&~%SbA-`P@M D 4 0: LP  L LP  L LP  L LP  KPl偸h3P0`3P P$PD3( 0lP+( fP3( `P7( ZP;( TP?P ( PLP( FP OP8$@Ѝ(P (8PT"e(0S ()P(0S (P(0S (P(0S ( Pq0S JP!0S0S Wp X`PPa D1R`!PU 0E /R 7VP(PU  ᥼00,0/00800CS3`33t3P0$0u00S p_0s00`'+%Z=P',VE$e$&d& A-@P~Y`p `p 00S VP㪗LP PP ``P $嚴 0@YUrd%S%Z@%YңO-MPn~SYp`䖟F u`p 6@X/ʸ60S ЍfP WP! PP ` pRP dP vP iP0`0 prPxP ``0`0`$`ag [1ES oWBu帅PU >KP$0 S0Sp7 #@[*0/S /0P0.S0S .S0SZo  4 0 R  @  0P0SP$0pS 0S@ `P PXPPy0S 84̖50C SU89`9`809`9$8l9`9`80$S P P_Y  00$ @UY 0㟖0S $ ?RR00R0SW2 $ ?Y  <0SX  P 0 !!0C0 IP 0S' &70S 5S 0S 0SaJP0 0 {X Pu&I0Sn9P i0S 0Sb 0?S^ 0SS0S 0?S 0SS X d000: S0S<|0S 0: SHP1 0S!  S/o" R vP SLI 0SI P 0S }0?S y0S0S Nr R',%Sg \K̘ | G-P@|DWp8a ^p 1 R1 `0C@P bSpP vP0pHP B6`0S WP /P 0S 0S0`HP0!600S rb%S'-gp@-PM~ 7 $ 0G~HP~H@IUITD GP00CWP3 yP 30S S! S  3ZI \3! d3 00L30S  R ,#6 R #!SR3, 3 2 720S ( 2 20S *0S'002@T$1P0"Z @ e xB00CS00 , 0 < ,0S60016 R0S 10S<P ~10PR< 0 01 10SO 10SK(K p1\1PML10S H10S d1 X1 0S  160S 0,i,@1 H017&( 00S0F0S 00' s0SX00S 00\" @`|P@(To'3r4$'-'.,'6'.@'-'-Q$$['9$pFl'-DG-@MP  {U2br@@0 S X "]pC 0 L1 0WP|7x %HPd4`x HPL4H8 HP44T; 0DS 00S8 @0xL?0QD0@0 0Q)@0SZ L PUǓa0@S񟗷D4BBBDpD<Dh@|gFP \寓@@L= >P <P ?P 0@0 00 1@L7TL8T0@0 00 0 WPL=| BD0S hx GPT4+Qr%S%S+<+B+H@ tB+R@th+]@t+h%a+y,q4g+s(^tg+@-5zEQO-M p,ztUn@0o0C?o`DT20<$<4@@@ Yp$4 4 00S ST [@ Y`> Z``: RPGPP! AH@ PGFFFG(FFFGFG|`hP dP fPvP$@``j1 00T 00; R4 : @P @AA0S #S!uAd2 00 0 `PXL 0pL#>. P (Vp Np rA Fp 呒0S<0 0@0050C SRIDJ\J\IJ\J\J(J\J\J(J\JLI\[ @P0S? 0g$ pU p0 R qX  Pp P    3/P00 S 2$ pT tpZh000S Or';,)$ %S,2,q4̏_';~̘Kg_O-M MP$Jq^n5005/5 035 <:p0 00űP eA pP pVμP6AQ ՑA@6P񟗹LM\LM8NMDNNMPNNMMO NNDNONNNNLNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN0WS }055050p ZpP P 0Xtȟ S  SSy `t050505484 RP LP@ 7@ط p0"S Kꐷ }p 0"S hL lpԾ0"S P 06HpA0z0500~00v01w 00 0s0g0e0c!%\Ɵ  R  ^%PS00 00055e46V0 PGoNWPE2%R U%RpUQp0%0;׊P%5S 0DP80: S0550GSTTtTTTSPU%R 2' WUz05CUr3G\4P$040Oьp`01`^{PP ~C\$iBVL%`M|TD00000 0BPP#2 BC5CCCPc`0 0S #P幏p@QS۽0#S  B0-D u0E?o2?  B `V4APPP0f/fuC`{V F`PDhO00CS0 {P Pp PNU0 P00CS0{0 UxF0S:00S:0yJ2U51fF1S)1S @GAPd`d!iBK%lLUxOP 0T CP! F`0U0w0 *FP协0PEUiP@ṏP  f/0 ҼT  ;PxAP';56|6c5666,q4Q6666/6H$,%S'=$6ig'<%Y65H6S߄GG7%Z@dm53p'<(PC-{M 0P !@㐐`p@XPN PP`00CS`0 O@T ЍX0 X @P'a%Y¤O-`@pP0dMԄԔԤ$`(`,`0`4` ` 0Wp0$@DTlUU!Z  QtPcPSPPPPd @"nP tP0 aP` rUdU 0vAp0#㽎dU4 RU SU" QU040  姎pUY [/lUT  P  $⯲@ $ Bp0 dЍ $⡲ $ Bpㆎ 8┲ 8 Bp( 8л 8ℲV  H~T@DLPP`p p `TEP 8 ~Bp@<P<`("(%!% +& "0F#`GV!  }#P Q !N=0P0TH> 0@SxMpMNGxX8 [AH P P% (=PP%xN`V08|h8 pA0PZS  nP 9F M 0`||LQ,q4%SLMӀD~LDLD{LLۀ(D|LLMMM!D}M2M@MMM`MgDM%Zaraydict0O-`O-222 22223220PaM$0 00/Vpa?  Q2nPE 0000U1dR0 U% PPL0lOp LKpP  PPL0_Oppd2SPbAPX0: S0d2232d2oPPS}0 =QPp0S H dzPGRP 3P@/PA1@P>___S@'P6`_____________`ab__``(_d0__`@_____d<`_`x`dH__dXP b@_______`4A@PP00I0000`P,@p \q:wX10M  Wtp* >W D,>I!140(S(pp>r037  7037Rh7 P 0@ Q S2S S 2S 2Sp 0s ` <>pD d2SM ?p W \1X! X1\!0\eN2T72P7\\'hX$^^.1 SR !R QRQQS 18<4M0  M0\H2R0H2 1!804P)`CQښ. .a0C 2 0φ'h,q4n%SAdenagXn%Z'ny'x$m{r'p4 Ennn'@dz'8noo<oeO-`@ṕ̑Q Op%W㬑 0S 0S  p10`VA 㷯P `岯0S H嬯@`V-Z ЍyPmPPP fP Zn0@ Syy@yxpy@y@y@y@y@y@yy 0 0000000000pmhW 0iP &7[P3[P 9Xq,q4'q%SqO-4$M` A:P! m9P80pD刔刴00PPPl$ Op3W00S 0S 0S 4rPp(4 a X' 0S00P 0S  PY30S ЍzPOPBP4 FPo >P@*P~{{{{~,{{~l{{{{{{{{||}}{}{{{{{{}}{~~{{{{{{~<~D~\00 ჰP2 }P20{00b 0 pEo0` 0fP00e @_P00^ 0 c ~PV Q000M00J00G0 m~1 P :K000001000-00*000&000"p 00000000P0S_P冔W00S 0aP%E`I%嚔~Z 7~Z'4L'0,q4'%SӴ '8Q6Ovsy$ qO-@MP8@k_\(庯PUPE10ų9vPlP,HP8 TP3@ ` 8p@-_  !s@tq!S0 S O < <0@Zx 㕄m@ PXh`p` 4"Mp(2 R Q!  R 1,0Q TP,00S  0( @P@Ck00-SE 80@0$0 b@P?Ѝ$0px1 4%?$040P ?000R0Sp d```8pX0Sȱ0S ~ 00 0@@`p @$@ @P Xn 03/p TsZ,q4%SLH$$@-,@,@@'$@O-@P8pM -,@0G8 0+f`^ _p Zp6 R0 l,8 /%4PP0\80\6pHPPPF U18vX(G` `F0G0`0IPHPU0  Lpp 5pO005S 0(0,00(00 0HP1PP%iKPzW`WNWU 3AWF CWPHe p  aW,e CWe LWf aG Qk(08@WW$ lt  ֢$ DR -@ K L J ~ dO {05xN 4Vt V ```CpM nH l$0%0 1 0 c 姢$0@S* ܂I V0 0`P?p 00J8p kW {m0G S=4b/b-[mPH0SI0SO005S* LPO0S U5S5 ( pH (0S  0C#P @P!@^p``p! P! P|! 0S1`!}3/ 0Ⱟt@ P`t1PP @@k1P414!45 HR #ئ0 p"4 P 0 400 0S0 pN$' $υ$Ϩ'p$h$%S$$@,q4$$Ƒ3$8*T ^i_oi iuБm@-P @'p@-D@DP@( p@'$ @,p@-D@DP@( p@'$Lj#!HA-|@|p `(P,0`8P@@@4,A'$*#*G-`M4P."tzP("h5P0 p) P4T4@P DW5@2@P0"0 0200@Ҝ 5 H8p HQ !=5P ! @  p1a 00 @ p0 @ t080<0@0D00P0 0 080$@P  83 HL@P@T@X@\@HPū H333 0400,0@@,0( 00PBpPPUPh0PP 0/`ЍޘdްOށދpSC$ɜAAp@@'DO-p0`M(006外Fp0  Ip6V K pV0Sv`v```@@0V|P 0SЍuPfPFP RPg g@P    \      0`0P0 `0#S 5P00 $!$00S 4 $!$00S 1hpP =0#S (P $!$0(0Sy  $!$0(0Sl00i0P P?q ?q ? K?` @f0KSwQ 053`33 C@QK 0cR pR= bRCJJK[[`0 0V9V 0V`, 808 0,3/8 R``W @g@2Zg 2P_0 0C?oR20S^ nX[J G00 0$,0$00S XV 0L $20S 0`0 00010ST1 0S 0XP0 0  Q00s  1000,0 028`3P8Z @0 $  G3/2`0d SR @0 #  83 02  @0 R T >2Pp(00s  12pp0 @0 3Z GxE,q4%S'LgeQd/u%aO-P@`p'M M $PP Gp*6춟p0@DT00SfT T!qr@P XkP㈦eu1p`Re0S*  XAP? a@PP񟗦T (<5pP50S $PX ~눥PX%000P00 0C 0Tp MP  HP CP*P%  P p 3P lP( <~}p qqPpq/7~00 000#0 00$00 0P @(vPPd~ (GP(Y@X 2 P!P(!|P( (Xy@P `HϨ0P 0(`p` qqP 00 00$0 00[@P3y@P y@P+y@P x@P h៨P T嚨P HᕨP!Pf@ ፨P Z P( (p` P( +⟡ /⦽Pm``ሦ 0V@ Ǐr0 0"0p` P!P1P,00S4ؠ00 000$00 0 ( y1p00N0Pa0SJ+S'- 29S!S@ 1Z)Y x\Ix`P'ݍ ЍhN%S'XXmn,q4) Enfg y}['h@dz'AdeTp@-P@cFp@-P@cp@-P@c@-p@-P@cp@-P@cp@p@-P@cp@0O-nMM000`4PW0P 0~0 P 嫧PG  >R~p> 0 Ep@7x>?a0SH>D$RT$r R  $t ~t00<4A @0<4x00<$ 0/p N <4 L!H <@:`PEB@D4T񟗷00004p0@0000000X0l000$0000000LL000,0D0|00<@P} Ps \< $t  @< m 0<$$r $e {; `;$50 00 h0 | j(;'0 01 00 H \: 0 08 :  N:$ 0 01 0  @:(0 01 0  2H:,0 08 P0 x $:0,:@90S /1P<: 000 $ & 01 0 :0 01 0  |:0 01 P0  940 0c0 0 X : 0 01 0 $ 888合@0S C.0 |nP-{mnr P0@4k P@e 8({(8@PD40 tPD40D4M T G y0P 0B ,000!0 0!t8C1l7@2P00)7 000  y7F:P?P/:P pz0S` 0T40000PEU UZ  z0PQ 4S<4Z H$L40 .po?H4LP4SL$H4R0l h&0-pP TC .p @= 4S@00\S 4E~G/>GLtHW00 4/1p5WHLt  npP ?Fzk uPP;d%KtPPT%T4zW.p X1: S(%,4 $R ,@P%,rP$  P0IXZs4S04z?0$80p!x$,p = l$0ϤP$0 r0 4ӤP ΤP$,03}p,p40S0X44S@0S4 x2S "20# 嫤Pr 0T40S 堤P 3T#0S <>T4S\古P P3 2"pFx2ŸS L4H$Q*ypp0 H$L4#"1 dpH2 C  xy0- ⳖpĮp  <0P 0P+ 㺦H$Lt?'"y4 S 08?0W0 9p04$$ST RQ 0 W0  +p pWR00R104Qf ;R040 Q$ Qq*4m'x?>%S,q4Q6%ZC$c/Y5#%aZ$ʘH2 6'DTK'+=bun' Hz; ^;U3Nb|$ʈXuD?vLH4 Q} QQ040S[R0[ 4S$nP 44崐S04144 0S @4S 0 0@4,4S $4R#1ѣ1,40 0 0Uu =+t 9+0S Wp@) P+ 0d!t7>0]S◕P=.X R04ʃ1$4Q :$4#+ T4S 9 v,d0<"t[7z+***`+\4$H1L4L1x0<$0@ 0+ptP Z > PP  4p   T4 w :.0< H'O-0pIM M∹i4, @pP_`9`4pGs04WZ h$  Ya' 4S<44S$$ 4R0(c*p  h+p  4 SP,0S x 4q$ tZ0 0o 4e Q $<1Sf $4 $Q_*`qwZUCUʰDPEU8TTTTTTTTTTTT(TTTvbPEUU\TTTTTTTT TTTTPTT6 (&p00( R0C0s0SJ p w044s04?0 00 d0 p610 08 ,V< L0A" 40 00 0  0 0: ;  0 0: ; 0 01 0 ~0 0c0 h0 r050 01 80 e,00!0 0!Y40(40Sv00; T$p0P0<$vh*p 4S 4)PP#\$n`P#D  8(@LP,4(0(00`V Z 00 p"#8$p = 02P0 r0 46P 1P#0>v3}p$p4S80S4\ 1S !10"< 0S,P 3"b~11  $4 1 "MapT2   v% Fpܑ ?5P le $$t 4r(4S 0<q5?0W0 \6 $tR $4%S 4$Y0; 4 440 W0  Q(pupWY0:S $R4 ĔS  ~ .g(0S Z _([3  0h՟Y0⫱ΟY+',q4%S'0$T/Y5#+bun' nS; 3Nb|G-GMM@ph ⩢ A>p40@D@DTQ @@5P  0@  X  l   $   x             8X h    8X L3@ 04030033 3(t|3  p0,@0p0H300083080(030#  3x @| 2p Dt 2h Hl2"` d20L0`x2"T XX|2`"L P8`2@"D HH2 < p0V 0 22 W62 * p0X01! $ 1 `p0x0p0X1 h(p`P%  b`vqP0 S  ~ 0`YP  9t0S0Sh`lP0 A/ᛏP"0 0 @xF3xN@Pt GލЍ %S,q43 j >4 nO-` -PMp L`KP'tDPhs 'P&p4''p$ `ZP $<pP$ 0{@{05S = 3# &P, C@4P`ŜdTƸHǘ<LŨŸȐ4p|ƈ`<ȸ 09 0 PP P  Q R ]s 0;8;08; 00H2HpPt" P R  s{ r;R5s PP R / < _ 0< 0: 0 s@0 010@;M 0@0 00 008;0T PP P R / 0P. 00~ 00{ 09x䰟 P%P ` PR |ꬰ PYP R @R dmK ?A@bMR`(uG{?z%S >Zs((Č,q4(*( 0$; 000H L] 0P 0 000l ptP  P R  $S0{{Z%PZ<;Sڨ%PS0gPv$ <v@G8 ({*<0(+R[X= P10H2pGS1<+0X2 10S Xp<0H1 ,d;2S 0: 0 >00!u 028PZP ̌p ZPUpȌ 刀pp=0Pt , <rUp AeFl%Sr(Č(t%a(͸?^$C(t(Pq(($8$L((` 0@ @ |0 0PUfPh 0C Se0400000,00(00$00 0000000000 0000000 0~0p 4RC PPH61@PWC 0q8;p 00 HL0v%pJ8; 00 L0h%p<8; 00 L0Z%p .8; 00 L0L%p@  0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;P+2(bP L0%PW;"0#10@00 0`K`QH `    ` 0$Pt3K0S PP K0$P& 0  00 3$Pd G0 0Ss``0 $P`4$$ !2P(104d 0`[[[[,Q0Q4QPPPP嚛d<;SʔT$>@ tz{@ k::˟S$@ 3tVz{@ k9I:`"2RgdD' { @`30S 0 ' @MHIN2 X0弅#pU00 p@+@0W0 00D/PT2 ppW O P $2($PG`AQKY $P`pjc1{{7 (H{CAZAGΦ@8HINT{({*X"@T7 0S3 <'0xpT0T00p0p+t"P 0S #t;<000[ Y0 0 |F  h/d2"SS% 0 " @$?6C-A~8@@(((4%Z@(͸((5:%ZC(($8< `I1 @S! 2R`2p0Cs0WPP0dR?L!L0 0 d20   O  `0/0h0lp0h{{7{{{3{{ {  M@ X9: #Rpp: h2Y0@ph2pdb |RF<0 00H 02 0BSA (SI; C 0;.W@pCp 0h 0S h⏜Y #,2嶐! 0I0Css0S 0I s0r . 0 d1帑;    0; . 0@0 0! W |E<00 H 0@0p0V 0 0D0$1 J 0 xP<0[NW D0 00R ZW |E<00 H 0@0W  0 I0D t?.ppl0Zp4.D0 0.(($8(h(͸%Z@(tNj0CS0LpܰܰDh۰ Dh܌0 P Q9ٜ٨ٰٸ $,4<--0ߋp@0ntplhd`\XTPLH0 |PO (0 sPF Qڬ--0 TP' -0 HP| -0 >PX 0 5P Q Q }{0 #P {0 P 0 P 0 P 0 Px 0 PX 0 P 40 P - 0< 80Sg AS S W |mD<00 H 0@0p,H /I_v .Su!=ak{(L(SIZ0KWI7P,DDUD0J0ZD0  I)0K9+ 0KF  QJY0KWD03 +Y :vP WD0 ,D0J C 4 ḛ ♑W\{,pDD D0I0YD0 0J#1 K#+ g, W_,O-M`PG@0L-S@᫗P. @,4 t 5p+40SP a`F0pP[P*PijQNpGK PN C/ lwP@ \3pC d0@Shp|L@20S8K@HGG 0Z 0p- -Y 1\DlZ'd`Pl#P`0b 2 R .  /0 S . .U+ 0 .!@/0!00:/X-*'$! p4 ,p0SҘXg͘` p}0S sP0pp@@n. 0k Vp)ᦘ`G4)t\%ShgSG'ٺerrH<aO-PAM M@`c|P p]Ph70dW00-S% @)P ე)Pwk@ p0K0\Z +`F0S0`@DDA@Dv Q4p .6p0StbLpPx63 Q \ C`)P -00 q,`@Z-00  D0B5S񟗊l`0l 0P000 b 00S jP}j0 0wꨄ#4P j00i00fd400b d4 ^0S Lj V 44 R00O *P H   300S P60$010(0.0,0+t0C?o 2R0S0$0P㝓`㚓P㕓D5w045)#@DT 3a00@`FrS; RS iS/ (tS xS- !뜒+M/0p 0A00@00S 0 0@T}0S -] -< 80R0B(0/S } H(0S r0 @:M^0S (0S p\|1 0h0vPS 4LM (0S (C0 @^ *,n=- P+. 0 P?@TZ $)̀%S,q4)<$XYJ;%Zb$d<@<%Z@*<NlUl;O-PLM)@pPph/z2p\?,#@DRQ0I 4%@@0SRmivP cP SP- TP0(3 LP 5d0@S(4LXd0D003030800H00 30$30,3ASzBAkA* GBN }* `* (@ABBB#B4BAR0@G-`XMP^LP C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0X pq04y 0Q0TPP)dJZp3V [v`(os`F zP% 0SU030#:U 5%Pr P ps#2. X&T&P6K/r0g443TvPS0 0 S/# G@⾐ SPE3X: Pⴐ"E0<6SR46SR 0&2RRPp2 01&㛐.6S )$4P0W0`W 0 nQ 3~ 0K/r04,6S m/2`P  @0PQ!"V%Y<6S:46S: d1Q0@6D&S|1 0 00Rl!  H&`R\! $&RP! 8&RD! 0&@R4! 0!Q   @= ې @&Ր@|0P}GL*X%SG9,q4GZNDGyG* ,*t*hGٺG%aGG%YGGH G'SG4GHH-HQH[Hs*HHG.HHFHHCHHG!A-Pp`IHM +p10PEU* 3HP h0@ S SL 8HHIIl1`d1T1 P1 `q 4刍P p 1!!qTPP b L<$@@p3@(@ @8# mP P(0S PxV eP Xnb0 0000 I;%S,q4$Hna*g+y tyIE tCINIY0G-`HMp05I,S,C, @+p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 3a0@S    0 @ P        x         X 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTPaV ДY 000 0:HЍP !PPp  a0S  ="0 `PFMPV qh V =`FR]*$,q4%S$P%Z@0RkG*(gC-Mp`@<UPPF! VF ^*pSPU 6 `V V 60S aP& tP8t6 R dBl&   >*p@6U@0V`F V"@T P  PCPV 0S A@D BP`V +! '!tP9@PA@3P񟗹                             , @T ht    zP0S<0S{00\0Su00Sp00Sk00Sf00Sa 000@00=00:00SQ@0000.00+0 034 $0S=<0S800S3@3TcP0$0:(U 0S# 0S 0S`V Q PF _`0S 0S 0S`V UUp1P `,P \'PPEU8P U3 UUU  U4 @U U0`0 0 C UQa-[PK0000 0 CP  A A$0S jC `A ,ppqf*j|@fT \ 0 s#&  @ #4U$P @᧊P ᢊP`AYtDY*%S,q4NXY{%ZYTgTX9ZRYYYZZG-@PpMaM (p10S QġPE R ލЍRP fP74pGE0SP` n_WOJsP1 JgP/0: S2  S)J /EP0 JN@n` 0q4S00`z0S  p J EPJ D@PJ0@\J* %Sg\g\q\MC-PGMM h 0ME= <8=8X@8DX~Pp=0D80l8"=`{C0D `XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxx8~PP   P:?t! 0^_L  ~P< <~@P | P @0P XPi0Pl Shߋ 0 l P4:T{ | P :h(s\ P 9T(X(i8 e,P 9h(g40GDS4 ,\H@P|P` P \h 8(V-S h8X(T(N T8,J8 +8P 00S= 8 ]8, ,, ,0 7,, 7H(("$8p:7, | 7L(w+吁 P:?@#  0 D7P(74wpOP78x7 7<( 6T( X(L7 6P 00S 70  6t(6 x6P 00S 6 6@p ?68pւp0⤖80 P 0SL6t pW 8$Rp(ys+ 5,0 0l5L(5如` L5`(d( 85u$5P @ y5?Q4LsGލЍx5| p,0D\<<|0P 0S q lUPy@PxdD8SQ`@4 @P 彀 st|t sm|Ct se|t s^||t sW| r\Q|X$TrPK|L$HrDE| 8r4?| (r$DM~jvDfvcv`v]v 0S0SA  b@288S2 p@P R<S P 0S H2 uN @+? P: B?\ 081<Skf+%s P*v{0:|wP 0P "b@P~@|u pusTs@@PHu@ u0@`,rTwPP0@P`6p@+0(@0@000,`40U0 (P<P8,8U0C?o20SP ,R  \0,0S k,8S= 唈,8S r*B@{@{{{${id{{{zL|9%Y%Z@}%S}>BT{|0|>,q4$@|j*K)K ,%Z||m{||,q0|||D}j}thhhhh}b5}z}h}h ( }\}T*Ot  }G-P`8B$E {h6,P03xp2S l P4[UfzPH t各9PB/PE0@ *  $pX40pEWQU <4 000` P L,PE0S#3 4# 3P ᛍP ZvP303 G`pd \%XzPP304D#4S 4S坐P  Z덄 P 4SqR勐Pl l e PnRy,1`<01 1> 11/΅01<2F01$1剏(㝃#2Rkp`d Pa Q1s0S S`qЁБ?p00o V B/o" R pP  \ᮏ=`S 0 0000 lM1s0S*v`#RS S=?o20 S S l31s0S 0 S ` S S SR$x+8.%S%a+H fx%Z@ $lQ$x$+D+p >g%arH+@-@`4PƄP 1 q "px10SAQ\1PI ̗D1C@婄P 0处P 1 nPbP9P0P 00@0c0@ S ,,,,,,,,,,,+VP    h0  X0  H0 T TTF ?Η0S+ %S$ n/D%ZA-`0S,1,巃P#P 㼘I Papq 000000S( M뛯PP`0S PPt00S28+ +F$Sh65+ l+F+E%p ,>+F+LHb+F+FO-pPB`ᘂ^?Cp h!pp2 0 QQ 8PPPEx@yuP`P GP( IP) EP 30 aa0@S211122313113413\1112`113h0000`P<  (P (y y ?Pl( (PT!d`PH ((',%KVH ,(,0!RP6 GS  g|㪰  P   P׀0S 㖰 hI΀0S ㍰L!0/X!@p7 0SS RQ"$r0p00S uP@0` | mTP Pp`,4v%Sg%Z@@thwPwwfw{,q4vvGvww)w3wK߇wAww0O-PM`P 00@}P }P>6ߍ*. U`?@P1X?/01012211B "L122Rp|KpuDpNm&KpἮX10 .0>p1F0[\18\1`0  F1|!1hQda0  j@PwX1j >0[ >+00. n\18\1=0YSpVPMP 6PR ?PI 4Pp㤍N@P񟗯KI4K<I4I4I4KTK`KlfP j@PP񟗞KKI4I4JXI4I4K I4I4I4I4I4I4K0=0P1`<,`F@pԌ}X1F3X1Kw0000q0X1lH j@fppcph`0 P 2P X1P Q0#P\ J0[ _0  @P 0 P   184'0 00\1 ⽳pxx  1S 2P D=    ⨴:0P X1@ @ Lp  p `( X \10 QP819:X!p*\1 d pDT C=P)(< $\11Z EzPPY* 9Y) 9+ 0)VX1 ⭨P~ P S Cz 0 09夿z⳿pHx  W H60S L  PQ ~0S(  \!X10X1808"/0  +\!2sP8"/0 2\!s"/ p= \1`  P%D|\!X1 0X1 00 8Ӿp 137 y zPtwht 00 7sp3~0S ${\1pGW%~0STy~0S ~0 S \1X!8 0X!'zsp ~0S &|Qfp}0S &HD 5P q  :wBt*\1 I S0pT9 `p5 P <7X1A>X10L1 00 6Lpwl s0L1 00 5Lp(Op `p P X10X1Q|)~2dX1 @0X15pP  <\1 X40  DZp` \!X1 $  $$ 436 gp   K5p 00 4咼p@|!R\14\11  P+p0v!/P0!  R!00|!R00SRX1 '\1 0㌃匓 Q01X:   i\1  1PU3\1X!( ; W A? =  1R@T 0S 0 @K@ 0S  ᐵ 0S EPpP P ( RW  R   0010 S   0YPUgQR庿X1@0@kMH`Z\kVX1$ |||= e%Cx || f%Srzf,q4zLz^zv ex4@D9F|g& e4DUk(x!(6F[6x>G|||*/ 4T*///*/@-@]y@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_RC3 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC3 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC3 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC3 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC3 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_RC3 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC3 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.0_RC3xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv6hfeb/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hfeb/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressnot ACK or OFFERdeclined duplicate addressignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d So PQ",Y'*d\*hb-$e//i"44i<,p=o=JBpSEsEyE 7JVLVʅ\`^rDʋxT^zTsZʖ ʟ$G3Dʥʲ^ʿ<DXgdSpTht@G'G4H(`@k  D;@%%wK+++-p-p:1 #4(9\;/B !G pushdnepopdne(_ђЛ`h@@їpAP0ћx@@ѡ$ѧdA @ ѮPѴ@@/>@@Ѻ$unblock and -DNO_CONV?]^@^cc^@#h]]\100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink }       ^  ^   E#Z7Lf|# _^F<>?PATH= tBf¾5d<5s cI5mB5lPWr p_ng5v ob    EOF reading here (<<) document\`dinrvzAPAFKPV۷Ltt 8}-+?=S@S    @3abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'';L0"D':1"L':1"R':8"\';80"j';$0"';0"':0"d':0""J F P{S s\KND G$  _Hi*##6 :!(J03                    $:ń߳8o!;xA$?a$E /c c$|$JJ;$M)t$$S$W$]]__$e(]@$m4$p4KtW$(4$x-i"D.v$$ d>/TT*$}$z$n$X4$3x'' K'';^(''. '] ޿\ ' **|H'~:X<(s>x(z<<()<jE>(;>(?8"?d,>(<(D(/>X >))) ) )#)3)#)3)!2) 3)'3)&#*)G)N* *@@***)V((*y**)7**? *N@*U*G*\u*b(*i*p (C$(C(C$(CSQ())(())(*)))@(@) ( ))* *@**$ *,((((***** )?@999@8@9@9@9@9@9@9@9@9@9@8 @9@9@:@: @99::::&:.:49`:::A:G:N:X:`:g:n:t :@:@:::::::9::Ł:́:ҁ:ف:::9::;; ;8ȁ8́;77*7:7k7|77777888/8:C8Z;;<hi< <<<<"<);<0<45;;~<:;<@i;";,;6;?;F;U;\;b;i;nc;vi;{;;5;;;~;;;;;;;;;;88:88888888888888888999 999&9/989A9L9U9`9e9l9q9x99999;;<hi< <<<<"<);<0<45;;~<:;<@i;";,;6;?;F;U;\;b;i;nc;vi;{;;5;;;~;;;;;;;;;;;;<hi< <<<<"<);<0<45;;~<:;<@i;";,;6;?;F;U;\;b;i;nc;vi;{;;5;;;~;;;;;;;;;;JFAGUa____``2`Y` ` ` a$ a@ abaraaaaab b/bCbXbnbb b!#$b&12b345b68b9c9c :c#;c=<c[=cs@cAcBcCcDd%Ed;FdPGdPHdPJdfLdMdNdOdPdQdRdSdTeUe Ve%We?\eIaedcendeeefegeheiepeqstufvwfxf)fEfVffffffgg#g?g_gwgggggh h)hAh^hnhhhhhhhii ;hii;iNi]ipi{iiiikiiijj+j;jVjxjxjxjjkjjjkk1kOkjkkkkkll*l`lllvSllklmm4mUmxmmmmm[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]T^ʐYS^i;";,;6;?;F;U;\;b;i;nc;vi;{;;5;;;~;;;;;;;;;;returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readxNP $@T$$~Z$(\x$,@@w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-5>gq&p($0C$4@j+=Q_ (4H\80XDXlڀӘi;";,;6;?;F;U;\;b;i;nc;vi;{;;5;;;~;;;;;;;;;;j$<@Ua____``2`Y` ` ` a$ a@ abaraaaaab b/bCbXbnbb b!#$b&12b345b68b9c9c :c#;c=<c[=cs@cAcBcCcDd%Ed;FdPGdPHdPJdfLdMdNdOdPdQdRdSdTeUe Ve%We?\eIaedcendeeefegeheiepeqstufvwfxf)fEfVffffffgg#g?g_gwgggggh h)hAh^hnhhhhhhhii ;hii;iNi]ipi{iiiikiiijj+j;jVjxjxjxjjkjjjkk1kOkjkkkkkll*l`lllvSllklmm4mUmxmmmmm$@@ $D@$L@$P@A$T\P$`($d@$pHFS0eCi{UFS0eC;!haHdInotNeedEFI *s(ҺK>;bqQn|n֏- q++Qn|n֏- q+:DQn|n֏- q+QZQn|n֏- q+kvQn|n֏- q+;=Gry=iG}M;t?WmCĄ 3KOOyD¢<#*=(РD3h& \M}- ޔM@jy֬,-ıܹчH;=-ܹчH;RIZܹчH^lI􍂱ܹчHYI􍪱ܹчHŠI2ܹчHi¥LǠ6 %?a±¶'S@ۿ )Ѹʪ1*@ە )Ѹ;ڑ1ۏx )ѸO $|@ @$backupstore_gptstore_tblT$@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsȚȨȷsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatuszprintallmaindo_setifpreferencedo_setifcaps~iz$Hiy$$$$I$4$$$$[$A$XT$ŀ$Űс$$dъ$є$ћ$ѓ$њ$ѹ  @#/7 @0I@R[`Ve pv |@zinit_current_mediasetmediamodesetmediaoptsetmediasetmediainstJGUJ `U J`go@goU `media_statusmedia_constructor.7>$C7>$77$lA7A.$ƈ@7+$Ƥ7$paddr_matchd l<H,settunnelqh$w$8print_link_addressessetvlansetvlanife$֜j$Ǵ֛֜"rsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchan>ADGsethidessidsetapbridgesetiffragsetifrtsm$Xl0 $t$@st0t$$? *$5-$py$$t~/$N$N@8 *$$d$Ȑܕ?Lۗۗ=><&Аinvalid major numberinvalid minor numbertoo many fields for formatffs@ 'zTT@TTT? . 6IVl} @@$T^ʐYʫ=BSK^PTTX ET F߳T . 7dW@ bnorripbgensbextattbnojolietbnocasetransbrrcaseins ET F߳T . 7S@SdW0@T@ ET F߳T . 7 S@SdWT@0!z@' ET F߳T . 7@ ET F߳T . 7S@SdW@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror ET F߳T . 70dW@$Jty @r i@w`AGPZd o@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvdW ET F߳T . 7@'_*AW8Kl2g%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@B,C;FGI`LjNwO%Sabcefh ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for datarG$\ FEc:+EE+rF r+pFr+ȴFF'+8GF8+7FIFQ+6FsF~+FF+qF@+5Fr+SFr+RFr+ҺFF+tF+FG+G r+G^+ҜGF+sG(G9+HGEϐ+tGRϐ+pGcF)+ÔGlF:+ēGzG+ŒGG+“G@+ƑGr+ƯGr+ǮGF)+ӼGF:+ԻGr+պHH+ɼH!@+ֹH-r+H9r+collectJ7QJ3R@@Qi;";,;6;?;F;U;\;b;i;nc;vi;{;;5;;;~;;;;;;;;;;NAME=SYʐPTmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdsi;";,;6;?;F;U;\;b;i;nc;vi;{;;5;;;~;;;;;;;;;; edit_fs_type_ext c$  L4 L LH _ ` n n1L L`e Lu Ledit_and_check_label i;";,;6;?;F;U;\;b;i;nc;vi;{;;5;;;~;;;;;;;;;;disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijz 0 T ` 4 d L H ɤ P t H Ȱ x d disklabel_change_geom Uh Z a(outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default+x+X++pm_from_pepm_whole_diskgpt_freegpt_create_new ]h,XD(D  04`l ^ibqbqY ;; !s5g&p ie8sss^ʐYssʫc=sBSK;sz~PTTX;s;sgpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - HFS0eCi{UFS0eC;!haHdInotNeedEFI *s(ҺK>;bqQn|n֏- q++Qn|n֏- q+:DQn|n֏- q+QZQn|n֏- q+kvQn|n֏- q+;=Gry=iG}M;t?WmCĄ 3KOOyD¢<#*=(РD3h& \M}- ޔM@jy֬,-ıܹчH;=-ܹчH;RIZܹчH^lI􍂱ܹчHYI􍪱ܹчHŠI2ܹчHi¥LǠ6 %?a±¶'S@ۿ )Ѹʪ1*@ە )Ѹ;ڑ1ۏx )Ѹh uuuifu;Avfk'vvv/ vBvPmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new Uh b b@Մ,tx\̈́$P ɼʠ <ߠ ɴހD<mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************r !control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2 dedhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option{b cVdefghijFklmn(op‚qorsPtuVvwxzG'yABCDE$F)G3HIIJ=KDLlMMNSO\PiQ=`S>/TqU{VWXZx146}j|~}  !&,28FTGPfX`jw* $0default_configread_configrt_compare_proto$$rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt\\rt_buildrt_deleteddsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initG5ZSscript_buftoenv/FF=make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @DCHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcpdhcp_bounda dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaq@q@qTqTq0q0UVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\BP8V\Ab<\|hnBBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~}%a  P8V\Abh @n!F!D!Bcs_path\X bc_base_maxr bc_dim_maxr bc_scale_maxr bc_string_maxr coll_weights_maxr expr_nest_max r line_maxr  re_dup_maxr  posix2_version r  posix2_c_bindr  posix2_c_devr  posix2_char_termr posix2_fort_devr posix2_fort_runr posix2_localedefr posix2_sw_devr posix2_uper stream_maxr tzname_maxr atexit_maxrP.8/@V/\0XA0b1p12h334,n4 !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%KC00`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_popunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %smemstream_seekrshrcmd0123456789abcdef %x:%x:%x:%x:%x:%x %256s 0123456789abcdef0123456789abcdef0123456789abcdefkMGTPEBKMGTPEKMGTPEBkMGTPE_getttyent: TLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~_fts_readkh?marshal_new_auth_authunix_create_xdr_arraygethostby*.getanswer: asked for "%s", got "%s")& @"NBCDB  d'B@;0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/54<Ҳ؉9I#ը32D=%[όh(doC_posix1e_acl_entry_compare_acl_differs_acl_brand_as5gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef0123456789ABCDEF_xdr_bytes_xdr_string0123456789  %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC 0123456789abcdef0123456789ABCDEFQ !#&(*-/14}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒ<Ҳ؉9I#ը32D=%[ό (doCCAy7FnM8O?ZwH02uOs<0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzVQuޝ3r(Ѿ唵V dj٧IY:Jp,.*ap+ѿ#K`j ggQR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqx6|0pY9 1hXdOj ggʧ;l٫Ak[~!yB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHO @Cisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB 0123456789ABCDEF0123456789abcdef/& ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::LX$YYe h8h@NhL'`hT<h\hdhh hp gPg\`ghgpgt g|g g 0 g g g g g g g g g g g g g g g h h  h h h$ h, h4} <D x X  ,} h8  f X X  s jt x Lf t   \ f  f < lgl 0f e f f f  f$f( <D xf, f0 f4f8 f<x ,f@,fD hfHhfL fPfT fXf\ f`fd XfhXfl Xfp X fx f f f ff ff ff f Lr  .f f  f f \f f f f f f f f f f ggg g g g(g0 g4 0g8 0g@0gH 0ehthhhhhhh h h h h hhhhhiii ii i(i,i8i@giHiPiTi`eee e xxyyyyyyyyy y$y(y$y0yy8y<z hx 9z Tz z ˜z tUD D DD D D Dhh!!,!!!#x4u<stngpnmbr@8(dict;@F@I99h9X99 XdkeyI@@l8LP(dataWUX,boolccc!' !' !'!'arayi(odmtgfl(h$0HTlx   0< T `l h8x|w(w`w@vvxvw(w@(,48w`@L\hxTX\`!,DHLP!,  $,08<DwLPX`hpxzH (08@HPX`hpx ,<HT`x$<Th|$8L`t(<Pdx!0LL,,40`,4P!3!3!4!48<d4\x888D(ltpt  (0 8< \` t|z\ (0@`L@PXTXlt  !48"LT#px$l%&')*+,- .,4/<D0LT1\d237c $,H8PXt|#p$l%&'P(),<@HL$<(4<LXht   ( hh4<LT\dlth ,8HP@@Lh$C!A!A!A!A!A!A!A }$ $$d$L\`dhlptx (4<HTX8pthhhhhhhhh| 4Ldx $8\l|,D<Tx8Ll(@`p$<`0@Tl0Tl0H\lx`pe(xe(`UL$u<HрҸ!A!A!AthhhhhhhhhH%a0!<$,hj,h%S0,h\,q,Xp-Ӏp%bD%[-%^%_0,]$\,h \x`,q$%Z,h`%Se(bjUL,gh,-dɸ%^-d%T|,!;,-t-Dfx-`,g,g-lÜ!,,]%a$%S4,g,ga,h%S,h ,q8,I,q0,,%^%SD,]H-0,g,d},hh%UXT,] %^%a,g,g,h%`%T`-<,h Ô-%a,]$!B,m,h!~ Sb^jj~cBffhrklmooppppqrdWu5-tvwwx_7xwKzzB CbJ O*P9S@T(VJVKXZZXZcjy   ((s,u r,wrsht<({4{$|r{,$rshF,  b/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin'.}-+?=###%%%}'4'4"a,4EV:eGFBIiLLFlYmaCTnkfrxpbuҪqshv5VVx'7 @=$$d hqBOJs0B_uBϯrBwBrBRrC rC.qhC9֧qCXJJ$K KK(K1FArEr K4rDK@KJGrdpr8KSK\ JKuK|K_$_4o ... ...LQ.`DrrrJ CaCCJěƀOԜԔԌ$ǻݸ$AabCdhlNsuvW:w:z$$ $($0$8 $T$М$pAPDAP,tQ,kQ$@AP,_Q $ $ Т$4$4 Э$\$D $„$Tߘ$¼=o($@Z$Ȼ$ $i$@$$À$Tж$;i'p$xн$ì;i'p$ä $$$$$$$$$@$˜$$Ĥ$Ā$À$ì$T$$$ $$$ITI%$TTE$A$;i'p$$ є$єѧ$I\A$TT$ T$ [$ [$ $d$8$$|A$A$@$+>$ >$$wH$0Է$\Է Ծ$Ծe$Ǭ"֜$֜" ֣$ jJ$h$$\ $P$)m$m$'$'Pd$ d$&$?$ * @8N$ * N0tt$ t܅$5-0$ɔCK!I (I -J3H;JHI @I fGxbIHFIp:"I KISI YI ^IcI 4o  '@@ ET F߳T . 7S@dW@...... ...... lost+foundAd.##.$xN=9=Dn==B=? H * B, _7 G=FDBJB=O=O/F1=UY[A=^ =g!=n"=u#$=~%=&='=(\)=*=`+=,=-=/=1=1=2=3=4֨5m6%Ii%ZR\RRRRRRRRRRR. (prog_root)`%J^*hϯ^1*hhhhhb5hh8 P U P w`h P `h P 7% P 6 P F4^* P 6Th P _ P b; P Lh P iS P ] P _|B P .*Q P cV P J P MF P Ph P _|"7 P F\h P gh P fxh P f P _i P ui P C P 7,@ P .B P H_7 P @m P Jd] P F P i P ^ P 6Ti P M P qi P pi! P Y P Pi& P ki- P Nhj P S0i5 P @\ P ZHbQ P S0ir P Pi: P v  P 6i? P o  P qiG P 9x_4 P @iL P 9xiR P pHb/ P PiX P di] P cDm P .i P qid P e@il P P= P Piq P Pp P J/ P H| P Hm P `iH P 7i" P Y,. P _iw P \ P i P ri} P @_5 P @i P vi P Oi P `i P ji P _i P [4i P pi P gXr P 7i P HTA P thi P ]0 P nXg\ P r޿ P EN P 7ti P g0 P k^1 P 6i P i P F P 4$ P ^@ P ui P  P Wp P H,gc P r P @$!Fyhc i&n | { ~<<R! @< T> Vdt Uxp) V|A G$R LlCt N+t Nc A. B B RP RPs P? i# R+%EuF)Pcia%l(/sh!+ !"$'(+-.03569:dH+Od_8+X,_c6)a*+m8/bin/shr'%6%?FNFYF`FlFsF~FFFFFFFF"F)F5F<FHFPF\>chmu~'%+F%8d <Xx'>h"um$$b$\$ $z  * . ` d f o404?sz _###)#*######%%&&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&''' ' '('('L'L'N'N'S'U'W'W''''''+++P+P+U+U....////0000>0A00011/11111122 2G2PMN`|ף0RTfhk`oooop"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|  ( ( ) )oK_pp0J#%')-Y[  : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----0*0-00ooprt} %&,,&-GQ).1256CCLL||װ /vz       8 : ? ?   $ 'FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB4@4@4G4Ujjk0k6oOoOoooo-0Fgi{тхыѪѭBD6;luuڄڄڛڟڡگ!#$&*06DJ%4%4%4%H%H%H%p%4""%H%p%p%p e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [< is a directory is not a regular file (use -f to see it)%% ($&6BN"Z>VAer; 7   #28  (%!1:9LV`&ROfk)w5e:%6.4 +,-.*!*?:E޿A/M/['gFt   ROfv z   WmkRkRkYcWbkCkc kG ky wb YMYrWca%(+G Xyb% @+F B%+F#c%+GNyyd%+F%A+FD%( e%+F)=f%+F]uF%+Fg%+F()h%+F[ti%+F j% J%!+F0k%H %H K%+FHmL%+Fm%+Gn%"+Fo% 0O% (;p%xH `P%p Yq%`+GFnr%X"+Fs%P!+FE]S%H!+Fzt%@ T%8 u%0+GV%( w% "+F*[x%( X%A+Fy%+Fz%+F%:"% Y~%!+Fb?% d#% 4%A+F%+F %+F-O%+Fk%( %+F %+F| .A]%+Fx %+Ft%$+Fp %$+Fl 43I%+Fhi%x!+Fd%p!+F` |%h!+F\%`( 0H%X!+FPWk%P+FL%H+FH%@ 0 %8+F@B%(+Gcw%0+F<%  %!+F %+F8"Q%+F4z%+F0,%+F,=t$3EWcmw$?S (#1C֨L\p‚%hˆ˜¡®º"00C|9O\i+H< (press RETURN) M N? N%h%h%ttags643{}abcdDgGhHilnNpPqrs tw xy !:#=+f+f-e^H-i^C-k^UK%,,%+ \H %+\ n% %+r%* Lr%* p`r %* M$(%* M,}%*l M %) %)| QrF %( Y g8rF%(L Yt i %( %'%'rF%'| Q jrF%' Y jrF%& Y@ krF%&\ Y k %& # %% %%rF %% L P drF %$|N P e$ %$L; %$ %# rr2$%#\5 Wr2$%#<5r2$%"5r %"r %"Lr %",r %!r %!l[%!,Zc% urF% j lrF% Lf hrF% j P lp p p qu l Q Qp QD U ]u n q@ qd Qu `e nd `g nh `\ nX^ nd] nt_ nQ Pl 7 P Pt P^ Ps P5 OG PT P_ P0^ PDi PX! O+ O O| O  O O ` n, n8 nHW WDQ qR VS `4TX Ve V\ W WO XP X@Q WR WS XTU V0V `x OP O\y Ol< m= n> n ? nS N O O4 R< R Q ^ ] o p NS m S R R R _H ^ Rt X NT N: N`I Ntk NS N$ N8 NL| mѢ m m m! m S S Sd S@ m T S S o o p< mx T0 o ol oj m\k ml TP o( oL mPʐ M^ N  m$ m4 mD M m m T Tp p p pt n l U Ut UT U0 U T _ ^x T X n l Z< Z  Z ZX [, [ Z Z Z Z Z Zx M M M Mu M [ [ [l [D l l M M& \0' \( \) [ \d \ X \ \% \L ] \ \ \| \z KS KT LT L,T LTT L|T LT LWx҈җGқ#Q ҠңҧұҹԀԝ֊פٽ;ڈK[BmSۂۅۈܻݠ,s %4Qk<!vHiWG3o} 2C FeOw&r ;YmYw>j%2^j|1&R)uKp .VI in -AO^m{ '3?Md{| g    A  U  S  $.7F^} #55O[hz!=XZ+=Vkp":DQZi~Z *6}Dn8ElINXdm;Z0;W"2l{uOTS|pi 3 7 A Y !%!!!!!!"""'"4"<"O"p""#p]######$XE$"$3$>y$_$gvS$k$|$$%P%z( ('(C(WW(((((()A))R*7*A*Mtq*hv *q******+++;+Q+\+}++FlFl,&,G,k,,--`-g----.L./t/0m000w/111G1p11223303R3b3x3334444445 5525?5G5Q5V5`5i5z55555^77%71777>7I7P7W7`7j7{7777777788 8'818B8L8a8r888888889999%929A9U9a9k9p9u99999999p8B9:::*:2:F:^:o:w:98:::::::";;+;:;K;Y;d;q;};;;;==>>,>4>Y?@B@@@@@A AA$A:AuBB+BBCDCV ` R'R+R0R4R:R=RA*@REXXXX K1/ | u ^V$ ^ ^T_+__ mx___0_$_*_0 _5_;10_C&'_J(_S)_Z*V+__,_g.1/ftpbH@Tpf^S^^YO@ O^^^^Xa p6> # ? p7@ Q Aeb Beg Cel D v E et F ; G  H  I `rY Pr 4r  1u 41e u 4jjjjjjjjjkkk k/]\9]\;<#rd rrrrrrrrrC $(,0\n4:=    @ C P S ɷ ] mhkcptx|a;aj !"#$%&'( )*&+0,6-=-J.Q.// 031[2_3e4j5Ҭ6o7u8{9:;<=>?@[\\] ^^)_4_=`J{U{h|v}}~ -dd-ddTdd:dd:dd s| s@s@s`sssjjjj#j#j#j#j#j$j$j$j$j$j%j%k%nh%k%k&k &k,&k4'k@'kL'kT(k`(kl(kt)k)k)k*k*k*k+k+k+k,k,k,k,k-l-l-l-l .l,.l8.l@/lL/lX/l`6ll;l|;l0l0l0l1l1l<l<l=l=l>l>m?m 2m2m 2m(3m43m@3mH9mT7m`8mp:m4m4m4m5m5m m !m "m #m $m %n &n 'n (n( )n4 *n@ .nL +nX ,nd -nl /nx 0n 1n 2n 3n 4n 5n 6n 7n 8n 9n :o ;o <o =o( >o4 ?o@@ oL@!oX@"od@#op@$o|@%o@&o@'o@)o@*o@+o`&o`'o@,o@-p@.p@/p @0p,`(p<@1pH@2pX@3ph`)px@4p@5p@6p@7p@8p@9p@:p`*p@;q@<q@=q$@>q4@?qD` qT`!qd`+qt`,q`"q`#q`-q`$q`.q`/q`%qCrCrDrDr$Er,Er8Fr@FrLcrTcr`drddrpejert#r|#r&r&r0rrrrrrrrrrrss sss$s,s4s@sLsXshstsxjjsssssssii i i@i@iiiiii i i i@j@j@j@j,@j4@j@`jH`jTjXj`jhjpjx j@j( x33333333hh8Hd|3333xpUTC33$P$PopiDj8oio,ip33-x339gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA%T%U%T%Ut 33UU33UU33UU%Y|%U%Z@|%W %Z|%X%Z%Y,0wrssx   @ 333333333333333333333333333333333333 33 33%^ !9L!9L 0000000000000000 -3333i43333H33%_%_%_ (root)`33 $P$C!A!A!A!A!A!A!A }$ $$d$L$\!B!D!F!H%aDFEFEEdEEF@@@@A0F`A`ApGdBCC8FDDFACService unavailableA0aeabi&6KZ  "D6(d7x-oARZ>J4T`0_! CH$ D4Ap%|I'9wggw9;&-RvۉiYfz*jRj~y|,xmQZ&Ok1]v>7^;>ekp+X̳,dzsw'{nwǞ=D=0j5g-I>;l<|̫5=76كY^kujrz^_{\zK5ǬқJ?|ϳvU+p.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BcHddP$\ b\V$\ b\$b$ bg$ btt$ (y$( ( %bH!2H%bH!2H0-x!2Hp!2H1!2|!5,MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5770 5804 6487 6775 7483 7539 7613 7709 7884 7907 7930 7936 7945 7967 7971 7975 7978 7981 8086 8289 8528 8969 9407 9442 9457 9469 9475 9487 9536 9556 9596 9613 9630 9645 9692 9730 9778 9860 9984 10120 10161 10199 10236 10271 10281 10330 10480 10486 10491 10495 10515 10625 10645 10651 10665 10677 10688 10725 10759 10783 10885 10922 10944 11043 11098 11156 11167 11183 11235 11403 11610 11781 11845 11897 12169 12719 13248 13680 14018 14351 14464 14479 14488 14648 14819 14969 15133 15156 15180 15195 15270 15410 15587 15742 15754 15834 15935 15981 16007 16077 16088 16097 16110 16136 16151 16167 16180 16235 16246 16261 16465 16698 16727 16742 16811 16885 16958 16988 17026 17080 17499 17525 17554 17658 17764 17949 18061 18176 18280 18967 19226 19366 19402 19572 19613 19749 19772 19809 19854 20105 20201 20255 20354 20365 20402 20439 20466 20475 20509 20516 20541 20568 20603 20617 20631 20660 20674 20691 20700 20722 20740 20757 20768 20787 20813 20831 20854 20871 20886 20901 20919 20946 20973 20995 21034 21052 21084 21312 21386 21429 21475 21622 21778 21822 22101 22128 22487 22671 22823 23004 23151 23309 23330 23378 23388 23396 23407 23418 23428 23435 23450 23462 23500 23530 23569 23622 23680 23701 23708 23727 23748 23755 23778 23800 23820 23842 23873 23910 23932 23946 23992 24021 24055 24095 24130 24158 24206 24215 24224 24229 24238 24247 24264 24268 24273 24279 24283 24321 24330 24357 24377 24400 24419 24446 24468 24500 24516 24521 24531 24554 24576 24593 24610 24623 24632 24641 24647 24674 24681 24705 24726 24750 24763 24782 24807 24830 24846 24852 24864 24894 24902 24942 24953 24964 24975 24992 25009 25023 25040 25256 25560 26008 26224 26488 26760 26812 26848 26884 26935 26952 26990 27004 27011 27028 27031 27036 27045 27057 27068 27077 27098 27140 27178 27194 27225 27250 27285 27341 27381 27402 27422 27463 27492 27540 27773 27808 28015 28034 28071 28132 28170 28209 28365 28380 28426 28474 28497 28533 28543 28553 28564 28569 28632 28680 28724 28785 28818 28919 28937 29076 29098 29221 29235 29245 29268 29373 29429 29545 29576 29581 29607 29646 29656 29699 29709 29725 29740 29758 29781 29811 29832 29858 30055 30098 30102 30108 30114 30119 30130 30144 30173 30205 30217 30264 30314 30354 30381 30397 30406 30449 30455 30463 30467 30487 30504 30516 30547 30803 30852 31428 31455 31487 31515 31567 31573 31579 31584 31605 31621 31643 31672 31813 31947 31960 32096 32098 32100 32102 32119 32132 32150 32177 32181 32187 32192 32200 32206 32246 32248 32258 32273 32290 32324 32356 32394 32423 32452 32474 32517 32543 32587 32723 32725 32805 32851 32899 33004 33106 33145 33212 33219 33280 33344 33348 33355 33477 33546 33834 33972 34113 34194 34241 34247 34270 34316 34319 34345 34388 34453 34515 34585 34653 34746 34965 34990 34994 35030 35048 35076 35118 35162 35226 35276 35352 35374 35426 35470 35509 35543 35573 35604 35629 35638 35650 35658 35669 35681 35700 35724 35773 35790 35814 35857 36179 36182 36196 36209 36221 36228 36239 36246 36253 36262 36272 36289 36305 36355 36363 36371 36381 36392 36410 36427 36448 36470 36479 36489 36516 36522 36532 36551 36567 36585 36605 36614 36625 36632 36649 36668 36689 36699 36716 36722 36738 36753 36768 36789 36811 36830 36840 36845 36850 36868 36887 36906 36912 36931 36951 36971 36989 36994 37000 37017 37033 37054 37067 37075 37095 37119 37136 37144 37155 37176 37182 37194 37216 37230 37239 37260 37278 37287 37321 37344 37371 37403 37426 37446 37457 37489 37505 37516 37529 37552 37574 38082 38112 38143 38171 38185 38386 38608 38775 38862 38879 38897 38914 38943 38990 39001 39020 39042 39121 39313 39341 39459 39481 39622 39641 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_RC3. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_RC3 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_RC3 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_RC3 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_RC3 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_RC3 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_RC3 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5767 5794 6360 6660 7301 7348 7461 7554 7588 7607 7625 7633 7642 7667 7671 7675 7678 7681 7803 7988 8216 8736 9087 9116 9129 9142 9147 9167 9186 9207 9266 9283 9297 9319 9364 9390 9431 9509 9627 9741 9795 9824 9856 9895 9901 9934 10057 10064 10068 10076 10100 10182 10188 10195 10207 10221 10230 10263 10282 10294 10404 10466 10485 10604 10655 10707 10719 10738 10790 10994 11202 11393 11453 11502 11769 12228 12894 13317 13639 14064 14196 14228 14240 14418 14615 14776 14910 14930 14963 14977 15046 15159 15331 15466 15486 15598 15690 15713 15736 15795 15810 15831 15846 15867 15887 15912 15926 15950 15962 15980 16190 16440 16461 16477 16530 16598 16671 16708 16734 16810 17267 17293 17315 17422 17529 17730 17803 17887 17987 18482 18720 18871 18905 19040 19084 19223 19264 19309 19356 19600 19733 19795 19889 19894 19928 19962 19977 20005 20038 20045 20070 20088 20114 20121 20136 20151 20171 20211 20228 20248 20269 20291 20306 20326 20348 20363 20376 20390 20402 20414 20428 20451 20474 20492 20535 20586 20623 20808 20871 20907 20956 21047 21177 21230 21490 21537 21898 22048 22217 22357 22477 22609 22649 22696 22706 22714 22724 22732 22743 22754 22768 22793 22835 22868 22901 22936 22990 23015 23034 23056 23061 23067 23097 23114 23141 23159 23180 23202 23221 23231 23261 23287 23314 23363 23391 23418 23471 23481 23491 23497 23507 23516 23536 23540 23545 23551 23555 23590 23599 23630 23647 23674 23695 23715 23734 23760 23773 23781 23797 23828 23859 23880 23906 23919 23927 23938 23944 23968 23978 23990 24008 24019 24039 24055 24081 24103 24119 24131 24151 24177 24183 24213 24227 24241 24264 24283 24302 24320 24338 24561 24867 25285 25486 25726 25910 25988 26043 26110 26150 26173 26207 26218 26226 26249 26252 26255 26261 26272 26284 26297 26327 26371 26384 26397 26434 26448 26459 26470 26481 26498 26509 26556 26579 26628 26869 26902 27157 27178 27211 27264 27290 27317 27473 27479 27522 27542 27561 27590 27597 27604 27611 27616 27665 27703 27737 27794 27822 27867 27884 27985 27990 28067 28081 28091 28115 28238 28319 28429 28457 28462 28478 28507 28515 28556 28563 28577 28590 28598 28617 28650 28670 28690 28906 28937 28942 28949 28956 28960 28974 28986 29001 29034 29047 29102 29160 29196 29214 29232 29250 29287 29293 29301 29305 29326 29343 29354 29376 29554 29598 30300 30324 30358 30377 30422 30429 30436 30440 30464 30475 30480 30543 30664 30787 30800 30934 30936 30938 30940 30950 30959 30972 30999 31003 31009 31014 31023 31028 31055 31057 31070 31082 31097 31125 31169 31216 31232 31254 31265 31298 31318 31367 31467 31469 31534 31583 31632 31736 31834 31875 31966 31973 32034 32098 32103 32109 32218 32277 32528 32669 32796 32864 32901 32908 32935 32981 32984 33005 33050 33101 33160 33229 33276 33381 33524 33549 33553 33587 33604 33628 33680 33731 33803 33869 33967 33984 34015 34051 34085 34109 34133 34166 34186 34196 34204 34212 34222 34233 34247 34273 34321 34344 34364 34405 34704 34707 34721 34733 34740 34759 34773 34780 34787 34796 34806 34823 34839 34887 34895 34903 34913 34924 34942 34959 34978 34998 35005 35022 35039 35046 35059 35094 35111 35130 35150 35160 35176 35189 35207 35227 35248 35258 35278 35298 35311 35330 35343 35367 35390 35403 35414 35419 35426 35444 35463 35482 35490 35509 35529 35554 35572 35579 35586 35599 35608 35629 35642 35650 35670 35698 35715 35721 35732 35763 35771 35784 35806 35828 35837 35858 35876 35883 35906 35925 35952 35970 35990 36003 36018 36039 36053 36060 36074 36089 36108 36653 36686 36714 36743 36751 36788 37100 37277 37354 37371 37389 37404 37426 37476 37486 37503 37525 37584 37742 37766 37896 37921 38047 38065 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_RC3. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_RC3 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_RC3 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_RC3 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_RC3. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_RC3Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_RC3Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Groupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5655 5682 6258 6618 7303 7364 7442 7537 7577 7599 7617 7623 7632 7658 7662 7666 7669 7672 7794 7979 8207 8736 9154 9183 9196 9209 9216 9236 9255 9278 9321 9341 9360 9383 9427 9456 9497 9563 9675 9789 9843 9872 9904 9943 9949 9982 10060 10066 10070 10075 10116 10253 10263 10271 10290 10304 10313 10345 10386 10399 10524 10582 10601 10720 10776 10828 10839 10855 10894 11144 11316 11488 11543 11578 11828 12232 12531 12799 13160 13340 13659 13679 13692 13881 14025 14221 14355 14375 14408 14427 14528 14683 14871 15058 15078 15157 15255 15293 15316 15406 15427 15450 15469 15493 15523 15567 15600 15623 15635 15653 15921 16240 16271 16306 16370 16445 16515 16546 16576 16668 17159 17189 17206 17346 17487 17684 17803 17950 18117 18675 18971 19152 19197 19360 19414 19549 19585 19645 19695 19986 20095 20152 20249 20254 20289 20324 20339 20363 20396 20401 20426 20442 20465 20472 20489 20504 20523 20555 20559 20579 20597 20609 20622 20640 20664 20682 20701 20728 20755 20767 20788 20818 20848 20873 20906 20941 20979 21232 21301 21356 21417 21535 21694 21748 22009 22060 22436 22591 22735 22875 22983 23168 23198 23241 23251 23259 23269 23281 23302 23311 23317 23349 23390 23426 23464 23501 23549 23573 23585 23599 23607 23615 23643 23660 23689 23710 23733 23742 23761 23773 23817 23855 23882 23926 23954 23981 24034 24045 24056 24063 24073 24082 24116 24120 24125 24131 24135 24170 24180 24210 24233 24262 24284 24306 24328 24355 24367 24379 24398 24432 24465 24486 24510 24523 24535 24548 24554 24580 24590 24601 24625 24635 24655 24675 24692 24718 24742 24755 24775 24809 24816 24845 24868 24891 24907 24922 24937 24952 24966 25154 25459 25890 26081 26316 26504 26546 26596 26650 26698 26720 26761 26772 26780 26804 26808 26812 26821 26832 26843 26858 26889 26935 26948 26961 26991 27005 27017 27029 27041 27059 27082 27127 27150 27210 27462 27489 27751 27769 27796 27845 27875 27906 28038 28045 28094 28117 28141 28170 28178 28188 28196 28201 28254 28303 28343 28409 28442 28486 28509 28610 28615 28692 28706 28716 28740 28863 28944 29054 29082 29087 29103 29132 29140 29181 29189 29203 29216 29224 29243 29276 29296 29316 29532 29563 29583 29589 29596 29600 29615 29634 29660 29669 29681 29735 29793 29828 29847 29864 29876 29911 29917 29925 29929 29950 29967 29978 30003 30181 30235 30926 30945 30980 31010 31056 31062 31069 31073 31097 31113 31119 31194 31344 31463 31476 31544 31546 31548 31550 31560 31573 31590 31617 31621 31627 31632 31641 31646 31673 31675 31688 31700 31715 31743 31787 31834 31850 31872 31883 31916 31936 31985 32085 32087 32163 32218 32268 32367 32462 32510 32600 32607 32668 32732 32737 32743 32846 32898 33144 33305 33460 33531 33584 33591 33618 33668 33671 33692 33738 33793 33852 33921 33968 34073 34216 34241 34245 34279 34296 34334 34387 34427 34503 34568 34662 34683 34721 34761 34797 34821 34844 34883 34913 34920 34929 34937 34945 34959 34975 35003 35055 35072 35093 35137 35479 35483 35498 35509 35517 35536 35548 35555 35562 35571 35581 35598 35614 35668 35676 35684 35694 35705 35723 35740 35756 35774 35781 35799 35816 35823 35833 35864 35883 35902 35922 35932 35951 35964 35984 36004 36025 36035 36054 36073 36083 36100 36114 36137 36161 36174 36184 36189 36193 36211 36230 36249 36254 36273 36293 36318 36333 36337 36344 36354 36363 36384 36398 36406 36426 36452 36469 36477 36488 36519 36524 36537 36559 36574 36583 36604 36622 36631 36675 36699 36726 36741 36758 36772 36803 36827 36858 36865 36879 36894 36913 37458 37491 37519 37548 37556 37593 37905 38082 38159 38176 38194 38209 38231 38281 38291 38308 38330 38389 38547 38571 38701 38726 38852 38870 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_RC3. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_RC3 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_RC3 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_RC3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_RC3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_RC3 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_RC3Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5749 5781 6273 6562 7107 7153 7257 7343 7379 7394 7412 7420 7428 7455 7459 7463 7466 7469 7580 7765 7993 8469 8803 8832 8847 8862 8870 8884 8902 8923 8974 8990 9000 9020 9066 9096 9149 9206 9317 9438 9482 9515 9554 9588 9595 9628 9705 9711 9718 9725 9754 9866 9872 9883 9900 9917 9926 9955 9967 9977 10078 10140 10160 10280 10317 10373 10387 10408 10445 10655 10830 10979 11014 11066 11283 11597 12121 12483 12773 13166 13301 13314 13325 13471 13650 13781 13915 13935 13968 13987 14070 14185 14326 14451 14465 14573 14666 14695 14715 14791 14808 14826 14842 14861 14881 14898 14910 14936 14948 14966 15167 15406 15433 15450 15506 15568 15628 15659 15683 15742 16088 16118 16135 16243 16353 16493 16567 16643 16721 17213 17433 17544 17575 17702 17738 17866 17893 17933 17979 18195 18319 18387 18487 18492 18528 18564 18578 18601 18634 18638 18663 18682 18708 18713 18728 18743 18762 18787 18799 18821 18838 18851 18863 18881 18905 18920 18937 18950 18961 18972 18992 19021 19050 19074 19109 19144 19171 19358 19407 19439 19487 19584 19717 19763 19955 19985 20307 20436 20576 20716 20833 20968 21012 21055 21063 21073 21085 21097 21105 21116 21143 21177 21213 21244 21279 21315 21362 21382 21399 21417 21422 21429 21455 21471 21492 21509 21526 21544 21561 21574 21605 21630 21661 21692 21727 21754 21807 21817 21827 21833 21842 21850 21865 21869 21874 21880 21884 21919 21929 21958 21974 22000 22017 22036 22057 22073 22086 22091 22099 22114 22140 22159 22187 22205 22216 22222 22228 22249 22259 22270 22288 22310 22327 22340 22361 22381 22401 22412 22425 22447 22454 22479 22494 22514 22526 22543 22560 22580 22599 22776 23060 23370 23550 23761 23949 24015 24062 24117 24161 24181 24210 24222 24228 24244 24248 24252 24260 24270 24282 24297 24316 24352 24363 24374 24413 24425 24435 24445 24455 24471 24489 24538 24559 24604 24848 24874 25128 25143 25169 25226 25260 25295 25437 25454 25503 25524 25540 25569 25574 25579 25585 25590 25629 25664 25694 25749 25782 25828 25842 25921 25926 25980 25994 26004 26028 26114 26162 26268 26302 26309 26324 26351 26360 26399 26406 26428 26447 26463 26481 26513 26532 26549 26706 26737 26744 26753 26761 26768 26782 26800 26819 26829 26841 26882 26927 26956 26977 27000 27019 27057 27063 27071 27075 27096 27113 27122 27141 27287 27329 27839 27847 27871 27889 27933 27938 27943 27947 27978 27991 28000 28046 28172 28263 28275 28339 28341 28343 28345 28355 28369 28384 28411 28415 28421 28426 28435 28440 28467 28469 28484 28495 28510 28538 28582 28629 28645 28667 28678 28711 28731 28780 28880 28882 28950 28990 29035 29110 29176 29211 29292 29299 29360 29424 29431 29437 29536 29592 29868 29992 30103 30165 30203 30211 30233 30282 30285 30306 30351 30406 30465 30534 30581 30686 30829 30854 30858 30892 30908 30933 30981 31017 31078 31132 31213 31235 31274 31311 31343 31367 31394 31420 31434 31442 31452 31460 31474 31487 31499 31523 31564 31590 31607 31636 31960 31963 31977 31989 31995 32011 32023 32030 32037 32046 32056 32073 32089 32132 32140 32148 32158 32169 32187 32204 32217 32243 32250 32258 32275 32283 32300 32324 32343 32362 32381 32391 32402 32416 32434 32454 32474 32483 32506 32526 32537 32552 32564 32583 32602 32613 32623 32628 32634 32652 32671 32690 32697 32716 32736 32761 32778 32784 32792 32802 32814 32835 32851 32859 32879 32899 32921 32929 32940 32963 32970 32984 33006 33023 33032 33053 33071 33080 33111 33127 33154 33173 33193 33211 33232 33246 33266 33273 33292 33307 33326 33871 33904 33932 33961 33969 34006 34318 34495 34572 34589 34607 34622 34644 34694 34704 34721 34743 34802 34960 34984 35114 35139 35265 35283 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_RC3. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_RC3 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_RC3 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_RC3 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_RC3 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_RC3Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_RC3Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log run spool ... ... ... . .. lock . ..