'V֔iЪ0*h NetBSD/earmv6hf ramdisk 08i<  ie0\t ti@@<@T 08i<  ie0\t ti@@<@TU itPP`Aiii$h iiiAiiiA.iiiAiiiAiiiAiiiAiii@AiiiAAiiiBmD/!iii (08@HPX`hpx$[iiiN$iii (08@HPXK$6iii`hpx[M$3iiiFAiiiDCiiiEAiiiFAiiiL!iii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii4!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii B!iii B!iii!iii"!iii"!iii"aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii!iii !iii!iii!iii!iii?\!iii>\!iii=\!iii<\!iii;\!iii:\!iii9\!iii8\!iii?\!iii>\!iii=\!iii<\!iii;\!iii:\!iii9\!iii8\!iii:\!iii7\!iii6\!iii5\!iii4\!iii3\!iii2\!iii1\!iii0\!iii7\!iii6\!iii5\!iii4\!iii3\!iii2\!iii1\!iii0\!iii2\!iii/\!iii.\!iii-\!iii,\!iii+\!iii*\!iii)\!iii(\!iii/\!iii.\!iii-\!iii,\!iii+\!iii*\!iii)\!iii(\!iii*\!iii'\!iii&\!iii%\!iii$\!iii#\!iii"\!iii!\!iii \!iii'\!iii&\!iii%\!iii$\!iii#\!iii"\!iii!\!iii \!iii"\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii \!iii \!iii \!iii \!iii \!iii\!iii\!iii\!iii \!iii \!iii \!iii \!iii \!iii\!iii \!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii!iii !iii!iii!iii$!iii4!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iiiaiiiaiii!iii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiaiii?\aiii>\aiii=\aiii<\aiii;\aiii:\aiii9\aiii8\aiii?\aiii>\aiii=\aiii<\aiii;\aiii:\aiii9\aiii8\aiii:\aiii7\aiii6\aiii5\aiii4\aiii3\aiii2\aiii1\aiii0\aiii7\aiii6\aiii5\aiii4\aiii3\aiii2\aiii1\aiii0\aiii2\aiii/\aiii.\aiii-\aiii,\aiii+\aiii*\aiii)\aiii(\aiii/\aiii.\aiii-\aiii,\aiii+\aiii*\aiii)\aiii(\aiii*\aiii'\aiii&\aiii%\aiii$\aiii#\aiii"\aiii!\aiii \aiii'\aiii&\aiii%\aiii$\aiii#\aiii"\aiii!\aiii \aiii"\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii \aiii \aiii \aiii \aiii \aiii\aiii\aiii\aiii \aiii \aiii \aiii \aiii \aiii\aiii \aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\ !iiii!iii!iii!iii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiiiaiii!iii!iii!iii B!iii B!iii!iiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiiiibpf!iii $iii$iii$>iii $iii$siii$iiiAiiim iii ($iii0 $iii8AiiiGAiiiHAiiiIAiiiJAiiiKAiiiMAiiiNAiiiOAiiiPAiiiQB@Mkx~c+'HlC:;߻W!x+xq.(|Z,[/dy{vo(/@`4grnekP[m'ed@FU:>~y9K. cMeӼl Q 'Iwyï3ʎQu5^C'QHU + [B8wbjBrѮU &P,a0U ʎ<!/.$'s'/S?tza%.3LWy 3(5t'D~uISAO_<߄eHB\r5t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4,!4 (M M P   0S;00 0   P G0s s0T TH T   P RP%\Y%׍SbdppY%H0`  BR` pRp RX Xp/P% Q%@- 0 gxQ% 000/]%pC-؀-`P p0M @i${ A (c$ A{{z`P$0  >ЍpY@]%4$xQ%@- M @00@  P  ЍA- l1X0Zp 03 @P N0S@ ((@0X;0% P-  U @0`V/PNX`! spN0-S {@|N@PhLP ULP@ U(`p0SX 4$]%O-6M@T , @P Ѝ  p` 6@5Xp0S 5%0 0 |5X 0S_d50S&<0 pP(@0SN50S0p pPJ400<T$尠ET00CS0 Pᐔ Pp  PYU 0 P00CS0 0 X80: S  + +HpP p Qt  X0 0, 0X3($05x000 00 Q00SD 0 0 ``2p8  p5 0Y 1(#00 H  0P s@XP㴂~ ti0S@z K"I 0R 0[0YY]820#0 p00 R0S =100S  0 7( Pʨ0S;a@T c@P@0 ?oR20S 0  H1 0R0P( @P @0S "P0S XP XTy P0Rt00!P ]%4$Sb]%]%]%]%]%f]%xQ%P%]%]%m%]%#]%0@-MM@P  9p  ;0U$C dP TT埾ۍЍ08 TP ,(0P XI4$Va]%Q@-@ TdP DD|,EP $ 0P@4$Vm]%Q@-@ XEP HH]0"P $ 0P@4$Vx]%@-G0 RxQ%0$/n&0$/m&@-s@-n@-i5@-dKI@-1   0 0 Ѝ`n&@-1   0 0 Ѝpm&@-1   0 0 Ѝ|n&@-1   0u 0 Ѝn&@-0   0f 0 Ѝn&@-0   0W00 Ѝm&n&<00/@-0   0A0 Ѝ n&m&<00/@-0   0-0 Ѝ n&n& 0@- 00 $0P@NЍ8$,0C-`A!圁!ᘑMpW0 |! R0B=00 B  T0L 8 R<B 8!4100!0ЍPP =I9P 0p00S  0 P0P      0 3/R ! 7000@080LZD0m& n&n&<#=c}n&30p@-|@PtP00 R 0p800 p0  B0Sqs n&n&m&0 0 0 /n&m&@- NSb@-@- LSb@-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/qpJ0S 00Sbm8@@-@-PЍ@g PЍp@-(`Vp80@  03/PP8003/(Pp@-@P`P 80 (0(3/@J P JPЍpm&O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A. 000+ xpt| oE  ЍOu0 P % pHp 81/qp4 ; ?P p 4 $J0S4 tp0 0 0 0 "/E0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0@004 8pX  FЍm&؁m&$Sb6ZR/ R 0 0 /\\CC  B0R00!/0"SSS S S S S SSS SS SS SSAQA0/C-lBM0 0  P0 0  0  $0 !(0Ÿ}?LB?@PN3c` D0S%H0}??@3c`_`RP0!!!! d 4 !`Pq4D4 c" BXX P!d4^4D4 P" B   !d4K4lD4 =# B  d484YD4 */0 D8p<@0! D` d @44  00C0S 20  60 0CS0L200 5 Z0 P CPE P 000S S  `V$ V000P >x tp 00C00 0CS0@100 0j5X 0PFP 0Z0 CPF V&P嬀VP0PP00oP I>wt pql} 00C0m0 P0CS0<00jl00`68q&p&@q&|*xQ%Up&Hr&O-P@`p P`T  0PS wP 0@^S00\P0S @\[ \+P X0 @P+0P00L$ Q%{c@-T @000 <P 0S( 0C00S 0C0 Ѝp&ht@H$L0 R QQP0R/@- p&G-QpP@ `V 0S0S  @Ѝ0S V 0S@@T0S VT@T0S @PP 0S 0 0 P 0Sp&G-@P tp0S)`&PUP 0 @P @Pp&X0000@-@a 40aA R    0/xX%p&40000 01h@-B xX%p&G-R肟@p0 0S0 "3( 0`?VJV$ V00 0 0S0 =D < \i1@s4<0"S04 @pp FQvPPRRRRRRxRRRRPPRPPRp&A-ppA1SPS a00S S P4!`0`00`0S00 S@P0.S0 S 0P00`P 00CS0#0 m W  U0100CS00 pPp&P%G-AP pRpGWR0`0`0` 001S 0100CS0H89 _P00CS0' 0S  OP 0Sp`0 0`0R00 00C0p00  %`pp&G-P4Ap  QR`X0A EP0A0S6PC000P 00CS0'0  W  pP 0圑0CS00PU`*?0`p&G-A 0`0P0 P 00CS0-0 o& 0FSp 1S 0PEP0Cp00100CS0p&O-LB`0pSP UA!0SR0XPPP00PD 0Q0CS00KM!1  P[00`F`0&P/  C P) 0100CS0G'(P; 0堑0 S, S  P9 00CS00  0堑0CS00  00P{p&A|*xQ%UA-A`qW ڬQ1ECe R0 0 C0|00|PPV9 ~00CS00 v 0q0CSQ00 \R `R `p&|*xQ%U0O-D0!10Pp Ѝ0S/  $SPPPP&P9.\ X(T400CS00   _0Q0CS00! P1̃أؓ 0 S)"Rʜc0U```00P 0b0CS00 / 1Q !@o!S/ %S !`V U 00 0P 0帱0CS000!000\Q00`PR# !RU``0``00Pc 0a0CS00jl0` 1 1S 0S11a0S S`l  ]P6 0a0CS00=?10`! S:`Fp00  1S pv3a0S `10 BRpE` S`l   P 0a0CS00   p&#|*xQ%Uxr&;( Q 0@30/@-Gp&`01S @-0@!S @5P /%P /p&D#7@-A00 S1 RUVʐ0\00PB7 00CS00- 000 @ R, R xP Ѝ00!S HP `0 Sڰ 0R0CS0000 0 Q  tP   p&xX%|*xQ%UO`?A-O0 R ,Sp WR ! GrYQYYRV||||||||||||||||||||||||||||{|||||||j|ln|||||||Trr||||ly|||||||||h|ijjllmnoopptq|qrLsTtwxlyhz|zPP00 nR pR lR 00 S  PP1S )PPPP0 nR pR lR 00 S1S 1PP0PPPP0 nR pR lR 00 S1S P!S00P0PP!R "R  RP 000@8 `PP 0 nR* pR# lR$ 00 S~Pt "PPPು0S!S  ,0S 1Sk aP0PPvPcO 010<+08+0[ R000@ ?PO 0!SP ;P00 nR pR lR 00 S+0S C, a~^1PPQUt P#G@ouG`GooPbVWP101 P00 nR pR lR 00 S PP0SPNʈ0 nR pR lR 00 St)0S hh P0PP0SP.ʈ0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Sz1SrP ~P0PP  PP` 0 nR pR lR 00 SV_P0PPBP T0nQ pQ lQ 00 S 7PPB@ 0  !P4p PP/0S `Vn0VkV PPPVPUXp 0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SPʈ0 nR pR lR 00 S2S040S402P0PP0S 0l0Cs0S 030 S1S 2SqW P000@ 0S0 0m`PP| 0 nR- pR& lR' 00 S`1SX!0R!S p*0S1S dc hPUU 0S0Q 1OP0PPP`s0 gRG  R7 0 B R3 `h@p?30"S; b(pR1 rR1 U0 R 0 S\ 0U0b0 * `P'00CS0 0 P00 S2S 02P00PP2P02 P P 0b200CS00U.4VP!2R002 0nSS pSH lSL PP0 nRL pRE lRF 00 S1S"!2R000#2 0# 0xX%p&r;X$T$s&|*xQ%h,s&xr&IE(8q&H$5V3:20 2 2020P0PPKP^p PPY0S) `V0V PpPӔʈ0 nR pR lR 00 S11S)67P0PP0SPӆʈ0 nR pR lR 00 S}P0PP QR000P0P00@j `P 00 00 P0 nR+ pR$ lR% 00 S!0R!S d(0S1So bWW P0S0P0PP1S 2SqXP0S 0l0Cs0S 030 S8 P0010CS 0nQ( pQ! lQ" 00 S3 00SF.2` `幤S@p"20"SY`x 0  PP00 nR pR lR 00 SQ0pS ZPP0SPPN0 nR pR lR 00 S2P Z2S7P0PPP&  \-@- 00 ЍЍ/'s&-0^S0]S0]S S]S[S .0Ls0S^30   Q  ]Q RoG-鐁`P@0 SS&tPD(!,RF`a`qU`0``00P,m1( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a .( L0 0@S G 0m8q&s&@q&|*xQ%Up&ep&p@- !0 P< P@01SE0p0S S u`Pp@0P 00SP0P00 P l0X 000QP00 0 ,(8q&s&s&s&'|*xQ%UO-|b|B0 %Q + PXrX00 SM Y< U 000P "$0 00CS010  Q0R0 00CS0000 S0&0Q@0C0RapU`0``00|P 0A0CS000 0P \S0P 0 S 0t00S|hhP 000S Sq 0`00 Pk8q&t&@q&p&|*xQ%UDr&Hr&P%0A-P0 0p@ W 0 `BP! 0 R00R000 1BQ/@ @P僢@p/0"S,$@gR0008q&t&O-@SMpcȳ00 0GS TcsT`0``00P/` \X00C0+0&SK BR D R: Y J @p RP/ 00C0S @Ѝh20    BR   0 \SH 1B\C00 BR?ˆr L\ DR-WppB@ \ p \P 4/bD @\<h00C0 AQ 0 T0 Tpppp  *Pu p BR   @W0 `0CS0(00oq 0 bt&@q&p&|*xQ%UO-M!@"0P 0k $40S 0 0 00 0(0lpPP `Cȳ0 S pSP(0Y01 Y  $ ƿP$.\ XǿT  B R+<30 #   BR 200S 0 0 m%0 0(PP0 ߍ00Y0 Y L $ vP$  BR 200S 0  5% P004 Q' 0 p1pG Y<||Z  =PD1 .C4 0=,I00C0StX 000 "2 0 0(0P< 00CS000\^W 004 00 |vP00S 0  $< 0 X cap&t&@q&|*xQ%Up&AO-pᬡA0M0CQ` 01 00C S00`NlЍ~  0P5 <P!` 00000`P00CS000  [  Q0S00CS0x00` P  Pp&p&@q&p&t&p&O-RB0M00bsp 0sqЍؑ0ЁS 1    000P@ 0.#⩟ɐ Y Fp10S 0p0000000CS0C01; 0 \" \ 0 0#0L\ 0C000@00000000 0C LN 5p&T$p&t&@q&Lr&Dr&p&A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT ᑾ@ 0t&p&T$p&G-@p0 PR` 0 PY(S%T0  d P%P 0 ,卽([t&|*xQ%U@-0 y&xQ%O-dGM0PS@pM$Q403/P 0: S*,00W +" P9:,?0ղP0: S 0S⽲P0: S 0S 0S 0/S&᫲P3ⰲP0S,)P( `P 0p# PN+?"0P 0#P] ]wP  匝/<P/<Ppp(P! 0S0S rXG Xм00CS0kKpl Pph pYWr TTe\H Z0Sh0S0c ?o2500?G YU.0.0 m"G=0JPT.0.0 ["G=0INP8$[(9$ 0R  P ,P0F@+$0S00P00P00hPP\0.S0S 0!y> 0P$0 0P(0 $ ( R P0 ᒺP000Ѝ0u&FVUUUG)[)dO-@a!80S )PP! +spW  ЍO<*<0匑SB儱|z*@P Z(@-*V(@T(0SL Ha50CS0\⹂ $j ᰂ00L0S \0.S0S +@0S40S 徸+<0?oQ20S X 婸040 Ѝ0u&`*)FG-`LFP04FL0 $廮P0S&00D0H0巭P0pP蕟0 pN5T H0 `F0P 0 P nV5X0 s0X0d 0t000|00PP' S'Q 'R0 S" S# S5 L0S5 T0S40S4P$Q40V  00Ѝ10@GS$```````````````,48````````Ĩܨ`,``@X````````(Lܧ`` Xp`|Ш 8`L 0$00H00P0L00T0QX0s0X000P0L0T0H0F000P0L0T0H00X0<0P00L00T00P0L00,(0d0%PP"0<0080 P0 D0h l00D0h000000 0p0p$0,p0$00,0000@00 00p00t00D00h00x00|000000000D0@PqD @з}\0 SPW( ?R004(0\ SR PPP00`0S0\0S00S S S0|0`0Sp0\0Sd0d0ꪃ0u&ht@\$lJ%ג(lXd`$/xQ%Xu&tH 880p@-@PT @@\pu&x|80p@-@PT @@\pu&x|-L MRM\0 X+ fp&>0 7ލЍ 00 ?>04@p嚶l0l 0 0  L00S   儶SbxQ%eu&u&tu&$0\ 0S rou&eSb0L0S/0 0 0/@-00 SM 4 $;pphGЍ\0\@ X0R@P0 B ?  0Ѝ@28u&@u&Tu&\u&Xu&P `00CS`0p S00 P0S X0X /X#P%: S@-  S  S/ I* S  S%|@=A-x1`@pTXPM !X@P10S D10S- 010'p C ε@0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?4  0឵T00S /( .p$u&&1@-,BPU` V0bP$00 p?W0 pGWhPh 0 SV.00P ЍP#ڀ;;S 00 0r0Q P?PppD1$p0pQ Q(% 00$0SP ( .0S000ES000S 0ES $0Sh.0S 0S 0SPU (0( .p$u&Rd#' 1|t!0SX@-dQM0S T100CSD4.Ѝ0S0SS/ 0070S S00.S0S0@pT0pS 0LQo 0p T0Q00L 0$P000S$ʲ/u&p$$<mkG-P`0 P ,p@P"ڴAQ"Q 0Q P 0QD .ЍP 0Sp$u&@-xaPMP d1@0S2 SU@D;00U0pp0 K0Q -Ѝ P0S(0S 02Q  Pڌ0U 0?  dQ-0 P 0{P 0, -p$u&.[&mO-rM,M R(`RX0E@FP]0 0S 0 00 S(0S `  P"宫L2p00 0,"J⡫J?00"⚫Tn" ?‬܍,ЍT ܁0S =! !傫!0`| n10St1pl1 00Z0,!JaJ?04!00(q0(`01娀(0 C0JK E00 $0 , 0 h 20| `*J T꼲$xQ%u&d#'&#'F|& x&| &p$1C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S R1 ث  0S rpP (0: S0 0C p10S10S PP f0 0 0S q4S 1 00 0S000p000 S(00(000 P@0S 000S x0P 0+0t0sP 0Xh p$x&u&"'0#'"'"'#'bv&$L#'d#'&&A-MM, ]P# ,G QP ",RB$0`SF 0`CĂ0S2o+p4P} /Px 0 u S( .p[+lY+h2Lr0`0CSXXP+M+HK+DI+@G+<U+P,P000 06+ 2 `ލЍ,+0S  R  sS SS YSRP+yS+$qx +l+<+P,P 0S8 4P( 1P *0S(*PP dP0000**"'p$u&#'#'$|$9$AD ؁g"'^u8HDd 00@-@FpQp`$O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S *@DT  A0d#0UPTP*PV0S pr*@X`ꓢ" @2/PL0 !ᓢ#, 08谲$$v&$v&d#'O-Q0@`p@F d[ PppWPH8* ЍPT10S  '*p@ 0 $03/P$ 0 R T @ A  80 3/PuP\\00Sd \) Q < 02/P " "d#'v&)$Or|&v&@-AMP/Mc)@P+ p`pP/0P0 Uh0h *AލЍT0_"J/0P0 0@0 `*|&v&00CS0 㮩0 /0O-S$M00`Y P$ЍP0,03/P00孉L30S, 0P! 0p 0P0U00pPF0P0 000/`F p 900`00Q úQ P0 S  PFꐡ&$$"'d#'p@-0@0PpP E0Pp@|ꐡ&$A-`PlplU@0@DTj@P U@0 00`PE萡&$G-P`ကpU0@0@DTG@PğU 0@0 0@UP0 `萡&$G-pM =@ P`T10S P:8 ! U00 J(; 5! BR P#?U0 P0PU0o0OPJ{8h @D 0RP J(L Jh80 Z `ލ4#'=&$gV Q/p@-JTUPPL0P > PpP@4$ 2 :0 40p!'0@-PM@ Ph00S Ѝ0 $ R\ 04 0R\ T#'0@-MP @PЍ000S0: Sx4 PPU 0D ፔP 02 0 T#'؁"'0@-M@, 0000S# Q0S 10S uP'0S% X0 "?A3c000S&!h0 "?A3c0 ᶓP 0NS 0X Ѝ0 0< 0S epв$̲$MbN2p@-@P`_P p P $0g 0 Yp"'y@-!@P 0S 0@ D"'O-P0`/Sp/M/@P7 P. mp /00 ٓP&  P!00S  ḓP ͓P0 Dx Ѝ#'G-@P 00/S (QP 00Q  G<∜ZP 0 0`0S :뤀夐p0 0P 0S@$<jP@D0 40 @婞D!' ! #'"'+A-M`P@pQP5(10S Ѝ 0RP  0RP 0: S P {Pk 0 ]PW P W  P W0 @?T#'<؁Zk0@-:(4@: SM=0P - \ 00[ P0 p 0: S ,Ѝ000  t:P/  0 fA-pQ?ZdV`mP 0H!@1@0S/0(DS7 (1!0 0 =  "4S pdP p0 tƝ0 40Ѝ@$<@0(DS PL(DPL(DP 向00 0#'#'в$̲$!'O-J#Q30` P (tJM Mp40CS񟗄3P x30S /P0: S* XP2,3,0(So0S| (4S~ 0S20S 4m0C?o2 000! "p"⑐p; 0 ",X2 Z/ Z\20S0 0 D"J>0@Pz=0 C,zᨐ Jލ Ѝ  ≐ Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40Pz qP#↑P  0 `0 + G`\ QX00O0S0(4 008 00#'8#'#'#'в$̲$ #'+&L/O-p@M W 0DQ 0S08 0<000SPP0C080pG0S 0`S : 08 0 x! x3  P< [ @0  0R X2@ @?Q*H @0 :0嘰 R ZP` dЍTT ә  ` `@d#'#'t#'#'Rs@-Ѝp@ 0@`PrQ 08  2P 0 !'0@-@MPPZ00800S =J"Ѝ0"'G-`QM MJP㠔@ Y #p P 0p 0PP=! SR J(Pݍ ЍxPJ 8 = $ HL0RP J(L0 00QJ 8 PT=G- QP M 000aq@T+00CS0pT0 0S0T@ 0 S@ 0 t P 0S@ 0S0 0 S P !'!'<$P% 0 0 S00@-@R00000S0@000S `忘P LP40P8#'<#'!',#' "'p@-PP 0S|p `ᖘ@P` J@P0/S000000f PR @@@p0K!'h0 RX R  H R/< R/ $R/Q/  !'L#'4#'\#'l0A-0S X0XP@0P`PpT R S: Ù0@"'!'|*xQ%rC-b@ 0,MS0S.,Ѝ0 0P50C S=" #" #P"# # ###t20S 0X0 00!P! " o PPP  0!$7$!2 0!0 㓝 Iz X B)(4 : S>  S8  S%  S04 0L! 0 J $!{1KP6 S  S0  S04=! 0400S -ЁЂ ;Ѓ"040+04 1P0P 00   0 P!'"' #' p@-8M@  ᄔD 0`P`yU`$ $ @ 0ÄP8Ѝp#-A-t1hM0@S TȘhЍA`Z(v="(<p@1WpP0 0000p084 ⤘40CSH$0r"60"$喘0( 员4 CR+x መhЍB>'PS+<  ?b"'|*9K|]VB@-@XM="p:(0 XЍe7@-@PppP Q Ѝ0 08 @ Ѝ0@@0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qqp@-PP,0CQ@0#S : P$B0WN%R0CBSB 3b 30tPpA0NQC S*p P@-*0S ^*00 S R( \000Cs R@30 ? SR@*:@ 00 Cr@ T \A Cr@T2  0a0Cs R"  p@-0C@0 PR#S : $B \N%R02W" 0C@Q `@ 0PpANQ0 C S*80P @-  //D#'nA-@8q8`Q PC-PQPUPQ S A赝A:UP0 dd? 0:S@ 0S000 h,"'J%xQ%/s@- `m0P PQ10*@PЍp0S @mR! bR kR% + 0*S xS SwR! /QP0@P0$+* &!PP@P0PA- 0S`PpP 0P# X p R 000R p0000S ,P0=0@P+"'s@-@`P0C30 0  R R00Pὔ@P0@( 0ЍpPE 00"'@-  >ٓxQ%-0 Rr @-/ἲ$@-4@4r>(o> l>i>㽓xQ%a82O-px ,@ ^\Pp`0, [/00 `x|O-lM/PoPY@P p`0p/小0/ `0@ ?/@|p??A0s S  R`?`/0X CRSE <QzP񟗳651565555565766655557555555555555555555555555555x665566566555555555155555550655557<655155L65T65l65555555$4`45l4x4545444454(5\5d5l55d555555`N>4=P $,PMP>@J >0 -R,Q0 00 0;= =, 4<=???????????????? C4C?|CC?CD???D(D(D8DDD???TDpDD?DDD??????>>>??$??? 2@ 9`3@ <2 3 T2 @ .83" * 2@@ % 2@  2L 2LP 20A00㬁堑 RK aR eBp Q PT@@@@@@@@p@@|@@ !00000 00K1]PJ `1J  P1I  0I Hꈁ 0 010L0ߏ1Pd H#'#'"'#'$BJ%$xQ%"' Q%&u&,T#'̲$2#'#'в$L#'"'X#'$$$$$ܲ$\#'$d #' pP%B@$nʤJx`#'P#'Ȳ$"'H#' -1\xQ%/rD#'&Lc@#'<#'v&8#'0#',#'(#'$#'IJ$#'h,v&#' G 0.d#'$J%+#'$ 9#pL#l9'0   0G 5가z0P  , G# 01F  1@ UP00F .P`1*PE 1E  1D s1 1C1WPC1PB $2B  42A  D2A  T2p `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C Ȑ0 0S3# C*SS8C0U Pg000Sv|30UӈePE3PhPN0000S 3 Y0P  /"'l0P/`0p@-0 PL@LPP@0@|P6 cB"'d#'RxQ%#'A-`  @PA?\+ \ *\.  Q R( [\SPQU !\@@]^.!Lo \0S8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ \#'p@-@@0/SN00N P\SpPQP`Q*C0CT030@"L00Q*pQc @-1MP M AaqQ P/P 0P0Sۍ Ѝ.S@T|`l @ @#'%X D +O-cM M33 "@p3]PW0`0 00S 0f0 0 0ɫP`` 00 ;RSVz @0 0;T* R`DV:  cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 ҏ 0@&P\P   (0 0CP;T+ 0S( `0V"p0S 0 0S ׎0S s  0l 0 xƎ@T *0S0T00  R S 0  "' VxQ%pC-`PMM RP  p\SP RT P0S #  0SUS\S R. gS PS$ SS GS @> 0 0=pS sS0S00 R @@@(PP埨P 㷌@P p 庚P ; ᝚0 0 ۍЍK&"'A-PP 0Sp`pሌ@PL P940  R p`@@ @i~"'X0A-@0LPL`LpT  SV ߍ0@"'|*xQ%`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0  ~04P 0S/  00p0S/  0`0 @0/S000 0D  /"'L#'\#'"'0A-j40@TPp 00S0o`0 00/S @Tx0T0oSP0 SD fP04"'L#'`#'2A-0@SP' 0`.S0.S0S/S X_PP 0 Q CR S.R  S.R0S/S | 10S410S 4P:4 CSR ! Q`V 0/S0S.00 p O00C0V0<0F `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0 0A0 B!"00@xX%A-Q@pW :<00S { @x#'#'в$̲$Ȳ$7@-@@Q@A@P0!!\S  q  10@, Ѝ0 @G-鸑M@TY `P!ApT 0S @T n@PP 0P0 0%QC ,P5]" 0`! A*00!!QP  ލ P    P] $0 P  0{D nvs(  x#'GԲ$c{1G- pWP `WY @ @P ѠP` ˠPA@>t@T uP`oP ,ᮠP$x#'<!d0A- @T`pH PATKP q@x#'Qqp@-@@,0C\P \A@ \ @AAA A@AP:0Q00^A0@00BP0B 03b 30@pp0 S  0 - R 0R$R:/A-0A R0.p0X!MPPaM\ 0  C0/S' 0 ! ӄ P3ڍЍ *R.@ ?R 0pC @@\@0@C0@0 C0 0 ⫄ P 0` T⠄ P 04 $┄ xX%c kvp@-`0Sp@e\ 1e #@ P6000p 0@- 900S  /#'0-h0^0 SQ0Q00P#' Q#p@-0PSp  l#P`0 r   H @Tp /ز$A-`p娀u@PPP@P 0 \YH0@ LT00CS0 $ 0 <$(V#'M-`PPЍ8"D:0J840K0CS 2  `70 01 .  dd (l] <tX @ |qp}  H=/ 0$  4 =C@2Q! 1Q) ($5Q/^)040)($84K ARKQ  $ q++  @ 04(4 :(40/S0004084(49)($ q++@k$#' #'C-j4@0CEMS*Pxtxxxxxxxx30SPP EߍJ(~J(J(J( J(S20d 000CS100 0=P  0 R ⨁0≎ᩑC  S@ 3. b 30(  J(L0Pu[[P001  Є=Ђ0(p ZP0<x SP0@ LP00  0 CPP t00 08P` &PJAPP P >#'|$_B("'// Qp@-(0PS$ l` ;@P|Bt 0000X0 `%V0  @p#'O-P`P Ѝ#:0J84YqW V#//00p0K0CSt3l IPk0<00H3  a  d ( |qp  }? $004000JH1P tp@0 B(1<.P lb<0 㓍 H K06S 0S 3 CRUXX~gSy K CRZ0 40r;;000(4 9 xS!04(4:(404(49(408400C /Q000Q($4S::  $ R(4 @0&"*4*0p000 02S($0 *4($040)($84  R KS 0 0 40r;;00 00KS8  0( $ #'#'<#' O-z4@SM- S `cV:60VS0d`F`0PS/S`S 0EoᨂSXA 0CS@P hDP0P 0@00aT8@pIE-'A-ppP`0006@60 06000@0CS000SA$'$'p@-P`@T PV 0@p@@-PG-Q=0@T: 0S W@0 Y =`P P0 V VX00CS00 kV 0 0 0{@p`-'$'$C-3sPc 0 p3@0! 0  0004 B @3 3 00`Dt5蒟 .0@ Ѝ/R@R R@ k&@ B&QМxxxxxxxxxxxxxxxxxxxxxМxxxlx\Нx<@0=S0  "?R 9R:BPꄛ؜$|R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R'0o  -R(0h )d%b#`0 ]xX%$'z$'<$'$'0@- $'0s@-0P`0Z0`0@S P 0R@P@R   P@J0S00S B0ST P000 R  Ѝp$'0'$oz@-L ^ꤠȠԠ̟Pp$8D̟TL @@~$ \.*1#P?  B 0b0?  b0 0RQQQP0R0R0P0QPQP !#O-`pu딠P @%RBW &R X*6! 2[00 @P@ P@ Ѝ$'0@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F4P@$ P@x W$'p@-@P0)Sp$'O-@`p04MTV TY T( T) #T! @$TU "T 0@#SP  ! 4Ѝ'0DSYG x@W'0I @S 0 0@SP'Y00p0p!&x }W! uz! o0  @@P! b0  @PYWO'T@@p@P, @w $'g>LO-p`M8P谟蠟6!@ 20 R@ 0DS U# 0 ^ 00S^^ :U 00SY` p PU @ 0DS Ѝ$'C-`p 0BS00@SP! @ 00 TPP@@ Ѝ$'G-`dP0@S! p0 00PP@$'@-@MP2`PL0P  IR NRpp PpEp@@0PS@ $|2Ѝ$'yPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P22Sp0@1PH0@P 0,S@2ꪃ$$+'0'Jb@P/-0 /RRR00$'@-@PMލ0/S X.mp )mp 0RP 0RP؁p@-`\1@P 1D0p@11T0"SP VpM{z$'p@-T` RpH0@Q 8 `PP i1pp@$'$O-p/WR 0S)P xB000000000CS020S 3@T  U tU`WY41gx828b0400@/Sp?EpPI0S0/p0CS0oppW002000pA0P00 w000 hXU \TU00CS0810S 00CS0 0W00 pR0S/S0@D001@ P  R*0000t/S0S P 0/0CS0 pG0S 00CS0001@1@1@$'$'$'$+'$D؁A-`p0@00kP 00CS000S q0P0CS0d00S b%@ HW 406 R0S 0Q$'$'$$'|*G-2BM8)r0@T%U@P' 0.S00.S000/SSJX20Pp  `PF y ePZ( `V+G9PP "6` 3 0` E0E9w$w@0-S0SH1@T@<UP 0UkPw0S /pP0: S W /pPXP PW v0S| r/pPsЍ謳$-' $'@-$0Q @ S @$'5p@-L@QK70P000S LTPP 0S}s@@P 101kP00CS00 P 0 O0p :xTH_-'`$'t$G-pPp@R` V101 0Pp )Pp `b\TQ @0T! \0DsQS񟗀hȶdж@0 0BP!0 BS@@00CS00 O 0@0 @T0S 00CS00 rO 0 0SY00CS00 ]O 0 ?O 1 0d1@ @ @ @ @ @\@@輴$;NA-@ ` PR 0R 0S SOp0S0 R O0S  OU  nOTyOGw xsO܎ Td@00CS00 N 0 ANꤴ$$'%'^$0[Sb$ 0@-P" 0匘$'@-@(0Q P$'@-x0@T   @@@@ @h@00S 4060S <Ѝ$'+'$-$0@- R    %'-@-   0p@- %'-@-0@0 H@-P@` =@-@-   3@-@--@-00l " ЍЍ/p@-P@` p@-@-   ЍЍ/ 0H P @-4 4N,P / $'0/$'p@-@ohPPPP gp` g`P gp` g`ps@-P50@T t0t`6 N &2h0@T POT0 0@ P@DЍp-'$B $'2's@-`P0@S'<0`%kG{{'jfk[P[x r06S 00S T(Ѝp @0t0S0T.S N@$'"  0    /$'@-@TЍ0Ѝ0CSؽؽؽؽؽ,8  000 P v0  6@ 00 0@-@M PU PP 0tp ,P   PPP 0tp 8 0  Ѝ0 Es0 0$'$$$@-@P 0S0S 5P 00 0A Ѝ2'G-`0S q0P00#@儡T0SX_'@d1$@00CS0D10S )Ѝ00S P U^fu4  R *P00CS00S UC0S=fCUP2f@ +f0Sl#$'$'$'' C-c@PP^0M& S'-,똓sQH@d$X|S#$0@30S &K0S 2$P@@T K^0S 0S@+T ^0S$0 0 @^0S 0S$0S 20S 7H+ @@$@++10S !H0S Ho^0S 0S$0S @TM$@P10S H,10S G 10S G00S G  0$ 6 $0?o2$0-0$ R  h00S G 5@2L<K]+  Ѝ謳$8.'$'@0'< $G-PMp@9+0 `㠀堐堠qAPP ]+Vx0$`W U ^0S W P 0`S+Ѝ0'$$$'P8PG-P* `0@00 0R0Cp0W S `S0p 00 P++S p0@*PD0(00$+ 0$ 0$/ᠳ$$+'$'A-Pp`@䀟000{^0S 0S 0S00CS00 0S  BR0 00CS$`0$`0C0 $0 R SP 0$`S S$'$G-P䑟 M^`AV $`t*pWT0尡p0p00WZ 0S- |1|az4KlK K00CS00 J 0= K00CS00 J 0 J  @N^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 :* Ѝ謳$$'0'1'$#A-@ M p) 0 0P_@T/ 0S0$`V@ 000P 0`@0T$0 R ^ R 0 R 0$0 $0) Ѝ`00'$'$G-`倂Fo@p0媢S' 0S$ L2LRH23`J8^JY8(YJVUJ00CS00 I 0 IQV000  'P7 V a< 0$000CS0l10SG  D EPq P00CS010S B00CS0 VVp00S #0$0CS0|00S 0S0S000073I8IG 0`Iꬳ$1'$0'L ` o $'$'$'s p@-42M000000 20S 00S 1 `1 3II0Q@TI1+IPP& |1  1@?0S @T H1 60S >0S$0S 00D0$ 01C 0d>0S$0S ph@DnT@ xP H047S 7S) >0S*00S5 -0000,0(00 0p(0P =&0S(7S%00S 0 0Sd= 8  ,=, )bp@ P 0 ,= M8 = <, R , ,( k%P000<<0S @A @X$ 0 $ ` 0bh<<<I1Gh@T: =p<P^`P H00CS00 uG 0PppH@T4`@T @ [00CS00 ZG 0 H@`@T0Hk PU#00CS00 >G 0 :G00CS00 *G 0  5BP @P07:0P XPP@HPP: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP0077S 0Cs0S0TT)SS B70s0SBP0 Q AqQ8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  p8 @  (00(00@070040! 8<000L-P7 7H 00R}0( ?$0SP007pGQhJ 0'000 000 7 0|'0x'00$(0h7  10103/$0 7 G474' 6,' EL0S L8 6 6 @ R] 4 0  X $E2&@00CS0 Yns`60S J⿏P x60S%,0`S5T6$5D h0 L5,,0( W0000+,0( P#0hE$0(0S,= $ \5 d50S $5,0S pL_t<%050S 0 @0 AP0ET>0 0<0$0 0C0 000|D000t4 8\XQ00CS0D40S 9P) `40S*T0SXQ\K8 3 3 3 \ 4 03Ce*00<p3 0 0S '|0R#C#0 0 3 BxhL00S0\P0"0C0000QK8 2C  |2  t2 \ 2 *00 0`2 T0S@"00CS0 2 R   01D0S$mߍ;10S ,0,!SS{1 08 L0H@:Kq10@0@0S P1 @0S1 41$ @0S  1@0sH1 R#0S01   B  @0S @0S7S@<L 0 00S b;X@,0S0  =,0Sh@P3 lF 0,0 0H 02'0'$'1'0'$8.'$' 1'$'$'1'$0H Դ$-'-' h,J%$$$ $' %'!-'$' B nG@T(0Sp0 t0],0 0s,p)Dl$HF0/$'0 /$'0 /$'0/$' 0  /$'P@-@'P@<0 QP cR    $'0 S0/$'0@-0M0/0@0P ^P S0: Sl  S` PЍ0^P0 : Sf# PP2' p@-Px@x`M$P*00S _#0`00``00"`##$Ѝp$'-'@-h@P$0k'0 RP  B R    $'//C-LM*8t8 p@<(P@0` D, ` 0CLЍ誃$ A-@P`\npWU uoNH" 00Z(Yp-'%'O-pWC R``%` P0S:S2E@А @0S,W@  @20T/S/00i0 00S00P R:R0:SPPP{@DOR"S"蠳$$%'@-@MP/p P㨐K  0 @ T9]p0 @~0!0P 08pWZ0S 0 `T0S 0S 0 St]p @8" f`P T T T0@@T >0DS%'FA- @PM`Rk1000  8p"XZU hBB Q PBLBQ8B 00AS 00CS00 VB 0* 00CS00 FB 0 ЍQ PBB000M y00CS0 TBBHD00S Y,y2'$ < E Sb$$'N X ^ $'b p@-P@@Pp 0S%SpPP @p@-P8@Pp 0R?Pp@ꄯ- @0@ R0S P P\ 0H$$%'G-`P@唀0吐00|Up00CS0h00SG0S0 S 0S00gPPp$'$%'H$$'A-`pP0@00 Q Q:R@ @:QR@P0SwppR %Rw@/%Ppp0V:SP0@w@2''H$ A-`P倀000|Vp00CS0T00SA0Sp00MXg@T`$'$%'$'0A-pPS R+Ԁ`a@T"W p000Y 0 @0 0 g00CS0H00S F`UP `@%'$'$'p@-P$@Pp0P0@ꄯ@-L@000@00 f00CS000S@$'%'$'O-PM/`@ 0P @@@ ([P000 0S 0S 000Ѝ#   P@ |#)P @bPR R R R 0S 0   " R0""  " /R0 dpP>Z0 R"00ㄲ0  pPZ m P2 @ 08@00Q  0S/R10SZ #P %pP A0000S R  pJt#P* R & R "(ZP0 * R; R 6s0@@DJ P R  IT T@0000S R    BR =D R9 7 a2' H$%'$06 $' $ $'O-@`pM&PP'0S*[ 000`0p0Sw|2!| S6hBy?01 P?PЍbPEU@0 (0800p`@[ Q tV  0P!0X ZWYV M1 00 _0S& 0s1TP P*X 00SW0 0 S0 P 0S,YT 0s P kV@T -'$%'$ %'2'H$p@-`P0000S S@LK000 00 00000CS0p00Spp@ $'$'0@-x@M0 0000\0P>00J 00CS0$00S Ѝ0@Ѝ0$'$$'@-gP 0S KO-@p`SM%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩00S"" 0RPW>= >0 @ TW 8L> P 4z>>0 R @ T Ѝi>>A00CS00 > 0 00  x100/ÿPXP!  cZZW YK>H>T|XPW>>W~`FeWxWtWq ~W 0` @ p`=`' -' |*h 5  J _ m } $2'  4UhM    O- MLBLRp0@0`V' VV:V  VF /V   BR 7` F R        (! R  |a[  0000SHB@P   ~p[/R 0/S {0WZP ЍY @TW 0 BR r R  BR    BR  G B ꨳ$%'+'$~A-(A0S 0PS0 0aqP0S00 P000b00CS00S P 0SRh`hp0P RP000b000CS00S %'$'$'%'s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `C@{0S00S=STL00 <0 R0AD1U0 S 0Sꜳ$-'-'A-dp`0PS@  R Rr00PH @%'O-rPԂ0M00B00 00$`0040Cc ?4`PP00CS0E0S00CS020S - HVUP+0S 000PdUP a P =10S 0EC0P0CS0X10S Ѝ000 @H[ [` V (Q P PAP 0 SR BR r R  B ~  ` B `FAQV  RP P%'$$'+'$'$'~1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xqQBP  `V' Q`:00Q@  @% Y0S" SP P@P P DoQP @@` %',2'%'$A-XPX@X`P0p00`0p0CS00S %'$'$'p@-PG"@Ua0@ p%'@-QP`p0G0S `*00E@P`P P `R@ Ѝ0P@@0`SP0S0O-@ Y X0 S@0 S@HY" \YX0 S@0 x0s0S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x r SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x~^\| ]\Q000``S XSQ0 0 @ 0000xqQuS^ P[Sc:Q! P-Qe]Qb  \QQ PP$"`( uP1 0$0 $`( uP%H0,"PP0 QPQ P !$ P80QP*0$0`P ``0]S0 S 0p@Y(\PP  8QP4\SSPP0 SP0S  @p4 zO- P@M0?S*S3 [S;0^S!S00x|\/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xpPS@0/SR"@ R0A$x r RP R  \$$ЍSPX9$P| 0U0/Sd 00EpP $0S/00E0S``0` xqQP 0S V/00D0x r RP0  Q: 0 R /00@>0P .Z. B/o" R  P V0  _$%'؁x|$'0 q Q0@-0 @\C\0CC/x~^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S P g$$$:^0$000CS0H00S V 0S ~0P%'$'$'p@-@ PTp 0@ @@%'G-p 0s0 S QA0P 耟`V `R`F@ V pllllll@S`` S =QQ RU  0P   Pz0G-p@ Mo oF0P Hw8a000e U00SW-00E@`PIPE@T Ѝ00CS0@̰+'O- R@@0`-SPM S! C R444444x44d?So @Sy 00C Shn0 0 =`f0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P@7@p<(W@A0S 0g0CS00  P6FBЍ666;0000Q00S h6h pR\&TV(0S 0 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 R I 0  U  R~ȣ0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   I ~ C   0S q QAQ$AQ!   Q R V  BR + `w ~  0 BR儡  BR  ~ ~  `K E~paQ 00S T 0s0 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00-'-'~+'%'$+' %'$,2'$O-$M000 Z0 0H'0=,W0Jp00 0 7'0` 0`F#ZGF@Y0/ 0p@P`6 Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG (A;9 6`0P`F 0 0S Z?0Y : @5% @AQ TK[Y0I Y@i ZD5  A0B F0  %T5  0 Z@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R%##@%@%x$x$x$x$#%%%%%3  AQ AQ~00AQ ~ K R  BR ~0 0  BR d~0 0^ @0RP[ 22 0AT[ @T 000S[@Zp  Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0 0000P  00B 0C 0000000T0 00qP 000l0 GR00#S00 B00S0p0 G0 B0[m$Ѝ|0s0S[0000p0SQz%'1'$$ +'-'~0'  8 O-0M Pp0 5 500 E 00B 00~S P0 0`Z Z":Z =Z Z! Z     BR  W PR 0 AAK J R񟗋*'***'(P)()Y 0S`Ѝ0S 0S0@S0=S( ( # #00CS00 w 00w00  4#00CS0 0 u #000P00u00"00CS00 00 00(0S 0  CR  SR`0C 0 Y 0"00CS00 v 00v000aS00s0 S 00CS00 ~  BR   Zl!`00000~00  `  000{  BR !  P  AA ^  ~R[=Z0SV 00}S N ` ,2'$%'$0'+'G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S!000`0`0CS0!0 0@ p  H 0  X 0  R 000 0p ꬳ$%'$+'$0'%' @-0 @ꨳ$O-XAX`0$M`F*O$+'}0S/p@-@PP1PL1DP0a 0(00R 0S"00D05#0s  0C?o2^0SP㷕p3P _TyP p0C Ao PQP0S*00CS0p,00Spp@8*'5rO$' $'p@-@\P0P00 Q@00CS0p00Spp@$'$'O-@`LM R0 LЍO<,ؐY) PPY   0SPs  0 S S S PQ 00SЀ0S@LЍ0S}22 F!0R+  p  !R -  x",p 0 0H"+ p0 sT Q0ٺp+ 00CS0X+0p W +㴱p^ Z 00CS0A+0 00CS05+0 | 00CS0)+0  Ѐ YZ+000u + #40  + +P S#4sLS 0 l0p@ gd ^+pZ*0㓉#ЀC5*'T$5rO+49^p@AJO@- 0 S  .^\Q0  p@ S0C  C/o "P R pO-PP10 0%SW P Y0@S!!Q@ C$0S 0S  R-S %S +S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  P T"@` P)P \0@00SJ R Q !" R @T$d*'sG-$a$30S Qq0m0@Sk @ }*Р㼐0Sʰ00CS00 ) 0 B+0 R  0 S !S**'-'5rO^$A-p@`QP00Sxt10P 0S XjPp pP@ gP`WP P11@*@V Q@ T0`p0S0 )@00CS0z)0S 0 0 00SJ 0 S 0 0-'*'5rO%55$800S /@-P `*'8 P  /Q 0SZ//*'`060S/P00S/D0Q<0  40 A!0 S00)ꬳ$+'$*'5rO+G-Q`0SS@00SjZqP000M:;@ 0@C$ Q 0000CS0L10S "4q000$100S010000<>00V00CS000S 0S @pWZ00萠@ έ0 ZNꙂ! P00 R @*'$'$'$A-`!@SPp% L&WVV |1N0S9 U 0S0PuCPBV81*NpP!1@ ! "&0@$$060S& $$$V&&U 0S PP AXAP HHV WT  0 +'$T$$'*'*'E 08 N R S  0S  P ꬳ$O-pR0`BM0 pP  0S0S ЍP880@000$00 ##P%:T 0S0 10S 160SdTf P c100CS010S 0S 0 2"  \ Q R05S00|) \~ Lo ^ \ \ \@W~ Lo ^ \ 0S 00>TP 000@0'$'*'+'$$$' G-pPE@P ?P1N0St `M@8BT @4BLpEsO `㜠@0S0S 0S0S$`@Y 0 X 000 .ꬳ$T$j*'A-@PP PT0Q 0S slP@ pP@ ZP@r|06 R0S@@d`Q 0p) 0 0 Sk5-'Sb$$O-PPdPt,M @P Y8 U0!0S05 @nT pTU P300SU00S00 ,Ѝ 0B(P ,P p0S 0S@3 P#Zp `X*00SL T0 @@0 00 00QBZR00 RiUX )Y ^  pPX2 R  Y RQU@ )260S'  @ Y00P'  P0`0V 00& 0V0S(0S0S 0S06 P 0Q p$@J0S 0S @sԀ0U0X0S 0 S0C0 J0SY UX \) @0S 0SV-'*'9-'Zp$)p@-@T?``Q000 R 0S <1BKp M!r0S 0 00D1  S @` 4s` V0P 4s0``0S`0S]00CS0X00S p800P0V0S $'T$*'5rO$'@1A-Q40@S%P`q0SP00CS00 % 0 e&0Jp EM.^!v%PlP000T0@0CS0800S *'Sb^$T$$'$'@- @ 00ꪃ-'@-@ @ꪃp@-`@0 0 p 0Qp\ PU%00p*'|A- 0pTb0AU RAЍR R =RU "0Bh 'Rf 0 BRb|b0cC< P" Q 000X00S*  RA PP0S:SU@!00S,@H&"@00CS00 ! 0 ( `0SP0 @Ṭ00@*'p1'H*'1'%'2$+'@$$A-M`.P4q4A0S K 6V@oP 1'Qe!0^0V 0P!1U00V0S^0SP60S .0S !PP P#$ЍP ^X8 0P0C?o20@0'$$$$O0*'0S/p@-@000:P00CS0p00Spp@_00S Z00CS0 P@T` `@V0`0T0@0l0S V00T00p@f$'$'$p@-l@0P00Z:P 00CS0 Ip@N;00S $' $'p@-P@PUY p@-DP@-EPp@-P)@7GpA-@P0PS`~Up~0000 p 000CS0h00S 0p000000C000CS000S 蠳$$'$'P @-(9 00C00/$00  0 00   /ᠳ$+'p@-@tPt`0000S0 000D0 00CS0p,00Spp@q00FF$'$+'$'@-D@ 00040 00CS000S@U$'+'$'G-qA0@0000I?o2 V0SPkPP) 00>0 000E000PS V 00CS0l00SG E  P0(` 0`00$'$+'$'T 000@0A00CS0/00S/$'$$'p@-$@P0 0C0C0p蠳$+'p@-(P(`@0@D00C0p蠳$+'( A00C 00 0C0/ᠳ$+'-A-@P(MHp@`DpPVP u T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@E0 P Ἦp T4O-` 0% 00\%P0@-_묳$-00S/p@-@PPEPp@AAA-@1S`p@DPU 0@P00` P-'O-@P0q儑0`0S -R  RF -R0SF P +R: `cP Z TPoP0S TP T``T |0|0T0rP0S \HT PT<0@@T0SOz-'-'-DXe$P0A-B00`0Q 0S 00S0S006X pWP ܟP6p60S0S60N0S60N0F0 0C?oR20S  0-S0F01P0CSQC0SQ0 0SgP   000S 0 0^0 PA! R   R0 0-'$w%'P0 b@-\@000D00S 00CS000S $'-'$'000C S/ @-O P 0 -'G-0p RP 0S5Q 0S @0?` 0CC10@ !,a``@ `Y@j `` -R \ -Q0S 0`@T0:SF 0R@1T0:Y " @`'@ `0 T 0:S  @`@?:\00|@Y00  T@0 CB!0 4$@ Ѝ)$P@-H]D0P  Q 000CH Ѝ-'-' $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ HPP0 @:T  ($-'G-tR@ 0S PP -R`@@$0P 0S 0S@0-S =@T 0T T@1@DSq0`000@@CA!0S:0\:0l0@#1 T030V:0 000CS0 10S v3  0 #@0S`p0C 0 XZ0Oa0C R 0 0CS0H00S E@0S >-' -$'$'Dp@-H@HP080Sp0u`0CS0` 800C805ꐴ$+' 0R @-@T =0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @萴$ 0S/xqQS  0s0 S/00 0/0S/0/z08 0/=P/P/0/z0 0@-0됴$p@-`R`@P:P t0 0Ppd0 Pp0-S0S0 0pV ($00080@p*'*'$O-RM0 p0pᔒb"%Q  X @  [c { R00CS0`S``@520`0@Ѝ X @ ,\[8R /z P0  BR (000mp 0 S B R { [000Zp X R  [R. @@  B@=0  1 Q P Pp P  Q  R P000@00 w 0 CP$$+'$Ԧ$0-0@ P RDM`ޥ0 Ph h "  եU0L T<0< 1 0 01 0 ꐴ$&>gԦ|Y@-P@M0 D 0P0Sp`@T*vpPT @TX;PLP @0 *PЍ@꠳$$-'l000S p@-XP@T T D0T@p8040@p 0 /ᐴ$&'1'P$2'@-0@?&'p@-d@dPn\Ppk P 00008  P8 U Zp@VP$$A-DR0@T @ B 0S 0 @ 0r8 0 00CS0!0`)V*V V v va A ` 0F S ``4``L` V@0000 @\V. |V ;V&P @0 ;P @0 @0 Ppx&P@0 @0o|P@0 @0@0@0p P  00P000K 0 ꐴ$P$%'%'G-pc0@0 T T+P,0S)㰀" OPP @~ @@`P  0RHP `FFa@@T 0 萴$hp@-`0$P P g 0R$, (@R   RP3Pf    Q F 00000S@p 0 BRp@ Q080@ p萴$@-y0 000萴$@-@oPp@-+ @fP P @0 000p` P @`@`ꐴ$ O-С`P0 $ @CPp/0 CR00SY%3PB%V 0 H100SD (100S @ 0YP@0@Y PX @PW W! V! u000 @(pGWoVP0V      000ꐴ$ԦO-PKM 0 5@00 04 P00400D$0]`P  0S 9 40  |4 ]t$0000 `SH4 ` Ҟ,4$ ($00CS0c 0Sf@pW 0䃟RPp *p0PC0pC0 Sڈ#sV@0  ឞ0 0C0Ps00090 000CS0030S0@2 0 2 0 02 P B1 2R z0u`B0PUZKߍ20S d2h@d2d0p@00 0S V 0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PR@0000 H@!00CS0 0000DP3: 3.3@@*pb0PC2P \00<0-,M00CS0`fR {00^ꐴ$$'$$'P$$+'$'0O-鸯帿pM0ϟ  Q"/O/0 0202280 `00P/20S0S 2Y H8x4 0Ա/Q00S: P.Q00S1 0P0C0p0000PbP.00CS0)<.0p210SxPpNTP"Pg KPEpE U0@#S?긫|t ḻdıp6p P00@ S0P@ A0@S7P@a0@SdWP@ W_ P H'P 0p@Wp00@S"ewWh'PG^p0000Pgw<0 0CS00C0~00P00C0l0P@G00@S0P@:u Y p0P0C0t0E6`0@?o? @2;R0S 6\P)\Pp ?PPpppWppUpW 6;E S8 5:0 S0 U0C *0?0%3?P00q Q~  B  PA0U!*00%60%3?00q Q~  B  ?PA00q QPA~P•3U5*00%90%6?00q Q~  B  A0%3?00q Q~A• ?P B 00 r R P B ~ P  B u300%<0%9?00q Q~  B  A0%6?00q Q~A•  B 0%3?00 r R~   B  U?p00%?0%WUT@>P0 |P0 &PU000@$P 0Ѝ ꐴ$P$$|%'%';Rj*'*'$xX%z-'+'$ŧ+'ħ~P$0 ,  0@ 0 0 S0Q >W @<P >P" &P0000000p0p0((0 P -P 0(0  pO0ZP0  0{P BP 10 }0 01{W00E000C00R#PpIN}PP 1 " )00 0: =}P,p @R<2 3 wp BR *p* p|2  BR P=  ŤM= P2 Y%W :W5 #Wg}y 0P 0 zn10G P wp BR pYpT3 0 @ R  B 0p3p哏P3?  BR 4p02!R1S $HQ x0H@ 00 X"0`0001BP11=t`P|4  wp BR pPP4HW I/o}W" R #p BR p P 0X0 'P02`5Qw0  0y0"0 `! $0  0G-`̠̀0@T@@0PU @ 0S 40 0  B/o"`f0p 0S 0 T U0 0 0kꐴ$@-P0@-2aM0$ 0 10< 010@0妠1|0000VPI@1| 1Q @@00Y d 0S $Q. 4QG Q ,4  8000<  ,000 0 0 @0 0 0 S00aߍ0  p0 `0 'H0 D0 H00S-VS,0㑽 0$'$$'$$$' G-Vp0 004 P" 000-P6DDDDDDDDD0$00pK@P 0 R |0f` p    Q0@0S 0 00}Wx P0, R_P}1 000@ 00 00 R, RP4 00300 0000    BR   00` P 0000 CR Sm 0 tP P`  ``s 0 0008 @0C 0 00`0 SlǜP XC0 R   L000`0S.0 R Ӻ00 P 0 R000 0  P 0@S P 000 x`@`0P0|0` P/ 00000PU# T 0S U0@P0@00S0P0S0S 000@Ѝ0$00pꐴ$$$A-Q@`Q` @ p0 P0 0X@p 0HP Q$@@`Q < W R    0 00 00 @ 0p0 `4 P  /_`P l0 08 00C004`ЍRQ됴$P$" A-P0 5P@. 000`+P p@``@@P 0`0 U000 PPe``PP0S 됴$$4p@-@|PP ,0 @P P 00000Sp _pp萴$G P/0S/80 P/0S Q/0(.'A-@Pp`00p` P@-` "$P(0@ pT@6 PP  ;# Ѝ g@P0#?<96 3 d $ $ 0P/(.'RQA-`Pp%#pWpPpW@ U "`0 R@#P P1 0Ǻ"0 Ꜵ$5A-`P@xpT@Q00C0U U ]/@P0 P"(.'p@-X@X`0P0000?/00CS0p00Spp@\$'(.'$'p@-PX0@TpU@PU@TpP"P(.'|0p@- PR @RP x"0 _P `m"*1 Cp蜴$Qp@-@tP0 S000C T  DK"P 0SN",03O@dA T @0@p@Ꜵ$gfff(.'p@-`P0 Sڜ S  '"@P t0 R@U &"p貜0S 0 S "@ꤜ0S (.'*'$p@-P @0Pp @  0p(.'@0@-@ P  Q .@!0(.' 0 P/ R/(.'C-LsP0 U00000@0CMS񟗮|,\<LL00` !@P@2@J 吹!@P2 R@Ux20S Tq ! !`<"<!@P2V0S' `t!p@! "pP|! P 1 嵹 0: Si!00`l!x`\!l `V'jPP 0 0(' V U0S000  (P @Ǜ/ 00!00CS000S ޸Ѝ@pT 0P/ DZ!$' %'$$  j$'Rp@-@P PP Up / |ĸ p`U n p0U c/ ppO-P `ppW@p  0Ù`ȐȠȰ0S UT  O   0@  U  }T 0S@@ `U 꼴$ȩh\ Ap@-P  @i p R  ` p d0 Rp  U p N p H p)(.'$p@-@PpD0 0RPPp03/6 Pp(.'O-@$M0@000`p@A p2@ ̒V 0S"2 0S2" $Ѝ2@0Sڐ2 R@00CS 0SP P . 8̷PzysPP jT 0S_ ZPPZ봡P000P000 S`|1 0R  pP\HE B R% >l. ( C PP / R  PP UP  R rP0 00CS0t00S 0T0 00`Q RP(.'Դ$$$*'*'`$'$c$'O-`0Pd#dCM`s`` `00 4p(V( PEWUCc 0 pW` y@p00S0SP20SU0SRp0sS vS V`p0+S -S X @ @Q0 @R: 帖P     Y,PU 0 P0SA<0OЍVF p p0 %  " Q  %5S' p"?m- Q  0p0T (00%S- l X0 M IU00 DZ h,J%eh,h*'*'9j̧$A-PQU 00CSQHq10SL R@ 0r`0CS00 `01L00<S0S  50qL0S 0CS>S0SSxh R 00CS00 - ̧)Dp@-@ᚘ0TP R R R& 1S# 0 兘PpR!Q QT " "D0600S0T0S 00S08.'$'$'$@-@1P @ +POP|@-@P PP0  ( )D0'WQA-@ 00CS00 P `tpt ?U UH?U!P0P0CS00 `SbAG-@Pp000 T` 0000CS0H00SG0S 00S )@$'8.'$'P P0  /\ Q0 S//8.'@-b@0pSM910S5 0SPPT,2C 02S Ԕp? 0Sl UX U` P$p2 W`RU_O0@D>T000 0i00 10S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ 8.'+'$-'PO-`@TOP P@IP ,DP0FpS`@ PCPBP/P34 !PP`tDa0S! 000(U 00CS0 PT40S 00CS0 40S ߳P@U00P@`s䃟1 R 0PU TgO@`@VT @c儃Q0S 00S 3@@TP@P @宓PP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X P̱̑@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR 'pVP 00CS0\00S 0U00 P dӎz{ W$d8.'$'$'\fAqޑ\$|*A-@P P0` pUTA0S 00S Do0@0@000CS0 00S P8.'<.'$'$'p@-H@P02`S@20CSpV02p8.'40T0P?o20S 0S//8.'C-p@`1010r!Q0@S10C1 ЍqXPU X2ePu+'ּP 0S ټ8.' %'@ 0P/!!R /8.'p@-8P\2Sp@?<9\Bp8.'0-MM01`"R !R X"R   1 1d"1!d2S ,JPl1, ,zJP L!0,00qJ@P$1, @T0d`0P, U @T 0S P00CS0 ! #00 0$0(00D>S 00 x"!0318.' %'$'$' 0@-`"dy8.'p@-L@E'P90PPp0C/U00p耨p@-T@TP0 0P0 Y&0 0000CS0p00Spp@s$'$$'A-@R`P  s0PPEU`pp WD,0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000 0 000CS0h00S sDP`000 0 0C00'$'$'p@-@P@0SH00Spp@00CS00  ꤴ$0ꤴ$0ꤴ$@-@*P%Ѝ -@-   Ѝ Ѝ/-@- 0  ЍЍ/ᤴ$ -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`*P$ 0S! l0S00CS0>0 "  u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' K$0Qꤴ$@-@@ꤴ$@-0rSPp0G-p0 P0R(0帐@0=00]=`Y`F@VPpPER000 S=S B`` R`ĥ`PG轖@ꨳ$+'$0@- 4@ 00C00 0 0"Ѝ0'0P P PR00/0@-HP@^ ^ R0L00zA-鸀(  R i(p`@pW p0S 0QPU  0S 0S   3/P@P000'0SfA-@ᇉPXU p`pp0S'STP@DAM'PP(  EBnSbcA-P0`Sp@    3/@PP@X #W p0@=S0U0 0 00CS00  0 00CS00 x 0 T )$hO-@00Sp 00P㼀✠Z  0l}@PU* Ѝ`V Y   [ Qʁ~aP`0p0'0'`0@ R P=R/=R/A-`P0S=SPERPU@'a\0\p!0qV@pT 0S WlPVpp@0'0'@-1`0@S @  PPV 0 `" Z h0  `R Ѝ@"Dq   R <0 2/0`" 0R , R  00 0000@!L@0P U U0 g00CS0`00S Ѝ@­Y0#L 00P P Ѝ謳$$'0'$'-p0GM00`000FP  80  00 Gߍ0  0 g$'$'A-`p= P 夭@VPp ᳋PuP0D @S= O 0V  @"`ЍA70C-GMP00 0EP00$0 0  Gߍ$'p@-X@P0`"@0U<; 0U`00 0p@0'L!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    \$Ѝ-'-'%'$*'p@-@`TP000T 00CS0p,00Spp@ά@$'$'s@-P@T@ bPP0 P00Ѝp@n` PP 0 @:00000 00PЍpȨ0'A-PpU`A0  [!0V!@TP@ 0@00`0' @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =|@@$'C-pP@0聟rS``PW! 100S T! 0  ЍC^nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000  h7@0 L /@   W P ȫ*-' +s@- P`@@P 0 Q   00 00CS000S ЍpQ     R T0000   6  0 1 $'$'A-`pĀ@TP0U0    > 0S R   0 02/0  00 00000'$$A-p`P@P 0`0PPEPvT` eTp` fTxTp`X @V R@A-'PP@-  VFC-ܑp000P0`-S㴁@TQ 堄@ 0@00`0CS0Uh10SQ ЍC踪 Z@P=N{P 0 @0 0  0 00 00000  0  RP 00 00=S Vt0T 10=S010C0 0P00 Ѝ$'0'$$$'  1'p@-@PTpu@p@-ӴP@`P \qNP@ xP@ IP@P(P0 P pVxf-'00@/ 0S0@/s@-@0 05P`0S 0"S U1r0!l%*0S`0T(000 @0C?o2R0SЍpxX%@-M@ pP ލhP@D 0RQH0PP0@-M@ OP ލGP@D0 SPH0PP0@-M@ .P ލ&P0RP 0RPA-@`KPI0 0SC PUA PPPtpPJ! 0RA@@- 0-RS# 0S0 00tS Ѝ0SX0 0P0S00 040,UP$p`h0@-0P!S@M0SPЍ0P{ 0SxPUo U U t}Po U P? PPEUR(08P`p P  P  P  P  P  P  P P p0St00@jT @0(S0)S0 0qop@-@`P(P} 0Sz00CSt4DTdddd  <hᇈoopPytP0`@,TV%@`!VT`@V@`@ P`@P`@V@)Fc0S0!SPpp(S0)S0S pp@-@PPPEP.U)0DPd0op=Pp0 \0!S0P p(S0)S0S ڧpV @-'0DݧU$@-$0$0 00 ϧ%'$w@- @% R1P\ * קЍO-@`@MT0pD P-R lRC 5R -R| `nA@P{2 000E @PppGWP fPW pGP〢倲PE0%S``PX嵧pW ;sR R`6pTP`2大PU W@1 000 PPP@U aDP@ 1 }Ap AP lQh;/X @P @@P0S0Sp@ZAp궉0 0 n `X0 R P!q *S0埉 0R dS 8pv   TTTsoꪃxX% d i|L+$|*oi[|0@-DMa0   0@@DPU#@0    ;0P x, pp LdDЍ0=wP %'&'T-)$w]LXp@-00S 0| 0x 0p0p p@0   PU P@P0P H0H P p Pp$'%'%'-'$(.'Դ$$$$$p@-@/0@x 0 0@0PU@0004A d0 R 00CS0H00S p@_@C0PC %'$$*'$$'P0'$'P/p@-@PTp000@p@-@P: 6$A 1|@  < S S  SP  L6 CVyP   $W        @u̅0ST  ӧlѧ X@ |@W ht @ Lx@l 4`(TL@ 44,@   T4 @KV ` X@H~x<z 4hv `$r Pn Dj<<f0b(^Z3U@V LHD @>|<@l 0@4TY Vt,<*8 $"H@V S  W  2VxApr`VЍ00 dR @V   Q  B0넑0l  @6 T✦l⚦@ p$$$$$% %%%%%'%0%9%D%L%T%\%d%o%w%~%%%%%%%%%%%%%%%%%%=$$& &&&!&*&$LA&$$$$$$$%%%%&%/%8%C%K%S%[%c%e$v%%%%%%%%%%%n$%%%%%w$$%v$~$E$9$A$& &&& &)&$1&8&@-N) Z F&xQ%@-,0, P 0 0 J 2'j&xQ%&s@-@`d}000 #S@PY}0S  0eN00S 0 UNЍpSbM'0S/#Sp@-@,P$pY0P 00p2'jlz@-PRP@ p`ip 0R" Ѝ}0"S0SO 00SS  00@OxX%@-T$oPL0 <p@|0"SMЍ'2''@-T oPL0 !p@|0"SMЍ'2''p@-d@P0S 0S 0SS 888 U   S$-Pp2'MK1'p@-Px@Q dMyP L0   P    pp@ @|(2'0@-@PPM 0SLD00Ѝ000 0?P0 0 2(2'J(O-Pp`PM 0S<;$ ,  P 0S ߍPꃯ0Q 0S @s?0P P@ P@0 ST WpU: 0S  H 09/PV` 0`2'`(v(U((@-{0S S S8 4 ЍS$ Ѝbt)Sb!)()0/7@-lP$ R\L;@ H! $0S p (L L Ѝ02')8' *4*p@-@P 0Sp@?s0PS 0P0v00Sph*@-h'PD@D D`DpD0So 00  |k*r*xQ%QC-P`PM 0S00(p/p0 @P" @/Q `0p0@0P T0p &PH$0@@ 00Ѝ 2(2'2'*G-@0X Th  HRD2D1H#<_ ( 4 [ , (W 0 S 8 O 4 K #4R! B !4S ; !4S 4 !4S h- !4S L& p!P0S t0 T!T0S \ p(HP8W ЍG2j0S. a`v` Z 0  0  0US !S|  !3 \ 0US:3 0U #,   0t pP* Q%| l>+*********+++!+BB*+2+c:+I+c(O-Qx ,@QdP0QL 4QP8PQ$80S,00 80<0S#<0P;PP;P1 QB"8`㠱8X0apS wpR   <0RTP)0< S4P0S9`(iwQ (bwQ @P0S0 BS `a 0ph R  R* P*da l(ZS+b+s+++++2'9,,,-+ ,q,8-O-;$M p*$ bP 0$S  ߍS 6P@T[D@hP 늤40 婫X ZS$ "$0f0Qf/ jp,2!S!R !SS0̡1,21S 1P P P@0 0ꈡ|1P#>00 P,2 S, P 0 <p#>00?s0 R* 0S 0pj8 P 0S 0 p1Sw j  @ 1S j/ f/ j&p01P P%DT 8'2'^--VEW}}U-WEV--.A.4' Q%A-P@p,P` %R 0R000005Sw D $0f0Q $I  2'8'a.2'p@-0@rP  P$p@`$0@-0S ,P2'@-P  2'O-@:P,kCM M00 8(P( 81bP008h80p0SP :VfP  @00 PY x uP 1(p Xn p@ uP$4 X p: 0 $0-P$0S  $02P  P pGGqruP,圙圩$ pW 0S$00t  P$00  P$00$0  P$00   @NuP pWa 0SY] 0 0$0P s@; 8$ 1\ t$ UP( $0S  S;Ƒ8@W0;RZ(( uP   % uP u P0 0$0P$0S ++RP0 0 # |t P 0 0$0oP$0T0 <t P 0 0$0^P$0`0 t P 0 0$0MP$0X0 t P 0 0$0<P$0\0 |tP ltP 0 0$0%P$0d0 (tP  50$0P$07 xt P  l50$0P$07 {gt P  (50$0P$07r jdVt P  40$0P$07a Y$Et P 0 0$0P$0x0P H4t P 0 0$0P$0|0? 780aJx0S0S  |SP0X: `X0 H0I0@0t 0 ST 7 7 2Z/ \儞0S 1 #0Գ000S05 0  3000"0$0 0 0 $0eP @$0!S D@0$0|2$ 2 ,@pCލ Ѝ0S 0q  QP0 QP0!A"Aq0S 0崡0S 0Cs RS񟗚k`ak`a`adl`ak`a`al`a`a`a`ak H0S0 0S Pz  0$S ro 0 S Pe  0$S~ r{ 0STss 0 Sk PI i 0$Sb r>^ 2'.h*J(.!Ĺ.>>>...2'./y2'M>3'"///C/Q/b/Xr////////// 02'$xX%.0]02(s@-`0PU V  Pn@P hЍp`PD!l 00a0@7V$0@O$00S R@-}u00 $p@-@5S4 0PSP p@@Pp0S 5S 1S bF|Pp5S T \Pp< HPp(( PpIF2'2' a0edArdA0s@- 1 AP(000(`;a5 S4 5S Pu0S u0S005S  Pt;p0pP"5S ЍpH DlP8 WEV2'fd0md0 $p2'gd1@-@P f/k@2' 0 I $8'md0S/!  -3@-PuT 9P 0S S@@ ԅP@Ѝ0@ Ѝ/P%p@-4@4PQ:p@`5 2 @$~77@-t@t0MQh  `P0cS CS SS 4sS00ۍ0X'X770@-MM@` PP 00YSP ,ۍЍ0mP777 0 x8' Q%@-@M0 vP ,ۍ 8zp@-@$P 0p@ W Q%4'8'@-YMM@p p\YލЍ<0< S <fCPژ10YS<0<0rdA!8:8f8@-*0gj zgzz'z'&z'z{zgzzz { Ѝ5}87@-P0@ 0$S0S> *0S6 TQ+BQQ+ QI10S+ 8@0 n 000!C0ASuuuuvuuuuuuuuuuutvc0As Rx4t2 Ѝ0zg{{' Q{ zg{{{ { { @X'88@-\@\0MQP  HP 0nS yS0 $00ۍX'F8 9P `00CS`0p S00 P0S X0X /XP%G-P 0p`0l@P @DpGnT@Y @ 0@_H:Pp Eop〠 0  aዬ U cn`V `` XЍ9*s Q%O-@M MhP`፛X%XTuTT0S0#!pD P pP +P'p0 p( P  nTt`(p P  nPP `;Z>P<08 Tt`( p P  JPP 0(0Ss`, p P  3PP 0,0xSXs`0 p P  PP 4000$Sr`8 }p P  PP 080Rr`4 fp P  OP l040xRDr`< Op~ P  OP 0<0 Rq`$8pg P  OP 04Qq`$!pP P  OP v04xQ`$ p: P  OP 8`04(Qp`P p# P  |OP I0P0P|p`T P  fOP 30T0ۍ Ѝ%94' Q%79*H9s99)[9]9999:=:b::::: ;.;N;n;;;;; <*<O-M@ M0(p PT `V:0S0`S7P`P8apEbWWnF `F`0E8ġ0 0S0A"S0#1` lop P( APgnP@#" 44l LnP0S  3/ PA pP ,ࠐ异Rx%.A 5p P" 4SA4`S>74`P92a0C" 20< S :A$z"YArx5|%.A  pY P0 x5< A B0qpAOA 0Q<0PADx[0x5< 0RA| KP 0 000S P0`p尀(V R s S 0 0)0`PXލ ЍH<[<$f<*`}<<<<=L==[=8' Q%X's= - BR0 R A-P@] R1!U 0P0 K塩X0 囩X0 p啩X0 \叩 ( H/, <+0 0'8 $#4 < $$$$ P T Y0p 1R0S*0X`p\PQ VlDA_>C>>>>>>>>?!?6?L?[?n?w??????YO/O-pᔀ 2MSR R@`aW 8QT ,[Q 0l0 l  "l0@"  8 l,  l  l`@0@"  0 0 !R21`  0S 0Cs RmSj | ||h| ||D||||   1 0 02|0Z8QK k\ Q<0P+8blQ* 8 0A0k @92<0P+8HlQ *ЍO~0 0 020 020p d8 T ЍOЍ?@!@)@@.@@@A@R@e@w@A-@Pp(D<D`8SA ^ 0`@@0/p/0p@-  R( R((,,004488<<DDPPT@TXPl XRl@PUt @ 0T0p  Q CQCQ}C2'@-@t40Pt08Vf/eWEV0H @-P \PY Q@1WEV2'80@-0@S K08f/d4' 0\ P0//@-L0 D<<Y8@8P(` R 0@xQ%A$EP7@-@ PTjP0 08P8 0p0 > Ѝ0hX'vdF0@?o2P0S@- p`Pj@P jP jP jP@V@ljPH@T@T Bp0 4{>@@ ЍB+A!X'udF0@-PM xdP@` "p D\> 0 400+ +Ѝ0X'zd@.A?AMAs@-@ p <>0  0 0`P   0   0  h0  P0  8ЍpX'td@uAAAApAAABBBqB( p@-@PM`Pl p  ( lV V djPЍp (.cH( p 0= 0UX'}d(@B06~d(BB0@-PM @  cP 8=4P 0ip0 =Ѝ0BX'{dЀFC-`0@Pp!匁匑,M00 p0SP@TTA  >p  0x=eP qP p` $0Q 00S*s@P V=QVW V 0>X R00tP 0S,Ѝ00* *  `@ h,J%BX'|dBCCCTJ]CnC@-P$M /@P p p=< (G`F@ @p  0Q` 4 ;$saqp 0`p ,N P \ IZe0X'wdCC*Dxd D_W0DFDxQ%iDDDD Q%CDA-PM @>aP D 6aP $;j  0`0PS j0"S U1r0%*Vj  z0p0S j 0"Rsp;PdPd `尀p\p0 8;0!ЍDENEfEEEEX'ydFEC-p`@P Q q;gP 03/ ЍC@@ R; 5p Y;뤵$EX'Sb 0@- N;X'FP7@- XP@TpgP DkgP804 p Ѝ0訁FX'wdP7@- 64P@, p Ѝ0X'd@E@-(0   #FxQ%O-p0$M@QP`H0 00000X$Ѝ G` p: xP p 0 S 0T@0SxtUZV XMQW 0  @DG_G*d)p@-@PlP1P' 0P, 8>0P  :0P 0P 0Pp@Ep@ 0x@dp@ZU@@4PptcidyaraGrbmngnts^JbSbG0D S/ 3C5C$1 4! 8<0/\'0@-4A QU0&Q  „?/.01 ^ L043c 0P0Q  „?/.3@01 24@5 ̎ @\' 213/P/\'A-PT0p(,`f@ f,0T@@DA??@\'?0@-0@0 (20,20c0P!P30\'> 0R//G-`0(,Bp  Pc Ee@PP'W ,20CS(20CS G0\'%I Ip@-@`42SM%^  E 82<"@ 0(2,"Ѝp@<"82E@d`,"(20@X"\4Ѝp@\'t$)I2I[IIIII%J9JJs@-P`"h  0SЍp00S@h0"S1Ds@-$M@fc00  0 0%몃JxQ%A-`P 0p @Tʬ8 /, s0d  ? B^qp  RЍA#L` 0S`@D@,^ Ѝt$\MrM\'A-0ppP@`pht!14P S H d" R S R 0 qaMU\'Mp@-4@P0S( 5g0B1p\'O-PTM0$ (00#,0x0@08030匠s0<080S8 (2,3`.(0,4 0b40$04 ?|b$0 0ub$0  00 lb$0bd"P 68$000 " 0 RL0 $R0 S p2000#1-R0" 4LGL`P@0^x0P00S qP  qP  qP% L`᳎0L00 S> ?b0g2< pwmE%KUL1Y.?C$\"00aP@\2S@0x0@XRx0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (0 0,00 0h+! @$PTЍ P @*TM\'t$M8_'P%mrNh*xX%;Nsw>NBN`N-s@-@$00CS0 #P` Pp pp_70 P00CS0"0 Y@oЍp@Ѝ/P%NmrO-a0 p97Pp/B$@0eO 0\qp Ѝ  R ЍOHt`c0S 0 o\qp `BPE,\ /0S t$N\'p@-|@P2S 0h`n/(2\!1!1U &"U 80U p@@PC @e@Tp\'Hf'^'G-b@p,^PP 6 P UsW剔LI J$ JJ,ZeU0U 1U01 ;I0s@s \ X"pG' '"q!'|"",q!#34#sO8#@<#$(,0#$1!#(#80Ԣ #ZYPPUJ0U @DQ ČUȌ̌X L X0PZ 80S 0sPU*‘ N\'NNO-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q 32 $450 (, T02Sx Y< ЍP P倰[R21 RS$ [0 0 2S Y *Pl5Y 200p@`p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$H00C0@@PAy`d1S  14P8 <   00P2S. Y  a14a8a<0#d1a#h#0)S Z0)S R0 Q !P 300 0^0<   0S8$\'Pt!PPt$PPP&QPTRvRZQPxPtQ|QQUQR1RQOQRA-l4RUP@P@^Ѝp(0PPPB1P@$a$aTS  ЍAFD 1?1 0p7 121!1<0 ) 1$1 ?01!1<0d  1P 1@?0ЍA\'~RRRRRRRR SS,SO--4M`@0P,0 q 0Sၴ0o_d\,P("/op" R 4 0 0  ( g 0U䢑 Zz @ pD H L( @` 0t0x0| 0XS T0@`t˟( PX=0 @`8 21S /0.30010204458<0 TTQ6 R:HL"T 1"R. r4Ѝ0(R0o_dP(0|D 0 P(u 0 P(l xVt  @D H L(@`0`XB(@ Yw  0 pt0x0|9pW2SjX 0h !? 09 ܂,i  R    0$  $  0 0@P`T 0 W0S `8p@W 0`S$0 @0u 000 V 0S<8Xr\" 0b[SR p 00 RW0`@0 0 `p@,0S| 0 007P2S XU9 @`@ _w 0@ ` R$'0Q0[002 @`S`Q $ 0 ^A$ D 0 H L@   @`021S  "/0.0010T0 320445 8<0 T @` @`2S 0 00P52S X?U @ `@ 0S3 :2S H"%>0 $00 0S, 1S) % X000P$  00SX0!14!8!<!14!8!<X $`LLD(`0 S( 21S$ / .0$40 81 <X S  PX 32 $45(, X\ 00$0p@`\3"Rr2S/ d00 00 P 00 00" PXT (00D#$0 #(#< 0'4 0'80'< p0 0pr0 @2S` BT0`lGPX 0 1<A 00@@',2`0C 00@@m(2? 00@@0`Fa ??`1`<A` 0@@,2`0C 00`@@(200@@@? `Fa?`?``0S 2S@ @TJ041S 0Sg 0s XPX2 0 RS  0dPTo_P(L\'=S}S _'SXS^SSbSSSSTT#TG-DBp42gS0嵆P(r(b42S 0P7U42S 0S 圆PqЁ 42RSf P:卆42S]1!$1(1,ЍGv0Sd Sl` d04兤Y2S Zt` ` 0PPJ"PR S@0SЍGAS@ D0ЍGSP) 0Ѝ\'1T\'BTTTTTfTTTTU@-0@M0@ pp`Ptp,ߍ\ [T0  08P \ ]t02S 0S " `P D!SR 0P$PqU+U\'4U0@-Xa0 0LAP d2S8 P(!p! 2SP0U0 $pt" Rp\EU$p0 00P d2SP P@ Ѝ0P0!!1 t$\'md0\'oUUHf'UA-@T2 @PZP YP YP@ `p@T 00S p`V@YPD00S @@Y@P +AKiH'$A-Pp`u#@R#O#000 0@@@A-@pT` WWPP#0@ @,#@G-M d4 P@TPD YP @ 0YP(4 00(0 4QT(0 ,0&#4@ 0#r0@,0S @@((@`@,0s0000CP倃0弴P>PP0 !01P,30  ,3Q #  c0T0< S;p@8 PA ,0S ,< 00S< 00@ $TP&0FSʆ`"P0S -S@= IP00@@P~,0S ,^A0 IP X8800  80 R00S' f410XAXQXa400C0 C,y[0S0Sr[0S0S C 10S C 'C"C$0#4 ܍p PS~ P幵H'YMhNiFQi\aigi$eirF0/<'0/<'0/<'-@-$@   xQ%G-P`p [@0S  0S X| U TY0S F0S@ <'^jj-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @RPPݍ Ѝl!rp@P=0LLD@rO8P,0: S0RP00 0&PP P81: S  S U r&PP&&P%PPPU rOPP @P<'x|kL'Sb$k4kNklk@-{60P  0 00g$Ѝ  ^kL'k0@-4S 3/ <'@-Z0 @(A 0$UZ@<'@-Y@WyUvUY@@-p PL`@@0 7/P0 S Ѝ W00ԋ'O- MM06@  @  @ 0p$000 (0o&P(DD5@ ܍Ѝp 03/0P0   Pp @$0PS <(0SDUI%`P 0 W xU euX0YpY 0 `  W xp[ 0S P%5 e@ u UT \ 0@W0SU 000 -` Z /V@P Z X`p* pW &0S! p0 S   Z0??VH@P 0  XK%@5#z @ 0X L0SS  Q  R 0 000  0R00 000 0@@0 00R0C0 V B S S `V` 0S 0Sԋ'kkSbkl\~}MlxQ%gl9lAkzd@xX%kll)l@- =lxQ%-p@-QCM0S 0P?o20S@@Cߍp@ Ѝ/<垀>!00S# 0S,aQ7G00CS0"@ T 00CS0! P @YT Y@DOoB 0Q  ` @OoB\ 0 @0  0 0 SNT'm*mP% Q%F"m0@-M 03s0c00@S0 oPP* R!PP<A 00@   0PS P5 `Ѝ0S 0S 0S\0S\  0/@ \0Sp 0@0 @,vp 0S0S w@g0S  @"  @0St @D HP@ @0 @ `!0xP|"%#   T`    P @@``a 4] x Zp h 0 @`'''4mL:mJmmmmmmmmPngnn/nnG-0@  0iP 0S< 0  Q*E  RPP>   0`P hJ xpЍ!URQ 4& l V0 pH00W0p ,P  0Q0  1!0 1!$0 0 0( 1 0, X0`P\  P@ 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0pzL00 QP   X 0P I1P xyC1pP1S1S1US1S 3S3S3US3S,  pP0p* p2 02 121300p0.L00 QP  =   0Pp00S1<01@040  0 L40  QP   0PA0O A0  0P 4A С 0R  8 eYywuX`V P0E R 06#++R`DX4 $0S,0,  RT0CQD0"P#10P 0 # 0QL \0  0P 0PdPd@ntn o7oQomoooooXRRaArrAaUoopCpgppppqp@-p@`P P00 P0[K 00QP  Ѝ 60P< !@ !0 P0=K 00QP 4 0Ptoo@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  V ,P000\2VqqG-X` p@!PB Ѝ0PZ%V0 0JVU D1 _X0 X0 PqqO-@,M0p@l@$0`P PprP$P 7@,Ѝ S0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0x!Sp sppP0 S 0 Q q     L 2Q0 2 q "  @ "  p@*"*  P0@ S  2"!"0  0@pq rq^rKr4r0P s s// /frjr2O-`@PpMP0S Ѝ X  H r0A D00 s/ r qh \7P0p@P q x0 ` !P 0 00 P 0 00 `  P s0 `P pP0 0 P`8P qrXrrrrEsbsvssssR0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0@tqO- p`0P\PPX $P  qQ0 0\Q@T(2 R@0 P" R S C0BTX t0D s  $ 0 TX  R 0 0 p p+P YP  L BPTR2 Q PE[ttt u@tO-X`0pM@PP`Ѝ Q0Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/QP H  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 )"0# 0G0 QP M PqHuG-@P`p,P0S 00S <0s+@qa$0S  0S 0S,0 ( 0  `0S/P  S`pl S HDpP@ q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hPP0P Wp0RQ@0\uuuXMu@-?`XP\@#@3P@T@TpW @@T`L'O-`@@M18 00TP0S<0T D0S Ѝ1@ 00 `P0DS%0 ᕈ0 0FQP P0 Y:0 0 0FQP PLC 0 P<0T 0B' vuO-M@L0Sp<`@DH S:P PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:'vvKvv' A-@/pp0%B?[`0S oK0ES PC Gp@@0T?  C0'0 PK %/'O-pcMW , 0 [P0 S~@0Pp(0@@D0 0$04@HD0' R$ X0`1#b3<0#000< 0,00'F<00 QP cߍ0P@4p(0@pD0 0$0``0 K2#  ,PV002800aL0`F08 0L0SD00S   80< 2800,000E<00 QP (1 0H 0  RR R0(10D40L0 `0L0C >d \HP.  (10(11  , B 4 0B0 D0P D0[140S  QI@(1  0I0@;+ R P(10(10@4 40 0S\ 0@ F /o@0(0"s R$ 00, P 0N0p(0@0$S@0! 0C@0 0@ 㓢#X0X 0 PP :X R: U$0p 00pP01So p U&0 pPf(@\Q UpW$ P   pPK/\iN g0x!P0p00pq P$ b QQ#hQh  0 U P p$pu00000 ,p$@Pp0S*0  Q .b A0 b @ @ bρ LG?@@0Cs PQ*W q0L 1r|1 8 <|10W01t0U`0 0\|xQ1PP|!R \$P PPL0sPP|!B0I|1@|Qx1U0P U* SR   1S \\TP@ 0I 0000@1$h8KPP 1|!RI PP 1@c3s00 0Qs (0R U$0p 00pPz, u:D000U\`0( 0$ (\T P000 0T 0P0 00 , Q@W $0[g1Sd Ia1 S0(0ZRhJP0S 0Sm \ppOR P0S02S 0S0SW 0\2SV \Q|!/xQP WPPy 00I@ s = |1P 3D=P PPPPPPL0Is0PP@1@S"U @[ShjJP=PU p|1WS  P@ |qppL0Ispp@P !SP h0PP 0 1|10|1#40L0s_?00010PP. K/\CPP05P 5P0h00h0Md 0ES:\P P|!d1HrH"HP :0 @0|12PPpB18 ,80P'I0 [P0 S0 U$0 P 0r00 0000 0, @ D00S< 0,00B<00 QP80,R0 PI Pd01S\:0!XBP %4QIP0%8%\0 P@l'u vvvv)vq' w#wLwiwx^r؁;xDwwwvwwhxxxxy=yxG- p@r W pP\aPP Pp $PK/KD08QP0Q:" 0PS00  Q pYxPh`P 80"8 R 00 05 !$x'Wy{yyyzytzGzp@-@5%SQ%  5%QPR 5UUQQp  0Q   0Q0  'A-lP`5p@ @ 0% Ņz@ŕ\'O-POMpLP* b5S 5唢@TE  HP@ ET XT 5d 50 ! S$5"R$%P0SOߍdP  RR @`0d B2" 0xA JQP d Zd0P Eh0K/0h0 J0 @!3,qr0d  01(A  j J  J,10,1#40L0sK?000/1001001#40>000310 00 000T0 C&A(%,5QP Hd d0P xz'zz0'zzz)[z@-@ P 0 5'0/0'0/0'0/0'-@-$@   y\xQ%G-P`pyJ@0S  0S X| U TY0S 0S@ &0'^jj-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @PPݍ Ѝl!rVp@P=0LLD@rOP,0: S0RP00 0PP P81: S  S U rPPC@P%PPPU rPP @P0'x|k@'Sb$k4kNklk@-%0P  0 00$Ѝ  k@'k0@-4S 3/ X0'@-|I0 @( 0$DpI@;0'@-jI@[GDD`I@G-`MMP@p`PR0 `: SW/uZ0P  rR CI00A 0C @H#x@ V& 0S UP0P帐`0PPJ0: S,^0"X@PTP&P FFP  PP @u3M`@ S @ SH@PPZ QPPn UD e-/@+S R U7PXp%t!0#PU00`P00D!  @P2  }PH0S`X !PiP0 _PP W80% ܍Ѝ~n|PUz ftUv TrU zz FzF F@0/p/p@-P@( $( $(0XRX0X00\00`0ddhhllppttpp@-@ P '''DD'@@'HH'LLPPTTXX\~`\`0p Qp` >P0@ S p@-0@"!Rc0p@-@P''''pA-0@PJ04S->Cu'->C?Xd'9>:>C_'?n:>CFZ' 0? AC>Q'}C>GL'mFH'EnFD'E~G@'X J.X R  $$((,S>, '}S>G'mF'HHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqx&1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,4+2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P VP( ,P,r 04P`P (0, 0S/(0, ۍЍ10S%  1pVW 03?00?s0?0P 0 0" R?"R0`00o,,Q"  P`k  '0 00?00@Є3/( 0 0 00?0 n000C '0|`* 0'h050S L&0 0'\{X''`''''`''@-P@p`AMM(% ;0 P@ 4U0:t0 R0*d %@1P K40  P,, o%AލЍ)@'u{˽zh^7@-0 Ѝ0@-\M`PpX @ PB0H0`0 `'!P0DP0S L P \ЍpLt-|'O-P`M0M:YP3P#6 PP#Y0P#Up ލЍPX @0B0x08684088t00 \`" :pJ"0S1 T L000 0(t HP( $0000S h0  0X.P 3 p\tK.Px#0 0!0K 0 . @p x 0 0S r  P1 !.P Ѐᰢ L000T0 H d n 0P0X0x2 0J0  000r00S 2j0 0H 0Hh [ Z0# 030C  4 S 0040NP!pgt1 09 090  kN000C0 0 S 8   0 0001   !p'0000 0 F!0vs  0 00S z˽{'|'{ȕ'$`c{'{{'{{|<|G|@'h|AD||G-P`E@pXpAZ x10S l10S 00 0R P4ЍG!@PEU< 1 RP0H 0  P `" H0S"00S U i 0S f0S GppЍG]X,P H0 ЍU''$'|ȕ'$z˽||||}'0/p@-LP@08100@ 00 .0@0 |=p'00S/p/጖' 00S/ꌖ' 00S/ꌖ'P000R0SO-`02@ RPMgD R0R0`ď080S  C/ S ! R 0C00 0@ἰ? 08p\5h!S 0 00Ϯ0 ?@U '  ϬR7 R  0 \5S0 0/070/0 0 Ѝ  [ T R  P00 0<00/H'''}TA}Y}y}}P0O-@`:1 R0* 0p똑嘡0 pP3Qx 0 T B:\500 8P/<# P 1R 0 0/."<0 P 07`0 C c00P0S   0 -0x 07 T0 0x 07400,00S Ѝ@'}Е''T'|'O-0x#M PQ P* <PX 0k:$ `\5 00  7@/<#| @2R 0 0/."<0p @x 0y7`0 C c00d0@@b CC cA30B$ 0Q,040(p0pPßPp0 8+10S 18P0YC9 P XEʰp0 8S,80<01h!0<S0<0<0Ѝ U9 p P\EEEk U0 0 0 S0TP0S<0а(? 0 XTExU p P 0R0SE ?Z0:P00EU SЕ'}'Tp'h'|'l'''G-1P 0p` 6   00@ 0S 0 0 80PS `P` 8UH0ZP000PS　8`48Q$,$ (,`(PP8'}Е'|'~@-@8P V080Е'G-Pܡ0S1p00 B?q6 PAP` 0@`8@Pp1 ?V6X10A0I00 00 0 V0 (pp1 p#",`(p ( W Vp`0PQ%d"0SjP 1@0  XPP00Ϡ^P0d000 A|'''''''F~P0p@- P?@5800P 0 .!SRpꤘ''e~p@-X`0SpL0LP0@1CA0S000p갘''' 00 /Ἐ'O-H0MSPp` M 003/ ލ Ѝ30 Pᰣ00 +0G00@0 tp0 ¯ S 0V  050W0D3p!0S$ 430S0S n0 *"0  1! ![0 02+ 2R2 t R9X:000XP  $O$^+P"1 Qu{{   Qt Qʬ1*!!0Q3 !03H0 0C?oR20SF D1B @  +B,$(P4 P R& P `b P 0S 03/     0P  0`V c5'd'|'l'X}'|~~~~'0O-S0P0 0㘄RM`#V@M( , : S P \p"(5R<R P  RSV 0 0 h0S  ;0V ,30{0 PB?U40`l 00p0S 00W a 8ő @5D0LT 0 a31 Q>P  10@(Ps 00 p4000?000S* A0 0000 0 @0S$p0Ym0 `00P v$ 0 00000 a$hR|''@- p;xQ%s@-@P `ǥ0S 0S 0 7Ѝp譀O-|EM` MP0S 0S L~p P 0Sލ Ѝ000S  iP J0S 0S 0S $0S\ 0S|z 0ShM0ST0S 0S4 0(d sS80!"70  0 " "t 0D@?!? 00? 0- 0-d!! 0-0 lpP20SS "04 0 R0  0"?  0,0S)(04,0AŸ80/R%78 <0PP0R [0" |0S lhbPUt @0S HDb@PUn ,0SP@PPDP~H0S  `Cn* lxl$|0S lnl0p00S0P0$ 0,0UA:000S 0S P H1 H0S 0S,0S _P  2 P   000(P 0S  vP qPP P'Ā΀8Vy܁ ;]'nNx|YnO-H0PSp`M W0R0: P p`0"M,"0 S G20SQ (ZЍ@ 0Աԡ 0 000CSY?00 1> R. P!\!0  S P  P (  . 80< 0 @80< `P0' P 0 $0 S@ `00 R 0SQ Q\ 0Ph'`'z\'T'S8'' '00S/p/጖'00S/0/጖' 00S/ꌖ'O-M,MH@r" pW+$ p000`SFW ` p P(  XP 0 00 0؍,Ѝp000 @( P  ,X XPh0S ! K P }0S, ' : : Z  W 054%00! ?0S S :00/0S 0 S :V00#03  R00S 0:0S6  0 1: 0S R CP40@S0y4`Ə3 P)Q9000 B?T+pQP#h90S  0h !` 0  0P 080S, 'mU09 SPp0 SWQ780S3  V0;R0.*h0S+ 8((d0 #0 (P lJ480S (00L` !p @((g70S 0h0!%7'(5SV/V R:'<V  3 #\  RGSQ: 0 0A  U0$00(p _$7 UPP0tX Zu`Pi ('000 0pP"P6*kPS"Gh0SPp%Q_'qQ PpQ^q U0 EpPQ Ppt A?7#Rp 10S0AW 0 ܿ Z$0S 1000S x50S $0S 01  徿t ?J*$0S 1000S 40S $0S  堿 10S0ꊡ 0a000 04 0 S0 0 00 0!$0000 #600S,40S P4 PP @ p t3000 00S0 LPX00 H00SS7 0S t30S0 \P$ !450vP  2 pLtPd[2 0\00Q&&0: @000S(28P040Qd/<05#fP8`\ RP 10H0J00A*Pa`ppPU0 \:85 @5D0LT 0 b32 R p'@ `글|$\5S0c%0# pD ? 0 $$D40S<40W SW ,4,t`V0`@0x@S yd0, ) 0 00030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0X30qA101[S>  0(A  Ϡ5  0S  u0S\000 T@T`V T0?  @`@T` 1 0X20qA000P?0P0$Gj !?,0 00 pS ;*00p0 VTX0 @ QX`` @W0`3V5 R01<`7: R 0@ 0N 00   0^0 TR 1VS0` T0P   W@*  A 0+ 00괘''T\'X}8'0'd''h''|'P'xQ%'$'U 'Ȇކh'O-` @ 0Mp̰̐ 0 0  BRЍ ;PP U QP ` {{@ pQ RP Q @pꀙ'T'S0/O-dMX o+0PpP0P1P 0L1L H1 0,0SdЍ0S @d0,`?(0 `ļ00@ట 0D RpT0 :u`P 0RA0 S0T TX0S @PSpt0' 'P''/xQ%|'' 0000@/00S/p/጖'00S/0/጖' 00S/ ꌖ'O-@M`PV`@@M :0S 0P *S *`0080< 010S y0 R(P0 X P )X P|9`0S 0S H)E8 P00 9 #R0p0,0S01000@!(0 01?10< 000800$p 0P @pfy a 0#cD0 @0C0S V*100S 0y 'P 0sI0 S$ 0S '00P|7}`{ 20,0S010040 <'0 01?1$'p0pp00ppP*0S  KPc 0 1`[?PW @p` xp 80< 0 80< 0@0C0Ɵ .0 00 0Q.*0S  P  0" RWލЍ0S 80< 080t5 0< S `R0 00$001 `P 0S 80< 0804 0< S xR`0 00$`S!  Br p ^x ⴑXP@280< 0 80< D00C080P<.\SP$ .P $PPP3P`080<9h3 Q0 *300rP2 0 0r$X!p0AS񟗴<<P0SS 3 00c20S40000?P t2 >#R0؀2 00 #R0tQ& l20S`20ST؀ 0 -P  : S000 -0 0 #R0 Q   0tFQF?d!d  @10 S& LQ#R0 š!ɡ0S  0R ؠP1  000p0P``0P00C0X?P8b  |''@''؁'χD'Xf1w>'et1'$' O-WM M0AS}4Ԣh( iP 7 NBl h\P P7 00@ , 7 GP 70S 60V6 ?X '0`06`00Ħ100V0:6 Rp0S8`@aVwPV}+Wލ ЍT P@P   ah 0S \ @ F  Lqw0 00@(0S S㜕u%)p%`pG(pP* 5 0  B, !D ]w850SU 0(0(0 00]/0j 0S WP(0pAp$0pGS(pD pQ(?W,pI'40xpS@09Y(0G5 D,0 S1 # (R& S000000Y!"!"7 $dx!hp9  (  ]/!  ,0 S1 #( R S),)-*-{ {d ` p0S(0S , &2(p2W ,@R@ )' 0x AT!W"!"dh R@ )' 0 AT dx@0 (0S 0$ QP 0  s00 m 0$ `010S x10!l10!B00C0L10!P0 H00000C0!" }p80S|@0{ 0 0C0v 00@q&>|'X<|=''' P''`'oxQ%|'X'lj$'qۉ|'}'D00S/0/጖'O-В"0`1CĢMa2@Tߍ0S Pdp@FDAG@D0 ddpj00@00C0 00 R2PU 2PU0p 0S0S)EP@R1PPUPRPU P0:0000S 00" P D100C,(P X P%0P0!!0` 00p0SL" gTdXJ{!Pe 0 09 J000pDTtꜘ''P'5xQ%''T'$'ȕ'W{b|'~cO-쳟p3张P M`@?  \P  ? 儣 ? V0 n\30ST30T ST D0 S 3 S ( @ 00000CSFTYr P 80R000303L32   ?l ` a2! Q,S Q0lB* \2<20S nP PB PЍS   XPh?00 1>!  R1Z 10SI0T!  0 S<1`0 ?  00 20!谟00S0H0S 0 04040c/0 $ 80QT $0 0$0404 L3 2   ^[0{ {<0 垶PpA''T'h''U `''\' '8'00S/0/጖'O-plMX 4$2唒唢00,0SlЍ0S @d0,P !0 @@P呵000P㸀$@1 0 0D RpT0;:<`1 AQ \`X00X00@SS갳p<pX|p\t`d`V %P 10S  0 嵴@P5P 00S  0 0S  Q\ {{00 O0Q  000 P  H 08H뜭'P'ɊxQ%'|''P'|COWO-oMM@PX00 n#0|2X?0SX0S $5S40SX(PYX0S $XmX S R잟f>`0Vd2 P\20+! `" d" B9#00!X d"B1h21$\Pl2\Ο\0C00p21`t2QB1l2>V 2l20CL0=SLq Q\20B  0S 0 ,$54> *>>0S 20 0`S0 $5B111`R B- 100 S  $|Ќ0S%  0帀- 00$%BR0Ө`S<B11@%L0PP X ZT PN 0S  <P| *堀xp<d<0S 0 00\0 bA?L0D<5A?X0 =<0T0.H0m"; 0VHRQX0h0@ @0Y"8 84<ϠQ b${ S W,0 Sa?^ @PC (;0S @ A>+@B@  CP:"  @0\ 0 0009tJ*h:\:0S G0 0؍ߍ0<00<`/  `!.0|i0S pd,  0 HH L00 4y+1#\Q  0 Xi ?蘟 0pS90n Sn 80S 0)S 3S 0S d0 080S 8 0S@8`0`480`N (8D8/˃2#\%R  `  0 ?d h pB2 `b7"<68+?P囓)<D TP 0RT%ͱ7DpP0W`C ?Q `,00C[qS  S +1#\Q  0将h ?O0$S 6!0S dP#500^00/\,$5St2 ` 0h pp WS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0P3 !D0 R  "0 0000 0 0P1  "b2* 2,20S x%0 0T20S _H hP 2p"S\?"0STT< WP VVP2 H 0"bST 2"TS\?< i0 0<30S 2@#S?d?0`#S\L "P  !P 0#S\ 2#Sd2/?L c\90 0 ppS $S00 S0`@$Sd2?/0?`$0S0\0000p`X 2R`嵟\ 0V $S`0?0$ 2Sh2/0^>00p`Y7 0%S0\000S7呫!"TpW`l嵏X7 0%S 0\000S7呫!pWO-P`@DDT(֮p Ѯ W @⊮A-Q0 % C@*r`! 10" q0SU 1粮0aQ0  a*1t10S H0 0T 0@# 03A0S4 F@ 5*< 5|000S  0 0@TP<UA7t0Tp Pd0 0S L P<0 0S ''$2`'''J'h0/ᄙ'0/ᄙ'0/ᄙ'-@-$@   |x_xQ%G-P`p|@0S  0S X|  "U ᑱTY0S 㷭0S@ )넙'^jj-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @ãPPݍ Ѝl!rYp@P=0LLD@rO⩣P,0: S0RP00 0 PP ⍣P81: S  S U rPPFCP%PPPU rPP @Pꄙ'x|k'Sb$k4kNklk@-0P  0 00ج$Ѝ  Ϭk'k0@-4S 3/ [넙'@-0 @(㲡 0$s@p'@-m@^c@0/P/00@-0@S @'^0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPP  hP R 8 4 Q  0/TTT8 ''`'d'h'T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/x''T8 T 8'p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0XH3H3L3u/L3P3P3T3T3L Hh p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0H3H3L3u/L3P3P3T3T3 EEP  4K44K44h 4 5- 5d0Bd00000P5P5H5H5=CS>S>h p@0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//|'O-x4MP U dDddtd`@qvL:8D80ŏ 0 P\kP SЍ ?0 Pz P\PP0S 30S30S tl3l#0Sd `#SX{ P L0S @;0bS  s* 0S @"\5S 2 2\5\5" 0C?o"20Qh [řT24 ᕁ(Ud $2 ?o:010S?, A!(Ÿ0#\ P  0B ? 0Sf0S c0āh 0S W|!\5St1\5P l10S(` XA! L!0 0@! 0 * 0S +0 0 00PwB@hPİPPHT* 0R A ]ꬖ''`'p'h'''֎''C'8 x'T|'Z'''t'''t'$Ǐ 9O- 0*MM08Pp7P岭  80S Ҟ :Pq埭 p0: S X ]PލЍ48H0,hSO 0)00S 00 78 7 $9   ` 8 ߭8 ٭[V``Z`P`L7VD T7P Q hP ъ_H8P0 0嚩86 R>0 0p 0<&0&0P7p0p(60pw>0 P0p(2S# *P *P *.pVXZ hY 4[ 0SY?관X V. 0  6 <0\:P$V, Q3C ?rPPe 2S|3%8 S20#"20$#20PC 2SB4$040404`02P&V20A2\02@2 00C`x `Fb 0| XH  ?`0PtT#0`P\`Q=S/0P 5` ( 2RV0 S0S9c 5*< 53 30S .0 0`20S 0t#0 0R V 10S `2R\\0SDz2= C ,0"00 00t 2A(07# l0`0S10S!0 R=S0S lC $0007 p 0L%000P%X30,q * 10S T0 0t'''$''7GX'ȕ''` Y''Y 5\TCa~0ёT' 1 Bc(I'A'*S|'PH'\''@'''''''ܖ'ϓm:'ƕ'|''''`'''+p'h'l''x=SZ0SR  0\p<<00P%X30*u0 |00S 0 00S5 0 >0S sPq 5*N> 0:#: 5L(1g 10S 0 000S(OP0q0*,1G 10S }0 00<cQ/,pP 0r<0* (2' 20S ]0 0倂0 RL%r0L%r0H00q" T 000cH00SP<Pr*220S ~+0$# 0 00L40q"  400cL00SPs*330S V0# 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*}d4\40S !0$ 0 04t R,5S0%45S R! t004e0SP*M$5h50S 0X% 0 00刅(0S xQ$ U0S< x 0(%0S8Pȅ* 5;50S q0 & 0 08%<5HSR$ ' H00850<S_TP*6 60S C0& 0 0܆@%D5LSR$  L00@50DS6%P<*L7D70S g0' 0 0 7 70S ,帇 0R" 0Rz7 0SQ `@ᬩPLX p @ Tʰ8 @/  @!. A@O@@ኩP 5  ,@ᓥ$)P0 ( 8  Q DI ϠR 5l)p) x)t)pnWP)pp [ 9 z1 P, P'Qڨ0Q, C 0 0S sPz*:, :0S b0H* 0 00S =0S0QQ 0 0S APz*::0S 00+ 0 0P <0Sh <0S <0SQ^  "Q  <0S&! <0SQL<Qk <0Svq <0S0 <0SH0085L0<0@5h<D ,5S0SP ,000<0,5<0(5H04e0/85L0l0<%/@5D%0*`<{<0S 0 - 0 08=0S 4=L=0SHm*AT=\L=0S 0Mh 0=j P%L5s0SB A-000=0L50P5?T5V>X50$E- 0 0B0T ӣ1`R.B!!@tN00 00L 00*> >0S @0. 0 06P0 @DT@8 HLd Lc B 0b03"4@ `P Z( \?0S  G8 H4L0d @ B b"30D?0S  ,0p00Px6ơ@ ᚧ\6PPE ^0D& 5000460S 1S P  6 6 @VQ KU @ 0`P @@  04 8 E5P l50S pVlP 0 0  `` 0  0 0 4 8 P 씟 <0S_oP`0 4?s0 S +0Sc^Pd0 4?s0S `p0SfDMPg 04?s0V:PP/PQ 0Sd2Pe000 4000 Py c0ScPd0 0 0ip:0S 00 0 0 00  :0S 0 0 00p0  0:0S 0  0000 W0  0l|:0S ``v0`#40  A0  0`qd:0S 0@00.0  0 1 1Q1Q,+ 0S >A 5< 0!00|!0x!0(pCSq #0p R0 !80Bs00WP P0S90@3PT0 Ql \  E/ !0!X< H!Uꔖ''$''''Ș'p'LBAL)'H}Ηa'X'1''(''R~A00S q: S *C   S D00S @-4崡 * R  S//጖''|1A-0`S hd9@ VTL! 0S<10S,勡$11 00 00Sp@t'00CS0ypP U 00CS0o P PYU 0 P0  0 0 SNU ''l'ט''*mP% Q%p@-PD0@0`S  0@Pp_'O-01 (1$100 (P 1 P 0P  PPPpp( @ PT`00 XT DV @p WP @@ 00p''''Ș'@'O-@1$M0H` Ϡ,"4  0jP p 0 <w (嫠P U c 0pP$Ѝ? 00 ?  B P 0q 0 0?QR0 0#Ϡ? 0  8lp0P dꐘ''MO-M0P8 0`ĐpP/2#V [ 0 Ѝ 0|x=@[ ЍO ?  ߟP  ? &0@pꐘ'X'I[C-P`U@ (1 U "P0 PP0 0T2`p܀*0 L@D0T@S   8 H4Lđ0Ϭd @ B t b"31 ~0S   g0P00`0@T Ѝ萘'`'''l' 0S/A-@p dQ A0\ a2Pa00 SR P00@00 0` PЍ''l'p'@-0P@T@TTd pL `l0p `̠V W @ 0 0 0P0@0@00 Ѝ@''p@-`P@XMX  i `P @XЍp @-Qp    H0@S X00S LA7004S,P00'ϙSbۙp@-<`# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT"'Ih''0 \P/Q/ Lœ0|   ,PŒPŃ ,TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> wS*3`30S '0P 0U`dSTSʞPsĞPUU00Q A'P 0S ??@奞ᣞP`"hR0"00S8 lr003Pb0S* xO0S* 0R0E>0*X4 2p610S l0 00S5\P10S 5 1TQ `1*X1` H10S ?0 0H10S <4 (1P 0*0`00S p0t 000S d0P` 0嬜 0wGtꄘ''l'p'`'t'''''|'''Ș''@'''nӚPn'x'''',O-PPMp8 R B@0S 02 ?Q00@aV`` 0[̑ YP >t2 \P 0 H2 0< ? ~0 2r0S0c Sc 0!S 3S =0? 0!0! !0!S`0 0 0` Ul!Ϡ0008 L3R 24  B # R#  B ` 0Q" P*0`0S `5 ` `Ѝ0hS  $  B$ $ R$  B  'H'\'T''h''U 8'`''A-Pph0``ATR 㦚@P<h0S @  1p0A蔘'L80 0 1S/ 0S/ᔘ'`0 5 /H0P 3S P 3S P///'^FPO-0(P,0@4p8`D P P0P` 0S 0 S   000 00 00S 0 S P0 v0       ('''Q/0/O-@8`夠 砰P8Q ЍP@p8Q Q0pሀቐpP,0` RxT@P/! 0p P  C1p  1p @-h0` R,o/ 10#/C!000P/@-h0` R|  /  /C! C!/! !/@-h0` RX<   /  /C! C!/! !/@-xhG-@$ uQql#`h RPSq p$ Z!Y  @  T*B\ !B a ! L @DQ%`L  R V@T@ ^@  `R A G-`RM@Xr kPP X)P`H `nP P7   p  0S zߍ<08 H(00,0 000040!04 04$0D0(0P WZ  帏pT h岏p* \X1` 8  4o (6o 2o .o *o 0,0$o0 o c [p 0`?`a8SPb 0  0**0P0o  0* ꄛd@edAzd@!oFě֛A-PMPp`;@ p@P  P06PҍU 0 2 "0 ݍG-`MMP@p`PR0 `: SW/k0P  rR 900A 0C @H#n@ V& 0S UP0P帐`0ʎPPJ0: S,^0"N{@PTP&P宎 <P  妎PP @u3M`@ S @ S>@P⬎PZ GPPn љUD e-%@+S R UPXp%t!0#PU00`P00D! @P2  sP0S `X P_P0 UPP }W80% ܍ЍtnrPUz fjUv TrU  zz FzF F@00S/p/጖'00S/0/጖'O-pT1`L10P0ʟ 0 a X 3#ˠ121@ R` 0SP䐟A00!R00S /% 0%#s(0! RXh000R T00 pp8P,0薘''0'b''x' 00S/ꌖ'O-,Mp0`P@ᄡ0V000,Ѝ00 ?U0$p$00 0000P$00S t00 ?$000 0 P 410S t,$ 0R00 00?000P+ 0(P0$00 00{ $0 0{000 0 R  000`@`00S j''X'({˝{!'^FF^'{|'0'&@XO-1APQ P1a`3$MS0_ 1P11r00`[00 0p|000P0@T <5PXpXT 000/ 0cP'0Ġ[@  0S +  NP PD0$Ѝj''(''!H*s''p@-P0 % .  @Q 0S pPʑ# #3 l0# #:>0 @0SpP p'^F'מR/G-P `$ 0p@V` 0@`` V`@&!D( `G-@P4S `IpY00qzuPt t 0 0! ##P @?Ѝ_ uP :^F: F^p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@40P/ Q\/O-P5>UM 1 !  /Y0@`Spp `J 0 U 0 0n7Π ^ÌVQ 0V>  0P" G`p P b72 R0V1Q0V"0   P 0 P$ ` U P ``ЍtJ C0A-1àQ`P |0| ||X0@Sp࠱ P$` p@QL ࠁ PQ } Cp@-@PaSl0l llX0C800S   0y0080P4 PR*Sp0 a, Cw2 ,0S/`0@-0@  L*,W0,0080S 0  vX0@G4'w C,0@-S ,0, ,,dX@TP 3@0꧟ CO--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D5@D0  0 00P契 U0#03?\[[UX㢐 `0P$0<5Q 4劑O0$0 =D 0XR @"!L0<p(08p$0 0H(0 0 `,0`4  0 4$WHP $0 PT40  (00 0LPI,05S00SUSP3S` 4 $ `UQ?V  0D 00`F<040 C@004`300DHpL`<0@ RS80 0 ,H0PpT`_@P,Ph3Q 0Q+ 0CQ 0SP THpPL`P@ YT@P" P0T`@V !GGP` T@!>00P0 p0,03(0?D00T P rHL PT0RP H(t`0, S24040S@p( D0A 0 P  X Z 1!< (H >`㝏400 0Q 80080p0?(00T` 0RZ@p (0 0 P 80S0 0C800S   0峑`OO@  D e$@$\Ѝ0$04'LBAWC&d NBAWx a G-0,0S0 VP@"`00qW40S*mЍ!  0P@P   k@PpꨟF CA-`0@c,0Sh0h hqVPpѪQ H0< D 0P@DT@ꨟ+Cˠa C-`0(Pc,0S0 FVp@ᥪQ |0l x@PEU  0P !  0 P P Ѝ訟Aq Cˠs X0sC-Ђ0@ P@` 0 00 0၏P 0Ѝp4'l'X0sC-Ђ0@ P@` 0 00 0fP 0Ѝp4'p'A-0PQ s@`p0P R   T0! B@P 8P4Po,꼖'8'B4'w@-,@P,0S <008'@-,P ,\  D Ѝ8'p@-P@Uh0h 0 SX0d0R 3?p@006.4 Q#3SRpp|'''27@-0S S+,Ü2 R0 ELi `Q |x*PCaQ* Q( PDP <4B 5*< 50d30a3 220S V0 00@ @7.Bp#x3 Ŝ ' 0P `XA 5*< 50d3}81,10S ! @0 d3S, CQ,aQ$ 0AS#uP z0@a3d3*O0jt00S  D0@ S Ѝ04'4''ġߡ`'''8'8P @- o<O-0p M##$0H@` (0,0t4 0SP ሗpP4t0SP@$ 00#2 qp=,IMtUhUaU$ bU P@i0E SOOOlOOOOOOOO|O8Dp,^ E P@0( 0$ 0  0S 00040(` 0,#!Q P P0V }ЍVp F$pe$P` di$ pVP$ `P0V:P0V  $GP$ pI0S 00a$$0![ P  X 0 S 0 00$ 0S [(0,  $ 8}-p R 0 S 0 00$ 0S [(0,  $ 8Y ps 0   l 0 Pc 0 ! P0<iJ%Xv΢)E G-p@P` 0P V  00 000G 00`000O-0` mM$0P@t004080 0 ;p40S+ mߍbP AP LP `84cP iP0p8) 4@0 0H4: S@ @0(0D04,0008`0 P  P 0 0! xGTd ⏂p 0Q= $ 0! $∑匱@P 0V$0 0/S<<`V $=pPpግ<劍0"<$P0<0׀`P< \v H>p< 0 0 n?C0 n?< n/᱀0P < €<P!$JJ 0#$0@0P!S_ `V|s 0S `0S  R$ R Z m0$H 8 HaPp`G0$pR 0$ pK opBZ (,PQ(,PQ S R `TꬣJ%lzd@ԣ ~Ze:m-fҤO-P-@p`,M,$P p($0S0$020S'$p P V 00 0P0Nd 0 "fP AP PP \^pP$}p,Ѝ`P 0`P ,* ?o  0 0 00 `9 p 0P@qp p Up`(J%.DYUkG-@pP` Vp`:D10S:? ; p7 o09 6X $$ op+ P%W00S $$ _p YPPU `fV rV GTP$$  Cp$_J%̥ @- o<A-@P`pP hh X8U  AD<4{  ڊ AT^xQ%@- R0Ѝp` P@SP 0 R SR  R $$20BR R P0 h, (P/00#s01"$#O-@  @T \  `?p蠟 T00 Ѝ@P 6 [ PP P7 U  Q*"ƌʠ? ,͆  RQ*  R*Q*"É?   C- 0P @8a8q@^ \ ^0᳀ 0S@ 0S@ 0S0@@0\ ?\CT:^ *$@A0607;00@R0@Q 0BR 3C !vG-(`$p@`PP 0㘤I$0 0Q P ᨊPЍ }PC-p$4P 啓R%p@ 0`Q P Ѝ }P404-@-0  Ѝ Ѝ/-@-00@j嘌 0 Ѝ@ Ѝ/-@-P 4(  㰈Ѝ Ѝ/^O-MPp`@PЍ P P 4S  0l&T0P$ dQ$VP 0S 4S $ X 4P S $SG30 0 !0!|p`0 0 0  @ 0P 000 00 0 0 P 3 0T0哇+ P#(` ,`$`V$R ڀ 0`  tB @  "pPY 00pP0Sp&+U2VzSbO-$M@pPTPP? 2R 4S  0e$Ѝ0 mQ Q0   RSRQ"  "S 0000 00 P 0 P34S 0S(  00 000 P0 0P0 <00SS P   0 0`V4S 0$R V P0 RS 0  000P` H0H 0000 0   H>pJ&U  =GYG-`p@MPz@P rh@TC^t# E@0$4$ 0840 ;p+p {၈M}px H4$$: S! R B.T A}pD $4S8 (4,$0.B.  1}p 0 0"dR04<,$$4(4$t0K>Ѐ 0 t E  900`d$t؀E0  `P0`P 084S   0p 0ep 0p pp{ p 0pps P P 0" RPp5:Ѝ Z0pY"d@ͧd@?[@-@P 4B BRP |p 8O4  YЍ@&{Ѝd@@-@Pp P P#4PS 4 #HA- @P0TP p` X` p0 pbx$$ QEAS 0Ŷ r0"(Ѹ0 / 0T 02 /$4 0T1 / $4 0T1 /O-`P@p M6`fP̀PP `00000C따 V:Ѝ 1 00 0P02`P1 0 0(P UPnxQ%eC$$0A@-P@- x`R@dfЍpP hP 4Y R 0 h,ũO-P_o!R0`@tMR(0S00S "R0oU tЍP PU 0SEpWB (0WS>!RSR6"RSR.pG/0[ P# 9/p " 9/p 40 P m0 $8  P P  P A-@pP`P 5/p 4 5/p 4 C-(00pS4P Ѝ$d@ 0 :  0d` 0,0  0 `WP /hO-0 0P彆p@ጀ儠T Ѝ`  P `V DHp 0 㚆@h,hA-P@$`$p0 @JTO-Pp$M `@Ȁ뼰0     Q  x0 p `p X0 X p`ⷃ00P0  $Ѝ誃98ƪO-PQ@04p 00` ЍP P0S* E l`P0       04 p p#p p04pp  ͪܪ0s@-SX`@ PJL0 ?o2R0S  Ѝph,@- iR sR aR p` 9i7p@-P@P (`VPp Jph,`p@-@T 40`P>PBpph,{iR@-- 0 aR bR LR( .sR% tR@P 0P0S`00p`(j0 ꟫h,p@-@ M\P`ᰯP0 0͵0,0S  㳂Ѝp誃G-Q@PM Q  ЍA~␀ p$`P phB~0 00 ` 0PP q۫$PO-$M@`H%P 0`$ЍPP 0 0 !0 $0Y!<#P0*,Q P0 0?Y S0SXP pY0 P pE04 PU 0pop $ ᄂP 000 00 pP ᧃ4   \ $  0V,S( 0 `$4 80p{ $Ĕ{%!#,[PP { T P R*L0Sg 0p^ L004 0 000 0/PL 4$$  N $ 0$$?Kp6 E`~+Uݬ00S 0@-@C^M E$āE$$0Q 0/PЍ0 @tq !᪁"`#XT 80 : @圁P8噁J%8 2G^|)0$ 8O-`DMPp4 2<0 p 0S8 ! R4!DЍLRd a0BS)S&ꐂdxD10S  0P ݁@P   "[参@ 3Pట 偂 T 0 >0@  T ۬@0  @,P@pҮJ%\h,dB:mLP%{A-p`(P@ P0 p!`P @00 0$0@-@P$0S -@*O-20SK@0SD00O@ DP 0SD0SA \^<40$ 400#qpp, 804<0ZP$ 0I,0  NP ~bU@qU PH04 8pPTЍ0$$  `VlU0Y `0 XW0 0 0S" [ P70W0 000$0 0(000qpp 0 QP Р 0Z)p , A#p p  $ ~J%<TɵO-@PDMCnp F#d ጃpL50S <'DЍqP sP 80^p#  0&qp PPp0#F0$$d`P P  0@l<0P0  0 <0 0$0+P $P 4  0 (0$0,0  4 PSs 4,  (WUXdcP 0T 1"H0 0 S :0 U 00[ 0 40P40 (, [0V [(Q,UX? U0U0Xd;P p (V,#X0. 0:p8 0  U  0 0LP\ Q QXXx!!  p4\ P 4 "$p0 0S 004  $ 0$ R40H Lp $01S0S p0`v0&h$ r/0$0s?`}ph7 4$$  6J%h:Qöڶ<0]ڷC-P0 @p`$M!!ᜑ P p*0S00 P 0SP0SM \^H 0T' 10S#!Q` [.NP. a@ P P T\\\\\\\\TppT T  ,$ЍP`J%|{p@-P M(@,`6#"X0P0 0͵0, x0S x wЍp誃C@-WM M`pz@T 4G0S @^< Pw 0$$ 0$$0 xn0 ixiP x xwx 0Wlwm0 $8PwLw#<Wލ Ѝ`x Sb)!Lй#O[P `00CS`0p S00 P0S X0X /XxP%@-MP@a qPxШh8PX`XЍ@mw`iw 000 010 0!ppYwЍtUw`hQw 80TPL0 0 $Aw0?wP 0  @TR Q2P  Ѝ@$w"w $m0 8 00  T ppx w1S1SDPЍ@vꟸ@)ŸԸ!XTG-PMM`" v" vX2㬂@r夒TݍЍ  v v % #`Vj Lv  .  `0"E0 B@B@P fv0S8 1B,BvB vv $ !P0#'P%$ !0#Xsv m0 $8g4iv0gv#$ bg@BZv 0BQv Nv   0S 0CS 080  7v 0aaa11b?X+1JCo@)QSb!W'ڹ.[G-0p P`@M!ဂ P pd20S$yPD@6 lP`Pa@ P$L,4\uP xP @ЍPP pFPPP0S00= P 0S0S \^ 0 Q  u u 0p帠W u u Q u   p ou\J%fX+1JCq@A-HM@Pp4 l `41 0S1D0 ~p T  P 00S0 iR TR a0BLR NlR s0BST pL]HЍTp<J%{0 Q /0@-$M` 0 0@P!!dq p~p$0S00b P 0SC0S@ \^; 0T 00S!  0*a@ P 괳Tt"pT T   D$ЍJ%{000000000   S /-0,M$00 0 00 00 00 00 0 00000000 t,ЍSC-` M @ P   000sS 0lSp` P$0㓆( p lp ھP 0㓗) p ЍpW`VpC-`PjP  NP ZPY IP @X IP p` P~HPU k"80xZx IP P R2")|HP  liPk `PU  p $ 02#W: (IPE `PP? [1! GP4 0!xxx HP) !0x|x HP "HP "pHP #\HP m0$ 8S0S jP  ck  HPp@#0T r00Ѝdh,J%`tѾ:mU4]ݾ. %3BO@mw){Ƣ˿X?(y Q%O--@P`؊zM }zp :0S ЍO 0FS iS:C>`C$TSP YL ЍEP@P Y7PX9Pa0P0 h`P000$$>UPjS`P pO`P (0ZUPLn j 80 ,FP $0 ~  Q4 GP 4PW0P 4 KPq pP00000W000000S 000$0`P X`0P(0 iPP <<<k`P k$apPP0  4 vGP 4`P `кP @ EPn H EPh @0 SD00H0 RL0$ 0`` 0qp<  R$4 "#qp 0`~ zd$4P `$$od$4P`V_`P _P 1c|&"l{_P hP'8,0 j`P j4&? ` 0uqptp JEP4p o  TEP   MEP  FEP   ?EP   8EP  P 1EP q8 *EP    #EP q/  !EP r EP 01S 0r/Sp, s? Ѱ  EP s/ DPz$$c$4P(gP೟{ ij`P  ij$$`0 qpS, p0%p< UFPj <pP < 4 < EFPZ <P  DPO  DPI D DPC 0< (FP $ <!8 ~DP3 8 Z* 0d$ Bp #$ VcP$4 "`#}qpp$ AcY$ 08"\T8008$00(0 0 00$0 p40P0,` 0$00 P00 T0nXj`0$$?qp$$c$4P000pH00L0`L$4'`q#qpg$$b$4P `dJ%h,TѾ]&wHƢc˿.<X?@UmU4ݾ %3BO>(yZ+Ux0@-@M P   0 0S`p< <a 4dp$Y0Ѝ0'i@-SM@P, 0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`p D Sߍi@i!i@-@   0Ѝ10S/p@-!MPM@P% PA. (01P A!?AqmP8 0`0?oS c`2 06P. 0I0Zm0 0A. 00P0P A ABm0 000t7mލЍp`0m0 0A. 00PH0P A4 4A@mv`O'' &4aHs@-6PP qZP j 0`@TЍpP  00SQV   l@k0 R !-O-M@ Pxp1p"2`P"    |h\P- `a\P:\\pP `pxU\P ` \AP 0"h 0R00  p!  APr 0SohQl @ bpal _! R R RZ  0PW l Z X幬X (s<㰬W 0j0S, @ hkbP@ `ebpd HQ L 40R !01Sp0S 3/p\ U 8 XFbp \ [ 5@ `9bp Ѝk7;=ySbA-p)[@P@q[PP0[\[ Pe"g[P g`Pg@- CP Ѝ<A-MP pA@P00#p`ЍpP  ⠡0 ap !0  Bi@-@p @A-P`B[pP00^P@?0^  FA-P`$[pP00^P@:?0^  Ff@-( @P00 Ѝ6p@-8M@ P@P 1 ! 1ZP ^0 Q0s0S00!^PP  ,[@&eDp g  ^< P[`eV8ЍpY=i0@-@BM M  ?p 0S 7  /  0(0P(@0S700$0/ 0h (!dP(@0S Bލ Ѝ0jz@jr@iG}0@-MP^Z@P ]P Vl0l l&1^ 0 0S ,pЍ0=i@-@M   pЍi@-M @?PC0 0x p  1Q0r R0s04 1p`ЍYiis@-`Pp@ @@?P0 0J@Ph哪&] P@ L㊪@.ZP 4 okЍp>YHZyt7@- P@8pT TjLY P@00 <<z00400Z@ Ѝ0y;=7@- P@p\ \C0H6@Y P40 00M0Y@ Ѝ0p@-M`iYP 0P0Ѝp]P@Uxh@Pd 0 D&p<8 P@ PP ji@-$Mp3YP00$Ѝ\`vh@Pp 0 XpL˩P@ P`@ p$ũj,i @-B@i ЍJ-0@-M00 0  P`_p `1h@P㕩 ` @O_pp P0 `pR00bS hljFgU hiPxi 9RxSbs@-@`)PP  ,p ^m0!gp@-` MP@XP C\ Ѝp P*    [  PX@bDBvi 0@-,M@ PG>P0 6/ p,Ѝ0 0R0s0S 0 $0[PP  (X@bDYfBp@-P(p@`@@,XPH0H HH.[Q P Ҩip7H@-T @=P00Ѝ  p  iISb@-B@-M T@=PD0D DD.08 0 p$HIЍэYi@-M T@=PD0D DD.08 0_ p$'IЍ菐Yi0-M $00I P  YЍi@-@0W P$0$ $$d.W@y00@ P/a CRWC/A CR=C/@-00@- M@ 0( 0 p Ѝi @-PM `@@Bq{G 8 8 gЍ$$; ?J 9@-饂@~VPP mpPL``P00 00gt0@`Vm`` PT0d0X @ @@@@g`ae03/`$8xQ%////0 L0L0/ḷ$0 T0T0/ḷ$0 \0\0/ḷ$0 D0D0/ḷ$0 d00d0/ḷ$p@-@p&P [00p00D S 0A0CSO0$P>PG 0@p踷$@-p0' 0`P/ R/긷$0 O-4M@@!2T0.  DP\pďů+ 0$ (`pVD@PT P p1cehT6l PP@ p 00JP`p R  P Q R/6 0TS $ P\(P  1/P ([@0S  P\p "SR(0S`æ\ 2/P W0 [  d'Xɚ;fO-MMPp  X p`%㛦 pP$ 100$0 T-f   ?\p1G t 2\p Q Xe e8 p$0Q e$_ X@T כX00@0 0\Pe@S 0 0忛 ,0@4@[p 0d0Pl0q 0X 40,@[pDg 4<eg0H0S $P31eH0S=I0S:Z`@T 0 3/@: " ڝ렒M0S:00 % p"͝pM0S  je)@ be!@03/@r JLI0J/~[pNI 1R㴥a`"%J` 1 0 d1 T|p 1 d\!1 He`@#%Jr!1 @ t1 x!|1  dP@Tf 03/@ 03/ݍЍ| i~i3;($ii4'BIipR[9epO-@PpP  p )T S@SPT!S`P \PPU D1O0S Td^^GbW &P.Z  P' ;P! K0S 0 L0S 0M0S 0 N0SO0`S PPV d 3 0'< Q%@-,MP@qpP SP`( H p0S h㙤 Hr9P00< <卤0 $,Ѝo'8i(@-P@j0 PkG-@SPP0 ~*`@ Y㔀RWpDW~PP  ޖpp H H@@@1e@2"'s@-@{xS@P00ЍpWPWv~@P <` ޖPeu c':#s@-@QNS@P|0| |*VPVM~@P T` 嵖Pdu( iЍpy"':#A-@"SPP0 )`@VV~PPp jp< >FJN@ "'n@-@ \8PP0P PP)L 0 S@@00 >00ЍvY"' xQ%0@-M@RPRP RPpRP d0P P P P 4PEp UЍ0 yc'7is@-@Uhb {P LbHPH`∕ P! ,bЍpb@Sb\hG-M`@PK ZppP"(    ᓘ Xp% (( px" <@T t8Pbl2P\{b UR TzЍ0 P@,b@PѢ $@Xp 幔Sbt 0R Jbk)b b` `p=btQp R%P\3b amKP;ЍGcQ\ 0Q    1 0PbP0 RSj bb # a0` R P U 0pD` P\\\o8i(i 12!+dg!9\CL-Pp@-P`@PP V  Q`P [`[ 00pPTp[A-@T 00`PpaV0 p `@@-MPP00Ѝ`0 00p0@ 0 P T0P 0 p 0 `P0G-@(P00`( u P1r0Pp*0X!U0"R0 "00"SЍB0P 0 , [p 0 @0@-@P 7[@ 0O-`@pP,(0V0S 8`P$P$P 40S 04S 0S(0p(`8P0S$0(PCbO-M00 X$0700Ѝ 0Q`?  0Q> 00 X6PP; X{pP ,,p(,4@[T /5@P00 D0800X5Tj (OB( R R[^"00aUx 000 wPo0"CQj BQf Qb?5^ Xp8_PPV  Ჰ$pP (S}aXD 0  Bp= 0STz 1PP]0!w8!10#R0 \0k8ZUaP Z@  0YPH@T 0CS 0 0r xC0X0^ :T 0CS wR0xL  @0aD\W@DAD\ 7@Dt@S 2s0@0t@0@Dt@ T130R@aTl p OPY< DY0 0 0`06ho(ZtA-X Pp@`<P00=0P 0 p 0 `P0O-P`$M@ HpgX8 P W0  rPp` 0p0  0pJi8xQ%HA-@0%M0F/S p p<8 6p- 9`@08p`N/8;S^`` Ppx0 p0d[P,00L0TP,00T0(`$0N/\%ݍ萦'Kio @-p  Iip@-d`dP0S s@ PpUQ Rp@@pP@@`$'O-(PZ` 00S<1 000xSP p1 @T Y  }P0 P `GR B^`Z     &P W:h W`%*0@D@PW@DB0LWLt@| @t@@PtX%xX%QA-@P00S 00QQ0s0S Att[p0 000xSX[`PpV[`   @0xX%|tX%Y :p@-P M@ U U( -00P Ѝp 0TPTT@ !!0P!!`ZPP  @ 0A-p`Pp@ @P( ሑ AQop@-@P`M   `ЍpG-SMMPPx!xޛppX!\ p@!H F/o "$@T SލЍ`P 0S0 S 09(00 1 ,0gQpY<@(0#70St0 00#00`X0`M/P41S 80X4M/,[k i'~*Ep@-`M@jp [0+SЍpeP     R #B <Qp <01S 80/S ;  i0 00S/@-@ZO'@A-P@`TpVP @ 0SP xQ%OA-P@p `PW\ T#PH0 000  (p`sxX%:i@- M @pd dޚ X/P00 Ѝ0, 1pƚ9i@-(M @p 嵚 1P00(Ѝ 00S H /P02 , p叚9i@- np 0QSЍS   Z/0\ S $S DDD S/8 S 00,/(/$/PP*PP0p S $S $S LLL S/@ S 884/0/,/(/*O-X`@p1!0R m P A^QT X_PPD@YZX80PE00OG D ;JPY :D@- M @pld .PT0T TT0H 0p@@,: Ѝi Y&ik@-@(M! Z 0P p< <妙4 p壙(Ѝ{i@- M t@.Pq`0` `\ upL 0@ 0lp,| ЍY&i ikA-M< Pp!]0@P "` # 0(0xp0@`@$`<0[PT100 0(000804 1p'@ + !P@0 @   :R@p00CȀ0 0p0 8P 00ݍ@ T0S l @ 0@!P0  S  0i8xX%h0@-0Mx @ pd dm0PP  041p Ԙ0Ѝi&<xQ%6A-@BM`( ` XpP 0 P P PP  K8 G! lCl pz l R厘"Xlm U#0P 6sp 6S30S | X0`P 6ap 6SP@30S <W 0P 6Op 3Q? WI0P 6Ap 2Q8W8  1p 0S0 W8 &pu p p p 0@ TcPpD2Q <WBߍ10S W10S WW0  `0000pWPU0``0` Rڬx1000 0:S R HP8gW`p$PQ ^WV pWP ,W=PWH0S LJW W~EWlLi8iii FU\xX%dht 0@-@P[VSb:O-PMM@ 40L004 T4P4'S$0P0@ 0 0 @PE( 0RtP 0S0'U 0ʘ9 0909 09帰0|90x90t9YV(@!!0 P k0 /C BRZ      -B 9$ B2"! 0P PE ^r PE0x800IppcppCppPpp Spp@BppA`\8 0PP08` V!0(X@"0(0(0S@ U0$ 0B'S$0؍Ѝ 0 0'S   BS>C0C''S Q:ǟ"!! CR   ##9C0C<"!% \'S>C4'>C2"" N=C0C Q 0*S ;S. RU 0C'S񟗥5`6h656`6`6`6`6`6`6`6`6`66`6`6`6`6`6`6`6`6`6`6`6`6`6`6`666 6(60686@6H6P6X6S0@1/1///12S# St 0S R SG %SB 0R  t t0]U0( 0 B( @U0S 0S| `ppIUllllpW>T 0R 07U`00S  .U0S `p000 !U4H3ट娀XP0  @ Up` U0S Z0t$S ZU0S T .HT0S 0T T`p W1qv `pJ, zX3,003c1s0SaT ,, T3pGT#Pt# Pl# hßh Pd# DT<H$#S0S 0T0S:  T5ST0S- Tr䒟h `0V V"    0tTV.nT0S ,hTcT` pX1p 0J,0Y20, `&#Sq ,g, @T1H!P! P|! x Pt! T,TLI  .plhd`\XTPLHD@P4ixiu80ܦ'H' $diSb Œh !5+<PGLQPX\eP*di#+3=BKT[op@-P M@` QP0 aPp@@4 Ѝpi@-< @(P$0$ $ ЍY,&@-< @(P$0$ $ Ѝ*Y8&0@-MP "MjI@PۍЍ0@4 P+  HP@z4ۍЍ0@H0S0S1iS0@-M TPp@@^4Ѝ01 嗓@i@-T @(P@0@ @@I \p 倓ЍWYDA&?@-T @(PM<0< <  >pbЍ肊YN&[ 0 /|$/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0I-@-  eVaV ЍЍ/@-@NVH 0S/@-$'-@-  EVAV ЍЍ/-@-  7V3V ЍЍ/@-\00S 0  0000 0 VUpЍ$'@-@XGH%GGp0H륄pHp@-pMPP2 P0S 0@P 0 0 00 0XUp DlP@@ ((@,P0P4P8PS00!031 0@-Mt 0IT@P \ב lPLPP @ (@@ 06TP 020Ѝ0$E,'12@-tl@0P ,Q ' QwOxQ%0l"ԽP@-d0 !X|!T@0 6p0\ (0000/XmPh0h@-` |!TD0 6p0\ ,00 00/XmP-4s00#q^0<\ 0000/XmP 4qs00#\,s0Q00/00XmPL- 0:# ^4 0Q$0000/XmPL- 09# ^4 0Q$0000/XmP 4 <# \,4Q00/00XmP@- 0:# ^ 0Q0P@d|0:0# TDD#^<s0\ ,00$00Xm.B@- 0 00NP ЍA$A-Pp`@WЍ ⴼP ᮼ3MP@ p7@-P@U0  (⽆]Q Ѝ0#A-0@nS0oSp@ pP``$RP@Q0nS0oSRPPRPP'h@-j0 QPMxQ%O-MM`<(0pC0Dp</8B8b8r4000 M=붽0S  x/0S0S40 l/ <8@80@D0 C  ,BP(0T0(00 ZL ꃎ0 0D@00 l0@p0S SH N 00,00 劋YINEp@-@PP (個0/Spp@@-)f K5IxQ%O-p0000@P`ᜐ (,唰00 iTp0@DTq oP0 P~P<A~9 O4J% h,h,<@-M@A>0 0D@00 l0!@p 0S SH 2N 00,00 HYEp@-@PnP (0/SpYp@U@-  [HxQ%aO-`0@P(,p娐娠娰0 Sp00@DT oP0 I~PP:~  HA+ OꝾh,J%@-MM0An H 0P0 $@?p 唊\Hp@-@PP (冊0/Spp@@-/e J;HxQ%O-P@M P0`r"nSp)20 R. +x   &  x `!p 0 *00)0`Vp?pz .uPfPMP9 9P$ GP g@Ph`____<`|`_`___0``T`UP|0 0|00|0|00|00|00pt`x0 h}P߉Y}~sPyr?p Z,0p0Y00t0V0;;0x0U*\E$00|00|000ЍY00t0h,J%,-MMJNP0 @P300 |0>p0 `啉0 0N/0 4 R000 0@(IHGl7@-@P *0Lo SϜ 0 _ Ѝ0`@-@p?0P@j@-@@0P@@-@ *0S 00S0?  3Ѝrp@-@PᣝP (-0/Spp@@-V@-c40 0,0,0(0(0$00 0'IFxQ%'r7@-P @{*P00S\ 0  Ѝ0Wp@-@ PX0 ㄷ0(pOcPP(؈PFp@I 'O-@H pdH 8媮444f Qp60pGWQq 2@FPffeeeeeeeeeeeee geTg`geeeegee\eeee|jejejHkee4keeeeeeeeg4gHg|geegegeegeegjfjjj@kejk40S = 4 40S 4 0<007aE08:h$0000000D30@90;g)P04P 0I 0(80@008 0{PP0       +  @   ' B ,# R#  # R" , @ ( "  )            z20  xz0$000 Tz0 000 0z0$800  z0<:00 z08:00 z0@900 z0,000 |z000000z0909Rf01r`0$000 0 0tS0,0wL0 0xE00007000+0咬40 E Ѝ$`$h,J%L'D'P'dH'ryd$A-RMMI>0PC@P@(0L AH`q刁( `L0<p0KSh0  R < (Lh0V'D0 ( h0N/@  0夀PP ` p,P.`0TP P T0UF0\ $00X 00@00\0|00x00t0 0p00l00d0=FRݍЍSD't p@-@PP (嘆0/Spp@ R R @-{/0@-@MP`p 0:000 ;PPЍ0P0 0 0;0 :0P `s@-`/P0@00 :P0 *SЍp0/s@-`P@00!  P0d RPPP @@ 0E0Ѝp蠨':(002P0/@-@BMP' 41010 0000000 0P дH< 8lEɴH00BߍBߍ@o꠆BFG-0@`p8Pp3 pϿ| D[0Dv4<40 8p0m,j<0(000pE040p<0< Dp PH00ЍpPPL PG E꠨'LnloN3O-$M@0 4&`Pp0 @T V0Q<00$Ѝ 03/ Z0p @' 0P0:@ 0 `  p00P LH0@3/p)P% 0P 0T@Pp 0  _%P P @0 ` 0  D꠆WC0/A-PMM`p/㪳V P@1L# 4ND0@@ 0@00 0@pسߍPڀ@T ߍA8Hꥆ'G-`[ 0M@@x0PP :0PP`X R 00d 0 P  D 08 0pp00S0 W0S00S0 p pP  iP 00`0SP0uP_uD0D00W 0 000K``0Ѝ 000<0'`S'--0M 00H0 @TP (= zg Ѝ@-^ GDAxQ%O-P@M$  0忲0p 0@"b0"@0@ "Mp20a0CS g@Px@x@x@x@x@xxxx@x@x@x y@xDz0p00@0dp ك! 0 UwP̃Fw P 0S Q |㮃  d㧃Kz \!! 8įP ⿶0S Q   -z '  p l+Ѩ9p t 0[4S08pS @p @Ѝ?B h,h,J%9?`Z_F@-MMCN@800 0@(00 0>8p 8 0 B"B!B(:0P( lB,Z90P , TB0LBލЍ4B(BWcp7@-@P }$0Lo SϜ 0  Ѝ0`@-@80P@j@-@}:0P@@-@ O$0S 00S0?  徂Ѝrp@-@P.P (市0/Sp p@ 0/p/p@-P@S $( $(0XRX0X00\00`0ddhhllppttpp@-@ P   DD@@HHLLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@PՐῐἐpA-0@PJ04S->C᭐->C?Xᜐ9>:>Cᗐ?n:>CFᒐ 0? AC>ቐ}C>GᄐmFတEnF|E~GxX J.X R  $$((,S>,X}S>GSmFOHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqx؏1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,l2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 Pn@-Y@ PU xxU?pp0h`SPP\@Lp0S<D0D,B?  ;?@X'xQ% {*00S/@-<X'0/s@-@00S 00S Ѝp@蠭0001!Ѝp@胒p0P`?.ăPP0)>V ҭB 0$m>"<Ѝp\'h'p'''QR/s@-P00S"0@00S |000 Ѝp@J ?,P0`=V A 0$8>$q<Ѝph'p'\'''wA-Pot10MSP8MRTaO0@OS@ 0 402#0  pt!?P09 ??. U00S.UN@ឪ@Dt 0ݍ8ЍAt0*Jt0 R `\ = V 001t0*nݍ8Ѝh''p''O-C ` dϠ 0@ `ÌxS0 10S  0Ds0S 80  B  R\ ?0!.0S   dϠ 0@ `Ì 01 0$ R$  B ,0X0: 0Pk= p0  ἠ/<#\P2[ 0  ?>#‚ 0Px 0ͧ`0報 C cà00d0 PS C cQ=xQ%O-eM  dϠ 0@ `Ì0 1H50S  0( R 0S[PpЍ P` ` b5BL RW@QWR4PPP. Rl4Xؕp P D "r PD1  2D1# "r P 1 21<0 8 P U Pp000 0$5S ? 00l1>0@D@ @00C030S300C00  0#0030 3#00020SNd 0@ `?5|0 ST0T00  B 0Pe SX00԰V,ڨ0d0? 0 0@ `5?Y 0TϠ!Ϡ<,2  0C! ?;00C000 \aS T10S   dϠ 0@ `Ì0 1+0! 20Z <V40Aer8 0 B0 080$ 0C $ @$  $ 40040 08 R R` /  1> ( 꼭'd'U #xQ%@h$jp@-Pl`0@S     ␡@00Sp0?00Sp0?0ph$d't0p@-0`S[\@ (L00S000000B0E0p謭'h$O-MM┵p,@ p51n_R0`PCSyqD51*10@ ?F 0SB/~F? 0?F4Pp؍ߍ B@DŒ@0L 0@?DKd04 0BP0 0 SE0KSyq4410v0@/0p22220B'oF0f? 0 040hl @@D@ 0L0@?DdK40 0@ `4 0@<0#p R0Cs000 2s000p`20S7w 2袟 0 000p0u  `  ␠Z XZ0 ``a ,& 2\0Q0@/,040<090(08? $0KP `@.  0@őD L 00 /4;020/ 0d0@ 0o} 01r 0`W /p`| 0 /\0X0`0d09{0?{{{{(,0 ` 0@Dő L0 0/4;$0 /}/ 0l dh 0@ `Ì0 1h$\''A$$'d'TO--)MM,0=0?0(8$0y/D0D`0S> 80pW:,0 0  0 7\'p'h'''P@P`P @4Q P@  4GpW/ 3E:p@ d3T@  H=SPp *@ ==P tC(60S0,5 Sx0<0(5002 0,%S0022Q049] 0Q8Uxx" 0 04 0A X8G 040A 88> 0 4Q85 00 Q*8, 00Q(8# 004 Q81 p00W/0G,\3Sr1\soXX\1X0SH8 X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001u8 p4YoP 0d0 a 2! Q$ ''l$p$|'' 7e'`''mT''h$OT't$x''' S,QdS18$Q<4R:t18  @0p\5?>C00#!3x000844$0<0t D0p@po0|00pXsL5P5 P4H   ?ᔢ8@`D ?። p?n`Rt00F,o! L ϧ !>   0%8$4<4R7#22 p84<00x 0 08SoPM @ⴣP@0 ? @P01PP* ?0@PP(5#R0:㕣P@0$- 00Z00 1`%"0 ?001>0Z`0 c2# S,[ Q [3?001> !00   BB`Q0١P`0/2#$ 0  ?ơV`1V`#T0`10F 0I ?໡ B@TP 0ἐ妡됈  00B1  BZ1 ` Y"B !!0 R0C!I0B ?0 `Ⴁ됈 0  B!ZӠ!` S1B0 S 69u @P`x1ע F084<ĔCP`0S84<Ą-0$5BPS,`QɑRB@L0 0 0000x60S|0` ?HL404P@0 @6ጊp;'!,Lp00R  Q@vL7\5?>C00!#4t x0Zp70(1#T a2!, A3 31 0  @P0 04 ` _ 0H$4  E$ ( B, @%LV.  R*h ,(b < 8( X @( \ H( ?.@Xd@+@B@A.@B,-8 He `w @40K `l0 ,p B8d A YZQ !l0 XZ R Ŷ{A/  <pW $?.t{ 4Ą ß Rï80\@$D04 0H4( 0ĀpL2 R 5#< 5023pr0S+Bz됺 z'z'{z {' 000d0 CSQ c6Rc(+S`P5 @ z犸 z'(Ȋ0 (08zl+S,t5 0  R0:1P000\tP2#00@Q@0 0ip00 R00l&$0 q0Sb@ RT5 QP0 뀠@t9 j0JF 0,PK 0`0S>'^F%_'z 'GP%ht@ Q%' T`'U +dT+Dh'\'4'h$Ld'l'8 p' `00S` 0 #$1 k$0+V. Q|00S  b 0=S,0S 0S0$0" , 0 B2\,(^   00/d A! a,3 1 !0V4$1H pp*PP04SP0 0R0 S00C0 S 0,0ᙠ0P0B 0,0STC p开8ȿ 0ᘥ+" < Q \%p#R!0@ (0 0 @DU`@4ARk20 @R40 `0```0T00^(s 0 a` pL3$,X0`0 I9pQ80< 帐 P0x0 0 Sx0x0t B\0X1`01Q0C00h0`0lR#00B1 d0R*4%kU0   (0 0C0L(0( 0 R R` `  0$5S  l01` p0000S3dڟ0%ST0T00! !0<%SP5X0`0`P5S00d0 0a ^   X00ட00080@ N`Q j+H0H (DP+H⣢ wjH000-ᴰR㰱 ,  BU 00kN0000T0 10X0岑0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4400CS ~T00C@ 0`w`d4  80Q~T:  $5SʨG $`$`(0wV0S ,4 t d,04  0,4 $ 00`  Vj^0S   0帀0 X#` x0x 0X\%Ϡ  R     dp 0G g!<n L9\%R Xi0SP.pi\`/ `ƌ$  $ m0`S` 0$5S  l01` 0000S1dᓞ04*ST0T00! !0X*SP5X  ``S 0d먐     0i00080@&0C 400400T%*$ Q`?0@$00$0l0`0@hppT:S $S0ppS $S00S0`@Rsl倐H)sP00@h8p`0x1@pY70IX!@@sl00@0T: @5A$\Q 0@08(0 ޝ (0d0O@ 0NN nC 01kp0SH=0S0 000S.x108C|M = R0/5,\%R    0 d0/ @ `.3,00 $ 10000S0S 0,00C0S0 \>0S p|10S 51>0S 0Wh (100|:x*,8bP>0ScN C>`>0S303040404 0#pCVW*DqV.嚗P\oV.GVJ0S  ?0 PS?\5=S,6??^ E?ᮛ0 0S 04 l dLĒH 0@ `Ì014 ,$0S0S 04 T d ,04 0& 04&)ݍЍSngG-`RM@Xr }qPP X;qP`H `P P7   &p 0S ߍ<08 H(00,0 000040!04 04$0D0(0P *WZ  &pT h&p* \pXC ` 8 ᘟ 4 (H D @ < 0,060 2 u m&p 0`?`a8S1lPb 0  0**0P0g   0* ꄛd@edAzd@!oFě֛A-PMPp`;@ jp@P  P06P$U 0 2 "0 ݍp@-@PP (op0/Spp@R/G-P `$ 0pj@V` 0c@`` V`@&!D( `G-@P4S `ўpY00qzuPt t 0 0! ##P @?Ѝ_ uP :^F: F^p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@O-4MX0p0\00``P嚞0 0,, 0S% P 0 omS;aSMSASB0C0b0C S SSU0@0 0DT dS$ 09R \"P T 0U8$UQUDT P 0 sS @ @ @U00@@@ X 00 l P:o0S00 0 000 00P4Ѝ>n@-I,@ (=/,xQ%d 40@- @    O-@0p ៝Pp`G0 00000ZI00SB_: W `B?F ᴐ 'l'P0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p '0P  C @- n co`/s@-PL@` 008-V @ nЍp' 's@-PX00S@H0`ă5#040<-V @ bnЍp'' '4\10 PS/C-HQ@@MPM`6`@fa љ1p P06 0 T:@6S-O@ b DD6ۍЍC+ 0 Q 0ˍ14 ^ 3?\ P;0Tᘙ 0+ۍЍ' ''''G-lB` p,PPH"Hm 0F0( 40 06# R 0 !m0 :0C 0 !m0006&0A06 0  B 00C0( 6V0:`8!D`Vp 0ỗ$&0? ೗0(0 6 C c0 0 &$&?᜗0`L0V&S %g0: S((0` n0d  &ЍGW. R0 'P Tx$A-Ta00S FT:p+PP  0 0A1S0S%. P @D A01 S  m0S @2106&0-06   B ! ! 00C 00 'U O-@PGM@X"? R`$\l h2 XSQ 0@H0$~  0 R (cR 5-0$00ᐩ (00UC (0 , P(0,   @R 0 0ڗ $֗0Fϗ0༟0 0 60 6< 0(,(@2200UD ,0 00 Pg@ X% 0$|儌0@d0c<@LP!r! 0T00<0Lh53+L0S0c, h*$<PU CP W  E0L VR0400 & \`#  @ \ 110B0F0DY0$APpepeC0CP!P`\` :@M*P0  `pM 0 0d00,0\0000<402802$0 0Cs0<000C(00SE,Z`j p0S04#*&D:C7@ @< +) 0 ( "** 6 !0H 0 09~PpD IH&0SIp9 R050Dk0S ,0S fPI@ 00S40  (0Sm0C$0pXp<01 0`@Y80R\(0 x0S6 0Sڐ0S00 0  C02#`(0#*L8LP pp PPXP 0R SHR SPk`@pb Spv0 0Y 0:Y:V3006弗  04(01 0K0 JET  060 D7&05$(6Y:0TSL0S d0 P VX60S_pW}@0S H崈5L R d0 P# 0PDT%_oRU+XED&0#>H6 C 0 ᓔ)6  5Օ0 씟 ݘ6U0CT 00C0CSX: BȘp5Y1 21[0!!!0 Sq`$ ᓢ"!ck 0d0$&S: 060& 0h0.C)xG{ 0W4#000848 0v)pXl0SMf`F`VI 30SA e)W )3PU CL0S \0:`0 7` PP1 P# zYp376|0X0000096 30JPp`D()i `` (p` z*27\X0000f &! 02/!"6 QP *dh"P P 0 |0PPP$"u v'`Pw!k 'P  6!b!PU:< U*!:0U:#*0 *0 xp*L0S\^U@!%8%E*0QQ:BS! ౗0  6Ps '''#'N{$$ 'H'$QSNt''''_':\ QGP%ht@ Q%+d+DA4.dl $$A${ &l' ''d  0P0 Sp %p%* 向  0p1Pm 0 !GP `U&`060U/0 x x#L0S `0  P1#'$/%\17JlgX0|000090& 2|0P  :0 `p 2& 0x@0Df?o2U+Du&0#6` c|2H峓 H0 HDGߍWAG-`RM@Xr AhPP XgP`H `P P7   p 0S ߍ<08 H(00,0 000040!04 04$0D0(0P x!WZ  pT hp* \gX` 8 \ 4 (     0,00  9 1p 0`?`a8SbPb 0  0**0P0E^ Ќ 0* ꄛd@edAzd@!oFě֛A-PMPp`;@ ap@P  P06PU 0 2 "0 ݍ@-`p&  b@P00S0?0\$ 0S 0 gS\F\GL \ lL|\|0gL|0 SDKT ЍE%KUJ%FZO%A_0 MX@-AP L'DDXP<@i/0p  @\0@ SL00♊  cP w 0 @勊a]PP#h#qp  fP 4[H0aS 1L\ : SRQt9   '@P@0j V@r@DOoB@b } P pY00S  PL G pP 3m`PUb@0D 0 t0 0$!@0D QP  D0(@ ]80S}0x S10S10S00S11011|0 0180SK0 RS00 R0 R0S= /姤P; 0@S 00 T^Y0Si 1Sf 1Sc 0 収1C0S [  [ *0SR3#:\00<0S @!0S P@ T <0 0P U8 PDJp8_P@@11 1 1e0009Y0`S`Sx0S4\0L 0H?0 0Jp+ p`PpC0S)2p3 p1S?V?`#)&p' a1Sl)p Q1SAf1S Y #p$ m 2"OKK@0DP?`|KL0OK\0K@L0 0Z0T0Q0S<K[# [ [ |A [l0S d/80S l0Sd0h 000@0D0 %h0S  d0S  T*,800S0 [0S0S"  0C0T }0#Stw0S0`0S S 8g,0S , 0C,00`00l0S1|0 0S010S 1h0S(1d0S,140S /40P(0&D"=0P(0 (Xpp(f0P!* Rb R V000S(dR0(0S00[X1`$00PV`5U0000Ac00Y ,`'HX뀵U pO $0 pSf:Yf D00>p` uU ?4$0`SM:(!@R&0S ,1 S&40(00p000 [ 0R5 R4*P (!RP5P"S4U  R,1SPP,Q,1p SR U ~DSRQ SP" 01S<1 ֍P3P%P5 1CP0ʍY [  0D࿍0P000pP1+!`GT0b#02b#b&$0X $0S [ & Y$: [ᙍ00"P!,"T0 S :0㈀$0[免00,"P!00"P!? 00Y`T00 !000 30q W5j:0+a& G$  +! 0  ܋ [\Q [PQRU10A+!0 FY0 0@c&0 t0 0 +!ᾋ$0@G010S1!YV*8Uhl SbixX%*"/C/ ;Pv/S#,/?RjUJ$,5=S\m)[t${4dxQ%l(gfffp URRaArrAa [0 [00S$0, S00R 0, t  [0 [00 cU*3!A$$1QR0X@ 101S0S0010 [0]S 03 $!q515 000$ T0 P0S | 1S,0 u 1\0p  C?0X0 g >0!0E?0040\ 1SL0 PU X$! dO hM Dr(tbtRQE C ,Q>  H0S yލ ЍS03150q5 [ 1 1S|0_ ?H0#2s`PP `H ?C#X 0 T02#H0$ [00H <080$4s0`0P0#4s0d0,0#4s0h0@0$0Q l #   Xt  0|04Q0X080 S ,40S d8 ͋80 0d 0hQ 0p$040S& [",q4 0W0W03 W00S pZ$pps 0S  pVp T  ( ) p ᧎Z [,1< C/oS" R `0 [ 0$0 @ 000000P00d00,00h00\0001010100L0 0  1$00(0$1,0J?03K?03)001x 01100 0$<2?@1c4 04v 08#$0 #(#<l 0 0&t ?Q X0Q40S00|00o0 00 R  ST (Xk0'?   pT TS `(!R R S 0 S7071011H0T RZ*JQ\0 [0 0+ S  R   0S* 0H0< 0J?oR20S R(0 00 25 010 0P B24 0180S   k B*{@- S-=c A 8 / eA@00@- 44@4P\P 0B"" p(-@=B'(0/p/@-9 xQ%G-`@ P po!>0P U0 0  P@ G'0P\0$+ 0L^ R 0^ U   p(h,s@-pP@ 0  c5X 0TTLЍp P `S50 p(Sb(@-03S    ЍRb@-@p$M0 0S ` P1 00P 0! 0))1 l 5\5L@DpQUVPE:$Ѝ#>J\(:0@-4M@ 0P0S ,Q 0  R0  7  0$4Ѝ0@xR  (  0$R 0S 0S 0  ( 4Ѝ0@J4Ѝ0p(c @-p]똹(D@-0 L@ R0* 0s# p(P `00CS`0p S00 P0S X0X /XP%p@-`g@P8!R#<10 <10 .810CS81V <1S 0 <1l0 h{d{`0@Pp <10C <1$0 810S81p($ Q%xQ%(0@--@4MT A`dhQ `"R d2RK id2SA |= hk0:{PPS['ΞkHk>[E{781 < =f * + (+S  PPP 0 @@@ zj{ k{[+S[f4Ѝ00B:k{{'*k{d+SX?@@-C6?Y@й(p(  1 B $x (( e p@-j0d2Slp(@0@-0S0@d2S`2"R2$p(@-@ 081\00?0 0<fP 0 0p0  0 pPph0<024 0 b P.X1 8?@c'D HpWppᾓ\0  a`0 0 (Vp t W?0z 2 `"R009:  tŸ `";+n0` D' ~{ Z@ {:+ ?+; 0 / 0 Ѝ0 gH\ ;Z [$0 ({刑 p0+0  R0+0 0+ 8l Jz@ k{{ !`P P\ ;+0 0{{; +$ 0 ( ;x+Q0;`0 0+;𿚙p(T(  # @(Mbl(? xQ%$((((F ɚ;6eĀ((C-@ PpP`4M  00S  0S* 0S$ 0 \0!2RL00% 0y_ P4Ѝp(@(` G-P-`@p@(a 0!0 fT |b t_ 0l  {{(+SLS 0@$@G G(@@p(s    xQ%40@- ,0R(@@_50 jT)|IIxQ%@-Q5@TP P D 8 , KxQ%IMp@-0@ R R 0 RS000p\RP 0SP0PP'R"R `0S SkP0xQ%@-@ P l00S\ 0@ !0R3 @00SP P990t)))p@-P0@000`w?0@@ Q-00B 0$10S !0 0C!0R3^0 P 0 0 0*00 R! ! ! !   ,!   ! R  C=00pPP 0#0%0P/0@0xX%)t))xQ%A-@P`pg P0 SR 0S0B0Q3 00@ 0  &m)t)) )P 00CS0 S00 P0S 0 /P%A-P@pᣅP  p呅Pdṃ`ᶃ`V :<<(0/S 0 R0S /Q C0p R@ `/RR FR .R@` FRPP @D T0t/S`0 /R/\؁xQ%0D0O-cMM00@00<+0< 0<0<00} =P 0S~0,3,00,30S3S03PXl\O P|P H w G00 3 S @@ 0T S S00 0K#=PC@P0S+K K_30S3/S9+K &K @0 K@PH[K>D 0t,  t  t  0S (8xS`S)?S DS . x000Kz*P0C K+ C (K0C+ }00CS00Ka0CSp'h&(|((h&h&D)h&h&h&*h&h&h&L//h&00h&h&/d0/ ⃂  OPK 0@P* 0@0 9 90Sx9 00K  K A ] 8 )PK 0 Q PK. K W @  PpK P 0K. 80  & p @PV P80S 7    ڃP>8(<08808407007,07(07$07 0707070707 07070707 ށ  ⪃PK PP ,70St'0 0C!0R3z T70S0Ss K - @P PQKh >ⱁPK ⭁t0@PpS K> 0 p塁t`@@hP0V#T00  HT\HX0Qt0pW p`R000QSL00D0Q㸂DD0@M0 `X\0X0S 0PV)PP PP| K 0P@0 K. K>x%x 0 " `@씟D@pP @ VG|  0S$0 0C!0R3 0S0S 0`0P `0P c=0,C 0  R+ .t  n0  d0d0`@ 4qLR p 1  1 S 01 \Q \HHB/p@!bK L0 S1P00P0P D0S( X3 R  h  X   `ҾH0 S   \0T0 S 2`,@0SJ @DUY<  ⌀  XP0S|& x 1 z ` FPcݍЍ m4  g  3PPA0S, |P  S  P F  Pv : x PPj@d0SXTO000+ +{OTSX!x|S$0) ))T)xQ%ZwGces)<$36+<5?t)#7\xMqy))gfff*^$؁D=L!YZd_|*fn*bt@-<00iS03S !):FP=x) )l0@-h@   L @0 0  8) "9)@-`0@Px0 B0PU1 S2P T0p0S @0R<< 0,$pF Ѝ8$))+6 Q%0C-PD1`0B8! Y!R!tM@p  10S " tЍ000iS00S 00S d `P W @ 0  P !  P000 p 0p_ W@0008$)t): Q%x))<$O`0@-@X0 B0@T1 S2@ 0P   0S 8$)O-tQ0S hhM @P 0S <@+b T0 P<%mP0? 4 c00?\)T)F$0@-@0 0u0@0Ѝs@-@P`P @TZ TT2?0 00?fu+"+R  + IЍp7 xQ%$0L<S/ @-lPT)F$@-<9p @,PE0@0F$ O- 2@`pVCMz Qp@0DWCߍ`TV B/ j~ 0R ?s0 0 z U@`1P0 S8Q 0S?(h X:0000[4*0S 0 0S 0 000R*Q 0S |[`WQ0/3?0 S 00000S  `l)() Q%[ o  ))O-X3p0]MS DD廷@c@C 800#0j00RS #0_Lp"& 9RPP "#OQW 0"C00RS[ 0"8xeLph"lL9PP"L  Pp^DDB@@r0PSY : SVH`P؀/0 x10L<aS$ 8 <8  @ ( D `  P  `\  T  ؂X  HkP ,? 8!88hM/0>+b  P<kP P <\0?0H @P 9PPD y} L P 9P3P|]ߍ) Q% )`)x) F$ T)!0!F$>! x| )S!\)s!hDHH)!xQ%F$!@-$@0 00: S)G-@ q `0S+P 00S 嫶P0 S00P R HRڄ00S t; Y `DzP 0 Y00:$00S $")t)xQ%!!x|!O-AMM`P@mpP8 0 840 AލЍO/0 009/P7 0p!p   )x`Q D D @P <yPD z@P@      yPD b@D z`Ġ崰TAލЍ0A. 4B   R ; 0 0  D E@D ]`0 e 0 D ]^T)؁I"xQ%!"Dr"A-MM00 /R @`㨀pPP 0S P@ۍЍ0 D ,w`D @P 0V dyP`x|T)p@-0@ @P ?P @ p@-@@O-3tM0 S pp吵l00RS\3 P3P#0L; HC4#S<88tЍOw, 1 $PL  {   + p0@`00آزL<`  L\0@ LWI < h`VV#W  _ @Pp L<0@'pk0PxSiSbP 0'0@$ 000 Y L<0@ U  `I`T|L 7tЍ0 0C0\10S 0`S$0` S\"X"h0SS   U18R10S d00X00%90P!Td0 <b d) Q%"x))`)0!F$F$"xQ%"BT)"#|))#5#V#h#y##)RA###A-MpM`@PP 0ppd!dZ@P TT& LMjz#< 0 ۍЍ aD D< pPUMK U`k 'p0P z x  0S p T0TP 8 z8 [E#^xQ%2T)|))"$M$w)@-$P@-L@4#S 0  60#S 0 @,F$0A-@P` 0 P0: 0tpp ?u0@$aH00S$``P P hw   y1RQ rQS $0!SP P0hѰ%0 P X1 D1H1D10S0"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t R" ) Q%&))&؁"xQ%&&&'M$<'x))^'x'))d)'@-@MQ 0 3/00؍/$+\%$#ꖝꅝ0@-P )'xQ%0@-Q 0@T0 R ||80AS@ ЍH0 DsPv ( @$) )xQ%'H$m (p/0/@-x 0 RS T0R H0P88Ѝ Q  )I)(xQ%A-D@p 0 0SP(r ` `Z ` )@(L0@-  Q0 0P ,0m Ѝ ))Z(xQ%@-0xP 00S@%*S` (P@` 40P , $  0CЍp ))(xQ%(0@-0@S 0$P B5/x00SP`P `lqpH0P@`u  0((@ Ѝp) )|))(xQ%p@-hPh@4S 0SP LLqH0H P0000$R0p4+ ))).)>)))0s@-0@SP  40B3/p00S\0 pH0P`@u  0((`mЍpp) )|))M)xQ%p@-P,@P@pP @l p@-X0XP0SpH`@P lP  >@ph)H$ )xQ%)A-P 1 a051q0S :pc@P 00PP'zrPyP1u_  0XltkP#uQ T 0HJ000@A(h) ))d)P%dB)E)C-paM! LQ\ X+ 0 00@! ?Q 0A0 08 !Q 讟 0"Q/ X. , !Q  0 00`  Q 8#`Rp000F"t Fd900@ LEЍH)) Q%)))))xQ%)#))))**<*O-鼣@0EMSP8a  0 @ሳ00T*0 ?o2Q03S P30S D3 T@#@ $0S _Eߍ0S 00p0"0S 0"p! 0|V- V V:   B B B 0 0]l"p0S0S P 0mqP 0- 8gqPZ 0SF 妭B  B B B 0 0.!  B B B 0 0 !V! V V     \!+x))xQ%0[++++_++7,)O,!,9u,,,yRH$,h)t), Q%-'-))c-|--))J--O-C匃5)S+0`V3pRXie0S, u 0PS, 9RP=0S X U)5=0+5 %+ `V909909 Ѝ02 ?oW20SPR0P `FVpZZ4 P0P5 +"+REUYQ! R  E5U91 R, R" R# 10S&LP"CT10S 8`0S6P!90\,P $y t  p0S  P6qd ^0t0 ?gqp;#;S <%5=+XUH )h)t) Q%-H$).xQ%+.)B.).)Y.r...)p@-7@0MS&6PP dP P ۍpV0S60S e00PP 60Sf FC@ = :741+h]PhP0#04 488<<HHLLoPlPiPxx||QP9^EMPEJP:^EFPET0AS c Pn 4PD Pg|T0Sp40S ddЩ00 40((,,TTXX\\``+o0 # #1 0002#22 02 0 (0#(0/,0, H0T0/X0X0\ `0/`0d 0,df20n000%60"|2-02R0L "S " 0x30=00 2R 00# |# #X0/80\ /`0d 0 %0L0<040h00S!#3 |t ~h1S 0SP! Da! AQhL\ 9-0CS  O R0 R R 0N\ \0|Tt0=0- 9!ml)lT )) Q%.kt).ye/xQ%'/H$\?/X/o////C- 2 B P000000 MQaM0S q쑟=聟0=P  RP 0AS^xp8Td=0p、0W\hq P  RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ0=ۍЍt0 h0P0`0\0S H,@>)))T )H))k)S0xQ%)//00:0O-AM0J(0 "S $[+p0(C0AУ͡ 5/0(0#R00 #0Q0h2P00 (0S $7(C#5/0(0,0S3,0P0?0!#0,0@ #P Aۍ<ЍP(0S  +p0(C0AУ͡5/0(0+p0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  B0S 8#R00SR 00S \0l 9P tlx3  P8P0S)T0 )k)H$w0)0t)0 Q%0 0 )h@-@0SS)0O-wM< 00 0 80 4 @؂  P  0 @0 0H0@0LP0D`)PP:P S  S  S;  S 0 ``jp SK  S"  S<60S  ,,Z(60S 6v0S -yPmG 050S  9Ѝ50S P 0 L50S  << 0,000%p,,[0S40S  40S | P 0 0 8"" ZZV0 00`40S 0 H F30S  30S30S 9 ?Pl 0> ;;V 0 0 8r"o"P30S` P [L 0 &0#p0 0020S  t20S620S P6ld 0 V 0 0 8%"""20S 0 $m"p0 00m 10S 403/ !PdV00 0IX10S00S 0 0 8|00S 0 44\  03/`V 4   00` `)1xQ%)W1 Q%)|) )2*1<$=1hpjjh1<))~*11d<h111p)@)km=2A-1( 0  S !@ 1 1R 4S8 !4|q04@0t\a00S/ P0S  R+* RS-MP- !0 010000 QP 0PT 0$M P ЍPB*0P;C0P|80S050 0040 0 @ 00 0))T0 )*2)W2w0<2@-|cM0S ll|hChS0S Y]Pj0#0,, R03 2r  0500K Pr5"0C590C990C9000Ph|n x30S \2d"`2Q090 9  ЍO8@p/00bP1@p!P PP0 00 EEP @ PWI E2P WL0S f@p5a@p 1)$P<=9p@-P(@P "^Pp@l$0S $  R R@0@- 1@H*@- (0 0 0 0 0WЍ[@=9@E@P P PDz@g@p@)a@@-(M0@ #\S@3@#:@ .(Ѝ , @7@-P|  @P .:NPP @]PQO,V Ѝ0H*H*0@-QPM @4OT 5_0d@Oo@! "U  R P Q T%< @w5_U@,VЍ0%(Tr h \b%Tq @ 0Wu  @M@H*@@@ Q@-.@h0 \!@@QR  0H*, H*0s@- @R`  P.MP ,8V0S ,1V|Ѝp l0!PU U 0< 4Ѝp@'Ѝp@ $H*H*@@-@T T 0( ( ЍЍ@2Ѝ@@H*"!Q p@-@P T p@<  p@0 p@ SbEO-@"PTMA@ p` @@0@$(@P PTЍPPT0 @@0Pt@݇lT:TЍO,0 EW y R@x   ;y0P gyR  ,\100 0 S00C00  Q,4P `0 m0 0`g S` `X`00CS`0 X0@X0 X N;@@ $d@P%@-00C Ѝ@-0  ; ЍO-@p P4 aTAD -QP  P PPP@D`FRPP00SP Ѝ@@-@0 0 0 Ѝ@?@-I  U@xQ%@-.A@-QAM`@0Vp M0d7 aXQX!0TLP0P 0 0 ,Aލ ЍP0001!! q?t0: h!R  0G$L@PYg2 c2Y<T0 <%<@D@ \0D0X A@ DD8*IAWA]ABAvAAT *JAA B@-T *0@-6S 8*)B@-hYeYbYx_Ym/l`4@P" X T:  <4*Y, @1)B$6BH*/T*@-  >DxQ%0@-h@  0@ 0\0CS @CxX%00S/p@-8P@U``p840#U:0X 00rX0X40P80 v0X0p`P -7@- 0@P00P R*0 B Ѝ0@Ѝ/O-PdMpP ]@蠟谟 T0D 0 S dЍ` | J ]  ^`q!0 g0 `00$C0  .0`  V0B⿅P \:xX%DDC-@`Pp㬀嬐@"!0# U 0 ␅pp p. ↅP@T0S0gP    Ѝ*0D DD-,M 808"40!00!,0 (0 $0$ED.E7EAEKEDxQ%-7@-`P @XT@ R 0@  000 Ѝ0@Ѝ/0$^ *lEp@-PP@ \0S 0CS 23 0 0p\p@ hh 0 00SpP 0 0pn\ Up * *uE06A- `(p 0pЍ P \-@P  PP 0pЍA7t01Sh0 ` 0X2TpT 0` 0S ` FP `E *0$\E9A-Q@1(pS1S` W 1SQU(W1S WЍWx1x QU HЍA <1ЍAIW(zQU0S) S S RU   b RU  QWЍAK   R U P> DD9 ЍA *0$\ Q%^)[)EE ;G4 0Q 000/  *0$EA-|AJM1MShE=`p,I0 `P[ c40`0 qDp0S JލЍ;X P0ZA7J.H0 0A1$HpL  $`0P0p0 Pp([V Li0S8b1!0  *E!F>F06G-xAp1 `S1SP V1S \$V1S VG 1HV 0 \ ?GVy\\0  嘠EPe0SVGxd1S ^Q 1S V 0Q G  * Q%0$\^:WF|A-a0 MSP@*000 0 00P    RQ  \ЍS @0  0P@* FFA-HAaVpP! 0 0A>\ SQR$SQ SA 0FS 0 |1S 5A{SpnRU@E@PPVT <_A Y` *F Q%0$\^:G0@-P@0$M00PP0 p$Ѝ0 R  h)d0 0 1S0%0 000 0G *^/GO-pq 0M08@ D @CT Ѝ0VЍO^R`" 1!0  @@0p Y PP  @@ 0 p R 8Z ttx00CSp````4g(  * *kGGGGH0@-P@0,M 08PP 0 pf,Ѝ0 P  )!! 0Q P0P,4 08~Q(y tG *0$Jb4Hp@-`@0M 0(`` 0 >p"Ѝp R  (|P10 01SL0 DA1S*'EP @!4G *0$\AHO-DMhZ2 0S 0 000 (\P (P(0U%`(` P@PDЍ`(Ppv (   pp$0 $PpDЍOS(P 0u$  (0CS-  R(SP`p㨡娱唑( r00R0S W 0G0 0,l,`1!0< 0( (0(Ps p( V (U((0$ 00 0 00 0 000  00 0$P 0 0$ 1SD"!!!! { *IHGh$^QHC-M⬀p`` (MW0P0 0000 [PPQ ЍP[@P PP  PP 0#pЍC 0R  ,'0W400(00 P(t 0SQP o0 Pp0!00(YP0Sxpx1Sd0`DS PpP 0PS IHG *h$^H90@-P@0,M08PP0 p,Ѝ0 R  3'0 01SL zZ{e[jKZfke[KK{K+SG *^HO-bp0MSP@M ET S tP4"4&J@ U X:0@8 0 Pp2o3ٍЍU p U "R x& X R TX PR*1 21 0T 1S1!T0 0*T 1!0 0*topP0 < eq _@P 0 < T` *P SbhHHO-{JM M`@PP3 ,XJ>tPpp0pS  ,8 @>,0( <>pp , 4>, 0>칟p  , (>, $>뼹|  , >, >댹|  ,x >,h >\{  ,H >,T8 >,{  , =,( =z  ,=,≠z  ,=,=뜸y  ,=,x=ly ,X=,xH=<xW 0 X(, =,= '(HQ ( X7$R Z 0XS XQ;X PD0S4EH0 1HpL00 1`00pD0 pIpL0X 10@sXp&4 0#Q0KX00CsGX`0]|XP` pWI-$T 7H6P&8<z46/601X00 d4\t갠Z 0 R(0 R npP J1SpZX0@s]|X 4 0 0 0 0P3A7/(%00D0 Jލ ЍX@  RH 1 H0 pH0S# 0 0 @3S H  ^98pW%$RZ 0 00@0P0@3A4/HpX񟗶 $ 0 0 @3SL1 04S) 403001P  0p 0040 [*&#Y S0 S P40So0 00   $ $  0`p`08哫*0S P   B ( P R0X0,( 0P$0 ,( I$0H0pp Kp0p=  H0pp ;p0p,;㨀H0 H0+ppR0 Sp HKpP  H0pW 0 0H0{pH0pp Hp0pH @P0P p ppH0p 0H T *p$؁h$\ *^HIIh*I!I*I2I IP00 S5VP0 xxp0 `Xp*qSOSbtS~StSSґSS|STgTSSxQ%?TO-pMM`;p.p P@@ p ]p p0Wp㼱0Z:}0S ލЍ0 0W@P\ 9@PLqLL?HHP  1pZV㟉 1Z SP Z.pZP Z.20Sa00 0Zo0V9 Z-P \Z.@)0T:Z^P Z. |d\edAiT*dyTT@-0`0 0%PPP 0@PT PP Ѝp@0(PP DЍpx +dO--tM< 8@40PPxstЍBq0P(0  (pPU  .T T T;P0t4tT$0 FT6P0X4XT$01P0H4HT$00SZPT(4TP$004 0S0R0S00 0 0 (0@` 0 0@TF*3#03  0303P0T0@؋P(0@`,@pW6*40S 0dS0ktDᅄ p 0`pu  ;Xpl X `(>m0P02R$0E 0BnS01 0<0S 08 S@ ?@0?D000S, 竸0相S0P ?DE T0 4 JP 0L 4E?L 0H,E {{'0{H 0,0 0,0@0P00D0@ Bn| 001 00X%p` d?4 $;`p J? !4 ;$hp X0 0T0R {{'0{0h `Pʟ 0DP 0D $0p7T Y@U12UUUUU?VVHV%VqV QV\VuVVVVV0SQ0勤d4 00kS& Lp0p$Xp p$;`p} 0@U 04p$;hpp h0` XPɏ 0nD p0hD$0@U00`  0\D$000$ T,0S0gd0kSㅤ8 q 0pXXp2 4``p$;Mp' 0U 04h$; p?p  4 A0 A{ {'{X0@0 T0    A A{ {'0PUPp Ǐ 0{C 0C 0 CT0 Y@$W*WDW@-v aWxQ%A-@`4Sp  P]T0DPEE$UX EP00EP 0-80 | P $3MDPE@D* Sbp@-P@Q0  0 pEP @0S \;$Pp H>0@ 0< 0p R$)$$hA*W*Wt*p*l*W@-3400S (0 0 ppV A*hA*A*O-\M0 MS1 HpW-Q`@`((Q(0 -T7+ 0B=P 0 0 ۍ Ѝ0 000nS ?S aS ppS qS x0  0 d00L0K0 8A*A*WhA*P%W\*WtX% X,XDXA-X`0S L00S 08P8@p0Pp00\*A*A*A*@-@L0@3@00S2',0, 0S00*'!A*lA*A***C-RP`tM  ,,E P RQ ğE R`S B0t`FQ ğR   TDR 7 4* CR ` 0S $ LF ,4\ P20@04ßQ [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+<`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ000,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊxX%tX%****hA*YPA-@@P@T -@ P`p0Sl d0 +@ P ,0< 8!(0@A$+dhA*\*t*$YA-@P@pP0`S00|0 R d R 0L 0S @!P@`T !l*A* F*$FY*WWP@-- 0 D*bYP@-- 0 8*YP@-u- 0 ,*iYP@- i- 0 0 *hA**oYP@- W- 0 0 *hA*(*YP@- E- 0 0 *hA*L*YP0p@-AM 00@0 0@S(- P1 PS" 0S00!C:P 0S0O>PP 0T00aS0` 00S0``0 C:PaS` 0` 0R`0 0@0S0@T@ @0 Q000S0C'Aލp*YY*YYY**G-1MMP, 84 1ݍЍP0$Cd:P @4@h0 jPZ30S Scs 5@PQ R0 3@cs0S0S PU~\30S5 0P/ P30 043 0 $3$ 3Q0RQ300?o2&Q20S  2 0[P0002@0 0R R00 R ?P 02D"000 H 2 2QT100?o2& Qy10Su 1@P0001@h, C 0PQ0S0T玞X,PU Q 0S 0S0 0P+ 0! 0 00} 00QQ000?o23&Q|00S  d0 0P000<0P*Y\*H# *lA*A**A***YYA*A** ZPC-p0JM M 00@0 0@S+ 1 @Jލ ЍS2 0S! ,9P 0S0<PP T0  t1t p1 R0 0S0QY`% 41 0S (1(|! 8PY#P0͡ _C0S #@$00 R   R 0 'l00Q$5qp P0ST00@1*Y****hA*'ZY*$kWZ 0 0 0 0[*\ZIE 0 0 0 0P*\ZC-KM MP* |2 Kލ ЍP0`"C8P @@2@<2000,)@P 2 0S@ 2 e|v. xP0 aQq0S 0S 00 3@P X.d1@0S t5PL1 `0P <100~-4 0 RU AZhA*bA*b A-PP   R ЍAP  R  =@0S00Ѝ@`p*0$hA*b0A-p`P0 AP@PLp @AP 00 00*hA*bcp@-X@PP D0 p<00Sp@,0,Mo0 0PpA***hA*cBcp@-0@p@SP \0 pT00Sp@D0D-o0P0,PpA***hA*Gctcycp@- @x@RPk d0 p\ Rp@L0Lo P0 ,iPp dA***hA*cccO-MMPQ ? 3 ٍЍP0 #C*P S@p3`X 3 |q r2PP@)L+0`t' P00S 0P @B0S0y00zp@I2n2@0SP$S \S0P0" 0   0  P#"00B   BR 0 D )bR+0 F0@0SPiR0PS 0 D)b>+020@P1Mn d1 0S x10SL1h`10S ,06n00CS0. Z +0 03/00S 0S 000CS0 S0  )t*00000i0 %X 0`S8 *ad[*XG*hA*e*xX%A*a_v_A*_A*A*A*@-@P U00P O00PI00 -d0lM T00S D 0dt P,00ppcA*A*)ehA**-lMP00S @ 0dU P(00ppD A*CehA**A-@c/P` p0 0Cs0SQ3  >PP 0 B RQP  00 0Cs0SP3 p@-`P@:!P  - 0S1PS !x,p@l,*`(P %v!P00 0,S!0R]ei.fep@-@P 00PU . =3Pp00p@-`Pp@0P<0 .0Sp 0h R00ݍ Ѝ0 0S0C Br RQ"  (F*qeP/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  BrxX%G-`P(P @ >P   >PU0 00 P0 10S / Pe 3*P@ P 0pS 02P p$*:P P p*P : PQ p000 SP0S 00S1 @RđU0 p* `=P0 0 U ))) 0 011  2Ѝ @p) P( 0S000)0S 0PS S St0 0S 0`S@)H0pW ),peeeF*eeeA*y|A* - BR0 R  P R O-0@!M M P<@8@4@@0D@@@'=Pm4` 0p 0S 0S 40S 0S H兌@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /CTpKX`V L(5PUp@ @l0S ;B@P d8P T3P D.P8; (6000@0(@P4uP 4@P@(4:4jP 00(<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU PPP @ @ PpW pPp3 Q  `3  +' =0 080( S, $#(0 00 0$)0"0 0R S"  c`pPR  0i(P0 Z , g0%T00S9 llX% 0S1  + g'=0 00 (00$@0S0S20}Skj. @/P00Y@VN 0SK U +H/'+ H"+HH` +@!'=0 00P$` Q(0 A `00+S '=0  0`0@@DcT@@0P/AP0,00(S  \e@peiex|A*ffffKfF*kfA*A**rf6**xQ%foZA*A*lZmdA*O-iM Mh8dLlOpt͍40,xHD@|0 0PL0.600K/p% ,Ai'@0f'4QDb'8aO?ⰐV=HLa少'TU01p 0S `oPP {d0sh0sl0sp0s0St0s t^U 0S V|V?0S '?0S0 /@P' 'P?0S 00SV4  0 _ 0 .=0S ~XP' Vi<, k)0S ~OP)cP$.`>`N0 0 @)00 %QT /=0S-p= 0S00?'"0 40#.0S ?0.T0.͡@!͡!..R0l0"R0.͡0 #PP#PP0S0S80S#PP 埛Bp(L000.R0@D0$.0 pww0PppP0 PXpX \)\P #P U p WpW90S |90S9xyP $0S @DT90S pYF1!0S   PZ0S= S E#@: @:` T00R0SE tPsJ   $P  &P Ud f:0Sf: P a** ϠP 0 ; T# D;R.sr ZOἯ.!0Q3/Pp;@張 6; R0 ;Q;E+0 0 S dh l|px"0S,t< 0R.Kt r1/0S ź000S 徺000S 巺000S 尺00|iލ Ѝ0S 03/0S 垺00s@- P@3P  3P0P %Ѝp|`P  }3P 0 FUprP Ѝp@3 0S S0S  _30PPeeeemc0@-Mh 00P P10S 0S00 0 Ѝ qQa @T0 S 00S 0s 0 :P 0 S000Bp@ T dD%P 0|S 00 0S00 0000TF*A* L *F*A*d@-`$MpP M0000000@8#0P/S:S y@P@tQVȹP Ĺ$ЍU#Pẹ@    0/08PP":8pP@P/000 09@P00-`0@@DcT@@00@0CcS1S@d*x|dePP00/@-^' (0@  000S'@A*(*@-M' p0@ `00S T0 0Lpps<0000S 0'@A*A*hA*A(*@-''@\00S P0 0HppP8 10 10S  '@A*hA*A(* d0@- T00S H0 0@pp-00 101000A*A*hA*A(*\* -X0lM@ id @E80 00ssa pA*mhA*<*@-0lM@L0 0 00 0rS sS ld dd X P0 00ssث,Bd $A*\*(**)nnKnhA*<*#n@-PP`@ @0@ss00V 0ss0000@? 5P UV 0A0T0Ѝp00CS0 Sp0 S 0 /O-pTM|0x0?X0 "?0p 0ެ>&0P`0V0X B@Ϭ0 @040SD H 8PZ0S= S DV0  k@P*&0S &0#S &|0pS l1 R XaR 0# J%tp uTЍ  ?$0000  PP%0S %0#S@DT|0S ph@"\$0 V `|#M"0 0 "@BA*hA*O-@BM MU@$@ A73?0a>0 @@@0`p5(`5夵P<$A PP)|50S5W h% 0\U 0X,U S00H00S 0S  0S 0 S  R 0 00U!$PP$p 0㤴 l@P$p 0\u`8 4 ap0TS 00   00Bލ Ѝ@3@30S VW@@c3!-T3 0  U@ L30S.;50G?oV20S4 30S0#3 RJsTN20 CRk2000/ U)U00e@ 0B>W0pXP44220S V: V `2IV"h2000; "00ET1#0 CR5@V-U 0S 1  00 0V $T V00T0ST dT(U@ 1 p1壵L10 CRVT$10S@d@0 @SP405+( 10S (3/1W 0    0QR\@\0 RZ P :/ 10 YS P 9/0G (* X *(F*`G*A*,F*hA*\G*$\ 0h0$<` ((0d $r 0( 3?$r / &<7R d3Z0 R0S R3(0s0?008'P 2X&00 97S0000 0-0S  x 0#pb8'P420 00 0  0 4!  pH 087+P(9 97R_ S㴁 0S [10S. 0S* ,0< 1, ]4P8!81 R  p 0 / 1Z&P 0S 0097S;7$0:70?70>7='<0S P0s00[X0 ?0S{ [X  U(*A*A*DF*H!*/oF*A*hA*oA*A*A* F*A*Wo*\ooodG*|*[p@*fpoop;p@!*tpppp qq@-2Bp`WLM LЍ@w 9pPk  2pe 0001`1 0S<0 ?!tq(S(00 Q 00SZ=9Q ='/?@#b!"/ap8 0S 0#S 0(60 8pp  0S 0#S K pp 90S0 00 0 0 LЍP4zѥ00A*A*(F*Mbrq(*Uq2q0A-H`D0 82Vp  R`RBR RB`2b  Q  ,00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 +W:+W6c 0S000A/(*| lA*p"*+*A**8!*`G**\G*p*l*<@ (0S 80(3/0A**~A**WZA*A*lA*@F*<*#/+"+ 0"%+?;#;0@#5;DE !dX@\ `U0XUڴ1QQ!0 P IPR AN Ak{H{7{Z(0`4!d4YP (e 0 +P<s(0@<se0  0 @0S  P0S S (0dx @(0l dX  .AA*A**A*J*UyQhyrywy y**yyyAhA*00pp(әKߍP@%U[0DE;@-T0@ R0 @00S 40 0,ppy@A*A*hA*A-$M ?0 0 f$Ѝ0-4M 00 000}P4ЍO--pMM,E, "  ݚ4 Ѐ0 P0p PUp0( RPUp4d"R 0*Pğ^p0S 0sd0S "P @0840S` $$1@`$S 07 { A0 (6 A{{:?dSd0 0#f!3` 3R - BP  8 BRڛ h3h図"B \#0 fH#2` 00ß R#3SPS0 1"000f0`  $P(0 0SZP=9 =:k{L2 AP09c A { Qa 5 P;!%#3\QP  d 0 00 f!姣1@P0G10 R`dP 1*!3^1?^000l!P0℣`1 000sss(0S"%+0!gUp; Z@0S00d Q@0 00pp@MߍY@.A**A*(F*A**X cC*Sb*y*Q y yzzyhA*TF**zA@~ry7z)dP P!$0  A A k{I{7{Z\0UzW0P  `S@<I00P<pIf0 @  @-@Q@p@-Bd00` pd00CS01Bp ,P P00 @R0S"P8d`Qd00CS0+,p "P \Pd00CS0p000S 8A0QPA p0 0 `Vlp0 c`Pd00CS0p 0@S P,P \Pd00CS0p `V0 0 _Pp@ *,$]z!*A-pp@`xP@ .PP n@P PE P@OoB@ *O-$U0mMS p,DPd 0S 姃mߍ⫽0P.0͵14PPd'0P0S SUpF P`4P PP P0CS` ` p, P P P0 PsdJP P P d0ppPP 0? dk`kdp P 0Sd0pp1P0? kp P 0S0S dh0 P P d00CS0p\2\J P Q4280 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0\S81Pd00CS0p0 dL\0p 0 p P`, ^0#S^0C0 d(kPXX B*B *vzd[**xzzzhA*{a1{xX%dK*d[*}{a{lA*XG*@-0 @0SP  P  0 00@ x0 l٣P T0 LУP 00 ,ǣP 0 xX%{tc*{&{00CS0 Sp0 S0 p/1A-0aS0P0(P3U P 00.S Ppd1lO `LX1P@  H,P10T0!0!00 (1( sU 0 ! .0Aq000 00000P0 0 0pS000P0T h0h0 @U t0 P$0`VI F*A*~a{hG*dG*hA*{{lA*x**bYp*t*$Y*B* Bc{{p@-@P "0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p\G*A****F*A*A*B*lA*XG* H0@- 800S ,0 0$ppA*A*hA*ATF*A-@iQp0S `0S pp00`Pؔ徔00000S p`0S ppĔ000080xT  6)pA*\G*A**9|O-P"2 AM MR0xB p" R S4 P |04 S` 4S4P  $Aލ Ѝ4Sg1+\;004P/S +H+DNP⤀IpUp儑0倁 00g000000000S L1ok81V$1 R100CcSppW100S 0oN 000000ޟD4SU00i$@iPPTy HP00\*A**A* F*x|S|a|A**A*lA*IE5]*dG*B|A-Q0qS0`00@S Q`Ѝ0G>P P h0 R 0000@ Pl00}S0s00T 0S$@,G F*A**hA*||dG*xX%*O-쁟a0AS000qSP4M Q 1G4ЍPF P0.0lP00XJ P" H@ P$,!020$A$000 0@,  - P 0 @ mP 0$0jqp00P0}S0s00U 0S(@<#G F F*A***hA*|}hG*} }dG*H}[}s}@-,@02 噊P*}}A-`PƠ`p  L@P  8@P $@㮠}}}@-@P* 0A- 0@0PS0p`0/P㬀" P 0S 0"S0x R S  p`"R"^ 0 00* F*A***dG*0@-M M P p E@? Pۍ Ѝ0xPh~4/SL @  P;0@TP/P؁~O-@P`pW 1@@Pp3:g pFb `ܰ0X1 0T@1`0 10S 0 SY J0F Q00S*00 050 Ѝ*hA*@- L0@0 <ppJpP0 0SP0 0n @ЍhA*ht@*P  R @-p Rx000 0R/`0000/0S < S0C00S/ S/0CA*A*8~A*A*@-0 000$ ~0S" R 0S0000S b0Cs R S             Ѝ xX%tX%7@-@P0S 0t 0p0{p\}X@0S 00@ 0,kp( Ѝ0@} Ѝ04F*b~8F*~C-@\ᄐpA`\P ^T1:00"\ \ L|9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR%0R0PMU20S2 2"0S0 C0GQ .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10Ns[00N B B ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0SP ^*0SPZ*@P0LG RX QP 0TJ*/0SE*<0 RS=*9 0S  7*+0S2*> @ S,*0 0 0GS$0P(0&A*d****/A-p`P @1eP0  T  `00T  0@ R   `FVp`00CS0 X7 PpTD000`000 T00~~P%~C-pP`@0尐TC 创 00@)ax0@P`0 \wL00D P 0 Ѝ訜*?hA*~~P%~~A*A*G-M@ `' 04P0 43`PT 0P #T 30S+ ` Q `V` 凐p 0@00E.002 P El"lY E@X{ލ Hp`0(T ${ ;p T{0q10@S  a 0$ 0/ 0$ %pO 0$S*F>C0S  FX4 `$Q(00SZ=9Q =(/?@#b!"/0 0p4 0S 0#S Z 0AS  T0 0000 0p 0S j 0g  0 Ɏpw0LT PW <00*HF*!#P(F*Mbi-p@-@PBp@轏ꗎp@-@`00CS0pP0 @ + 0S0`00# 0#S V  00p0 PA-p@`pP0 @  0S0`000#S V 00p@-@PP`+P 8&Pp0Spzpo@-@}P @-K_P@-@e_p P@-8P@0@-PlMQ@00 00 T  40S P 00 P 0 0 0 PACcpW' 30S @@@`  L P [`HPJ P b0 S8 v0P 00P02 h 2 PP 300 @T   P $0 0@T  P lЍ=P 0S ]@P@E `   P@U T T0S >@P@&A 0S @P@3 Tw 11@T  0P |0p`VPP) 000@-3CM000030S3@TCߍCl#P H-<#1S4!(R< 03/3CPQ2`P0R0A@SB-R凕@P; Rbp ^P7@00S 00,S 00S0 `10 3/P00000S0S 11 03/0S1000夔}p0 P0 0 Sdn000 &PTq0 P00 SH$R0000S 00,S 00 S00S 0 xp 103/P "(000 t0 P 000`(***L1 *fX$*l$Q*,*B ^bh* *0*@- 0 5 |*@- 06**P `00CS`0p S00 P0S X0X /XP%C-Pp@  l1s0S `l 噈0S t 0ۓ`V   Ѝ*X$|**@-+ p( P@ P +ЍX0/LA-P 00<,y<ÁɁX$xQ%.΁ځ0s@-@ 1`s0S P0S :   H@0  0nS fЍp`*X$~}h*Ap*@-PMP T` P H00S@0\A PЍ @PEK+ *X$ˁ@-@80T 06+1 fx*D0@-|AT 0S  0 寇iX$*@07@-LAP/0P00  Ѝ0X$ @-@0S S S 0\ \ \R@ R0 RG-P@ ?e  圀?` p ?Zx` @Ò QT@D0 DЍG*s0 Გ@T*Qs00!$SbɁG-AMMP`P_xB  d2d `2 'T2 P@ 0 04R 0 0 3 0R  0 S!%{O`sPp@D✡0S1  1 0S00SR&@@T  ކT @L*<1<1s0S ps P0\! 1 ƆAލЍP0S S  S00<1s0S p 0圠0CZ 坆Z < * 0 @**`*p***4**6 ,X$;$*h*(0@-EM,P ⅇP$@P)Eߍ0 ,PP  垆 ጆꙆ x0 <  TPQ僆 )Rbx6 X$O-`h3MP@ pPP/L`v<#B03 ,?UPE r`S00CS0%ᇽp00 R0ScP1s0S7 `$jP22l1s0S  ꍒ0 0 Pp`1 Ps0S 0 ` 0 D PVS,1s0S 8 ` 0 S 1s0S <1s0S #l1s0S 0|0d1 Ʌ RGL1P)  V 11s0S WpG'1rP`ɼ<1s0S0 僅 ЍS R   RvWP0 Uq0QLLD(`**5 4*p**X$*(|**h*$*;˂p@-BM,\@P3L1 D>$!P1 MPP(`0<1s0S q P00  1]ZBߍp q@`ϵUPp0DAJ<[ᔎR`*4*p**xX$h*$**߂p@-BM5,hN@P3X1 PԄ0!(1 $rPP2(`1<1s0S Uq P0A0 寄 Bߍp =q@`eUP|@噅喅N<'R`*4*p**xX$h*$**߂0@-@pP4M\s0PP <<0000<<0 w s4Ѝ0*$*0@-@DP4M0P 0P88 0[4Ѝ0*@-M, ,PF A f 0 001 &1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍X$`*  |*@-(@ $x @q*{t zt @-@>T|@1p@-@PPpP p0@-AM MPAލ Ѝ0⸄P;p0!⫎별PPl1LAd1T@҃Ѓ̃ʃ0!P0*up弃広嶃+嗃@寃 =U 0S S 000 7To   T lOt  10D0 S B/o" R  0Cӥ X$ C*xQ%*$4*@-MP Pppp pNl@PL\܍@苎, HP 厄܍,0 < *T*fX$0@-MP MuP%@e0@SۍЍ0@e&P551d dPPTۍЍ0@M@ 5 , ۍЍ0*|*fp@-"P dd;@PpPPΎPp@4<&8P L|l1s0Sp0p@O)*TBX$*p@-P MP(P @R0ۍp@&Sp`ᚎ@P\ۍp@P l! r R< < 5免 ,=ۍp**ăBX$܃@-  6 xQ%GO-P4M$`5~`=@Pu`0 `4$$p0Z$ dQ Y  Q$0 =P0$404tqtnhk 0X$X#P0PH} p@z <㸘U, U$$t @DOo0B$10<13 B0lS010S 0P   R56 ቋtS)`S FSI (9S /S 00C6&`a0CSR Q R Q S T Q S Q Q Q S Q Q S R Q Q TS S hES 0ScTPS2PPy Pc PPO 2PjBd2 @dPV  LPR @P/ ,2!00(1 1 0 0!0S1/ P @$,00!0 0 x10,P p  01 U PUP0 0  0@@@P 0 T0@0?o2VP0SVP%4Ѝ**$**|$J%0*RA*(**] *  Q%&X$|*#xQ%h,< 4+O\kl9@-t *@-@M h- \0P0 0D0@10S  10S0S@Ѝ:P  00S߀0@PBm 0 00S0S ڀ00P0P@0 S090 ,($U *0***Sb t A-U0S7P@g@PG`0Px% /Q4 ~ \`PPeDpMHu0S+ 85  05@,5 $5 5 R- + 5 400000@T ,P004@Ѝ0400/S@啁P v v vld`UX\U 0SaQd0S p=0c  p;0cs0S000S : }0P0 0R P T3Q |30S p : h}PX30S 2Q P o2: @}P 2 : }P 2l!: }P 2 : z}P 2 : r}P t2!: j}P T2h,!: b}P 42L<r> 04Ѝ0*X$@-`0S@ }PI0S 0000q20\ @j*ls7@-0Pl000p@h R R  l R  R4幈03/ Ѝ0Q PX$$*Sbp@-$A`1QS 0SP ~A3P00p00)0P "P0 P0 tP  dd\#0H@H  "  \ pX$*&K.xQ%,$*,0@-1s0S 0P ゆX$*@-(0(@ |0@ |p**h*p@-`BM P|@0 S0`01s0ST01y0 弈0Pn00x0 |BߍpB/ BR 0|00P ͳy0001h*X$IE*p* 0?o2 0/X$@-AMR 0b0000@000  |Pڶ0 q y|P 0SS WS BSs0 +f|P  3Vt0S &1@0S0 pW '|1s0S ؀0S R     |P W 0@^S00CS00  S00 P0Sm`*4e ***X$*p@-PH@P@pP P P @X$ 0/@-l|o/A-@PP" p00CS" j j j |j j j j j `V PPlP0 P00TA  0S P0000 !0S0R 00 }A-AP00C!SaXp `0000CSP l k hl Pl hl hl hl l `00CS`0p S X0 X 0 "S  ˇ0S`00CS`0p SX0 X ! 壆X!㰇囆0 0P0 PS000 `准0"S0L0A0|0 0P0 p *P%SbcC@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 ꡋG-@P2 pqp =`P`IPP2 00PF 0P $ V @P @0S@0S00@PP?P PPP P 0!SPхS-*cCX$A-@MPP\1 \ ]@P `p崀  OP}u00u0ۍ0 *P 0@ 0000S ᖅ  P00 ZX$ËB *͋p@-`@.PP 0 #Hp$PI@p-s@-@P` y { R { {@T|MЍp(R( dy0PgP O<bP K(]P *f@xt yt *0@-@M@0(@,0 0 '@P Ѝ00,x0 yPPPP0S p00@SPr *X$*@- (, ٌ*@-@ {1  {lP % by0P3P xńtÄh z XOy ҅ z}yЍ*xt yt f@Q0@-4MP4PW 1<1s0S 善AH 0 9 0;夅 LyDS<Q8 y,0E R4 y y<P! 81PP }0(0S$4Ѝ0=RS00ES`u u xu u u u tGhE`\XT H7MX$W* Q%ccCin*֌|Mt@-0 x@4*cC-@-MgM-@-Eg0 R   ЍЍ/+-@-7N0 R   ЍЍ/+A-ARp`P@1T yxpPt `@DO-dM@P܂0P0Ղ0P0 0 8p800,@400(P@`@P p0p,0SX ,0S5TX  @@[ X  ( 0 0 ( (c?xptP T+o,00,00娂00T񟗾x y y z ,z Hz lz z z z z z { ({ p| | ( Q 0S0T崄岄 0S dЍF 3 P ( 0C,0dM@ @( QQ `- 0C@( ,0u( Q4 0C@( ,0j( 0C`@( ,0bV@_ ( `F  ( 0C`@( ,0R( 0C@d( ,0JV@F @C ( Q @0C( ,0; @8 ( Q @ @` 0V @,80"(B2P6 (20S!h{ { { { { { { { 8 R/ X (b0R040880P(8[xtph8 8 (b0R  "L $0 P 8 Pß0000S(8@SX ( P0C S,0( X@S( Pl0C,00 S( L꺍ݍȍ+/IdjҎ >dO-lM($ KPHPU``8@ p0F0Ÿ   0<02@02 @0` 00J@P hvt@` 6L`@0S( P @ZX $0lЍH)?@d €00 S @. @ C< ⤁0ЍC0$ ! Q%ޑA-Mp1wP`ЍAY0@: SPPT@`P00S 0 00hQTP1 up P PU0DsLS<(    _W12+'/@O-0]M-SP MP @p<vP3 00S0W0S( 0S#Z` pPt40S ]ލ ЍO~v/8]ލ Ѝ  @pl`0* RT < RP uPP$Lu *uvP #u>0v: S+  뤳 0P@`P   tP pd ` 0 0L!0 00 0S0S`- tP`(u`tv `0S 0 tP |V tP `z{ R u8MRK tpP \ uP x!1Z[  0t u.u[ptp`l< 0S'HQ0|!0v0D P: v?b  0S-vOtpP v|\W ]ލ ЍOP-6Nt 0SItpcP P : R S00 R0S tPPdVT}+$12`oݍ А!F\P%0 R R /0@-@P0R0  APCU 0APLU aC\ACP 0^0\0R0 0 0@-@P@@ L!P VIP00S D00S  40 /I #O4[/}+(=+\+$@-J_<@-Pp@-P@ᯀp 000/0+p@-@P0-S@@p IP0Tpp0p@-0@S`@MP0@ M~ GP@ЍpPU PY a0P0$0+f@-@P @00S@x0+p@-@PPp00Spp@0+A- `pP@P000 PP0 04@-@P P0P00S@0+@-`dM qPU= 0S: AP1 @@?T.  } `00@ C @ H00 *S ?0`?ZP10HG>P dЍĒ\ 0@-$P4Ѝ80S <080~KPc 7PW %KPQ P1 2P 1 0,00000400G?000x00002002"0nP X1 KP4 P. P ,1 P 1 K P1 K P+ 0P$ P 0 P 0 P! 0P 0 P 0  0 0 t0 h0 \0 P0 D0 80 ,0<i0+K+J_,7@- #sPP@0PS 0 P  VPʼP  P 00  0S0 0UhP xP h`8PTP Ph0hh0SP0h0 Ѝ0ht@0+̒Zgǒ$ג[5Ғ@-,1P0P@Ph | Ĕ Д ` ` ` ` ` ` ` (P 0(  ЍxphP0PP0<l00l0+ߒ0+@-`Mb~oPuH[0@EP<0P0$0P00:JP 4Ũ 40P4  TP00t<P00\<| LxPD40<AM=++Wq@6ׁ/) +ZOZ(4Ӣsw#mD%]~cC%X+V0  0+0  |0+@-@(=St00S h00S\00S L00S  b400S  [0(=0+=++\=+=+=+0P/0( P/+0+0 C0+0 $ >0+0 90+0 40+p@-D0@0S 00S 00S  !<0S <0S 8S0,=t00S  \00S PH0(]0Sp@ jDP 0Sp=+0++=+=+\=+=+/@-0  @0+$00S/0 R/ =+0+00S?D=+0  0+00+@-0P4 P1 +P00p@0-0Cs0LS ``PP"0-0Cs0LS rvp` 0  0.S00 U`T  Ѝ0 @-@P VP  P P ЍQQl0l0ѳQQH0H0 Ѝ@Q$Q a ekv/p@-P4@Pp@A0S +S90+Sp@p@@-@@@    0 00+  00@`/$p@-@lP     <00S   4u @p  0+D=+D0@-0S 00 @T@JF@p=+0+@-@0 0 0@0+@- Bo 00S dC0 $0+A-PRp@ FqpADFqp MP GPp P`UX@DTUtl@8/pXVt @W@T*U A (ꆓȓ$ $0 0) 0 00S/`+pp@-@ P 0s  SD@p$O-`0S@p 崠)0   ?990 VY†T00S[  RP l@  D$`+ P 0S  R 9  (0///`+4 O-䤟M`V 0IS(,  RQ0 R005r: 4) "P  2"RfpV  rq$ <$Q  $Q Q 0x#P 0 {   {`  @`   0 PP 0 @@0bvyf`p{VX!SR@ 0?  0yqp1tCЍ QP$0 0@R*20 R    @ @  " @@900 SP05:Pk09a 2 q4   10SO  09ϬRXV a0SG\C002LAP10SI `10SEPB  D1 09 0$ 00*b$@p 09c|p  RB 0P  k l00St0PRc0SL00S\ O `+>+=+$ ++Sbt=++8 6$K+800S 900//`+@-`@0Sp <)00S000(0,0(0,0`+p@-@0Sp Q k00h@ x00p098@00sp000B(Pp 0 $`++AK+G- q`V= P@;U000P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@`+K+@-P \00S @ T S 9(,0 `+p0@-@TI0 qp0@ @}00p`+K+p0@-^ 9 @ 0@&)60 P@ ^@T`+0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/`+P00010 0/$7@-P R I0 0#0 Ѝ00R% 0@!"0@@Nqp Ѝ0@GA`+S0@- 00> Ѝ80098<@ q|/ 00\ /`+A-p`!PP"@h9  @0@  P09   t!09 r`A$+`+@@A-p`VY@  @ @ 0 wvP0 0p0 iT 0 0bv0@A>!`+$+0P /`+\ -P0S0@  P2:1S0BS /O-@ 0 -R  UR +R  >Q @`?}0:S X?u0cS .S bS S@ @0,S@pS wS ,>P ( 6P 3%vPx@Pt@Pp@P0 0  Sx7P 7P 7P6P hP ^ꪃŔp+|+++Ԕl++6$+?M+xX%!& 0p/l+@-p  01SP R t0 T!WP R HHt@08 ,r@"P0 l+W+|\[ 0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aqR R S R0/0 R /!0 R0S //@- @P괼 ̼ ( d 0#-?003&?=r 0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P pq!l? pPpĕ ?`llp@@`@@l+0p@-P@P QT4@pTT@DQ0`VC@S@ T0CQ @6@l+@-l@PXPHP <00S,P++$=+$$@-l@PXPHP <00S,P++,$=+$$ Q p0/l+P@-4sЍP@EP @ $@P r0 p0tT! _P P0X!P80T@ 00 0 W+[l+@-,@1P,P+4$00PbA@0CQP//DA-RPp `@X@@Ѝ`>P@\@P, PP@@+A-P` @P lpP ` L@P  A< $@rT әp@-Pl@P TCPpD>Ppp@U p@PpdEO-MM`p 0@P fP0: SXqqX  R:P  @P> 4ލЍ R R R00 P P@ P @P PP 0"SU T 0S0C0 6/ :P 0mS PB($6'$/P P / *+s@-P@` "0 00 BЍpA-@Pp4` R 0S xpp@<@-P`( @p0` G Ѝ+@-`@ (8R808Ѝ 8 0 CS  8 0C 8++p@-`Q@PRpP0S  7p$0Sp -pp@0S S D0V@ ` 0V, pU  p@p$|*'/< $0 (((( 80( /+$ 0( (( 0( /+$C-@"㼀`p0S Ѝ @oP0S 0S 0 ( ((08v9P 0 PP 0l++7@-D@P@@00S Ѝ0 7P+@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08a9 80 8 00S08S9++0@-AM0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS ڧ 0`++@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00++s@-@8 R 0R0` (0 RP08 80 8880S Ѝp0CR80S 00Sʨ808++p@-p@XU N8PE`V` D0(  p8Soppp+$(080S @-/+p@-D@0S PX* 8P 0( pp+$p@-|P`@l0 R(0p0CR0R: $0( ip00+$7@-@@P@P  AP Ѝ00P$ /+0S/0G-0PS`p@U @0 pP0@@@ X .P00nn @ P00`=+P R/z-@-4@$P(0,0P  $8 +$7O-0PSGp` 8(hS?Pp $8SDG(R008(h8! 0S0S ^ Ѝ0S08R00(hkP080h88S 08 ЍO`0F?oP20S `&0 S PpP0@S   ( p 8 4 eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)0$h48VK"3P( 圓R( B( ( W(PV  PPl>@nH80S 48PS8P m08880X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 0iP0J``` P Q`*ZXP@$ 0Pl++0+$+Ax|0 pC-@P M!00 0 B R   0.S q3 `! P` HP T 7 Ѝp0 P`000C/0 !GP00+O0(8R/+0$P00 /+00S/ + O-鬡MX[$ 00! 0S R`PO Pl@0HQSQ0Z00k@P7 ppaP0: Spp_ P)dp0 R'0 Y& Wk@Y  K0H2  x*ᇖ_llЍpP00+$<+b|* 6800S ,00S 00Co//\+X+`+p@-|PPF@T p@``kT0S S VS 7Sg@ @P+p@-@0S00S 00SM7P p@0qp  y00S Rpll0P@ QP0PL0@p88 SP@ P$=++++=+d+@-'=@24G-@ eT00P  00`p|| 00ST V0 000S T28 P+d+K+A-pP1 @`0000  (P0;0 A' 2 mA0PP     P  5X A*P+op@-}@Pp$R0%S!S0C Sp S} T 0C Snt ( @ 7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP j0S0ptp 0p@^ 000Sp p@B0!S $P j$t00Sp$dP`p@&L00Sp7D00`Vp(O'p@4pP+,++p@-`@P 0p@MP+A-`P0@@@p0P/00,0S W HT T A,0+ P+d+eV3p@-AM0 70000]0  c0  ^0  Y0 T0  O0  JP`0S1 0 Ah<PU0 D<<1 40 ЍpP+ĚϚ՚ݚx|*+@-@0D$0PiP/P+< S /@-0 044 ЍY %@-@x0@ P+p@-x0@M@T 0S P0`P V@Ѝp`F0PS +@-@J0$ 00@S 0P+@-@@P@-@0G--e`㉋(B(r0$2$0@M0?000S0S  @10S y0S 0S45?0P P (2pP`0S P 1`P 0SW80S! t*2S80SeV|Z0PS0S[ /S TS S S U U"8=P d2Z 0S F:1% "1P++P+K++=+++&H=+<$$+<>*=+X=+=+Sb$=+ X+5=+=+@$PZ+dpL$V3+Ûқ=+$+7S< iS0S P0 P P P 00K`P iV 0FcS񟗘  L l \  l l 4 L X D ,  L x 4 \ | h ,   L  x \ (                                     00E.U S``ydP ePeP= R0S`Fc 0SP0@_U0b ,0Sl U U000#=U00S `J V P+U@  U !UQ0-UQ00  {@0#0P NP 0 a0CS00 0`.P  ` 00P 0Sa0@S @P000S AV"P 2,00 @0S 0$ o-P 0S.P +Ta0ES000+P +0 /UPnUU0ESfX $   *U( @U6 !U[ Pq 0S US'T60S# PP pf0SLH960S 60S0 97R0<  K60S07S ;07S 00#0'JeD/K10@S0 @007S9 :<#0CSdP .=P 0 j0S e`q0 S (0!R0*?0I$80S p o0 S h(0!R0*?0/ !R00 !ı#80S!R0F !R0 0!ı 9 49!R00 !ı\90S!R0!R0 0!ı !R0t*?090S 90S `0 S 08:0S y0 S 0  &a 98L!LjR00 !00<0S0 !0<00 eSd0C0<0S 0d !0<0~<$yP0rP0qi0S 0!ıT; [4 /U;0S0SVp @ $< D ,< H 4< P Bl<000!R0 0!ı<00<0 00!R0 0!ıR 0< `0000!R0 0!ı= ` `<02.!W?PD!R0 0!ıPH ,P P !R0>>0i?Pd!R0 0!ıP& !R0>>0Q!R0 0!ıt?`P0E kP ?qp X? !R0 0!ıv?`P+!R0 0!ıP l?`PM P 0`0,`IP2)P 00,00  &20S?V" 80 PP U U ?V "R0> 8P|P U U "B0 PlP U U ="10S %PXPs U U.P!0Plh!% T(P0` !R0L1 0S<10գ?0/0 $!0 S00C0 0 C!R00 0S00գ?0/0 00 0 00iS $0 `;P00S0802e+V3L$*7CK=++X+++d=+00S/l+p@-@P/!pO-S`PpM`&`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0d80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 )0P R* 0.P0   80 cP d [0J0Cl+0   /G-pȀWY+p S@00PPP @ ZPPE0S`0S P B0 0R R@0`Vp@-`R P@ a0P @@@ 0ppM-@p M@9p00PCu RT0Ѝ` `?Z>P ?0 `P?>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#+  0 \=+P++A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ# 0 DPzdP fPP Q gR 0S 0R   R E0 i\=+P++@- @ @+ @-P@|,+X @-P@o,+xG-(2pW pЍRUPP( P0`]Up`@P 0pKqpa -UEU? SZ a0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Ul 5 P @U(X0jP +++p@-p@`PP<J,<0SV@` `<D IP +p+ 0 + 0 +7@-dP@ P_P 0S  P Ѝ0+Po/@- + ЍSbA-`QpP P P@P%U0P 0 P l @`T @P 6/P`ڜ@-~|0p p0h hhP 0X X@0L L8P0@4 4 d$\$ 4 %2AJTZC-L1M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@\+X+`+G-@`M0PSS003 @ R S0\R% :R R DZ Pp WP0H3/0S@@ R0Ѝ P/@-麊p H( l*`Ѝ00S @  d[*\0PT T D( 88qp bSb=+iG-@P0`&p*ppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(Vp0  S P 0F@@H$I$p@-@QP 0S R SppQ0 QA QR P/@ PRP/p@-`: PPp@p>p@- 0@-M + srp@  * PP  000Ѝ0$++400S/@-$@P P@=+$+@-@P  $+P/ @-p@''0@-M@'MRP_R00S@)PaP DP OP AP )dP oPi]|0t00SЍ0 "R0LP 00)qp+R00@)+ڝ$\O-(M0S 0S F0@S R v P 4X ЍM D@k Pp 00o pPPP`TP DP  PPpP0S P``30STPQPN ((@(!P3`00P0`0 p{P0`0 3P T ( ,^0 b~QP`& 20SP `JP   @( YP uQY |2 pd T2 )D2p@20WF0b,2P 0S P (RP11P =)v&0S )/ 1X P DP Pd1 ]L10S D] 010 (0 yqp 000Sp 0 P  0 R  [ R 0 0P: l X $+ +5qd=++Sb+(+?+=+++,+X+@$@=+K+4$ڞP@- 0@$+00@-˼P '@+ߞdA-P`XpVWPU@JTXlP0K+ 0 $+@-zP@ @0 $+ 0 $+ 0 $+p@-P@@P Pp@7pp@-@`P*PpVU p@Z Pp PpA-@Q`Pp f\\U7G-@@` PР @PUЍp pP\7CP |\8p0SkЍG$+@-W0@0S @y$+0 R/%R %R0 sR0/@-(@0SP00+)7G-`dd@p00CS0 چp PP 000 P U 0D IS  \\op@P@- 0PSA-@_0 0pR`@0S00 R0S@00?`P0S U  P@00H$I$O-M@`&DPp!Q Zl`@pW*p%pP` P` X iP UpV`PI`00@0H0L 0`YЍ8IP [@00H$I$b@-@+pFPPP Ѝ@[@@@`H0H 0P0YQ[ D@K[ Ѝ_BґA-PPЍ0S `p@@@YPP D00< 0`eYW |NP[Nx|@-@@ A-p@`P@0S P@0S0# CV* UR@ R %S0P G@# CV* WR   R %S8 P0@[+@ +$+C-EMPPEߍ@ 0@qp `,NPڬ嬐P ` P:T0S E~P @  N0pS<`P  z P@l+=+A-kX1@0SGk @1RpP? ,%@ 1P````P0p000 0`00XKZ밀P@pW O;p:ZW P0S.ZЍ 8;%Z@+driI$H${"0A-0S@`t@P0L HX@pA`PY@YY+@-@@0P ,+P &od5q@-M@P XPۍ@ ۍ1O-0S# 10SPpuP 0 `|R@0 -R` dP JP @ $@ ЍP PP I 0 W Y P YU @T ` vv`LP 'T@@P@T 000d0&@qP<`$@ 0SXY|=++dq0A-`V8@PSpP0 PЍA#nPk`@@@@0 `aW YY@YT ЍAÃЍ+͟ן-M MP  @oЍ0@-@P0MSP W@dYY MP&!@Ѝ0@T@0: S 8*@EY=+H$X$@-M@MP͡0 00&Ѝ0@-Mo0P@w `MPh0 R\P0 R\ tu p0St00Ѝ0$+++/@-@P P0@/R@-@ (0@0T8$@8=+@- 40 R\00S@@+=+h00S /pp@-qp $qpP@ QPppd+@-P#P3#0 R/  +O-q$M0S|10S%@=P`\\100CS0S#P`vu @@$P`0S00S$$ЍxP`@n 0 R  0吠00刐 00 000 0 000000  0P0000`0E 8=+4=++P+ +X+O-M ЍOv *O-P@4M(0X0 ,0ut@ P4Ѝ40SW400 ?Q)(@PPp@d00$0Jp P9P  ` V0. 8@p` P P@00Pᰳ尃0v V `V@P,0S3 l3X3 A5B)P30pW0 0 `P20S Y Y` P P `V@Y*$P `@T_A0S t20S  P0 (0 S 4  3&PK20S 0  @ 1 0R00S: P Pc p 4ЍO V000 P0d 0P@ R LA0 Pp``@P,1` !X$0u$0@P_ V Vm@P{ P P Pu Pa@Put$0X$0@P_|$ 0S V V0$0$0S E@P R`0 =++d+K+=+X+=+=+=+=+7@-P@sP ,0 R  000 Ѝ0X+O-`V =R+` =R-`8 t Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =rPV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` cP `` e0Sv} p0Ps {LA$$+Y %dP%B16<El(ȡ$0 RP  /@+0 14/@+0 Q/P/$@-04 ,    00 + + + +G-P㌐剀zL@vLPT`ppP MT M ᗲ ! ᒲ M M @`匀@+A-8p@0PS` 0P0aP @+@-@$ 0 @z@+P 0 R   /D=+p00S/p@-`@mPPPpP 0S8@pPp  =+@+a@-@P00Pl0 0  ;D0'(<%(8#(4!(0(00軤@+x̤ݤ++++ +P/0/@+0p@-@00P0 0R 0.PPPPPPPPPQQPQ'H'D'@'<'Pp P0 Q00@+++++ +C-阁P0@SpM`Ip`ll!0 0!0S~0@ 0  @Pa00CS7 `PU7 0 Ѝ P -0!0S @P 0R 0rq0 U h Q H S  {PwP=+=+<=+P=+@+L=+$$,0P$0 00S000/=+L=+=+P=+p@-L@P`0S0000p01S 0n'P@+Pp@-`0 p@肵X10S P@@p(1@0PSP5pP/}`P0@@S  1CP0 1C%@<P 0S5000|  0p  0d  0@@PW 1CcP l+@+ + + + +O-|C0M0dwvP1Sy0\P1 0S b 0 S1C10q&QF 000 00PP20SI 1SF P2!0sr R0l2ap01UPL20SDXO 1R.sr0nS`J j`0F[J 1RKЍ1S d 0A# R Y1S1S  ` 0kP  00KU1 0[0 `0S/& UzD& 0R 0èQ0pP 0C001萄 S rI  0@+<=+P+=+++d=+A-pP`5p00S HP `P 80@0@D@ 0@0TЍ=+@++p@-P@A 02PpA-`p@@PGE$1S 0P $@@\+7@-Y 0 0R  x00S U d00SX00S D00SX   @++h=+d=+<=+ + +=+<-0 R!  ^ !0@+04/@+0 R 00S P@0~0/0P 0/\!4 0 / B  0/@+=+ 0 /@+qp/G-p`@PpP 儐u U 0 0W 00V@00CS7P P 0P@P@+K+PG-P0P`PpЀ@ 0@D P V 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB@+K+G-p`P@0@@0W  S #R0C00C0Ѝ ;,P  j uF 0 CpGA-0PP@q1k`EP q 0P 10@+G-1@`p`P0 LL0 rS00TD`0PT@+P+@+p@-@PPpኯ P0S0Fp P$@-0P $80P/ R/0 0S 0 /+00 0S/$0$ R U+=++A-X@ 0S0dS 0p(0,`P` pU` s0+X0QH0H 0.4 00/ 0 0++,+A-@PU  ^"04P4p 04 R0PU R4`40 0 P ^PQ p0࠱`  0+O-1P0sUPP@PP0⸡p`@` V R0 SRA 0 V 0  W0PR 0*JPA `Y0 0 y W`@TP0 00  0` qp +@P PAp ` W0 0O0  0`qp @TP=++K+P0G-cpPU !R00 RS@ U W0S P*P @P P`@V0 0 0 0 00r  0@P`Pl`@W 00 0 00r  0@P`V@+K+G-`AP@pl0Vs 0SP@`.P@tu TUPP+G-g@P0p`Pxx80@ p 00  0`P 080qp괠+K+800S/,00/PP//0=+8=+00CS0 Sp0 SC0 p/O-0P-SP u   E f7pZ7P7@P0S,@ 0R S%@T EC:7767;X   m  0 ЍO`P @@ W@ 0A $ ACV3A_'+ґG-@P $`P( tmpP ` } { [" d @yz  0Z P"p@ ;p Tt p@m ɬT6k.sq 00P6 B06PU p7nAP0PPЁ  G;P 5+$+=+@-P ,0 0R C $+zl0@-0`  ^ @^TSa04S '0s05S #$+5+0@- @P0 QA6R 005+G-ipP@P P֬`PA`Ap6W @5+00S/G- M`p@@吠吐qpp6W @ Ѝ 0 PU/P ᣬP P 0 @T=+|*5+d@-000mS Ѝ 0 Q0 >@P 0 S#  PPP0`0 S  Q0 R pV`PPp Ap00P+17@-PU0P( P@ P0 Ѝ000SK@PP @jP@ Ѝ0@H00S< Ѝ0@? 0 0$09 ++ĥ$إ 0 +<07@- R P(0(@?@ 0 Ѝ0 %P+@B=+@-P M# @0.S ]00S Ѝ 00S 00 00S000 l >ԩP0@  0R 000@0,0  %%=+9[b<07@- R P(0(@?@0 Ѝ0 %+@B=+@-P M# @0.S 00S Ѝ 0S 00 00S000z l J>kP0@  0R 000@0,0 %=+[Ҧ@-@PP  @M Ѝ@-@PfP  @> Ѝ0Sp@- Sp00S p@t, }l0p`xP p@qpP@ 0p@ v+7<+=+P07@- S STl0 Ѝ0XP@T0PP ? @ Ѝ0@?0 00 P %T %UP/L0@-0@S *00 $0$ @=+,+=+x|P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P9? Ѝ04@P,0  0 10 @ %< %8K+D %=+Sb0/0=+P/OP @P/A@-@| plb@0TxSPLHD@<8@tY %dgj<z@-V0dSK@S!1 CRJT" R&0CO  R  |  @P3 @.A C#Rꄒ  ̒ 4 L d  k Cr \ ,0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~D=+V/O--@PDM`00PP*0 S 000C S ?  0p00C/  0?>pU:Y U :TЍ D0!R1@0P S 0,ST40, @0D@D1!0C 0 t+$$C-PMP M 0-@6ݍ ЍC` @>>0Sڐp吀吐# 0PU`)>P0P  @@ݍ Ѝ i>$pt+)h{$SbP@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000I$H$@-PM 0  0 x0  @lᒨd P 0S>000D ;0Ѝ,0P dh=+d=+ĩP @P/ 0 /ܩ+P/00S\=+0/@-@0SX=+0/@-,@0S0 0q00ЍP=+0/@-,@0S0 0_00ЍL=+0/400S/(00S/@-8qp@@=+$+P@- 00@ ^S00S00 Ѝ0\ / %Ip@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0SX 0Ѝp40@0000$ : @8=+4=+ c{,qP@-P A7 ЍRS+DSSS 0e C R ( 0 8 @ E C CS -S 1 CR 0CrS dSWS ^S0Sj0wS     0  E000 0 FK N R WR Q S-00 0  겪$=+ͪ800S ,00S 0P//=+4=+8=+$0P/0 0 0C/=+P+8=+@-PU  @B Ѝp`@3PppQ 00S0\Q0S 0S@V ဗP 00$Q00l=+@-0 S 0*( (9 Ѝ * 9<+@-'@ <+P/0S/P 0  //*oP@-/ĥ 0LP/<+ 0@-L   Ѝ<+@-`MP@ᱺ0-S0p00Cp S T 00ЍU TP PTU $PT00W` 'O-P$M cLP 00S S03/0L0$ЍeL0 @PpXX 0 R @@-PD &$PP 0@s093@!+P0P0U0 P @0+S3P :╺:9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P# aK[  0 p0 @ =RP   R R tq000SPP000p00CS H ` ` ` ` 0U?o 200@S 3/TWU 0 [ 0S00S0000SL@40 S 0_P&00S <+=+,+@j@-@PM @PU@`p0@ mPPU   c(A R  { 000CScd   RyV)00SS# P|U  U Uc0?o20RP 2/ 0RP0 VW 0 {Ѝ 0?o2RP0U U U6W0 0S00S00W 0 0S00S000ESX RU U U , 0 S0R  c R U2/U~00SS 00S000 S000;S U000 0 ҫDh+s@-P`@ᓸ000C S0 ` 0 Br ^ ST00T00VЍp $`~S 00  000S/P/=+=+@-XP H0H@ 0S0S  0  03/$@ꃬ=+$ 80S/S/ 0CS/$$O-@pM8Q 0S [= 0S0 0 Ѝ`V/$P  0P ! AAQ-P $ SQ@ S0 0@@Oop B0 R ` 0 0S Wp0p$@-,PP0贾 %/-4M @20S41P 2     +2 0S 104Ѝ0! R0< "$01 S 10S 10S1 `11S(  }+2 T!2 R (10P!000 0 o R  RR+0 000S P 10S 1v\ 1P 0S~ 0#Sz ,0 0S P  0!=+=+K+K++t=+ %d+ % =+@-娅=+@-  Ѝ@-Pṥ9`@@@dp0 `5 ЍF@-@9P  ľ?+G- @$pP` 0ᷠ )!0 ଠ@@ό@0p\p3#@- d 0 Ѝ(7@-P@2"@? Ѝ0@B@-<03?B3c/ $ 0 0 *ЍMb@B40@-0@@T w*P  0  %?++@-@0@ %0$R/ $堼?+p@-04S S S צ0S  0 [Q0Ŧ0S 0  C  Q? 0   ^R000 Q\ S$R 0C 0N0P0000\\   0C R 0 CH %BK+O-pQpPpMW My@xcPJTpd3dC  \\Ls PZ PUA (3T Qۍ ЍpPS@DT2%PN@ KH @@ 0 X &| P@ &T@"0S000&P ;04P ST@ 1 Pp 0Q 1T [QP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P? T0p0000,K+H %P%K+xX%|I B0@-@nPgP |bP l]P \XP oPH %d@-@P @P P P(@Z꯿տO-|1M0S" @`0 ЍOdPp400 0 Ppxy&@`00S 000S  0P Ѝ P0 000 { % % 0S @`K+K+=+=+0@- LLPR^0S @T 0 BK+H %0@- LLPR^0S @T 0L BK+H %0/K+0/K+00S /K+@-JP PP@-0K+//@-L@ p0 P㘤S0PЍK+\ QR0* /QS QQ*/0000/@-@P $000000/0S0C 0//@- 0#3P Ѝ@- 0@SPR? P W[`Q  圉$` PЍpA-`pP@T@  A-P`"F$@p ᠍QP ,0 0(000dPЍFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0P00`a0C@S  8 @ H P X   PЍp  000@@0 0 0 0 0 0\/\\A-1!0 b \[Pa@1!0 b[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CqQV 0p@]^S @p^404 0 4ybp\00]+]+o%\p@-0Pt @R RP D D <@D@ p@u @xX%]+]+~C-1`pMQp@P0᠁ `0Y 0 .PR l1@d1`0 Lb\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . Cr R 8" [T \[R@]S  000TT[T@  \T  \R(0 R Ѝ]+]+]+@f+00@-00M/SP M $S+ +S00+ 0 0 9S#\S @P0 0 a0IS@P R00ۍ Ѝ00@00 S00@]+]+O-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S 0QU t0t Pp0 `Hab`0V rP0 0,"PK+xf+]+]+O-`M@@_.0 0\0.> 0` S \|.t>0 x` Q    `   <  D < P 0S 00@0000 0S 00@`0`S 0S @p#S ;S 0 p00@\ b}P  P 0S| @,Sv p0S 00@P 0S  00@[VXK+%U+_NqC1U%d $ p@YP  0$ 0     呻!1 !  00 $@$( 0 0 0$00$0 :00܍<ЍG-@`@lp圀P䘐U@T00S Gl0h0@X0 0S0 0 4 PK+]+]+xf+,f+@f+0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0    m 0 ,f+xX%A-@P p0R`*W00 l 0P P 0O-鰿MO00PЍ080?PU 0PH0 \ R0S40 P0\0 P R 0SQ0A 0QES0=0C>SL4 # # # # # # ' # # ( 8( # # # # # , # t, # # # # # # # # # # # # # # # # & p1 ' ' # # ' $( T( # # h( # + # 4, - T- - \1 # # x1 1 \2 # p1 SS4 0 PS0@o0P0  Q Q* S  H S 0Q sh0 R 0R0 0R0S0H0[0S 4 0 k0 P^S0@oPL0 R: L `0p奂00)0S;;8 00 [04 0u<0S H0SWP80S4PU 0`  EvP0800A E4 k0T P 0  004 0 0 || 0:m00z040 0D:DR <00s( x0P 0S y0S 0( P2S 0 Ho` 0S0`V: 6$ 00@ p9@墆0S  0DW H0$P x0 0H$0;$0 S8`0V:$o l`000 00C 00P0 r\8 0R:L`8 0Ft `S p t7 P0   R:ſ ` 7B7` b'1 01S:尿` 007 xN0 S0`$78 00 pg04 0t<0S cP0800 SP80Sf04 0s<0S  80S0p4  HVu`P <000F400<0\04 s<0S V 0400<058 00 U04 0s<0S bL0 R: L # `0pQ00pY R  Q 5 0V4000  P 04`Z Z 0Z 000 G 00 00 Vt4Z  0Q\ 00 0 v  PQ8 p0V `XDcH0p0<Hp<(0000S s04 0s<0S p PB"000Q0 0  0p V0`0  `0P   P\   p V0S` 0  PX80S0s  "  p0 U04 0 40P0 x P 0S 00Po80S0sl!l p 4 0 40P  Pp P R0 0`pL<0p<S80SP4XM  0`Rl0%#0VB*000]+,f+\f+M+]+A|f+ Q% %גht@{c^+FI bf]+lDf+ SbU%f+,f+^+l0pW(p0 1(W0 P0H  !  R 0e_P 0 pW* 0$ (1 0X`pH0`0h<Hh`<x0h041 8<0 0R0((xQ 0{Q  M+|f+p@-@P`Tp0wS {S sS 0p 1 P 0 DT0`@p " P `SbG-`'/PIPU00Tp01@ R  pmPVCGXpp0!S < CrQR2L6 6 t6 7 6 0  qT0 0 00 00 00:S 0S0S W00 000 0V 0S`: qP 000BS ݱ12f+p@-P0@T P aP1 0S-7 7 7 7 ,8 H8 8 0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@f+J_, 0@-MMP>@P  PS p4S+ & P<ۍЍ0SbH0  BR Rp Rk p/P%xQ%@00CS0 S0 / QP%@-,ACt0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@^g+1@-01\ @T P#OoB\@T P P P QQ Rr P\ p\ P P Q qR  `d,g+0@-  `Ğ\ @ T\    %R    g+`d,A-pA0 5S$\! R  (P 8!W0  ,P !N0  4PP6  qA<0S 00 <4P`p夀0U00S 000\P P D 000 P S`d, h+8 xQ%h+n@p@-@0` iLT  tpd lP`PT p !oP000STպ @P%xQ%f+s@-@P hsP 8@P @0?SP@P` Ep Ѝp/OP@GP 0S S @ 0S00Ru! @-, &)xQ%@-0@<TQ T00 0001S R0Slp@[TX` T@0$ @H4T(8  @,g+aryxQ%`d,@-}, axQ%7@-@Pᦀ  ᚅ0S 0@T 00 Ѝ0蒀0"S p`@-@P  p QЍ<0p@-XPP%0ATp0 "R   DS " @DdAp % 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,|0P01p++01//00/00/00/00/00/ 0  /H+ 0  /H+Y00/ 00/00/00/00/!00/0@-@|t+00/@-@|+ 0  /t+  0  /t+ 0  /t+/00/00/00/300/;00/C00/L00/Y00/c00/m00/00/00/00/00/00/00/o00/ᢱ00/n00/Y00/sO /gb@-0  0Ѝ@-@ +@-  +r 5@-0S04c  +@-  +k @- 0++ @-+( 5@-0S04c+  @- @- 0q+t+ M@-s+ @-  r+ ( 5@-0S04cyt+ < @-  pT+< @-  gQ+ < C@-^t+< @-  VS+  @-  MS+  q@-D|+ e@-<+ e@-4+ e@-,+ @-  $T+  @-  +  @-  R+ @- 0++ @-  T+ @-  Q+  C@-t+ @-  + $0Qa @-+ @-@D {P d 0  ; 0@-0 |1+ p@-P' dP% <P 9 SuP5P 0CP  @@PV 400C`F V$P P P0S p400C`#_}m1ST !0C B/!?1D_xP00 S11X@zP`PxP@a@1S50200D(PZ) @@Ppq u u 0@Su p u p s p p p pq p p p p p u p p p p u L3P#0CP?P* <P >P P10!1 NSPNQ0^ B жr0s0Ɣ P P?@ "0C S񟗊p pq s (u s q XvPr P1auD P ^w{1S'ʰ1 fD P Ow{P e00P1 RE40S 3/Pg PP g P,ЍPR0j P^ 0Sp0W 0] 3/pW P `$D P  w eg `{`g00x00A>0 b02P 00P000b{@gh+ {hxQ%^,RSxX%^,@tX% 001/h+P0 R0//h+O-p`*@PP [ ! 0P @ Ѝ0xr00 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @h+mP/D0 R/0@-A1 P f@< .rh+O-Bp0 W vi0p 000 Ѝ`((0S 0S pP OY000 @  S! S0 30S oP 4Y 1Y 0 0 0 R @ S 0 oP Y0S Y0 00` S P0PS PH0SPPo0 00o0S ot0#?C S XPU  %l0X!0Cs0S;3PP0 PEX,h+xX% @VUUUO-$MHZS  R0P 0L`iDpE@ =0Y0 0S 0g hhmP`oaono@`0l@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C 0DS0  0hFoX 2 h0  B} V P0{ P>  PN P P!VUA`E DU@DP`0Mh JhGh@`"PD P AP;  JR !   ` D0U0@0!P`1 V0p00@  \`\nz`F`FV0p00@  DPEU@DU`E¨` Y @ RgGl@T`— R    BW0S 000 0 01g$ЍO0Y S ,h+0[eUxX%xQ%A-lP`Pp `}n@vn@0T I`P@ P P,h+@-P@p 0;0T0* p@Ѝp0 00f 0l` 0@ U@t 0mP  #%,h+Xh0p@-P@XP0Ps H` R :P 0S@@Q@pu#%,h+@-@(A,h+0k,h+0l,h+-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@Sb@-@Sb@-pP@`M,0 0( 0 00`Ѝ@- Ѝ䪃O-M P`@pm@mUjT0 0aPf 0D0PSY 0SV L00SRDkPPL00PTP]y@DO@W ;p U]PQWpV`KЦo`0 S`K0 r@PC@0 H<PT0 0P00L00$T X@Z  As cwccЍ00D R00S 0S jL0X#3pxrP 0 s똰FGFee  @ǀ0 EGrcP`-GF`jeme,h+`^,@-,, ($ +Ѝ䪃@-P@`$0 0  0 00`Ѝp@- Ѝ䪃@-pP@`M,0 0z( 0 00`Ѝ@- Ѝ䪃-@-00c h 9Ѝ Ѝ/ꪃp@-Pgl@llp,h+@-{7@- p@`+B$hYPU }% ]*00h@PU m%T ]*00000S$$ Ѝ0L+>+?Ph+xQ%?O-DAM@PP4q@ &@ ~O) @ \Pࠟ   P*Aߍ`V i {I`PX Y   =R@@0e `|dBh*|*xQ%.I .?1@-r0O-MM 0p@s`P2 :xPP* P ;IP 0S0 0Z    JPPkP 0 Q0 0PqۍЍ0P 0 ;0  05 3?x|,00S/ 0P #C@-|+<+@-T_P P <'Ae(^"Pq@x|A-@M @/m0S0|Q%P,  "mw0S#|P  a0Sl Y0] )PeQB@PaD'D*JB^&(ЍP@R>#P(P'20S IAP'.Ap 0$!P=~ X $P 0)AT RPP AP p`PP 0q+Q Sp 06&V`T(p`AT-@p0T-:W?Q  R@4Q p0Q  R@5AP`003/P 00  h0S  R l 10!@AP+++Sb@-MM+@(b+(UB+(bB+U(X@PލЍBO@P 0 T @@@@@ @@@@0&'B(,?zCxe -MM+ b+L U+ b+0U @P  ?ۍЍzCxe0@-@M k1@@$#P @! qP A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*@P3FP/[P+W@P'@P# 0P} <x}  0S 0_ Z(P @P4o0m)&)y*00++bCC^,^,@-@M Uk0@@1?v#P* ?@  qP 00*!R00$Q /*@P  {0S 0` 'P%(2*Ѝ++O-`M!  0X#*0S ` 0 SS 0fp0 S00C `@f0 S:ihPP@ B pQ %S0S iSc %S, dS `0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 `xX%7@-@ PPU e! Y&00 Ѝ0llP X M!L  YVj( 0$[*+?CCCC\Qp@-P @<00S   0 p@7 0@+FL+7@-@ PU ! LsY&00 Ѝ0VPP | 6]Yd00S j.L 0H[i%0 ,L+>IECC+\CxQ%s@-8Q`@:kX{ aie{`ew `^e6ye`77{{g 0 Al@Pxx5>6OP AtA`` ᵅC{Ѝp^,Sb/xQ%!DO--{MpP`0[ 0>p F @0S  9P R  -0S  $됵P X뀥P X,Lp@T Pe DtBT0B? 0yE ,P "K%@P "B%00MfPHfP; P  l}; B;0S >;P :; 400z4"0{ߍ4]U3 ,h0z"!`׋؋ 031,0l0,0L,0   L 0P600Pz?"!!0 #  PV e YP*U l @2 0S h2P 9{h0S h@PU rhL P0  T 0  SR 1P W 1 U 0I2 _z?0YCv0P0SP @ 0V0 R0SQ ᤡrW0S/ |P _yk  PS 2  +d-%ptbtlDf@L++EoD|*6~DR+DMD[DD<+*DDD.0@-0,MP0 00 0\PPP@P DDE@0Q ,?,Ѝ0@! h-%xQ%DL+ -O-piMs?!0WKP 00iߍOЍ/lx@PX1P L!L00w#@P jZ`  PPW0FSV030#Z0S c00W"#!` zP Pkp0W0#U80P , 00j#P#BL+PL DE-O-p0MT@X   p$p塏 `V X @M'U` TPPsbP-@P 8H E0ᕏfPU 0'SP0U*S/ xP l [ Eb0@ 0 0H0 "qP11Z j0城p`PUQ\T ( 2S022SP0220C2   S`` ɂWx$00 00( 0p|wW  @0   (PU PdQd(c0U 1 ]W 0X0C?o20S t] b$q](bdWx@0Ukg]d]Lx00CS0000 #T0U Z$0S  rE7NUg/xi 0%S @SJ B* BeD0 0l/00L 0.RP 0 0]cPH00ZpA@P 0A0 0X૎3 4Q7g Uw00X (Sc@0U dwz  0UX ~a\awcS PPW  WK0ЍO Ѝ/%EAE|VE+dht@^,P%AYE0@-CMlPP 0S .QwS@P 4\Cߍ0 P\ Th+Si+G-p@ 堀堐PB`AT:00Z W ,/Z 000 CSP EQ 0 @`ExX%A-`Pp p@ e ,p[ &P@Rj+A-P`@`opl [0S DQ0Q.SP @$ $N NTh+؁Si+@-M 00PDP  ~[ 0PDP  p[ p@ ( d a[ P_Ux@(  P[```p @A(PPЍ :N 6N`!iRl+%ipl+Rj+8i(l+LhO-8MXd0 @ZT400_0 ,aP40,   -8 4d0 w=C$ C><Tr P, 0.̟ Q(<P 00 ( 0 0uPPPPP8@<,`0tD0D, Dq,v `<I /  0p>0a XvZZ  aPP\  aPP;U 1sS 1lS;"000 RP p@ v zc! HvchH Qp0TKT[T{1D+0~, `P `P `P `P `P `P `P0:4: @p A*0p 0HAhp H0St:t*10ll MDP 0H0 H0Ahp 0 AP1PH , X$U R QPPP@;`P@- ,Y)0xV)0wQo`P\8 0\8UXLy0 y?T. 0)0z8 ;V`@PEPS%PN X0 "\6SE p0 6<@P: ;5 |t h[7S'  PH@C07@ P 0(AAP\XP@Ps:4S 0 zP 0'APxnP 6P'`0b@Pal\80<'8\8P,W 8X8 CPP0&08P 8X8m 1PP0060&S\880\8P 8 X8U0S d&8P 8X8F  PP000S\80\8 P0S\80\8P@sT %0}C\8%0|;5T$A Q0:$R$ Q9ğP \8şWt^ H4   3ᙐ4SP  0@?S @P GX4{ 0Q0:$R##\ğR#$R#W%HR($ 3 ( Ts0S1 `P 2@T P*LHoH#00S "0S <#|P3S3 TE 8"DC?00N?C0C ,>$P0  0@F0@P]EDP$A?p@Px080Ca@,0,P pM0S ,\ IX >0S@0 <oX+4AS< ". 0 0S D\D'W5S !"o0 0S $c\XPPXzTh+yEL+ExQ%ElEExX%-% uPj+D+kEgEx|il+oEG(G+dFXL Rj+\-FISSi+Rl+m+Fn+IEG3F[F_F\FzFFFFFFFFGF/GJG"GGm+9H+HCIm+pl+IIIdl+JJ1JNJkJvJp+JJJJ K'KEKJP 01/XL C-鿏P@,Mp]P3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ߍ;_KfKnK@-p`CM|@u]PlP#d0RXPP @ W<0080 `0(PCߍ;{KP+T+K +@-@ @+@-0  0 P @0@ =28 0/P $  ,ЍP+ R++e0@-0@XMP0  0@ P x x0 t0Ep@2P0/Q   LL 2 0/R@, ,@Ѝ0Th+ P++R+P+e+-MMMP\P  V V0 00SލЍ\0\ \TP L0 (0< 0, t+SP+Q++T++Kx+K@-RCMX6S 6P \8lP XT20S H&2\6S 8!2020"(Y2`Pr\8. q^|10 ^[:4S !TQ\@f10 H:4!SO *00 0 B=p:tt!2@P) M1d 0T-L*<'0S ,!, $!$0S   R cP\6S V < NCߍ 0 BTh+K+JGRj+KPj+LLK%l+LFdl+LIE)L4L\F_FSi+NLRl+fL)|*jLm+wLLLL@-@T^ S C @TR00S\0\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-p@PhM 0S'phЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/ 0\ P0//!01000/ 00#0//O-`$MPA@T ZY p&[P00 P0S 0S0S$ЍP P00 S [S, R ,0S R : 8 80R:P#3///@-@MP Mp! *0 `p Wd5\\ SS=S 8 d3R 0 ,c0 ^ڍ ЍTT}MM@-`QM p@ P PP uPЍZPTP0 p1P@$U@@[T @ @d0 @(PMYM)O-Pp0@0Mw'PP `ĐĠ0 R + PЍ 0L03/P 0 KX놁0 EX  @$0S P @iF @eF`+Mp@-P`o0@0S 0p@)F@-0MQ!p0`L0 3/P< 0t@T 4/@0p0 X 0W 0@$0S @F$0 @FT `@F @F@ X0S0C@ ,$@ r)Ѝ+M+d0[DSb0S/p@-P@J 0000p@O-p@P|M YF0P,0+`v,tP|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U/0 0L1<00 00OpP ,0<<0@D'@0S >P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0T  @-Z P 0P 0Pp PQ` QTyPQH "P <080P/,/(//tL Mwp@-8@Q0@P@DPp *Pp-%p@-P@P  R D00ppIE@-  p-%@- | p-%G-@PMP N/%[ Q0 0 s0S1 0S XP a-P ލN[0S J[0S1S P |XP @l0 1h0$1d0(1`0,1>1S nP >,%0`>\@`qpԠ( p$   $0fY 4 P 3SG `t Z Z00? (Ԁp䐍0<P 0S0)#0C?o27 #3RR  0R6p7P 'SH0pA(\ C~ QJ N`P PP @P  ,0!4!Pß0#pU2P  @000@0"'0N?P0'SpH0AR 0 B Q  > 0 0B,0!4!PŸ吀0#0!pJ YKR Y00K?(0811~$10 100 d@0 *x ,0!!P0#*0h peYMG/H>HMHYH}DxHq+QNEFXHM.xX%MN'Q`N@-PM`p PP 01p W@P  xPP 0$p P|@PQ 7/PЍlM +d@-0 0P Ѝx @-0 0PЍ O-aM,MQ 0`aݍ,Ѝ@PɭP VPK pVP0 QpL4PpUu80$P 00S 3/p0$Qrbb>0Eo`YG_FPEeVP 0000!/9PP 00S 3/pO003/No,P4DVP (S("t+"\B bl+bTB`QTP@``VBaV>+"DB+b?B3\QQ0QUh $P 00S 3/p $QUY ` p0 `` pxb.;8/ 0 ``px`;".6/0S3   B O0 0i`PxqxxU" b +`P  P]^P"+"Ab+ "`P UP# UP UP UP UP UP VxT A  A` (iPOx|M @++giNh+AKi SbqSOa!N00A-p$0p@` PAP0 @ p> C 01/@P00pЍpP@00003/003/$Am&NO-PUMM.hh,@4PW.zWQ_(x(FiU`V`(0$S^ 0(0(UݍЍT  n? 0.07 00P00@P#Ppύd40z(Y^ 4S =(7h400C2 7\4=1 V =V?h400C26\4=1 0 000000000 00pp`` , :0440\40s -1yv0 00 00000 0zap` 0440:40s -1ଔV3 `v00. nhE "MX5@0Y^ =2XL=1pP0Nόeph \  kv00$? 000*0(0S00Ӧ?"N?@/&#`@XT,0(04@S0S N?/$$,4pW 4 0}10  A .M ")M %M4!0p  1$,01(L!!,H48> C6$1^(1)0!4 $,10 (q,1 48qH!L$Q p{ \x^v #Ÿ@p#0Ÿ$1H0 0$4;p2P p>ؠCT $100$10 0: z0G80<@80Sp Pq $003/$`lSPM `qS!> ,! 26$H,@IS  GPp<PJ ;HSF 0.$10B04!8C0(1}1S0}1$1S `4@@+^,P% ZSb-%+@+p++L+nN_PP$030/0@o//BO-@P MMA E0*!Rp0)Q`U0 $0   P q Pp ,\*'0$0 |$(pP d4\,G ܍Ѝp 84oA0Spp0 @0 4p0SW00_ , R\  000x;8,9/PI 0  x8;,;/ 0 x8;,9/T08SS0CS񟗕 d `  Sn "Se S P0~  R{ <pWv  &P d0S P"8-H8 }8Rd0S $"8\0S  "8`0S !8X0S! S! 80W}L0@ \Q\0S ` R !8x8 B}lQlh<}`Q`\6}TQTP0}HQHX @1R<&}0Q0}P00P0)0YP0 U @& 'pPv 0Q  c+OYf!Ox|\kN |:O@ONOOVO]OQdON}OON UONONOOOONNON+O-UM0M*a8V"e&E'@r& pepT pW i&0 T0KT  Q ,囍ލЍ7 )qWd ^P FPq' nP ! @{P @p`H吴 XBT0SWd \ T 0S 0$< 0P00,0P FXP14s10#5:# ,&*&(&0S #&!& B PP0Z@DPA@ pe `V  H `p80  P 0 0 ,0ST0 S00 P0p800SS 04  0x; 8:/P00400ST0(ll S S @ 0 ( Sc  SV 0 <0tPP<0PL!@  PP ,0$  40x( P0 { ,1PP :PP 0005S0+4^WI 14  u0 S r0 jJ%а 0İ 0+PkL+P4POPkPPd+QQQQQQ(R.R4R=RDRFPOx|OOOOOOPPXQ UYOP,QQQQOO-@AMT MXp P`L @P`T $P```GPP@Aލ Ѝԃ̓C̳ @3 (4@$80DP@<@T@X eP \]430$3 00 P2 $02(408@Y =~P 5딢娂  (t208@d2@DDAT P2P"PP0#P <2 8%PI,2 $ *20)ATp !0% YP&!0%0 Z@0S o#P 0St H0@4 000@0x;8 8/P6  %P !b%@P 0  zp @$$0 +@pW:p@M MROi\RY` ?vnRRRRRX m۶R$M R(+P+Sb\kBbk0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  &PBq+s+ $0@-@"!P(@q+@-$@2S  02q+O- @P@B`P@   PP@ hL@p0Ec#రPU* ЍI A,P  ;,P @BI    R0S pxX%i@-@00 TP Q P 0<Ѝp C-`PJMM⼂```p 8aP@4PT_H(PejP8_ Yo`GFWI MP 0 000!00P < 8<1P#<@XNo<0S0 0< 8`PV 40,0'1@ 01A010000 l@@@@x,W@T0S7 0S(8LJݍЍAT P0 8`$!QQ@0RT<0P 0 003/@#S0 S(0S 0S8(0S003/@#S@@+ `/% 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> foS 0@o/b0 !!/w+10/Lp@-@4P0 `E1111pw+O-P@p`ԐԠ԰0/ C !  !0  PO00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝw+ h   0@-P@M/.N1, 00 0d0@00 0T0@@@@1 0 000@"P,mߍ0 w+O-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+ { 0 Q{ 0S  #E0 0P  P 0 0H  R,  4@T  8X $ T\ ( p` , d A- 0R 0  DQHa@1QRpB   !LAPAP&0 \AI0Q     TTAU @@w+!JSO-`BpX1MSL2X\1S,2\X1S \QUЍ0C`1@`1ST`I1PS \1 XX1! 0`1V$ 1x C H0C 0aXP 0 S 0.S  {Dp `Z!X&P Q0X`0 09X"M\P \!M000: SX1x 2 \1` 0[ 0 X1 ` SX10 2 $ e(7w+/% x+  X"  x|p@-MMP?PRoۍЍp/P@`+ D P*+p6 P*+6 P*1P-P*x|p@-&Mtp@k((+K`P:7 i<0 0H P (6*97(:* gi^ <@P vލp/aSSb+0M -W @-X@01SP@0S01S0  w+  O-p@MSP! c0   0 `尢Y Np` 0 0P0STߍP X%]P0 JP0 a0CS0S  P6U`08Sڠ0S( R% S]0  0 a00忿 p 0d1劅00 0s0Z+ 8p P` '0P!h!R( 00@(O x 00O0 0S* ?0!C  0z 0u0t00 00S 0wUa0 4bS\k d@edA y+Sw+aC-L1 @1 R0   A h9'Q   R 0<1LPDTPapHqGLP mGU `1DP1 gGU `1TP1 aGUP1 `1\GUp!00, p1@ ЍC 3M 9M w+\M JS@-M@ P @oЍ@-| 0S lP \0 T0T 0PP0L004 80<( Ѝ Ѝ+Sx+t+eP+UQ++@-p@Mp9t)0 0 0T00.00 0p $0t !Ѝw+M p@-L1@0P Fp@r/S-?@-P @ s R ,q0$@)XЍ0@ Ѝ/SS@-0  0M P L0L L@ 0< <@}0 $@vЍP+p$ R+eP++-3M M Tk9P0  4]HP WHo3ݍ Ѝx|-3M M M9P3ݍ Ѝx|00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PD @00( (0P,+|+Tx+S+t+7TUP+Q++@-0  0 P <08 0440000 0 Ѝt+9TP+S+Q++0$ 0!S/ /x+0$ 0 S/ /x+ 0( 0S0 10 1/x+w+11<0@ Q !@-0 " !/w+0 10 1/w+@-Mj/.J, 0l0d 060 P000@ 0e@,Cߍ/% w+0D D /Q/QQ Q/w+/%@-@0@ 0 0?OPЍ@T@- @0S00x+TT0@-pAMohPN @g@  JP<04Px9Z/70Aߍ0kTw+gTzT+@-P@ Y0P  RЍ+-@-   Ѝ Ѝ/-@-\0X0@P D  %Ѝ@Ѝ/IETTF-@-\0X0@P D  Ѝ@Ѝ/IETTFTT@-4P P PU UU@-@DP@ $o@-4@FP 0 P lt+Q++@-4@FP 0 P lP+++QA-@@1@#PP1P#Ttpt` `P t uqb  ??88ZAZ^,+7@-@X%P @ I7 0/ Ѝ0:UxQ%!U0@-EM̺P@ X? 6P0000U ($$0x:@Eߍ0+*w+@-pM<hA 6?+DH1^G P0x ,! %5D<0P H ` p 0000`0 0PP`PDߍpb02Dx:X JP (>(%(JaUw++\B4# vU /%UkT@-@P !0`RxzEP PP WxZP`h 1  T .%01I@0PU@T =7Y Ѝw+YEB/%@-@<i0@- 0& Ѝ0@- 0 Ѝ@-0@M00  0Ѝp@-P<@0/SpQ 4EPp@/%@- 0PT+P+O-$M@Sp`P 0 P( 0 PP0P00P p @0}PP0PySa00ͅ0݅ 000͕0ͅ$ЍUkH+\+Ux+R+UO--,M`B$O5@pq[)pPd $B5P@cdT00S@ BPPEUM T1T!TT厞$00  @$0VSS00Y00S B 0 C H C$ 50 0$0  0 $ VRR   P # 2R @D &>0@QB `P$ 4@,Ѝ VM  VA-`pP@P!= fPP 6/ApO-@ M$4`P Ѝp0P 0`A0 VSSTP$4-@- 00Ѝ Ѝ/ -@- 00Ѝ Ѝ/D A-p`PMMP\' pQp@u@ F⯹V ,(($$cp&  0Su 0CS2PJ{S0)  0x 0S8 0S r0S 0S QN@|FP$ 0 \k0 L@nD2P 00b0C?o270 姏0<(G?0SލЍ!7SkCP1Q! F?p@Foh!H1PH0  0M('  0S q0Sv 0Sr 0So QN@iP  00 @PYF? Q. QFHHnJVqYVuVhV+oVV+|+VeVn+/%m/;{KV+T+V\ ]-MM P  LP  tۍЍW-MM P  7P  _ۍЍ!Ws@-dP' P`P L%P0S . $. ,. 4. Pu @D`FP [Cv@TT/Ѝp؁9Wx0|+R/ @-d|+\0XT0PL0HD0@<08~40w+TW+\W +fW++n++P@-@ -%@0V+p@-@M L(@H@D0 #,0H ,0@@08hPp0: S H0BP b; ^;܍p,D 8DQ @P6@Pڨa <-PT81!|8<DQi T1 08808PP oQ &P00S ny < R t00 00000 00l0p@ m(t(0S!t+ӢP+Q++8+ pWM 'V +x+H+ O- 0CMSP0q ` @h0!`*0`SPW!000 @ 64@3/@P CߍW! 000Z 0SX 0 @QT W  00 0  0S l00S \  P0W0 ! !  000P+R+K+WWSbW8+Ww+7@-PQ@0 SS 8A0 000] Ѝ02S  WXx|O-(UMp !l4Q 7} aC#ß0/SCP3c0ЃC0P/UEA# 0SPAW|C1 dR` .PL(P$ 0RP KP 6C^ 0 10S 0S6 0 1S20S lP`F $l2lD:2TP !0 a40 0) 0R RP 10 1000`zRP 1R QA  1S Q00R /RSR UߍP 1 0000$0000 Q1 PKP 1 ;T1 1P U+ X+/%w+3Xx|Y Y(Y2YsY^,^,P+X&XLXXXX9Wp@-Ph`@TUapUP`JP  XpL7%SbO-`MMp\` `P kPP0P c 9/@ڍЍ jP jP PPP P5t@PI@ < i0= M?P0=S`  < ␜PxvV PP  Phx@  D$P@TSb3YY\Z2h*0p@-4 P@~A0 Pp@@-G-`P4 kA@T$ `V! p0F&04 p0RSP pkPp Pp40Su p 8Pp@T/0 R/@-`p0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ P@P  p@I@-@ >(<@9A-P@p`p0S 0pp R)A&05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-8JpЍP@` 寯p ᡯp   0ᒦ`{3V뚳 ot@ l=P\P LP د@ZT G/H>HMHYH}DxHYHYp@-PMM`; p  @Xp @P~@PۍЍpA-@P #@pP` P  0QPZ|d zd@@-PM Mp;P ` p  @0PQPU7@Pۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP600/00/40@-\80S0 S0010\80S  0\\@!SR0(SS QU S!0$0S\  0M 1Sp@- l@$\ 0P!QS:pQQ   P \ Q0\" 0 ,04S008 0803/P,000403/,, H0 , 4 T 8 X M 40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 Br Rt01 408 00803/P,000403/,, H0 , 4 T 8 X M 000/O-0@p 4MPPp`204ЍO$0 L03/P$ Ѐ0 \ p!D@ Z["H* 0*P T P , [p 58``pp 0S0P 004Ѝ0D+O-P@4`崁崑崡 Q 1SQ " 010 r 2 R  R V V $R RR 0S 1R",0S 0S0 0 0S 0`0 K3/P p  0!"0 0  `0RPH P00P0 < Q Q  Q R U Z C DW C C d O-0c(0M<00PSp@p`00 $ 80s!3r 0n9h0@l0 S@3` 0D@  43R0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0D00t2 p0 0'9HL0  900(, 00 09P23U 40p0P<0SOP0 L T00SH0Sjk000q p0 x0 a0 000000  P0 V0 00000PX 00808/80 PpQXQ Q(00,0p 0#U ^p a X0S h^ 0$0p0 0(00,0  0#0p4 =0x++Z|+ZZC-F`0pSPlM^t80S 80 S880S 80Sk80SG80SH~80SIw80SJp80S|i80Sab80SH[80S000$ R(000 "0A W(40S  0$S $SS $S)400 0$4 070D( m$80SL4 LQQ004Q00S $4Q $4 lЍCy W2W/Q Q R P P Q Q=0 L3003 070 Q lЍX300P3 070 0HS(0p`@ 0 2 SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@0 8"_, P0  R>0 H0L0 H0L0 H0L0 H0L0 H0L0 hH0L0  PH0L0@ 8H0L0U lЍC!SH000050PpG0  d 9/ 000(0[0x+U Z d ++[ [[C C C (f #[Df lX )[,[3[:[C[J[V[^[f[k[DW C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``S0 0pp07/@-M0@ 03/P 0 004000 4003/ލ@-`,MHP 1@0 0 0PP@00 RS THP pW H8P00P00P0,Ѝ @T@0/W/0  0W1H P00P0xX%d0@-$M@D0X  0P 00 00,0PH0Dd$Ѝ0)[G-%p(M@PV gXa `Pb`D^P08 ,`SS0 Q "S `P  P !X$U06$U ` 0 宑0 00 00 0% 0MPPmh(ЍD M t[TN [0D C-40PS,M80S,ЍS S S !S S @P `p䐟`S`X 0 e000 00t 000 0 00 0 0M*`Pt:x  Q * Bq Bq BQ B` B  0^7 0@ X@@p0 0,(0 @@@@@ p@@0`PUߍ 06'0 pD`∀HC *000*8b0A-0<0@SH04 `pP4V093?V090VP:0A!r0S/A-@P0\03/0 0    `0V R!  B B" 10C)Rp0!:P! 0 `0PPp !@` B"00080000$0 01P0100ATn qO-P@OM H(6a1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,pP5Oߍş[@P TşT0@0C0p0NC2 VH0 0$ 0 R̴ V 80L0TX 3/P1t0 00H03/ 0T 0000 3/P#%#& 00t80x 3/0lPp =-̍X 0 0|30t3700F00, C@! 01 SH0 V p .4tM` PP00P00X00 3/088q0X 0L03/l 0 , t T x X h H !0T`X 006/P `0d Q 10  0!s"D  V p0 BaD!2 B"W1ᴡ0C100C0 , `V`s`V T00 03/P0 0D 2#4`0Z5 P0a 0` 0d0  p D00CD!2 B"10C10 0?o2100C0= !V D+hN N U (O N H A-Pp`@f!l0P  p0Q pp 4R`P !@ B" 4T0 01`0(`10q0000v Lh 0S/ LP0 05/0P0 8p<  @  L 0P4 P p $ Q:  BS:Aߍ L`0 (06/P(0d 8< ` @]0`4 V  V  R U  U  RC $A0  ( /( P0 /p ,( ( ,0P 0 pP`p0  / 0P@/p`P\ p `P@0` O-0@AM++\O-@`4M0P\03/0 X ĀX p ppP(V 0 Y2 2 Z "00 " 0  C" 1 " X "0  !" " 0 " 0 "  C" 0CCW 2";0E0 0h20`2J00T 00DP<1,pp@12((4Ѝ嗓)08q P ,01P,0ZH D00z0v 0P P`%0,00弽0P8 @ 0S[00S[ ZP P00S`(0,(00V,00602 0i3/`Lh \+qn V  _ u`G -\hO l[J \ r|+x|@-@P00P/DP0S0x|O-pMCO TUtd4{ 00 rs= 8b0  * 0 P  0@0 B )R RtPQ0R r Q0CFS0TR000US00Ѝ@0  ||WPT00U00X@0 \%D1R4 !8R0 !R, R-RH T00U0(B.@ P'P 0R 0R [X T00U00} [XxT00U 000/SS<O +m+l\+T8 T(++ 8T+x|O-0MS@pأЍ`  eW0 @00PS8 cSG MS  0 mS  sS. gSR  0- 0S cS !MS @MSCS GS +0C?oW20S 000 00SSSR mS @ R O-OM M P#0 P0P<0@0@00P(0` 0H03/40080 00!6 0R 0  0(3/ 0Ps`` r S00 D&008&X6U\a`v0$0000s0,00$0%&p`0(`HpD0WX0h05R0lp0h > `pV Svh 5`U Tnh -PUhh 'VU 00 0$PTEZ씟0P`040dPS800O>0=C0D0 0,$xU 0S  T0PZ0 000D0P0 F0uPT0S tx.P 0S00Q00`Q0S 0L0 aA3/P 0Ȁ`0` 0&003/`Pdp0E0  7#`@0o?o,X` X 0 [0R0 `<0@ 000< R@  0S8X( a`v0"$0W$0,0-0,0$0&$0x D 06, 0xd0  0), 00 0 ,Ȑ 0 x0h00l010h Ht0pH+D9+ 5L L0` S*pV 0 TYYU 00 0\TNY0 4THYT0P0'$0, Q030#Q0S $0( A(02`FD_p 0 `&?00`P3/0A` ``Q/V*P[0H X 0A48`Tt(rOލ Ѝ+u\z\\+\G\ d\\@-@! 0$   0 P 0"ġ0S 0$ O-Mp @$ P(`|1/0@T 0P5P[0ZP0   0M+ @p0G+@Tp UZ@p 0 ;+ X00,8000P<00ͱT0,%000008@ C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a+$0pQ@-s㐻㈵ #"T R0//s@-(@T@ЍpH0P0 w003/@Pd\/@-tM`P @P0 p@@#P  30@Tp@tЍT0 @T|0t dl0l p] o`P L @P+{]x|]]į+]]](+]]/@-r 2@/]L///@-0@Q s@o?0 \ 0P000@-P4M0 *T0@T f' 0 !  @!4Ѝ0Y'@0į+//G-pP@`ㄐVT0S0S 'P$1H0PU6'0 X /'0 `p@]į+0SR00/p@-@P%<0P4`" 6D0# A@$!p++A-<`P@'Pp(   Aȯ+@-_@-p@-@M @)0 hk0S Y `L0LP03V 44 0 ܍pct+^(^F^1G-1`PM@1P1!!  xxaxavtK@Pl7ToP*.P0 [Թߍ BQB?O% 'pP0=SBC%?q@ B?`@EP ^ BMPt@4t P 0 T D :9T}Bh*\S^L+Sbh^a^o^1A-1P@,dp1P1X X T`T`  P  @帺 00cL+:9^^^^^@-0M02000`00Pp0d@P @T 1\ 1TO/11 'PO/11 Ѝl^R; 0@- wP n+C-`CM P@ `(eP pܐ܀0 `0`#0SO/11 Cߍ5S  xxl lPX \\T0S  <41, 1t+_s++0_A_P_u__M;Jp@-P@ 1 1  p+1p@-P`|@Px0 p@_p@-P@ȸP PN/1 1 p_Vp@-P@1⪲1(1 rP1 1 p_V@-㝸@b_C-@aM.p>(T[BP`᠂rU U.v20P$0 waPZ `"0(@80WPW @",PU , # 0ሹ,P@#PKS1PL0P P110PU)!,`pApP0S7 S1  @' 0` 0P@P`1\Ϸ0P~P aߍ@]0!fVPT0 ,\N?P0@9 D9 0 0 0F& 000 p @M7%L+++_(`~`=9:s+t+++5_I`^,^, K` A-P$p-@P a-@T " ߸vP( 0 NP  0ȸ P $@ᑹoЍW\\a P屸< 0 Ϳ`L+`oaa}` a5aeah//O-c@T Ѝ@T@T( ^& L U[Z [Сԑ YZ PUPE P P$P@ P$@0"/+O-4Mp(tfZ,@P @ P$ %R!0ͱV0 02"  0V @P 0'"@TPT0@P0 0 00000 0 T0$000R0#02S4Ѝ; 0 0 0S  R# S   @ 0  00PV@00V @P 0!@TPT0@P RK RH RE (  , ZQ R Z5 TT  Z! 0 S0 0@PV00V @P 0!@TPT0@P 0T00@PT Q Q0   .0@-4MP!! 0  P P"P@4Ѝ0@/@-@ @2ap@-P@/V7P `@ HW#0P P `Ra BQQ pQQ 0@S:p @-H0RH #@-e0@-P@04MS#!1PP Q*   P +U 0@S Q 0S4Ѝ0+0p@-@ ^T00PUPU' \$ST Tp 2@Q.^U@P@ @$ $ 0 00C 0p0 a~p@-,@P2%0P ;pA-@p```P匀0ST 0@P"Rp@PO + 00S@- /+p+C-麋X@(p,P0`$ 0АYĐY T  T: X0WaU|U VP P 0aU Ѝ V0  aaSS@-@P 0  1|@UYP ap@-P@0S|T0p 0 Tsp0"S @0<00Rp( T4p0 +++G-lP0`Sp@;S S 2@1+1:X bp  QBp\T.@T&RQ0000(Q $4!p Q 0S T v 0@1 00 0TRT0T"1+{p@-P@q@op1O-0@Sp`P 0 PQQQS SK0UȰС0r 0 $^0 0"90(Q $ p0, 1QX#  E vQ 00  R [ R pR H0H H3{ R# Ѝ 0W1Q:P ++bhP ap@-P@P0St!U 0E p(0"PE0U055403 0(2#p+++40@-0@SZDP0@0ӕ+O A-AP0`SH!U 0E p0耟@SV Ѝ 4 U(@0Ǵ`P `4p00 0@0K#Pp0P ϳH p7 `00 Pų0'p(0,0`+++)[swb1A-0PSp@` 0 PQQL SD0 # 2r 0 !Rv?000  (0V$0X3,0R 1RP0 0000 1Q\00R00S 0W1S` +E@- @O|00S T ]㬲Ѝ2O-X0MSM2"z\0@S2"`0Sb2|"d0S2d"|h0Sl2H"hH 80S@<80S 8( SRM80S 岴, 70pHPASTPPDP呩 @ⶕ@`P- @ \00`0d .0xh X hd;S XH!H@0GP@_o RݍЍ 0:S 000a 1 0 0 0 0C0 x;0CS||qPpbP abbbbbxX%ccc'cKcbcscO Fcc~cc{cAp@-XP@0SQ!R+)r00 S @ 0N Dp+O--BM MpX\ɲ@P 0`^ ;`( PpBލ ЍH0 ⷨP O Q 0 0 d!V`ppu0 $0!`4X00 (00Cv$0;S 'P 傺PW +RQ 0P \P SD0Rpʩ0S S 00S 00 0`S0S00000000 0 P 0S   0 R$ ?! 0$ S0S 0$ j edAcO-DMhPl`PDЍ @P >$6#Sp 0 `P` ;#S0Up0 d00\ `0h0x00X P$`P`t0 (04H000 00 00p;P b@-`X0Sg0 x\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP S &0[ ЍbQ abbbbO-0TM00 0$ 400 ,00(0 0800P! 0` @@{P$0SUppФ Q 0U U H0!<01PRPpPUp<0L @P PUDp p0S H0L HLPp00D S400@00P4p S 0  S PS p0S ;S S 21+1:$0S L$0,  QB\X<X4RQ2ȠP,$0)$0(Q $p(0 S ! 0S H (vz80ƀ1 0$ 0 0 0S0 0S 0$ TЍXRX0H"1+{O-P0M@DTЍp`ȠȰ@D0S W0@  0 0 `P1/Y  S      Q R  0@0Q0 0`Pp1/P $+P A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-@P`p1S 3/P @`VTd0@@T0P0S@000S4000S(0000AEQ +$+P U `\ p@-@4`4P0Sp@510S 3/@$+ +0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp `^$ 4R R0 0`40$ Rp `083/< 0 2 P   ` 000 0S0\000 t 00//00/00/00/10/Q@-@@L 0A0003/P@(A @e SbC-B`0SPEM;0)0pS!0 S| 0S 0SH 0S00Sk0S00$ R!000V F 3   &>0!C> f`0 010@0`ꪃ-++cSbO-PM0@߬0` P(" ج `b0  Y00 0Pp!W0@0 0C!K0g0p@尬 o@Qttql\@d塬 0 L!/H嘬 @p0 $!%$厬!p 0`쀟P0 R 3 P/Ѝ 0p!m0i ` `OT 0-00@p NR S3#:@`0ꪃ++[c+dd+,(d/A-@0`\03/ pPW@@P@OP< 0쀟DW  \-W0 U  0  !   0 00$ 1     t   Ch  0SJCT T0T TTws0B@@ r+q @ u -dQ yads@-P,`@/01Ѝp萱+p@-0(M0P,03/`0@ S:0 00 0 0 0 #p` 0A0j(Ѝp0 d O--PM4,@*PЍ pP 0p @r @<  PZ0H03/0S@`G@`@0 0}`P p" 0 Q!d2A 2I0C 00000008"  0$0㷨啥ᐭ0S("0 L0P 3/P X0P@T`@\0`0 S8<PZ 80S ,1 0, S001{40P ∡0L0 3/00 P0uF 00% % d 00qp`̩@r0,n0kph` ㈤80|$4@`!0 `40 000 f0,0p媧0$10?0\$109`\0@ pd0900S< p0 PÁt ,l3 000000 000 0 080pzp` j3d,0Rῤl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV 0P2Q PЍ4P00SZ 3/@@OoBS l@0&0010@!Rx!@!x@|@pPpt@ߠt0S|0X*@JP PQ 0!@x 0T:x0S@ #屨t@OoB@|0xT:@+dQ ad++ R 08/$ 4 +D uh  L+d>O-S[?UM< 00@48@`D AP <pPn Uߍ10P40 P,Q_3, 080S 0R@ <0S6(1SL0L ,H!0L\." C 4<#H@; $ۥإ 0@P8P @T "2B 40P 0S 3/P,00,02, 0SU@`PD`D@t w T2R壥| Y0N 噥 ,H!!LPH@0#,`P`T@入P D` 7@ 4,1,00 0000q @: %   , / , &ᯧ00P1:1!lM @0 000000 0000 00㲢p` D⎟D0U4 Q[T Y }{y4wv `n +$+dT nodQ adO-/0@JM M`0屚PP+ P) 0S% 0l"`!`\r\/e&0P T  0CT *0C/Q 00gP$@᎛m+  P:?0  ϛP+0: S `V >00ꨰ  UPJ>0@0/S> 02+ Y  S (P+ M  P*,P 0/S`0oo`bS 2p/0&000 SV+t# P*+ P*#P@!@]Jލ Ѝ؁e\x|@-ry*@-M @FP(0  @P ߙ P ЍP:00p R O-M` :PPp X`p㴠崰P$Ѝ0S @ P0  <pLP Xp0  @=eet eG-|M `P`P PP<+ ך@P@ 0 @ 9⿚ⵚ@PP+Jh IJ.0ĬA+JY :J.0T㵬T2X 㮬PP~D)4 ᥬPPu$>+J9 0J.ᕬPPe.+J)   J?` ~PPN+J tpll40 0J>أP 0 ._P UT [ލ1P@Y+J J0PPp0J.:@+  /P h lJ>(PR e!e,e2e 80s$0(0, `pX05 0 %500%` 0$0 0$0S000]d5\` @@`彜@0S 80< 03/P0p80<P Ѝpv'80s Ф 0Q:8`0S0L0` 3/P  &[Z T0 SW`vp 0 D 0$`Ⳣ0$00  0 0 0#3P00 0`0000 0刢$0Sr D##D Ra @Z%R[eP*%0B?o 2 0; H 2/$0`SpHL I 2# V 0  0 M Y0 ; 0 P pX00 0  , (0  P   0S {(0, ;DQ0v1;0 H0$0L010,!<1H0$00, `P Q    R PP0 Z{[ 8 40P40 Yp 0pY 8pB YP  P 0 0 ; ,(0\j Q r,00a+erf+6\xX%+Xx|C-pQ|MW0PSSp`0 00 P  "  w " 0@T0 S>T2x@&L"@(n@@,0S:(Ҡ(0"Pb@P  00+0@080s=0 0( T  W|Ѝ#㬠!@&(:00T1 0$ X!00  C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1\!S<1@100> C @ @lPp( ,L"#0|@0 '8t0' m0 W &%, –0徖80000, 0 >0尖0嬖80000  0'8T0圖0H嘖LH0P (P0W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000˓pp 85P,0ᣐXpW) 0GSC0.(>P C$ 00S H @3/Wv@DpH L0] YZX03/ 0! 05@0L0 3/P 00S 0SpW+ WP0pH03/ 0! P7/P%$%$)@0 Q1XYK @1003/Q  01/ 0S 2"<]$Є  0;P  0+ Hp0  @D@0 ᄀX80X> Pnm,0S pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P~ 000#++p408/ $ 4 +D  uh x|gT f 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-Yp@P` 0< # 80s#   002  0 S R( 0S%   吁( R Q0 2T 0 < {+800 s"000S   `l 1 SR0r01/+!0 /+$1p@-S@ x1SP $003/p@訖x1祖P$1 0SO-@0`PKMM0((0DpH0S >I @=0 0<0o- %#{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,⃑ppK܍Ѝ([ȑ(0S*< o #8 ;c&@@ u-O-`0@PMM,0d1d0p 0S (0 S> 9 H 00 0 <0.%#@~40kP`0V,p0U 0000000 0 0000000 00*p`ލЍ,o,0S*< #, 00A"X R00C0C0000S0 0,0A$P+ u@-@-0  !<$10(10,1P001.@-@}0 0! 0O-,MTTpPP`0 Rヾ,Ѝ "P9 @@5/jP`K L` V`G2 B 0" ( 00 0噐`wr0,ЍO/@[;p@-@Q-666667P 0 P40 Pl <0`p@PP80 P<,0 P00 p'3g)=g*+p@-PBMH`@Ғ  V778,8D8x8888989`99P廒 0P岒 Bߍp`姒P00S0`園40Pl`喒80PS<80  0X0S,!@ 傒 0Pz\0 `0S  @`id0Ph0S @l0S @|p0SD @P`Et0P^9Gg:Qg;=2>?]gggA)BCE@-PAMH`@*  V(0::::;0D`qK0 @0S    8`V@ 0 #P 0#Aߍ(0S l 冒@d,0S D |@@00S ( r@ ^+d/Gg)12gg30@-AMP@0Q*;<<<<< =$=<=T=㽑  z mq0`N 0S (0S  `  \,`V DAߍ4噑  V Iq0`N 0S (0S  <  8,`VPy $0Pp 0 Pj0 Ppd0 P\^0 PHX0 PR 0 0[+dSbkg   60S O-@MV M=Pn 00x R# R0`^嬵嬅adDp80  @Q D0 P8  3PD  H  `V8p00(0S%≑$B00,0S$|$B0000S$o$B0+ 0 p0B/Ppὠ C"U0S1 `F` Qr됣0p⇞ 0S  `,pYV o$ <8r4`Ύ ⍷0`0"  !ߍ@廎 0  0S  r `pV 妎 0  1 PS0N  T唎 0  0S @0S@兎 ߍG<0040!00 @0Fo$ 0DL03/00 Gppqr0S !0PD` 0S   p8` V0(a x Q0W 8 < RFO    0@ /-@" 0  e R0Wx 0⨎  VhdghgWii+d)[rh&Sbxhhwh.c@-x @+0 @0p0ΕdЩ @Jqh@-D @000(0,0000幕d㻩 @5qꐯhp@-XQ`0@sJM@!   0,1S:KLDLLLLJߍp0 00@ @@0P(@0 ('0 0(0000 0َ(,P(,4P,@,P0@00:%u5)670p@-QPM,0$0`s@|!   0(ˊ$1 SIMMMMMTN`NlNxNN 1$ 嗇PЍp 0 ,⎇,0S$0YP@0 0⽍0 000000 0o0,P0,!^@HP@@P@8P @00:%u+ )O-P`00 P2" 0`00 0)1S080.0$qWp80P$P! 0SL0X 3/P h U PU 00$%1/Pt0S _PUp0a00Vp0  0P10S D0 0D0 lQ0 00  10S 41L000PP00 000T0D0 00S D0 0D0 P 2 b"` 0  }/40 0h S0C 1ġWߍ @++h++p+ 8e+0U DU ++lU ]g`l  0r 80" 00$! 0 0D080W0L0X 3/Pp 0SWht0S 0_SLʚ  G0 2  0` 00 p80 K0G-pP@㴠崐(M0TG 0^ ^ 0S 0 @❉`P aV@(Ѝ@@+C-@4MT2P`p!PP 0 L0T3/P  Q000T0SX0`pS@, XT $0Sb S L L0S004Ѝ0CS@Df7#(`,0t+ܼ30S/O-@SMP 000`#/X0`P DD <3P $    00 ,0 P0S* XZ'0 3PP Tq 0 x0.0I1P/S X(?0(0 00K0SvU ( 0S `Pp (00!15:% p P q Q 0, ($!p p $ P^ 00 8a4Q101T/ +T+@+eBjx|eii0S@0@-S@00 0S/X+60O-P̲EM 02@T PP0 2P |1S$ $P| 003/P `2P X @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 ~pPP2@0S- $P* 0 x0D 0S+6+k +h7T+N+ܼ+*kA-$A0MT@ QP` 0p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T  @TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 ++++++\0p@-T00P SDPPp0AS@  1SADp++@+0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^@ ^T 0S"(+l0\ Q0/\P ^U Q0000@-(+0O-`GMM40X2@TL2V 00 0 0000000@@@@ 0h➀p@c<  + G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 x0@W 47 `4}Ⴠ4 VL0 <0G, ,,L@+u +0@-PDM@S P08 @\ 0@  Dd  J0 0DЍ00S+0@-@DMP. P0, P\ 0P  0T   R X  !0S0000000 0DЍ000S+p@-@Q`P@M<E@P   T0 0SP@Ѝp@脄0 @00 D0U@Ѝp+17@-@SWXzpzzH{`{x{{ Ѝ0!b|P4PP<<0P0<0P0<0P0<04PP<0 S, 0<0uP<0 S@  0",|080#&|0,0$ |000003;LC@-@PD x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍpmo3Y@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P q0 $< i <Uú l0$壼P 0|! w|Ѝ0+a@-80@SP`4Mc00 0ρP 003/00$1U Ut  4ЍS0 000 0xp 7/( (0: SHkS0p@-PQ0M0@$ 0x`0 6/8 `Px1Gx1a1S0C€10ЍpRkp@-@P 0jP  Pp0S@}p WP Pp0S 4! B! BP  ؉Pp0S h2P R 0L ĉ 4忉Ppp6dkh7tkܼkiFkkO-uM Mp, Z-H0cS_ Cx0SSozB0S ㏁PBԒ0SrzIJB0Sbz2 P     P x2@    PP2 HD     P>0x0001 @@K @P @ PHPP< ,#h@ ,D@/1K 01R010|100P P 0u}p@  P04Kz} 0S10$1S 10 0Suݍ ЍPaHPkPj1S |!R P  :%+++ +T+++++t+8+X+++ 1D0+@+@-@ឪ00S @P很+k@-@PЍp$QU0 Y`P PP> C  01/P ,00 H$L Q>+80S @-0 F/U m kG-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  4T P $QY]$00S U 0 |1 08Ѝp_P ֭P P Q ᅭ  P ­  ቭP +A-M|P8 U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `pXEH2 08 8/PD? 0!! `b7#`00  3/P"#"#00 03/p p0` L03/὿ o⏭` 0SWp`?`B414!44E0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv dh 0 |1 0? U U  k+G-`RM@Xr ᰿PP XnP`H `TP P7   %up O0S `ߍ<08 H(00,0 000040!04 04$0D0(0P xWZ  tpT htp* \1Xvn` 8  4IT ({T wT sT oT 0,0iT0 eT  tp 0`?`a8SdPb 0  0**0P0崵 ? 0* ꄛd@edAzd@!oFě֛A-PMPp`;@ p@P  P06PsU 0 2 "0 ݍ /O-ЍdsX l@-mw0SЍ@-@M wT0  CR$00S ЍwA-pP@0ST 0S` @5Pwo2\ Eo@-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p++08S^-/+, p@-@ 0(  P0R0PS 00SYj ppC-@`PNMM< ЀuM0 ` P `Pj000 ;@PD Sap_NލЍ_ llydG-xM` @pᜐ堠ZP! |!0@P 0S PU 0 R<D1D!DDz100S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZL   vYZ( ( Aj긿oH] Eo\kgOO-`p@BMMP/0;@ D0P0p X@;$  )j P) @_z BލЍqiP (0  h   j0/SX k0H, k!14"So[ 1 SR 1S  RS1S1Sr`2pB@?↯0Q 30 STS "0SO[@8jpPI P 04 8 < QR@ Q  A R !Q Q Q "r " 0뿄ϥ00 " "ko@ U01U01VMKURXA- 0MHd t1t!tt?0Pi@PP0ЍT00剄 0R`0 !?020 20#02p104 pj" 0PS" $0Q00 L03/P Q P0Q    R D0QR003/~n\] Eo>+P/A-uo\vwR2UR@C0B0Eҁ@0$H#8@ 0A- @P^U PP0 8^ @T 'hP ` ` `b` ` p Sp` 2 q!aPaa Wj00`U08RP08}/ ^Q 0Sp`82S011111111108 r2aq40S0Sp  P P2S222J040UP 2SX<oO-bM M 00 QP $00/;L0P0`bލ Ѝ$ ^p y?`x00@ ,(Z 2S 1S,2,",,.0@0 Ḁἰ        0S@!? U㪋p ኤ< (gP^bV ]T&PRQ 0 0 p  W p!p'q ?p? @p  W p!p'q??p0g@P%  0eJ  pg?WU E ,(M pgFi?W U `d@o] EoUs@-RU0 \.@`d0T `Š"; P0H0N`04 oЍpoy] Eoo@-@ ^ @ T@@@ Pp` TPPVPU Sx   D L"4 0"8 0.4 0@.800 0",<< . 0+D+O-P@dM0p4005Q 0 }Q Xg QP08B^  RW* 40'D0Q   R0RS 0}υ^ @^TX 0SQQY WpdЍb004@F@  0@TT0@ 0@4P SD 0`P P\ X 0`VBT`@00T04R21 SR8080<0 0Q<0$02ơ 028 02S01  (, ,(0 PH W2r`!R   R 2S SX 2Ƒ1 0 Y  ZW1Kt "QR 0S1!-02#38P0WZ eV,0$ S 802o(0 0<pPD @0 Ă2Z02HY PY g 3L0S 1P0S`10T08<  01Z o 0  RP   0SH0\ \2 P H+pJp] TEo] lO-@|MHX0(S S|ЍS S7 x( [d8d(ddn,D S0@ }(00$0,,QT@0S4000(S$0000Q 00S 0[SX770QP"4!( $ (00) 0P00U00( 000$00 00 U00040 080408 0,000, S 0 08B4X6~u? v?( $R BT@2r/00q?`0sh00`0 ( R   T R,0S0u0<0lepP<0=X50B\0o_P0"H``V PV f 0( 8 @0o/O @0S U SQ0-  T 000 0/ !o/ S㴲< $ 0  ,0S00@P0PT000S@ P0bb P0;c0@SP0 0HL R   ? ; ?8/Z[d0P `@10d ἐ 09/0P@\Ѝ)+G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/+>0@-@0M 410810!|a0 P0u0L a0 I0PU ! 5/္Ѝ0+,X@- H`X@ V@->}@ 0  bE`몃qxQ%@-<@0s W(00pp c0CoT:%+,-$M ?0 0 DW$Ѝ0-4M 00 000[P4ЍO--pKMDUW " Wx4 0`p0 `V0 R`V"R0*`ğ p$ T0S 0s 0SKߍ0S P (Zc30SP #)aP#S 07᭥{ A0 ( A{{:?dSd( 0(#e`3P 3R - BP   BRڛ 2図"B "( e"2`P 0Ÿ R#3SPjS0l 10h"0(0e`0P P 0 0SZP=9 =:qk{1 AP09= A { Q; 5 P;!%#3\Q0  d 0 (0 eP!`$1@P0& d( SP P* 0"%+0!V5 T`@0S(0d K`@0 0(pp:UY@.A+,+,,,+,XcC+,Sb+,y+,Q] yyzz*zA+,+,@~ry7z)d0P #0 A  A k{I{7{z\0WW0P  ``S{@<I(0P<pI{f0 _@  _@-@s@SRG-@  700pP ąP:<`X:00X 0_P/@-P@`pP0S -S :S S  000`  0 \0P0 ЍU0S T  APxX%p@-@PTp  `T@TU6700@pp@-P 4`Tp@  ]TPT@p@-M@ Up$ ЍG-`p@T2 P  ᄾP0IPE {PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝx|p@-P R`@0 @ BU0 00S o UP3PE Ѝpp@-P@@IUpPppA-@Pp p` j 80W0 |0WxX Uh0X`0 P  0h0H ^ЍU0 P 0 וwrrr؁@-`0tM0F?oP2p @pT TpST@Sp h2STp L0V#4 - tЍUh"Spp@-@0  ~S0 S " 0PUPUp@_0S   0 0S __0S   0 0S __A-p@PMU `0S@PE7  K0P004ۍX700S @ Q@BPE@C0 00 pL 0S 0#S @UX ^ s.s@s@-M@ H Rp8lۍP  ^ p@-\1@0S`M @@>  <P  0 !   RpR0 S N09S 0Ѝp0 S   000 00P0 PS @ d0  pDL  Ѝp@ pLs _ _ hs(rsp@-@$`P\Pp0 @ `P0 002 0pp@-SP@`xM  _j0 0_Rp@) MRp'  GRp! ARp  ;Rp  P  L0  p,4#xЍp (R2_ Ls(rs0 0 s@->@P`Mp @ p0 p`` P0:p @ 40 pЍpDB_ rs4p@-@PqP  Q01pP`qpJ Q0#1pp@-pM0 p @ QpQ@pЍG-QM6700ۍ   Y & @`V WQ@pP`@-`R00 Ѝ@PTp \@P  Q*@ 0S0S0 S   0 0S0 S* ]P ` ]]0ST   00000`0 @@P0   (@-@+@ P_ L1p@-S@T1S#d1S.RU9lRUppbV:l]lbp1C]L10CL1L1PSʖ]0P11C]T10CT1T1XSʈ]0X11C]d10Cd1d1hSz]0h12,P0C2bVl]bp2,P0Cp27@-@0 PP" H10 D1 <80@8@- CB Ѝ0@0 Ѝ0Q@-@    b}PP p "00` Ѝ@ Q @ 00b pЍ@l ЍLsg_ rsQ@-@  i  MPP p 00Q Ѝ@ 1S70|\ZP| 01@ 40& pЍ@0 ЍLsx_ rs@-t0M0@Q0$*p Ѝ  _ s081/@-@d'P0S  P 0800L0S S@ ~'ssw@-p!@RM Qt0 p ЍAp1Ss0@-800@@@ P@-@)p t10cSt14 Ѝ@- @d 0 ЍshQ7@-@  ,, _ BOp  PO Ѝ0@ P 11P,|1@ R  |&qAQP |`00CS`0 X[@ T0Wp 0< Ѝ0@a X0 X Ѝ0Ls_ Q%P%rsp@-PDGOp44p@2 @Pp* p@KOE sp@-P@ ` 08 l, X>U\& 0m 0 008 , 81pp@ s#sp@-`<1P:<1x1S0p0@Tp 0S    0@-@T 0S @G-`P-H0$:0@0   10 &000 0sH0 D"4S4$ 0>0S0&0 Pp0P GW  g080jP0403?@- @T08 00  SHP $  :HHP%p@-8Q ,PMp0 ,N0,1 Ѝ@tP_ st!` p@-@l <=  x1P`PUp@P 0S^%P%p@ fs@-t0@SPLM 0$Q0@(p 00 p0 `P s LЍU @ x⪾ \| 2`H1 0D1xP"`!` 4tFtO-@PP 0p4` R ' 0 08   ~0 0 XU @N 8< 0S 08   Ѝ^tt7@-@P@0H!D Ѝ0A-鸀@x0P P ЍA E 0 ` 1 0  0x1PU 0" 0SHP ЍAET 0S 800 P P ЍtttA- M@` P,L`p$ PO 0S PuPU{ 0 P8`V,P  !Er ЍAF$ @$;080SV $0| pOA0SK D ЍA 90S $  + e p A ЍA! U0 0S V ] P0S t`QP  7,t R XP 0S ;P; 0S 08# ЍA Ѝtt ust6` ul l<xG 㵾Pʌd` hsuuumuu]ufu ,,}uuuluuu@-@ ! ,Kp  P<1  ,;, K0,1ЍP0@D<1 P$6Lsu` vvBv Q/@-@  0S@C-q`@ xh @P_00@ 0S  z0 Sx   0 @ Ѝ 0 pPt> @P 50@0PE.W  x+ PP 0S  I$0$0> R>  **X 7 0S /@0 S   000x1  @  0SP P 090 S   0Wvnv` wvv0C-MM000@"0XKp,002P؁+ JP`pQ v07S 0 S W h0 0\!`1  `Px1 (ލЍ PpP  R쀟쐟PU Vxx x 0 S   x0 ppP 0 Px1p  P  0S 0r0 P` vvvt)`(Q@-@  ll7+p;07S@Y40 S 00VS,0S@Ls` A-`R@p@M PP U70l0h @ЍAp"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *9P 0S( <0 *?  <05 | 0S 0d  r 0S>0 P 0SV>P  *@ЍA趺` F7wTwwO-p@`,$MPP   P 00A $ЍO|Py P000 pp X&SP  Ծ   ع0pG 0pG0 ZppI[U3#pp pp  [p#3s 8118100x1Z* rHPx1C 81181kP NP  6Pp4PpUPpP xP nP p 0S 00 IP  YY p 000 0SZ81181$Ѝ 'P  YY qp 00`` 00T0 :0G [W 000x1 Z R& ` @P `[` @H0` 0 00  WB W W 0S 0`0 7 0S [ xx{0P 0S [{0 xrqw{wwwwwJ%a w#p@-@>Pp0?R02P?004,003?00> *;> 0Cp耼p@-p1PSM"`! %@P T 0p1!V  T 0S X\zQP Ds@tAtЍpp>0S \0x1@T l1S R  @>0S@ E`l1S   0 @ =@P 0  @  B.(0$p ,)l1S NbSb(a | 0 R/ 1/$,,/A-@P 1 !  SXpR0 qP 0`0S000S \ \-QP0 S   00S000@00P10 paU01a GD0P@-p0p ppq R00P RG0 U  Aa p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@PG p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LL Y@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@JP@P0S 0S0 @@Ta aʚ;r@-@^~00 Ѝ ^   ʚ;@-0 Ѝ@-@P`pᦽ, 0B0 0p"#l ЍMb@Bp@-P(0 sPUPUR PU PTP,PP@PP4PP4\pQ@ ha P)@-0 I0PT0/a P@-0 :0T0/a //P@-$0$ $$'#08D0a @-,MP` ❿1U0@0$00  0p@000 0<0S Ep,Ѝ8010C>SĿ00@( ( 03(00@000 0<0S80 ϼp @=a Y@-XgP@P $FpQ@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0hQPU `0 P  S   p0 D00C0HOQ0HPLPU0 P(P0P0V00 S   07Q0 S ,  0.Q0 S 4  0%Q@-@@QC-@PM pbĂT0SY 00C01@0S D3/2",(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0SH- L0 S* P% HLH R 0|S0       @@U 0 HN0SPp0S} `Ѝ\r P RUk Yh T0e0S 0S   PE  \P 03/$,,a @-8 0b(@ Lp@ t@ЍxQ%A-`M4PspM 'E0 hNp@ jC@ۍЍ4F P ڣ# "P  RP@@#C 0 ,$@4   YR\:%xQ%-@-   Ѝ Ѝ/@-MMP`@p0  $N#R 0pۍЍF-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/\:% 0p/Q\:%p@-MM p Bp P@;00 dSV j00@ۍЍp P0 4Od\:%Sb0/\:%@-$@@Q4 @Q\:%p@-dP@I; P#4 P P  i yQT 0V00pp\:%xQ%nQ@-@P`:?@O@-q@ B01p {B01@!Cp@-PM@` ᯼  b0 TCp 1@ R! 0 p`Ѝpii$0 /L0s P/0 #:60#//A->PXMUV0P0XЍU700p@ `R0 PU B0>000 <0  ,> J!PP> *⍳ꋀ@-@T>@Q/@-@T?@0P/ R R /0G-`P M`0(0S @ ²P P ỲP:`P 0!00 0   P08S0 600 Ѝ080 00S # `pP `P)0P 0iS.S  `P04S 040:SxX%0@-@PDM QP@T 00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S Q 0  p=@P @-骻000Q/Px1P/$0/@-@M  D  0 XBpЍ~iO-YM `F/@H,9X0KpP pYߍ0epaM 0S 0S PP@ Y ⌸P @T0SL0瀸P 0@S0@S@@T1S X1 ◉PAT1S@\1S`1 ≉P5\1 S S R@L1SP1 xP&L1PC_oSRPU@7 P0HS 0s00P 0*m81 T48#88 S R p S 0 S T X @@?@0?H0gp 0P0H0}>H0 @;000L0PPPa ݀i4A-p X`0P M0 @R  RT T 1 #  0@ @ QPUx!@T00 Ѝ S @@@-@@p !p !p`?Ȁ %0R% -@ r % A  !@   + "*  ) Q%£ £    + "*  ) Q%£ £ /A-`Pe@P─@Ѝ ⺖P\zKxKP0 qP dpP 9a A-PRp@ M 0S0T00 Ѝ/P xP&`0 00 0  J0S TT 7PTP/00T 7@WO-P@v0"S0Z"SJP Y ppP w70p0 ЍT WuYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8daaaaaa4baaaDbT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: * U*`XJ:0\S 0}   0P0N[ SP0Sl  *PTPp@]pxX%P /0 S S /S/P0/S 0 S S/0/O-Pc@P ЍO^=`P hha ЍOIN U qWIec@P  P 1 A Ѝ=ᖥ0@S- P'[ Dc`PI ``HP 0 0  0 0a hp@-@P I` 0SPI$` PP(0S $I0(0$0p,e P,e PO-4M10C`p@XPS|||qqq`r s4ssssP 0<0UH& 0S# /ZPp؀  &P00<0/H`P 00 /0P0 000H060U ,0 00 0 K,0HS  >h 0A  a/p`  P 4p@AK0  U ( U ,P 0S U 0 p H0 50d h050,0 % 00 0 ,00,pYL 4$ U%PPeU700 5$)0 5(@pp 0 *  0 p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0  K,0HS ;U H0P SPH0;00H090U ` dk`,DpPۯ D`P 0$'D CaiFH0Q7;0UlQ 嚱P0l1 哱P0l1 匱P0l1 P pdE0P p1tH000~U10H 2xiP0H 2p aP 0H 2h YP TPH Z H000TH020OU  0pPl_ H0 S;70<H0207H0602H0;0-H080(UV <1#8b0w4儒00 0 P000 0 P0P0P@U2 <18∂04gr000 0 P00 0 PP00 0 Pp@0  @U =IP fp ᫰PWH0p000 SP0<00 ᐰP WH p P  ူPWHp   sP  mP  xgP  daP=WH  BlP R  ($p 00v ,p 00cpPj $ ( H,8  P> B9 \PWH B( $tp? 4pP; ((d (a H$8]  P  B~X:%a E ځoM#6S] Q΂~  $-HTawtƒуރCjzЄj !*4CyY1<am @ӅH "*`YRer{:#oa 20*NC8= GNg  }P  4wPW ,0 00 0D H,0HSx  [P /o"Bh ($P/۟P0H (0EPo 7$ ! (0'0J ($Pa/ὟP0H  (0'PQ 7$ ! (0 '0,UZ H0&X UCX H020H0 0005/H000 H000H0 00H0 00(07600R 2 \ *W350S00T01=5 =50H0U <10@0P@(470'P 0S<eU H$vC\P$U 81 800 ,0 00 0 G,0S0H0800 .PP0 0 P 0 04&H010H010}H000xH050sH050nH000iH,';,cUaH090[AK3O0\ U0` 0 ZHAKοOAK OAKҿOL+Un \0@T$h(@" `P  ,00@G,0 SPP  pP0:0ጞP  ,00 G,XHLDPPpP`|=fPDP`|PmpPh CPoP`pPj CPaPRpP$f 0CPSPDpPTl dCP` xCPi CPl CPb CP`Y    8lw X W$ ,CPc @CP PCP` d{CP` xuCP` oCP ` iCP@` cCPh ]CPd WCPe QCPe l JCPe DCPl 0>CPg D8CPg X2CPl l,CPl| |&CP ft W ZP0$, PP"  A P|P00CpPb [pP  R  R 0,PS0P , S%00 0$0(00XH` p Ӫ@ j dZ`0P ʎJZ\0PZ Z U HP70P7H0"800H080H07 00H070U W6P0h2|h2S H000qH070lU `P 00`RHpP؀G 0JP @EPVGJ d;P t6P@1Ȁ0<H0407H0302H, 4,,H020'UU 0 pH 5H000H000H0@00 U8 ,0 00 0 E,0HS U# ,0 00 0 E,0HS U ,0 00 0 D,0HS8 j& (O-pУ@`P8 P ᨫP `nV<1P ЍOR$ RZ0 ,08 ЍO Ѝa #"O-S$M04 @ 0Q`P  8Ȁpz⨠娰<1H0  00Ep0   h    P U (  5 $ЍJ%wwa h,A-PQH 1`Sp/1Sp4x1pS8  ??$?0g47S90?8g<7S:8?@gD7S;@?HgL7S<H?(?A?? 1pP??1pP?X  YP T0 ST47,`0C47 <7,`0C<7D7,`0CD7L7,`0CL7O-MP``X@ D3&7 D0 + 0+0 0P70P7}? G000 0:00 30000% _p 2 +8 0 D 0p0 D+ ਣ0 P#Z 1H0E,=P0047(8␣P,:؍<Ѝ80Ԕ$080,CP(/p,078247024<7囗 SJp,8>@D7囗 SD@>0H'87l"L'<7@7D7p"H7L7808 p,20!C ((P ((pW 400000(0 00Q(@(0S 0 S S0P\S @pp8000SS ,38 P,,00  CP 0?o20804P0P$0pB(8(P v((0S0' & © PN(PI Z$d hⱉPP78=0ѧ0@(0S 0 S S0P\S 00@ :0P  zpPpP80,C9P(0)S YL ;?00(hQdqWPpdq P DnP0S (P d `P 0S (P VpPP| 0)R00S GP W400000(0 0  00S D:$ D000Xh i @,,@ h j h*F Ԇ0Q//Q *///G-p0@0P `3P Y 0 0 `R:S@C@3@D"X HG]U( HG蠢A-TpW0 T`@V0 L0LS @sP X X| |00 S HH0P 0RS mh p@-P @PpR=@-0:@P p7i uP@-,0, ,,Qc0 T蚊?i up@-@P,0, ,,PP puHi Po@-$0$ $xT0SH<gvꚊOi A-PQPO0 dgU0x ` џ@T ʟVp 0V 90V@Wi q>p@-@Pp PᮟPpT0 p@1@-0@+T 0@0T0S@-0  ꆊei A-@QX2X"XXT0p  Q081800` ᤞPPW 3pb0S^ U @@&P "P @T T0Rt0t 0SP t0+ t0( 88P) W(( tt0 . p0S pt0S@6hPT0$0x x0R lD@ t0 pK0S (Ꙋri ;ۊ̊A-`P Pc_؞@T ўT0pS@p@-Q Mz0 DT0S0 PU|0h xPc_`ߝ@P Ǟ0 @ 99  Ѝp蚊yi G-Pp0M 帝ⵝ ⲝ  #P 6@81A0 81<(P  0Ѝ |B a@T{   ZT0 R0 0800+ P T8p0SS90SSnPT0c f`P| 7 |0   P @T T0R88tPY0Sx x0R 0 +⑝T \00XXSP  &P T T0R88BP\p70VS tc_ ӝ@TG ˝0`SS-90SS)PT00S8 00 H*: S R  v p 0S 0S W@⶝T 00,F ო@Pi i i -Ai QA-PP@pQ_` { 0t0cR0a100FS  A!/gP@-;000 00S /00Ji UP@-Q000 00S /00Ji UP@-}H0H H0S Sov/00Ji UP@-D0D D0S SpZ/00Ji UP@-H0H Hx0S S,0@o?/00Ji U bp@-@Q0 ZRP_0 0`S0 SQ 0` W7p@p0 p@iW0 p@4 ꀋj {U1@0P@-x0x xx#Qih0X  P R !P BR #@+@蔋 j Up@-PP M0 0S0S 3?@c@Ood@T $S 0@0 Ѝp賦/0@d`Q ^0000P 0 Jj UH,,'A-0S00@Pd` pW ~/0000Pp 0 H,,ċj nUP@-808 88Qv(0 !>000J,j Uދp@-@PQp68j C-`TM@ P `^ap) 0 a ````a1pWp0`V& a! @ 0 +@ AaT  @TЍ00C>S 00`"P!@03@000C>S00p"P!@03@0$a a a a -3@- P _Jp@Ѝ0@ Ѝ/@pA-@RP0p`@0S pA-0Pp`@S:0SS 0  RS* R0 `V1S* тP a 0@DpR: Q <hj  O-ATP` M zy@@PAD@081 Z  wp 00嚢PȀ 唢P 叢P 劢P 兢P 倢P {P vpPpZ l Dp \61@ R H:p 081#?Q0800 00 & &(p L0S% S% p H p P p $  p X pw P0S t0$0Q0p P pe x0SA08!塙0x1[:5p M cP> p@ hPH 00 \d\$k˖P|$| p* +d p-"p]@x p 0S P Q [ T  5p  #5p塡PO 圡PJ 嗡PE 咡P@ 卡P 刡P9 X00S 2"Q`` Mp  Gp %P  %P0 x1`$@ 2p X00S!XppW" a a!4p%P `V%R  p0S0S"0h 1SPq2;ᕂp@0@j   rpb 0!`pZp  < `pP 08!pGpPA 1 RZ  P4 ЍZ p pkj }swstnvs8j ^!9uˌ׌i PnvSb+d(Q3Cye\p@-P@pp p@PRRA-P`@@pL0s  S  U@ p@@@dW0S R H R U pswQ p@-P0U@Sd` *00p VP@@T:mp/c Q%@-P`1pSMAT  p@l_Ѝ T)PЍ@!R 0$ 0 0 p@ =@aV 0 !p@,`P ⧛p0S lt00#40  LLD SP 6 0 (j hmj Fj p@-PP 0S @0`0S @@p聢00p SU   \@ .S0.Si0_S-S.00  @RU"0T0 0D0pxX% @- @0P P7T00Q  qDP `00CS`0p S00 P0S X0X /X3P%p@-h1@SPMPPE @p b0.SSPP X-P H(P 4P 0  .ᢏPP[gp@-@P'Uc 0 j20 te20 d`20  T[20H/@,8)0& (#@        &20  !20  20 20 2 Np@t IP3x !)0;GQX_d`lqzj Q% 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pP:Wp000 _1QލЍA. !. d0h R1p`0SPE@Ep 0S:0@0D{wU}O--,Md`pP. qL}`  @P2 0S  P@ fP@,P$ X^P$0X22 00,Ѝ P,P, R P,PE0S h R* 02뢠0 7$ R, R ϝP 6$ R R ,Ph!@P !!! 9 P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@V00ЍPW "0$?S 0[ PW RPPUT  P70 .0 I@0 0IU:D X؟0 0 `TT  DSPO-`@P0p 00900W*0S T [700 Ѝ!0 *00@KP  00T [ 00 P     @ \Jo"p  & Z/Z#cT [\*00 0000K@PL\ZT [T [ KP|xX%j G-QMMP<p`8p; @"<pE dL0p V=p ;4 $;0pTG    0 Ep P; EcP E/    QލЍ   x20ޞV00\2 0@E p , @pP0P@T*p0S4 p`@ᴑ崡T*T 0  /p @ p    /r /ps @ /r   2//pa @@ 2/ TF   .0E/PI \E//pC 0S @00S@%<z/p3H00/SbH  )[)A- PpU@M 垔ЍR` R (00P0S 0 -0 0t0#0Q0 NV 0 00 0N.P0S 0 ȎO-4MX@p 0S\`d` (0S:0 `p20"4ЍOG 0  ,   pqp0,0 ,0SPC<1 ,4axp 0!00(,/4ЍP V0 000!0   0,pcp000H!\ `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  0<,Pj !Kp@-P@`P 0S P$`(0Sp,e P,e P  0#0@-MMP+ p P0@ۍЍ0;0 C@P ,P w@- PΠ R00\L  ^@-QҜ00P`PV0 V=`V xЍp@@T   ḓ0x@ `DPЍp`Vx1@P 0>0S *wP PU@P PP`ꉜ/0P@-000 00Q$0  @u\pt h@-` ,Mi00<0@SP  '0x Bfp 0pt0 0 01 0 0S0S|0@0|0 0  X00Qx0 x|PT ,Ѝ0 8 0@0S 0xPTqMA-`@VPPFP|P2Xpx`E-P x倂|"x20 V0  |20|2@-`@MpP! ㇛ (⃛ (6X( 8p"PU@ T700@Ѝ Ⲓi///0@-$!M@ 0  I+PPЍ0 3"Qp 000)00"p0000@ 0"plp 00 " 0!p< wp ؏zt ďp@-QUp@p O-0x1p@J-p@->`FMV C0P0Fߍp@PF/ 9  0坑t01 0 `'0 HF?!P 0> *0 F?! ii@-@MP4@ $CP P@Ѝt Q@-<0< <<0SSP`///t h$0 /Lp/@-Q @ p000t0@0Q00@-P@,M(  v  ) P!p 0 00S p,Ѝ08i(p@-@MP R ` M   (Pb!PЍp:iC-PQSM M3#T0S3"`V2"@p@" 0B01801T0t0 H00C@L0@T3H @0H0L00L0 P T0X00L00L0PL0 0L0TH00H0XH0 < 0| H0 x ;H0R `0p 0`00t0H0 L00$L0T@Й120@ 2T@@D@@0@L0 X9   @L0  XH@L0   @L0  XP ސUPPEPP@ D$r p`Sލ Ѝ A ÐXH@Ꚋt h C-`p"0M` 0$`  0-pP @T+Ѝ`*PPA   0-p0 S +@ ``T*x0V*t00q+T00V:0 (P|P@ (U ᅎY 0@Pt @-`@DM pP@    ᧏!> U 134  R2$ $@0 #DЍUi@i@-|@QM  ˘00p |2 0"x2Ѝp@-]MP#Up PP -R 000S0S S SS wR0S Hgp՘VPS CQRS@ 0`  x@P -$0 Bp 0S$ Ha HhH wp 5 $ L 80St S S00,0S  R000@0S  R00@ H @ 00 H!>50H \0Bp[l0S h01S dd0Sc0 0 000 0 0`hTRY>S SM  ]ލpRIx@P= @: 3P0 0- H) P[%0S" HM P N000Sii@t @-40 000 0z+Ѝt 2S/2S00/@-@@V002@-S0@0 @@ٗV0002S s/t G-PM`p (PtP(@P0 0TT`0p<00 ' pP0S p kp PU0S p )@! (( Qp | PJp 7/PP ?p 'P Ѝ@"+qB@6lBpBfB@O-@p`0M00P U 0S9P 0 0 P  R P崡 R V 1!N P    P0 PPP0PU:000y Ѝ@-   ЍgBp@-0M2S`P@x (VP@0 \(ؖ00ލp@ t B-$M^ * ! $Ѝ@-@ (@(@-@pp ap`~B p@-A^ T~00p``0@D^n"000œ\p@Tp0,p/0/R0@-0 \  0s# R0p0QRO-M@@050`1Q -V00ЍP0p Q :8Q@SH 딂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 'P 0 B0 ٌ 0 S2X͕00cSc@-@ 000P 0S00 Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S:Ѝ@-@\0S &\0\0@-@`q0`0`0@-@08$@0p@-800@P >0S0&0T0gT0x1 RpR 0S TT0Q  0800 >0S  p@mp@-`PK@%Pp00,000S00 /0KpcScO-@GM`ḐȰp0 rGߍ0RS*R? g 000K C%PP d R FQV (P Q Ph  0 " > BQ *ϋ 2& t QqR  o TgK$x0$ C\  D^V Vd^ h  \ (/$  H\@ǟ`$\ D\V R < R @HT6    < @ V6 HR 8   h'R @ (!R p H R=  (  Y(100@R FP%*pp Fr 7rpVa %Rp  HR+  %A C+ %V @= W_V G %R3V0p p 0 RN  HRl3   0 HRa7   @ ," R20' , 4 QmJp    HR>2   W @(!RoVp 000DKP*0W(!R_0(, "r  P V: ART  , ,R\ Q:(,q P V:@QT  ,    D B W   HR9  0 Cp@D $R Y  HRM  $A X $ @(!RWEVwW08 2Sk ;( 2S PHt [:Q0 0 2 0000 00 @V5 VpWJ h 6SF 0HSr^00 &A  60@6W08 2S'V0081 0 Z00 HRO P0@W00  ^00HS>t000@0D0D0 HS3<0 0 " ω 2V0@ WV}[Q0000 00@0 0P0"9 0HQ 0   ᥉ @~0, $ꅐcSc25֐7@-P\ R&@P\0S x0x08  Ѝ0PP @ 40p h>%u F|6rs@-PR1!`0@ 0p\ 0C R1 0R00  06 30 0 0P0 0:0 00P00;0 00P0060 00cP00 ЍP 0000000 00Hp0 00<p0 00u  C-P@UM"P, 0P`00P 01iH00P0 0븀x0`  (#0(10: cV ``!P (8@  ' 0taO!P( ``(1 (1  0(t!pⓈ0 +"70 (P 0 >``v`&!P( `"(1* (> >Qߍ 0*  su 7M0@-p0i0 MSP`$M |1!ppp@E0S i p ۍ$Ѝi@ `0 Pp 81Q50 00QpP P(u  aP%$Fxu @- 0080PP `V@Ѝp0S  @P  00O-IM Pp"PHLL `PR :{ @P0.IߍO"0,0"600 0400` 0 p00,0 PS2 V30a2@0 0 ,0T8`0 P u8<@PIߍO@k80 Px mVT` 0X`0TW80 4`ZN8Pꦑu @( ΑO-@pP`QP,b尠,`2S$P㘀U`,@ , gP , Q 0S ,9   RP,`0u ۑRO-00!`p@PT:p T  X ⢱00U *"0 p Ѝ0R0   @70 !p 7  !pL\@-RM MϏ00@P0BP Pp` 00 pۍ Ѝ` p p @7  p 0FSSb@- 81SsQ S0 00 0@PЍ 0SDPD3pO-04MS@ h@@ `_0P o0 00 00P # 00 y0 0P#  R @ ^@00T0 @P0g 00 0`P^ 0 $ ( XXVpP 0$,0(,8 %P@ R  !Q*"0 0pP 0[ $0*(00 0, $0(,8~ P@0 Rh0` 0h0  0304Ѝ $ Dž 0 0 b f(!p,  t  00 !0spPt @ p[o0p$00S,0 9P@,0$S  S S0t020P !R "R h!p( $ (,8  |P@O-P0M040@p0` `2''pp'ppW9 pW6l0S~,0Sp,0儂0噇 2Sp,0800噇 847Sp,0l0噇 p"R000, 20wS4~47S 5 0T "pߍ00 `2(Ip (  0 p 00 `2,7p( 5 0 p (5 0 p,5 0` p'0}0,804l0 40po'0n@0!04,0 40p`jp`gpgdpn,0 !P ,; 0,00lS  R0 `"CpP 004100,0H0 p 0 lY00, }R0SP 0I p p  00R,0 !P !0 `" P 00 0H0p0  05,p$H6]u@p@-PUp@0L0pp@- P# M+p 0` 0 ` 0@p~@ Ѝp ` 0p )X` 0p  ઌ00; U100np@-p@`PQ81.(080000&0S  0R  Fdp`H! Ѝ@$@ ,0p Ѝ@ Ѝu 8rsO-`@p 0帀SP$H` 000 0 0 `00`0! Р+0 `  $n4 00003H081v H` ЍOG<0 $P4 000x3@0Sl3H000s$8040=4 DS ,00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!4 00N*S:kG{{'{*zdm8 S zkg{{'{* z0_$3 00AH0S0ST h Q 0R<0S 0S11H000s8040 P14 mP18 gPp10 a#\0@ 0R0i ,0.0 0p 0h` E P0 20S00H Z P 0dh0 ЍO Ѝ??}ْ#b 4(ԓtǓΓA-@PT` R0A h0`  | R 0i09qP 0S <0S $,3   .p0  p0 pp,0 00 0ppH0  00 0$0 F#5 FAd0h0+O-0R\M@`pP 0$$P X0 #3P 0 RT000 p` hPP. cL0S0 0@S@0#/L0}]?H00P X0 "2P 0 Rzgjzzz{T0d0S  $n P $[ <X x& L" D"p  $P(P Q6,  0  <  @ , D  0H  <48`LPPPTPp[ pT  ;PPK  i0v` 0p10 p E008=]@0`0v P10 0\ 0}`?v 804S"1S0810  \ЍO#p   0S @\Ѝ7S zDEv KhCDCΔ @-`@pP`0 h0X $7S R @`0s0  `, 1 0 Ѝ@4   0ӔEp@-P@ $ 0 00L0p@ $p@-PUp00CSp@0@ R$1  (00.0L0p@49 p@-P `@p800  B\000D '0<0L00p@8 % Rv$ Y`A-P`@ ^0h 0R0P3 081HA4p` P081( AP     Pd0d ddJ 0d 0 P $AꏕʕXv  h00h0 C-p@ PR0  R $ RP508Ȁ `0  Pi@0S PP  P0 y lH81t0@-@4M813(0LP 0S 0 0XP00  * 000 0 0 4Ѝ00    y\0  4Ѝ0@0p@-8 PR@  ! P   0,Hp@>Ppp@ꏕp@-@P (h00h00L0p@6* '(#C-p@x0ЀM= 81 R*aP 0S 07S Ǜ ǛY  ST.  !  Q 0 S:500 0p00 0 ( ЍOv Y 0 0Cs0Qo0S0 S0L0  p    0P 0 0 X0SY0A060@ 600 0Jp0 0  `P  B0 S 081ni@x6P eP0S0 0<S<0P0Ѝ 0    0~P 06SY700S00YV0S9 0Ul00 0P0 RS0KSK?3050X%0 Y ,ii0 (4 @0S0 | ] P   \Z0S Y Y 0  Br.  Br*0 8- $P0 0 0 CY ' 0  3@ $ 0P 0  S 0S0@00Y$00D0<0<081(?00; P0 P4 000а 00 0 0P00 S*P *   p{ @ 0{ЍO600 0< P0 0S * [P  p{`81 000H 0 000 `0`~0f\0S   0L!/YP 0 8 R @ 1ЍO5Y Y) Rr   0 P0Pd0 Yk 0 63, t ЍO|-D`ptӗKޗpv };)XA-h0PR@ , 0 DA0BS`pbp ƃ0 Af$O-` Pp 0䐠x1@T ЍT 0S R T0S> R *4_P  0 6@ӘO-4M@PP Q0 4ЍO4PE ahUPp @RL RIYUD:paV@ U=:$ GP3U0:" R-   >P% 1S 0Q00R0<2  $  P [+  44Ѝ0 C 0 B:v @-` MQP\@M  0p000 p 0S TH  ۍЍ 0]`V \@TLsv $FA- p`@PpAPU+ 0 HA0S 0A\0S 0Av 2A-0 ;M0M`pp@P @ p0媂0<000C$00(00$0C,00@pV004p8  XXNU0`$0 0$p 6ݍ0Ѝv Ls  p@-@PT  (@x1S0pSq G02p 02022p R Rp07@-PX0E @P 0S10>0P 7P7;020C0s0S027000000 3  Ѝ0@#};U zgjzzP+S, u@ 0 Ѝ0zDU8#p@-@P0( Uph0Spp@A8#O-P`@T Q Pd0S  0 tZ0`d0P0BQ 0S 0P )  &0800 |#  帀81- 8 0 $ 0R0hd`h08 R0 , 00C0 l#0800<0  P`00 0 0w0S $0 pWp1s00 2   0P C @R 00pwpWL0H0Htt0pyt0/@-0P s0 @Rp@-e00p0`PQPE@ `  @d@$,b p0P @-P01S 0 P04/P/P/Q 0\R/ 0\/0S 0< S8/@-P 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ oSQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScG-`x1@PMT. 0S pW$ P Ou vPP@0Sh0S d0S4$5ud0 0S PPPЍ|0d 0|0 00d0 00090P uP] u PU9$0 00 PP 00d8dX!{ uPP u|0d 0|0Xx+uU" 8iPNP v i | uPep|0S DP 8 ? P  JU` P < 0$Q S "  Q  PuPp h  5< 0 e  h-pP; t0<0t0$0 00 80dxQY X uP :u ~ Uy  upP )uȐY $0% h  5< 0   $0<0|i v *rJp@-PP1!` Zp`'01S #0S 0S 0S  v0 @T 0Q0 PSP 0U d0S0h0d0p@ދv Fp@-@T PP@0>pv G-Pp`P1@Ѝ0E @P00 4d@P 0P000000 000&10  $00 pPP&0 Fp~0S p0 CP  0@R 0 0000@@v LК@-@0T PQ 8 00*:SR h0S dP _H5` ЍU$`  Pdp (0Q,0Q  W `P 800000( ,0?P~0S  0h dW $0Q 0h0d`0SH0S/0S/   O-MH08PR 0` xP}00ЍpP P}0 X@ XP R R R0 00Cs @ЍOP 0S3Y0000000Cs ЍOd47 @PЍO p    @@0 0`%0  Sv L0S/G-P@M T 0p `x=00 0@0 0 @_@ЍP/@-@TP@90S   02p@-@PPP (000px P} 00p0000 S0 @00:S 0S @\S000@:S @P,,xX%0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/p>% 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO4E`VK `0P0E@ 1 PP| 00pCލ Ѝ@@;04pW p40(0= zP  0 `R0 :R`00Fd4@0  0(880P4 PF0 {0S G p PP ;000P6p 0S#0 0 0rp8`@[ +  t0P R 00SJ |@|@ e0P 0S00 `0 SWG p@DW :Sp:SY @\Sp S Spp p00T:C P@D 0SJ ?G0P0@ 0 Y@S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 P0@DJ`F  0S y w{ 00,  @ ` P D,0`  `,0@PE_ P0S $ D0A00T*q PPJ 0PP,,p>%P@-0  0 Ѝ@-(@ P 70 0P,,0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ jr0Pv Ps @ o7 Q0; P ލЍ Or0P P 0@PT70 PP U L P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  P,,xX% <p@-@PDp@NA-`= @P@ d PPd flz 00@^S0S:S_ p0 R0S@Ad{ PJU \Sp0S:SH 0C^ 0@0LT1 0L\s0TSpASBC\ [[Z[[ZZZZZZZ[ZZZ[Z[0bC|^ 0 0 00:0 0Pd @0:SS0AR0@A  P A-p= `P@ d PPd0`Fy 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P  Ph,,BG-Q0S `pʯ PV00Ѝ  2gP00CS06 Pp0  W00S(@ vP   , P P00SW  X  R00S 047σ,P R   S@T PR   R h,,H/,p,,@0@-0S yP `Ph,,3,@-@WP08Gh,,p@-P@PPpP5Pph,,@-@AP M 0@87ST h,,3,p@-@ PS P@p p@-@P & 0@87ST h,,3,O-pWP`@P @ ЍZ K P uPT  RT@ Z //////O-Dr@00S `P$  4PV00 Ѝ  fP00CS04 Pp0 0 w U00 S huP  P `P00SU00 Y00S P IP00S  P P xP \P DP ,P$~ :ePy3,H*0@-4@0P  P3,B)X0@-0S ;@@0@00DFP0DЍP3,3,@-@`0P0`Sp 0`+P PP Ѝ3,@-@P08D3,p@-P@PPp3Pp3,A- P@`pPЍ0 `(0P84SUP @3,@-$ 000B;P Ѝ3,A- P@`pkPЍ0 `(0P84SUP @3,@-$ 000B;P Ѝ3,@    /0A-P<<`0@ "0p0D0& SQՈ 0@/0PA/A/O-@PDspDpG``b0Y:0z  Z# 0@@Dms 0DA\0:Z: [=0 S: p `$ Ѝ `p7,A-@`Ppr r q qA 00@-A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @PZp TT0 pGv@ <0@ "404 4/,00S o0TЍt>%A<7,A-`@ 0s P0|0p0pGWp0PsP @P @pT 0@@PP @7,p@-@P?@0 ?@0R:@@pP p7,p@-QM$0Sp A1` 6/`1!6/&%!Q10P! \`6/*)x!(Qp'l10Pdd! \\\^`P 6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/Ѝp7,t>%fAe  NIE[?E}cDC`u6]›ћO-Q<08@0(00IpPR @pjh`,@480T:(t(@#0T(:(t(#0@ (0T: i030H,@`(4 i8 00 D3#00 `@4 i#00c4 0300 `@80@ 000 4/0SD0p 7,w w t>%p@-@0`,0DPSp1S@7,0D0P/7,O-EAMHP MU=t`0, 00PP3p0,0W0@00`o`L+pp A>0t@lTllH0SpW W DfP 5P 00PpXA C9R񟗈s0t0t0t0t0t0ts0t(sPs0t0t0t0tpss0ts0tst0tt0t(t0t0t0t0t0t0tr0t0t0t0t0t0ts0ts0s0t0t0t0tdsxs0ts0tss0tt0tt0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0 0  ;/Qs$0`S 0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 0 00$zh`| qhj,`PPDAލ Ѝ, !>s4P 0H07,8t>%KXITl12 w P8,h8,0H0S/7,0Pi /7,A-HAP|0`S@M*0S'0S S f0P 0P@ @Ѝ pW*P 0 000fh0pp+s@ }`0pX0 T7/0S T0SP 0 P0@ЍAAh7,h8,t>%A<G-\qPL @0P12C001b5R 0 0&0S  ih0S*0s0PE`1``d0 R1 *! q ` `  !`` 0Rh00g0S0PS h&0S,P N,@GH7,-!\  0L0#07,@-p0M  L0@31 ^AP 0C! 0ЍlYg7, @-L 0 0@11D ^Q       7,A-@b@0Mu L0 @2# p PW%cP_  Bc p\  Zq$0 HD@,X#10000 2R01   0 0S0" V00 S g ЍA X 1(4/00~X0威0 nSV Q`ЍQ0S gЍAg`\c  Zq lf@lg%0S Z ~qb0@07,w C-Q`0MS 00S` R@P: 0s%@Ѝ KgpᄐW   @Bg ag0p0|0S0S +@Ppp00FV@@P 00T p@efp\`W 0S:S* g (g0p0pp7,h8,O-`HqL1P0SU#,@T,P@P5 &0B1 `P 1cfh L0C R P!050%Pd @T: f Jf0 p[L0CY1T*Q@@7,G-QT0Si:\0`S& 2 c@Oop @d(0d$00@X1 0S. S0 P B H %Q * RA  p0<408@S1:X 0p@D7C 0p03 c0?o< @@D@  VfP  tfOP ` @!Sp0 a`2!! !00p30P7,t>%A-p0@@ `P PP0`0P P@le%Q *0S  p7,$00S:@-@@X7,@-PP` U(0SP@P )@T \0@ T0T 4/r9p 00'0S 0 (( @Ѝp7,t>%12O-$M@PpD00T0SdS )@TPY P3@H3H 4/@Y(0S p0dpY`WT0W$@p pp0Yk0 # 30f*[`C`fQl: L@P7W KL ) D2 10Z 0F30 %0S6*0S  no0@P1'0S 0 0@'$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@@0 f`[x [`K``fpP @P0p0 KF K0`F@  L @xd%Q *0S  @7,t>%12P8,@-M@pP,aD(0SWTP )@T: 0@0 4/P0#880 kP0U: @P  n'0S 0 |( @vЍm@P %Q|0S0S Pn 007,t>%)12O-@QpL$M(0S@ P x`(W .0PT\\0T**P* 0`0  `?oo 0c `S, `P T 1q*eM'0S l p@`$Ѝ4 T$P030#P0S X 200301S%T#2QZ E*0T00S  D&n`P 00P`P0 0#  0|0S0S @ @p,c,d`0<0 0 p`  oc`P% 0   ac%T#2QZ J*0T00S  DmVvn 00FP )0S 00@,0, 4/@`P7,12t>%P8,V@-L0@'0S 0 00 0mT Ѝ@Ѝ7,12J////>%/>%0p00/xX%0p00/xX%0p00 /xX%0p00/xX%0p00/xX%0p00/xX%0p00/xX%0p00 /xX%0p00 /xX%0p00@/xX%0p00/xX%0p00 /xX%Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/U%P p*0 0CSp0 S P0 /p@-P@,`XjPp@ Tpx 0A S010//x 0P/!R/P/P/Qa/P/0p000 /xX%P/ 0S S//@-@!c0p00/tX%0p00/pX%7@-@PD@P 40R0PPl0  Ѝ0誃0[xQ%PQ 0S///>% 03P/q0 ACP 0ABs0P r CoSPS//O-MX@ @ЍO@SQ`p rT} 04S`\xP0@`,S@T~L_Uᚔ!` Nc@T`0`PErCT 04SX:`\V0㨱0 kT  Q X ( Q  bgP@PZ P  cT0`0S0?oT20S@W-Ѝ @&0R @T`0-@k@`00P  0S S @0V @ X 1b@0@V X*k 00긅 00S00/0:!lX%00S00/'!`K%,///@-@H.@P k(  @ZxQ%w-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A Bk00ЍQ@P 4k@p@-0P `| @P  \*. Q  Rp R  (  p 0 B xX%|8,qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00o Ѝ0S/1>3 !/0S 000/|8,0S*p@- @PG P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!N0`0sA-0p0@P`M̂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ00 |R 0S |0 3/000Q R R0SQ|P.00 R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍ|8,A-PRp `@P 0!U`000A-@Pp`0 SW' WV00S񟗋괟<<<<<LH<<<<<<4V VjpGPX`ч1 X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0PS Hp  B0s  B`NpGP`Fe`AA-`@0PS0<R"*1 21<0S 0R0PP0S*! !x000S(!!!,p (E0PA , (0 ,PU%tX%pX%A-Pp0 R*S\ ]\ t`@BX T wePcP`>% R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00|8, 8 0 s000/`Q'Q!//xX%p@-P@,`%eP@tp Tp蘍 Q 010//ᘍ $1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0P`U%tX%pX%O-P 0R@M d P&  d P 000Ѝ 0@  DPP ЍO 0 PS@ g 0 00<00S*^Q000800R ]R00-R f0S* ]R -RQ\S0]Sg-Rm0 Su:0S0086000S8\ 00000 5^p0a SaR ,0Sf40Sc$0S`<0S](0xY d 0(`c0@`F p@ fUj 00C0e-R [RQ :R =R 0pS:   0Q00`S0`000-S]S0`S0`0p4 R*000pBW R:0`S0`00 S=*R: :R7 ]R400C  m]0p pB{P⌳ 0w S0<R$ CP    uP  p$0  0$ 峠0S00`` 0Q00`S0`000-S]S0`S0`0= r R:0`S0`00 S*R =R ]R 0S0 -RC Q@]Q= -Z00  W2 0S- W0`S 0`00S ,Z00W0S Z4 0 CP  pwp400!0pᲠ40 P0S 00000 P  P{  [n 0]S S `Q\ r  0  EB#ЍOBIU%|8,xX%p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@xX%tX%pX%C-@PPp\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  vHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB Rt r I 0D OX &(  RPSxPA4#X z 0   000`020+U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP"  B   B0  B0V0\S0{SPP0PS<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S b^0<0S 00$000*Xe .X< 0e|8,)>{^ ]xX%@-0@``P?Q $0As R SꜶĴĴĴ`ȶȶĴĴж^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )y V 1L   0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   000p030` 0V:0S003000 <Q >Q q`x!P  &  R  #+S  *Sg 0S8* *B?RP {R1 Q. 2000' E#,Pt 0S 00h2Q 0   0R  0 `S|* ,Ry  2000< V0 R  !   h0 S*}Q00 0RX}QR  Q +S ( 0  BN  B   B0B  B~?S {Sz   B00  B 0  B%  B  B " A 0000S 00000|8,xX%^ ]0S C- `M pQpG ]pL@P 6W:0 ЍPPP P $PPxP @aP0 uPP 6   00 0  $ ( , 0P4 8 < @ D tg000G R:0S005000 S3:  P 0A0?P  %00Q p0 P>3S! 1St Sq S <0RpQ00< 0o (  {SW S<0RuQp< 000p000Q S S SS8 S S4 +So >SQP>3S S' "S 0SU\ S: ? <0Sg 2H 0@0 @010 0  P0S ?PR, 0E10S*P 08 BB0SE0 1AS*, ^ R0C*@ Q U B!U \1LX0R#3S#^S!7l80SD 0>Q Q QS 00 0R 10C/TUU0Ȯ|8|8,Ee$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0^P`U%tX%pX%0p@-0PS0<Q@*@80P p<0S P pH0@0@P(00Ppp@U%tX%pX%O--P@pMLPئH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T *P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0l30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  9P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 CP0 0 NxX%ΠO-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0\0( 0(0 000p 002   0 X @ Q  0 R)  R # `Z X!,    R  $  S  R  V  PP$ X$@1`v X PP@(@ xPPP @(q P  @@ $ X0  QvW PYst va  r _V R  !    _X RG v@(@X 0x  v% YPt P vI_Vxtt xLt v _`V `R`V t@@ v(  P Px Ptv x N_XN 7@Y (@X fY0txPt, xt v  t v  r   _X_V Q ( X 10 _X @jth v xx ,    R (ZS $X $ 0` (ZS  P 00004Ѝ0S0 0x~ @P xX%O-P`M80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R >sp0 c800@ 0 ZZR  D>sp 0 L800@ 0 CZH  D>3 1> Q p0p0800@ 0 p'ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPئH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0l30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  ;5P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 CP0 0 NxX%ΠO-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  9P ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E 0000S0R0SpG pGPx0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPئH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T =P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0l30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  -P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 CP0 0 NxX%ΠO--lM%PQ0x @%Qs ppp        Q 0#RS. 0 YS,Q 4^ 80S 0~ <``F`Z01S` 0s vQR\R 0C1!S` `0aM0 Q[0 000,@4H80<@ PP 0 TX\ L0`Q Vd 00 S`FY1`0 0 0`,P XD0S 0 0D0,`PD00D0 0R < 0JS : ,P Z Z `p5`XD0S[ 40S,0@4440S pj, 0@ R0%00D ;0$0 0D0,,P5DQ/*0 F00,`P& 0 0D0,TP HP 0000 0D0,AH0SPHDgX 8 D0`F0C0X?4@` 0 ,0@` V 2 1(1( XP4P HP PR [S3 0 Y,,Q~ 4^e 80S 0a <``F`Z#01S` 0s vQR\R 0C1!S` `0eEU%5L0 Q/0 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S8 0 0D0,`PD00D0 Z ` 0R< 0JS: +P Z`XD0Sf 40S,0@440S  p4P hHP dlЍ, 0@ R0%00D ;0$0 0D0,P5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0SPHD^X 8 D0`F0C0X?4@` 0 ,0@` V 2 1(1( XPpS5 0 Y,Q 40S 0s 80S$0o <``F`Z$0 1S`0s vQBo \R $0C1 !S` `0 K0Q0 000,@4H80<@NPP 0T X \ L0`JOV 00S`FY10`0 0 0`,P XD0Sb 0 0D0,`PD00D0 0 S` 0P< JP:$0 *P $0Z`XD0SY 40S,0@440S , 0@ R0%00D ;0$0 0D0,DP5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0SPHrDiX 8 D0`F0C0X?4@` 0 ,0@` V 2 1(1( XPppn plpj-Ѝ///@- // //0p@-8P00@S PpSYP p8,7@-4P@0S TP Ѝ0P 8,@-@P 0S I@P/V<P0 0 0/ /0 0 0 0 0/////0P P@-  /9,ڠP P/ /0 S/ 2#0/87O-$Md`pPR0@ *0S  P000b P000T000 R0030#$όZQ^A2 #%# T P@P U*00 0T 0C2@TPT  # 3S R0 SX00G0S.T0S 0) QX 0[00 0 Sq 1000H R03S XMX 00 $Ѝ P00#03P 03S 0 S: 00[0T #3SQ R[#  ) 00H0K?oP 2R0S 0SX 00HSX0 Y 0 H0X Q 00 0[HCI S 0f 0z0 C R9S> 0 S I0 0CR 0%2 L 10 HY0S100u 0 S 0gH!  s0 @S P0CX 0SY 0 0$Ѝ 0 Q 3R0D]T00S SD @ PTP?: = @   A40z0 R03S? $P $P Q0@-M@(,4`0  P#USA\ 0 `U-00ĵЍ~ r0\pFW`&SA-M{ { tЍ1Q0@-M `@(,0  P#USA\ 0 `UU-00ĵЍ~ r0\pFW`&SA00G-M@0p`W PV P%Y P.X PmZ PNx P4 P 5Wf  5 5V+  5 5Y  5t 5X5Z! L 5< 5ЍYXZ-  |5 w5  n5 i5Ѝ `5 [5ZVY  PЍGkM M xM XM PM (M (M L M L L XL |L L (L G-PQ00R0p`ᤔ00M 0 l@P @0S nS a0CSsNU2  0oSm HPN ЍHPZ V000U000HP[Z V070U070PHPZ V000U000HPZV000U000HPZU000V000zHPZO V080U080i0@q@jHPZ: aHP [HP UHP`ZL V080U080?DHPo >HP 8HPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000lGP TGP K J tJ TJ J I xI LI I I H H H (H H DG DG 0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  p, 0 Gp@ /Fp@  p@@@dYJ0 PyGRJPPJ0 PIJP`ЍDJ00@O-1MM @PDL 8 "( p C. `pX@D;@8 (S0Sl pp  ` ᰑ 00㨱$ %0!`^p@ t0!0 PP `0S RI001ݍЍI0S 0K0S Rc P+p 098D<4! @ P0 020Z  0&0h,R <1ݍЍpE E FtHE D D D gt0@-P@M 0  POp s,p@ P n Ѝ00 0Ѝ0@Ѝ0A-@@0s/ VPP0P  0]p` ` `0`0VI0ppX`p KI``0`0>I 00#p@-@PCM1 /6P3 ,pPB ` {@#I000t2 06{C.@ F {P4D@ @F!;0S VS00 SCލp@@0S@h0h 0P@0 2 P@1:H?00@H00 @@ @ p@-QMP4@SMY TE /6PB QP0s+ FP QaP 0`pG @ 0@?qp> D p7 ۍЍp)0si/1p0 +>V@0 P@0  P@1:}H?00 [p 04qH0#S @kH@hH@+p@ `H00@8! | %@` ,? 4? @-qP`O-$p(W,P0-S`@/U'Y1 ? _CZ0 0YCP :[#J P?5#I x@t4 2px 2BzPYh@rUZ0J[% 0@-DM@ P, Pnm~^gkH,T lT0XYP` 0`0?d0t00P0?T0l0@0?D0p080?<0h0H0?L0d0/X00\ 0 00#$0S`@PH" R"  " R,"2!x"~$0S"x`@s0`@0m `@20 P $:($^0<P0 0=R( ( @%0h00D0c 0r> 0$p!#:6 00 0.$0Ϡ.>H!! 0!!!^0C 1(02 >0. 0,S$/2"́ ?0 0 #1?B!   0 $0S(, 0Q 004 0`@0@a0!!!0C 0P ,"΃0/($0?,0S00#0S<,000, ,00Ϭ<(800$ 0 #1?B #: 6 4$&60|!$,$0!,>Â!!!0C 0R!,"΃0, #1 (, ͌ , ( 00SP0$ 0 0T 0D"0=R0`@00N `@l2t0 P :P0 0<R$0h000 $`@  0 P0*^*{ r0s{P T80<`@ 0dR0  \u Q $ Qf$ &PT8<`@  \0X000 Q00SLPT8< 0`@D0`@0  0C0;000 @ 0S2 0 h00$%`@0 @0D 0 0h$% 0S 000000$0`@2p rp t t `@  P00  0# D%`@D000 P 0S %z`@D000 P 0S!D% &j`@000 P 0S D%\`@D !V 0`@ D!O 0`@ !H0S(0S `@60P : c 0 $_< $&,:6 00 0.$0Ϡ.>'! 0!!!0C  0  " R Ό " !( X'\$?h#" ?00 #1?B!  ,,  0\$(  R0# 0 RO#PKOI RF  \Q:%8< &0dP(003( :60 0!$Ϡ0! !>(0!!!0C P/8!#? /" R  " R $ $0  0#1A0H h0 0%L 0C00000S P0 0   0@0\$   C00 00S ^ 0 0  0dL  X* R" O-Mp`$:@0LL06@0W@0 V. 0 2c1 00 80 PP/ 0v> 0`0?d000P0?T0 0#?<0 00$$%"`˟$` 0000  000V ;0d0PX 0TPK dPI$`P0Sʼ Rʨ R ʰ R  0 0` 0S0`@d?O$@Tȏ(ET0}N0`@d00? v^D@pD 0G080HXP0 00 PESQpSp pPQI| 40 dhlptxPV@pS[R  R00d@x0Ut0Yp0 Rl0Wh0 Rd0Zxt [$[8P0>C 0C 0p00@t0` VP x0S A?0ppt0 00@ d0 0Pd x4( "ό R t0"! R RWv 1p?'/!! #./ B pW ?,?.P P00#1 ?<v.C BL\Sx  Ptp Pp> 0 !qpp 0qp>0S@T` VP|0 ?oR20S>00ߍ!>d@!!qp@P   Q+10!R@'NS$ \TPd0 P0,Pd000 0  ZR 0S 00@ q>0d@ `g>0S  0X0ZS0 dd`` `ް0dP0? T0հ0d80? <0̰0d@0? D0ð0dH0? L0庰X$\GZP @@>0S? E/ßs"bW2(:##c2S" P$m8PP 0 \ß0dT0>@30@9= 00P `p@ d0@P ? /' Rß&0Q| 0Y/0 #10">/ 0C!a 0C0 0"#0R"P#. W#0,jpW10' #ΌQà3\!=30S 0>! B^ ? 00 0qp8 @(pKCt=#00q=0S>@㴰0d0@괰[0"c01 2c1@TÏ!S=!Q  s!P F=T00C=0S10'` #ΌQ1=00@t+=T00['=T00dl8g)\P(\ ףvɻ %I$@-@ LpFC@Tnat X00 R 0 R 0Q/  /   p  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/  H  Q j.0 0#  Q/00Ɠ\ 0@-pPo> 0@" \ 0 /A-@P `p@P@0% P PPA-\@`@P pjNP@0& P PPA-\@`@DP pH@P@0& P PPO-P M pP9 谟P n`P P @@ % pP P0S  Ѝz T W R7  0p0S A-pPQ `@Q :P 0@DDB(000S   HJ@- M`pPPp) ; 0 >0@0S ;0"S" 0p000S0 7/ Ѝ;0"S1Ds\0pT000S @ Ѝ1Ds$  Rd L @-@n l@iO-P`U M PP2SpPK P@N P K <10`0#@P6 0nS# =)PP00Q Q P R  \0  KB" 0 0Q@00oS@d000S   p Ѝ4  D (TGO-BMM@p:@0  0EP:(PP  EPn0096~P PC @@`KN0 PPCp i0P0 0 PP5p \@P! H 0dSPkPU0 Pp` lp}  07P n@PP0 PpS Q Pu sq: 00BލЍP/U ` P 㺿p@[:0SQ  0PBލЍ 00H0PP0 p=  #8:00 P 00d! 0 h0 0$:0<0  00ꋿ:!0 O~t/K00'900 P 0a0}900  P 0U0q90\0 P 0J0f@ < FhS TS zd@  pD  X @ 4   T -{M 0 { =PЍ -{M 0 { 'PЍ >-{M 0 { PЍ ?0-,M 0 >PЍ( --P0$ S   0/ 00p@-P/U@p[9?( ( 0P 5/pX p@-P"U@pB9?( ( 0P 5/p\ @-@P 0003/H @-@P 0003/d p@-P?oU20S@ 0 0 03/p p@-P`UV00P00S@p$ P05/pp p@-P?oU20S@ 0 0 03/pH@ p@-P`1@Pp8(@0 p@/ p@-P@P p 0 0 03/p -@- M  ap@(0(003/ Ѝ@ Ѝ/L @-ap@0003/T O-`$M ؤP @~*0Sp$Ѝ`80,P@@  4/$Ѝ` O-`$M ؤP @0Sp$Ѝ580,P@@  4/$Ѝl !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////   \   x d  @ 0    x d P < (   4 3057$ 5 $ !PpO-`@VPpDM@P؆, 6p0@ U p 0@T UO UK 6,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R#00C R00CT,@DЍF, 0R3057, 5 05 R, S# 0C 0S 0C 0S 0C5$0P$p 0@V@B 0S1 `@@0 SS( S R 0C#@ =0 00 P, Q0Ç0,  0, 0 P<@0S80S ,0 S>3 57,050,0@q`V  FV")VX*0FSTRQPONMLKJIHGFEDBA?>=<;:98bV5?Q20S/ 031 a< A0100@w  0 00P, \0Ç0,0,0P @ YfV ?R0@SQ  b9@S B88 C c3<21FV 0, 00 R Q05 705,5 0,0 5RQ= 305 7,5 0,O| f@ 1$01$0@@@0TS`VE.0Z0 Q X Q=V, R05`7, 505 ,   R,0 Q ,0 0,0 R ; @Zp 0Sm @R@ 0Pb % @ ?RY0@SV b9 B88b00 F@00b%#jo%#jx%ju-M{0{0Ѝp@-P`M0@ 0@ 4/ЍpG-PRM[  `TpPC/a@"P @1000< pp. Ѝ80S&  1 000< pp40S0000< @ pp40Sx 40S X 0 < @400400 ; 0  P @  @-$$@M ЍH6O-EM M`X@P+p `E* E0P@'T 0 E0P@T| 0 0EAP  UEލ ЍT400O4008 @-@` pMPs1P& /fE 0RP$  rR$   P @0Cf rR  Ph 0 @YЍ0 Ѝ@}0rS 4 0 ,  A-`@ Op 0P/S /EP @0 Sp 0 S  *p@-IMM@`PP |p 0: S X0 0up IލЍp3O00@IލЍp300D p@-IMM@`PP Qp 0: S X0 0Jp IލЍp3O00@IލЍp300@6 -{M 0 { PЍ 0P 8 Q  8 //p@-@P PP` q PP u "P  p@*PPp--00 M (0  ЍЍ/00P --M  Ѝ Ѝ// -- M O<P 00  0 ЍЍ/0000-@- M@OP  Ѝ@Ѝ/O- q`Pp,M< PR% Ppp0 0CS%_ P[ P@ 0 @%[P N*!,Ѝ000:Q!0P00,Ѝ/<p@-(M `@P& (Ѝp0 00 <.0p@-`@PNpp p@p@-(M @P,0, 0 `& (Ѝp-0p@-@@ @  `  @PNpp p@i-0p@-(M@PrNp `f&8 X(Ѝp@-@PT T  ,M` @WNp pK& =,Ѝ,0C-PP,M/ p@``FV`R V @`0 @kT "Nq ,Ѝ00 0:2 0,Ѝ,<p@-(M `@P& (Ѝp0 00 X+0p@-`@PMpp p@p@-(M @P,0, 0 `% (Ѝp*0p@-@@ @  `  @PMpp p@v*0p@-(M@PMp `%8 e(Ѝp@-@PT T  ,M` @Mp p% J,Ѝ*0 P $ Q80 @-880@M08 Ѝ880/LL0000 0<Q 80880Ѝ/)lP/0@-@0@0 M0S 0000 X04 x0PP | d00B/P00 Ѝ0@A#P,N(0 O-3M0PP 0 @Va0 `D0Fp@ P P00U tpp0 0C{ Y 2ATT00  RF LD@D T\:[ 2 0000~`K L0 V0 W7 X2ATT 0`Fs 0Ry L 0  0 B0SH L0Ѝ V0  0 y L 0 o0pHX<0S3 0b Lw 0 BW@ 0 BP  BxL`FtZ  0 B@  BhL 0 6z ]L 0 )0S 0 B  0 b00' 00 P$0p@-@P/Lppp@ 0RS00 /p@-@<0<00P  @Lppp@ #0808 00 Q0R00 /#0p@-@`PKpT T   p@pp@-@P\ \  ` @KpTT  p@p"0O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDA Œ Č Ȍ A`| Bp2  W R ? \ QQ Wt ,0 000IC1100Q0 0, Ѝ000h"0 00wd 0@-@0@ 000 @T  F͌(Y Pl> C͌ X P$> JB͌8W vP= ̌1S cP= ^B͌``=@ 0S078D H0P `P P  P P Pp PP P, PP( QP PP (P PD PxP'( lQ780H0x100C40S000C,0h0LP 0P( (0Q0Pd  , P `P X hU1q @a0T0 @卿T, 0X  p @dQYh`@0`@  P`'  V U `0P1A1S  ,000@!1S 0D 0| 0?piߍ00RP,,0`L0!!\\, @  B  $8 P<`@ Y& 00A00@S= 00 1 `V P` V ,PY 000 `,0匰 0[p$0p1`㐀0@@p`㗼Pp  W 0@0@S  P8<`@P(04 0R(0LPP1@0ٿ0S@@X!(@L п0S00!$0P ȿ[T¿0S0 0 庿, 8P 0BX00P0 P< BY 00 O0 T ,q` 0q @PV f`Xp0@  P  U  PyU,0V00@ Pܰ封[ P@0 PP  U `X0pP @Y 0@X RY0,0P0  0, H V 少[0D|A>`Fp1``  0[`0Lꈰ  0PUMP  0@TPOQ @ 0PUQ @ 0YSJ @ 0XU @ 0pWWQ^ @ 0PUY,  `6,  B 08P< T$,  p , 0 H T0封1D|a#>p@(8P 0<04 ! , B BP   $@ 0[X T[0,p`p0q0 0q08@<X\PV f`Xp1@  P  U  P1U,0 V00@ P封Y P@0ĺPP  U `X0p8@ 0<X\P@U.[P,0 CT', 40p! \< ,0 H0X 0q1D|a=p@P 00 0R1 (0SE ,00p W 0g1(0pS3 1@ a! @0T0P0 @夼T,00 ` @!(0R1@pPB70P@> T  0Pp 0,0 SR,0, 0B ` p0 W" 0 0B00`S9 0P 0Q!1 @TQ @PT,000 @,0,0Q@@ఱ>P`p߹ PP U  p ` $0S; ,04 1Y 0i1$0 S- L 1Q!qD0 @00T00 @T,0 0P @Ta$0V1@V T  0 㓹0P@,0 SX,0 00C @,p0 [# 0 0 B0!0@SC 0T 0a!H 1 P U a P廻U,000 P,0|!0RP 0P1` @K0P`R T  0 @  h50 0R80000S 8O-pYM|Cq0cS@` Q 00L3?K͌ 0 0v0S?H`3K͌ 0H0w0S?pp2F͌( 0p0u0S|?Pl2F͌( 00x0Sp? 2C͌  00z0Sd萍 1?B͌8 00{0SX 1?̌ 011s0SLN 1?41@BM@0810 PYߍ 00v0Sk H`w0Sv ppu0S Px0S z0S 萍 {0S  1s0S N  <0@-P@L0MH( 00 ,0 40Ѝ0(00@-P@L0MH( 00 ,0 40Ѝ00\0\ 0 R/D@Q 0Q(00?H/d0|$P0P0/ D <  R ,  R$ 00?H/|$0P07 A- D   R'P?UH@0aaS,p10 0D C  (  \@Uy@U(  R 00/|$0 00|0l P  `0H?30\ -@@  D\,00D//X|$O-PP 4M 0pS4ЍPH D0 0 0L|!0M:|@孺P` `0D0ZP`@0PZ0 T3P V@``@|e:L ?3Q 4Q<  H0 00DpL |"(0:9`P0S R@,PR @0P ': R0`S4ЍT `@004  0ض`Pu @|`|$0 00]d0p@-\0\ 00PU 0@S PHpp<0p@-@P 0PS P1ipp0P0% H -? \0| DR0  0R0 S000 0\$( /||$0 000 00 /᠔O-tRt2P0M`@V0u T":L"@"4"("2 2 $ 2 T 0 01X 0 01\ 1 ` 0 01l  1pmp0p0npp@z20吲0唢園 $TX\0` 0lm0n \1Q0'0 0 0 0 tЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000x h( d0C-餂pP@M 并PP @@{ d"j =@-ÆBBB {`@C{@@@@tPV Cd pQ 1pL 0p R] @B0 @@@(P: 0 @@@(P/ Yp+ #p' p0 @@p(P  3'h,000S :3S 2ЍP ZB2T @Ta_PЍh0S,zpP_ 4t A-Z`pPp ZBz2S @TP00.000 R A& A !@-lQ+ P@E0`XM_  S- <1^p0!!!!v : !' !_ !| !o !* <#>4{!*prQ>{ R 81 R 0SЍQ L0 0 0El0T0Ѝ!fT$l@0l 0̃ S/̌O-C@p`ᜣM[ +:(p($W 0CS0SL38P $3$0/# {% 08:x{rH̲ pŸ夒堂8ırxrhÃqpr(rhrq`r`PrXr弁qPrxrHrÃq@rr8rq0rr,rqps rqrqrqrqrq rrrqrsrq}@s: R 0S 18p10S pWЍQ 1 0 0Dh' Jl`p  \p  00(@T(0Ѝ `ap, !+!,!-%!.%0%#fq&i%`"j#%ok{ %|l%m<%ns%t$%u4%v,%w%x~#p#rd"ye"z@h>pp<^v 8# :0'#z #H#p--`_|opryzߵ{ܵ@|ٵh}ֵ6A-``'^` p @ 0^ 0(`V(PԈO-`ܶ6 6M000ƟJҭp6 0000SVF C p =p PP[ h p?P4S S S|V0S'pPn 0@l   $ `00 4S 0 0 40 s 00bR$ 4S4 0P%00Ѝp PP 0 04P40 s 00bR4 440P ?21 R R0 ;0 $Q B q 0 ;0 pP.4 S S040S$ 004 0r0  cR$`S 404 ` pse0  ;0 ٴp PP4P0u0PPcRT T4S{0z$0P s 00bRS40 00V0SkpP 0@  ^ $@ `00 4S  20 zS 202 `L pv p 0$ $P0 s 00bR40 ; 0tp@ P< pg 40 s 00bR4 4$R2P00$0C?o$ r  aR$2&100#?c p2 p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100#?c0`00$P r  aR$ $ Q 0000 4 00 40 s 00bR 440`00\0\0! 0\EPLP,(QP`A  0(  0 + 004 00/<O-T4P@P0DM+ 8 `$Qi w :Q|#R3Z 300S 8 0 P0@P@P@X@-@"P @P ;P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o" O-08vSp@`M$f`ZP T0 ʍr `r 0I"R 3S(0$00 0PK TP  0XSd%$ X% 0"L5`0T <504S0300SL p0SI 4SC 4S 0t24W】匡Tp2 >PN 4p2[  LAT `P P ~s@ oX4Ztx2 PX 04x204Y|2 Pl 4|2hЍH5S4S~ 4S0?o20 D p$h l $ <%$(lY P Z  P [ Pp2?;~0p220P_0 rr 0I"R8YD  P[2[x2Y  Px2?;~0x2W  Px278x2Z  PL2|2[  P|2?;~0|2W  P|278|2w1S06 4S2{L%R/q[W]  PXx2!78x2|"[Z[(`1M80<4 |2O[W,  }P'x278x21|29p2[0 S;,0 0D | 0 00P0qipI PX 00C E0HSP 1TX[00CS``[TY0IS`YPY0 0CPYDq|0 00m0p@-@PpP`0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/$!O-PP + С1D0, 0 S 1H`?c`` AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CwKhl0 008k0T0 ?o2R0S P (1  //-(^,0R0^Q!R@O-A1@ 0QM4 P`p, @p 0S" Ï#SÏH000C  ```P  (0R0 (00000C00T0 03/p 0PS@  ЍLj (0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0O-`P M@ VU``D0S  00C(00P00 T0P 0 S `&, 0 SPp0SᴀJ`Dp_0 `| 0mpP Ѝ 0 S RQ Ѝ,͑P e,0Ƒ0P 00X p  ``F , B,(`aaA0  U p0E`4ᜑP  Fp`,004@ 0U` p0EuPT   PB  0SQ 0 0PC 0$ 0\R =PT 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000U1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP xd0 PQ8 0 /$ $\/ P/aPQA-a@`ؠ1Pp0$ TZ 10 0 QT$ D 0R U ETpM D10 0 QT$ D 0R U EBp; 0D00  Q P@$ R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0Qa0 PQA-`0`p0*Â@$ PP q@D00T 0Q_P- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P  0 BS0@( p`0,,0A0C1!0 0L0`S@( X0@-8  PE? J0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M4|ڌ`ፍ@Pu z{툰 {ᆍPp,n ᠎PP0a Y4% 80!S0` ``pX08 0 T``0a$$ <@0H0|08 ( P0@0, 0!0 s0PT* H00#D @ t@T,0Q0@t@T4000SH00SZ   R ,  H DS400,01$00Q$0 0P 0qQ 0%, S00,0,1$0000 S 40p0L|@0H00D00ep 0SL01H@400 0,0000,00 0Yl0Y 00S 0` S0F 0R_4000,00 1 1 01IY0CRڸ/o<"L\ Rn Y@L0l00P6P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Xp  0 AS 0 V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s D  RD   00SB 80 S8( 0`V 00P0 0CS 80 @!@ NN Œ Č Ȍ N LL\80ɟ`Vpl,8( 00S>0X *1h"0( (80 0 @ `40 , 0W Pp$t00Sz000 @0p_ 1`11qW@7@'@@0 K<00 00S 0X *1h"0b40V @ 60S F6( 0p|Q:0A0 0C0/t 10 0 S' PP 1 11RY@ RRQ 0   S %( R R !%`FPA p0p`P@ !?3 pGWaF`P `/0 < p  L  `P 0P0P00 PP0yP0D0T H00S {080  400 e H(40 p`\Ѝ8 L0j bT<00D RY 0 R PP!Y j [R  c[ $RX  0E0 p0P  0E  <000$R ( 3 H000S2( 0<000h0S0B  0 0zN@t 4000Vg0 0C B!H00 R d1S\Ѝ4080 @0 80-P00C\H00^@0SC T\1( 0, QA@`0`4! ,\@XP ppX@P DP0@, Q J   4p@,@ APWp@PT `` > | 1 t`tLDl`TPp P @0`, AVXDP q@DH P! R @   \`Q  ABQ`P P4 BQO p @ p   ,@ 0$8 R p P p , [!, !`w @@[`o P p0 WPn $ Q  $P p,@08 P LPA\H0000`, Iy$ @A`0,  \- `@00400   0{8 0%00@ 0C40a0 pWPx p p  P  , BQ 0` W G 4 DP @P | 40@ PL0Y0I D| p~0TpP:W W@ P n@DT GpGGD@`0 0: 40Rpp0,@0C 0B0W,0P 0p p000E,0࿜ PU U R0a R  W R RR.0 S0@^ 0 RAA$8 LD@ ,　H@X LD 0B0 B$8 B!! 00Cu 0U40P0 P,0a0 0R0h400,@P d1S ( ,7 I <0@00!R 7Q R dP  .@ ``E 0E0p0~ 0E  <000P+ 88(  <0@ C0,0 0000Ss 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  P9( @` 0 ``( <@0 0L0 00 -<000N( l>@ x0 `C0`  <000tW 5 b0 U<`? 0 0LRP6Pj <00 pCU \ʕeH5Sp@TL 0$`P@@U= 8P8P `$=`O-x:xz0t*Mp$P( ,pP @*00\` S@@s  aRXAkHQ00) 4 @Y @B@0@T ROoB@TP `NNQS0)\ 0  |  bR\ L)` R&<) R! CP'I@, 4R S[80S 0P0$  B$ X@0C, 4R CPf S ^\ \( 00Q <80, 004(0RJ0H 0@0( v $P)0S700S00l0S# 0 S , 40R#0l P, 0S eP$0CP$D70 RЍ (70( M$(00 SBFf@`- & (00 S4$&P0C (00xP0S  *P$00C$0@d&  X&0 ,@(@ R 50 60, 40Rp F f@` 0 0, $P, 40BR0S(0g 0KQcڤ%%  p p d% 0(@`Vᾖq@nR @D%@ T ,00P0S 0P0$  B$ X``Q 0[^[ $ 0|$0C ,00(@0 K[V p<$ , 4,! ! x D @  ^$ $@$#0 P(0i0 Rv ,,Xqa00P* x# ; l# (0$0@ ?3S0V{( , 3\0$7 (000P )(0$0S p "0P0  G@$(0lP " 20,  , n40 S ^ ) D20$ ,B@0S 0P0$  B$ $ 00P0 ! 00(@T7ڬa` ! (@00T0!0@Dx P(@0S  0P0$  B$ 0, )a`0S 0P0$  B$ 0, l8\dhxT\( (h\,`h0@O-hsh3pdC@00 S M I400040(c`(,P Zm34@ 3`0T&"0C S402PK䢟  50@DS(00S00lP 0S 20 0 204@,P0T0hP XRP0 @P 0( 0CS P 20 0 P1040 ,( Ѝ00S00h0S00~0T100 Ȱ@P,P  Ȕ<1(`0 R*T$!P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( l0  04@SSCPE@D4@P,L 00SL004P  hpl` $@- ,(4 00P@-  ,(4 00O-p1p!0 h *⨒YP!P H!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU,@0@DaQaS@00 0 Q  ST 0U0 00 08QD0S0l%R h%R /!R!RtP/P//4 0 000 0P/O- MtuPp) h5` 80s,  S̠DD Pr 0R!1S5@50  50 `\Pᴖ 40 0~0P 40 0s40 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0 $,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q _S~VZ]9 Q gSf2 Q 4SSVi^* Q j^S! Q k^S Q gSf Q[-S 0Y[=20  0S0*Spt !-=000 0R$"R 2U8Ÿ= @0A004 1aA`PU+ 0S 100S H0 0YH0,N  Z000 0 0 00RY{PU Ѝ0  00!R 0ʀl2 00 !R 0ʀl2 %R t5S 0ʀl2Sw Su Ss Sq So Sm S\j`PlHd1P0TX POP# @ QH\F( 00ʃlœ\ 1:t“ @-'@T! tƒ'> 'tƒ /A\  B\  ^tƒ    /1P0A 00` P;ʀ :l“3\0 /@P%0000CS 00000000000000000/(@-@P@M&\\ Y #3t P P 00 C000 0mЍl`P -P\P Y͌# /4@-00  |00S d d0 8=0!D00 R 0@-4!41 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ !A\  `00 000:h/p@-@0@`P0M*l"R R`   P H00 040@ 0 @ &Ѝp|lX02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R. R !p@ '( V@ Ѝ1=00QM0SJ\1p20P10 0H0剑Q:20t1=00Q!0S0p20l00 0(0剑Q:20h00 00`0pY0!Q 00pM0!Q 4l0 000/|p@-x0x 000@00CS0 S p0 S P00puPp0T0p@-0CS@0 S p0 S P00puPp0p@-,0, 000Pv@npXp@-Pv@dp0 000S  @-@J Q P\,Q    @/00P JP\@-\,AP / P/0S/p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0P`Pp@ W vP 0 0C S0+,+00GT0 S80  G2 0@0 @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p rPP+  U  P `X(0 SCJPC0 0(0C\00CnB`$ЍHz TP P  D0|0ip H0@D002 T `V `tV `` P|| 0 00\0p@-@Pppp@p@-@80800P  @ppp@0O-<6dM0@P$0 ^ Q| 0pzu`PyU Pr0P0O W 040P0[000P0@SE:I.A@`0XP0P00PEPUO000 00PS0408 00 0`P0p @R@+40T R80 ) 4000C?00uP`FuPH` u$ \400Pp pG`0 0p`0 PP Y 00 00 E 0 4,QpQpP Qձ,pp( X4 R!p! Bp G" RU     HU pG4 S0 0 P` 4,8p 04,0@,@ 0<8=PU 0 4Q00C  00 Sb 0( 0C0, Q0 00PSl 0002 mt$ 10 P 00  0 0 K00000p0[000C?00OtP pGR0H`FKDtP 0I pA! Ww 0H 00 0ᰡpG W!D0|0psdЍ004 p` 040T pR0`40 00 0P} 0GPr`dЍ`r0 00 b`0p@-`@Ppp p@T R00 J0p@-@Pppp@ =p@-@@ @  `  @Ppp p@'0p@-@<0<00P  @ppp@ @0p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``O-葟MS D@HP 0X 0p`@ 0 0[  E4/ 0 R < $R0<SP10000#10#.Q00S0> P 0 0@0 0x00 P00 Hr R0S0 0?{P4/[WЍZ00 Hr R0S@0刀0^pP4/pW P Q" @-@ RM !R "R pPĜ\  00@]Ѝ/0Q " @-  MS S PpP$R (@4Ѝ/L-4M0 Ѝ@-@000M, @ Ѝ謘8p@- 0B\\@S ^\1  @ % e ,\'\ { d"LA!!A0 4"!! L}0 p%   @ '  pPU< 0 ER3\!@`P    ^0 B! { c\  "0  {  \ @ o% d  + {o\\:\ { cQO-M  0nPP 0  %  0  S  h `\ @u,S 0   @0S *  QS%S +0B GSSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8 0 Sp 00PЍ%0iR@ 0 `fv`  00#1.R0*R0 S l@0 S[0@@00dR% d 00 @0@00 S0[  00 @@"0 C0 0 S[ 00000 K0`"@ @ 0 @00 S020 0r 0  0@ 00 Ssؑ00s00 00 00 000@ 0TX 0@d0 0 r 00 C C00 0 <0  0 @D@0 @0T0 S\R Z I00 S0   ot  000S0\S 0 S0 00 %p%c%+%c4 d $</>p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0pxA-@0MS0D0@!0@p0S? ` 0x 1!1P!1"b2cP@AL0L  00210BP0 pW$P@WP 0fSPЍЍP 0ЍN| gA-@0MS0D0@!0@p0S> ` 0 1 ‚P P@0!0A1 0120BjP0 pW$P@TP 0nSWPЍЍP"0Ѝ4kL >C-@0MS00! 0p0S2 PQ 0 `1H $@0m)0pp 4m @[P00TЍ l   0 z 2$ ‚0  @衟0 0A 0!1ȁ0#ਁሂC P㈁J 00 @> x 0JX1@ $A0!b4!b @1c1c0A 0 00ࣀȈ(!h!bC P㈁ 0tS0cS0S㤠 0 @0Pb00< X 00u +l Խ, NgݔkL > -?L*S A-@`p0\ %\0PpS sS lS@ 0\TTW 000P1CP0@CV` 1D!00O-霮pQ qM PP- 00S0406 `$  0l@H 0z0S1  RS Gg@T l P p 4 @@T %T@%T400 R,:PjP 400P,%0p,00=0,P0 - ͟00:T T) `DV%?#"< / XT c`Dv`Vfz t``` 0`D@lQ 0>T-0p0  Tg@W -@@@C?T@^ >Tp A0Ds =R=S2t 0BXaevV.`^`0^@ C @00! Dr 2\* R:0Z'TOP ͍R'R ͍T0   R'R'Rp@@pI@[OhP 00040FhP, 000p^ Q1`!RX 0BS11`U PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#y1S 0C-11@ Q 34 00`Q,\*P 0 Nhp 40P040`OU; 01 1`0@1O1S  0C-11@ST #Q,%*P  4 @@9AT @D=AA0@a DrQA DR3@D1@ؕ& R ?R ;RL  pR 0%R 0@a0Ds RA0DS 13 DOS ͍!!010@Sl00l0 0St00t0QU PE@=1QP OU5 =1 =10@1@10Ds R-1!TORP=1=1 @T!p1S 0C110 S@Rb  ?R ;R QeR  pRT 0%R 0 00000 0 B10 OQj }RR0  R}R}R@@ps!R =1X@ BT! p4 Q`!`10` Q,0*S 0 ;gp 40040@M, 40,qߍ! 1J00@QU PE=1@Q@1OU =0@01P@ Q$-1 1OS00PgP 400P,V 2gP 4 `V 7``&``VP``P``Ì`@oobP``V  `{`@xu`rQ AQ A QU PE=1!T@QOo1BV 2~g0PQ 4 0,0S@pP00@K 0 nF00 @?00` ' V8~`200/0&@DQ0VT&$#"y p ]K5#0@0C!@DOo0B000@00-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/p\A-pQ@PM 0S! XB MfP $`V! 0v0* V Uz ``ЍpP0U0b ``U b4 0 0 R Ut TU\NP0S U( ? \p 0S R s0r (0 000SU00;P G0 p0(0/P G0 p00TU@4 $ d ht@Z ؅ 0 0R @-MI0@S  ЍA-pP P U) )@`TV 0PS |@P0DV  P oA-PR pQ 00@ `P % <P 6P #00 ES  eP  l0 000Q  0 R0 R   ^ Np0 PQVP PU`̇Q 0S  0 S o W  _0Cs0S0S  0 S Q V0Cs0S PUE 0$XPGPG " X= $0 Ž20nP< sPJ fPZ PR00V0S 0 0qQ :%dP NC!dPJ<dPL5$ PP e$Pe dP$$ W   PP?V00S    0S V P(C-P|a@x!`pM0 c P 000S< PЍ`P  P 0 p R 0S 0PP  PP004PЍ 0 P @``+ P *@`Pi h`hO-M M:S&0:SSP 0`S:Spp@F T R!*  @ 0  tDmP 0P:S ۍ ЍPۍ ЍC-pP,Ÿ,M M@`t P) 0/SI d~P5P 0 ۍЍC0P p! cP20 ۍЍCl0P 0S/S 4~pP $dX 0dX P 0 ۍЍC0 PۍЍ p 0xdYW L0L 0 $ۍЍ404 0 $gh} T} 4} } } | e{ dh{ G-p`@P  X0@HdT  NP @\PPxP P @T  @0Gl(-@-@ M00 Ѝ@ Ѝ/, Ѝ@ Ѝ/ 0p@-S@ 0  p0000  P 0 p@-@ccc@cc c0c@c 0p@-PS@:pS bP!psa @-Q @fRQ ^nR sRQ 0  \ A- @X p`fS@X P0P@ @ 0nS sS@X@@0 0 0S00@PA-P# P p00`pp0,SS00 0\,\@CaP  T Pp`p@w  G-pL@`P}P 9pWS*nUJ sUA fUH0D Y#R< @GbPF H0D@pH0@0 H0H0nUp@0 H P4 sUC fU; L00L0@P @XP00W 00 ,00 ` 0S0000  0@ SH0 $H00H0H0@ HH0@, H0@0H0(H0, 0H0($PH00H0|f v u O-P M @Z p pY ` `(080H03`P- 0@  }Z0p@   @s`Y@  k00@X U0R@O0@ Ѝ@-0 000 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\$A-`p PPU@R )aP !0峀0 V00pp   0  0 0P_O-`0@ $M 0fP paPpUP5  VP/ `0P  0a pP|ွ@P ;P@@`Pa $Ѝ aa0,P pU 0$0(0,0 @ X  @@R 0 S00lPJ PU|a0LP@UD0@0H0L07 pfS,  0pi 0 @P PU  @0nS sSpX@@ppp 9a $Ѝ @@@po To A-Pp ``V@R =`P A0峀0 00P00 0  0 P^0A-P pW@`R `P 0` 00P 00 0P^0O-LM< <t+, 0 $0ppP |@P0|0ᅼ`P9 00 [PT P8:PPq_PP  (P< V $0:T $0-, 9P`/ `$010#0(00S% ( .S  ROS= =@@P 00p{< <00Q4 Q 0/ R, P\`LЍ#pP= @p@t ,0 S Q0S Q0TS$0 400000 P40,0-Z80 ,D_80 R&``'Pv@0@Sr 9p@tp00$0 0f0 PV ,`p@W 0 WP`h *\WQZZ % R ^W Rj p@W0P 0 t'0FSY{  0P ,`Z0GqPE G/R񏐀~}|{zyxwvutsrqponmlkjihgfeda`]\[ZYzWxUTSpW@ W<00p@ p00@%00  <   p`]00 D?D0 0S"P  Pd$0 ` 0SO t0 a$000  00 n0Pp p`\8004 $p 0R  S 0Q p`        04 $  #t 0 S00P{?W u 0p@P80  0B\| 00  4 0$ Z80! S0pB PWppp`+ 0$000 0s0ZP ,`9pp@ttp@t: ,0 Sc Q0S \ Q@RPaT` P00 $LV0$ E,`wP00A Pp@t0G <00QG Q 0B R0 `$80 07P$0$ '00 0S00 P $0`@0 $$< 00 00P p  P7g f f d e d 0d Dc ,c b P/$P00//d @-M@20 0!1l!1"b2cNL 0@@0#@B!A@C0PЍ赁N g P0`0K?//| @-M@0 a0 LlB N0"0L 2<@0#AB@C1dKPЍkL >$0P00?// @-M@0 %0L@N $@L0B!b!bN?AA4 1c1cL0P0@$C!d!b8A@C1hPЍ-?L *S p@-0P0M`2@P 0Ѝp], 0 0S Q20Ѝp G-1!0  aP P@4 04 S0p0p2,0PPP0  |Qp`  =WPeȄpEQ  2W| 0 ȇ0H00TKȏp K@-@P \\\ \$\,\\,00!R  !I 001/I001P//I @--@ X@X0@0@0s H _PJI HH @ԍPp@--(M G7@` @@PR~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " k{UF{{o!00 (ЍpP P # 0U 0f {kUkaW!00 P ~P T# 0U 0 0"{P  0cP0J30{kUk 0 iP  0cP0G20U 05{kF{{TPn  0cP0t20U 0x 0"BP;  0cP0x0 0U"  0P;  0cP0|10mU ! 0a"1"UJP.  p0cP0%ʘ 0U"  R b0cP0$d10U 0"P1"P  P0cP0$10U 0"1"P  >0cP0@00U 01"0"P>  ,0cP0@ʜ00U 0 0"P  G??XP0Z Y Y Y X `X X GW tW ,W V V tV 0cP000{kF{U{ 0# P  0cP0uʠ30{kUk 0 Pb  0cP0\30{kUk 03 mP  0cP0n30U 0_"3"[PF  0cP0L20U 0="2"IPO  0cP0ʔ20U 0"t2"7P  0cP0EP20U 06"\2"%P5  |0cP0 20x{U{ 0 P  k0cP010g{U{ 0 PD  Z0cP0ʌ10U 0"\1"P  H0cP0H10uU 0 P<  70cP0k10U 0\"1"P_  %0cP0&00U 0"0"P  0cP0ʀ00U 0"p0"P   V U T ǘT HT S \S S T S S LR Q 8Q GQ Q DQ 0cP0(,00U 0"@0"~P  0cP0l00 00U"- lP  0cP0ʰ00 00U" ZP  0cP000*{kRF{U{ 0 EPn  0cP0`30U 0q"3"3Pd  0cP030U 0"83"!P  x0cP020U 0"2"P  f0cP0Wʔ20U 0H"2"P0  T0cP0HT20 00U" P  B0cP020 00U" P  00cP010fk{U{ 0y P  0cP0ʈ10U 0"`1"PN  0cP 0<10@U 0% Pc  0cP0Z00U 0K"0"P  0cP0ʸ 0U" 5 ~P  0cP0qt00 00U" lP  8P O O @P GO N 0O HN M N HM M tL 4L pL 0cP0_(00U 0P"<0"DP  0cP0h00 00U" 2P  ,P  00{kF{U{"00 t3030vx30 3U""00 aH30@30 3U""00 Q30 X3U""00 D20{kUk!00 72020 2U"$"00 'x20p20c 2U"!00 @20} p2U"{"00 2020 H2U"k!00 1010$ 2U"p[!00 10b1010 1U"GH!00 `109X10k d1U"8!00 (10 01U"+"00 0000 1U"B!00 00400g 0U" "00 00 K \L @L lK J 8K J K J \J 4K 8J J J I J |I I J 8I H I H tI tH pH 8I pG HG G $G F F (G 00U"T!00 bP00FX00`00.htp00N |0U"!00 I00{kUk!00 930 3U""00 ,30{kUk!00 X30vP T3"ZI aI  3"Uw"00 20{kUkj!00 20{kUk]!00 20SU"00 P"00 l" d" A )z PI : S@ ;"00 6"00 1!00 ,!00 kk%!00 "00 "00 !00 "00 "00 "00 !00 kk!00 "00 0Si !00 }0S2 !00 u0S !00 m0S !00 eP  _0S !00 W0S !00 O -DT! @F F F F (F E E E E 0S "00 70S !00 /0SO "00 '0S/ !00 0S "00 0S !00 0S x!00 0S p!00 0S h!00 0S `!00 0S) X!00 0S  P!00 0S H!00 0S @!00 0S 8!00 0S 0!00 0S (!00 0S~ "00 0S "00 0S !00 0S !00 0S !00 0S "00 0S !00  3H "xP !H H  3"0SI!00 e0S !00 ]x# cp# v"00 R"00 M"00 H"00 C"00 >"00 9"00 4"00 /"00 *"00 %"00 I mI "x2"2l0 0o2L0 0f 2,0 0]@2 0 0T\20 0K820 0B20 0910 001l0 0'"1L0 0K1,0 0"!00 P10 0S,10 0j10 090 @@0 L0l0 0?? ? $A h? X? > > l? $@ x? X> |? > T> > X> > x= > < ; ; P= = < < < < ; : ; ; p: 9 0P0 0య40p0 0৯2X00 0|00 0`0 @@#0 s0 @@0 {100 0ru,1P0 0i,P1 @@0 \oh!00 10 0N!10 0E10 0<G2 @@(0 /82 @@X0 "l2t0 020 0+0Op\>0U) 0PEt@T7p0pp@$>00Ss o=0000CS 0S =007s@ Q=0 C0 0,0`S P?N?P?^5?d1 M?1 Q?H?A?L?h/ J?. - C?+ , BH) 9?:?;?0@\,( @Dʈ+7~N82q@D0 D0B$0Sp0  0p2@0W'8<#0#w[ 202HL0  200@S2D0u po 0S3q0P0;T02@D0 C<3q@D07s0D@C s P5l0{1r0ರ^l[PEt@[UxR!B"0$ 8 S0l00X0S>0p0P0?0X00 p0tP \40t (CQ @m 40e@ 0p040I 00p`40T4l 0Z[pPEt@[jU" 0C00Sp 0 000(1 T*U $((U^ PEt1岐@^ Ԃ 7sQ0D7{D @C7s0D@CqD<6L0$ R'400  0q@x6p0@ 0sxp0@+MP7s@DZ 0ಷ@D'q@p6l000` 0 0P00p0P0 Xtp0(0$P$(0/ 70( 'r0R0S(07@D0dSR: @3 0@|008@0I80y 0s  \ p T d \ h tP |80G pC=0S804p@-@ZPP80S ($03/$0(3/00pPA-@`BPP@p0 QR 408 B4 08@V000PA-@`#PpP 0R| S  +P00S  : 70S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000P@P`P-@ R2Q <001 0 0S!B<@0 RD R  0cPࠓ^ S R5 0 1 Ra @ <00 R1@ 0 <l0P\p\ G R R0c BP  R S R 00S  0S  pl0Sp0p0Cpp0+x0 00 0RP,040p0 x0 0 0 30 Ѝ0l0S  pl0@@@ EcLFS???CP 0S $0S 0S P?,A4 BR/ Q /@o/A?A-PXPx@ 0!(`3/PPu 8pWG  ( 0(3/pP00@c  Q 0  \!ᏮP S>0R:oRS B P T  B T p W0Bp3  (08#q8pPp  BS>00p000@ Q 0  \ OP S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰdX 0C0 0$SQ $Cp0`0 sRpW-0 p  p0 Ѝ0` R`V40sCJB 0|<J^S20 b6 0s0^0X 0 C∀0S 0SCXP! P( 0 ! 1T2 0! T 0SЍ0W0T0S Ѝ0D?o 240%R00S020,0@0000,004@0D?o280(000 0 0 0C$0PU?PU@PUAP0UAPR@oPP 0C R R0 PR \:0S@\!v!w|U!1^  RX  `\h$X  `\h, Rl R O- M`0P 0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPH/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S>00000 S *S0SWq00Q 0SD0@S>P0 W0Ss S00W0 00#400 03 0  0#400  0 `0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000. R0f9S ?0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E000S ! P B R  PE[ 0 X0 * PH ԡ0 ,0 SR0 B00 0 0 0 0 0 S0 S00ӈ R01q 00 D R}0ES IS= [S8 gS8 40S0CkWi D8 RC0SS@ S   00#  #800#"0   K ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S,  Rg00 0 B000,0g  S  0Q0u0S 000#40}0q00]0SZt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SWc :W㴖K 6SV \0l S 8 B0 l0\000SDI\ R8 C0 l0\000S7 xZt0(l 8`R B  ^C 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l S/t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [ KoP᫲[@ `P``0P0@&ƅ&s0(!ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0<00S=p#  #800#"0 00]thB 0.0c*W6F &R< \ R80l0 C;0,0|K 0 00 0000 B 0L0DC0C t0S*l0\06\0l S 8 B0y l0\000SD10,\ R80l0 C97531/-A-`pPTq@PG Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0 `\p# 0S%t l00\ R6S S L D0 BC e060@! Rppl4p@-@.PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ 2)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOzv `fp00$0`(0 } Ѝ8 80  000&t-M 0 BЍA-P?PUPr0 `0@ 0S  00 0t!(3/@PU \!@僝 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P. @ R+ D SR% , 8 U, @@ PL DD K&!F0 0C006& 0&;> 0$0;/P O-Q$M R0  x 0S!q"$!@P`p,ß 0+0* @$)z0(!y0qx0a{0t0@A P1:SuPQ "9SuPQp'8SuPQP`&P5S>3s0uP1+@$ "@QP0 Ÿ " rP"$!!! q !P!"  " " rP"$! ++{ !Q+" @$ $ rQ"$ S4T@QPQ@$t@a@Q"$&P%uPQL"T% $r A Q%D$ "r Q Q$T% "r A Q%D$ "r a Q$d& "r Q@Q&T%@$t@!\%$"C0S 0!q^"$!$ЍP!AQ1C1@`puTP T N N N lN @N N 8M C-PRp ` P  0!\0 0#@B .P@18R0  C @$'L C-PRp ` P  0!\0 0#@B .P@18R0  C @$'K @-@Plp`hPp@` 0!đQ0 0#B  J @-@Plp`hPp@` 0!đQ0 0#B  LJ p@-P04`^00# @L P%!p G-pR'wph Q RO SRCW-o`VA0A0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcV V-2Q0 pGN0 Q"R 0pP1W1|G.7&c2pG0N 1pW|GpG1^NNQV=F10C>@AP  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0A0C 00 pP80'7b"c2pGNq%R&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /qR&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /q/U/0S0`0//|256@-S k>@@0 #400k.06S0k. ς 1O- p:PTU0!`Q`+ṐY* V@ : U @0ς!\KU V*  p0Q=0^QQ [ 0O-DM PX%@QX 0F  u pGjP0P4 \AB\S 1vσ p P Q-0[P4尐&G B&Sp  @  ipWPQ=00ද0 K`{P0: `;VT`+0I AX{T4T+ pQ}Qp0W20|q~6x `00[0` IT$P0>0 0@00 0pˡ0 S[0 ⵟ0  !  W X SA ׾ᨦ [㑢* & "& R\+ ೞLY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00U0 0S@\ R @02^02N00 R0@\DЍW@  yP 01LX 1R 6 G2#6pP^p N j p=A-`@PT1R`QPE0+~PT S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O-` MVPPR@ʀk` W !.⾐ἠ i5Rs0( P000P#406IP0cZ3s0V⾐5s0iS0P⸠P0%TPVIPeQq BYr 漖P9s0000P#406cR!0C 6Vj VPT@Q p` 0F?oR20S RV0XW R+}~ʲᰐpj5WPs0pPJs000p0#40vPpgYww0 UVA5Pps0k.00P0p#406VPcQ 0C6PT@ Ѝ Br 9 kV0& PPQ^`徠἖0`j9Ys0`J 0 00#4 0编0iQq0  R0἖`g)0 6b궐pi5Zs0P000P#406I0cW3s0 Y㼖P Ap9s0k.00P0p#406VPcQ 0C6PP) P V# Br 5 yO-ʀ6knS㼖0M #P  #  # #  #  ! A@b9 Ts0@p000@p#406 B0c^~00἖&R @ P$ pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಐApi>Xs0000#406I0cWsw0 0@弖^ `D Br @n9 Ts0=@p000@p#406N0cR#r0&0R἖f b9 ^s0 @Pk`0`00@#4PP0 B0`Qq0 k0&Ѝ0἖=0἖9J J J J J 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I( , &&A-@ k΀`P s0! Qr p p "$  aS2s Ak> ,u 0  u0#Ġ  <##4U0 0 (000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ M, R 0p&]P+&(+#0N  q/ ! R7@P j   Q&Q3 "[q6k S ;p3 s0000 #406 cPp 0Ck N.V6 0G. 0R0 0xS0   0LSZ=00IX  &&0 Ѝ  \ R+R +R ,RE R  Q ,_ R3 "&][Pj 0w ЍO R \3 "[k. Z0q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦|qk>0#40缦0j\3s0 J Z㼦syzk>0#40缦0j\3s0 J Z㼦T@|qk>0#40缦0j\3s JpM⼦k> / ! Zq ! 缦jR!r JPἦ L I  Q3 "[F@q:sy:s0:s0 r :s0]q#r 0XB hA > :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  < 0S A-P p@0 C`0@}"TUT @-'P s&/@- MP`p*@P @ P y"p - @P  Ѝ蘛 0@0 Ѝ葛@ Ѝ茛0@-T  Ѝp@-P{*@P @ߖ@pv 00p@-@j*0P 0Ζ000e 00bp@-MP`V*@P @ @幖00 0""p L-@ЍpF0@C-T ?@Ѝp0p@-S P@0 C`P0@!T' 0 p&0P@p%yara0p@-S P@0 C`+0@!T 0 ph&0P@p%tcid0S p@-`@0 CP0@!T @ܚpp/0S p@-P@0 C`0@x!Tp,&(0P@庚p/k%yara0S p@-P@0 C`0@T!Tp&(0P@喚p/G%tcid0@- M P@ [!p  @P Ѝ0|@ Ѝ0w@ Ѝ00@- M P@ @!p < @P Ѝ0a@ Ѝ0\@ Ѝ0yara0@- M P@ $!p < n@P Ѝ0E@ Ѝ0@@ Ѝ0tcid- M} Ѝ- Mv Ѝtcidp@-@P%0PPptcidp@-@xP%$0P p00ploobp@-P`m@P  0@$p@-@V@ @-@P@% @-@J@< @-@D@X @-@>@t @-@8@ @-@2@ @-@,@ @-@&@ @-@ @ @-@@ @-@@@-@@@-@@)@-@@>@-@@N@-@@c@-@@q@-@@@-@@p@-P` @P  40@-$pp@-P` @P  "0@$pp@-P` @P  0@ $pp@-P` @P  0@#pp@-P0`P @P  0@#pp@-P` @P  0@#pp@-P`n @P  0@#pp@-P`\ @P  0@#pp@-P`J @P  0@#pp@-P0`P6 @P  0@#pp@-P`< @P  |0@u#pp@-P`* @P  j0@c#pp@-P` @P  X0@Q#pp@-P` @P  F0@?#pp@-P0`P @P  20@+#pp@-P` @P   0@#pp@-P` @P  0@#pp@-P` @P  0@"pp@-P` @P  0@"pp@-P0`P @P  0@"pp@-Pn@~#(0P p<0P 0pgntsp@-P`@P  0@"pp@-P`@P  0@"pp@-`P9@I#<P pP U patadp@-P`m@P  x0@q"pp@-P`}@P  f0@_"pA-P@#X0P pA'`P  P `)gntsp@-P@"(0P p0P 0pgntsp@-P`9@P  %0@"pp@-P`-@P  0@ "p@-@R 0@"p@-@ P"$0P p00ploobp@-P`@P   0@!pp@-P@P "!0@!p@-@ @) @-@ @@ @-@ @W @-@ @s @-@ @ @-@ @ @-@ @ @-@z @ @-@t @ @-@n @ @-@h @ @-@b @! @-@\ @/ @-@V @D @-@P @Y @-@J @i @-@D @~ @-@> @ @-@8 @ @-@2 @ p@-P`@P  M 0@H!pp@-P@P  0@8!pp@-P`@P  + 0@&!pp@-P@P f 0@!pp@-P`@P   0@!pp@-P@P D 0@ pp@-P`@P  0@ pp@-P@P " 0@ pp@-P0`Pm@P  0@ pp@-P0PZ@P 0@ pp@-P`I@P  0@ pp@-P8@P 0@ pp@-P`'@P  }0@x pp@-P@P 0@h pp@-P`@P  [0@V pp@-P@P 0@F pp@-P`@P  90@4 pp@-P@P t0@$ pp@-P0`P@P  0@ pp@-P0P@P N0@pp@-P`@P  0@p p@-P@P +0@pp@-P`@P  0@p p@-P~@P 0@pp@-P`m@P  0@p p@-P[@P 0@pp@-P`J@P  0@p p@-P8@P 0@rpp@-P0`P%@P  c0@^pp@-P0P@P 0@Lpp@-P`@P  ?0@:p p@-P@P y0@)pp@-P`@P  0@p p@-P@P V0@pp@-P`@P  0@p p@-P@P 30@pp@-P`@P  0@p p@-P@P 0@pp@-P0`Ps@P  0@pp@-P0P`@P 0@pp@-Pl@I(0P p0P 0pgntsp@-P`@P  |0@wpp@-P@P 0@hpp@-P`w@P  \0@Wpp@-Pg@P 0@Hpp@-`P@<P pP U zpatadp@-P`@P  #0@pp@-P`*@P  0@ pp@-P@P L0@pp@-P @P <0@pA-P@X0P Np"`P  eP `%gntsp@-P@}(0P p;0P 0pgntsp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@|p@-@Q 0@r@-@R m0@hp@-@0 P $$p@PP#0S  #p[#0j@-$@@"YjP 0R @-P Q o//ꈱ|P ᝏ0 t@-0  ,@-P Q @舏@ @0@ f0 l( (0( g0 c ܂  0S p@-\@`@@ PPpP p@ 3 HA-P`p^# !@P  `P `ppk"$P` b" #Z" `##TN@hp@-P @`iPpP p@@- i!@P $ \0 0 0 萘A-pP V!@P"  I0 0 0 PE!`P  ᕈ` P0 000 ,0< >@D /@-@P ߌ@ e 0 0X ` }-A-M `V $P0 P!@P!pP  0P! ;ЍAЍ/ЍAЍ/ 0 0t h `~Uw@-@P @  0 0X M( ~`~}p@-@P x0 0 0R0 P 0P Q |# p@ppЫp@-@P `0 0 0R P 0P Q Z# p@phTP/0 0 0R /P/<0 0 0R0/P///Ĕܪ0P @-od  QP  QQ #/dTP/ 0 0 0R/@-@P \0 0 0R  ' 0P Q "00갓P/00 0 0RP///<`A-PPM /o00 0"P R Ѝ R0 p 0 p`P 0 S  R H  l  pP` '"  00pdA-@PM 0 0 0R ЍQP 0 h 0p`P 0S d P 5  pP` !000( (0( $0 , zdy; P -/o<0"0 0^ R  R/P/D0 0 0R /@-P o꜐P/D0 0 0R /@-P ݌o@HP /ol00 0"\ R RP Q  Q෌ /ԥȥfP 40 0 0RP ࢌ/TtfA-(0`SM.P@U Ѝ P0zP pP 00  0lP* S'P0S0"Q00 @P X 0 0 0 @Ѝ( TP !,iP 00#0 0 P 0S S R/P/ R0/@-9 @ UhA\O[p@-0(MS- @{ S  P{ ` `YP rP (ЍpX  (ЍpD P { (0( (0 uTuu u du$@-@X Z@-(@@UZ@- M`p@uP0 P0P!s*0 00 Ѝ^0"S@- M@pPS`0 `#$qp 0 00 Ѝ>0"S 00 S 0 P :\03#/S 0 P \0///A-Pa`a~@P vr(pP  eȂ@P ]W@Q, ,0, (0 X x> lr4rM 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ xЍ00@- @PM  @ jЍ00@- @PM  @ \Ѝ0@-@P ,0 0 0R 與 /P/0 0 0R / 00 !S R!* R0:/-  ^0 : 0P0*  R*/@@/ / <P $0 0 0R //TP $0 0 0R //P $0 0 0R //P $0 0 0R //ᬅP/`0 0 0R / 0  \*s00/S:tP/`0 0 0R / 0 ɓ\*s00/ S:P/t0 0 0R / 00  \ */- ^ :䌄P/t0 0 0R / 00  \ */- ^ :P/@0 0 0R / 0 0 S /|P/t0 0 0R / 00  \ */- ^ :(P/`0 0 0R / 0  \*s00/S:ꠂP/`0 0 0R / 0 ɓ\*s00/ S:,P/t0 0 0R / 00  \ */- ^ :丁P/@0 0 0R / 0 0 S /0P/<0 0 0R /  R*r  /܀P/<0 0 0R / R*r  /ጀP/X0 0 0R / 00  P :/R /<P/X0 0 0R / 00  P :/R /P/D0 0 0R / 00 R /dP/X0 0 0R / 00  P :/R / P/<0 0 0R /  R*r  /~P/<0 0 0R / R*r  /P~P/X0 0 0R / 00  P :/R /~P/D0 0 0R / 00 R /} P -/o<0"0 0^ R  R/0}P/L \ /  JQ\/|P/L \ /  JQ\/|P/P \ / Q/S/Q\/ |P/P \ / Q/S/Q\/{@-M0 `000 00S ppP Ѝ@( RP +B 0R xR#  P 0S t uP Ѝ P PS cO-\1MM0(@P00 p$0`0$ 0 0[ Q` $ 0`;/0 `(P Mߍ 0eP 03/P 00  $ 0:/P 000 PMߍcЊ0p@-P2s0AL7@LP@a`Lt0 0LWLV p@|0 T0s0^0ppO-IM袟P @p ` @@@$@@@(@00 S S   0CS R0fSE ;"Sm [SbL20 @3/P 0 0  0S  0/S[ p,p0 S S0` ` S S/S >S S 0 S S0FU0 RcP0/S^ 0(00>Sa S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p0 0 . S =S`B`0"S0S   0"R R  "RC$ >R0 W0(00>S` 0  $ 0L[| X[G-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R"@ tR Ѝ mR8 pR oR sR ;R'@ ;R<@ tR ;R>@P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮otfe"R /R@S00S@Ѝ!1 0 A   0OPp 0 +r  RA*0 Rf \Rc  uR_ 9PZ +r PU6I %"". 0)p" " <,  0   ,0     SPY& Yy  ͕)   0)#<  Y,!*-"-    )&  w WWG-@`pp W W00 GR0SWL 00<0W0PPF <W0@@j\r\\p 00 S S   CQ R<S+  ᘃP)   ᒃP#  ጃP-0@S@S -S 0@@-S0>S @ 0<@0S>S 0 @>SSS @@ @dP (0SP  R @W' W0S@@m@NaPV` :P @P D /P0SUUUxT4vSBG--`Me|@PX ,( ppO  pO 0PH h``S`Gp0!  PjPP u3    p `P Ѝ&  .jPP u  00 L0jp, x` r Ao/A-PP +P`p @@PW@@@P p4.0,p0P4080<0Tg5@-@  @5@-(@@ yd5f\Y@-@ @O-4@T p`, FP @@D¤@`T P礀Qㅑ@0@ @@0 PZ PZ POp O @-R 0P< P 4Q ,  D D0D )0 , ,0, (0 e dO0O O Op@-@M4 00R0SP,0SER 1`V- P` 0 0P 40, 0C40P% @`ЍpS' Rs|Ѝp 0 Z0D p p0p l0D \ \0\ c0D D D0D @0D p NML NMy( NM @N|MiA-@`,pPP W 0 !4{,P0`2,P0`C-`0@SPpMD  ]P00Ѝ!0 AP ,0SU !0 7P ,0S(0S00  0"P 0S?0S0"S 0:S 0 }R00 "R  0"S P  P @` 0 @P , ,0, (0\ 8Lsr L LJ0p@-S `  Q P@0@p 0  0 x` `J,J0S 40 00$ $0$ @-0 _` @KI 4 @-R 0, B4 P @ @ @0@ <0 z, ,0, (0 q JhI JDIO-80M@ Ѝ@p`# PP @ ` @ЍȒ j wPP0 004QY  4 R] ,剱1Qw  6 P 0YIW  B B!g,0 P 04 `<0 04 <0 P;~P,UN<U8U+yY& 嘡 @i 8P 4 wPP) _ ,0,S<SS> dP\ @ ,0P`<04 0<0x<B !2g,0P wYP {,.x x0x t0F/d d0d W0,L L0L 0 -H]+ FF2| GEX hGEp@-@PPH0S L  Q <0 0 p@9 0  0K/gT[ PEEp@-@P 0`0VPP l l0 0  0@S0<  pPp( (0( $0K/9Z , DdDO-0@SP MR z`40SM x `P@ ЍmP pP 00S 0q 2 00PX 0S. @0R* P# [` 3P 0P 0S 8P' X D` ЍOQP 0  03/P  40R 1#PP 0 0U/^ 00C 0P `N@zh h0h d0U/T T0T 0]/Yc|Y"X @BW8 CA CAd@-@w0,S<SS6 0  0 W%d tB@PG-U p`0VRV@P7 404 S `  S` D000,0 100,0$ 100, ,0P ?o  @ 2\0S0S P`P :  404 SS`  `D D0D @0c/0 000 ,0c/U TA8?! XA?7G-PS @- Y`' T 1p 0R  R P 004 00R% OP ? 0S 0 GU~d d0d `0i/0,S0 000 ,0F/T \@>1D `>= G-PP' 0 0R"A4P 40S @,0aᄑ1p  ,0`p40@T:8 408 # dS0P 4  Q@-P80080/Rp@-@P80080p@p@-@P 80 0R@ pP4@p0Rp@-@P \0 0R@ pP`00S@#:p@Qp@-@P@pA-PP 0 0R4p`40S @40S ,0 P@b `X t+*/P/?o8  2\0S /0SP/=p@-4@4P@PV0 0Qp =0S   0T=D=@-@<< T (@@6@@ @l,  @-@P (0 0R#<P/0 0R/<P/0 0R/\<0P -?o82 ^0S 0 S0/(<0S /(0p@-S@ `P`0 pP0 jP ll `@@ @@pDDD@u @0000 C8 @ `  (|(A-PP  P`p @ @P @@ @P p<``` 0,p0P4080<0:@-@ @  @-R 0P< P 4Q ,  <0< <<0 ,0, ,,0 X:<'` 'Q'@ `'VPG-< Pp0`W=W@ 404 S P SP /000P,0 10,0$ 10P : l j 404 S P b PSP@ @0@ 0( ( (0( 0( ~ #&Ŀ ,&%p@-@M#S+RP, R7S 1CaV( P` 0 03P 400C40`ЍpR S#   Ѝpd d0d k0< =L L0L |0< 44 404 l0< + @%$ !$x %$A-@`,p PP W 0 !o,P0` ,P0`p@-00P4Q8 @Q s4 <0,04Q<0pPp 0 0P L #d#o@-P MU2 0`Sp@#  PS00 Ѝ 0 P ,0S @t 0 @P  Ѝ0]S$ $0$ 0` 8 H#P"Rp@-@P 0`0V( PP l l0 0 0@S0<  pPp( (0( $0 l4@| L!!w0G-S@PK Tp# 40SF   P@ P P 00S 0>P7 0 03/P0  40R 1#P' `P 00C 0dP  @ꀐ pG \ \0\ 0 8 808 0 32x2ȹ  040S 0C40/ 0  @-0 4 X H0p@-S `  Q P@0@p 0  0 1 |ip@-@P 0`0VPo0S R <0 0 p@bD D0D @0 0 000 ,0 0 $ wG-S *X@` V 0P 0R `00p *V` $V 0S  Gr@ @0@ <0F/FA0,S0 A-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p/@-P80080p@-@P 80 0R@ pP0@pT.p@-@P 80 0R@ pP4@p.p@-@P \0 0R@ pP`00S@#:p@-p@-@P%@pp@-@Pz80080p@sp@-@Pn8@@@ipp@-@P 0 0RP`[40S ,0AT Rp@p@ 0  0O/y, aA-@P 0P 0R@ p`-8040S ,0X <0, 0Q<0@@>@D D0D @0S/;0 000 ,0S/2,  p@-@P H0 0R@ pP`@p*A-@P1 0RP`4P%80,0!qW&  P  1P ,0P < 0@ 40< AiAD D0D 0W/, ,0, (0W/|* h0  0P -?o82 ^0S 0 Sd/8)p@-`P pP@eP (0S p@ ( C (0 //@-JP0 p0 x( ,O-IMP @ @T p `0 R 2/0J\ P Y  9/0  paPV @T!1 0 C003/Y@ 9/T JT T @T@" 000Q 1/0J' P70S+ 03/P. Y 9/qJ@T 0 0(  0 0 Iߍ 0 0( 0 0( Y 9/Z 0 03/X X0X 0( H \@ T d0 8̮  P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0BP 0 $ \00 Mߍ0 000 ,0H S R00ꈬ # 0/0/@-@@A-PPp`M2 0S/ io@0U  UU 0/P B 0CU/PU  U0 0 B/Q h!0C@T@!  j;@04D.0 05o  R0* 0 02Bp@  V s0P'a@sPۍs?00@ۍS0p `HNp %p s0P@ p@-R 0@S PR :   Pp0P  , 0`0` `90 L0L L:0 808 8;0 pԩ $8 8 p@-@Q PPpQp@-0 MSP@`PA Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPU pp 0 QQ Px, ,0, 0 T    0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@ LԤ ( #0p@-S+@PPU Q PpQp<{Pp/tP PQ lP Qp@>c 0 Q0`  4( 0p@-SG@`PU Q Q DP<?Pp PU Q 3P QPU Q &P QpPQ P Q/P p@>  0 0| 뀢 cA-PP4 Qpp0` XpW*!@P&  P <V`p p0 8/PcP``<``Q# POP P 0S #P P PP@ @ P P 0 ꬡ 4p@-P@PP xl Pq0@  q@p {z011/A-\@`pP \1S 0 €  P 1P1 `p P 0808 8A0 $0$ $B0   |@-@^ P ^%QRS  T00NQRS"  TŒ 00 0 Z0 묟 G-@R00QP(M P 0 ` p Pl `0T?o20S00(Ѝp`0 x0     Q /0     P /0 2/ / /    Q /0 2/ / /    P /p@-@PP`(M/ 0S, R00\k$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0M P0V00(Ѝp@ R 0S V00x0Q000 00/@-@/p00T0{0|0} @-@T @-@T000 000S/@-Wk4"t000 000S/@-Gk!t000 000S/@-7k!t000 000S/@-'kt!t000 000S/@-k4!t000 000S/@-k t000 000S/@-j t000 000S/@-jt t000 000S/@-j4 t000 000S/@-jt @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#|D 0 01/001/0 01/0S@-@1/00/p@-P0P0 0@0PS` PpnpQj@t/^000 000S-/@-?j-t@-K000 000S/@-,jtAo//0- M 0$ Ѝvt- M( Pp Ѝwt@-Q0 M Q Q 5n 0 Ѝ 0 Ѝt ^t 0$(/0(/0$/ 0Y.<+ < 0/(/$/R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@Jm P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Ph80 0 @  0""048# /UUUU3333  {~x: S@-v P Sd0 V Sb0?0 r-w - 0!= S U 7SJ @Sx00 r@-@w- 0`@  RB R7 Rx 0 r-w-! P4 P. P$ P x  00Rs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- - S0S t T A0a0-0O-[_ApP@8 c`P8  _pP% 00[_` 0@T iP0=S AP` AT BX ! lA`7_ Tl00C-@``"`2`M 0P$DT@Pg p`XP \@`@d@h@l@XUipk p Nip` o{{o{$P  {^p[ p0 0S08@R0<@@@@40040,'4h'j'0Q'_L1L0 00D000_'X  #k0S dp@ i i  ЍroЍ @k0 0 h h h XXX@O-p`M@-fP-TPm +T@`0\ ?  0f0 f P p  ! @00Ds \a0DSW0DA0DS70DURX : QP   S  R Xk "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0T W 0 p0@0` XR A B0A PR W p p88@ 0`W p p}ꙙ0@-BR"^L M @000 Ѝ0@F@Pj00TP Ѝ0p@-BR"^p@2@Pj0T0PpO-p`M@VeP-TPm +T@`0\ ?  0e0 e P p  ! @00Ds \a0DSW0DA0DS70DURX : QP   S  R j "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0T W 0 p0@0` XR A B0A PR W p p88@ 0`W p p}ꙙ0@-BR"^L M @000 Ѝ0@F@Pj00TP Ѝ0` p@-BR"^p@2@Pj0T0PpO-MHP@0@Q0@0BU PR"S0`8ET 0  0  0 P@ @@~P3H0: S4 d10@\! 6 %   0G- M砐 p@ U$e P'0G W09pPUo0 ;u0+ @P   U0 U W0PWTP W0@{W@  ~x p0 0 4 30܍ 0MQ/p xP|` 0- M Ѝ@-dM @p`Ph h0 00\00d s?0 (0 0 \0 30dЍO-/? 0M000T@@P 0\@?P `@ %   " H l%T!;d Xp\<@lA @87lA$` @b 9 @nM aDP,dPlb!5_L`h`:b.͌6o+(d! P% PPbQ pP5_l & d!, p' )``d!" t` 6o* dx@n,4O-p'`pp%nQ (pPp pnQ%P|p !7( b n ]>a,$bA!,@bA$͌e!@M l8+,`&'pbq p)7 +0.).4o&e)  `` `e.d)` !6o) *", $*" *(((e8P*+/+ ( ,"* " 4 0/" *p'*''`(pdq p dq' p0 o& o&o&( `n da(@} (a (,nA!@o͌`nA$g!@ oMnal ga,`ga&$`_? `/%/",`!g1)p`_%!`_%_%0`/"!! d, !:`PodQ `P%P`) n o],daa@n!o`,o po& po&   (M `$oe!na `4.+`+,͌.. `dA.( pea$ `& `l$me.`_l P!_ O%f _%)_%(O$_%0 P_lQ_%$,,_%O$_%%Pnf._P*ᝉaQ.魊i P%쟃4f Poa ` )` o.o&.o&,`$`4p..0pp]j oaa.o& p!!(o&o&,坉o&eQ`ja%p `&`i%j篃m _n/%i./"! " p _%_%p/% _ f!.iQ " _p%(4p0_%_%(`%fQ 쏃P%-a P]$pb./f!`(a!( "?a1/,"''p!+p/"+0p/"p!/"  m!!8e( &f1e1fq p?0nfpn10}e P`1n1`?f1?O#O$$,@`?#?#]?# $04g1`1ga`?n1`0. 0,?,.,..eg (eςm` ae a捈ςg 0pfa fςe Ϡ8pO,O$O$p @,,(@ ,Phf hA@ςa @!$P,, !!!`h`M fnQ`Qn_͌hQ`dQpnQdq p_`Q,` *`8*$  `plQ dQl_nQ.`)o)`(`.P}..aQlQaa `_dQgAaA`gQPOmlA P`AgA` OaAO!O$O$,!]!!f` f ͌菂g p''(( e '',peqfq`qlqeqlፈ$fqaalaaqpoea`(p_/l!'% 0))0+ 0'+0,_%_%_%@Ÿ''韌$< h1 a10h 0m`0韌h! a " =f 韌h! -c1f#韌( 蟠 )(((돌 )))p菌pfqob1#0#0& a''ppꯌo&bqb!! "= `!-!c1``#O @ b1# 韌0#abb!!,p뿌0 "= `!-!o&c1`q `#$ b1# 0#abA_0b!!=P "`!p lyZnܼbp!-c1(@``# όo&b1#@ 0#a0pbb!! "0= `!-!oc1`a`# @͌DP nHbb!# "`L m0 00 `0 0 30Ѝ60@-((( (@( @00#EgܺvT2A-`p100.!0% "q0 ?p0%0?SP@@g I0gS@pG"# ` *y0S@@:`F AIp@- ! 1 0M0 00 P@R00 113R0 0~? S `` 0~? S U PE0"0 1<3R08 (0 0 0 30Ѝp(( 00@- 0 0MPQ000@  @0  @" 0S0(0L @0 0 0 30Ѝ0)PPq' lG- MM砐 p@(U,eWP'0H W0:APUo0 ;u0+ =@P   U0 U ;Q0PFQTP Q0@;Q@  } x0 0 5 30܍Ѝ 0HQ P{p pP|`  0- M Ѝ@-lM @p`Ph h0 00d00 <0 (0 0 d0 30lЍ  0{,!0 { / #EgܺvT2O-tM0@ @P 0\@ 0 H @&0 40 h& 0,80lɉf+ 0 " (<0h+`,h;!@DPafl;"f0#R0XD=\`;@` Pb! P@$.@n dH@la[#l˄h{P% PL\b[b+c.,P ˠaˌan+% "T cf c;e+, "0X 9n;nl+! " \b)e+e[a#.P`kKXl[lˎc". dnaahpŒȌ̌ p' pb%,h̠cˌc;L{    (he . 00@28<0h; @$g@Jf;l@ b b+@ j $!n;,0#0@/`cpmvmzNS3hˌe;# 0͠T0+>C3C7Cg; )0隠c{n 0  k{Pct0fˌa" a(f `hHekb,b(e P]@a[l&al( h4bf%bf! L+I pᕓI嫗Ik <ll`` +LLd e+(Ldˌ p'e+" p g|nˇ\pb)f+ *h! ph,f{`8+LLLnˌ ꩠkˊ i p`Kfileka" a,eP @0e]h[ $bK&@hˌbK$ @dIDaKf%aˌf. n`be$be(p苠8fd.  f+d,dlʠeˌgn{( pe+n{'XPp"` k+`fjkkf{d{g,Th+, dh+" hP+AAAkP%P4]+AAA`[`Lb*n+lK')@n lK$ik@*XMhKg"hg.h 0ll;Xd.dˌ@e nb$ b,l̠gˌ,04p (llphbb+Dpl0h{,p+>Cn{,p'3Cp7Ca;}d{0lK(0@$@dJL0nKd;0h;'0# 0;l;ࠤ< ak g$.ꩠk n8hnˌP+LLLkˌ ` f "( P`+(  ,`+ j+gd#, ͠gˌ\p +~GsGwGf{`k芠c{.e p' phhgyd{g H "+@@@e b,a+P``&dnK,`@$mjk @Hj )dMcKl 'c; ` <0n P`g;$0#09ll˃T00l[d; 0#a\0gda{`;,0# 0=d;$@ cKhK@(@clK!@$ @H`K d b a+# " )l+c;$0#0:a;dK"b+  @$@0䊈i= 0tЍG-`p 1?P10@@e00T0U?W@@0@W@0W*TP(@T(pG  GA  A >0eW*0@-P@  M  1?0 @ cR c B T 0 E,̠P,ĠD 80 0 0 30` Ѝ0@J@ Q/* 00 R:* xB@-d @4  R  *4 8/n x0 S\ R `0S Р@- dk@ 4 *8/,TwxB /*(0"8 /:$& /--M  Ѝ Ѝ/0 4 0c  qp@E E` 0` (`E0@@MP#@EE` 0`(`E0@ @P 0@}EzElЍlЍ'(SR@B@- M`Stqt1pP@P`@@T 0Q zP Ѝ$ SP @ Ѝ@ SP"0S- -S?@0 0000 P  U RP +R@@D!0DSX uSP0S +S!@?@!@onpX ?P L0P00 1 R/@P/!R/L(0 @>R0 00//@-M Pp @UE`P`W0D>S 0!3100 0=EЍ>SD 0!3100H00H00ꌄ/-p@-MP@U@0 ` ` ,Px0x 08 R;0Ѝp@Ѝ/0 a0( ( 갃`Nk F R$ "@`0   1 =Wr +0G?oY20S ZlX 00 00X00 Z$`EP >E0Sl$0 ""@` 傡 0T 000 ) HR;%I?#I0!0 HR<IE0 @:0@0S:E0"SW  T4* 0 SA*"-+ @ LЍ'pC=W   00$`}EP $a>uE0S  $0""@ `Ⴁ|hE00eE0@b`E@`LЍ舁$`WE P $<>PE0S" B`01DsCE00 0pXp+P-@ +B XR R  +B0 -R +R XR 0 -R  X@PPQp  0{-M  {hp`Ѝ  P 0 @-D/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`W2P+S2U PU  0  jP $PwD0@pD@PPrUP ,000np 00^=.p@-0P@`T @T0rS Pp|p@P0+Spp@mkGp@-@PrQ` 0  P<0P0 `@p0  P{G0@-\A M@0 @f0P0A 0100S7<p@& P 7 00 00S00 ЍQ0 0 @Q0C@7`0 00S -+C@ Ѝ4(($stPSS|SS@-0A M@0@  0P00 000S.p P 0Y0 00S&0 Ѝ!KqCt0 @00SicC@ Ѝ0$TrtTD4@-414!0pP0 MS'1@T0 `0`S$ @0SV+ 000S"P*C0S%  <p   Ѝ|t0@T0S \C00@}40 0 qtCHC BG-HM`0 PLp p@ HЍ@ pP 0  5p p@ HЍpB0S @W"0P R@O-4MX`\@\+ `0  R % 00 0R`% 0 0YPY0L XJ V  Q %R%   p0@Pp (0`0o4P0$0X= P!0PeY@` 0P =Y00U0S `@(01#@, 0P` X $ 2@0 $*&  # #. B@T#0#"A $1?Ϡ "!,7# PPU4ЍT# 0 0o<30 0i(30$0PFU ,d0PE#0PE0u20STp@,`P`p 0 =P 0PU\ p@,`| \0S$"$:600!$0"!>!!!0C!0T!"0 #1O"X0/0 0 0$002#D!0 @0P!T! 000!T$/ !.P !Pp A(0 410X0d000Pp(0d000@tPp(0 <  R0@$ੑ9v 0APX00A$0儐I P0x 0 P2P2P0 p GzGPrQ(\)\\T8  oRSQm0Sx 0 fBQ>0/ 0 0@  03/0BB0$dd**PaO-pLLŸ KMMčؔܤ\0 /\@ @`P\/\P  `W!1 0 4 30aKލЍV4/\ T*/  0/\W@P P`P 0   R  ; T/R  * R& R 0 0 0  0/ r R @  (03/0S0: SW/00Q0$>/0 `0^^O-@ş5M$M 00000~S`P <   pH 0/SS;R 0B0 4ZS 0H*0; {P4S 0 0CPR IR*0S0;R 0X @H p S    ᬓ嬣嬳*S1 s00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QT Რ@  P+@PW |"h2 0 0 30ۍ$Ѝ@\0 D Sn 0]S2!^0100]S  s000-S]Q q0]S  0@< 0|10s  0BW 0R S0BW 0R S@b 0 Qy  001A0 )Y0  p:"/0P0H*0 ;P 0[0!^0  @'Q@f@d3,\?**Y[!-]%O-QM@`pM  @ 3^ @P}\ @\ [\ {\PU PE0]\\ \8(|PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S00 8(# 0}^S0CV  F B   H3  @ ]RR ]RR zA- 0` PpM 0 S #0{S @ 0\ @{\0 pLP Ѝ0}S0S ЍA< 0 @-`M Mp0 00000  , 0 @;S \0 0 ލ Ѝ@\ ; \\@\ɌTD P\ލ Ѝ\@p@-`Pp@0T1@D 0CP@DP t000p0 S. *S8 ?0Cs\#S 0 P/0S /Q 0S 0 0/0 S/@-@"S,$ \5 CP   @0S# 00 CR S 00\S 00@0#000"S0 @T0p@-$!$Q$1 P0 QMMR050   0 0 5 30.QލЍp , @ ` 0 Rp x @EO0 \PD04 P 0O"O \799!5C-0$eP`M 500S xE@ p#S":0 P$ 0S %P @ 0Sx:0SЍt `p  0@S 00 40  0Sx t倄倔p 0fS0fS 000#3R0 4$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 Q7P 000#3R0 p# 000 <7P 000#3R0 # 000 '7P( 000#3R05 " 000 0#S 20@ R@@'P00Ѝ0 S S\ 6P 000#3R0 " 0@00q  6P  6P2 000#3R0) ! 0 00T 000#3R0 ! 000ElP XF0@S0 @  6P =Q-' 0P0 0 6P =Q' 0P0 0 0 @00 ໓L!pN(! !d , 555<@p3 3 3 L2T ,2,1t H11p@-PPV6P f@P$PPP |00p0H0@-,@@Pi00O-pQpRpȟ MȟW ` S@P} < *p008 [V }8U (8 0 0 30Ѝ hs?0t0h ⸨p X 4 ӽUT 0'02f11 0(00pV( A0( ,0ܽp Pp}8<000S[ s800'0߽'@l8@Z 07 e800'p ᳽PwZpR '0BqQ #S X BqQ #S Y BqQ #S ^ BqQ #S [ BqQ #Sz Z BqQ #S  Q BqQ #S  P BqQ #S  O BqQ #S( T BqQ #SC U BqQ #S9 V BqQ #S/ W BqQ #S( L BqQ #S M BqQ #S N BqQ #S S:U 0'0S" R! B 0 P 000'0  0'0 F  RS0,'Z *p0S 700 '0'`7`W 0 Z[ 700'0 '@7@p, 0F7 @l  0# 00  㵼"   2000'0"   2000'00'0r೼p0840@ 00@0@8040qH | P;00Sr[t+64k1700g 2k  \'e S'\0`000`0 0SpC~ `  pG=w0'0B0 60SpY00?[% {0S0 \  '&p(`00C0M  'ppp&[\ R;0;0JGdGF* *@ZT)H%(X((0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpFhpP 5P ЍpXA-A@0`S(@@Q0+pPpPP k@P  ᶼp0 @BAQA3M@ ᡼p0 ᙼp0 p@-p`pP`P@T T0T0 R@@p>P00A-P@P`@p0S |@@j1 R"@`v,@P0050@cH, @- 00 tC-`4MP(@P 0S|0V ! UpЍ N0P;  =R6 0Q*G B&R&>$#"M = -Rp㴀Y WꘀqvK　SБp؏0X{FH̏  04$(?L$  # #"=X9<%" "X"0O-,,% BMM $ %u  %p 000 0000+ 0勏P 40 4P P@\ P 0S l400#S \ P 0S 444d0``\ P 0S 4d0``\ P 0S 30   \ v0P 0S wc30\ i0P 0S jc`30X3PE0 +!+@3@0 0P`\ N@P 0S 0PP[[ 1P200xS0xS0Se "P2 0 4 30BލЍlR@P\ Pq 0S @200#SF \  P 0S 2R0P\ PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ 0P 0S bH10\ 0P 0S b10 ! 10P 0 $0000 0000T51P8" ( 4  H  | @   d 5T  \,D hpx4$`p@-d@@0S P Hp@P@P 4P {p80 p@-P@P0 $S ṎpPP0P TPp@`@`P$Op| d p@-P@P0 $S ጎpPP0P 'Pp@`@`P$"pX0p@-\PP 4P ap<`<`P@pHH,@-@@P00O-,S$M M @p60P`U 0C   500{0?SN Sl *S 00 *Q @R50*QLU 00  *QA[SU \S0  0 @ Q8 $Ѝ?[ [2 *[ @[[ \[0S @@0S /Sy .Syw 0W r 0W/So.Z^ Q /Q b pP  /P P$ЍQ /QU 300000  ^[![00 0 00 @ pp /S \S? S -RF P0 U@ ᱠ0]S^0 p Sv tj p, 0Wl  0W/Sfdp @^U/X2000 /WU0@  0U ᾠ]QQ \Q  @P PӥU@  Q$ @@  0\ @ 8!  p[Q @ P0 @0 C0 0p`@0U0  Z 0 P/ZY  /lQ /Qk 0000`0 @0lP@-@ P 1 0 Q 4Q?o2cpp@-@lP.P X.P T00pT 00pZ1 0 p4$O-0p M @qp` P ;910230Y ߍPT 0 RpI  P: [ ; 0` 0P 1P) @@ 0  <p@ 0 !P0P S P ' ">0 "C 0 p@0 -R0)(O-0p M @p` P 10230Y ߍPPT 0 ʶpI  DP: [ ; 0` 0P P) @@ 0  ᴶp@ 0 噶P0P S P i' ">0 "C 0 ᔶp@Z0 -R&&O-0p M @ap` P 1/10230Y ߍ˿PT 0 BpI  㿿P: [ ; 0` 0P 'P) @@ 0  ,p@ 0 P0P S P & ">0 "C 0 p@/ -R&$$p@-T@0`P@ e0P0S SP pp p@-T@0`P@ 0P0S SqP p p@-T@0`P@ =0P0S SXP p訝 0 00 ޴!-H- M 0 S 0  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/! -H- M 0 S 0  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/Y  -- M0 0'--M  --M  A-`hpQpP @Q ᝽PD@(0 0000Aq]X0P R   0//$O-ǟ7  0S0 (0@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!T0h0p\@@PT |#08@@0/S(@@ @@ |hA-M`P'TA0P@D H!0C p0 00   ! 0b0C S1</.-,1*)(1&-p<,0 v0@S` 0S 0S),0"S D6!@Ѝ T1r0:,00ЍX  n@-@P1 0S* b'@T. 0T)  /Q0C T !@# *0P@/S x0 B@T@!h0 0"  T <@0@0@/SPD0{-DM  {000嵱p 800S DЍp@-`Pp' P@ w돱p V U phұUX p` ñάV@tQ?o?o 0C-@c^?c%^& ^ `pCc&Pc2680E270G2&1H01./ "0;:(0C0 /0 @- / ,00-+C@ P@ 7KE0 0/0E0E0C 400-+C@{$PG{6KE0{7 Q/ 0E0E0C /0P!Qoo G-@`^?`'^( ^ @p@`&``4 3V4X4G1Y010? 1?1>4!50;:(@000 /0 @- /k{  0 +C 0/A0C0C [k{ 0{+C{7 Q/A0C0C Jn@ @-kp A Jc@ @-`p J-@ @-*p J"@ @-pPP `ۯ@-w*00 ̯?0/R//R/?0S/R/P/R/p@-PMP`V @T 00A!Ѝp{ : { p@`($ b (0 00 R ̰d,@-O*00 0S@Z꠻(0 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PBPX `%@ 4PPY  @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍPP @@ @峵0(@$08  p O-\ϟC 0C,0  !/"b!!A0,0 W0 0000 0YWP 0  R0( SP 0 00HWz 0AP(0PW%S(Pk6 ,0 6,0,0 v>C 0CWP0(Z 000"0W0QD6 0 0P( 0, ,04#/A!b!b0C P0( 4 0 Br0 S8P(P1W*p 50 ,P(W0 00W =0 P( WTWp ;0 P 0 0p S0 (0W(Ph 0 P(]c0 , 0PS( 0$0?2c1, 11,0 020 0000 0 ,, ,0 0CP0(J 00000 3 ,, p,0 0CWP0(000c c0 ,_P([(P000yW0T 00. 0 GP(1 u  RO 0s! `p0@@v0 @`   ` @aKal B  0 B0 V PKUS ZSP  @ 0,"P ( 0$0 R0Y R0P ,P\ !/#b!!0"A `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0,40 00N(0~0 S!0 @pA_Q"pG@D  W@ 0 40N~ Q @(0:P 0(P00)\P(\ ף Ā Ql'$Idn\\v Q(PP @ ACLC|q \^JS S 00#3P0z z H/o"(PzXn|TQ(P7 pp@*CP(!B0pu10 B0,Pp> ( ' Pp#/"b!C;R, a2ba126MP P(P @ @0C2c2c2P$00( (0 00 @ 0 @Q ,0@0S} 00@y0S 0@r r,p0 0P P(00, 0C$0(^3000c^\0M0cP$`jP$`   0P  P(00 , 0Cq$00(06  p  0P( ,  #P ( (0 b$ 00 0M0ЍA-1@0QHPP P MK Q$`10 P1#L@p P@@ (. R! v P`WU Ѝ0 P0  P La@` 7U#T 0 Ѝd   0!#00p p *gfff(<@-0M@ u0P 00Ѝ@-0M@ℰ0P s00Ѝ@-aP@gp@-0 00M0,00`P @  P00Q Q Q # 0 l d0 0 ,0 300Ѝp <J ,E @xt,t,t,0@P/ P @/G-X# `pV@P0PES  R  D0PEV R  SS0@0D@R@- 0BAs @Q 0CR "@O-` MVP ? @P>  pP9 c0p01S Y Ѝ00P@P 0 0P 0 0 =00 "00RQ@-M @PЍTT "@ҳЍ" 00O-- M Mōll PMP` @ppB @\; CX0 ^00pt0 O$00 T>/ q@0,  (@P  Px d0 0 5 30 ݍ ЍO"00@J"00 lD H0   M Ѝ--M  Ѝ Ѝ/ -- M0 0i ЍЍ/O-R @p` M R00?ob100P @ P 00 P! !  3d1XP5   VP W9 V[XP0Ppp`0 0`f`0` 0 00/ Ѝ`npP% P彳0XP C0PP00  ЍQpP V JpP `0\@-@ M(0S2 0 `0( `1/qpPp0)  0 0 PUR <0PU ЍPPTp 0S  0CPU!00Pp@-P M(0S: n0 "p0( p1/qp@`0/  0 0 @ToR <0@To1`V ЍP@T` 0S  0C@o !T00k!00d0 R/p@- @Tp0 Rp0 0R0  P 0S P0 0c0(ܲ 0P0 ײ0 SҲ,P β4P ʲ8P Ʋp@òeEp@-@$PP0PJp@)0 @- @@"MJ@p@-,PP bK@pĉ@-M 1!00P00S p  0 XRp p 0S= `@@ W8 CR87!0A0 S0Q\.*L\*\ ( L0 s0QW   "Q @\ #R.SA a  00C "\ #R Ѝ`0@4  R  *4 8/| 0X\S 040:8 R РS /9MxB@-@`PLpL0ppD尀 T  g z®@-P`@0 p@-H @~ \\\%p \!00pq`P\ lrTI`70000E00p400 00p#V00 0@0;V cQƟf `sdQ 1^01 0SS100S0dQ Ul60100 V =V V 0`060000  m 7`Fv`000b`00FQ00100C0z V V 00o 50000  N70Fs0 0^L 0 0   00Fs0(% 0W0Cs0 20L0?Q000C00000=-Q003 ^QU00.00 J 00Fs0p0W0Cs0 000FSE0100C0#Š,\Q \%Ao 00&Ao  00=Ao#` 00. 3010@S#;V d30000 0!00C0`` 0AnSrXGFEDCBA@:gSJIC:-$ 00`F`0]00Z00[00R 00S 00N 00I 00D 00? 00:005000\00+00 cQP_dQw>0`Fv`00Fs00<00@J00 $t^ p^ ^ 0[ O-` M [P5 p@P@ 0 D\  QA" 00[ @U 0000 Ѝ0SS0Q00A0 Q0E000 S 0  00  ਢpA-R@P0`Sp ""#b! DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@00@1003/P(!p0 $@ c0V0 p00 R (㿬P000P3/P" Up  R  SVp  0ST廭P000U (/>3̺|l| |L{x{=A-R@P 0`So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@00@10 03/P(!p0 $@ Ϭ0V0 p00 R (+P00 0P3/P" Up   R  SVp 0S'P00 0U Ը|PzHzyXy(yG-@P P`P (rp^u  0F0\c<!"#b!0CaqV; Y _PpY` $00100S p w`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(ルP`0003/P 0 p 0000SX劬P00}00t/>3̵wh00 @?00 @00 @0000p@-@P Q Pp`\Pª0@P P`V 0"S ᑫp00p@p@-La P`M=  00QP0#P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P ? 800  7 0 @P/:P-0SP S:R S 0@S0S S P:P@P :R0P:P 00/hk0@-@A R R:\|\00\0S Q0A|R  :RRO-ǟM MtDčpĝ!^ $ 0 ^ |G@PU 0P0  ZpP 00S D  R&' ݨ0 00 PK00P000x` @ Z0P@0 S [K :S`\ \S S S`0UD*Z0+ 彝P 0@0 S[BV`P0#SS  [P500PS0O0SE0AU0:$0p%x5 0 D4 30Aݍ Ѝ:SV P0U:HGPPE" pP`PEV  00 0S g 00@ ⯧pP  w4@00PS0 00p4 p0040(0,= Pv :SL 0@S t40@0 0(<P<`4 pD pbPX pI  :S2 0S 0IK 00S:S:0 0pK0HW# 0 E 0P  L᫩ 0PCǨPp`ᠩ 00C R0@0B HPEJ@DନP P @ :00`0000 0 0,S p' 0pS gp%0 SRF ]0@ZX@00`彜 `3@E 0<4004P80 0 `6/p P K0C 04 8 0S:S X< H R0 0  Q!000M P@04@@0  0:S  00UOPK0 S:S008$ 0S:S000 ꌵ@,x{$0y0 00 Ա-H-M0 S0 00 0 0 0@  00^100M 0 @R0    R L00 嵘@ 00 0 0 30KH Ѝ/ᘾ뜱4@-:@0 @ @0*tO-@`$MllPiX20PY 00 0@`Qt@P p W  HP G p pGpPH0 S#:  % U10 r 1$4S1$ !t@00H H0S "<100S (!0 0 0 306 $Ѝ U r pP Р P 5SX0(, VT00#    PH H0S[W۽X|SD̐Юܡ. ˠ@-(@M@@0BPЍl  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A A{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T P0 0# 00Ѝ 0Ѝ0-$M  00 0P$Ѝ0-$M  00 0 P$Ѝ0 -M 00 0 Ѝ  '0/C-@P sMXp0^pAtA0O@0PP P{0`0>TA{ h 0 $@ @ 40 0 1 30sߍҼ Pة0   M ЍꄩO-ϟ MÍ000PQpZ P   P0%%Z * 0S0 R ,/$? 0 3 30< ߍP0  P 0C PS !000C 0 `0zSN~|{oyxwvus1jh?*c_^\ `ZEU000 `0CP0HPE 0SF0 0C0000 000Sw0  IY 񏐕r<)P0  P 0P0CS0000 @ 0D SB*jr? (0R0 (0 , 0C$00 40A@QPVo`^ 0 S0 00 Y8 @@0  P 0C0@0@ @T  0SP 00 0@0 @0 0CP2 0S0 000$0 $0S0 =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SP P000, 0@C0 <9T@!r?(0@0@ + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0_000@T@09S XRZ    0 ( 0        00 0@0( 0CP000&     ( S@ @x& YʱY  P rP @0vP" p P 0 S0 0C0  S  P @00CS0D 0 S0  @$ 00S P40SZ 40AQ0G 0Yc $ @00ESZ i P 0@0CS0O 0 S0 G @0ES$ PS|Z| R0/ 0@0CS0 0 S000K @+ D  @AQ X+ @ 3P 0@0CS0R000 0XO $ +D @@P 0 R0 @NT9 0Tb@@P9 0 R0 $ @XQ[@@P   R @0 00K'? 0r?(00Y D   00S0P0SY 00 0(0C@0@00<000jS0,` `01D0(0H@V< ᑠ P 0  B0=>J(  r0  Bp P p @p ;=>3PSq $0S0000PS`FYP Z,`XT $0S0 00 00;0j0<00000:0^09000P   yT tH  0    0 P P  +P  P0^Z``,40 Z`I` @0&0,(0( =>0#C0,`-QR ]QP @0J Q  ,` 000 0 P 0 0C P0 SP 000;000;0000900000000l000090 00a0:0[00WqIT  ,@  BR 0 R0 @$P 0 R0k @X;"  R "  R1XX  P BR@ $YP$L 0 SI 0iT nT  , BR@ 0Z0K @ R񏐸D" AR>  @ BR  0X0@ NR-  @ BR  0X0\ $@(T  @ BR  0 R0 @)T  @ BR  0 R0 $J$0 S$@5*YY0$ 0(0@T 0V040 (@) y`00 `500S @0S/ 00 0;Zd P 0@0CS0| 0Y0  @d0SNP 0Z 0aP 0 S 0 p00 00W 0*@ =. #RR @R  B   @ 009 @0=>03SS2 0@T0C0000@000& 0S`P @X A 00 000QP[ 0XX 0@*FP? 0 S< 0@@Q=8P1 0Y. 0@ 1,PF 0 SC 0 0 (m ?o_T20S  00CS@0 0 S000  Pi 0 0H0 B=>  @J+r0 峝pP P p P 0Y0C P 00S50@00CS0400 0S0  @0\,p `0$  , BR@ t 0 R0m$00 (@G_00 P Z 0@00N,  ]R$ `ZzPp80$0 0 P80,  4`, rO<`T xP$0 0P(0080<$p[PR 0 SO 0NRP 0X 0$@4FP= 0X: 0@;PE 0 SA$P P</P 0 S4$4I2$P 0Y 0$ @0P0 0S- 0 @0I$P P P 0 S 0@X,` @ tTP 0 ST' @tZ ( S C@ SP 0 S 0 @000< 4P $JP @-P 0 S 0$@   ,$P*, [ 7 0S@!0@3ZO 0䉚P@ P 00 0 {Z  ` `>0$0H00 o PE A=>0 $ C 0r!p/ P ZP@D7 0ST `Z   @DAP0 T0C 0 p0S-P Y ` 0@000 @(XZP@D`A-@P`p0 0@@-@`P MDp@0p0 000@ Ѝ計2p0A-| !P0@0S5 n0`1S010e C000PuP! pW@0PA `PQ 0 00 @ C PC000I0  Q  Q*RQ' <00@8 BP0*P00`0s0 `P B/0 B0 PXp@-@P q0@p@- $ M0@4/@PЍz@Ѝ@-X0 T0M0$@ 4/@PЍ`@Ѝ蜅@-0M$̓0 $@ 4/@P ЍF@ Ѝ@-@0\ \  M $, $@4/@P Ѝ)@ ЍȄ@-0M$̓0 (@ 4/@P Ѝ@ Ѝ@-@0\ \  M $, (@4/@P Ѝ@ Ѝ@-0M$̓0 4@ 4/@P Ѝ@ Ѝ@-@0\ \  M $, 4@4/@P Ѝ@ ЍO-M@DX@`pP# 0SP 0$,  ;/0$ 0H@ 4/@PЍ@Ѝ$ @-$$@M Ѝԁ@- $ M08@4/@PЍc@Ѝ@-X0 T0M0$8@ 4/@PЍI@Ѝ@@-@`pPtt0l尀 aT  ᪫@0 U$ NĀhy0RO-şM `@0  M 0P0 pP0ʿ00! B b09<Bp  UQPE @ 04BL3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b ϘP  00Ds0S0S0 S  \00t0!#300@ 00@00 @0`PUb*Ѝ@\ M00 员P-  R^^? @ 0 `0  ᎘P 0J ZS0 0 0J ZS,1 0000 Ѝ0S0 P1 00000\  s  `\00 00 00Cs0S ``0\  a  `0\  b  `0\  t  `0\  n  `0\  v  `}0\  f  `v0\  r  `o0\  @`i(qA- Q@Pp`! .P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0 P0 ADw v A-P@`ᶗPp .T Tp!0D1(0D,TS0 pAd_T %(0$"0@ !1 I6v O-ǟ UMLǟS @`|  sP0P0 rp0P0 [00 x190 H@ U1 p00PU`p! X U0 1 #ᥗP00? PP P5%0 ;\PU`p0pGGq WP1 P! Dc`ǕpP- Ƞ  0S V D0 G0CSax1  * 50 0  Rx1  ' 40 0  Rx1 00x1 00x1 00x1 "00x1@\00x100Ox1 I` U $`xPUO 0p 9/P00`ព圖嚖嘖#3 0 L1 30Uߍ 0S IP/3#0 [CP 1p3p#pz0 [\ T 0 Dpk War$00P 0S 0S 0 Y `0$0C04@@0@9@p`@-M @p 0: S  p  ]Ѝ00ЍO--3$M0P`0 *;#;$Spp{@00V00S00 e00 @ @ ` T  * P 0F @`  0E  Ip P @D T*0S^ @Tz0 I X*@0p    T1p [ 0Ḡ @ZTgM@Pg Xp#: 10 001[ 00 pX0P p 0 S0S[ z K`@0 P$0@$Ѝ0 e00 000S0fp0P  0!~~pP| @ p 6 Lp@-P , @T @&T0 0p [O-@Q M0" `Ppb [ P5@1 P1 5*P  6/P  00Y[ @D:P PU Ѝ/O-RLM<mQ`* @<000$0@ 凈0P 0` V0P@0p000F< 0 0 `00p :/Pppp Xh*00 d P `RP(0`4``p,0 PV 8/P  W Z(,004`V1011p1*`G0p 3/P00X < 0G 0 X  pW: pW 0  X:p H(0:/P(0<0 0H00 p' RP0 S <0 `00 Vp P` `(p Dp000 SP C00P E \0#03\0S pQ ,0P4` 8 p :/ P0 0RP p`ppP :/ PpW  V p 0S$0 S 0p  BY 0Y30I 0 00L W 00 0 SW1: ,0P4`8R $0S0] AR0pB00^ `<0 S; ὉLЍ 0 <<0 0 <UT `0F0W 0 Z 0   S`V0Y 0I 0CY0003  0 W R0B0C0000(0U 00(0 0 pPS PPp @pp`P @P Y@?p :/ P` @PT00p0 p5p1 *`Pp :/ PpT:P p 0S$0(S 0B  BY0Y030I p0@R0 0' 0P @pCY p 0:/ P0000Y`pIQ'p :/ PP`Y0p0Y0I0CY0003 p0R 0 S^*$Q\ 0L0CM 0A\ 0L0 00E `Dp@ 0 S 0`X00PJW9PdP `D  RPU @ {00-0 M0 Ѝp@- P@U 00S  RQ Qp0P{ {P 0 pH0H 000S@-@(崆0(@ᮆ<tp@- @MT TPT @TЍp0 Q 0QP ``0`P 0 RЍppC-M@P`0S$0090 0] _|P( p$ PQ# 0 00CR 0 U S R 0S$0Ѝp00`$0P0P 000S@-@("0(@:tA-`P@p 䀟0 00S (P   (0S~p qP   qq0S P(߅h0SdPp`4:t 00@-M!@ TP 0ʈp @Ѝ0@B0 S>PX0P @-DQ4  8,h0P@-X  S H@ @z0( (@ }P84,l0R0 @-\@0@ PQ 000^ N/7 000S 0 00 9/`-  0  ^^$  00mNAD A- p`W'0 FP@Ï@hC12c` P@ R0d0d 00 1HP@@T0`10 Ph_ N|p@-HP@P 0S,000@ p@ քd4G-xx p P@`ń `FR0A0A10 0T<T10 0!p 0 ⣄?TTT&?  0p0@p0 0@\  B0B10< @` u| @h G-@0`萟&䀟 P #QpY PFR0A0A10  00 0UPQ@pG@P H06&```8800A @*P 4@-(@@ @0@H@'O-p`>P& 0Q@@PppW@Q0Jh `X  }0PX@aa݃(O(0pG.wZ_TaB 000 D. @-*,@@0@P0S@M-`@P@_}P(p0@aa☃0Oԃ00ZO.TTaXPB(0( $0 0 00p@-05S PP0SZ sX@ 0CR\p@T P UP@߃\X/0$0! 0/p@-$P@քP ҄$ЄP ̄p@Ʉp@-@M P$`0.WP  RP DD)M00S 3/Ѝp003/ "A-$P0@MSp p0(`0 0@0p$p<Pp0(04,00S 3/@Ѝ y00,0(p03/pP 0S /A-M $P@0P P00 `pP zЍ00pO-d`yM(p`,PP } @Po 2 ᎂ20 RF ᇂ0!$@ !  00x0 4L  00 0. $(p,`: PP 80 03/``孂P"   !0 0 1 302yߍ         cᵃP ᯃP||pc᥃``gc,d,00 0D0+4 , Ы P00/@- 0UM 0H`0L10Hp! 0H1Yx@wpPw0P`p  S 0$< ,0 0 L1 30Uߍ謜)t@)p@-MP@AZ`P`Ѝp G\P YP  YP 00 0  P($O-@P(p,YP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV ශP``b@P V@0SZ V@҂00 G-`R p@P8/PP @VG-!1 0M@Q000`PQ UI U .00P!1 0 0 30ZЍ0) p00P 00 S00 0 wPP  0wPP v0PSoUp!0T  vPbp0 pPp Pvp 0 @Pѷ0 00vPꛛ&`&/ B/0  Q B  /0 R % B   %3 %//Q0 / 0R  B 1 // 0R  B  2/ // 0R  B 1  // 0R  B  2/ //0S :p@-@P0C0 o 00 0p/0p@-S@ :P0C0 ] 00 0pp0 $000  / 00$0p@-P@YP 0S S pp@YXP p@Xp@-P@YPp>  ZP  YP 0S SXP p@Xp0p@/p@-P@YPp >p@Y Y0@- MP@}XP Ѝ0{YP 0S00 %Z|0 0 0S /p@-@PYXPpXYP MXP  HXP p@BX0S S  /0S0/ R R 0 /0 0 /0  0/ CR  0  0/ 00/ 00/ 00/0 / @-2/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030< SPE YPA 0S !1 0 3 30<ߍ(#@- R R  R pP& R p  n~ 0S  %% 0 0 4 p V~ 0m0DO-PPğIM,M IM$J͍$@@Pp P0`S S  #3 I0$ 0 30Iݍ,Ѝ RJ- 岐RW# " "  J=00h^ \#Jy0  ~ $J- 0S $0S> S" UV J=00 s J=00Xb O<  RP 0Su 0SD0S  0S0s S0S UVJ= 0 03?"R #< {<0J8 0J=00 0 P J- 0S.J=  0S) S HJ͍0 E:01 00000G0 ,0OP @-+ 00SdLP# P P J=00X0  2RPmJ͍Pd Qܜ 8d H O-xxğ M@pQ4@0P0C`S,H6)('&%$#"! D QWX00 R04 0S SYex#p3 0 0 30ЍP#D3 0 0 300 HD@pЍOQWX00RT]WX) 0 "? s0|pPJTH0S0S ? /r x"s0 D|PTVT008" 0 | X: P00Sj!0 y|T@@O 00!0 j|piT 1i #pYp \1\\ P0 pY 0@D    F|T00? YRp0쐟젟PP0 ppW 0@Df    &|T00? D |P|TypdX  |(xLD   l 4 <d8G-p 0 FM& P@`p VP  RW  P Wr`ov` 0@Sp0 0 0 1 302Fߍ000 00?1m 00  0P Y: /r RX 0S P 0 v꥖A-@P`p 0 | 0P p@-MP`&P@@P@T 0S  R0S }Pg @PЍpP_PЍpp@-@XpPpP[p0. AASq0C .S .R Q P-S.S S /Q P_S /0@-S GRC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ R 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0S00@-d!$M""0 0 AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S0S'  R  R R R/S /0S S/@-/ 0  00S S/ /0S//0S 0@-P M@P0 PC@0S0S 0S Ѝ0/@-pQM @Q`P Q Ѝ0SS ЍS PPpV0S S p  0`00S S<0 y P 00  0TO-2MpC `<0 0pSP0 03/P 0`&<00&,SS00 80R0S^  RDp4pՔuPUI Y F*p0E0p(pp ,@ 0 C 07S@P0 03/P @S 0P0S`SVx80Sg U& &<00Sj&<00SDv!P` E/o0"SQ[EoᩒRG(0S0DY@0$P@CH<0D\; Y^7 @0C ,0P3 0P,0(00(0%S@ @$4 0, 0 30ݍ4ЍKS00&<00Se &<00Sg  E'UR!`w [pG_0p,@W(PE [p H00P0  }GP @@`!1 0 0 30\Ѝ0 SRJ @PF  0 j`P 000S ᒎP`P@P uuT ' P X0 SR @P  0 3`P000S`` WP)P P001\// p@-@P@P ttTpO--P@M  x/ x " 8 0 `PK  G C0p X 0S0S % p 0 . "2 ߍ0S0S;0S PUx>35 p p 0 0Q P  >00U  R  A/o"\  P  R R  ' p P 0P R   L" l1,P0S$g0 RS S0 00 LpP  <p00@(0$pW g972 G520W0 0S   S  R  R Q ^  ^ \/oQ" SR RS0S  0 PwQt x+0 0Sm QRi 0pS[ %U0P,0U  P , 0 B  0P0pW ,00 X,@@T0Sw 0p(@($ S R  P  \C P1 @T( T d842 D52 0T0 S\  ^$SpQ^,\)@(T2 X 000`P 0$ `pVPUM q0P(0G 臟XVP 0 ``P`T+tPXP6(r0S. $0S r> 0p@/oQ" SCRp  0+gPUe 0 PQ RN 00SG RQC 00  dpP 0 Pp5 Rp  RSpRqnRp  P<R \ 0 @X0 0P p[1 0[+-0S 0e/0 5%0 @`Y X4V0@S ??`$,PX00pX@T $PP@P qqT$PX@T0 4p0$,P` P 000 4P_@T 0S S00SppRSQ ԃ,@? ppq@ ,0pP,0  0P& p @P q~qY@P$fuqp$00oP  0 ``rPXH [:0P @Po@P H HEQHPT [` @T@*P @ Gq020,0(0x4PX@⠰ @+ `\P0U|`0K U0n t0h0 pD0 , p`^ !e0P 0 qdP5 K0 L LeP00K*00|000[ Sl S  ^ 0Q b 0 03 S0*0P U U :d d  P  h p 0 xIi (@4P0 00a"0S0(0pP@P P0U 0Pp R0 PP  p00㸠P$0r`$p,Pt K0^.% >✭ <:eP1x00x0 ^p귉p@pPPP @ `0V 00`EpT0`@pO-ttqLM @ p PP0 00PE ``0S S S T@P `0S `(0( (`TP00 U `V X 00 sX``VU$@LЍTG-XM`@(P pP @00  &0 2P 40S0- XЍ qP o  0 P o8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ0-   00#EgܺvT2A-`0!ᣁ000?0"@@h>VP0p: Q0hV@Hp` G0S@@:p`F Ap@-@P0M0` 0 00 !? 7R8 bx b  D 80 0 0 30X Ѝp@2 K h G-H"H2 0M000020"00P003  `p0\ @ 0 XS@@|Q0 C" T. .0N|Q0.\'^V*00QP0@^*0^0 8< 4^*0 8<ꙃ  - MaP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0D7  xG 8G A-@8`4 rMX0P^ppAtA'h0Och0 000TAΌ L]gP" 0 npP 0@hP d X0 0 1 30 rߍP i00 0P0 B@ 0   M Ѝ  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/\ p@- M@ Pt00h` 0`0 `P@@X@_0@T  Ѝp @-TT1 0M` !000]p @P   ]p |\@ 0 0 0 30*Ѝn\PpW @@T PU 0S(P@<T00@3001 i 0p@-P@0 0p0h(0Ph(P,Ph 0\0PP 0P 00,,gP 00pT8 0@-@ 0 0^ 0 0 0 0 00@- 0 MP @0h 00P 0 =?o20c Ѝ01 00 0p@-@P 0U0 0pp@-@PVh0PPRh(0POh(P,PpG-P0Pk `ԿPd 0@00 S S0 S S lÿpPS 00pXp p8 (尿@P 0q0p0S S S@ 0A S  Aᘿ@P0 ! 0S 0000gP   fP0@@DXO-@ 0`p M,0(S{: (T_ TppW 00SS 0 RM@D@T0PH 00SD000@D@D0P0S- T0Y  0!0J@0PI 00S$0AS00}0  au0S000 k  Pd0S& `0p@Zg0ppVg(0pSg(p,pO@ ЍlfP  (,@A(|0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0]P Ѝ0=p 0$  $ 0 . Ѝ0O-@XULMP$`0 @@shPF$dpPB 0 @@fhP7$PPW* 0`Q QD QR Q& 0S:00Sz kdPb  `00m0 @p R  R/ RY R 0 @T:p f 0J[0H 0 LЍ   @QA@ 0S`:   (⼐(p 0  ,i  p0p 4`0^W G`@Q @T: 0Kf00Ff `^ \LQ  QA@ \Y ^ Q\ @  p, 0S QARU  R  PP@T( Q  A X " X. X4 p X@  P@T+:>X X X 0` `p  `  Q@` ``  `p`e|; eUZ'QO-^p P`PU<>c ( [@$0`  $ X(0,2(``-P p`[ # 3X(0, 0!(`` -0P p`QJ`a!Q0#03U0S` Q:PQ Y5XX030#1!H 0 De@?000X; S`3 `#61S41`F2s2`Fs1`FPS0`Fh O0`Fv`4:0;`0Y S`3 `#61S41`F2s2`Fs1`FPS0`Fi 00`Fv`0809```6 p@-`MNXp& @Yp) P0u0'{0 {@{0@KXt h0 0-P Ѝp|Y6X000X / p@-\ ,@\ \ Q :\ :Ap00p00C-P$0@SMJ 0( U4p :`H;$963>0HG81GpB70B- 0R  R 000<890L>1 0 00LЍ 00!00< 0 0@-S@ 3/@.dp@-W Q4S @A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U  B N B ^ '" ^ q N $P@@DF$EA! BB  D B &"AA!@@  B B!"AA!@@ pQ Q@#`  P`PE@F$NN. B B&"@D@D"F$NN. B B""@D@DA$NNU. B L B \'"\  \ \ , ($P@\ \. \* \, P@^ ^ N@N P@\ \ \ \ @wPU  0R40008 ^`1S   ;`1S0 `0  0PJ0  0P7P  PP$0  0P0  0P0  0uP0  0iP0 0^P`1SxYz < Pp0ppW  0R 0#^_pW 0pW  0Rx 0^LpWf 0pWa  0R0 ,0]9pWGpWD 0 PS00 ]`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0001p 0001p 0001p 0xt1p 0[V`L }]tЍ tЍ 0 410 -0 & 0 0  00  x0  H d `x ԍ|X؍xX8@-@`00AMM0 400p00 7PP0S `D 80 0 4 30AލЍ.$w뜓 0 0,@-@ M pp P7`PP 0S <0000 Ѝ00S.S 0S ЍLZp@-|0|AMPt 0 ` $ 0 @P 8 00 0 4 30Aލpv, p@-P@Q`  @Q /ZPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝp@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00ЍpH0@- MPq0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0Px Ѝ0P ,Јhp@-Q`M x00<@6P 0PU  0VЍp_40P 0`PЍp @@x ̆ 0@- MP0@0@=@T  0U Ѝ0p0 0P+U:L@@ Ѝ0<00@00 0P Ѝ0؃ 4<`40@-@ M T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP\`0ȅ܅ԅ̄0@- MP2@O@ fP Ѝ0 0( 0PO Ѝ0\0@- MPh0h@0@B>@T  0U Ѝ0O,0@ 0P. Ѝ0 4DMp@-@ML 0 Q0P0<00P@ ` 0. 0T @D i[000T H0 0 <0 30 @Ѝp@Ѝ/.0 T.t | O-PM@PP pi`e0 裟Q  ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0`g 0 T @ P  S#3@ P 0RQ  S # 3!# 0T: 0 T @  P  S#3@  P 0R \  S # 3 # 0T 0 0N 0L0 000J 00  0;Ȉ O-`Q0 dM R 22/18R{20\0QS0N0@0l2a!##\B2b1!AP2aL5BX2dD@AEW0E0<02h8's2Q>?2crlqqHL01NਂhL΅ReXT P0HP QNos ks gs[P0 T XF Z H Y J (0L0$0\04 0<0,0H0 0@0p 0D P40:[ YZ YY YdЍ00N\0`R`(`j  0 0dЍXZ HY  8igMbQ8}||jjj@-@P0D .R\*^QA@0T.S @-$MP`@P`PT0pv> 00pp< pp_p  ~WPc$Ѝ{C-@P@ `p MPOP @U UP@Wt Ѝ @Pt0 0000 0 PJ @0S0Toᨂ#v \x zC-@P@ `p MPx@P @U UP@Wt Ѝ @Pt0 0000 0 P @0S0Toᨂ#t Ȁ yp@-@P00CS0 S u P `0 PpCX`u0 0CS0pSr P 0 /+X@-M@0  00ŷ00 !R !0@·Ѝ@-0 S 0@Q0 R  004S 0@l@Q0R Q    R Q ,} Lp@-DPD0P`@0pp 00p@,X088| Lp@-@ @ `@0Ppp0p@,"{ LA-DD p@0P`p0 A { LC-P0 `0pMpp@ H 0D @ <8 %@Ѝ2,{ LC-tPp0 `0p MFp@ ( 0  `@ Ѝ1z L0 00/z L0 00/y L 0 00M0Ѝy LA-TT p@P`Mp 0 Ѝy L0 00M0Ѝo,y LC-tPp0 `0p Mp@ ( 0  @ Ѝ1x LC-|Px0 `0pMp@ 4 00  @Ѝu1px L0@-P@000 00M 0 0 Ѝ0w Lp@-D0D 0@0pP p@K1pw L((  M  0 Ѝ8w L{ R) p@-P`@V *P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-M,`(@Pp 0^0PF0 R # P R8@  0  B0 00 ЍW Q ^.Q  Q. 0  .Q P P D00p@-P0@S` 20 0C0p( 0 pO-Mp8`P@P*W2*00V-:Y `* 00 p pZ+ `±P 0 P0 P 0000000Ѝ`<0 PFЍ ` pSwwRA-PR@`p0ASAA0 0SA0q0@ <0 eP00`p,vO-ϟMM M $0>0?͍0 @@8,0=͍p 000\0`@L@H 0 P, 0PS P0⯭40H0P 0 0APr0(0-0 H< 0PPc00H= K$0 0 D 00$00x0X>d 0  0  0PA0( 0JP8XX 0HS Z=KX*Zo(~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! P1 R 0S .S 0S 0S00S.SP90W) |9d 0 P 0 P0D 0 ScD0C,9$.800440PI0000 0@ 0CS(00x0p` 4Z@$`p @D0  yP(0Ssʌ0 nP0 0`PP8000#8088, 000.0 r  .00Q $0 AEP0 0Y0D:0@ H;C't7 0  0 30 ݍЍt7XWwd7P0hX7WP0e H' dP0⯭40H00( 0 PPm0 w0P(0c6000#80P0寭40H0 0 0PM04 0 B0PC0HK@0DW-P@6@DKd 0 @ 0 P(4 0 BbP HK40P%W=, P$ ,0 PDR$ t3d 0 P 0 PpP: ,p PD[cd `0  0 PV,PD[0d  0 PD,2@d DK0 0 P`14 @0 BkP) 0D @PC  2 P`aP71!0 Wzd,0@00Td 00DK1 0| 0 PPG@ d1 `PV\qVp# P@) 0 P0U0 0 DyP00e0S0PEV 0 jP0d 0 ; 0  \Py$r q (utoophp|c8oi $m ma0mlxl@lkTkj iih*tg4\ggfgeL C+A0W 10"3$ 0;A0000;A0200;A4;+A0W$1 00%;A>A C5;}W 5P0%@z 0 P3 0 4  BkP)0DK 0T*Pup\z `$P倐P 0(Vm  R @0 Y$ 0d  x 0 P@T0P`B*0l&@DK1#|0X 0 |P@ p6!?C0 S 0 fP 0 4  BP0Dk 0PCUQqH@p@Th1 W2 w0d   0 8PW  7P0v40P<8`@C 0PP 0 P{ 0  PsD 0  Pk0DK 0PCU x80FW 0d 080 0 PQ`VcPD[# 1R0@ `P0000=pHK0 0="n-@0GV D[HK0 0S@|  0 P0W^d)`9@d DK0 P 0 P40<8p@C 0 6P,  0 P 0  &PHKWW/)0`@*):Dk @@2 0E  0 eP 0  yPPW J 0@ PD[ RP ` 0dP] P 0 D[ ?P 0 S0P@ 0D;  0,P4 0 BPAp4 0p BPz  0 Pr$lDK`(PD[0d  0 P\(PD[0d  0 PJ(` (P (<@d `0DKP 0 P0HK@4 0@ BfP$P  0 P@D[i( 0Pe(HKb( .I@W0S W ]0Pd 0 0j ` 0 P0p0d 0D X 0 yP 0 d J 0 kP0`DkS 0 uPv>P0W?P0'P'0`00( DkP0  0 P_'0D>d 0 { 0 PW=-P0 W 0 4  B)P0Dk 0S|-C1#00 S` 0 qP=pP`HK0 0=@PE0DkHKP=pP`HK0 0 0 HP<P0$P( 0 PU0D[y:Vl<P0z`<`,P0 xP<P0pD<P0l8<P0h@ -`P.V!V5 |pP@ᱵ 0  Pk0U0 0 DPb00e0S0PEVڌ 0 PRl;P02`;d 0 ` 0 P@U $kP`0d 0 0 0  P-0TDK 0 P! @D[ 0 P 0 P0 PpjD[40`@CP P 0P<P0D[ 0S 0  P@ PPUU yp`@ 0 rP0V0 0 DiP00f0U0`FUL 0 ZPw,9P0 9P0&`%P%``@8DK@2 P0P 0 4P4 0 BP0H[=0 0@=L 0 Pv%$h`P 0 pD{Pf7d P0 P 0 PW 0 aPO 0 PG% 0 P `D[P9=0H{` 0S.p`F=`H{0 03P! 0 Pl%VpP 0  `DkP =0Hp 0SpG=pH 0 0P4 0 P =% 0` PD[ }P=0H{` X0Sp`F=`H{ 0 0P 0 ]P%\@ 0 DK @OP=HkP 0*@P=0PEP 0`Hk 7P0 P 0 'PHKD 0 P:}0H[=0 0ᱳ@.@4@$PG0 R04P0J$4$$PG0 H 0$PC 4 0A 0 PQsp30/ 0#PC3 0,@ P`PVV spP@r 0 P+0U0 0 DP"00e0V0PEV  0 P 0 P rp 0PC202"0 2P0 0 Prp2P02"P0 prpP@ 0 tP0U0 0 DkP00e0S0PEV 0 \Py 0 SPqp1!PG0 $@ 0@X0D:] 0|!PCx1 0l 0 1PPqpWH1H!0 rbxU(U UlTSRGpSQlQXQQDQ4Q$QQPLPtQ0QPP`OONMM8NlC(M;LKK@KJPP0 ?p@800pp@-P@t8P p@ p@ p@-@P 0PS <0S P 00p辱00pQP@- 0R R  諱00p@-PP Q@ @Q Q QT0 D3200pP T0DS@pP p@-PP @P  T 000ZiP IP NP<4@khP 400(S x  201 0ZnP q V PlЍ 00XS 40Y Y00] V4000S @ lЍ zgk\ 0R0D Rk0 ڐLg{R[{{0S, 0yS0%bQ, 0BSPQk S0 0 {k{'{jP0 00gP 0 S B ? @ 0,`v@?A( (  N%?L\ @, $ [  ``Q0QJ`FKSFZT0StVj[ Fj@PN 8jPI 0 ` 0yj 0Sd P |g J @U D 10jS*k&0B: @>V  L1D R@0s {{7{8hhh h7hpP   ! ⑦ TLjP8 i@P LTQ0 0`B A0,`AR Q6`v $  z 0BSPQ S0 0U(3 Pe [k{{ER' U'p{jp8k{'PP{WP D$ kPaU U94UP@PP7KaDjP{@{0 $Q0@0 "00 X8 @ 0SAXK @4@\  0@@ T  4T440@@ T(00040Yi 000P  4 0P @d1 @R`4 00@ 00100s^{0 S4@B0G{1kV40 0=0@@400@ SHA4@0@D00@ SIY\E;$0S@dp4@yfP h@P 8'hP( 8g(Z8 8hP8,` 0S  55X$[ 8igggegcg agPhpPp,`RhpPP  f RVD ۟4ğ [ 0U0j[0S {۴ {:S03:g۸VM{M{ Qk6 C A@{{ {*30 SU{{@0$&00G={۴|Z8,` g ggg g#  B"$ 귻N{@{7{c۟ VM{M{D  Qkf{G = 0V:0:G{G5  0$00tŸ0 T00 0T80` 4< (c0@ SV OO@0S46Sl{ q۟] ^q{MM{^m۟MMQ|Q!&P{pkP{'QpU{D倁5AD{k{' DTQQ{ZVEQ85́Dh A5&B@D {{ *00S{*0R:s 0$0 0 0Co0 0 ꔀT@{0 Sx0G{0V1 400 ' ?A5??? ||N @ p {۴J{۴SR 0,`$8@p8 LPR 5 e8 f0< @Mk0S3 b0A!Fk{1V 40{'05&D [  $J(R  ⋐RЁR ($ 0X 0 0R4040C40dP40~ 040a@,`G 0Co0 0 0S,`0S 0SA [8eeee eU  V{ *p1 0S3LT `P %46$ $D0[ $,` w R ^@0 @#{{78{[@0"SZD 46SU00jS  U R*k&0B:@{{8{5?55?P9p @0,`0D 46S400kS0S0S| fPW fPsD0 U8 9 kR77RXe e e e ekqU D 10jSR-@ R ^% M @{@{7@{83 {B@@U@<q0 ^  l36B#: :@ D0-b)&^@0 ,` 08$V >fP yfP&ݱ 0$H 08$Cx S   0&D @0L  jRq8S" k`Q ?0 00M 0ЍPL MA-PU@`0pS  ᵨP 0S UDp@-P@}PyP0 S :pSSp 0R:pp808 8e0 $0$ $f0 wh  dA-P`H@ET*AP/ =P4 pPW 0P P B $$P W 0 P l l0l C0 4T T0T D0 +< <0< E0 " \ܔ 8 0 0@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-r-w0-x0R 00M000S wS -S rS  0S /xS  /  p@-^ PB2 p 0 pP P//0S/ S S/0S/0S/@-@g0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 /P\ h ??SQ $0$ $p@-0 / P P P`/AQ/Q/Q Q/?0 H0H Hp@-0 Q/?S0?/0?/ht QP0 ?0/@-郩 0  A-%9P 0`00`@pq PVj0Sd0@a;_@pp@-P0@ ES`M aЍp I 0P-A0S 0 p@-@PpP Q 0S P);0PS#;p@ ;A-X Pp@PEX `PP@``O-` MV " p@IV P4P @0SV F!0 `F`1 Ѝ Ѝ :` - BMMRč `` T @P 0 P-   @ 84  0@- @-ßs M Mp$ȍP|`@M TF "  r" @$@`p 0 "l2 0 $8 30ލ Ѝ6TB^T"P0 @ڣp -0 B^P.Q!0 <100A@  0 d P0 \ AL+\ -L+*)B'&%$#"   \P  i\\\\\8SX  h ` H  \ ܯ x  0 %\    t 010/C. *     A-RP`p(M @x 0 @0@0 P0 P0T P@ 0 (Ѝp  X00 5CS  A/0cS#:3 3Q31:0CS! 2#0@-@P S 0\\0 0NO-P`M p ǡ@P-Y[ +Y @0G ͣ`np"@ 0Iq \ aIQW IAIQ7 IUTPRQ @ 0T  R S` 0J0 0 ЍS T0 Ѝ0Y U Pp`Ppb0 0XQ AA0@ \QUPpbPpbꙙ0@-BR"^H M <000 Ѝ0@f@Pᨦ00TP Ѝ0 p@-BR"^p@S@Pᕦ0T0PpO-p`M@P-TP0 +To S0T W  p S  0㜡j  0 ?0 0㊡ 0  傡 P @p P ; Q P  S  R2 !" P 00Bs ^a0BSW0BA0BS-70BS*| Y[  Q P  S  R!" S@` "00"00 0S \0F0 0 ЍS@ `?0u0T0j XR A B0A PR W  p] ppY @p` RWLppL0@-BR"^L M @000 Ѝ0@ @P᭥00TP Ѝ0 p@-BR"^p@ @Pᙥ0T0Pp | 0 Q?0S @-P-- M[ ЍЍ/G-`PΖ00 !PER !U6@  PG0 ZPU pWU@bPp X" 00婖  @@pG  p800癖 1 0@00ፖሖA-P@PH`H0``@p B6T  I AH dp@-@P\00CS0 S u P `0 PSp6`u@-@< 0`00@;- M ? Ѝ0 000 /0O-`MQ 0 Q0 `ߍ0( 0Y4PP 3p000 00` P 2@P 0 "0 0P @ R R R#Z0P`0S 0@ ET :@D0SZ@DPg @ e P[P@DV RZ6 0 0 T00 R R0 S S 4 ؍P@  @DOo  @BP vP !V_*0`TY ᴱ p  R R R RO V2* ᣍP @ R p~  d R @D0PS C   @DZ HPT* (5P `F p ` 005(4 P`F m p` p75pa p_@-DD @1LM0D`QpP- @.0 P) U) pp0 00  UP 5  0 x0 0 D0 30LЍTPLpp  @ j5TN   TA-``@PTpM) W ``00实 0 TP ?5  0 ЍX`` k@/5T Ѝ{TP @ 0S/ 0S/p@-0` P@ Q 0p0 :00 Rp` FQ`00pO-llß OM4`PQ `Pp@dh Q 00ޢ/00 Z.` 囐P 20 00 [ !!.PQP\.Q O :!v!PH [ 00:[.[<##=[0Q.S7 Y_0IS00X00 I Z  0O P00 0J ` `ٝ0 0C S:: l0  `  C:[ 000(0,$@0庝0 0(0 `0 $cP00 0 0 41 30Oߍ Z]00300<4 "PPU U.R  :P vM  tX  O-ʟ UMMLōxŝ| 0p: \0U刕$8 \ \ 04*0$: 0 L5 30|UލЍ*0 0(10P,0 0 ?s0 XS#``Po ,35 00 @P 00  03/P @ X:0pCorS  Rb  P$0 `PPP0$,v`VX00 XD05 @00 0T0R?`FHL@04p< 0\`P0 C0I pP" 00  03/P @ ZS 00  0Sp(0EY (@v X`F,04p0H00,0D Rz 0 dP0L0QR  RL p 0p XPD `BZO[P0 00S 烱 [soQ \ V\pp0ZP &0 0,W D0SX0 B@Gq 0P^!P" SPSP@Qp$`0S 00 0`@H @PC0@P0CS`@:Hp$` @ԗ2L0X C0 0CS`:Ɨ0<0S0 Su  R;  C'SR\0@0P40%P P5I RSN5 0@0i @PB 00  (0@Sx@[ 00pS2 @p`p8P%$0B/P$0 0S0S D0S$0PΛP0@T` *\0L 0R*  WD0`@0(@LD0 R R 80P0?R0 0 @P 00 ? (0@ST H0,1Q?*,P䎛P P `P凛0p CR00SYH04p0,0H00,0A@e PzPpm0`P@ CR00S0@iP`@ 03/P $`,0H(pC 0T0 10P}  , H00,0,1ݟ 0$ 0% 34t  0 Nύ00S@1sPg ,*$0pP`p_8}.P!0 ~ pPW 00 , (0pSD0S$0,PH0,0@T L@,(p90%P 304p08T H0,1Q *,H0P,0c P" ,0H(@C 0T000P  , H0JH00,0  Xi th A-0S`@M05 S Ѝ0p 0.PP4 [P/ 80 0P媬P  0 0P)1QU 00S S 0p1?1 0 G-20BM0400 00`S0. S @ᄒA~ P p0u #0G)/P @T *X8 4"@,2P 0 "1 0 4 30vBލ 0    ! .f.@PI ОPPD 8 0 0@yPAP 0 00 00000 00@0T7 0 p pIP  ን00S 0  0pW&   0 0ᢞ 0 q0 0 k0ᓞ 0 ጞ 00S S ႞I \( G-Mp0`\@P0P0 0   0 p`<P]Ѝ 0 0PP A-M`pP6@P , 0 (   P0@:Ѝ0, 0ЍRQ0@-$MP8@'0S9 0S0S9   0 40 0 0P@P 00$Ѝ0R R" ҝ/ 0 0$Ѝ00S ǝ 0 00S000s S 04   0l  O-DDğ DM<h@P 0 (B-0P P`sp/0 `PP P ,0  0P0ß RR RR 0 Q Q 0 R R 8 $0$0@P`  s p0S S S@ 1Y g*@؆@P 000S 0 R0 ?@B 0I  R06@DQ1 #  @D T!:  @Dp0 Sq CF P`0  @D q [p>`_PT* P`.. 0  0d!P1 0 <0 30HDЍ(.PI `  P@ P1 0 0 00 J P`00.. 0 .0 000塜00 `G`Pt | p@-M`P@),0,0   0uЍp`x@-M@$$ 9 Ѝ @-M`P@vpP0P0 ɠ@0@ 0   @0TPuЍ0@-P MP@T 0t  P00 000P 9 @ Ѝ0@T00T<$@-p1p!00M@0  p` P 0^! 00 0 N RB0100 N.^Q 00 Ѝ R0XS 00 9^0 ^ @ A Q QV $ (,03?00< O-Ÿ2 0,MP0$00@P P /00x"p2 0 $0 30 ,ЍL"@2 0 $0 30,ЍOq0:[000 0= [? 0P P` @q0p <P00 `V+ @PUVP C `$pV氀0SN V0F S0 s\b 0:[@  P 0:UV 0S 0$ S氀 @`0S @`$p @.[P `$pVPiFV p @ PX 0p@-@P  (M $  `0 ,+P* RL @0 0 $0 30(Ѝpٚ 0 /F d O-ß lMPd 0 P / 0 #3 0 d0 30lЍd#X3 0 d0 30 lЍO 040 $(,00h1T@ RT@P0 q0S P q u XP 0SP q, u00 X0S PX$Up#P40@ 0b:0@Tp0*PUY 0 SY*  0CR00R:@ᤐ{uPp40@` 0b\!J 0 e*PY9@Tp. U00 S` V,*:0UT0X X- X@P0( R0  JP ^P RU @Tpu0 S: 0 ': 00@SP 3E O-XX M@QpPL (Z= U U U  0 Ѝ0` Rz  ?0Z' + ňPP 0:/qp  00P @ P +00 0 00 ߊЍ1p p? P0  * R + L UZ pp 0* P 00 0SN  00 0:/qp 00 `P¿^ 0? <`V<X0`w R0&0R0 jP0 :/qp`0 a 00 0`VÿR <0`VÿpX0PZLS 00 0^O <?` 800C`V 0Y!QD`L0k?  `:/qp> 00 `P  @ P *00 0 Y 00 UP'0 S$: 0C =P`T 0S  0C`ÿ00C`V0  Y 0CI 0^ @0^ *00 00 0   0 މ S\0O-@ $M  H`p 00#p 0 0@H`# 0 B0S0 Q6  R00S 0B QR `  e)PP ;00[U X0 00@PL  RWRY 00S ` R00S R Tu*0D0 Sm P^ TP`p^[  C0 P ATq ^a S 0 ` H`@@3 QY/ ᛅP+ 0S "  P00S U0S S" S' S- PP000S 0 0 T $Ѝ`dP`V=W WS SSS )p@-@0P0FG p 00p0 0@pf0TSb00 -M0 3/Ѝ/@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ R R R //00/00/ R R R //00/00/@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/Ѝ0@- @RP M R R Ѝ0003/P PP Ѝ00P03/P 0@- @RP M R R Ѝ0003/P PP Ѝ00P03/P @- @RM R R Ѝ003/P 00S00Ѝ 0R0 02/Ѝ@- @RM R R Ѝ003/P 00Ѝ 0 03/ЍR0 p@-@PPeP P0 03/P U 0| p@ 0/003/P U 0@ p@0/@oppp/@ tA-P@Qp`M Q Q Ѝ0 03/P V*PX T'000  0003/P P P PЍAR X %P` }0SP%'? Ĭ ;A-pP`@P  R 0 R 0\A/W 0A/0A-M 00@SpP` SV D  P RPU U U Ѝ&000SP Ѝ VP 0SPU& s%P` g= Ȫ (#0@-0@SP M S S Ѝ00 03/P 003/P  0 Ѝ00 00 0 3/P 003/ Ѝ00@-0@SP M S S Ѝ00 03/P 003/P  0 Ѝ00 00 0 3/P 003/ Ѝ0@-M@P0.S00Ѝ@-M@p@Ѝ R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 /< L0 00/ 8p/0/ 40/0/O-0 MS P`xx RX Q XS@.PL @PO XG@RAS0SI <  cSB!  S   X3`"SpP@@Pᬲ   pGFW`W0P@vWl 7`@FT0S0S V*000F Ѝ(00AQQ!X@R P\! C]R% X!q#c!! Cr   "!!1Cs0#"1 0@0Ls 0;S!S" Cr 9" X00Ls`@S \S X 0@@XQ P`S pg' 0`0~ pg'!"d0`0q꜒000X.0`0vp8 QĎO-Pğ@ $MQ `0Xt P`p)[V> 3P @Qa (P @Q`P P @`VT*` P`Vy [\Vr .V DAv Xt0S Q.Sm @]Pj `0PCU`PxQM  D P XS  ``/Qj ]QOP R02   0 ]R) PR  "  XSnP   R0 F b"r R` V` v`A ` @R^ .R @ё@  0D0C  X1đ(00$Ѝ辑00P  ` < V    \  PS X R0Q  S0 T 4*@DT[@ XS(@ X000… Q ` T`4*@DT[@S X00`ܭ x4 h1 0G-AQ@<*p0S% R3 @R`P00 0X* 0s00瘠    P 0 Sp00 NAS 0SPQP!00P0X(008  RO-P3P#RP3 M0U p\` @0I @R: R R& (000 ЍQ*@ ĠS? A @ G0RPR@\ 4 R @4 S0A  Y*@T*0P྇ 0A\ R!ɑ" 40S0 4 0- M ЍO-S@,M `0S0g 0S 0S0^P @^Y \S0pS0 0P00C0$PU P0S @Sf  [@_U pPU00 S V*0 B>\ A XP00L X 0 Ġ? 0 0P R SAS^01"0!0\WP(00P0S 0 Q*00G S 0S 0 p  0AUn0S"  ! [*@X0 `v(  ABQ AA\ Q`E  ` r  0B>S500A S00P0 S 00ď(00,Ѝ R `0S P\0[ $?0 ,4B0`ꠏ0000ZDPᖏ00{$H p@- M P0 `00jp @ !p < 40 0 1 30ލp@: A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ:H Q:/R/0S/S:00/@-\@3#* 0^ @R R R (000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R00Cێ(00/C/A-@P`TP% UVT P @TP 0?Sp 00詎(00QSp@-`P@ 啙PP@`V  0R p/pA-PAUQ?UU@A`pP W ځ1APf(00a00]?00Q @-A?SSRB 0@S AB00=(00/-- M  ЍЍ/@-M@ p TЍR/0S0 \ S 0S0000/O-@P M ` ᅈP-Yh +Ya Q0Yj T@ @Q u9pkU`Ppgj9p`U`P" [)SQ" K0Iq P0aIQW0IAIQ70IS| V[SQ;+ꢍꝍ0S \0J0 0 ЍQ `Q0YXP  A@0L ^P @T@@0@-BR"^H M <000 Ѝ0@]@P]00TP Ѝ0x p@-BR"^p@J@PJ0T0PpA-@p`P rMX0^pAtA0O0p`0 TA΀\`L PPo$08 @(0 0 1 30rߍg8̘ , 0   M Ѝ  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/x QPO-M@ \ 0S000!pR !01 ?|PP E`#3`7P*Q30A 0#1#2#4#8 P 0    U 0C  pSYIP0 0@pQ 0S  Ѝ而T 0 @00Ѝw 0 0A-@`Pp}0 0@}$0$ 0 M ЍXD Tp@-0 000St@@@pdPddP@P@P m0000 0 tp? p@-P@  p@A-@`P7ppp0php :T  0<0 y.  A&( D|T@-@P0S 3/000S@@ A-pP@`  F lp000@P p@-@PPpp@z@-@!1BMM 0`PF040@@@ @@%7xqPpU h10S \!p0@  P8A0@ P< 1 0w!0 0 4 300BލЍ嚋P @P  4/P Q Q 0 0[wp0 00P |0 0 w @W6댒 P `,đ Ԙ\> O-qQpMP Ap@f a@0` RD 00]\1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W 0@@00#AGQx00p@@9ЍP3Ѝ<0 0v= | <{<<< < 0@-0@P$M P P0L0 0 P $Ѝ0 G-RPL 81040SA a q@`p #)/0@S-00儑 000S 0 000 00 x0 00 \0 00 @ G(00(v@,xA-耟p0S@P$0S!0`PP @0S PU @@P 0U00 n4@ 0@ P XO-dM∀`XSRßQ ! 3000SYC@0S00 h0X#00T3 0  0 00P ZP3s003@0p0VQ QN  QI cP0S_ 3/0 0P U@p@|RPy00SJ`" 00C0T@dЍ8B,@@@$20\r 0,0SO  R10$   @$(00 L00LuP 0S 0 <00@00<00eP 0 S@$0<S(  ( @0P 1S@iPQ 00C0@@00$   @$(0~P< @w$0S(  ( @0m$  $(0f< t88 8847 6 @6 5 X5 ,5 5 C-@@Ÿ 8MpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W?!1 0 0 30[ЍU00ì?dPER ?\00S T=*0!0 V5 @0S00L0  0T*0 V @0S00U0Pep 0PT*0@0S00 V@@W <0Pe 0P38 Q (O-ϟ M|ϟp `0S㨐嬀m  Yt 00 0S` %SP %0BUSZ:(!@jJ.'1 {x\E>`-= 0 |0 30Ѝ dOd @040 $ (P,9h-h##d-cR:\-c2SP=  PP 0 0C@aa0C0C Cr  \\=N>?#c!!"N ,  "bQ0-5:bQ , !(-#c!!2N 0  h\0 S 0!Y&0`0S00 S `0  p`0 S00C`  B2;Q/0A!b0dP  pY0`0S00 S 0  B2D;Q/0A!b0dP  PY0`0S00 Y0 p`0Q0: 00dP ,Y0`0S00 YX0 p` 0Q0 : 00dP Y0`0S00 Sa /1 b !Q 9Q00dP  Yj0`0S00c YB0Q0<9 00dP YR0`0S00K Y*0 p`8`p0 w`-8 Q0 0dP  Y0`0S00 Y Q!/ b !Q  '0 dP0  xY0`0S00 Y Q '0 dP0  _Y0`0S00 S Q 8'(0 dP0  EY0`0S00 SU+P#U'P Q &0 dP0  $Y0`0S00 S 0Q0X6 00dP  Y0`0S00 Sj0 <008@0 0D00dPH00L0080 0X0% Ym0 `0S00e YD 0E0 S0ڜ0YU I` R  L S`HYE0$ `0S00< S00%1?2c 1 R11Aãd0Sâd0CS0c0h4dP 0Y0`0S00 Y 08  8  p80 S0R`050dP03 0dY0`0S00 Yx0 p`0dPS0083 0@Y0`0S00 YY0" `0S00 Y0 p` 0S 8 @ *qp  [qp @Q 0! S! -Rm Sk! 1Q0!Z0S,)@Ϡl  ^Z R SH+ȟY`` ؈ظ v@@PPȟ%ȟ娨 ,H)q Z.xx pȟ5:llX@ $ ^, TΌ3# `_ 0RS@xWCYPP  @E`E`ǟ'ǟG ,D|h(ao[.hgt 11 :Pg,@Dg$ ^, 4Ό3# ` S 0@WP f崆`D0"ʠƌ唖 !@ Ό@|L @R.H pp'q@N @ ᄲ᤭ @ @ , @R Х ) ,  Όܕ Z 3#pP Q 0C   SUD05H 00cP0SL \8;Q00i`@Qq d(8NPn (0, UTA WVH V07(0P@`,0Pp? 00?0S  S   (, 0  9/P(0, SRS@PV0By00u TrT00ЍWV `Vpb .ER 80Ŏ;0R000;0800S< 8 0S Q{@#Q!Sz RW0ST 0S ``VJFm F|$ 1 S `hp  Z:1 S@PTJ#M @A(0, 0/0S/0 0 6/P  P0 Sj u@Dk 0PE S 0N WxßSD >BW@122e3cdPL@. c 0'x4#(: 600+$0+>! 0#Â!!!0C0(AX Oÿ2+" ?00 #2>[?W'`FPG`D2#2:#0H"H @r,W"!0 / 15: "  0"#2>"Q0 3 #101`0U15? B4sppp0/S[0 p c 0w!(: 600+$0+>! 0(ad! o`!!!0C0Xÿ81+" ?00 #2>`T[i@t c 0w $: 600*$0*.0$1110B@T0 I:#$B0Nn :E.€Q_uk9"mnSc$IųQ\(\ףp= ףhQ(\)\˜s c 0Lw8 (: 600+$0+.X0(a1110BXt0 o☉;#(0```0 0 cQ @R0!T BqgqgYpC(1 ? c 00w0,!(: 600)$0!)>X! 0Â!!!0C0x!Xß)" ?00 #2>r/E B 2?A1c1c0R0B 0 2P!502c4"2c2A" "b1C S/  `008P2P":#"0 όB! TY: 0"#2>"Q0030#0000U  PE0 S0  P P$ 0Ѝ@t)1?c 0 0~v0t#):60 0($0#(>!!!0C#0Y("1 #2>t<0P0@<`pa0@<0P0@{T 0 @-M0@P T 00t0(0Ѝ 00p0(O-`@PM 0S6  V 01? [Pv01#^ 0 01>! 02P"> 0R \ 00!1 R jz00Ѝ0 S, 01P0% V 0"> VPu Ÿ0 1#̀P0PQ V0" RR!Y0h&P l6m&N Q Q@Q@QDQQ@^)OAN h(0$ n$ (0N h  P$j0p 4 h`@(P,0(0^S0 ) P4P"<$1PP TZW [[$p W  @`  0^ ^4$0^$!? K[ (P,004`$ V F̋ nP R S  0A0B 0(1 0S(p=0o R !0S P r 1PpN h Jn0 P@PA-RL pBU, "P/ ppcW   $ "(L S@ J 0PhhNO-0@<SP|MJ0@S|Ѝ0S >S`@0FSH{pP [ 0S10ƒ!0 hh "0mY OX10\1001Y <Y30 S0S >S@p1S*S0S -S0 C R`@0F0H0N<)`h0hlpt m|Ѝ*YY -Y00I S@0IS0  S ,S;SQHAL f ;S,Se SlH^(- Q 019mPhj`@019mo\@ `Ko`h6Pc^`@L 9 bp&kg.htlw@ 0 0N\hP:m00 @3m @ P 1 00@1 00|P00P 0,Sd0(0P 0S  H LɅ bh& `p&g.tl6w6`,p0 `p̴̄$$cR0#03 1`002c2c# b?0cYZ  [  R `pK 444$ cR*($L4P 0 S /G,p`0` 380b 04cP0#031`002c2c3`?0cPpcs V P  P083$;#cP*(3$3401cb008[0 00",` 4p<@ @`pD 08@Z"28#!BcRd:t"cR0#03D 1`002c2c3YTX @R  *PŸ Zcc, Q  \Gce Q!Q*R/ ! !c 0p?0  c@R`(0X$ $ ( 1 0 Y Y Z,`04p8<@@ f>0gΌ t 0HSl0Ű1`,p0 DD ף)\(\{3PA-PQ@D 0S! pN,00 01h6l6h`v`P 0:S fP `VpFPW N ho0PPT`V_pHPNLg@P`/bPpVE`P ꐾ=A-A`P@pP oPPPWqPqpATW  P>UH QP |1|!0 t0000`0V m``@ v P =D0C0CS\@0d/@D  y@D0P0T0S00#  1PWPࣶ N0I0Uh,hP@P0P P0p0 000̃p Ȃ7d<pS (0@-@ 0 0!R !  @-\F0@L @0 0 1 30ލoT 0 0,$ h# -(0( 00M 00Ѝ#  --8M$ 00  0 0 0ЍЍ/" 0--M0 ЍЍ/p@-0 0@PX``00CS`0p S u P `X0 X PX`pX1`uH" \0\ 0 `00CS`0ppSr P X0X /X! --00 M (0 X ЍЍ/4! --4 M0( 0 XЍ Ѝ/ G-@0Sp`:Q !SJ Yp}`0"P U U * f0J0`0+P2P f 0 B 0 0c` P0PU` ``P+P Ikp C000 G`nT 0 @00;` Iukp--M  GЍ Ѝ/ -- M0 0W ЍЍ/ @-MP *p`Pp/ {@P,  0P$ Sʤ 0`@ 0$  0, 0 (0 0Ѝ 0bЍn0000@Ѝ  4p@-P_@$C@_pp@-P`@i R T0U:T0T:p@QeRR@-00p@-!@R ! 0P0 0S 0BuPQ`0AP R 0 U00Sp]P0r]P `l]P0  n 00A- R` P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ 110L00^ 0A pW \00W00S PA0 SP0Ã@80p@,1! L0  A 0AC-p@0T@1WP` M m fm0S* D!Dm00@ Ѝ00m kfm0S 0   im0@fdm@O-P4M@p ` m0  00ShSf  %R0 0BZSZXWUTSQPM'J?>=<;:97310/.,,+)('%#" vrqp! $9 roR V@7VK 0V & 0 aQ S  T 4ЍPP؀PP؀010 00C0B Q$ROL:P00 x3 0S 0V`1!'  x 0SM 0V`1!  x 0S6 0V`1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p V`1 0! xO 0S  0V`1!xX 0S 0V`1!0 *RS 0B Q@ 00B S@@@ x: 0S 0V`1! x  0S 0V`1!    x 0S pD 0V`1!dx$ 0S 0V`1!W V  x 0S] 0V`1!F +  x 0S p (  xz 0S px) 0S 0V`1!x+ 0S 0V`1! x 0S 0V`1!xn 0S px 0S p  0V`1! py xp qp jp& cp \p Up"s R 0Hp0y  V@ `1 | x 0S 0V`1! | xm 0S "pT  0V`1!t ; x 0S4 0V`1!e ; xX 0S p/ T- * p# p$ p7 p#l x 0S 0V`1!'P x 0S p[ x 0S 0V`1!  xi 0S p 0V`1!$R 0@C p7 x 0S p  0V`1!x 0S 0V`1!x 0S bpx! 0S Vp@ x 0S Hpz  0V`1!  x  0S 3pe  0V`1! PZ X PU S PP N pG PD B P? = P: 8 0B Q@ 0 B  0B Q$Rh x R 0p0 V`1@b P  p  P  p pO p P f P a P \ P W P R P M P H P C P > P 90s 0 S ~p  0V`1@! P $Ry@00 P  P  P  P  P  P ~ P{ y Pv t Pq o Pl j Pg e Pb ` P] [x 0S pP  0V`1!p PE C P@ > P; 9 P6 4 P1 /O-ϟ MMƍL0@00\ !TR !0T00 ` 0S   R  0, \H /찍  @(嘰d 000D0h0X00PU @%U 0T  ` J 0 R 00S0(U` P0`~-$P0 0FZSt10BoSU fiMMI~"0XiPpWP    RZ00sV P>+h1RR8hOth.>TQC{gˠ}P`G0T,\ dDT|8H@L@P@VP@@0@ 0@00'@00F p`A@00F S$V $@GPU" 0T$0S6 D0S D0p0@0S0000WW v+: 0 6 30 ܍ЍU0P00 P:, 0_   S 0S0q-0~00S , ` 0 00 @TS@@R00STP}?p@~ 00PP4Pa00~ @P 4 < 8 -1$S0PP00S@0 00`@VR    R ~ Q(-!R 0 ,!   R K/ Q(S @DT 0L0000p0S0aQn TP@@: 0 $0(PCUW@0Q0(圠D0800S@@0S , 1 0,080S00 0; 7 pR10P1 D0P0CH0 0PD0@ D0S-0~00s<0  `` P,0p` PW,0L01 000 L000,`S P0 @T0P TpP pGWp P~ `[`B,0@V *} Q g 1 ,k,0`@? PPVL ,001s0pL 1,@n`PT@(0000"0 SRX 0S `\` p00F S @@ A@00B S$R0 S,L0 1,  $0, $ L0$0S0c$0P` PP~0`S 0~0~+0`~0z, 0  S 1,  / Gp  'Tx~}X}} || l   T d < ,RL0,0x0L|@@-1jJ0S0 ~0T/ `0`Z-0 0,0p`D0S nWL0,0PQL0U 0S0S@!H徏  V[N/,`04@0T` P @0  0 0@s,`@ PD ?  P.[T0 pF 0D ,`00 8@B,0@p/ *~ Q?  P1 000S-a,pl|`;`0`0X080SZ0S0$00< `CV`V ڜ  RA Q(<@V@DT0 <X\0   _  ` Rn` Q5(0 0CS``Vڜ00S`0Q[(@V@DT0T Pt堀pp` p(`@DT \Qa @DT400P @0 0 $0PCUU (ep`@ (p`@PEU 000Sp0Q2 PEU 50P P0xQ SQ0P00@00o$0`CVEV 6堀00 F P(@`FV   R Q`FVF60\0`0Q(  QP WT ڠ` lPdP(`@DT \Q @DTlP70P0@0 QV(PP P0P00 0 S00@npq`pPp`qH P B @ Q (0H@LTPhR . Q P0P00 V8 F tpPp(@`FV000S0Q`FV 0Ftp) ^` ~ CPP ;P P  2PP l0)P Pl0  tl0P Pl0  i R@ 0 uQp0h0>0(0 0 o @?P 0 ZQ^h>0(00000S0;000Q{( 0 00 `000000S0Q(@T000$0\ O0P00H0@C(00 S Rpp@D@@pD00NS `V~ <0000@P@p 0P@4@<@ Q(~ OyO0P00  `0\40 0<00I R nRd d0  ! ,  c @00!000 0` @0SQ0000@0B00T*ژ` ~堀pp`(p 0@DT\Q 0O0P00 iN@* Q ,0 ,pNu@ q Q ,0Pq 0P0Y@ Q ,0 ,p14 P`VRh/h pP  0 lP80 P 0(pXP4VPӨV4`F@400CP QU 8LYY ڜ P = Y@ @@TTڠP:00XS Q0p O)AoR^" 0[0 k12000 QS0T0l1 c, 0# Q:|00Q )Q  0d O-M<0 XHX8@`p00S 0 0Pu0@0P0  DB0SG^P0D= PPb P0 Q DS ZH P 0S S SD `Pb@00@0 00Vp@ ! JT 0 PeS5q0 0@00S Z 0 P\Pc R  BPPb SP0E0CSڣ0SPX 0Sa E0 0UX 0p 0 Q U P  U UE^ PLU 0CC10BfP0DSy`0 S0 S C U 0S S S IP@"00ЍRq  BPP+\~ -\  L^ ?L NZ @\ #L@NT @Pl '@Ѝ \ 0P@0Q 0S00 LS S80S #000 0 b@0{I"00@C |`P `D21 2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf w0 S_ )I@"00Ѝ@P0M@E PL `K"V`pKW  ` 21p 7 ` PEF@QP!80Sj80S 000i U U EP 80S800c8080S `T0)  RP!@L#80ST80S P 0 0  B P\ \vj 0`e  BR "@` P3 `2 c 1P5 p  /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPU 0 BP @` pV  0 BPp0U`980@-- M@ Pc@_ 0 B00C2S*ސ*KU Q6cZ AKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ G0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/tT0A-@T0000Pb1 !0^2, l!p(  ^2,0D10C#10RA! @^ ^@DA0DC1T0R @@-P@M: Q @ 0 R Q ~@ЍA-$a$1`pP0MS3 U10AT !0S 000 @T 0 0S0 00Ѝ@0!0D1S<000S 000T tH. 0p@-@P0p R pPQ`00App@D `n80 0QApp@b txH@0  0#10/sP30s R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P;pP   ! =`~P03#01S412s2sS/1J //@-@P0@0O-0Z  @ SMpPA PaU* F B  F  ^'* 0H0C X000300 ZP@T   `d` X`Z P` @T@T 06S @ЍG-0@pR$A0 QPiV'10SP`P\ 00001010i0S l1c zPP4 @p PU `@00SaPP# 000S 0904PU 0C  pPph0"iV0S <0 ,0R0i | tqDHG-P0R@T`塢ڃ0TP$ Zp  !p,E0   a!  \2)0L0C\0003R @@HpG \ -0P!1^$23\ *G-0@P@DTpD !1PD*32\ ::P @ P@a0 0S 0S Q 0@A@DpQ$A3 ! V @00S 3 #V0`F`F` 02NS @0@PpP 0!Q@3A! p@-@ AP`DD 0` P0R @ *\ l10D R56 501 P56 +Cp0R `5<#511<?@--` M@P=@P : #z:S 0W0 0 C.G B 50c0 Ѝ 0P c2# R   W C>C0C012`0S0/0 R /@-010aP`@M4lPP2 pP,0S  Q,  p 0: S%QP 0uPP0@ |0$  t0,  l0( 0 0ЍD00Ѝ\PD00DO008u 4p@-@\500CS00 PZ5pP  BR  /p@-0rSL wS aSOP C 0 pLP0S! e C+Sr ^R)# P0SPPp0KS0LS0DS0ES@P0p@-S4 @4 P00P! !& 0S 3/PP೼000P @ P o00 `i00aa4@0`` 0p[2PTC 0P000@-!@R !P 0C 0 0 S /d2p@-Q1P0@0S4 0 NL 5000S: 0#$0 3/0P:s00-p00P @ P 00< R 800pO0PF2P00s02  0@000 pB 0 @00p t-Ѝ/p@-@P@TS S S B 0 pH0p@,0p@ha0p@6@00 00 0000/<P 0p/@-B/41S O- @\c\EM  Q 5/p17/9? !0 p;o7( `l (|:/  p ;o$7@(p:/,$`;o0(, 7:/4p80`;o<48 7:/<`@D L;HLP̀FJK GpE` tDI( | HpŐp$` ǰĐpP`Xư`0`pA/`fpf APpM_ĀmZPQ 0pfPUQ 0pfPJQ 0pfP@ Q 0pfP6Q 0pfP,Q 0p|fP"Q 0prfPPQ 0pgfP YEߍ/AOA,waQ@-P @41S a P  P0AA-4!@N pPP/1S 0L1y @P!rPPPUQPMoPP aQp XW RAp_oRMApJApp@-@P 0@?@A-@`P] VapPPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V @0@B@@SSC-`p@ M. Sq$QU$( P 0PM VV0( Rz⁐Q 0(Q^ 0yP  Ѝ0Co$!? R (avP^Y P  PRv0SYR @ pEp( !$ P$$(  Y 0( ^ \ :0  1PL@00,1  Q$.(y( (R"  Q (剐0$ 1 ($!p`0 `kP  QlP$Q|O-,M0 0 S ! rp2/0, (Q0 Pu @`P@P\%$P 0  CZB 0@PUpWW 0 `PM 0@SP㲀1UJ[K ,Ѝ 0 iPPu/  $`:jPB 0 $ `P# 0@SP㲀@1  P\ \4 \  ᰠZ"[ L`PP  *cP 0 eP@00,Ѝ$`p  0pjP   cP(q@GT 1S(Q0 @-@ ! \ @,P 0 p <* 0ɟ0 00 84  D>@ ~>vPXP UV P0 S40R !Q!3^ pdȟ ^ ^@4E; P34p D H 0$p cP7ɠ3 LJ<,0(  pQ>PVNP  P  0{p pt 0} Vo 0Sl A/ 1 *4+ )4p+́* (4) (<' 0<' .4 .<0 4< <0 4< 0#<  <$ 0 4< $( 4< (, 4< 00,#<0 <400 44< <840 4< 8<0#<< < <08 8 8Ġ  4   4| pp $ <  x0$0 (p , ( 4$,0p ,(048 < 4x0080 < |@ <4, 8p | < , <00@)Ġ| )  p' pJ0  | S!tpH (( x 岠*LL,| , S[,CC r A[W 3pWSA^O  8/@ PG( PC 1DpN8ɠ0  !NV QU0 aPP$4Q$Px 2R Ÿr@ B 0! ` `]ߍOPg<P| 0<p 0 pp<P<Qj<pW/ <*  8004 Dr<@ n<<IpX ڬ<<@P<P<PX0a|<<_ Xa4bt 0 <Ͽ0 Tp 013? 00<Ͽ013?0/ 2/QP  0@0\@-s0& \X @@p1'4<'\&4<&L480<04 8p0 <. 04. 80,< 0S 0Cs@0@ > 0 <Ͽ0 ST!CC  013? 00<Ͽ013?0/S 0Cs0PP0>@<   0<Ͽ  <Ͽ  0 <Ͽ0?00QU#A0A x0@-@PMQ s&00U0 2*(   %P&  1 0 2001 0  0 H&b&P 20 2Ѝ0800b1p@-@PQ /&00p .&p P P P AP`ppR+8@-@-@ / ?!BC5 @P/P/0 00P /Q0*   BR1$%&'()   " "        "P0/  O-RPMe @T Rp ?o2` qAWsp 0R0 \\S 0  0C1"00Q!  pW ` `  0 1 01 p S pr pm Vj0S0`S 0b\P @0 0C1"0!0a`oobR@H 0 =0A0@Ѝ\@P WPB WpGq0X  0 @0 A@`0t[PЍ001 A0@0@c[P0 01S Z 0I`[P0TeDA 1Q=00/C-A MT' }TP# `P  6# 0 AT R0 X 0V@T Ѝ0[P 0 00 0 1 01 0/p@-PEp U@ Ჽp p60@J6@@@-!1 0CMM0,40@PsP: T10P!,` @ PB*F{0p C{{p@ Xp#   p U np ٻ 0 0 ,4 30CލЍt(0P60 P忻{6P@w6?00 ? @H \GO-@ş` LMQDpP #00 2KU  N600$%5 0 D0 30>LЍ w0Q1S4 ;#P䁄-  00 0!0A0{Q:1S Q[0 0Pʰἰo 0S !# 0P0 崰0U P 1  AP: C r[ *00C @ y1 Aq010 0f0a(0  0R 1SP  C# U| 20 2^(W U w0S/*S: pG 0000 8000S0,p4040,0 p2 0(00 @000S0$`<0<0$0U4 s"P 0㸱0 R510C0s00C S010{/ⰰ1 2 ] 0 KpV "0 " PPE " 0 { R[q ! {0!j0B0s00CQ0 0P {1 S0"1!N500^t= < G-@( P`M A ഑ 0` pU0p pp I1w 01v0CSxp ^01QA0cs0S 0Cs00Pq SA(0 . Ѝp0Q1S  ( @a% 0  P-  p p p 0 0R1S0C1ŁW- V10C0s0S3Q]Q?X@a (00(0pv0I 1@ P(00(0> 10C0s00CVU:Vp0 @a~P 0 @1PD Q 10C0s00C 4!P p qP1(00  (0!0!0!0 !Pu 10C00C 1P(00  ! ⴑ@P(00(0 |!zp@-@PQQp P 0 0f!Q P 0 0Y!ppG-Pp,aV0F`  1 @P `Vᆐഡ 010C0s0S0SS PP   p !!   J&1x01FVx 0 R 0 1^1 C`fv`V 0Fs00 \ r S10C1  R jP  0! 0P O-Pp@QM 00 28T T *300@Ѝ(@ @W @Ѝ  `P RA 2@D@ t@_Z* P  0P  Aᴠ@D@t@0JZ0  PP 0p 0BRs00010C0s0S P@0 `P 10C0s0S4 1 1@0C0s0SP ; TPx@ 20 2ЍP & 10C0s0S   T     PQ  0S,p_ S\ 0S0{ 뼁W`q 뼁`WY 0H 1`P, 1 X0C0s00CR  1r@ 0 @C11 0@1 @崀01 <P@ `Fv 0   +P 0  L q  `PNBPb T \TW 0f100    P , 0R Y lqW`9 eq0W `0G 1P WR  B1r@ V @0`F1@1 0p @ P`F~ A1@D@@Dt@ vp@!  ) Pg0-M 0P ЍQRO-`Ÿ JM Mčpt" R  PRLI@IU/ )P ^100 "2 0 4 30|Jލ Ѝ >20X0 0TXS 00; Ii0$ U"* 0S @0C/[00ַP0: S 100 R I R1?00A@V# 4- cp!10S X  \0 RK [ P000W ᚷp ♷P 0@oy0) G<) R Q0P:Q0Q:'@- @-@@0 $ @7  p@-@P#L-`P$ # p@P 0@-@T M 000 @P 0S  Ѝd 0O-TM Pp`0H0 @8  8$(4PD 0,0`< @@pLp PP 䢟䒟䂟`p  @$ "dXb`%0# `!,l(a `& `zcna'b(*abf ` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah `猈b,) &`dL(bdl+`|.`lXpp<%cjgpl&`` `ga*aldH(d` &b() `b`j+g .pl\c:%pWpl̠ @s@ T0@P00W@@YZ- 0 0 T0 30&\Ѝ @ 0 0Q%WY P  B%@  Y  t 0O-44MpD`$ $0(0D0H0,000L0P0T0X0\0`0!0   S P C[@# ㌱CP ^荐 ] Y U 2 @PF T$Z3 Z0  D 04F  P  P 00e @@⽾P0 f0`00d X (0 0 0 30Ѝ tX%   0@- 04M 0P0,00 @T d 0T T H0 0 ,0 304Ѝ0$ $  A-$!$1 0HM Q0D00@P `] @T( 0T½ M p` V 0V   h X0 0 D0 30 HЍ$ $ ꔽxl T   C- 0 04MP`0,00Q*` @ mpW:T p 0T :*T H0 0 ,0 304Ѝ$ eW;(  0@-,M P 0 00$00 @pT ` 0T P D0 0 $0 30,Ѝ0$ 7) 0 0  p@-(M ` 0 0@P0$00@ @T ` 0T P D0 0 $0 30(Ѝp$ x p  O-1$MH0C0ᰀs\p! 0L 00@`P BrX  BQw    Xl U @pP uP0    r@ RSZ 0 `Uv`:00s0!01(0  0R 1S0"s0&1!U 00C01 VH05H 501 10C0P%01 U* ⋰@ p(b X @Bt@Qf\|{zyxRvutsrqp'XPS* UP X !    z     qL    rP @puP@@Wt@0s0 !\0s00s01$Ѝ   r   r`Fv`00s0VO0 ` P0NXC-Mp`@P%  PP 0!0 000 0`r 0@@!! 0 040000 00@PЍЍA-@P` Aq08q0P00P 0p0S   L| P00  000 0S$1  @p  P 0  P 0 0 0rXO-MPp @Pl   0qZ 0!Ჱ0@@p^E  0傻`P 0I 0 00 00!岱0@0 0D000"0!p!ᙼWpP@Ѝ 0Y`P 0 0 00 00 ! 岱0P 0 0p01@0尠P@Ѝ pbA-@AtPQ A @pq  qQ Aq⁀``X  0!0 0E Bq0 @r0 r R  Br `` PPV0P00 0 0 00 0QO-LMxP0tp`S.400 @p$0  (P_ 1"0Cs0 11 "p q 0000p04PS , X` ``* 0H 1P% X 00x0C⾂S񏐰S 04 E p P? ; 7LЍ 1! BR2*0 S00"G X 00 000CSjgfedca`_^]\[71a V0 0% 000XQ @0 0 @8D @<86/ Y``10 00Q!x4 B0001!0C0s001 B 0C s0r 11 0 04S^  0S  2 0pPL  뼁[F P p0\!d3 B00010C0s0S 0Cs00P 10C0 s0 @pS  0Cs00\ 0 004S D P p > :LЍ1" 0Cs0 1V1  U00000 / 000p 0 P 0 0 0b2 @p00  0 R } C rX * A∀H  1010 0 0 pA``00 0000 1 20 p00SG { 0 0i IP0 p00OUG- `P@PL `V7 2 < 0 `'  pW& Q08 R   P7 `10C0s00C 0 P0 0RpW 0 10C0s0R p TW0 R  Hp 0R  P ` 1C-@P`Qp$M $00 WW 07J  (0pGWX{V6TS2P0GSr'00$Ѝ(0xW! ,0p110C0s RB  x1p崀 QP,0p1! B r R  1p  2P弁pP 0 00 P(0r00㸁(0p= `PF 2 ^00$Ѝ0S 0S  0X弁  0pt 0S !0!0 l Pc W: $W7 W"(0&XJWJ p SW  PH H⨀Hx弁@<W  63긁0(0弁x⼁s(01ḁ0C0s0xXW$ p W  P Hx꼁,0WSBq X0G 1 oP꼁,p 1ᴀX0C0xs0X!弁 X0H 1 SP1崀ሀ!0  1 @P pp z0Cs 0 t각 0H⨀Hxl0!1 p崀  Pp@-@`PP 0 00(0`00Q(0pO-@pM,0 01 P@ a`F`v`V/ P`rPV @t@ @ 0Fs0P ` 00!01@0 @O 0U @Et@ 00@ 0 Ѝ "  U ! B r RQj0 0P Q P !@ B  B  - PP   a0S0 < a 0R P0F 1jP @VT !@Dt@@U `E!`@1 0P  KPF A1@D@@Dt@ VP@!  4P `  ἀ@P7   㼁0S0 11 X0C0s00CRK 뼁0@S& 0H 1P] " PXQPQ \ {PD uH`  lC ` @Dt  1 01`01V P " r R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/h @-@P L  0 0@ ($ 0"茂O-@T2M0\0(P 00$` p @ ` pP03?0% 0g#"," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00Ѝ$4A-pP@ $Q`?PU(7 )f#0(0 0`0$0d0H  03?\0h P# 08R(@R )P@ bA#)8 :#)P8 b4# 0A-1?`@Pp @f(X6 @m 0刁0 0$0@pG0($0p. ?W?@`G?`@`(`0@ @T 0 0$ < T 0$ ?pW (8 0$ q0 0$ ?W@`G?`@`` 0$ <@@ T 0$ `R @-/ N@-@P P Ό 0 0@ (" 0"|R @-u/ )p@-@P X00m]\`  0 P" 0$$p\|O-B(6TM0^~?D00p$0 0 00(00400000(00,0000,0400080 0<080H00P0H`L<,A0$ @($` P p`p4<&c0<0$)$7'90#%ɠ%'nj) "ˠČ 0#ˠČ@0 ",0  .Ϡ' )00 *$(0 (0'& ( 0@0 0  0 08$  ( 4 , +  ! 0D Q, 083`0~?00L`AHpD`    $   @0 !1P"0?0#`%o#,.0#.,',YW) " g Y i WP& 1` 71!004 4PU 08  R88P@PX`0(A@ ᨫ0 801248 Q!:0 S p808P呫P8p4P 8 ` 0`P p8y00u08PrpP8ml00`h <`y O-ɟ M@pD,\($ 0 PU 0H"4S2S0\90U 4000Dh00 P.00e d0R 0h@00S d0P00 0CX 0 $?01H000 p0 pS000S0!Q0:X Y 0c/d0O0c/J  00S 0 Yp 0 SRPU 500$ R 00"00'p7 0 2 30ߍH2SL708 R4003 4P0P\ R400P^4`400刀J@ 0  p 0`U:` 66(0_Vࠓࠃ6048 X00Sr  0\ Y``VP `PP$XY0”2  \8Q(( Q &P`00S 0 SRPU 00$0SA00t8Qr 4Zx ` Z``q XPF 0SU 0 RdP ZaY0MX  R,c/w0 0) Y2 0 SRd@T h00$0S ,0S  !$0(0S (0@TP $ U P 0 SR@T @00$0S?00 ZY0 0c/d0,0 p 8Q 0 SRPU 00$0S00c/dp y@  X P2 `0 R(SYPR`WY`P2 08@04倩tRP@{Pw0 S (0( PC_oXRPU``  0S0Sb\40 40 8 \R8 \P0` @ v` 0 SR@T` h00[@ @ h M`Ѧ(0P`2 ` 8@P@,@ bY$0S00B 0X0 0 SRPU b00$0S/@ ` @ Y FD w  u `t p p A-`PpX@M@`@J000,0 0(000j0@;Ѝn @- A0@ @ €1Ep@-P@Q 0P ! "0 2pp@p@-@P` VP p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/@-4!41 0MQ020' 0S0. /!PR*/ "RR /@ 1@Dr0Q R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ x| | /O-0,M "!  P  c 0pQ PT 0@`P㒦&0@ (PP &  ;/P ;/P`W0 0P``V0b   F BR R  L B@ER !R4 0T0TF SV:P^0C 0 0 0p0pSpP0@哠(T **p@Pc`Z* p  Wp ;/P T T  0 X0 W p0p0W:,Ѝ  `;/ 0P 0D  P@V. ;/PW W  00R0 0 R0T 0g:W  000@D`X 0YW   S W0 0 00   R0 0 S*T W  RW 0 P  WF  P  B B@ER !R AH;/P  ;/PM `0  0;/P  ;/P0F $0;/P ;/Pڅ00DP 0;/P d;/P ;/PPWAD S  ;/P`  R0 SP0 C 0R\P 0 G "! R  B B@ER !R A"! Ry 00SV;/PAP ;/P:;/P~ $;/P$`v ;/Pa ;/P Y ;/P0 0P $;/P`X 0 R0aP-0 M0 ЍpR Q0P:Q0Q:ߥ@-BC- 4PS@ M  $3/`t  0 QP` 4P4S  $3/000 Ѝ00A- 4dpV:@T@T 0P0S  00 S  0U@P0`0dp@ B ! A-`M p?@P0: St1PP ˅P@ P 0 tdЍO00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0I@԰  0SL@-  00AS 0O-4MS{@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0    Ѝ P@ $ 0  QP 1$R P0)S00@000dS0  pq0Vp 0  $6/Ѝ y00t00pO000Q 0A00/0@-S@  R   0 Y0STp@-@PT @T 0 `pp@T堗P`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 0 3??oP//@-P0Sp@M:Q !SV@Ѝ0A 0`L P F@IЍT 0 @00O-0S( P% 0S" p@p" a,0T T 1 !3/PS00CS@D0 T,0@p2P ?0T` BB \|  i V`! 0 0C00`@000CS0 0T` @pQQ   D R !,03/`PIʼ0@00 "R( Y `1`! 00PVQgRJ,03/`PY M 00CS@D0 T@0Tp  P@0S*V* #000vP@DS*`A 0`V:20P 00``F0 ``i 0Y0C00 00KP  00C000Z` 0005P s00r 00n0% p@-`PV 0@0@DT`0@T` ,0 3/0Pʼ0@00pD0Spp@//0p@-@P0 0 Pp 0P0, @ს jP}pl tR0 q R/ S/@-0 00@0S 0  R 0   0 0c0   0R0J0 P @P D0 0 $0s0 蠥 @-@`p`pPM pP0:*C/o" R  S L D0( 0R Ѝ ; 0 Ѝ;0ꐤ @- # 3 0lM0d000RP@ C 00  "2 0 d0 30lЍ 0p0S `0Pw `"` ` 0R00 rrMP0 0S!$`@ Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!`00 *{ {){ 00{x 0SP p 0d `` ` 00 `DlPꝺأ ,p@-@0MPᣟ00Ta奠V( ⶠ0T1S O0T1S娠0`吠 00UTX!\!R Ѝp@~\!㕠00Ѝp@u00UX\! X\!0 000S/ꨟ tp@-0 00PUp@0S00TQUU0` TQUP GpX1P0X1D0T0`X1x th0h 000S/@-@0,0X10CSX1 @#T1O‟0@؞ t0 000S/g` t0 000S/p@-P@0U0 \AQ\ X10CSX1 p@` 0T1OL0p@8 t-X X0 04M 0,008 00 0 ,0 304Ѝ䳹댝 d  $t,@O-MHP@0@Q0@0BU PR"S0`8 R>  "   T0"] \haa0 00000 0#0 0#0000``0000T ^pp@fR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@7Q `T ` R\ ! iR00 B-ptx` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*Ap@-T!T1 @0(MT0$00: 0PS` RT= 0ST@ 0 0 $0 303(Ѝp (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@t댅 ( t O-p`M@P-TP0 +To S0T W  p S  0j  0 ?0 0  0   P @p P ; Q P  S  R2 !" P 00Bs ^a0BSW0BA0BS-70BS*| Y[  Q P  S  R!" S@` "00"00 0S \0F0 0 ЍS@ `?0u0T0j XR A B0A PR W  p] ppY @p` RWLppL0@-BR"^L M @000 Ѝ0@ @P000TP Ѝ0Ā p@-BR"^p@ @P0T0PpA-@P`UT0p  R*(P @p@@pR T@p@@-0M @ Q:  P < 00 0 0 30Ѝ3p 8 80 S( 0 / ~ 0 S 0,/ 00<0 S, 0 /00<~ H0 S 0,/ 00<0 S, 0  /00(|} 0 S 0, / 000kx<0 S, 0 /00<Y$} 00 S 0,/ 00DH <0 S, 0 /00P6|  0 S 0,/ 00X%` <0 S, 0 /00d |  0 S 0,/ 00l <0 S, 0 /00x{  0 S 0,/ 00H <0 S, 0  /00z  0 S 0, / 00 <0 S, 0 /00hz t 0 S 0, / 000 <0 S, 0 @/00y  0 S 0,@/ 00v <0 S, 0 /00dPy \ 0 S 0,/ 00S <0 S, 0  /00Ax  0 S 0, / 000 80 S( 0 /008x H 0 S 0,/ 00 80 S( 0 /00Bw 0 S 0,/ 00 @/ /H-M 0ЍH-M 0ЍA-`@pP@8#pW0PpP@-M/"O R ?#0!PO$ P!Ѝ  0S RP/0?c0 3??oP/ -- M0 0C ЍЍ/0@-0M00 0000@>S@P  !0#00  P0Ѝ\00L0 @-0M00 000@>S@ "0!,03,0  dP0Ѝ800@-@ @ p@- MP 0 0000`@`0@PP  BP< (0 0 0 30 Ѝp[|t Ht s G-QP@ ` S V 2" RpSR Pa 0Cj /o?o BR00 b8VS& ?o/o0CSpp0 c08ϠT \  Q0SpᢏVP00B V0 0T0d0?oc008?o/o Brp!0 S c10pV Veo0`08 @c0q< Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /p 0@-@$P  000r /-$0$0 0M 0崉Ѝ0o  RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 0000@-Q @% ST 0 C0 P @D^TPPU0N QP Q  00S@R S Q0 S 00 /U/ S R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ ^S QNP  S^ PU@Q @0S Q RU // Q#/  //s R RS0  0/U/00 0/ R S  Q  R  /SR  Q 0/0 U0/0 0/0/R  -/@-\0 @@0Q00R S 0Q00S0 0/0 0/0 // Q#/-Q S  BPQ P0C SP PU0-Q S Q P 0S 00P 0@-M | @!00QQ00K M4 ,0 0 0 30Ѝ谫e Te 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/4 40 00S 0M00Ѝ/c t@-@p@-0@ ,p{pP>l0Pp@,//////, //O-̱` Pp U4M y02000"0&0*00 ( 06/4Ѝ0 S@' (!S0S S7 2S@0SQ00P00^) 00@[0 0 T 00 "R 0SPD @RUl00 \00 S00000@plX///O-@@̟ MQ0 < 000 0%SS.S^ 0 ` p 0HZSZXWUTSRQPMJ'~}|{zyx?>=<;:9876Z43210/.-,+9)('&%#"^ VQ yuh(lX 0 00$$P@V \ [: Q ^ [034S0CP Z0Մ0˄ R*d 0@FT@D_ Z 00˄@T*Y`00Ha`00H S_     0/00Sq0- 0`V0`fpB *X 00H S :! 00H S3|/|,@ PU 0s   P 0 BS @0 b B} p x 0p 00sP 0SP00{G P0S0\00NY @V@@d@ [\* Q[FQAV Z0˄Q*P; ] 0 0 000lX pp{ 0$ $Pp@pp o 000 00sn 0SP{00f 0Pp0 ,  q QP{~p  0000 +ipf\ bP5 0 0 < 00M 0K 0pp{S @P 00!""0e00DC @D < 000s Q0@0#`%%%:`XPP*Q@DTQ4 R%P . dX0 ⪠` c *`@0PCC0DC @ 0 p 000  0qm@P.10e0Q\ 0 0@D EP0C @ [  04FQA Z @@˄Q*\ Z>: Z8  0@@ Z˅ -e I { 000 0N0 [0K0\"@2 0 0 30Ѝ0 0 /  , 0 0  @0` @1 00 0  @ 0 0   0` @00r  *0@  q 00 @ ) q0PP @0b B0@  q000 0/00 0//T0 0 nꅧ` $̼V |]A-`T0T 0pP@PU J0PES 8/`uX@pW@T x 0SS S 0R / 0R0@o/ @-4oO-((@ CM Mp4čP`0@  0 @0 44 30+Cލ Ѝ 0p `0pP t 0h pԌL+  ᚍ  0啍/TS S S g0;G-0pS+ S'QU$ X!`@0`S  0P 0#S@0S 0S0S0S%  P V Q@0 R!R  "R0 R R \O-  紀BM⸏xMXčH1 0!p P` X' 0  pfP@P Ugg0 ZPwHPH <0 0 4 30BލЍTP O O-PP AM @ MT0č?2 Y.: px (R`5 P_0#s0S"uPU/ 0 0@T 0+S .0CS7@50P0PPU a0 2|@X0 0`!02 @@XBi S0\01S< 3`0`00S S8P16 `0 }P00 `S|P101@PDyWchP p ` {0PW`0P 0D TP Br R D0DI  |Pʱ0d0P0@@ d06SH[F  N M $cbc_ I ^C\[[ZYLYdXX XWVSRRRQ SlQ8QPQDPPQ4OONdNlN8NLNMTM\M 0b6pSX06H`s DP TP Br R D0D {PO0d0L@J0P t0 0@! hVW0 0R 0`1 g 0 @1l0XP0 &0R  L(UH0!0@! < 0 P 0 1 X@0&0 R  '(h H0S[=00b0H"0l"l 6   & Gr R P T Br R D  R,#{Pʎ 0 c0@ 0|P`P 1011S100 0 x30 X00<0d0d000 3@X@0" w&0 R  '*0 3 X0fr00ml0d0i@g0P ᑉ0l$0@t$t T0d0Q  `0 eG0+S .0CSB@@>0P h0$0@ %  \W 0|p0 D(0d0wP0 @ @r0|5 @X:90%0% -P0 @ #0&0& C/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@{P$Ѝ0 {P͡0ıġ0"c110$Ѝ00@-$MP@zP$Ѝ0 zP͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM {0/1A#b{ Ѝ/MbO-@ßBM M 1Pd$č$p000 S00- 0p } P@QP0l T0h PN0@0A !< S 0 T40 ; P0 0000 ; PP  P00 3` hP10$430KBލ ЍS" ` 0?s0S0Q. Q( Q" `  @  : )Ͽ| 0/?r s0 ___̞4 $@ @X(J2 IIIC-LLP AMM č@`p04" R3  0@`  P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R` @@H ]D D ใ_ld1 IL0 4%hHO-0P䡐 M0S5 @@d@t@`p S S0  P&  P0 PI  P00^ 0  SR 0  SRS ЍPd1 00d1 HЀP0 À  OP  HP060 P0 ऀ 0P  )P090\ 000<i0:0   P  P090090| P010r  P020h  0P0Z^ d@4 ?R? # 嚁 0 2M$ 0P0ZC @ ?R? #  0 (32 P+ @ P010  P010d>x>>LH>h=P==4< =<<<<< ;l T;@; ;@-@HM@vx*v% |Ô0{ D   0  x{ 0,vxHЍ D@-AMT  u0000 00uЍ@@0@- 0 A0tMT0l00  u 0P0#0 @ 80 0 l0 30tЍ0@@>  HA-@PIt 1!01n0SPpuOPp 8tp0Sp@-Q@U x3s|p ᵀ01P 01000ptcuVxtP //D%P //7G-P`@>V%0VQ\@ 0\!R p Âp p "p O-PL+L; 0MM0500;@00Z0XT 0 0}01'0`,4 05@ d!A  d!. 0`11110~P  PJ0@ʏ@z$ p d10 d1r $P$ `@ `0D@SH _\ S\  S S00 Q@0S SP C0SQ0 0CQS00000,9, `P < 0 @00 P+0"HP 1#S;S 0 S# 0(Sz 0(S> 0(S 0(S 8 R 00sS2 S S 0\( H8 R2 S S0S 00 S S SS@@ P `0i_AP@ 0Q"0A'A+S? 7R2 S S00$R00S 0@0 S S00 HPP0S S 50P PPPPP00H00@06w_ 0: 0Ir Pe  PH1H0?:Q@ Q$10 p?  960@`@0O-Y tYXԙxXWWWhWb<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH FP (0$( p 2P ;00 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p \ ЍR @-@`pQP M I00U,0`V( 2S * 2 P13/PPF `P 0 pu 2P 00 Ѝ  Ѝ00PO-1PSM0:00 X1*q`I`[ ap@ p W 0 G P tZ 2< 2ЍЍipP O-MXr=*`00A̱P(pP W [K DCp@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 Pu 0SЍЍC-"1`S M2:rWB R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍoP"! ЍG-pZ RbM'*Q* U@0U @ RD0 z P X U 2< 2Ѝ@EЍЍG-邀഑@ 0`P9  Ip1v`wV0`F1v` 0 \ 01^` |0N 0 L|\ L|0Q0s00\2N0C2pp@- @RP ` PP  pPp@-P`@Q 00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M b00 Vu 2+ RI 13/p)  0$! 2$  00 3 p`0 9/P 0 9/P  b0P 4Ѝp$  0qp 0 {P 2: 24Ѝ?p`(0 0,9/P 0 0  0 -1/ >P0 0 0 0 `0d 0 `0d P0$ ,!᳁ 0,ؠܐPYZ0     00h0 l 0 h0l   000 RS0 0013/s S S=XP\`0N ( (0, PU`00 XP\`= :Z몃yJ%dm&׍8$n&m&Sbn&pn&  8n&GO-M MpẃD _c}44H4 ep 0 Q 0  s0(0G@-P񟗙 $DPdp|00@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S 49PU RnR oR0P<0,`P  [P8 `P,θPPPPv +\YR8S;d5PpPLa4 1S}H @0R. PV`@0S0H0S 0  P P 4R㓥' FM P3mY`, 0 ,0S| 8 RS P0SP(P4PD0S  $V00$C`İPE@D0p/SP/P0 S: p  ƤPPUꪃu&J%HA-`P@M6~ D 4 0z LP  L LP  L LP  L LP  KPl+h3P0`3P P$PD3( 0P+( P3(  P7( P;( P?P ( PP( P P8$@Ѝ(P (PT"(0S (P(0S (P(0S (P(0S (Pq0S JP!0S0S p X垷`PPa D1R`PU 0E /R UP(PU  U00,0/00$700CS.8//@/ P0$0u00S pJ땰0s00"9ꏮ"'xQ%uP"'W}$؁Qv&v&A-@P}eX`p 3_p 00S VQPLP PP '``,P $D 0@S몃H_J% Q%P%O-MP|+Xp`薟F ^p 6@X/ʼ60S ЍfP WP! PP ` pRP dP %vP iP0`0 prPxP ``0`0`$`a [1ES WBu弅PU ;KP$0 S0St=6 ӿ@[*0/S /P0.S0S .S0SZ 4 0 R  @  0P0SP$0pS 0S@ \`P T\FPP&0S <8150C SVp44434434440$S P P7X }00$ @-X 00S $ ?RR00R0SW3 $ X  @0SX  XP ? 0!0 0C0 IP 0S' 50S 5S 0S 0S]JP0 0~ QzX Pt"I0SmP h0S 0Sa 0?S] 0SY^R0S |0?S x0SS W d000: S0S<0S 0: SHP1 0S!  S/o" R P SHI 0SI P -0S )0?S %0S0S ꪃ#'J%SbFG-P@ {DZVp8a ']p 1 R1 `0C@P QpP vP0pHP 4`0S WP /P 0S 0S0`HP0400S aꪃJ%#'Sbp@-PM. 7 $ 0GzHPzH@IUITD GP00cCU嫴P3 xP 30S S! S  3VI \3! d3 00L30S  R ,#6 R #!SR3- 3 2 #920S ( 2 20S g0S'002@T$2P0"@  xB00CS00  . 0 < -0S60016 R0S 10S< 20PR< 0 01 10SO 10SK( p1\1PML10S H10S d1 X1 0S * 160S 0.-@1 H01O8c(I H10S0F0S 00b s0S10S 00#U @`|P@)To*'l$$' %'-' %'$'$'$$0'P$A$'|G-@MP xyT2br@@0 S 7 ǼX "[pC 0 L1 0P|7x !HPd3`x HPL 3H8 HP43T; 0DS 00S8 @0xLA0QD0@0 0Q)@0SZ L qPU+a0@S񟗷?>>>@??@|cFP \@@LS> ?P =P J@P 0@0 00 @LRLR0@0 00 0 PLG>|@?CD0S hx GPT2O몃J%J%t&z&&Bt @&ht@&t@&xX%&h,Sb&#gt&@-xE{OO-M pxtS_l@0o0C?o`DT20<$<4@@@ OXp$4 4 00S ST [@ Y`> Z``: rRPGPP! BH@ PC|B|B|BB|B|B|B$C|BC`hP dP fPvP$@``j1 00T 00; R4 : P @BA0S #S!Bd2 00 0 6`PXL 0pL#>. + P (屣p 婣p B Fp 0S<0 0@0050C SRDEEEEEEEEEEED[ ,@P0S? 0ː$ pS +p0 R qX  Pp P    3/P00 S [1$ pS tpZh000S &VN몃2'a'$J%j'h,[2'FSbZO-M MPÅJp^n姅5 00 5΅5005僅<:p0 00nP B ipP pVzPkBQ 9A@6P񟗹HHHXHH@JH@J@JH@J@JLI$ "0Y!`BFV!  !P Q !「;0P0~TH*= 0@Sx LpLdMFxX8 F P P% ;PP%OM`V08f8 p0PZS  Q yD YL 0`||GQh,J%G  I~DGDG{DHH|D("H/H>HMHYH}DjHxHHHHSbx|HxQ%yaratcid0O-O-222422223220PaMⴟ 0$00.Upa>4 Q2xoPE 0000U1dR0 U% PPL0DNp LjJpP  PPL07Nppd2SP_APX0: S0d2232d2oPPS|}0 t=Pp0SP HL dzPGRP 3P@/PA1@P> [([0[S@'P6[[[[[[[[[[[[[[[h]4^[[[[[_[[[[[[[[_$\[\\_[[_P ][[[8[[[[[A@P1R00I0000k ,2p,00SP ,p</0d2,042)02&02#02 02@`[`k @JTaߍ02 20202;/`ᷧpP 0S Qp< 00  R Qp. 00/ ᚧ`P   R Qp 0$0/ ሧP000S Qp 0 0 R Qp0$0㱊0)2i000 0B BiP 000S 3 S;3ŝ|)00Ti 0l RP 000SX"\2R4RX2h/p5P P@PX0 : Sx9 q `P [K/P D)0 P\d>`Ph+ @p Xq:w\108  W($* }>W *>G!14'Spp>r03 8  T703D77 P 0@ hQ ST2S S 2S 2S$ 0s Z 9>p d2SL ?pV X!\1 =\1X! 0 \P02T7,2P7Ve_'OSb[VrVHf'UVVVW!W[WeW _'Wc'rdAWedAW\'e'^'BT X>WW8_'t$:YfY1 SR Q  RQ!R!RS !14!8!04P)`CQښ. .a0C 2 0PH'h,iJ%edAi\SbixQ%`'iX'0U$hP' +AKiijh'zd@'0jNjtjjO-`@ṕ̑Q >Np%W㬑 0S 0S p10`VA ㄯP `0S Hy@`V-Z ЍyPmPPP fP [n0@ St`tts`t`t`t`t`t`ttt 0 0000000000p(iW 0[jP %\P\P 9Xlh,'lJ%mO-4$M` Z:P! 9P80pD刔刴00PPPl$Mp3W00S 0S 0S 4 Pp(4 a X' 0S00P 0S ܮٮPY30S ЍzPOPBP4 FPo P@*P0yvvvvLyvvyvvvvvvvvww(xxvxvvvvvvxyv y@ 0P414!43 HR #0 pe!3 P 0 300 0S0 pM긷$'$`$P'H$ظ$J%9x$ $h,$"$3@k\p*B7>iQiui m@-P `@'4p@-D@DP@( p@ꨦ'$p@-D@DP@( p@Ħ'h$$A-|@|p `(Pr,ou0`r8P@j@@4d,ewlA{ܦ'$0%%G-`M4P xP 5P0 p) P5T5@P Dn5@2@P0"0 0200@G 5 H⢧p HQ  T5P v @  p1a 0\0 @ pS0 @M tI080<0@0D00P0 0 080$@P  83 HL@P@T@X@\@HP匫 H㈫333 0400,0@@,0( 00PApMPPUPh0PP 0/`Ѝ_ 8=|$;;::$'O-p0P`M(006唖Fp0 @Hpt6Z0PE `V0S9PvPP`@@0V|P 0SЍuPfPFP RPg Eg@P긌44448444444XF0P0 ~0#S 4P00 $T $00S $ $H $00S fpP ~0#S (ZP $- $0(0Sy  $! $0(0Sl00i0P P>q >q > =` @fE[w aM3K30C @RI0cS pS< bSBJJPEU ]P0 0U8U U,P 88 0,3/8 RP cW e@3Zg 2P)0 0C?oR20S^ qXUJ "~00 0$P,0$00S XU 0H '0S 0P0 00010S1 0S 0"P0 0  Q00s  1000,0 028z3P7Z @0 $  a3I2&SR @0 #  S3 02  @0 R T Y2Pq(00s  L2ppO0 @0 +3Z A}h,J%,'Sb=PgxX%O-P@`p'M M $PP ~Fp*6춟p0@DT00SfT T!qJq@P Xk͕P㈦e1p`R00S*  XAP? a@PP񟗦lГܓ 8@T5pP50S $PX }눥PX%000P00 0C 0Tp P  P P*PP%  oP p P 3P( |}p qpPpq/|00 000#0 00$00 0yP @(uPPd| (P(UY@X N2 PP(!|P( (w@P `Hᚨ0P 0(`p` qXpP 00 00$0 00"@Pw@P w@Pw@P w@P hjP TeP H`P!Pf@ XP Z P( (p` P( +i /%Pm``V 0V@ r0 0=0p` P!P1PG00S4ؠ00 000$00 0 ( 1p.0,00Pa0SJ+S'- 29S!S@ 1Z)Y x\v`P'ݍ ЍJ%8'Sjh,a +AKiSb H'zd@'edAOp@-P@~b p@-P@vbp@-P@nbK@-p@-P@dbp@-P@\bp@Np@-P@Sbp@0O-nMM000p4PVP 0n0 P vPG  >Rn`> 0 KDp@7|>?q0SL>D$RX$r R  $t  n⽩t00<4A @0<4x00<$ 0 0p N <4 L!H :8pPEB@D4TGHLXȝ$t<0h؟hؠH4ܡ`00<@P t< $yߦPt j  @< l 0<$$r $dT4S`ZP T3 2"`Fx2S H$L4\*  x``0 L4H$Ϡ2#!0bpH2 C  w0, &pĮp  ;0P 0P* ㄦdL$H?)"f4 S 0_7?V 8`04$$ST RQ  V  0+p0 `VR00R104Qf ;R040 Q$ Qq*4mX'w"vFJ%'h,MK1xQ%{*m*&L2xX%+x$06|jXn'|:MF`'cuie'6Y6(kLh$ x|wHL4 Q} QQ040S[R0[ 4S$mP 44崐S04144 0S @4S 0 x0@4,4S $4R#1ѣ1,40 0 0Uu W+t S+0S tp@) P+ 0d!t6>0]}Q P=.X R04ʃ1$4Q :$4#+ +T4S 8 ,d0<"t5+++ +`+\4$H1H4L1x0<$0@ 0+ptâP Z > ⰢPⷢP  4Wp   T4 v 9.0< H'O-0pIM M∹i4, q?pP_`9`4pGs04WZ h  Ya' 4S<44S $$4R0(}*p  h+p  4 SP,0S x0$= $tZ0 0o 0$1 P$@ 1Sf  $$4P_*`uZUCUDPEUTpppȳppppıpppppDpppvbPEUUxpppppزppp<pppplpp6 (6&p00( R0C0s0SJ p u044s04?0 00 d0 p610(00 ,V0,L0@" 40 00  0 0*00 +0 0*00 +00!00  00c 00 h0 050!00 8 0,00 1 1 s40(40Su00; T$co0P0<$uh*p 4S N)PP#\$im`P#D  8(@P,4(0(00`V Z 00 p"#8$p = 0P0 r0 4P P#0t3}p$p4S80S4\ 1S 1!0"< 0S,٠P 3"b~11   $$!0#y_pT2   t$ ⹑pܑ7 44P le $ t$4嗂s'4S 0<3?X  R5 $tR $4&S 4%X0; 4 44 X  0l(p0AtXʟX0:S Q 4 $S  0 H &(0S Z w(1!4㟟X0⫱㘟X+'h,J%:M'($*m*2+ci'N6kG-GMM@ph s <p40@D@DTQ @@5P(<L\<<t<<<<<@ĺ<<<Ժ<<<<<<<<<<<<4<Tt<<Ļ< ,<<Tt<h3F 04030039 3 (x3  p0,0p0L3000<3080,434#   3~ @| 2v Dt 2n Hl2"f d20L0`|2"Z X\2d"R P<d2D"J HL2 B p0V0  28 W6 2 0 p0X01!& $ 1 `p0x0p0\1 (p`P%͡  aqp`P0 S  0`YP r0S0Sh`lP0 A/aP 0$ 0 0 @x1xM@Pr GލЍ< J%h,T"/v -<!C/iMO-` -PMp L`KP'tDPhfr 'P&p4'3'p$ `?YP $^;pP$ 0{@{05S = #3 &P, C@4P`      t   h             \ l   T  \ 09 0 PpP P  Q R q 0;8;08; 00H2HpPt" P R  s{ r+Sq P6P R / < _ 0< 0: 0 q@0 010@;M 0@0 00 008;0T PP P R / 0P. 00~ 00{ 09x䰟 PP ` PR |ꬰ PP R @R dmK ?`RMb@Ap(    {Gz?  J%  : X v    (l( h,( 3 b ( 0$; 000H LN 0P 0 000l ptPe  P R  $S0{{Z%PZ<;S%PS0g QAu $<"u AG8 ({*<0(+R[X= P10HC2pGS1<+0X2 10S Xp<0H1 ,d P 0: 0 >0!.0u 028PZP ̌p ZPUpȌ 刀pp0/Pt + 8pUpeA~  J%l(T( xX% (P :\ { T((#   ( й($,$(@( 0@ @ |0 0PUfPh 0C Se0400000,00(00$00 0000000000 0000000 0|0p 4RC PPH/@PWC u/|q8;p 00 HL0%p8; 00 L0%p8; 00 L0s%p 8; 00 L0e%p@ 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;P+2(bⵕP L07%PW;"0#10@00 0`K`QH `    ` 0%Pt3K0S PP K0%P& 0  00 3$Pd VF0  /Ss``0 $P`4$$֙!2P(104d 0`[[[[,Q0Q4QPPPPc㽙d<;SʔT$>@ qsz{ A k::˟c$@ 3_sVz{ A k9I:`"2RgdD' { @`30S 0 ' @MHIN2 X0弅*#pU00 6@+@0W0 00Do.PT2 ppW O P $2A$PG`AQKY9$PVpjc1{{7 (H{CAZAGΒ@8HINT{({*X"@T7 0S3 <'0xPT0T00P0p+t"P o0S 2彌#t;<000[ Y0 0 |:E  -d2"SS% 0 " $@-C6?8~A@@p(((R Q% (( /(mrxQ%{($< pI1 @S3 2R`P@pEUTT0dR?L0 0 0 d20 !  6  `0(0hl0#?ph{{7{{{3{{ {  M@   X 3PŠU h2Y0Ph2d@ f P 0h 0S ho 0Y 3! |D<0 0H 002 0BS+ (S3; - 0H;9-U@P-P2!0@0Css0S  0I s0r !- 0 O1帑;    0;  - 0@0 0U |FD<0 0H 0@0zP0W 0 0D0 1 J 0 wP<0[XU D0 00R ZU |DR<0 0H 0@0El  0 I0D T,PPL0ZP ($p(( Q%T(P{,D0 ,0CS00\0X| 0 P Q; (\dlt|^,    R,0募P@0h|xtplhd`0 fP; @0 ]P2 Q8@H,  ,0 >P  +0 .P +0 $P` 0 P Q Q ($w u0  P w0 P 0 P 0 P 0 P 0 P` 0 P <0 P + 08  40Si CS S U |B <0 0H 0@0Pi+H "6Ng9GXf Y%;u4,(p(*)/SIZ0KUI7P/+DD+ D0J0ZD0  I)0K9+ 0K:  QJY0KUD03 +Y uP UD0 *D0J C 4 ḛ KU \*PDD D0I0YD0 0J#1 K#+ * U*O-M`PE@0L-S@ZP. @,4 t 34p+40SP a`F0pP[P)PijQNpGK PN . j&P@ \3pC d0@S<D$,4L@20SK@HGG 0 0pk, h,Y 0\jZ'Zc`Pkn"P`0b 2 R - -0 S - -U+ 0 -!.0!00.XݔڔהԔ єp4 ,p>0S,Xf'` p,0S "P0pp@@H- 0j Vp`lBT)J%+dSb_BC@t\O-PAM Mc@`xP l Pd70`W00-S% @(P 5z(Pi@ p0K0\Z *`F0S0`@DDA@Dv 2p .6p0StbLpPt63 Q X :(P -00 *`@Z-00  D0B5S񟗊THHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH`lHx  00S >iP}9i0 0w꤄"4P 2i00i00f`400b `4 ^0S Hi V 04 R00OB)P H ܃  300S P60$010(0.0,0+t0C?o 2R0S0$0UPP\MPH@3w00'a"@DT3a00@`FrS; RS iS/ &tS xS,e똒弢+2b.0p 0@00@00S / 0@T]n0S },;zv,#R0B(0/S '(0S  0@n.?0S (0S p|1 0h0WPS 4L{(0S ( 0@?k) N,]P+- 0 P @T[ Q`)J%h,:R)t8$IE42xQ%YD$3T7 Q%Gbt؁lE3O-PLM)@pPph/0p\?,#@DRQ0I 4%@@0SRgvP cP SP- TP0(3 LP 4d0@S$$$$$$$$$$$$0D003030800H00 30$30,333S 7300 '`,'0'4 &8&<&@& 0RVS[0DSYPQX!100gS @kp, DX0P  aR @L0Y? SpA f0-S4 @03Rk@@ @D@@D8d@@@@D$DDD`D@D0@@@@@(@@"0 0: P@0 0:0 0:43043k0830<3@30@3``jjiihllkT ,0f3T ,0T ,0T ,0T ,0 F30p 0T ,093L00L0T ,*0pT SH S0 D@00D#8 D#<#  P Q0P0083 X00k0CSX@L(40 @0H0H 0H@0G0G0G0,0  2,0 20|P  PH0Sl'll=0-@PH0SH'H<10! ,0GSW p43gS0@垔/NaTG cT5 gT0C@㐔03SX0SZ 00gS$ H0S!pYP 0d&d %0SZ H%WppTpWP 0S00O< % $,`&0^&4\&8Z&<X&@V&DT&TLЍ0000H3@0P xH30娀@?D30) 4 00R*SCP 0C00 ,0  @@0TB A ϓ40  0,  T0D ,0 0R@ B @ x<0S $3S p4@0 00 R  B   0x< Q $0Q @0 40 R  B   0sx< Q $0Q~ @0 80 R  B   0[x< Q $0Ql @0 @0 R  B   0Cx< Q $0QZ @0  <0 R  B   0+x< Q $0QH @<0@DSJ $3S0S .Y/D0SS @pdi07S e. 00# st  ?x.U s. h m. z g.  a.  [. 30S 0S 0S  Q 0   wpx@T \.#8 30(#0<  x4 Tڰ{@m) J%E _<<<=$*X*`*h*p*x*H*ov<<vu<<*JCґ=@**;2=?=M=[=l=y=hM;G-`XMPJP 8y8I ,p  90VJ<4& cDP% b0@SS $x80 60$60(60,60064060860<60@60D60H6$&R 4&<  <&,&R 8&R 4&R <&R 0&7RaQ%p%PA\7=CP @P8W0S  gP 0000反P6T&0 pn"[PP061  (VUtpE% 0+Spl*d6 0003<00 0/16T& P 0 s000p :XCP00G00X<%p0 @P   |  4 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0qp,4y 0P 0PQT)wb͌JZp3V v`(os`F P% 0SU030#:U 5%P| P l!2. T~%P&T6K/r0E303PvTS0 0S0# G@SPE2X: P 0 0<6SR46SR 0&2RRPh2 01f%婹6S |夹3P W0`W  0 P u2َ!EK/r02,6S m/3`P  A0PQ! !Vqu$㵎i<6S:46S: d1Q0@6D&S|1 0 00Rl!  H&`R\! $&RP! 8&RD! 0&@R4! 0!Q   @> 댐 @$놐@L|0PB8*J%qBh,B |IBB *dT*H*BCxX%BBP%CCC _BlB2C?CeCCCC *CCfB DD)BDDӎ{ D.DYBA-Pp`IHM c*p10PEU* z2HP h0@ S S(((((((HHIIl1忾d1T1 P1 `q 49P p 1!= qUPP a Lp$@@Ѐ@(@ @s! 7lP Pُ0S PxV dP X`0 0000 sDJ%h,($i\ *Sb&yt }DCt DD0G-`HMp0G,S,C, )p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 2a0@S( 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTP,`V ДY 000 09HЍP F PPp   `0S  < 0 w`PYKPV qh V <`FM *h,J%0$ Q%hMB *SbC-Mp`:PPF! VF (pSPU 6 `V V 60S aP& tP8p6 R ~P< <8~@P |vP @0P XP0Pl Sh0 lP4:T{ |P :h(s\P 9T(X(i8 e,媈P 9h(g40GDS4LLLL<LLLLLLLLLLLTLLLLLLLxLLLLLLLLLLLLL4DLLLLL4L 8(VS h8X(T(N T8,J8 8P 00S= 8 \8, ,, ,0 7,, 7H(($8p)7, | 7L(w+A P:?@ 0 D7P(74w pP78x7 7<( 6T( X(L7 >6P 00S 70  6t(6 )x6P 00S 6 6@p 68pŁp0⤖80 P 0SL6t pW 8Qp(gr+^ 5,0 0l5L(5啁` L5`(d( 85u ~$5P @ y5?Q4:rGލЍx5| p,_0D\<|t ptrT>@PHt@ t0@`,rwPP0@P`4p@+0(@0@000,`40U0 (P<P8,8U0C?o20SP ,R  \0,0S Z,8S=- ,8S ꪃ`9*;v;vvvQvd w%w/wuqwP% Q%OxJ%vx H=Ovhwvwh, $w B*FdxQ%ww@hwwh, x x6xx|xxcccccxVm]xuxcxd \  xxTF* L xG-P`@$E"}hk4ޅP03ip2S l PYUzPH t各9PB/PE0@ *  "pX40pEWQU <4 000`ƒP L,~PE0S#3 4# 3P˃ȃŃƒጌP DYvP303 `pd \$XLzPP304D4S 4S厏P  Y~ P 4SqR|Pl l g PnRy,p`bG1/΅<01 1> 110101$1z(S#2Rkjp`d Pa Q1s0S ᰅф`qЁБ0p00l V B/o" R tpP  \៎=`S 0 0000 l>1s0S*v`#RS S=?o20 S S l$1s0S 0 S ` S S Sx*Ff J%xX%(*>]  Q%DL$X$K\$*P*5 ׊ˊSbpX%cCځ@-@`3PxP 1 q U!px10SAQ\1PI 㺖D1C@[P 0VP 1 nPbP9P0P 00@0c0@ S P(`(4(4(4(4(4(4(4(p(4(4'VP    h0  X0  H0 T TT  -弖0SO+J%JI$ |*xQ%A-`P107P1 0Q U 0SAPI6~PEl10S `10PHQ,0S,1,iP#P 㩗P4qp 000000Se ;닮PP`0S kPPt00S8+ V=+ d*2!1&5L+=+L<+P %dv=+(C+=+=+O-pPB`ᘂ= p pp2 0 QQ  PPPExyuP`P GP( IP) EP s10 ~a0@S.X-X-X-(.l..X-.X-X-.X-.X-X-X--X-X-.0000@P  L_0082",2͙P W 1QW 9b 1 Ѝ-T5(40S6 r4P(U@P 0x 0U0 0 0 00 pP , H(40S(` +8+x+H+@+p+I ++t+H++uxQ%@?s?@@+L+m?@h,+x^,+@ L x (+D++Ph+؁܋ AO-pKM90 `DE 84`0 ` pPI 5 W^Y pP 90(<Pt ` 0!0 04QX 000ssP *pP02 0P` PP.dPPD~ A m ! HRpUaUbPEU??????????????@zU" !0  0i 00 0`3 1 H 0@Wv$300r`p p00: S) 0V0[0S3 Y  { <`P<  (^P (y y}=Pt( (P\!c`PP ((),'KVH ,(,0!1QP6 Q |g  P"   P0S S pIꀀ0S JT0 0/X0 @ph6 0SS RQ"$r0p0W0S uP@0 { HT P Pp`+,rJ%Sb Q%ht@rrrrh,FqrBr9r]rgrrurrr0O-PM`P 00@U}P O}P岨ߍ*. S`?@P1X?/01012211B "L122RpKpDpN&KpἮ\10 .0>p1F0[X18X1h`s0  F1|!1hQda0  @Pw\1j >0[ >+00. X18X1=0YSpVPMP 6PR ?PI 4Pp㤍N@P񟗯(GDFDDDFFFfP j@PP񟗞FGDDEDDFDDDDDDF=0P1`\<*`F@pԌ}\1F3\1Kw0000q0\1lH @fppcph`0 P P \1P ͧ0#P\ Ƨ0[ 0  @P 0 P  孧84'0 00X1 {pxx U  j1S P V;  / :0P \1@ @ Lp  p %( \ X1 Q 0P819:\!p*X1 d pDT P)(< $X11Z yPPY* 9Y) 9+ 0)\1 )P|~ P S y 0 09jzypHx  W )50S L  PQ T~0S(  X!\10\1808"/0  X!2sP8"/0 ۱2X!s"/ ѱp= X1`_  ݱP%DAX!\1 0\1 00 8噽p 137 > ┳zھPtwht 00 79p}0S $@X1pGW}0ST>}0S }0 S X1\!8 0\!'zsp}0S &|fp}0S &H 4P q  wtؿ㣳X1 I S0pT9 n`p5 P <5\1A>\10L1 00 6Lƻpwlҿs0L1 00 5L嵻p(Op >`p P \10\1Q|屿)D2ds\1 @0\1d4pP  <X1 X40  ⅰp` X!\1 $  $$ 435 +p   ⇲Kpp 00 4Xp@d|!RX14X11  uP+p0v!P0!  R!N00|!R00SR\1 X1 0㌃匓 Q01X:  -X1  ɳ1PU3X1\!( ; W A? =冾 ⮳ 1R@T 0S 0 @@ 0S  S 0S ᾱᑿPpP P ( RW  R   0010 S   0PUBQR\1@0@k `5\k1\1$ &x-xqw` {||X:% wwa J%S|uh,uuu/|B|` hs@x|m|z|וw؁^a *||$||}|}0&}7}M}\}j}z}}}}~-rs}C}~#~xxx5~H~2T~~~|~d~~(!& Q%  Q/0p@-x@0Ppp@ P T0Qp@ 0 0$0100SxDX/O-1!bM0 Mb  [ !1 b0 0 30Zbݍ Ѝ  0 "m !l\ $5{`  $; 0 0 +Hp0Gp( 80G( Gp` x8_S0؀00 00 P00 @G0 xP x8##[`@*xP0 l8 40GPU P0 l8&p3pR*/ 4T*///*/@-@ y@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_RC3 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC3 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC3 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC3 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC3 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_RC3 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC3 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.0_RC3xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressnot ACK or OFFERdeclined duplicate addressignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d K@\  #%%(++Zd/x078989>NlAAAoXFQGxRWYdmtsYtunz~HLiB\Z4T\S|Ě"ĚNO`_BdlBd-4,4 lC5;D>6$;X@!F@!r'I'O'(V(r,[/`5Wt7g=U}tC2 pushdnepopdne#`|@@p<0x@@$dy H@ P@@gv@@$unblock and -DNO_CONV?pYYYL_@_Y3XYX100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink   Z Z" 6 J E[ Zo    #   _ ^ F < > ?  PATH= t=fmdtmsBcmmzmlr |!p,nmv b    EOF reading here (<<) documentTʻ5  <y~ GE V3}-+?=#N@N&,28>EO@kŒabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.',2'0|1'1p1'11'82'002'01'01'01'0P ֭~} ?v*#4=ʦ4=#<ZD<#0=f$t=#=f#\>\d?#%<yed?s#>#?Z?`(?#T=#<>g#>d?9$=$A$E$J$#I$3R$#Q$3Y$2X$3_$3^$#&$$& &@@&!&*&$*$)$%%%o$%w% %@%%%%2$%% #C$#C#C$#CN#% %$ $%%$9%$%'%@$@0% $ $$D%L%@T%\% d%####%%%%% w$@444@3@4@4@4@5@5@5@5@!5@)5@04 @.5@45@=5@E5@44L5Q5W5^5f5l54r5y555555555@5@55555554556 666"6(64.656=6D6K644S6Q2b2r222222 3383T3g3r3{ 3!2767;7cC7H7N7T7Z7a76h7l7R0666r7sx7ӢdZ6d6n6w6~6666!66_6d666R0666666666777.733 63333333344 444"4*40444;4O4E4N4U4^4g4p4y4444444444444!2767;7cC7H7N7T7Z7a76h7l7R0666r7sx7ӢdZ6d6n6w6~6666!66_6d666R0666666666777.7!2767;7cC7H7N7T7Z7a76h7l7R0666r7sx7ӢdZ6d6n6w6~6666!66_6d666R0666666666777.7FyACPZ [ [6[W[j[[[ \ 1\ \\ x\ \\\W\\\]B]g]{]]]]] ]!2#2$^&2122^32425*^6285^9;^9B^:[^;u^<^=^@^A^B _C6_D]_Es_F_G_H_J_L_M_N_O_P_Q`R`S4`T=`UE`V]`Ww`\`a`c`d`eafag*ah*ai*ap1aq2s2t2uGav2wMaxaa}aaaaaabb;b[bwbbbbbbc.cEcacycccccccccd;dCd64dPdsddddd2222dddefe*e7eIeceseeeeeeefff4fQfiffffff g,gGgbggg22ggqhg)h2*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readsN$@dS$X$[ $@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-!4?mv!ح 0$M>p$@-;NcuX`l8Lp,@Th|LdZ6d6n6w6~6666!66_6d666R0666666666777.7$@PZ [ [6[W[j[[[ \ 1\ \\ x\ \\\W\\\]B]g]{]]]]] ]!2#2$^&2122^32425*^6285^9;^9B^:[^;u^<^=^@^A^B _C6_D]_Es_F_G_H_J_L_M_N_O_P_Q`R`S4`T=`UE`V]`Ww`\`a`c`d`eafag*ah*ai*ap1aq2s2t2uGav2wMaxaa}aaaaaabb;b[bwbbbbbbc.cEcacycccccccccd;dCd64dPdsddddd2222dddefe*e7eIeceseeeeeeefff4fQfiffffff g,gGgbggg22ggqhg)h2;]L|nQn- q+Wc|nQn- q+r||nQn- q+|nQn- q+|nQn- q+.7=rGy=iG}˼;Mt?ּmWC 3KOOyD<#*=( 3Dh&\ M}-1B@Mjy֬Sd-чH6u-чH6ZIчHYIчH UIчHܼ½2IчHdݽL6 %?aS'@ )Ѹ*1@ )Ѹ71x )Ѹ!+\$@AĻd$backupstore_gptstore_tbl-ph$@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapssetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus!9uprintallmaindo_setifpreferencedo_setifcapszi($yiظ$$+ظ$э$$y8$7`$>$ظ$,D$ظ$$$ظ$ظ$ +7C@O[go x0@6Q  @9uinit_current_mediasetmediamodesetmediaoptsetmediasetmediainstGA !   `@ Amedia_statusmedia_constructorfo v${o v$ o oL$yoyfh$xoc $oн$paddr_match<p< dP <0<settunnelظ$$print_link_addressessetvlansetvlanif$$Dsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanvy|sethidessidsetapbridgesetiffragsetifrts8$*ظ$ $*ظ$W$VW9* ظ$e0P$$T$8*ظ$$Gl:* ظ$$p$98**p8 invalid major numberinvalid minor numbertoo many fields for formatffs@ %"19uO@O@OPPwKT f .n @$;@\OY UuzNYO  +AOB,BP . 9f o_&@'.3<FJOV bnorripbgensbextattbnojolietbnocasetransbrrcaseins  +AOB,BP . 9f oN@N_Rh&@O@NK  +AOB,BP . 9f o %N@N_RNO@hYu&@1"  +AOB,BP . 9f o&@  +AOB,BP . 9f oN@N_&@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror  +AOB,BP . 9f oh_&@ @ d@ry @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv_  +AOB,BP . 9f o&@NK 1_ by:p8j 0%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@SBdCsFILNO]Sabcef-htikmnorsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:3@@@h pp pp ` @  $1м|^t0 Non-system disk Press any key to reboot 3hhh3hhh3hhhDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY====>->W>>>>> ?=?e????@UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_printNH(N(4N>N(JNPN(FeN(JNrN(NN(NNNNN(NN(O O!Opp;O|IO(YOaO(YOuO(YOO(YOO(OOO(OO(OO(PP('P+P(GPRP(ePlP(PP(PP(PP(PQ(PQ(3Q8Q^Q(pQuQ(QQQttQ(Q(Q(Q(bitmask_scan-iuMMMMhw.disknamesss tEzIzMzQzUzYz***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20260107  " $#!%Z^\`[_]a   : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataBJ\ !B#A{ 6+,A5AR+BAP+JA+VA_A+ CpA+AA+AAt+AAQ+A;+A3+B2+ B+BBT+)B+0B7B+AB+KBY|+TB!BS+^BoB(+{BT+BP+BaAt+BrAs+BBr+BBs+B;q+B+C+ CaA+CrA+*C+5CCC+UC;+aC+mC+collectkEMgE:M;;MdZ6d6n6w6~6666!66_6d666R0666666666777.7NAME=N UOmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdsdZ6d6n6w6~6666!66_6d666R0666666666777.7 edit_fs_type_extZ d C C C DW lX (f Df 1LC e D uD edit_and_check_label dZ6d6n6w6~6666!66_6d666R0666666666777.7disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzd 0 8 ķ   ̮ ` h  h  Ի ` X < ̯  disklabel_change_geomP @U `\ outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_defaultX+8++t+pm_from_pepm_whole_diskgpt_freegpt_create_newX \ЩP<ؗhxd` p԰ PT,XYd]]= U -66ܼ! !nm4! dI`3nnnY Unn_unzN6nO6n 7ngpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC-dSFU0eC36Hah!IdontNeedEFI=B(s*K>;]L|nQn- q+Wc|nQn- q+r||nQn- q+|nQn- q+|nQn- q+.7=rGy=iG}˼;Mt?ּmWC 3KOOyD<#*=( 3Dh&\ M}-1B@Mjy֬Sd-чH6u-чH6ZIчHYIчH UIчHܼ½2IчHdݽL6 %?aS'@ )Ѹ*1@ )Ѹ71x )Ѹ!+4d pqq;da)q6A9qa_fCqSqcq vqqmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newP ] ] p<LԿ0 4l@` P|0xLmbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************EzIzMzQzUzYzcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump25`G`dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionLvbEcQd2efۆghځiKj!Bklэmn:#opqjrs tSuQvw|x$z_By4A:BGCDNEXF]GgH$IJqKxL?gMNOPQ8Sg9TUVWÇX͇Z,t1܇46xԆ|~} !3A?HFMUZ`fl,BO{ƈĈ͈ˈӈbˉ G݆*=JXddefault_configread_configrt_compare_protoTTrt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtrt_buildrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init i|ōύ؍script_buftoenv~*ƈz8͈make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os,  if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcpʙWٙdhcp_boundْ dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa0h0hDhDh h hVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B3̌< ,Ll0̍BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~X% }    3< 0@<>!8?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_popunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %smemstream_seekrshrcmd0123456789abcdef %x:%x:%x:%x:%x:%x %256s 0123456789abcdef0123456789abcdef0123456789abcdefkMGTPEBKMGTPEKMGTPEBkMGTPE_getttyent: TLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~_fts_readkh?marshal_new_auth_authunix_create_xdr_arraygethostby*.getanswer: asked for "%s", got "%s")& @"NBCDB  d'@Bʚ;0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as5gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef0123456789ABCDEF_xdr_bytes_xdr_string0123456789  %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC 0123456789abcdef0123456789ABCDEFQ !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG @Cisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB 0123456789ABCDEF0123456789abcdef/& ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::p~|~LTLUPa ccNc`'IJc<ccc c bb`bbb bc  c  c c  c (c 0c 8c @c Hc Pc Tc \c dc lc tc  |c  c  c  c  c  c  c  cy <Ě x~   ,(y h < a | XT 4  o e t La @p 8 $} \t  a a  lb 0a @a a a a aa <į xa a aa a ,a,a haha aa aa aa XaXa Xa XH a b b b bb b b $b(b ,b Lm .0b 4b  8b 6T.̂ЂatadMKMloobXXYXD!D!L!L!yara^ ecT]l\4(4P\xȊԊ$@L ht   ԋP 4@dppt (08@rHLTrrX`dlr r $,<DLptT\lrdlp|rrr̒ܒԓؓܓ$!ēȓ̓Г$!lx|Ĕ@s̔Дؔ $u,4<@DHLPTX\`dhpxȕЕؕl$,@P\hȖԖ $4H`pԗ,@Th|̘0DXlЙ  4H\p'!\܄$܃܄$X̅d,+!+!@+!<+!`,D`ܞ0P$```xx  ( $$(DL\`tx    ܤ u$(8<DH\dx|<̥Хاԥإ 04@Ddh !"̦Ԧ#$h%4&$'4<)X\*``+dh,|-./ħ0̧ԧ1ܧ2 3(7<@cX\t|ȨШب (#@$hX%h&tx'4С()Xȩ̩48@DL̢آ (0<PXhp   ̣ԣܣ,0@DP\`x|ȪЪxxxx  $C9!9!9!9!9!9!9! y $$D$,$ȲԲ  $,8@HPX`lt$oij0@XlĴش  ,DP\pȵ,<Td|ж0Ppķܷ0`x$@\tй,@ThxȺܺ8Lh̻,<Phм  4nZZVJ,tpx̝x9!9!9!olX%T3!`$J_,^,J%<_, h,Pj,$Y%Q%-U%V%S,<$_,tnh,Q%@_,J%Zh[|_J^,dal,_U%4-]\K%,2!h,T--P`\v@-^,^,L,|d!S,pX%`$J%^,^,pZ^,J%^, h,?,h, ,U%$J%S,-^,D,wH_,hL% lT,U%xX%^,^,^,hW%@K%-^,0t,lX%T,0:!`d,^,3!pY@$,Y%L!S%D_,^,P%^,$L,th,mtX%(Y%4$m% @o&H Ph$.~ bj,jc=fhklmoopppq#r_ue0t*vw2w?xoZxrzOzGBCJXObPqSxT`VEVXZZ   `(t-uls-x`sst({{||ls{`ssF  /dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin%'}-+?=###%%%}+'+'ZadlEVreCFzIiL0BlmCPnfpbuq׍sh*v!1VVx-'@=$$d *q=?Es=4v=Ls=Px >Hs#>sD>rS>)fqq>dr>F&FAFKF|`FiFPyA(2AlFxFFCؑkFFFFdFFZ$Zhj ... ...}f|!HED''{ ɺ׺{ $:{ HEVӿ"Kd Lx=ظ$$AabCdhlNsuvW:w:z$$$$$D4$$<P$<<?<ddD<  $<ddD!$Ժ$D$$D<$$$Dd$4$L$L$8`ȹ$Lظ$$LBظ$ $̻$`$4$Lظ$6P'X$L$6P'$D.$ĺ$$̻$$ظ$й$$ $x$$$`$`$$4$ظ$$$\,ظ$,4?ظ$4t]ظ$74}ظ$7y7L$6P'$\ظ$4ظ$4yظ$Tظ$ T>ظ$ >T,ظ$ Tэظ$ эLWD$\ ظ$ \yظ$y\pxظ$cTvظ$ v\ظ$L$4<$4ظ$L $<Dظ$Tظ$ Lظ$$LX0$\x$ظ$\"ظ$T!ظ$ \L!ظ$T9Wظ$* WTl:ظ$* T*ظ$ Lظ$e0ht$8=KY@C`@CeDkBs|D@Cx@CaA}] 8!8"8#ˉ$8%8&8'8()8*8+8,8-8/818182 93945i6%DxQ%NPWMMMMMMMMMN N. (prog_root)`Y?EbYciY*cccccm]cdV3 L L Tn d XW # . Y d-  $= bY 4- d V E Y 6 B d `  T G lV zz  & % Z Q A + D RA G d lV o L= +d ^ 0d h] 6d ] | V -M tFL pa4N |y> $C CTE +TE c˄9 .܄9 ܄9 I I sG ?+4a #<PI *P EFJ$PHcda]lg#sNhY* !"$'(+-.03569:0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ$$$($($($P$$""($P$P$P$ e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<!% is a directory is not a regular file (use -f to see it)$$ (G$T^nNz">Q<?;Ģ 7̢ ֢ ߢ #28 #3 ?(GQ]!ir9&Mf)5£eˣ:գӥ%ݣ6f4 +,*-9.L*Yb?rEy//'F= ݡ+? O Mfq7A9u  & 2<WmkRkRkYcWbkCkc kG ky wb YMYrWca %=+Ϭb %@=+| B %=+6[c %=+d %=+ح %A=+ %D %( :e %=+Gauf %=+F %=+ɮg %=+6ah %=+i %=+ ϯj %P /=J %!=+Jhk %HD  %H K %x=+L %|=+ðmx %=+np %"=+ 7Hoh % hO` % spX %H PP % q@ %=+~ұr8 %"=+=s0 %!=+}S( %!=+²t % ҲT %x زu %=+*V % w %"=+@bx %( ʳֳX %A=+y %=+%<z %=+]r" % ~ %!=+? %, # % ܴ %A=+  %p=+!C %t=+e %l=+յ %(l  %`=+!B %\=+d fy %X=+ ܶx %T=+p %$P=+ 9Mh %$L=+ k` %H=+X %!D=+ԷP %!@=+D  H %!<=+ S@ %( 8 %!0=+0 %,=+ڸ( %(=+! % B % =+Sz %=+ %=+ɹ % %!=+)E%=+Z%=+ %=+#Nd% =+uһ&/ 8M\k} ʼټ $,w6<CS#[=i{H %ǽнٽ $2>JZhh{qw˚?+ (press RETURN)#I wI I H %H %T %tags643{}abcdDgGhHilnNpPqrs tw xy !:#=]+]+-e^H-i^C-k^UK #%"%0S <"%e % !%!%C !%Hg  !% D (l!%D }L!%lD  % \ %G F %P ^ F,%\P x`  % %%F\%G a F%P a F%(P a F<%O b  %# %L %F %LG [ F \%NG \ $ ,%; %%i 2$<%mN 2$%m2$%m l% ,%  % % L%[ %Zc%uF%jc F,%f_ F%jG Xc g g h uc |H XH ,H L T ue (h Lh H uW e|e dW ge hW \@e ^Le ]\e _le TG ohG @|G G YG G mF F G G ,G @G YF cF 3dF ;xF CF LF W e  e 0e W,N Qph RM SW TXM eDM N hN OtO P(O QN RN SN TUM VV x8F DF yTF <d =d >d ?e E F F $I I H U xT f g E Sd I I I |I 0V T \I O E TE rHE \E pE  E  E 4E xd d d &d !d J pJ LJ (J ld J J J f f $g `d K e Tf xf jDd kTd 8K f 4f 8d D YD  d d ,d D c d |K XK g g \g e c L \L NO:d LAR]l t9Yq'+3FiBCj{6AU~>O^2>As * v +?L]ji<Q^ +aI<,ENfB 9?Xey5DQ_kwD9-y  @ J R \ 9f o ~      . B O [ mm           : Y u    U *      & - : J c u          , 1 : @ Q Z r |     V    '6ESb<n!<N݆?p})Vs*?h4L4.Ts/,ZjvO@dkoy ]!JQ_lt.X?2@}SZkvq  D#_#{## ##### $y$$$o%y%%ݢ%>q% %%%%&4&c&s&&&&&&AA^''''((J(((()!)')))*1+++  ,",grK,V,,,,(-W--O.@h......1/W////0,0B0W0j0w00000000001,1O2]2i2o2v22222222222 33&373F3X3_3i3 z33333 3333 4 4+4=4I4T4]4j4y444444444445&54 z355@5U5b5j5~555554355556&6/6ZH6c6r6666666666 9+9G9d9l99:z;;;;;<A<K<\<r<<K=c===|>>P [M_MdMhMnMqMuMx%yMBSBSFSܼ>SiF/h u Z ,Z 3ZP_Z7Z=ZhCZKZRZ70XZ^ZdZ iZoZ10wZ&'~Z(Z)Z*Q+Z,Z.1/ftp|]@PkY YYT@ YYZZS 6>l #< ? 7@ Q A` B` C` D x E ` F 6 G  H  IԚ YĚ  l (  1u 1et u eeeeefff,f:fGfTfcf]x\1]x\24WTi ؁CPTX\`dWhnq   ʻ t w     c5_"WĞ6Ȟ̞4О0 Ԟ!"#$ %&#'.(?)Q*Z+d,j-q-~../#/0K.123456789:;<͟=ٟ>?@[\\+]@^K^]_h_q`~{{|}}6~ʠ  -dd-ddTdd:dd:dd n o@o@o`$o,o8o ff f(f#0f#8f#@f#Df#Lf$Xf$`f$hf$lf$tf%|f%f%i%f%f&f&f&f'f'f'f(f(f(f)g) g)g*$g*0g*8g+Dg+Pg+Xg,dg,pg,tg,|g-g-g-g-g.g.g.g/g/g/g6g;g;h0h0 h0(h14h1@h<Hh<Th=`h=lh>xh>h?h2h2h2h3h3h3h9h7h8h:i4i4i4$i50i5 j? j @j!@j"@j#@j$@j%@k&@k'@ k)@,k*@8k+@Dk&`Pk'``k,@pk-@k.@k/@k0@k(`k1@k2@k3@k)`k4@l5@l6@$l7@4l8@Dl9@Tl:@dl*`tl;@l<@l=@l>@l?@l `l!`l+`l,`m"`m#`$m-`4m$`Dm.`Tm/`dm%`tmCmCmDmDmEmEmFmFmcmcmdmdme@fem#m#n&n&(n08nHnLnPnTnXn\ndnlntn|nnnnnnnnnnnnnn ff@oDoHoLoPoXo`oee e $e@(e@d4ePNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[SžK%K%K%TL% 33UU33UU33UUP% L% Q% M% xQ% `O%Q%P%,T\dlTsxnt4onx|x   @ 333333333333333333333333333333333333 33 33|U% 0!0! 0000000000000000 ,3333b3333B33V%V%V% (root)`33 0$$C9!9!9!9!9!9!9! y $$D$,$<$4:!8!@@!X%$?@D?\@L???8@H@;,;0;8;t;@;;A<D=|=A>?A<<8>Service unavailable hA0aeabi&6KZ  "D$6,`7xܭoAYrV`.T`0 AP:D"MP(onѽ,Kٝ7+/[~w?2^Ʃ k;+e)ow7ZD\n泈2 `fXkϖNf/oa*"bߎjr3w\嚇qZ\|:k9E<[x}}^ow|Vlq\g핶Ec3./3ܫurZk[RUŘA{gwFo3]Ĺi><AQħ6l!TG%+~_yȿ""D\-mC_t3͵8~];|ҵݏ|Ҥ'EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+8.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / B_H``P<$ Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5767 5794 6360 6660 7301 7348 7461 7554 7588 7607 7625 7633 7642 7667 7671 7675 7678 7681 7803 7988 8216 8736 9087 9116 9129 9142 9147 9167 9186 9207 9266 9283 9297 9319 9364 9390 9431 9509 9627 9741 9795 9824 9856 9895 9901 9934 10057 10064 10068 10076 10100 10182 10188 10195 10207 10221 10230 10263 10282 10294 10404 10466 10485 10604 10655 10707 10719 10738 10790 10994 11202 11393 11453 11502 11769 12228 12894 13317 13639 14064 14196 14228 14240 14418 14615 14776 14910 14930 14963 14977 15046 15159 15331 15466 15486 15598 15690 15713 15736 15795 15810 15831 15846 15867 15887 15912 15926 15950 15962 15980 16190 16440 16461 16477 16530 16598 16671 16708 16734 16810 17267 17293 17315 17422 17529 17730 17803 17887 17987 18482 18720 18871 18905 19040 19084 19223 19264 19309 19356 19600 19733 19795 19889 19894 19928 19962 19977 20005 20038 20045 20070 20088 20114 20121 20136 20151 20171 20211 20228 20248 20269 20291 20306 20326 20348 20363 20376 20390 20402 20414 20428 20451 20474 20492 20535 20586 20623 20808 20871 20907 20956 21047 21177 21230 21490 21537 21898 22048 22217 22357 22477 22609 22649 22696 22706 22714 22724 22732 22743 22754 22768 22793 22835 22868 22901 22936 22990 23015 23034 23056 23061 23067 23097 23114 23141 23159 23180 23202 23221 23231 23261 23287 23314 23363 23391 23418 23471 23481 23491 23497 23507 23516 23536 23540 23545 23551 23555 23590 23599 23630 23647 23674 23695 23715 23734 23760 23773 23781 23797 23828 23859 23880 23906 23919 23927 23938 23944 23968 23978 23990 24008 24019 24039 24055 24081 24103 24119 24131 24151 24177 24183 24213 24227 24241 24264 24283 24302 24320 24338 24561 24867 25285 25486 25726 25910 25988 26043 26110 26150 26173 26207 26218 26226 26249 26252 26255 26261 26272 26284 26297 26327 26371 26384 26397 26434 26448 26459 26470 26481 26498 26509 26556 26579 26628 26869 26902 27157 27178 27211 27264 27290 27317 27473 27479 27522 27542 27561 27590 27597 27604 27611 27616 27665 27703 27737 27794 27822 27867 27884 27985 27990 28067 28081 28091 28115 28238 28319 28429 28457 28462 28478 28507 28515 28556 28563 28577 28590 28598 28617 28650 28670 28690 28906 28937 28942 28949 28956 28960 28974 28986 29001 29034 29047 29102 29160 29196 29214 29232 29250 29287 29293 29301 29305 29326 29343 29354 29376 29554 29598 30300 30324 30358 30377 30422 30429 30436 30440 30464 30475 30480 30543 30664 30787 30800 30934 30936 30938 30940 30950 30959 30972 30999 31003 31009 31014 31023 31028 31055 31057 31070 31082 31097 31125 31169 31216 31232 31254 31265 31298 31318 31367 31467 31469 31534 31583 31632 31736 31834 31875 31966 31973 32034 32098 32103 32109 32218 32277 32528 32669 32796 32864 32901 32908 32935 32981 32984 33005 33050 33101 33160 33229 33276 33381 33524 33549 33553 33587 33604 33628 33680 33731 33803 33869 33967 33984 34015 34051 34085 34109 34133 34166 34186 34196 34204 34212 34222 34233 34247 34273 34321 34344 34364 34405 34704 34707 34721 34733 34740 34759 34773 34780 34787 34796 34806 34823 34839 34887 34895 34903 34913 34924 34942 34959 34978 34998 35005 35022 35039 35046 35059 35094 35111 35130 35150 35160 35176 35189 35207 35227 35248 35258 35278 35298 35311 35330 35343 35367 35390 35403 35414 35419 35426 35444 35463 35482 35490 35509 35529 35554 35572 35579 35586 35599 35608 35629 35642 35650 35670 35698 35715 35721 35732 35763 35771 35784 35806 35828 35837 35858 35876 35883 35906 35925 35952 35970 35990 36003 36018 36039 36053 36060 36074 36089 36108 36653 36686 36714 36743 36751 36788 37100 37277 37354 37371 37389 37404 37426 37476 37486 37503 37525 37584 37742 37766 37896 37921 38047 38065 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_RC3. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_RC3 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_RC3 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_RC3 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_RC3. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_RC3Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_RC3Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Groupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5655 5682 6258 6618 7303 7364 7442 7537 7577 7599 7617 7623 7632 7658 7662 7666 7669 7672 7794 7979 8207 8736 9154 9183 9196 9209 9216 9236 9255 9278 9321 9341 9360 9383 9427 9456 9497 9563 9675 9789 9843 9872 9904 9943 9949 9982 10060 10066 10070 10075 10116 10253 10263 10271 10290 10304 10313 10345 10386 10399 10524 10582 10601 10720 10776 10828 10839 10855 10894 11144 11316 11488 11543 11578 11828 12232 12531 12799 13160 13340 13659 13679 13692 13881 14025 14221 14355 14375 14408 14427 14528 14683 14871 15058 15078 15157 15255 15293 15316 15406 15427 15450 15469 15493 15523 15567 15600 15623 15635 15653 15921 16240 16271 16306 16370 16445 16515 16546 16576 16668 17159 17189 17206 17346 17487 17684 17803 17950 18117 18675 18971 19152 19197 19360 19414 19549 19585 19645 19695 19986 20095 20152 20249 20254 20289 20324 20339 20363 20396 20401 20426 20442 20465 20472 20489 20504 20523 20555 20559 20579 20597 20609 20622 20640 20664 20682 20701 20728 20755 20767 20788 20818 20848 20873 20906 20941 20979 21232 21301 21356 21417 21535 21694 21748 22009 22060 22436 22591 22735 22875 22983 23168 23198 23241 23251 23259 23269 23281 23302 23311 23317 23349 23390 23426 23464 23501 23549 23573 23585 23599 23607 23615 23643 23660 23689 23710 23733 23742 23761 23773 23817 23855 23882 23926 23954 23981 24034 24045 24056 24063 24073 24082 24116 24120 24125 24131 24135 24170 24180 24210 24233 24262 24284 24306 24328 24355 24367 24379 24398 24432 24465 24486 24510 24523 24535 24548 24554 24580 24590 24601 24625 24635 24655 24675 24692 24718 24742 24755 24775 24809 24816 24845 24868 24891 24907 24922 24937 24952 24966 25154 25459 25890 26081 26316 26504 26546 26596 26650 26698 26720 26761 26772 26780 26804 26808 26812 26821 26832 26843 26858 26889 26935 26948 26961 26991 27005 27017 27029 27041 27059 27082 27127 27150 27210 27462 27489 27751 27769 27796 27845 27875 27906 28038 28045 28094 28117 28141 28170 28178 28188 28196 28201 28254 28303 28343 28409 28442 28486 28509 28610 28615 28692 28706 28716 28740 28863 28944 29054 29082 29087 29103 29132 29140 29181 29189 29203 29216 29224 29243 29276 29296 29316 29532 29563 29583 29589 29596 29600 29615 29634 29660 29669 29681 29735 29793 29828 29847 29864 29876 29911 29917 29925 29929 29950 29967 29978 30003 30181 30235 30926 30945 30980 31010 31056 31062 31069 31073 31097 31113 31119 31194 31344 31463 31476 31544 31546 31548 31550 31560 31573 31590 31617 31621 31627 31632 31641 31646 31673 31675 31688 31700 31715 31743 31787 31834 31850 31872 31883 31916 31936 31985 32085 32087 32163 32218 32268 32367 32462 32510 32600 32607 32668 32732 32737 32743 32846 32898 33144 33305 33460 33531 33584 33591 33618 33668 33671 33692 33738 33793 33852 33921 33968 34073 34216 34241 34245 34279 34296 34334 34387 34427 34503 34568 34662 34683 34721 34761 34797 34821 34844 34883 34913 34920 34929 34937 34945 34959 34975 35003 35055 35072 35093 35137 35479 35483 35498 35509 35517 35536 35548 35555 35562 35571 35581 35598 35614 35668 35676 35684 35694 35705 35723 35740 35756 35774 35781 35799 35816 35823 35833 35864 35883 35902 35922 35932 35951 35964 35984 36004 36025 36035 36054 36073 36083 36100 36114 36137 36161 36174 36184 36189 36193 36211 36230 36249 36254 36273 36293 36318 36333 36337 36344 36354 36363 36384 36398 36406 36426 36452 36469 36477 36488 36519 36524 36537 36559 36574 36583 36604 36622 36631 36675 36699 36726 36741 36758 36772 36803 36827 36858 36865 36879 36894 36913 37458 37491 37519 37548 37556 37593 37905 38082 38159 38176 38194 38209 38231 38281 38291 38308 38330 38389 38547 38571 38701 38726 38852 38870 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_RC3. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_RC3 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_RC3 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_RC3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_RC3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_RC3 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_RC3Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5749 5781 6273 6562 7107 7153 7257 7343 7379 7394 7412 7420 7428 7455 7459 7463 7466 7469 7580 7765 7993 8469 8803 8832 8847 8862 8870 8884 8902 8923 8974 8990 9000 9020 9066 9096 9149 9206 9317 9438 9482 9515 9554 9588 9595 9628 9705 9711 9718 9725 9754 9866 9872 9883 9900 9917 9926 9955 9967 9977 10078 10140 10160 10280 10317 10373 10387 10408 10445 10655 10830 10979 11014 11066 11283 11597 12121 12483 12773 13166 13301 13314 13325 13471 13650 13781 13915 13935 13968 13987 14070 14185 14326 14451 14465 14573 14666 14695 14715 14791 14808 14826 14842 14861 14881 14898 14910 14936 14948 14966 15167 15406 15433 15450 15506 15568 15628 15659 15683 15742 16088 16118 16135 16243 16353 16493 16567 16643 16721 17213 17433 17544 17575 17702 17738 17866 17893 17933 17979 18195 18319 18387 18487 18492 18528 18564 18578 18601 18634 18638 18663 18682 18708 18713 18728 18743 18762 18787 18799 18821 18838 18851 18863 18881 18905 18920 18937 18950 18961 18972 18992 19021 19050 19074 19109 19144 19171 19358 19407 19439 19487 19584 19717 19763 19955 19985 20307 20436 20576 20716 20833 20968 21012 21055 21063 21073 21085 21097 21105 21116 21143 21177 21213 21244 21279 21315 21362 21382 21399 21417 21422 21429 21455 21471 21492 21509 21526 21544 21561 21574 21605 21630 21661 21692 21727 21754 21807 21817 21827 21833 21842 21850 21865 21869 21874 21880 21884 21919 21929 21958 21974 22000 22017 22036 22057 22073 22086 22091 22099 22114 22140 22159 22187 22205 22216 22222 22228 22249 22259 22270 22288 22310 22327 22340 22361 22381 22401 22412 22425 22447 22454 22479 22494 22514 22526 22543 22560 22580 22599 22776 23060 23370 23550 23761 23949 24015 24062 24117 24161 24181 24210 24222 24228 24244 24248 24252 24260 24270 24282 24297 24316 24352 24363 24374 24413 24425 24435 24445 24455 24471 24489 24538 24559 24604 24848 24874 25128 25143 25169 25226 25260 25295 25437 25454 25503 25524 25540 25569 25574 25579 25585 25590 25629 25664 25694 25749 25782 25828 25842 25921 25926 25980 25994 26004 26028 26114 26162 26268 26302 26309 26324 26351 26360 26399 26406 26428 26447 26463 26481 26513 26532 26549 26706 26737 26744 26753 26761 26768 26782 26800 26819 26829 26841 26882 26927 26956 26977 27000 27019 27057 27063 27071 27075 27096 27113 27122 27141 27287 27329 27839 27847 27871 27889 27933 27938 27943 27947 27978 27991 28000 28046 28172 28263 28275 28339 28341 28343 28345 28355 28369 28384 28411 28415 28421 28426 28435 28440 28467 28469 28484 28495 28510 28538 28582 28629 28645 28667 28678 28711 28731 28780 28880 28882 28950 28990 29035 29110 29176 29211 29292 29299 29360 29424 29431 29437 29536 29592 29868 29992 30103 30165 30203 30211 30233 30282 30285 30306 30351 30406 30465 30534 30581 30686 30829 30854 30858 30892 30908 30933 30981 31017 31078 31132 31213 31235 31274 31311 31343 31367 31394 31420 31434 31442 31452 31460 31474 31487 31499 31523 31564 31590 31607 31636 31960 31963 31977 31989 31995 32011 32023 32030 32037 32046 32056 32073 32089 32132 32140 32148 32158 32169 32187 32204 32217 32243 32250 32258 32275 32283 32300 32324 32343 32362 32381 32391 32402 32416 32434 32454 32474 32483 32506 32526 32537 32552 32564 32583 32602 32613 32623 32628 32634 32652 32671 32690 32697 32716 32736 32761 32778 32784 32792 32802 32814 32835 32851 32859 32879 32899 32921 32929 32940 32963 32970 32984 33006 33023 33032 33053 33071 33080 33111 33127 33154 33173 33193 33211 33232 33246 33266 33273 33292 33307 33326 33871 33904 33932 33961 33969 34006 34318 34495 34572 34589 34607 34622 34644 34694 34704 34721 34743 34802 34960 34984 35114 35139 35265 35283 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_RC3. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_RC3 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_RC3 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_RC3 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_RC3 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_RC3Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_RC3Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..