08Vi<  Vi%-9t tVi@@<@T 08Vi<  Vi%-9t tVi@@<@TU Vitpp`AViViVi$h ViViViAViViVi.A.ViViVi AViViVi/AViViVi'AViViVi/AViViVi`AViViViaAViViVibmD`ViViVi (08@HPX`hpx $[ViViVi (N$ViViVi08@HPX`hpxK$6ViViVi{M$3ViViViFAViViVidCViViVieAViViVifAViViVil!ViViVi aViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViVi aViViVi aViViVi aViViVi aViViVi aViViViaViViViaViViViaViViVi aViViVi aViViVi aViViVi aViViVi aViViViaViViVi aViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViVi!ViViVi4!ViViVi!ViViVi!ViViVi !ViViVi !ViViVi !ViViVi !ViViVi !ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi B!ViViVi B!ViViVi!ViViVi"!ViViVi"!ViViVi"aViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViVi aViViVi aViViVi aViViVi aViViVi aViViViaViViViaViViViaViViVi aViViVi aViViVi aViViVi aViViVi aViViViaViViVi aViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi !ViViVi !ViViVi !ViViVi !ViViVi !ViViVi!ViViVi!ViViVi!ViViVi !ViViVi !ViViVi !ViViVi !ViViVi !ViViVi!ViViVi !ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi !ViViVi !ViViVi !ViViVi !ViViVi !ViViVi!ViViVi!ViViVi!ViViVi !ViViVi !ViViVi !ViViVi !ViViVi !ViViVi!ViViVi !ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi !ViViVi!ViViVi !ViViVi!ViViVi!ViViVi!ViViVi?\!ViViVi>\!ViViVi=\!ViViVi<\!ViViVi;\!ViViVi:\!ViViVi9\!ViViVi8\!ViViVi?\!ViViVi>\!ViViVi=\!ViViVi<\!ViViVi;\!ViViVi:\!ViViVi9\!ViViVi8\!ViViVi:\!ViViVi7\!ViViVi6\!ViViVi5\!ViViVi4\!ViViVi3\!ViViVi2\!ViViVi1\!ViViVi0\!ViViVi7\!ViViVi6\!ViViVi5\!ViViVi4\!ViViVi3\!ViViVi2\!ViViVi1\!ViViVi0\!ViViVi2\!ViViVi/\!ViViVi.\!ViViVi-\!ViViVi,\!ViViVi+\!ViViVi*\!ViViVi)\!ViViVi(\!ViViVi/\!ViViVi.\!ViViVi-\!ViViVi,\!ViViVi+\!ViViVi*\!ViViVi)\!ViViVi(\!ViViVi*\!ViViVi'\!ViViVi&\!ViViVi%\!ViViVi$\!ViViVi#\!ViViVi"\!ViViVi!\!ViViVi \!ViViVi'\!ViViVi&\!ViViVi%\!ViViVi$\!ViViVi#\!ViViVi"\!ViViVi!\!ViViVi \!ViViVi"\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi \!ViViVi \!ViViVi \!ViViVi \!ViViVi \!ViViVi\!ViViVi\!ViViVi\!ViViVi \!ViViVi \!ViViVi \!ViViVi \!ViViVi \!ViViVi\!ViViVi \!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi\!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi !ViViVi !ViViVi !ViViVi !ViViVi !ViViVi!ViViVi!ViViVi!ViViVi !ViViVi !ViViVi !ViViVi !ViViVi !ViViVi!ViViVi !ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi !ViViVi!ViViVi !ViViVi!ViViVi!ViViVi$!ViViVi4!ViViVi!ViViVi!ViViVi !ViViVi !ViViVi !ViViVi !ViViVi !ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViVi!ViViViaViViViaViViVi!ViViVi!ViViVi!ViViViaViViVi aViViViaViViVi aViViViaViViViaViViViaViViVi?\aViViVi>\aViViVi=\aViViVi<\aViViVi;\aViViVi:\aViViVi9\aViViVi8\aViViVi?\aViViVi>\aViViVi=\aViViVi<\aViViVi;\aViViVi:\aViViVi9\aViViVi8\aViViVi:\aViViVi7\aViViVi6\aViViVi5\aViViVi4\aViViVi3\aViViVi2\aViViVi1\aViViVi0\aViViVi7\aViViVi6\aViViVi5\aViViVi4\aViViVi3\aViViVi2\aViViVi1\aViViVi0\aViViVi2\aViViVi/\aViViVi.\aViViVi-\aViViVi,\aViViVi+\aViViVi*\aViViVi)\aViViVi(\aViViVi/\aViViVi.\aViViVi-\aViViVi,\aViViVi+\aViViVi*\aViViVi)\aViViVi(\aViViVi*\aViViVi'\aViViVi&\aViViVi%\aViViVi$\aViViVi#\aViViVi"\aViViVi!\aViViVi \aViViVi'\aViViVi&\aViViVi%\aViViVi$\aViViVi#\aViViVi"\aViViVi!\aViViVi \aViViVi"\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi \aViViVi \aViViVi \aViViVi \aViViVi \aViViVi\aViViVi\aViViVi\aViViVi \aViViVi \aViViVi \aViViVi \aViViVi \aViViVi\aViViVi \aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\aViViVi\ !ViViVii!ViViVi!ViViVi!ViViVi aViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViVi aViViVi aViViVi aViViVi aViViVi aViViViaViViViaViViViaViViVi aViViVi aViViVi aViViVi aViViVi aViViViaViViVi aViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViVi!ViViVi!ViViViaViViViaViViVi!ViViVi!ViViVi!ViViVi B!ViViVi B!ViViVi!ViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViViaViViVi!ViViVi!ViViViaViViVi aViViViaViViVi aViViViaViViViaViViViViViVibpf!ViViVi $ViViVi($ViViVi$>ViViVi+$ViViVi0$sViViVi2$ViViVi8AViViVi:m ViViVi@H7$ViViViP; $ViViViXAViViVigAViViVihAViViViiAViViVijAViViVikAViViVimAViViVinAViViVioAViViVipAViViViqDzxy@YwY}D>`G& n+vgXڟ|APHGQr3nVD6AhMuKbEI+O hi8T<}Ɨe&LiOk U~ՈWX?TLh+b 84'0R'_+vn{\d=3tV2=5Faш a1MzJfo5w' -_U[eh%2% 5;y&ŝ3>+fCV<-{WfBh:@#>&/p!abNT;!HIpyT$[<6U> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4^4 (0|0|lllLLlllNetBSDAPaX NetBSDearmv7hf3D0D 0p@-F+`fpywh+iK8FV "oȿ+aoXF`P;HYF h#Oc+a8K` FU M)hHFV0ZЛB) FU%jhR"!XFUV0 FU1hHF4 pCO FU1hH>F3h+)FXFU, I I#hZF8FDU.( DљnNsPlh Kn:f*oB² *IV񷹚mQeppGh&IFFH 4Jh3`pG؎-pCF-FK"F)F0F` A @FIF( e KA1 I H! {z"hpY@؎|0p FFmF@)F0F< H1F` ph-ApG#sFF `.=0FUfFX;h+J$h#@c`.2Щh0FUZ(C+I+H0 O$)KEp;9F.20FUD0*;h-+.IH$,HUF(ѩhHU(ѷ OH)F($ I$H O FHU.00+.|"K-OhFHUI UF(~ЎIH$x!Fj"FU$AF KXph+KJhhCЅK+@Kh+0yH U0nvI|H0FU"+nvKh+FuMmJ tI(F0;0+ PF*Fđ(F (0OU.؎XJEs#FAF  4(F39o"O UFSF? JF(F(O2DUB!BI$BHPAFUj(V ;HD0+H$)F0F2(J3I5H4E4J  ChF*Fl+I(FUBB#I#H&Kh0Iy#BFKFLO2I0FUbh00FU(Ff0+0FU, :jB(K(Fhh! U(?|hG؎ 0MF Fj@2iFUC!jH M0# 05 HU I H IhFUbFHiFKh(Рm8m|zFIHU( I H| hHU^FIHKh( F@ |zFIHUj( I HT h #HU0FIHKh( F@|z%IFFH8 KXbpG؟ KXbpG( I ,I BI YI o hhUpoCFO2H#"#K]П oCFO2H#"#K ]( oCFO2H#"#jK ]؟ oCFO2H#"#RK] ?#F "H<K] ?#F "H&KK]( ؟ KFh[ ?#H" K]h ( KFh[ ?#H" K]h ؟ ?#"F HKF`  FDIOr-C#BL#FAI88#V#hX;JB#CS#`#hY_5H#h4J@*D)71I b8F%F .I:F X=!6*F*IF#;Cx'I*F#"IF"hhBIhC#`Ch8FGJKFJ`! KC#C#`#`LKKIK( h ؟ #= 7Jd%?( y  8KLhMchk`#B#A khc`##81bh;a??xE][, ؟ ( KQKpG؟ ( J I hJ I hkF[ijG bj IkpCj_ iIG#j( ""C#b6##j"G??:Th+#jChm8@F3~BF F@"F= pFj.؃k"!0FhGI 6k0FhGbp1F FF IjF Tk2F)FjjGF:"iFh T:` Fp K-O(MVzLFF+N#mK 1FCEr =2DK2#Rc V#BsCai i3i#iDca.#RQ@F9C@YI" OU/ V3B\(#RСl'k jG??bkHI BFGHQFe(sFFCbkAI x:nh+bk=I'FP&2A&2 #9$2 B$22B2&2DINEB&2 #BB23B2U23B2M23BEE2?B#k 03ak#H0,#k[bk Ik FF :( ^hp*R*xBxKp p: F F*2 1L3 L L L L  L L  L L L L L L LL LB ў-CmL2C "kI T2CgI" T!TOzw aH! sT\LAqSeUls Euad!V#&%#######EJ 9 F T #RQ#C0[պO ajHF؟ hh 𵅰4L%j #KC3k!j DjG??bj 'ID#0kji!IG(ki!h[jjG( 5F #Bv#0kI'jiG0 O #BvҢi8F!h5FBBв.F( hmF J h!!B "JF\!FH0 -OFTMF0+FА8+BJ!@ A 0+>Уh!Hch#H####oH## #o"hH#H## Ma!@ B7 0 / '+ 0@0M0aܳгo$0+[ЃK0#0#+`O~KI~K0 #0 {K{H*F8+h!F۰O6;+`B=)E(0+I+h9FlJlH2lJ2 2:FiK:,0;gKgJhH #F0fHv)eK0 #cI;+`B*`)]I *`B*`)аoаTH6X h ! #f C 0+$03DK@C!DJDHAKOq>Jh/Or_Esy9FXF9ZAFFF(F8RFF F 8|FFXF9F9E1FF 8pFF 2Cq# @! #4!JF+FHH{4*D >k8'0 YF8F8 U YF8F8 wFFF=FH00+@,0+#H" $ph "40+#wH \Bw )F8;F1FF 8F FF(F8 #3 f::F9FdH!$hbMN*hh *h2h *h2 2C# @! #0FIHIKj+ xcQjVr:H !2F+Fx=H{+h/NOrWE{X-9FPF8[FAFFF(F8 LFjP(fk0Tk#c(F I" HN( K"3<3+2  pD L I*FF H H' Kh# I:FH Kh6̤  OF FB ;h)F x(8JhIFHH$oX4 p-OFF F0F hx'xx$ 20Fa'8F#*iB T20F( 4-hDB(FF(o   -AFxF FF!+&I0F8h!I2FF!HN H :!Fr:F)Fo(F3x F!+4(8hW I2FF H& H' Kh# IBFH-}$6&>̤ -O$TMFtkh;k`+%OH'LFF#ѫ@8^hHIFHHHH8"#`EK`ol&FF4F+hZ*`xf BC۴FOy  D0IF308"h.IF*H-H0;0+)Kh z 0;0+Khԛ U#K"`$ /Jh3`0"UK `0FE#`K hUh&FK`Wb p  -OFDFF; +--=`9 (|LO3;`B9yNxAF3h33`48zh0pIFpHpHT3h;3` lKh  &3h;3`+cKhԞ#i*FF6, "F+D,MFlL0CD< +QH=B00q308h i#U>` p V -OFFFF(H%&DB { x405BI%H x ^+\(\  HYF3( 5O500 x00 x00th$y8I"@ h#jF ` IS( ۽0+;J`0+;JS`] ht@ KZh B)iBHo -GF&MFliPO +iBkic!Ho Fki+Ж+i+$4tki+.,<ki+,i FFMF(Ыi+ #"#AFF8F(kiBѾ -CFF0HfoL0B̿H F FFB (F()i;F"F@ (-hLF KJh30 H-oa9 Ki" 2 #Da  B Kh30a8Ki@[Ho -CqMԁli p;xY2I +"(7p )(((iiiiiiiiii^.30-.^. LD"0x?.. .@ 300xA2@ (I8#EI "`CF;38h"+=Ho Fs۲20Z-.^.#O3DO3 1H8#,I "`CF;38th"+*..0/li*/YBYA0xB30z*К Xxpb;.0jikh`3k`,i`B,+iBڥO4 #Lc`ci3( ch+F"+b`h!Ѣ`!hch 3 c`x,) ;) +F"+b`F Ѡ` S0x;+`aBу ! L FF R .F3V˄E5F+/`:5F! 8F Fp8hpIFH@H F8##+iapB <\+9@  N0 ~3h8"#3`3iSIH($H4F6 (F 05F9Fc I F,/*/"bU"Zpr3iI" Fw $J1h8#@ C` F H  %;"@hO1#@; '8L`a1da, *1I @B"``3x S0x *ћ+2x.*rx *0300FF0;0S#h E" biF#`B#10;0+#hԛ8FF,F(o -CFHL#hB07U%B0ЂB"(FF8FhFca1(hAF$#10;0+_ hKMѽ*F9F H0;0+6o#i1F B̿r"((FhBF,8FF0FF;hh+`B]`00Կ#hȿpȿ33D#h  0FtF8FpF -GF3Lhc'eaBF"ܯB ݪSOO +J]00F30)F0;0+4#h N'* 0;0##hԛ=6h`i0;F'Fbi@FF+F(o -C F*LF FF 0300;0+:#h 2 L#i9B̿h FHF1Fh9F#i5p[9#10;0S hѽo -OF^LF'#iB̿H F0FF]ETh {B۷=F0Ou5D30)F(Y0hP;0##hdԚgDJAF10FSe(w0>3fa0(Abi Fo(:#10;0+\ h68ѽ(FF(K+ih;DB:ݳ y IF2 ~7hzIFHJH0;0#h  q0h;0##hԘQF*i8D5v+i-hDVo 4pF-Ljp/1QXibB?+D",(Fw09F30F7ZhIFHH50;0+#h  0jp;0+#hԛ2x\*rx6/*6 p-G#Ll2CЬH!YF on B;@B0 F5D30)F7hIFHpH0;0+#h C 0nP;0##hԙ1%@!"p x +8"B@B0.F6D301FT(0b;0##hԚ*Fo5h1Q"ZU8x!XBXAt!+@%+n nB"۵F0Oz  D30QF(?o0n;03#h?z?|0!xSU0Yx\)љ[xU5F~B.n BEE.F0FF6D301F(?30n`;03#h?>?@0nZ x1ZU1 [x 'H1n`+DBݳv 1F2 (?0n`;03#h??13Np DBvp{0++1H pp HF'F6@aCB!ݳv 1F2 F(?0n`;03#h??1>F+D++Q*>DJ1h8#@ C`' KF1x!+ I6 /! F2 H+  7KL0x +9IKh0xP1E *DH 30 *!i 0x!+0(0/HP-6u0)F307h%IF%Hn$H0;0+#h B 0P;0##hԛ# x )"TV(QYxT  pK-AhL0F E2Pi (x /9!ȲY(AY)><<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<Z<hHqX<Owb<}%E0 F+n*p*l*0 x + JHEE1 3h(o(FaiF(% F+n*p*l*0 x +1  %(`iE0EEaiF(% F+n*#p*l*0 x +1 (#B3caE0EE!)iah)Hv[x320[ Hn 8K*F(?r% F+n*=p*3l*60 x +L!i (Y(R(3x 1KN!0Fw(@lJ#1O3`J`5E0EE!+СH"1F43x+Hah)[x320_F(? x!+іH%E0F+n*p*l*0x +ݮ xH"4HVEEQ H!i (Ӯg/ G/(F(ɮV/ (  ( F+n*p*l*0 x + 1)F31zE0EEch+?% F+n*p*l*0 x +hQJx+?yPIPHsE0EEch+?׮% F+n*p*l*0 x +=22+?JE0EEh 3H$%E0 F+n*p*l* 0 x + 1 Jh8EE`iA( % F+n*3p*l*0 x +1 #B?E0E ey pEh _x(%`3F+n*p* l*03x +9FKE0EEaiF("Fn)p)l)0x +vB(%B0BBaiFf(mu7(fch HNh.$#iB? BuۮB% F+n*p*l*0 x +.1 k0F6H#E0EEaiF(%"Fn)p) l) 0x +BB0BBaiF("Fn)p) l) 0x +جB`B0BBch+?N% F+n*p*l*0 x +2^Kh ]Kh2E0EE#ch+?   F;l; ۲+  x +1+2q/iO5[x320]ch #i`3F(?{% F+n*:p*0l*30 x +U1 !3x2!+ ,H"1F43x+1+?4&Nh0F(J?J#iB?F#1AE0EEO%.F0xg*M- *=0: *,6 "9F`@80C6h"+>Hb t& p*"r*#-0x *-[x +*ѥHٻE0x +2H̻E30EE2E#2D#20b30 i`F0;0+#h  ZB (x]#b20;0##hԞ-ArIm(~!2C2 xn+Rp+Al+IaiF^(e% F+n*Lp*Bl*E0 x +?1 |!D#!2rCH2Ճ# #2C22 2C2CE0EEaiF(u(ch+?h.#iB?u% F+n*p*l*0 x +˪1 0FӺE0EEch+?:% F+n*p* l*0 x +E0EEؤ Q)300 O5%x320Z:F(?!ich C73 F+n*=p*3l*60 x +W!3x2!+ ВH"1F4 3x+1+?;NHI#W/F0Fb(K#iB# 9(?E0EE1+?12+,q(o$ch+?  F;l; ۲+  x +gHai `D(0x1;+"Fn)6p),l)/0x +ҩVKhh#iDBFV6&QI "OM`(`@806h"+IH.`B0BB%E0 F+n*p*l* 0 x +ch[h4HEE!ich+?](% F+n*$p*l*0 x +` 00F2+fHyE0EEai `DF(Mh"F» H2oC $ PJ@'HS+]pG x^+0x]+0x]+ +[+Dx.۲+ JBF/F])ѢB F ) F o-GFP,F#xB +.eJ BS@B4O.F6D;h1F3;`p(76hk,IF,H:+H;h;;`)Kh [+\+ 4F( Ht&0Fcx +HF H;hJ`;;`+Khԛ,a*F0F4LK"rU@h+)F0F #G p OT ,Jphx (*H# ( (L01'H0 Y`[x +ЃBMF pL0Kh۹K&0)F`KhX(J@'000a 0(6h IF H~ H  k p-O_N`L3hZ2`Yx%)"h5\O%|3hxKEX EF۵F;hOxD3;`AFhP6hdKIFKH4KH;h;;`HKh xIE33`CHt h  N;h;;`+0ԙ3hZ2`x"h +SU*3hx*P;3`B@B'O.F6D;h1F3;`(;h;;`+!Khԛ#h"`ZU\+'3h5Z2`x"h + 0oKh+jXX(Н0D< +?Y 0#` 0]FO 0 p  # MF `F`*hx /J`##` (+hx *кB3+`+hx1)6$I "`(h0`@806h"+H4`og*3+`# 0 -OMFNF/h*hh0B"ۜB@BO&F6D:h1F2:`O(;h`;;`+yKhKԛN+i"U=:x&*^  Bܤ KFSE*iH۪ Eȿ#FD  {2hYF22`6Xh]IF]H]H23h;3`+o FSKh  3h;3`+JKhԙD\3PT\*Yzx 1)S0:BOX E ܤ KFE*i5ܫ Eȿ#D/O q:h2:`5h&IF&Hp&H;h;;`;h;;`+KhԟՒD\3PTFB@B2h'F7D22`9Fn(?Z3hp;3`; Kh?j?l +iU440 p-O} FF#/(Kh#!i #"#i"# aF(@2FMF`h7Bf  E?`IDq(i 2 5DhIFHH : Kh ( : *xKhԙ0+ # " F>(i!F0D3 JF F[hK>o HF }  E!IDq(i 2 ( : *TKhԛ0+# " F(i!F0DNF3 2D!x)7DAK? h  EO QFOq1 Di2 U3KH5hO0IF0H/Hs0;0+?RC#" !Fd(? 0;0;Kh?4?6/ 2CH:Q Kh+# "9F Fx(i:F!F0D3& J+i# K hKE &`S`9Ho h0 `T:FFb >!hFH(+Ji +hO 3+`0FF+h;+`+"Kh A "hFB+h;+`+Khԛ&h  XFF$F(:F1F0F(  0 -O[O[N;h3h3sh3VH^oSL#hRK"`T R $0(F30(<+ # # | FOl E ^AKh .3h0sh;`s`0;0+a7KhV  R2 ܾ' `FSXSP ;Dhh0 KhXhhh`X`KhhXh`X` hY` ; =?a [ D -A &M2; Y J#+`Kh`JhZ`\ Y/ D+`hThhB F FkDF#FD  -CF LFFh"hB#hO bh8F P#50Fh`0Z"`d1  "`3(Н IF H H2`h D p IFFH  -O]NF FF3h˹IrhK* FG()FH ;pCO5#`o `Ob)F3oB5?# FP(pCOгhS FP(pCO3hkh[+x/+2(FPnH)FP FP|(@B3h+@ހ!F(F4((8H"F)F `(#FyJtOa\otOb!F `3\ ` F(OakJ `@ `P$(fH)F/!(F<勉/! F6G9F@F4FX3i+@׀si+XOX8F1VIX"F0;0+@F$6F88F (0F'F o3i+@si+shoc)FF[ #FOP oEE(.#=( ]`PF(ѼB&.#=N ]`P((NqBBRBB= ]`ZF)F3 ]c ]`JF!F3 ]c 3i+Ksi+u!F(FO (Mi+T ]WX2-dL"#kG#cchCw3B+ ;hS"##\0.+ѻi3k B8F +ˀmsEsBs 8i B8FBs h0B_Ѫj BF7H0ҲCBF#  A h+ii)Vi&J ! X i(j)P+j J ! d XF3 BFPF 3BFF8jpI\F3BF3DFF x NF(ѢF(Ѩ 0YF(`>QF 0(Dh`6:jJ!F0(D`. FajQOsEq3J!L34j(+?KBsD( !J23j-+? KBsD-;B//3VUUU-OFNNFNJF!Fk+"RFF b!F 7h/(FOOk'(FFx4,h(F|4&`4"h+[1IP0;+R#lYllelllel%H\ &!j`jFXF #sal[\0.+ѳi+"!F(FX3l+sk!jPFT9F(FdF Fk+)њ!jHF<#scx g-GFhFI L4 1(IjF O| 0 J`#3O|#ah'%O JFAF0F8CfюKbml C"mCЊH14K`m3 id#eBaoCC  Co C@M#hE+c)@c(@G#*j+[+Z oKc`l+@rcm+@ph+@n"miKiI* F*F#c.e0F`i#d1G+HO|WdotO #ã`#d#3`ce3m3Oe`#3ced&#`#3cedO3e#"2#Od>`O ## 0#cf%E#c#cE #"cdff#cdf###`#x ht@|jezwF#`#Oa' 1#'cbb#cb#b#a##d##b##g#cg#cd#f#g#g##a#0##0#cdE@\+IF+H  E$I8FPj+[b#hA*ѢEEK#n Km KK+++KK#n Km KKKKKI  CgQffeegffeau=yu8FKh<jFHD\ D8 r8FKh<jFH D\ D8 rl\m!J@A DOb!FN8C4Th IFH mBh@AiJ##THKJhhC F Kh F!FHhtd K\hjHOHFO dhhplKJhhCKAh˱K "!!JCS!b0I HLpKNhK*FKhU(OsAq3F F0Fp@Oɺ   Kn:f*oB (КmQeppGIOhpC O س_гO I * @O г`O% /  | @ = 9K-AFhmF,#4HF3Kh۱3Kh+5 #"2/K!#0,I X+H9FD)K)JhhC40F&KDhC%KhKhpCOѨhD FKJhK) FFKh<OsAq3FF F@F9FxK0Fhv焦   ܦ  hF`"K(FF  BKh[5B I2`IYBBAI[bBA5B 5B 8Fh82;CЪi Fij h-GF ~K}Kh F`&h@@@ 2;C0m+#ajoH0mKh+| "''KiJCS!B0dI i ܦ  FFFhFmCF L K!hF/ F(AkD MKca #k`S0O0jpCObi BI_'@IhNp##a0`+@:K:Jh`:J` #!#a*`*@1Kh1K.`O8#"#h0b??3h+$##aY pD//EKh.A2FHFQF2C9K# !#a*`+c##0 dS!P nm8@ /%/^;NOFOA1`Q F CF"FHFQF2vqhC[ѻ4`O S3`/6h/o03/P$KOB`OF"K`*?W0GRYBJOS` GQPBOR GQPBIOR+ ` )OS)`Kh(ORO  KMi+ Lch+ݠhOBiFM(`` M0 #LcbKi #"#h0\ F 3Jh O0h"(0  Ki* I UO0h(K JIhhG0 (LT! ZFFF$*F1F8FMBD-D F,FFFF$*F1F8FMD-D F,FpFM Flh,Nh1i)FMJ#s`hB`3` FpM#s`l`D3jJh Oj FI0 FNLeh- FFhBFJN#cbs`(F7isc`?/f(f3h +P?I #c`%( +U#"#h0z LBhcs"*(Dg`#s`cj+L%-I 3h+ #c`3hE+#c`3h+3hE+cj+3jJh 3h+3|h+3xh+(-K'gbw`hYi(FDA I j I3 I8F0 9T!\4K𵅰 * 2MjhB1Jh:*0I  O0ZhZi**9"Z`kh+ 'Ii!`* *"i`Z` !I *@!Y`B(݊BOt'"#h0)"F3F16hf0)   I#hM(#k`Ot0 #m(O-G FuFFO#;!Oxh(.9)0!h0j F)"I9$BqF F!h0R) 2 Jh O0x`a  0+W0 F8N Fph(%6Ki+<+-t]2I 6-qT#'"h0  2P)Jh8FO0p`Bc+ڳj+!I"F!h0),22Jh K-`t(F!F1\CII#h0M(2 Jh M# s`0  m)-O]zOzK F:hX*FrtHV20[bS#"F20+:;h+ʀ!0F##eJjV|dK:FV<1`J;FLOqV]JL3FOQL,@XJXI(Fh ]t0ӱQK!0F##GJ.MJOQ $茨1 팩F MEKh;h+BK!VhAKBF8FV<16JCFLOqL9J;F0 4O yh&J1Kj!0F:J!@FI  1  L1X FJOqHFJOQf猨1쌩F Mg,k0 NpYvLT!  = T!  -CXMYNYLh+#3`30 C#i+NKOOh8h MKMI8hh28h.ThIIhMtFhjpCO$2C`iM `@Kh+?Kh+(h(!M|hM(h("0 C #i+ ,O2H9h)K8h"`.O3`2C#3`)O#3;hj3b0 CML+h# h#+`;h۱KHh1塀KOR%hPOI1dF F(FI . h. 0 T!$T!LT!P T!"T!* /T!xT!-AMI L(2Jh (" L(2zJh xMyLkj`+\0CXH0#rKsHhagiqI8F1 (oI8F1(#i3+j9F=hHFgHCgKh;+7eH;]O9h@F4aH1aH.`H+@A:(\I1й9h#ZH0O3k`WK"`O60F MSHRHRH0 OH s+ S+ Y+`i(aiHHy+FH2O@9h@FBH@A(4I1(Н0:H0#7I j5H4I1z3H1@CB/Ht(8#'I0O3k``a#H,T!<V0 LT!t:T!4%Ce6PT!_KFhC F0O0 -OL =OOu-Kh+,I -<,()I"FH+$Kq"hBFB8 I O0*(>0+I HOq$&H!FiGL#(  W) !FH J`Y   lT!-OO 8M$8H+hFFh9FYFE$кXO;XF -I (L)Kh+(I(I FO $@F+hAF#H[jGF0+hiRIJF$HF+ k!F@FG(HFKh+II j*hi!k HG("2"T!   +Q/!MFH$F'p1FH.h/##p-K)FJ O0 MK0Fu")F1/#X;9FK JE|#p  hF;`+ MhZ` "ppG-OMO3F+h( (+hjG(+h kKhFF+7рL4 F# FF( F((O3uKh F# F(.@΀nI" L~kKh  (ڨ Fp(оbK4+`O"FL(28ZJh P ;+! FyKHIH#y/+ 8KH1JIFH+/ F FEKh+ F(0K@J+hZFKF F(O +;hIB FlG(UC F(2? F(: FF('! F(!#y/+ 8H0IFH+6KBFHKFlKd0[1Jh ,;hjGI" L aU#AW(T! hX,T!-O/( /[M+hlG(+hjG(( 8SKhF[QKhL01OJh MKhùMNT+hjGII" L: (ڷ ++hIB FlG(8KSA F(0KS# F(+Kh+*HL((O;h C#HL찹:h0B`CXRhBAKBA FG(! F(+H+KBT!hS!lT! ,T! T! T!x  h T!#y/+ W8tH0ptIFH+ qO0:hClHLt0+g;hKB`CXRhBAeKBA[aO;hKaJ+hTZF_H43h [Kh ZKh+ (;4+B +@;+9OHF+5<1YAکP;h+?ٮCO;h+?Ԯ(hK"`>J(F232;Kh+:z(90+?R̐0+?K.Kh#0B&HL(00;"KBAKBA%KH4+> +<;+ P( H.PPT!"T! ,T! Dh x $T!T! T! T!T!T!pT!lT!x"FKb( 1l8Jh PJCFh y 8F  (+1$S2J8h _O92BA BCX0)sAF8FD(O9HFYBCX0BB RICF(  K( 1SJ8h BBBR ICF(|T!  /VhpL-jMN)h hl( #haDa2Br2p 3h#b (ۄK"O0` T!0FK퀻Oy$# -w'.BCX0)s0F-w6Kh /CY 02J#h @I#* .32C O0 /Bw0F*F(WJ0h 1cE D-gw*BCX0)sۘT4B IXT! -AFDL- #*s&%' h0B@!DAq#h!Fi*F.F+Da0B BA*I  (%K"O7`#Kh#hB+Da'8Fua(26DBr2#h2FF.F3DaKhYi)0F)(0"hBDa܈ (-0 J#Fh #O0 FKl(Kh,0J#FT!$T!m𵯰FF6F4#g##9'N3h&Kh  FKZꀻ3h[## J!Kh[##J!iF FK`0hN+0~J#Fh /0t J#Fh -iF FKf0MbpF FFK` p2F)F FJ(Kh,0BJ#Fh O0$T! FJhKh,0(#FJ@h e$T!--GFxFF/+O80O/ (FO /!+F(EЀiF(FK`@(Fl0/##piF(FK鐻p@@O0&Kh#:F1F(F!(FKR(iF(FK`(FAqa#jF(F`O&O0`T!-GFh#x/+ 2Mhh(1I"v#k`O09 "G@AK0UXH0#h#J3h N3h ;'0`!h;FBF1$(0d0C@$8F<>( K$h,4 JQF 4`DS!J$T!hT!-AF FFFFK(@.Kh (BBBB#I2F O0pCOI F/fh FJN(0J#Fh 6 FK(/ !F0FJX(0 F(/J3FAF T!S0F(4pCO)BCXSh(s RRBA## E `iF(FKN0pCO  I*FdO0'0#"#iF(FNSF( P Q# 18pG-AFXUd>J|(0\>J3Fh 08`AFF( J#h&F`FJ7F`!FKJO(FAѽKhKhZQJ)+@K`(P @=N hz(;S -a--------------------------------------u{------------a---- K----Q--a-[-_-o---------- -?-`2K(` 0I $0@` 9+K*Khx-*)JYx#``#%K"$K%J`$K$K$KKh+"H(̀K"`"K` 0K"`J#`J`J`LT!\T!T!|$T! t&D T!H T!tT!`T!PS!dT!K Kh(C xKK KKJ030Kh0)Kw E  0FOWF Ip 9JhF; F Z` ~KJ[KKRKPuKh(?^uK|JI|K}JF{K|JCyK|J@xK{J=vK{J:uKzJ7zK1eKhhK1xK+xKxK`KhvK #0'sI`*+?oJ`oO#< h(RjK"ZakYL#h xCfH+v `x cK#`bKL"t7^K`(@@ h(@'WK"`VI  ;6%hPI(F.Z(@ch+{a4;i3;aII.L(}i4DIHF.>(BIHF(@JF>Iv| EFO vF(Ѻ%(F.IHF. h+?bJF*IL(FsT!t&T!T!H T!\T!T!xT!mD VLB8.$HT! T!T!hTT!PS!T!]N`I-@;i@FO 3;a}}I"@F-塀;i3;a%(FO F@F#a")F@F(#VjK#FPyi"(F4(#!(7F ;W[]%hXI(F-X(c`h(?4!(ǭ>FRI-F(Oeh-?Ю47FQF(F-:KI(FFP*Fph(!{(ڣ>IHF-$p=I"HF- ! !HF7N 0Fe(?![(0FYF(QF(F-0F0+*F7F4!(FF%Kgz;`"J!FO KF(FAFL3I@J `K`K3@C‚:hIHLMO.@I0;0+򢂰1 ]h$T!nǹ9z*πGEAKN{Z`{)/5;~  &)W"FFK(`? I _7K"F`K"F`KFhK`K"F `KJ`K"F@`K"F`K"Fv`KFvh(ԮNKHh<#/Ffa*Тe_  ) {J!`zJ`0`vJ`wJ`" sJ`sIFfdKhB(FVmK"FV`kK"FF`iK"FF`zF6wT"0aKL#r`K`F6d  \I\I\H@#[IXH`L#XIUHZTIVH0uAKUJUUK"F&`@PK(q LIKIOrF&%HK"F`)KFH0h-0O30FFL(;I V.Kh ((F5K"F`3K"Fv`1I ;ɻ/K"+KFfKh>(Ff T!T!t&D T!H T!T!T!dT!`T! T!T!T!mT!T! T!:@T!T!c UKh2(FVwQK"FV`qOK"FF`kMK"FF`eKK"H`_IK[HKsAKhGKdFKGJaGKjb# `DK3@bDJ2@?# `AKV#2c# `IBF?ea3aKhR`\`g+P+S+G+8F: F!3xI2F0 p+ s+aiAaiAaiAZha(T!-AFFFx;I O0 F IO`(F, Kx`h`` `hTaF[T! K M N Oh#"i 9F "h)F0Fd#diT!p0Kph[UD4-I"i h!B"a p(Jh)bhz$* УB5$Jci F`}#4p0b ``I mch /"p#c`O0ch/"p#c`&h0F, `83\/+#3TO`#aDF[iB2I @T!T!T!T!V#F4 Kh#i!hy/+di,Kh@ Kh Kh@ @B h9F,( h"9F3D((FS(# O04T!T!T!F_KFh[y.+Cy.+уy/+˱YI(F *FF2x)Z*,.*,.* M.hv#y/+ cy.##q.9I #+`.h  5C!F*F(S4+;+ CA@F(Э CA '8F,aF8F&#h;#`  T!7S!LK-AFhF"F%F;8FFe(F,|(Fkx "x0;0=U F5`,n8 ([ P E :  #^0`v.+O0- FF"x !cx0:0;3D+N4sa"x cx40:0;3d"SClssa,090:"Dsa"Fcx 09F31;3a"Fcx 0;09F3`"Fcx 0;09F3`"x !cx0F0:0;3s`F@0O0 d3FEM/hS@=I:F =I# +x##a l;x{!F8F(%2I:F =/&a*c* C*M* &iFm*&iF$I;F { Fz#iC#a#И0@F(IBF#iC"aBA I;FBF P FOg#ca Kh` ``hTadCT!-CFK FFh@=,W! Fѹ I  h(BBѽ@F#eG$T! Lch !@]``( IO0T!CK-OF_h/ZX4+K84+FB0CP@ShPF,^W!F\F LF#BEBB) i, F( `U##ca9G&@ ) FI zO0!h @@B*X4+ ## 4i;a+i h0] FZ T!@"K-AF\hS8$*-4+);+&B0CX@0F, T!@U 5#EBiBB F+ѽ h0 FA T!K-A\h&T4OV_]/Fi8h8F-ѦBѽT!Lhs!LGPQ`0I O0JKh S BB L h K`0,#h Jh ) hGt T!^DT!@T! Lh !@ `( IO0T! L#h !@= `( IxO0T!P" 09@ @B-O[NF3h+B C PO0B0C XPF0CEBCO#CFGFF(Eh+:0AP"F(@BBX"(SZN (IhxaB C`E`B0CP>BEB<i  BE""C("FBE/ X##h a` I *I  ##T!Z Li !@= a( IO0T!-CNiñ%O F@Gi\Yd### hj5BT!-OF-F'K0@=HF,X! FSFYEHEBBЛj+0 (F `v(H%@ FI OT!-AFKFFFiԱ@=F,T!@jBEBBB(FO0` h F T! pGF!KMFFh{x/+ iF8I*F  MF( FI*F(F `XI*F  F M@3`## ##07Kiab``S! T!-AMNOilcha3h cjh h\;h C #3### h Kh!j h hM FJiT!dT!@)s¿@9@@!F$%FB["B8F*0D1F F+FpP%5 D-OFHM@,}ЀFLGRXk1F@FT @FL$O #hB-Фi, F(q#"#*)_2FAFBLU&`##0S' aC'@;#*#BB , Jh #O0 M2FkB,J2FAF+(B`CXShBA  , Jh  F,JI wB Z r   T!-CF*KFh7)I8F] @"W F5 CF(70F6F `p(F0``0G(@h,!h0F+(fh(F1F+(0F)(F``( I O0LF0F FIT!   F KFFh h@"T @T!h(F+0ah:F(F*0`hT!pF%)O0BB4.3O-..O -HTHTB DEt039TSBD6# F"D0!,B%CO0 p T\TlFF0OpB DB0[(DDK@,-A]\FO. * F7J#hBD",x/+61JkF@  < (EO0 ]+]** .& CDl+F]3D,?*D+FV7`\&JkF@   (JkF@   u(ڹ JkF@   fB J U c pFh FF*F3e-p@(e"GEF)F h#(F#`3`pF  FI n O`!KhOp!pGO`T!0#L#`\3щhY`ah3!`!`h(̿  0O0 T!8FxO08I"+ Kȹh2"` I"FOqF(F O0"`  -ANOtdFȱ%h1F(F+dh 9F F+xI#F*F P K J I JO00;+I#F*FK"`   5 T!-AFFOq0F(O0BB! FU,S #840K;+dK@A@A ` @]K "dFBH]"F (lQ"F<tI" !@|??Dy`" !2B`BPBPBK`PBpBK`PR hK`B 8 &2)1)(4*1y/)CCC"(4#$84K+!ٖ(4/5)#4(4C C(43y/+3#3q `/"CC$"8$K) # #4T0}hYBBU`!BCC(4BCxhX!YBP`B!B T!T!-CXŰF4;+: 9("((Kh;%(FETI( TI(TI(TI(I(`mB#I ! pS! pG pGpF.xcI"0F+dFI0F+vJShi CCI F#a"FGOqF(F0BFI2F O4 Fpc T!k  -CFFOq0F(O0BB! FU+2S#84Yq_@FY@B)t/#DG;0K;+ٝK@I@F{IF8D ` @Ko "dF" ! (|OBC??P" !B`BPBPBK`PBpB{`P)K`#QH1("tF@Q#<1 (1("lF<YI G 06+ 0+٣3*sFF/%g+أK*~#4BCXZBI,"I#(4CC x+IJ#4(4CS(4#4(4CC(4#84#h;y/)#`#q ($4+I BBBR($O ##F4"FFQ *K# CCG<#G<2+($B B#($4#BB4#($84JRhK+ # #4BCXZBI,"I# I JK+ F IN J I HWT!T! T!    -OW}F4+1!+"РFXkc.BݭK[h+:.d>FD5F6й/ѥ++JѢIBF;+OFF|ẖ+ Jkxl<+=+/ Bkxl|+#F Kkxl&+#F Dkxl=+!#F = jx+*k' 5jx-*k( /) -% +# )$ '#F $#F !,FF  U!RU!bU!U!FKHhU!Ks[hM.h+`K.`0FH"xK*F*d"` F(F F*Zhx*Th3IxJ\ HL3(F!FpU! b!R pFFF#- _iXfm {6E'.2~ t=HR;HO(ѳ??6H ,)BFFp) FIFH 6F,L hCh;C`+ "hhY` " Hp@ {hZ` V!`V!hJFh4,!` V!FK aXi0XaO0 F V!K\i"a"FiF aDDC Kh3 K60 F! ( (> V!\!Kh "` hV!RK` hV!FS[))Fh FF FF)2F)Fh FFO0R FFO0 FSK)t!Fh@pG8 FF)f*F!F8@hO0R]pG FFO0 JF0 H ! J DHBѲBPh2$V!KhpG0V!pFCF h( ")FC&BF hC2&``h( "!CCF`hC$f`(FpO57MH+hhK"6 N cK\h\-h Kh#F2F(F``hBB $h F0_!0V!`c!sF$N Fh+' !8<#XC`h(F1F(0JF! Fg j` g++ V#x6+ cx0+I" F&Vhp F(."D=0+<.+(F"pN@0V!\bK"`"apG0V!F #h;+h "iF'[h#a iH "iF" FYh)dhhhh a0L%jH*F!U00* bB H!U0 J#jhy`q j0 jK#b0V!d(lFh+уhch@Kh"hh3`c!h-GF!>O0FO5F;h3;`hFsh@F+gF4K\b;h;;`#2Kh h1`h#hhF( -(FC)hcF"Hrh@Fah:";h;;`#0 -!!(F +C! {`h!- PC$h`h!(FC+[ V!0V!V!f-C FOF^0Pc!N!h)3_{lCP rJSb$qKh +πlKXj(ʀ,ǀ `hAF^0hh, `h!^0sjhC$&`h!^0+h+sj+SKh L)F Fje)F F@YEKh 0)F Fp0 &`h!Z^0+h+sj+h,Xtb4Kh AF F/Kh AF FN*Kh AF F%Kh "ioK"Zb`h!JSj[ Sb`h!KZj*"Kh Fv")F F H K H s +0V!a!_!{-GF!K!(Ft&hbl` @EF ~K^bױ ^0khD(F& 0+!F b!0V!(-GH(Mh7%L $K & hh0*x  0;Jp0+k +0+xF;F=F +{#hF K(FjlKXjK"Zb0V!\!-AF!LF&i3ahh!%^0hh+#i;#a+ #`+ "i:"a*#`ifb;a;+fj*hcj * +Ѩhhfj++0V!-GF4GLF^`fj  oh/[ `i3a/h)i0+/7K7Nh0S 5H h 0hCh;C`+= j2hhY`="pxh 0hCh;C`+0 Y2hhY` "p0h 7"yhh hAF^ fj"h;+#i;#a+`?h"QF8FhhhZ`hZ`+#i;#a+`ifb;al0V!8c!, b!-AFFh`h"0eMh,4h #'hdh3i0F0YhN#dh9F0kj|hj^ R"h *9F0kjkbvh#F0V! b!-GFhF2h J 0chSYKZMhZK0hp WH 9TH .SH (hCh;C`+3 }*hhY` "p(h [JM.+h+`%! F&RF!FF(=.HFANM#sb+h;+`+5нIF(h " 'hZ` ~((+h;+`#.Kh h! `hGl+h;+`{. .'!Kh+нGKh+k+h;+`pb#Kh 0+Уh+Kh K0h a H ^KGh Ҽ8c! b! V!0V!V!OKpȰhh##IK0۱hñGK &GMhGK0h !DH h BH =Kh !FX5K `:Kh $,5K"ZbHp!F(h2F `dh /H 'Kh b"K!h)L !#h3#`K`h #h;#` LXh#h 3#`K` #h;#`+ H Kh +Kh+Kh+V!8c! b!V!0V! V!V!#O23##KF F^0+=(;N3h33`x(H!(F")FFK0`h B! |!(F B`#`3h;3`#Kh s"  V!V!K-Ch$3 KM!hbKh,`iK`[`hh(@N%#i F*F3`dh,"N'`hm`h4#ih3`(m# `+m 00+h`qK60KlKi3 +¿S< hK0+T +'cN,@$hx0+x0+1YKh+@3[h+NUJ!h3`[h Z@# ( JHdhi F:F)Fxdh h2 Yhh`@Kh9K0h ^d='O eh9F(F#F`h sCh;C`+D hY`5Fp{(F ^$h,N $,X#Nh0h-[Ch;C`+_ 2hhY` "pKh WCh;C`+ hY` "phZ`hZ``c!b!0V! c! b!_! V!8c!GM(hCh;C`+ l*hhY` "p`h $hhZ`"F)F 2mh( $hZ`#x04K eh:F1F(F'65$h -KB%C FF;VF˼-ѐ- рx8 Kp(%F (  m0 +YD#x0x0+?Ȯ;+ JB?JB?  $Ji*x03+ (x)9) KB@3hF3Qx-(Hx(-(ъx*Fh# C + фK"Z`h`@"` C O3~Kk }K!h+ (@jwK+`vKh3B@L h +Y\#x0xiL9!`` gJh#c3`eK"`#dJ`dJ` bbKhS#S G`b WK` [K\J`\K\J` # pYK`MK"Z`* cЁ3@ BKB@5+ @KhQ`hR`"`+@[!\mCK&0++ѽx0C[hh;Kh"`"-KbBZGF)(= )K` 0K`$Kj*Ob@F F  o(~C&K`&Kh+fcc(^ Jh;h`3 FFH}Kh+MF+(6Kh++J bB(c$0V!V!`c!_! _!l&|b! V!V!V!+ KKXjhKBh +` K  j^ C #F L#cb +@ `b}K"`|Kh+?,(tKj;B! rJ`rKh+h W!jN FA &5F"+h `#`Os ^L;3`3`#h3#`]Kh`\I h &#h;#`#TKh +!(-RKh+&  IK!`JK`JK`EK` >K`?L& F+h#` 5Kh +` cz X6J`6J`h1K`)LB &i3az.H & !Ji ;ah L3` K F`K`K`K`+h #`K`Jh;`S Kh*""GKXj  0V!hV!V! V!V!^!b!V!V!b! c!FKh+ # BJBBJBAK!h`#8 "Lj+ ! !h [jS Kj FBB,`h)F $h + `Bt `p ClOB H ~V!GJb!V!0V!hV! V!KipG0V!KhpG0V!JFpG+#!J F-hS`I*FF HdV! -AF F*tL$>Kh3"1FhFFKah5H 8F A2H 2H )0H1F z.Lk hCh;C`+C %"hhY`*"p hCh;C`+9 "hhY` "p4)MH o1FH +h`h3+` !FhF+h;+`;H Z WHKh+H1FhZ`hZ``c!h V!V!8FL h0*xxB%+`h8)F&(48FL h@x+xB)F&`h84\ K "0%h I:0Q;+г(,۝rhlV!-CFL%dd#h3#`|-#h;#`Kh˱C0[ChB h;`8h(5+0F V!V!lV!"K-AFhO6Bt%3xF+BQ:*(l<:+5:)lM+h+r.` F.`F*%*q H9F(.F,F,Fs$`c!-A&MX+h3+`|.+h;+`˹KhA0+ #h`h;`  FJ2H(tCE?p?-'h*?e'h*?_'Y!F8FL#h3#`!0F6F *O   "h:"`*Jh*?  O )  `c!6 V!V!dV!-O$&F'FFFFO H`F(1   !H ;C3CvK &O h7FFFFh+@oK|BUnL h i#h[kH% (Fb=-R%HHGHHGGGGGGGGGGHHHGHH#O O O '&$OSк)Vл,!FPF5J/0KRFXFh3+4н 03C,? &Kh+/I h `?d!XF(а0+R#II?IOI,н 03!XF!P P%F,_!lV!V!`c!p FN!3h33`0F+ +@h +#kh`krhc`3h;3`3Khp@p V!V!0LFF#h3#`#0 K>00 ](F#h;#`;Kh#0@0 V!V!!@0+@h t -OOM FFFGF(FX!hM xc+7CWIЍHp(v(V('O&&/<ЅH+hh+97F+h*`h,l F cHc&H`H]!Fa.+h'*`haH' t~'b_!fx>p`c!L  =@-OaLFaMF#hF(h#h` .؀.:.) .c/.*TI h: `*OkF *Q"sNsNNsNsNsNsNsNMMBJ z>N(v3h33` hxs8H F"O &/*ј0/+ QF"pAPF@Fj,/K :* Ҳ * 2h:2`**hQ)`2h:2`* *hQ)`ZFB*` B*`V!\!V-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`e3h;3`+;h+"#caFh[aaNOcihHhBȿ`XhB"3h33`:ci3h;3`+;h+WV! V!V!V!7Fx F!+$Kh0 0@+*+ Khh"E;S/ x* 0; +&&# "` F(F&h+x =+T Kh-+x+KhBۛhD9)A+. *FqBF*FO B1 5D;+J :* Ҳ * : "+ &: [@ "FV! V!V!0V!V\!EK-OF[i FK G`kh`h`>KF&ZhVh0 0;DE #x+ D`F xɲ)K `(F~&)AO 0D`lh `h`aTF E#x+$Ё+@F  F! 0H! F@F!p H!LEF(TFF &FV!tc!(V!0 M L Nhhha#hh3#`#ho`;#`+3h+3V! V!V!8F%0D)FF =KjD``b8V!) FOF{;2F6h#9F`F0FFahhh%`( 5`.F*h,`#FFF4`&F#h+%`F! ʿh1-OO FFF[غ*Tк?#xGк #x+4#xSE4T& غ\#x+4!xCx$ x۲+?b+ cx;@" 4#x+ #x+4Ax#xQЙB4+4;Cx+*+Ё+*xҲ*?+[+ѠFF8F?*И 4*4"xB)Ё*FbxBИ 4B{x+ѮAx!)^)5у[x.-?l]-!)^)&ц##x+ +cO x;xɲ)@+?J[+5FZ:)5F[;F>F#HI(F(ШBqx)ѱx)ШB)x?JQ\ BB # pF K .F;]+[E?,7F4`5BЕ  85qE8+\+ F)x-)&ix])#Ё)\)5 k"# p( #6 d(ؿO 5BO 5F0+?ٮOFDFJR-OFF F"#x*+6?+4[+=cx!+^+ѣxx./](@[($Xx:($Xx^](/(3x:+ѳc(ўx+/+3F:(ћx]+竱/+"(3x/( P3狱x(ف+4#x/+:4"TL+FfjxxҲ*ف(1 x+ 1B`j`j)@(EL $BICBx/+E#<F($0B/#<#x+5&kCFF xɲ)ف(F08F./#<x F1xҲ*ف( F+F+AEӯHH& 3(F/+*/#!F<8FF(Z{.*Ѻ. "@F(.(F$3V!rV!FpFx3ɲ )F &x<p,XpxQ-ً,p+F F,F+pFF$M$N`hF;C+j`h`#F$h+b*+?+[+3h/j33`kjK$oO`hbahhjhj#kb3h;3`# Kh +jB"`8h8`Fh(V! V!V!8FM8+j`h`x,b$hV!-CFxF0۲ +عB1"FO FxV*F !F%FU*ѽ>L .++*- F!xB`   =) ЁB MB*FF !%F+D%++2F5!FR-Gvtv F FO#00F !2 6F0и/ N F-#<=O3h;3`+K|\! *-OF#xF-+ F +@򉀣! *|L[?+v@+0; +m%# "`0FF%h+^x =+Y.@!Khj-gNMLx+E\ ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xpqK&qMԡhBK yc0fO;0+;hZ:`"yp6bK_Lh!h& `^K^K^KC;`#yp@-VKhOJ!bh,KMW;+x+1+hGN;+`+3hZ2`"p+h;+`+3hZ2`"p;h++h;N;+`+d3hZ2`"pC3`#pC3`#p.N=x+0 ;+ +h;+`+3hZ2`"p+h;+`+S3hY1`xp\C3`#pUZB2`xp+h;+`+ S3hY1`xpx+ћ:ZB2`xp0C3`#pm_!V\!V!\!TV!^!KZhVhK3xKhW+*?  ̀-ʀ|x:h*?.@A)-x*ДIP h: `* Qp :* : * Q!p : *J P xpB "pQAxp1ɲ )9)Ko~H p9)DAK0xp x):h*?.?}x :*RIL h: `*, Q!p ,: *$ Qp;=A!p5KC0 xp谶'B "pB pB p4+KhB/hF>S&0C#`#pZB"`xpd3۲ +3h;3`++hZ*`p3h;3`+S+hY)`xpx+C+`#pZB*`xpN'Mtc!0^!\!V!V-OF; (CxJ\ O O =!@F M 3G ОKJ.h[hh<Ѻ _$O &@F.hKFh@ @@ "" h@*"b@F f~K.hh}K@,'0@+!*+Ъ+rH9BFx+к#HHF R$`$FO h49`)-)hH(` p ;ܹ 3O̿F"DO  D @ЀMK)hhD)`LI hD `xDJHKA`pEKF?JDFRF@FLDkO ;Lt$[FА'[FF$O @*-Jh*@B@"(--{++++ K  9) 9))ho~H(` p9) )hH(`\A)`!pUA)`RV!b!N\!^!V * "h:"`**hQ)`"h:"`* *hQ)`j#B*`B*`\$#"~)hFU(`*["FiL8F!;x+@78F4*@",8FCB[x+@*B$7,tX0;0+70Z "pF ( uC_/0+  F) њ)ښ@)њ =*O(`hI h: `B Q!p'|B "p [I h: `* Q!pTI h2 ``B "pNI h: `* Q !pJB "p( QB): &/7I h: `* Q!pB "p,L+1ɲ ) !h9!`)H p h8 `(D@ )p *A!pD@Hh1`f  F)@"F *F@h h Ftc! b!\!0V!Kh8`(C0kpᮚ ~*ܮ=)+?֮#)F FC0B pTF\!-CF;KFf0 "8L)FhO6Oa05J(#`4Kh;`ih`3;hfCT;h3;` `p#hp;;`++#hZ"` h0  F$AF#j"`+ i)F#j"`i*qh `s`C#`ik #jG`` bV!\! b!W!"FsKhK@0-OOq5L&h02O;h;;`+FP#hZ"`"pP0F5D(F0 h"K(FhF F #h2D"`:hD;`+ `!J hO!h F+F+*ѹ"3D0FYF#h@F=+D#`;h[;` |C#`#pV!\! b!-O*(NF(O !!FiFF7V;h3;`0`KahUDи*HF")F3h 5`;h;`3h"p#x+H*FI   Ja H KFJF0V!\!p-OFrO+,FFi0 9! 0308``K,ah5DNDM ,|,!,FO B ;h"pRF)F0F(fфй44tO BӔRF)F0F|(K#FНB ,* *Fx)22B8FtBRF!F0FZ(AbЕB <+ +Fx)33B8FRF!F0F=(#x+44BӉ,Fuc:h=C3D;`>00B t;?;h<`0;0+ c;`##p;h;;`030%C;`#pV!\!-CFLFx7h!p'ha0ga#`Kh00;0B#hZ"`p0 h"1FFK FC#`pV!\!-AF-LFA,Hn hCh;C`+&"hhY`&O"pB"HAFW hCh;C`+"hhY`&O"pB hZ`W&6#DhZ`W& hCh;C`+ "hhY`6hZ`HHHBKhpGhB` Kh) Khj3c1 i@ pGh(h pG pGW!Kh2`Zh:Z`pGW!-AFMFlF+h3+`0j  0j`bKZhB`h`h$hB`g+h;+`KKh3A$ V!W!V!K-AhN,j3h'i33`@F#0`D< + +KhiCah#`K$5bhZ`h`h`#hE (>ob#``O02;i+j#h;#`+chZb`x$h+3h$h#+JF!HF>S"!HF>(@F3h"`Za2hchQiWa Dc`F)F+: * Тh:`* H`"`h!`:`*;#`+#+p#.x+p K03`h Kh.poW!)  L#h;#`+chZb`xB#h;#`+ڽ@7W!8 L J#hh`hRhaabhZ`#h`O3 ``#3aW!FLFI#h3#`"!(F>lN3hh(7hi`#O`Oa K"``#s`#h;#`3Kh@? V!=pW!V!F-N!F3h33`>)H)FM?xpCO)"# F!C!" F>(F Il( F>H)F#" F#!C F> H)F F>B> H9Fp3h;3`# Kh + V!DRXuV!FLF#h3#` . O(F}`#T K^`#h;#`8``3Kh@ V!W!V!pNM4h+hh3+`(2if#j˹#h F3`_3h Jh`i`i[hQ`s`+h;+`KKh3p@tp V!W!V!KhpGpFNM3hB ЫBѬBH~p$W!8ML+hB8$W!8FPM+hh(+h`8KhB`pG%Jh%LcC$LehB5F"E p B2eF b`) )$O30 bhU%b)Ldp/0"Fbhc` d[!5rOFSMhB%RKhRL(i hC]OH!> `0 hKI `? h(`GHrFK"N '8F 7/8F>H `0>hB! r! 8! 5O3! />9hB >0$ph&"F*H 9h h@0;$`h"F$H>hB 0F>0$Lh"Fh h0$>h"F h! O3#`! ! `d[!\!v\!F0+gH3K3Hh3KaYC1)1N% !Ow3h33`B 0B(&K)Hh&KaYC103[h? ѻB5!0$h(ЌFH ;OpO5'Qh сBU`p;3h;3`3 Kh@d[!85rO V!y`V!8FM+hB+`Ћ]@! F[+h;+`3Kh8@r8 V!V!-OFFF 0hI FO;ؐ3QHBݪ IFPhShBE_  ++ +E 90+ і0+k0FЀ FW0#00CEooKpHhpKr@hZCB_G_'B "-"fJ!"Fh aJ !0XFXF"rD  Q=XIXFDO "`!FDech;c`+ F#h7/"`!FOH( o# X+" "=J!O#7J!XF5J!XF(OsB < "YFL0XF"D(H@=ch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#hFZ"` "p:FYF F7Pd[!5rO9W0Fp@ճ DPh PU4mh-(FB! p$& F +; CC+OrB 0-OFFGKHH[h x%+c PFPFCAH+%@JQhB!h"D0ӱ Fkx+Ъx2-+%+++3K $i ,-HO)F'KZhSD(K!(Hh3000+ kxp?+YF8FL4F69FPFU(((F&VKC;Ԕ Z) "R,B4HH$d[!-G/N0HD3ic.M/O+h!hP0F#+H+HJ!1h OA%H2O yC10CE!Ch;C`+#Z hY` "p F+hh"[h*`+ HF 1hZ`d[!_!5rO$F';MF(F03;D+7Hj(p(g(&'$0Khh[h .H!F`+Kh+KAYC1*H$ FF.)9$H0#N#O0B# cC0F4Xc8hCh;C`+9h0 hB̿ # #P`p;! KCX0hB̿ # #Q`4FNR_!zd[!5rOPhJKi !T(@Bd[!JiH#;pG2 pG pGd[!KF60 Kh Khy Kh KZC200hIټ FpG\!d[!5rO-GFKM+i+G?_#+a@F;@DO;h3;`(YOhpFkh",`!O O0D"F93k`;h;;`#3Kh 0O! F;h3;`/K0;#0#63Os0h0n. pC;h;;`#Kh  F0 F40Ok QFF!F#F"EPF42B03 *4td[! V!V!FJJFFhKF F'-)d` FCKCJ` FAK`/N-?K60+I!F !F !F `-5K60+2KN00˹>F1F >(譹+K1Fh0#h@RF$H0h!F !F K603-K"a-!F f!F bv Fp=H)F=8 IH0+/,Т\!V![!d[!D FF JN js0+ ""BO0>2"F-OFFF #`iL AFHFFh #hh+#h+(F-$0PF300"B.00OKh+OK60+@DE@"P"sGK!Fh0;0+BKh+0ñ !0##FB C )I*#00?#ЬE?O|dE,O4T`$@8`F? OsE!2 O~EtEѐ@D@T`#*#!0DEѲP"y0C0za!\!V!d[! V!"-GF F F " F(0KN0O &@0B(ڽ'JN *3$N0hTF>lB4h>fF F40 #Th @j"FHwO0C0C0 F64Д0ոД0#0*F!F8Fd[!$!M(F&` M,+hhё xH^ l(p(Z($$$ NK6 "0 D@N0h+h!7hh "FF8Fs+h*`[h+!F?_!h-O%NOF0FF`t-N0۱$en,p,H=hO Khh+-@0+M#KO &h>GջF'^F[Qhh+,O #1"9| *@@\F#"(FF(kH)F#!(FgH)F0++ F  8h8A2B̦!@FXSKF( [, З *!8F F% F(F1hGK60+8Fx ^B4 s O O z@$("0@#!0F0F5ѾB=Ж0+0F>\F;;i#("F3JAF(FS) 50b0+\FF'Ԁ 0+R0FԀ0+8F$_!_!d[!0 ;!KCX!J  0+0F-??"AF(FJ CF+Ж0+0FpF=5N3h33`F 01K)Fh 0#,h@RF*HO!F 0+ %K&JhSC JRhB! F! F%0+ Fj3h;3`#Kh (Fp-OsB 0 5OsB-(F!:% V!d[!5rOV!1Ki0H0F -H%+H&1+O0B#(M(hCh;C`+&*hhY` "p!Khr0"hHOrFH8F51rhZ`M F+h3+`c F,+h;+`F# Kh h Fd[!$h V!V!H`Khh@}_! FHQ h@p8L0C1"B ۓPUP-H(F#ca823 d[! #-C!F Fo%0.@F+:F* ؀* =*{-آ"۲+N&#:*&S"I_Ɍmu]DK)">+w++ \*э \"zx#*ѮzxF5K /CFF@Fx0? /CCBЁ""Ȁ)K /CF&KOaO#}"{x +Ѹ!K$"""I JICF%:") }*Ix/ј K$"K""+FP.?M"#>;G n S##&,d[!-AOFF,ni+k%h-*7]sEO(( &&XUM"hBJ!(F#h;+h+}HC`h!{HzHh.F`h!vHh%`h!rHrHqHdhhoO=޹ch˱mH hh!+h8F-hfH`h!udH dh5F`H`h!dSHz[Hwh!YhSLHmVHjh!LGHbQHQH]`h!?@HUMHRh!4;HJHHHHHHCh@FH=`h!DHDH4chCNCOh.=H+,h ?H!h0Fh!#h + @F8Fmhh3H}h!vh!rYhr.M"-M"-M" ,M" ,M"+M" J!Yh!V%HR%HPd[!4N01;KPUX\ n_cjq~v,^CL:>BDH6pF N F=! FnchKdh0F)F Fc0Fydh,p;pFN5KFa6 N0+ 2$$!aDi+ <."+*UZpp"pp$i"pd[!-AF)KFFFh+A*C%KN0+:P!F F=v. Kd F0!F F=h.FKd0 Y!KCPO3C`#r܀/9F܀ FAF=F.Kd.Kd-O\!-AFFFCFЀF:F1F(FA"hFHF:F(F1F F-OF-l@ #0NN>MKXO ZhKIKhh 3H30KE"QFhFFp[0+-#x+:"FF2x),/*- F= (""B#rڿ z%L F%L; hCh;C`+5"hhY` "p"##  65S] :+хL#hBK*Fh F *#cU=FKh+FI FRhZ`[!b!b!\![!dV!-CF3L&0 6/O?U(FBA(K!h[ %H/#HF^0B(1.ܔ^0+P60+Д.0+H6Q(( _B-ѽ(Д^p/ J>FhKBKA9F`Hx[!a!px+P(L!#h3#`<(#h;#`+B"Kh+>нp@KhS{!#h;#`+M@Ĺ&F z O t0;#0#0p@`&#0@,#$0p V!V!8!LF#h3#`<&( !#h;#`S 8@H)FKKh+ V!DV!8F F@-`h; 8H%2H28F!0)FF\ F8L&M#hBڶ+h7FOw83+`bhFpC+`+h;+`#Kh +hh3+``#h#`+h;+`#Kh 8F V!V!0I " `oCBH , D4C hp$r5UFF-8F ApG, 4S l)F@FDh(F FJ-OK"O&M` #8F/F0Kh+hH>p,r,d,+hx.h#8&0F#!HxKHN(F ^J#Fh2`O" # <(F5$N@2h22`F{N ;܁O 3hDE#pH"F1h"(hpNU(@ V F#\\+ӹ #F+KKEйIF xPHIFxB/LHh:`*F[FF;/?zDHh:`*[FFnF h?g72h_:2`* [FF OQ{F Ohh2h`:72`OiF 9!I(h!zF:2`*XF0$J#5h2`Er@3h33`p"(h" " \W!h$_!_!n(\!X(?@FR/? "1F-A%|L FF(@030<F<0;0#pKh oKhh,|-u^r#,F0;4kDw" ,x4kDx" , O <^r#0+F3jDw!<3jDx!3xkDOHF,\r# 05kDw",5kDx",@H #<;L hd#h[8H&0F%d4H9F#x0; +#!FF x0:ղ--H!F'/_(#*ћ&H!F0 F30FFx0;0!h!FFHCNF(F0;0# Kh C<Kh+V!_!%  V!-O'؂f$=F@FF(1Ē0+:0B6ќKh2-8%/ODFW <+sђL h#h[ՏH&,0FS.a.H.EE'4F [hHo-I@F% ((@FF !;0Բ ,ٛvHAFT?z sHAFC 3Cz O0oAZF KH,FJNJIHH#h3y@F#y\4IF74/BL hCh;C`+"hhY`=N$=O " p)h9y@F* 2F:F45,ѽhZ`1H+N0O؀yyB*h\@F45,$L hCh;C`+ U"hhY` "p*y8FhZ`)I LhF F4y4,Ѽ $&U6A8F 6 !F0FC 6.K:F H],>$ KF $yBѽ@0(KHY\,08Fych=U h8@PN8-AF T 0F0+р'======e=====;=$9==========X=7V='F?'O MF0 +0  OEѫ (@H_'(#Р0/0+-^_'(@T^0300h Q_,K] ;+#h;#`#;#hEF;#`Z0n0+0_ OF#hEF;#`#U?;+`(H\('H\(!'{X\!TZW!W!2!!VU!H?('U'V'TA+7Ya+WP/-٥XCo}H#h +F"ho2"` ?b? Eɲ )#h!;#`!hF9!`+?0"`* b Bɲ )#h!;#`!h9!`p?Eɲ )]!h1!`!Yp#h;#`H"` b 2Bɲ )#h!;#`!h9!`pA?Ҳ *Z"h 2"`Xp#h;#`Epɲ )U!h1!`!Qp"h:"`;5oK"`*b BBɲ )#h!;#`!h9!`1pAҲ *Z"h 2"`Xp#h;#`pA۲ +S#h 3#`Pp"h:"`pRl!!-j"`b bBɲ )#h!;#`!h9!`pBBɲ )Y!h 1!`Xp#h;#`3 pCҲ *J"h 2"`Hp!h9!`p ' '''\(B? (0300h ' ' ?'3D[#h;#`#;#hEF;#`{d|E #hEF;#`\#;/V ( 0300k2cshZ:\(`(}(ۉ˱I²#h \; 9) #`#;#hEF;#`+%$("(ћ+#h";#`CF+"h:"`\" Fqh)EF#`#;#h;#` #M3DB*#h;#`#;0FChFF`"EFZ*ۉ+?t0FChFhqKB#hEF;#`#3D12#h;#`p[ #h0F;#`#0F0F]IChFF`"Z#h;#`# [0F#h;#`#F0@F((F@u((@fr#h;#`#F;sh[#h ";3DۉS0F'n#h;F#`(FpIFU#h;3D23Dc#hEF;#`{sh:<)(F.@F&rh;EFK0F5#h;#`#;pF #h;#`#AF0F3Dۉ+S?sh HhB0FHcFVZXT!HB#0FH݉M0F0 Hc#h;#`+DۜK[hsh+C'<+=+:#x X#xF+D Fh0BF`ڊKhBȿ`>/D,$>(H#+`00F`]b0 a)F Ff(V0@Fbbi00Fa0 0O2`+hKhB`>/O4<(>(3&(3#+`'|(#&(##+`#'+` `0 (j]`a0j-("`$t`##+` F#)F#h{(3=J\V{/#`OO ;3Kh#h3#`$i#(Fld}(F*K\ 'Hh00XM}(F/FO MK]hOh:`*E{5K*\Fh:`*O=eEF+@Ӏ%/Ā:/a#/mOZ!![!R\![!^HIF0pFCp_O PF0 (h:`* {sKFР0 *٧kF :`pgKFO V="cKF+F`H]KO ]KZH9FWK(h:`*@{h:`*4O {OshZ  I JJ)OhJI@ C ST0F ChFډځO;IZ`FFOVB  }/ h#':`* O {FO FC ST?'(rhhJB0F#`#pIChFF`"Z#`$#p7#h"";#`Bp0F J!ChF`"ف(_!\!ZVT-G0h $i4&F0h *h4D`h3 0 khhZBZA F Fkh`Fh+0"F!i1K"QF0ij``KX(OK0h!kKKP0 GK h  C BK h #F>(P8K:M$!F`6K`+`"F3IY*hj; )3,I)Mi!   2#KFK$Kh K`K K`K`+Fa0K`K  K` K` Kh+!# KKV! V!XV!!-GM"+ha# (%*hSi3Sa(v"dd|+h[j;` O F F``` 0 Y`( +hi* M  +h F ;Fp` 3`" Zi2Za +hi+ # #F` `` ` : (+hji8XH^ #`F+hik`a+hi *j*NIi(+ #`IK`#`C`+hkai``:*Zi2Za+hk0` (!1`c`+hiZ* ;nF+ +h"a(( ! & `0F[& F*h #`Fkk` j+hk``/.h3i +IitIO0O +hi*" "ak #FJ;F+hi++hi * ! "kS+hFn( +hi*! vk 3a3+h"`aW(Р +! b ( #3`+hE &F` #```! +ha, (0*hSi3Sa#;`%#h+ #4F` K0F ( +*h8FSi3SaF F+h[j;`E-AF?MO$+h+h (k8`F+hi(Oi )\j4`&)G2B±Zi2ZaO (#`F+h`k`a%O F+hh:h0FZcH0Fh/!zFH*h##`;hk#a+h``^c FYi1Ya*)O0"="-A"%0aW(< Si3Sa~FK( "#F# F`F` &FFd``4`0(>F##` Si3SaM VF0FL5(є0+H;O"8!M*hQaa` +h$`(*h Si3Sa+hh+hiHhH8 Fb""FUpGChBhKFhpGCh hhBpGhp_!F FFFch```v`FhF9(!H)!K7ih8FBȿ`F F9F F 9!"FF(8! ! !F! !F 1i*F F9KXh8 pGp_!F FF)O9TFBѰB0F8K FhB`)F0F9FB, hA*F1FFH F8H#F*F1FV#p#-AFDh FOt`{h;{`-- FDF2h(F8ph+Fh(p_!pF N L5h#h(F3#`+h(F3`#h;#`3Khp@-pp_! V!V!8F Kh\- F!$heh$h,8h(8*-hp_!KpFh FB`hB`BF8#"!F(FAB h(F80F!FFH Fp#8$Mkh +ܿ3k`kh@ , !bF8(+hB(`8K2Kb , $`8dgfffp_!pFNh +JhBh !(F8 KhB`B(F8 Fph+ h +"!(F,F8zh+p_![!8F Fj(KEh``8p_! KFS 0hhB`+ F@9FFp_!JFhpGhBhp_!-CFOhFF;h -;`ܿ#KUh;+݀K@i!0F8 &tK$`!Fh1FFpH40F8mKhB`-iK0+𫀬B{"!8!  F8iOr@!0F8YKV0+5i!0F8CFOr@!iF90h F8`FK"`!hf1FFEHpCO F8#`&iOr@aiOr@ !h.=0FE0F`@ ?*F1FF/H - .0s# 0;h;;`#(Kh n'O)F0F "F(hZh*F!FF(F8lEFF)ZBO#)F F(<h)FF H)! F8: V!hV!x##V!#pF F FXO0p !FFH1! F8 AF-h! F8BF -h!FFHH@H@$($p-OF"FFCFD#O"I2F8h J!K!N-FF3h8h[%I"F8hIOhB BFYFhC8hIF EFQFz,h+$ 6-$H$P$4N$J$8 !MFh8vC Ѫh* b ! F8lE KhB`8 !R F8^A " ! F8VB" ! F8PCHlp_!V$8F KhhBVhFhBch)FGh8@`8p_!-OF F C 0 #C`FxKh``ؑ 0tKtJ`0sKqJ`pKhhBnKhB`3h F;+hB FF8 !FFbH! F8(hF@ FEB(` F8 Ffr+xh!FuF(x! F88(0300 +AK! Fh0BF28CF]xh* * *0ph&!FF2H ! F8j \h*"! F8^ BP"!(F8R Dh* 2P*F!F8F0;0#Kh +$030BF0Fvh B(p_![![!~$$V! V!-O&JMFOFL#f`+`:F FA L}M+hB|L h#hX@òs+v+tH.`O oI0FFX,СW@FF@FF000+x+@F4(0B@0B+ѫh+Ъh FIm+H!FH!F#h*ch;c`+ F#hZ"`-"p I FL Fp%j%8FT"K,hh hJh*31+/K"`@`8*Qh)Rhx*,h*hx*!" D" K60+,KhK`_! V!V!F" F@I F0 F(O0%FP0J#FH !HHa!%FYCh;C`++#hZ"` "pN%O(F1FF F -?- !FH@X!F8FT!%ch5;c`+ F#hZ"` "ph4-C$MFO+h3+` #;`+h;+` KhC}X0;3hx#0hJ4 V!_!V! Jhp2FX h x3  _!F`NF3h+_Kh% [h+x+%%,Eі,2 ,$,,32+l++E$+JKN0HK6 ʹGJh02BK60+32+K++%!2+>++7I%32+JjF! F0+,--%! F0&DR-! F<#>,33)#`"iF 7t%%F%KN R,--ѵ*ٓ60+|+?zBvb #@R CB<_!\!_!(-OF F!ѤIhehI(F0I(F(@Àkxp4p+F(@ŀHO #(GehI(F`HK!hpO PFI(FF(lэNLkh #h3#`hh!i`g#h;#` 'Kh+!8F#h;#`#~Kh 7@/#3`(uO$&FZh[hxm,@qH$0FF@F6@.jHjN$kh{khxc0Fhh FF@F4@,ц&W(3$%FPYOX -V-%^hf,OSH$y(FF8F5@-,HHj4'9I hF8/P% ''/6.?.԰<ԐO T(?:v?(Fp5K"h5IhYO .%/?a,F %(F4wF8FR ,HF4F0F4hF@FC ,]H,FW/Kh h^(%h+x-+kx+%.?ծ4%h%%%N_! V!V!%4%%x&F'/O D0+?z)HsD'H0C%H0FF#H (()-h030% OZhXhDP!0Fx0;0+9 Kh+?40030-(FFp%NFV!-AFK"`d%N-,ѽA{Yhx3h33`cYBYA+3h;3`#Kh p5_! V!V!_!pF LF#2 ,D2;+!(F(#2p_!KXmh+(x+ pG pG_!-C' L N131#rQ3@+1;1qUh-hFX2(FAFF(F+hF_!TV!K@ 8 !*pG_!8F M\2B ! ! ! \B8_!Ͱ#IK`"b!*8X"*42d"AKAJd2`K !6 *N#`" 77N!F7@+P "@S  CC _!TV!V! V!"K Y_!8F I&'!F F `]8 8BOrOA X8 M Lh#h3#` #`k`#h;#`3Kh8@8 V!V!-AFF F*F1F@F7|-D'7 /`h+O0%FhFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+`hc`` `+h;+`+Kh+y3 Mh+hq`F3+`thc``0D `a! V!V!8E F?C K[iB F8@ch;c`+ F#h*xY!`p8KiܿKYiֿFHP!F&R]pGKRi]pG Osp FFR& ;+Ap0Bd#<p@pG-G F'!Fb8sx+[I0F3\ch;c`+ F#h!F0FZ"`""pXch;c`+ F #hZ"`""p3x[HI0F7\0FzF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0F F(ch;c`+ F{#hZ"`'"p'=F&XKYi5L FG@AFxr+ HH&&h-Ah h2xh+xB,K=!0FhKh0j=!F(Ff@B!'F=++x;/0;0 =*+O%p=F)F0FA7F/F5F&Fp\!ChL!2hJh F< F a!'FxB #` O^8\ 4F[=B|] *`R-A("l DF: 0('kFF?0F'`T;+Yhh)0X[-jh++iC(FG `4-hhD;b!Fx#@HIF FBNO#x3H!F@'+8Fe,F'! FF H!F"F0F%'1'('h,'-AFiFhFFKBh՘GF,մhF HAFH9FOF40=+sh-H F8hCh;C`+:hhY` "p8hCh;C`+ :hhY`,phZ`hZ`8'<'-OF+LFF0; #0n% E"K)FR@=* Xk.qhղB FIA%`56h;FT ZFJa!b!C/ B=*Ѱ@ pG=* pG pG-AFFF F;;JU$ F=+@`'!Od7` KDi,hB Ѡh*FAFD.7`'F$hb!a!IKFy F!XDiF0FF(nChZ `0F#t!;Hg`j0F@{5O:h2:`iRsq Ch!F00DGkh`Ѩhc*ikh2R"*a L##k`D#k`khH$$TCKFBB0 ;h;;`ùKh@QE $ TG5Fh``>' V!a!V!Kǰh!Kh@ K` K`G]K`"K`@V! V!-AFF=!F BFH'G(FcBF+$t="+*U"Zp&41F(\'`(FA 0FrD;Q'Kǰh!N@#K`G]K`V!87L0`Ft KH-FZ0 I"#`0 KBF8@Ha!p'i'P(O!0> h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp"( ] ^!_!`V![!w'pF MF+h3+`T+h;+`sKh[p@`h1F7$hp V!V!sM,hLH0h `#;0p@;h 0Fx0Fh"``kh#0Cc`h#a`5pa!'%O-ѽ@ch"h2`Ԡhch F4h,5[ՠhch#@c``&Fb!"FF BhiC՘G(h3DhFKFh(F"F!FeFرCh2CiՐGph4D gh)F8F:0=!8FD F$hh4V!-C' h=F #xr+&&@FOp:Khh#*F1F FCn(p('% . F&'-*Khh,0 h(F! F c\=+   2FIF F(Ch7 3C߹F#C`Ch#C` H"Fy%ChH"Fp% Fv(H!F_!''s" FFFChX)> I h2 `#c`Jh;`#Kh pHh2`)! DRx I"0F|^ch#c`chCb`ћԠhL"h F`F V!V!-ANO|@ #heh0m:h@Fh2h$ Fh+Ѩh!"i:@hh0DGkhԨhhk`h`#i+aa!-AOMGFFF(F(F`VK'h=U Fv, e, f,&x,O''OGFC/(hAF*C'_!(ܽ@(H" '-CFX FT030;x-+F!|xHM(h*hGI0t`3`0`;0+w?Kh+sC"8FF=!8F F8F%A"h##3a%8FBehBh`BB`"B0iC02aC`B*@*% #c`h\=+8FZ% rKB 1\=+ 1#30!8Fpch+Cc`V!b! V!a!8F F8`h)FC$h8H0N(x(I($(F ( M+h*`hH8DDM$!F'_!' hxxpG hFxxPxKxpGsF# "` FtFFh{h"+ jfC2s3H!FBxr H!F Khx21 R3B(F1Fpq((̰ FiF6 L& F6(6BB8BԿ  BA ̰ FiF6 L& F6(6BB8B  BA ̰ FiF6 L& F6(&BB*BB  F F6& I#\Ch @iBѤ5j6ؿ%hFF(F628W 3jB8FFxCx-*xKK"I#`dx K " I#+K" I# I.(H H8(@0Fx F!+Cx+x8 '0(F(𔀰0+@P- - - F x@ @ x8 -iF F6((E 6 (=-` _#)/5_M_AEI___V[!hF<!!p@O  p@Op@_p@Op@_p@@Op@ O  @ +s 6B6< +x(+ #x)+kxbxCO0 UO0RpFFFF(𙀰0+@𔀰0;+{ "+:IWep)F F:@ @ )F F08 )F F()F F"(Կ  FF(F FBB  FF(FFBB FF(F FBA FF(F FBA FF(F FBA FF(F FBA)F F)F F)F F&fcx#x!+ )F0F(  p(++x)+kx 0xkO08 FF$I hX="IT% HRD%-011 chx@ 8c`h(0\xx!+ (  (+x)+Sx+H ((((FH!Kh (KhHI3Fh `V!)7 "FxJoECAoBAI"F 0)-OF F I',khf/x-*@Zxl*bI*-*(F:F(@vJ(F0h320[^F(@>7.mI8h.>7̑=ȡOU;x%+y8FF(@)h`HO>@FOs*њx*LНYI(FF((FF(;hB(Fx.ќKJ#xh320Z FZ(Fȿu F+h(?sBK9Fh.(F0(FF ;I*F a9H 26HPhx+I$w Fp0n# "`8F&BxڹOBoBB?IH:FYpFh)I!FXF50 *h?IFQFHO,,O!XF5I))p))))40`"K#J"h!KhK$`+wKO2`K`KS[L$(F #h3#` KA"!:#h;#`#Kh 8@տLx3(TV!l[! V!a!V!0pG8F F8+h)F`h3+`$hpF&N F,G#h*h6 D*`+?!!!!!!&!!!&&++;;;;;88;;66h)Fhh)Fp@ȿhkh3Dk`h)Fh)Fh)Fhkh3Dk`dh i)Fh)FpFHh;FOK,J`pFF@h1J h2 *D `+2 22222622$044<Fc!,-CFFFpL@- H9F%k##a9F H2F&D,D#Huc!,c!-O#N(F F3aeKhS#S7`h%!2عOO:F!F(FHC ќKh-  L(X4#FS+`sa,FkfKhBh+щE4\. " FMKFhCh;C`+ |KhhY`$ phZ`%.kx%+ѬrKhCh;C`+ nKhhY`%FphZ`kI F4#\'*+7F;x.+{x|*+z7F^H)F8F\IO6DXI F 'O4{xxOxp غW غ%9Aڲ*KKH)FX +R#1111+R#1Y1112LF\THF0AF\(ɁFO\ ps#;ppuaF1F"F(Fc!ڛ|,,J,(()Q ,(.&*Sb FXp'(\("(0 Y>o p Ff n r t v O\ OM ( ^#? F ;HpaF-#(@@^#a e a!F(F=F{pKihL h"h0@(#I SxL`dO `I"df PvFd(x! s#;ps `~H#F2F)F*0tL"xI#n`:hvHsCF2F)FpHaCF"FBF)FkHKl"Fc!(FrcCF"F1FOsBF1FnZJhh(!3`eBF!F^AFF1FUF(Fj"FF(FQFZse"F1FAJFCF1F;aJFCF!F20h(6 x"+'+!~FFX0+6L"QF(F#s)e!"F1F # `0h0  hYOO BFKF1FaBFKF!Fr c"F1F(FBFKF1F(FfBFKF!F(FN.ɭB,ƭ$Ki pH'c!c!h, hh5h"-C.-OFF:!\LI L0HHAF8F(x+=!<F =I"F #;IF(F(c5I F(]`i0I F;`-I F(I+I(F{bl&I F(8`o2QF F{`I F(I(Fb 61h) x[E F(sh;+ I(Fsh;Dt3h+w NS.h...hJ..$8.#K0#M0#P0Cl# CCCdk#cc#bpGj#ABrC##bpG"r#lBl`3CCdB3cK@CcCCd#c#bpG$@ hh5̸#dBj80]F@k~##cfF@kt##cdFjhK#I4#b#`t"pFFH4! G"[cc d`dBe f 8,"4NF(F4.#bpF@kF8#bF@kF8#bf dH5I.80@FH5<j >kBRBckBcBl"rBbBd"bpGjF@#80h#l#SC@s#d#b I4(I ]t.I 4(I nt .I 4(I ot .h"phF F+x-+5 ##bKI # >ȱhԢj* H)F$3h2`[hccH)FCh FG p<. -FFFF)h9%x--41hF FHh9h!9`kh C ;` 5 F8:h--sh "C68 FhJh@(F b8J8(F$( JD(FT(J<(F<(D88FL#h# ##`e`8c!) F2Bh:*J!HH JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJHc!c!4-pFM.h6FihHF(`phDH. H< H!F80H!F2+hDc!0h-CFFFF<(F(F !FBF+H.F hHbԐH'ԏHaԍH#ԌHՊHbՉH+sHՃHcՂHՀH{Hv,}Hqg|Hl!zHgyHbwH]"uH,hsHQrHLbpHG'oHBmH=clH8 jH3iH.+eH$cHbH``H"^Hlh\H [HYHO@VHTHh!@@s+JK_G0F.򋂢BHAH ?Hb>H1F1L1T1[1b1i1q1y111111111111111112 222!2(2/272=2L20T2[2c2k2s2|20$02 H|DРHAFtD/H9FlB@hHLHH LHHbLHH'LHHLHHcLHHLHHLHHgLHHLHHLHH,HH`LHH"LHHLHHLHHKoFH,hW.NLHHLHHcLHH LHHL~HHgL}H~H!L|H}HzL{H|HtLzH{HnLyHzHhLxHyHbaLwHxH\wKFStHlh.>LpHqHFLoHpH@LnHoH:d!mH5mH2lH/lHhkHo3F"4,? )HNHaHaH`HXHWHWHh.VHVHVH@THTHSHSH1%1211?1>1G1F1M1L1U1T1[1Z1b1a1i1h1q1p1y1x11111111111111101111111111111111122 2 222220!2)2(202/27262>2F20L20=2E200S0G0K0O0L:H;H</39H7!L8H8H1cL7H7H+L6H6H%L5H5H5K?F.h0H/L0O&h>0F5,Hch F 4\3F:Fd!.zh\:zBBF !r{h8FO 4\BF !FHDb ,$jh 7&T2S2\2c2b2k2j2s2r2|2{202$2[2IFH  l2K IK( FIH Vd!343:3sFFT# "`#x#+4 FFFh#I"F Tx+I3F"F >(Fph38Fx;#+MI F`8 (Ѓh`d!43 hh4FFFF "!F(F0`02hB" h"++x#hx(иB K0h30@ O O  H$ Kh! "CFh"+I F(d!8 H KXh! "tCFh"+I FWd!gpFLh h#i{B H@F IB F FBFH"#%a#pd!o8FL!h!I*F n(F젹 K"y`YaR`"(Z`bya ""`н8@ 48Td!0Fh FxC H)F\ K #`0O3!H)F#`,d!-O%}F/F& 0+2H)F. j#@FOr6 0)H)Fx0F } F"JU#B 0+H)F y *$((#( F  E,9/FB 0+ H*F)D@FG(݆BF FF Cd!h+ + + H]3+HH]4oHH[c%pG7 FMjj*I n I IkjB B I"F l"FI X0d!lj!8Fx 8 I:#\%+5#I#T(F:F(\+j L J N O8FT; T8F1+F1FBFTt-CFhFx;H1FK +`/O7/!Hx/)\0`0\CFT0P DD+`H1F,d! d!"-GFcIdH2좈bH*aKbIbIH#$j_IZH j]IXH"k\IUHkZISHbkYIPH #akJCBUJUIKHTJH0aoRIFHOJJ0+OIAHKJL0#LI=HGJN0#II9HCJ#m#FI6H?JcmDI2HĀ'0B *I N(HG3xU<+BaAFHFUb)FODB?W(?.)FB?KW)FD KBd!8d!,d!Ks&S[}>"1F F8H8(Fp6 I(F K"1F(FS$4B -9$Kh@2#`O0T8F&L5+5 I2F(Fs(^h+ Xh+H #5sI(FX(HKH]`<(F5 p J I(F@( H2Fd!WEVfdmdTa:8d!gdFHBOr F@8d!KJIXhTj!mdF1 BpG3+P@FQ JOa F x (( ! F( @pG#pO0 8 L M!hAP8@`H2񼾢h(F 4\O!V!mLKhFJ!h)FI(ݝ0c+ C+S+ HFs+##` m#!BOBu!!0MIFhFF( ݝ0Y+ F(H M0!F(FA(H!!!KFHhLi!hmI#F"hFM("iF F m!8FMFJ(F>K!F(Fh8@he!i! hhmIFFjF0H~ mkB If (ݝ1Y+cFHXrdA! "7"*Fgj zF JOazzgzGz z j]N"7 FFRFF+x$+kx+_(FBUxT)GB))HQ <;Kh+IФk#"FC##A8C++R#====>===== >=====9=>cڲ*HHO0F0zg ` Q0 zg    @!b"q"mLKhFJah)FI (ݝ0n+y+#c` m#H!"m0"" Kn:f*oB (КmQeppGI23h-GFF"F )F#tF-I 9F+H0 V HJBFE 4"K$")F8F!FH FhDFhO FQFS)`D0FME0FFB6 &/F EB"(I<h-OF MH FFJH!FqOAF+(#W# ZB𢁰IF(I"HbO [ }I";F7C("8F2F)F FtMtN)F  Ah1F(kHn  (eH 砀0aM^Nj)FB=h1Fd(YHBbWMQNj)FC$h1FL(NH*bLMEN"k)FG h1F2(DH#cBM8N)FkAh1F(9Hc7M,Nbk)FBـh1F('Hcc,MNk)FxCh1F(Hc MNJ )F^G(?1F(5H"e!h#H#[#@w#2#####$7$V$x$$$$% #qJ04M4N)FL AYp1F(,H`L0*M'NN )FB?p1Fh(!HFN0MN"m)FC&h1FN(H,#eMNbm)F0( 1F6( Hce M#%@C%c%%%%%%-OMFH&K[h+?ʮ"O%FO3& B Z B02F;h!F@F%#D65H M&0&\;&q8R&&n&!'&0'i!h!H'&&h F0:*F`ڍiBhQ`p0pG02< FNIFf F*KKLILIS" \KI" FTGI" FN!FEH$mCH!FmAH!Fm[>H!F!F j;I F,j9I F&*k8I F"k6I Fjk5I Fk3I FH 1I F J /I FL -I FN +I F*m*I Fjm(I F!F'Hp#Q-;FX!O\5V/9F FB!FH F@2񌸉(p-(((((((((( )#)2)E)N)^)m)))))-OFOFX 0F+a)cбk)`,[FbFYFFZPFYFdJ@! ` jhkFFjFFF>PFFUJ@!XFlSI:F F@*{ F!*NKOIOIn4+{;ڲ*j+hLgLggagLggVggggLjhCI:FBKhk{11?I Fk)_hh;IF FhhkBA!F+ }kjhKX DDt1IB FX 0hhDkB2!F+ d*H!F)O1u뉪hk{11$Ih Fk{11 IhI FJIk!F* !F k)!F* !F )O1))))*)zz *Z*g*:*-*@*R*F FF & Iz H!FP0B F@1-2F;F)F F6m*}*pG@pG8Fh`Ȉ؀R[B@[(R[B@[шj FlFbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXeTXEXTBElRuBD3l#J1C 1 f# 1 `# Q XC Q Rh"C B8Q 2BC Q Ǽǜ@tF6L hhha@BFih3HVؐؠ,?2#.H̰##ihDg#BA$h{"CSr(hv2F;F??ihH26GHFOrAF(h0HXF\PFLR!wd-.xd .?0A.+.N....U-.h5(-A FIh"(4I" `!i. "(/I"L"`hxFFh'I<h"+ jfC2s3!I 6.I("`hJxFFhIh"+ѷ??I*VMI,(h00#h jh I Hn6./3/K/e///!ydOi/-CFFM$OY!IBF @F2h48Fh1FG hC1 LMDOch`hBF `0bh I/![JFRh I!Oi(7 FMh I(F눱 I(F( K Ih0Z0 h 0"m0!wd(7 FMI(h0<0 hihH0!d@/IFFH ,0-OFF# HF F 3!E "  (I(FJF00%I O }(IJF(F00SE K ,F$B$}IH  XEHIFROG#2F(FQD4O D{111O*\p FF ,KB7+KB@}SB F&IF $KBc#3B F| FHJK( FFp@00 Fp@F FH0 FxFFH Fp@}? FF H Fp)Ftcidyara1rbmn1|.[1J1HLhDD"!AF!F*LqO0,ѕq@p8D``?`. h `h%Ch-<` hh##DBO0 q@p8D``?`.2@ D8!K !*03(pG@!-AFKFF銁0FFAF,@3BFI8Dg2FHPDT6KOYh\"DCDSODHF F\2TDUXDXR$X2[DFX2dFX2dFFD B t EA *FH #F:UFLF(F!F ]F5>!77!>88B8F8I8M8k8sLQ lHch;c`+ FfFN(F (0I #hZ"`xch;c`+0FN#hZ"`x +% YXBXAp@pG8>8-OF0NFhB.I NuhO DDkB tRF#F??O0rhh9FO0\`/shBRFh#F??`B=Or9F Drhh!F/shBOp8!pFL2sN(Or#21F11U#&2oU'2MIP#3@+B p!!!-G FJ?K?H)ؿF1J1Fzh}"F+F8HpD1*+2+ 0+b.J9F+H R F)F02XCF/F3FZFQF H:1F6"F+F.2Cw#2r!:Q[:zz::::1;/:e;::;;_<<@#;*"kJU#BR*T=K2+s #F;Nҝ>0)+6J1F6HZ0)+_1J1F2HXE#.I/K/H*ȿ F(J1F,HIF#K2+?"JU#B!KJ1F"H!HK2+'*KJ1FH)! |FI KYF"#KJ1FHrHF|!zz<<<::;;;;9+< <-AFAMF4bN (B1-h F5NE 5Nm1F*F+3HA/1H$1*F1F/H1*F1F+HG71*F1F'H1!1F$H@sD*F1*F1FH1*F1F?H1!1FH@sD*F1*F1FH1H*F?1FA/c!fpzz<<<<<<<==%=7=-OF-4cE(~ F30B@0FO A+ x FI "jP жH | #QFXF& " *q@ pd `CW@Xr*@ۀBuFJ%FT@lJ%F>">.>+?ZFB@X2[BBB2F F)F0@#x !-GBVLF42yTH SO%SN42)F8F)F"5#0Fa-42##jIHIO%@i42B+yP(FFBH42+m!>HFG/i+:H)F8F~(F&hOE*E&F F0F!42+@Fd(F&hVDF F!0F5!HN"FHDiBHG/w(F$h}E$F F F!GܺFH(H"#)F!<>B@!M>>>>q>>>??>C C}F!O"OF F0H9F }\" FRI" F# \"! FK2+h+#9FeH#"i#BBh*#iB/:7?6?!??#0N0LB d2C-I.(+H+J !0(H#B d2CI.(H2 FiB1o"hAE"0H)FjROu-h@"0 H#h5;D!md@!z??!?Fi,/iI FHI F I FNh4h<Khñohhv,F h9F( Kh+Fh0h9FF( F$&L44!F FF|F8F8 `0F4#`kh````4l`-AFhF FF0F F5)FJ3F)FF@D<`F F 4-G]Ki L h)F(dhIK# Kiѹ Oph +`JOa `0F#h`+hc$h !F*h O@&4%h$` ;9FrF(D%C$ ]`pKi QnKrJ hrHBF@pN0FS%8BE .F`?,J  {{ Sh+ Sh` Bv(FF0+-+ =!HFE$4#4;E$4FGH  {F{C 8Li 8 a88C 6Hi/k .4'Ki[0L 0M*F@A 4@#h 4@60h+T?+(h+!H 4AF 3H 4AFH 4AH 4A S Fh(%H|琷!~4 N$44*404dk4z444 h O ?* ](?#OrB?|FHKKpG!KhpG!KhpG!LR F!F  -GFFF5ILch!hHhS!hH 9F0FH-PF|FHch{ LchS$h!FFH >!66 R]pG R]pGHR]pG R} -Gm(FiFAH$@.B>H5F(F mr@20F9F.%CF!H!FL.L()FNpC_H)F_U"FOa8FvFȹH!F F F(-hOa8FFQFHF[,F%r7 7!07J7h7!h` J! H H]#!H#J7!7K4 G .(넸!80"Ih -K! "$(`!h ! ! `hF Nki(iG3h8+ 33`!-O$FFK'FBO`FB Oa F;@ :pI$H F 'G2h@OaF8H@:O \F F#F9FH +X-]F(/M NO@kiFh'FEF GE% `FH@-kh+hrIrJsK( FrIrHrNlhrOrM,0!h"i) )F1FiH9F$h/i+-#)FrhhGF(ՄBF+=\IJFWHO h! b(FshOcCFcQI .00F F-*HFJKhCFKDEF x;62`qՠ  0Kh.? FHF2F#` 0B ?3`#%Kir``Zia2Za 0 F(F 2i 0FhRFIFF   0+6h)F H)F!77h78M8g8847zd@70F  V8F0FHF0?􀮁EF6h7hJHh{iB?h*hBH#!i%+COqB?+=h9I:Hh"i#*.S`O `##`hK c```h#{a+h;+`*1ji:ja.?~CE{jiBwh6h.Fh+si+0F;a2{Z`bh` i{h{ F{:a.8FF(?HEF?`LF5Z?xO v88)8IFH. 8pF7Mðkhsh3$ FCp@pG(0HDHGOq hKh+5)N)M0F(H kh;k`+)#HHF ,kh;k`+'(F> (y,&$ Y\B\AhJK)FHhd J+hZ*`x竉դ+hZ*`x +Y,n,N,8!9*9hB4"9𵣰#OFKNh;`3hFH|9h" FI I-0:h:F F-~H:#;`(FF#(F- 3h% =`rH!F-&0F#3h+ 3h+ 3h3+eHfHz(F"rC(F-+':F(FC;FC{j7B3hMHFC~3hHH:4C&(FC3h?H&(F'CD9I X@(F7C&(D! ppC *H,4" ԣ 'I %H$ sD&&uz(F-6?AH\<HXHT#(FC&F&D!8!::-G FI#F-OsҝH zFH)FHF-BF ЕH(Fz'8F!U*Ѫ)ЌHl"!O3o{d 0g`#`'8F(ЁH9F)|`` }H01F* #aa0jcb"bk}icab*jabezFlH zFgH#iclCcdgl kj( +e*(0* dR\HqjHFjcbc+"h#cZC;F#k"hSCBBQHup1FHFR-CKI"0F vIIp" nFع1ù11U+і1+ і3S3;3U+і3+<8H/8I IF(;5K'"hHF3`SS 310K13#kZC;F#k"hSCBB (H0Fz@Fz1FHFR-ZC'#k;1c1#d cckO "hHFZCSFPck"hSCQEB$Hd@: ;;H;b;~;;;;;"RRaAU;<AFHF-LBѕA0  O"A0 akO BH   0BIFPF  e0Fz@Fz(Fzm3H1F%h ik)F@723D f*H)F'HAFcjCbceBF"HjAFclF e opBBdeH2F@sB KR#@r[OsBOr[ HT1"#!e#ef$ <x<<<<-=<T<F F hzF$H#k%"h8FZC+Fb"h#kSCBBH0Fzr R1F8F-x#hCk8F!"l!"kZC+F<"h#kSCBB HR1F8F-#hC0FzD(F ;;sFFlFh" B$c+`,h,n3f p o3g,mB  KJ Fl H@2F} I 0O3 +`K v=h===-GFXFh FF (Fz8`8H)F` h#@F UV*F3FBB HI8hzm@F"h9hZC-m"hSCB ==-O$D FFp7m?8Fz FXsH9F(Fz$ F :F!F si*xlBkxhѨx@(dOpBx)?)j $;op@B7x)y ,y, ly,Ѭy,,Z( (y(hy(Ѩy()yOHyiy)yxxJIII $lOrB2opBB0O 3mKE+(Fz)@FOz"OpB op@BЩx3H0Ix0Hx+Iy$/lOpO :B   op@BW+QF@0F`JFCF0F7H JFQFC QF`0FJF3m[EDٺx0F73QFH ZFCD  |C=7>>>u>^>FH KH FpGHpGHpG>>>v=-OFF FFO 'P0BHF )jE!2K P@F 3F8 2 6H9FZF5I ع#I 745  F9FZFF)H)I #j+b#%I2F(+j#bF F!H9FI2F (I 3F9FsBFFHI (I2F(#H FBF9Ft I (I2F>">??)?t???? @!@pF$+mBpkhBыYl`Q`-AFF IFFRF0*F1F8F  IF *F;mB4X*O30`o@=-G"mFFBO %;mBHFHj j 3FO]hBZ`0V 0+ٜB؈b21QhB ёh,F" FX,$٣B b 2 F)FF-HCF*F1F8FI 5RhB)2F,$BH"F)F BF)FHH#F)FCF*F1F8FSIRFF  :mB!chSE =RF1F8FH"I e`tX,@@A8Ao@-OFm hF FF_C8FyF@eH9F]&0F:F!f#lfFci!ipp+pOsBopCB m!O|opNB7&FFhCEz(Fz+p!pj`OsBopCB &&l!FPF"r((Fz&2F(FIFHFzOlX `bEO)rEn2f2 px3lf"Cl1n2fFkFn2f1  Bp3D`n2fI2 3,mPFh"#h+[FYEBH&g:F)FPF,B=wA-GF` FFF&'#mB #k+kY5!lJq0F$0B' 0# 3+!,0( 9FPFV;F*F!FHFCF+ 6Id0:F)F FF7nB"F-H3-I M!lFhK#mB1n+ X+$J)nHc!FHFC!lJ"mB(+ X+'"mB + X+'#mBn'JH I "m#B/w'iX #d3AA"aoABAhO? OBڼB`\&knx05H!-OF7аFF_C1 ;D,3mBB  1Drh5nPFU3h#BF+FB@E:FPF,B#E#BFPF+FB@E H Hi ;:FPF,BB$YEB,BH!-OFFFVF+q/+/H+I EpBlJB@FJAIF1bRF+F`( AB-#B  HH ; _BBBBH!-A#NF/'e 3c~@F*+FB5FAFf|F$h,F ?",+FH!K Opy4Bh %pGH!-OhF F /Eл@ф m[E@̈́$O3%F'F C D07 *3 X0`3v 3F #  BBСHl cO3=FsBD00+ @[#  BByH(1Osp 63rx*E*gHF FlHlI (G(1" AF#(11 $(?sE1 "BDDD(1%DD#DspC(1D KK@!JJKH +II((1C(1 D 3{+@rxQN 2- =F FOr!PF{ ;+K; # !  ( ! ( ! #KB"HOe ;F/FF[+?@HA-@;F /FF3{ BB%/ ' :F/FF',BEBBCC$C=H!DC\CH!Or! 2{ g3F^ϘBOp0# ()D {Qh)!h'-?ӮHF#"AFO32 +FC%:;Op3-=F qz ). D3sqzDs 3 \ D O D (9Op/@opBL[B_r}CC}Cc_i`/ uOrQFO00\-@ހO3 ^R`C@ހfFHLI f(K5wDDvDL opC@FBuuu_#_^5-@2P B6hB`+R`ñ+FHI +( DD#D 0wwsw`IF(@-_ 1BŁHFFHI F(\ 1_v_ 3wL opCB~1su1u 1F۲CR/DBڲ B?5- ;F/FF-'+0\-?PZF2#AF  +FVC?2 E/1B?*HDD$O1 ;F 1B皹MI00h+?9|FFHb#*P0B[X3 3+ChB?[X^F8HX_F5H=^"3I SF(#spDDDh 3 <_FX)FF&H/F$H$I 0 PDDwopCwDuw5wvL BOuuu`D+ڮ--D+ѮDCCYD>uDCCCBD7D=I(AP-;/h_ӱHFFHI DD_D7wvopCL Buwu%D !BmHFF{HyI F 0 1D/F}FqHOrP( x jH Ch55Sh03h0d BkF^HQ^I k(?Y_%d`DBY@FO3DQ_`5'%FJK +B$DO RP0[E?DZ =FHF#!O31AF +FC!D00ӹ T BBΫ ]#K*F+4B«$D$@n khd0]C`Bc`+FFHI (?DD`+ uwwD+ -w P>D>DDESEwEH!+E=-C F#Fi?NOAEF@FxF08HAF HFxF(8Fy1HIFH8Fy@Fy+HbOr!nclСk)#mB"H3 X( +!ShB khC`5 !縹H"I H5F(F mr@20F9F+H%C F+:(W(΀x-T`tX.`+(h5FO`_ph!+&phOr@!+F.#KERE a$(Xp%t#3 F:(ڧ-O ""`=J3F!f"!+PIF+( h+ F6+\P+I F+phh F+&'I F+d(xU$## F ]`h+x@x:O4x5 -Xhx*-+,ۻ-+,G4GBGF F@FpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h`& `lwhd   lm(d  lcd`p`lSd mO(e`mKhemGemCeQ BC p`"P54S+BE+8#FBT#!A#38 FF8F F#T#E#34+gfXX\\lf`|q|pcRcWJFgBfW:F4cbaXXSBBczgfp j $d$(^(,X,cWFH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr  F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3C OsE0F)FBe %`O"j;h]kUC0Fh 2O [br 2PF MTKh*F"QKhFBiYQF[ӈ[Ӏ# 0 #Rcs #*sO 9DO F#cF #爈$oO`FFhF 0 Cѽ0[0ch F@ИGF8%J0hC Cѽ0[0*F2FiFF k0ND #9hOR 0i Kih 0iFi# 0\ FFG!d!!!!!!!MFFFFH(!F(FF 3F:F@AT v-tK#BAH!F(FF( z I Kp@OFH M8'!GGFG7 FF0𵗰FFFX"!FhF4#H0K7## Khk`h hiF F o`o!(-OFq FFF𨀩K#Bq𠀸u𚀐EuX"!F#0Kx68Kh-~`h!h"KOyBFKFC:O{-lBFKF K PFYFlk F9@$;F @2F@Ag 0F9F5pKFMF&FP0  @@!C! (x ں0F3U30RhC0 t o:!`o6"VBFKF K (FYFkGFWF 3U#0+##C8 VF C300 Oi" Oz2H m  $ K F%JK H    J JF! Bq A 8 @@l D 6!!!d!j bb Jnp DFk fjf! Bq  JFAFKCi+@ i% k6BiF*@ %i oIc0D0 DBa# 0 P  @$C C^I h)REq 85L @5DAF CiF+AMI"iMH AFKKh{KHR# 0! 0kZ#!# (F "F8J3IhFD5H(3K,K0hOxOj%i  a@a8 K"`7j 4F$ b an`@]f !GX!G!Gd!!-OFFFFBB4(Fq Fb "##0 0 [kZ##F uKhuK)h 'O@gp :F?4p(F8))FOs#Or"6 B0eK@ Fh *F0F F[KhF0ZkBiFr F)F$%F F)FjQF"iFK(hi iIk DE" :Kh+Os#{+Cx!F z"#F8F"HFQFr*KhD0FAFdx+0FAF]x+"F+F8F)F FeAFhh0FI)FF FD0)Fp F=x+x)FF F2AFG0F-C3C0FAFF@l0hPwd!!!!d!-OlMF F!X"F4)F FI@@F>pCKHOF^ F)F0+U0[2C ##; lM2HT3C1FC3CO2C@! !H0#X0K0F PhhFi##J2CqыHH(щK"`oPoH0cL0" !zO#?F FRH !ȱvJh3`0tHP"#nH(ѮS  !F@}8yPXFQFT0 + PO^p@OHSHtRH(`" !L0#P?f H ![C"#f#X0IF02 - F)FAC;CO b# F)F#BF?? F#)FBF@^0ZPi )FC3C# F+F H"Fq??FH3F.Kh+ HHX!-G FFF@FE&=L ;KhS:Kx;"9I0FG%#"#F=F-K,KBB7 'I(Kp@OF%HNv"HAF3hSKx- 2H3hH3hkx`GKlH(K"`-`!X!l!I!GFI#I:IPI\I!pG8F M+hkF C +hkn+h!kFiP F8$d!Kh @pG!KhpG!Kh )pG!-OFF@(q^K#BsaRcBOpAtOy0kB Z rIBFA KJhB;JH+@*F;F(F9F # \5@IB΀FO`0(^C Nv0XFs,I Bw: QFvBv O)Jh**F;F)H%J\5Bii(h2SC2HBr2"FKF vF ABq  Jh**F;F H0"F H0KFv !\!nITIIIId!(q-OFFNK#BALH"F3F882pSx ИBv BBvb\5 F 1F# PFFFF 3 D2KBiC,~OrZC " <bDBFZF# ;n  @ @;iA CAqEM*hi#a:k01Fo#(` F f#0 F1Fo# Khi Kh# ! JT!!!d!J F-OFM@BAET@EAҗHBFZYEs d(FjIF` \5 # .@FFFF 3 tDKBiC,~OrZC " <bDBFo# 3n  @ @3iA CAqsnDgN  @ C qjPFC): s_H]IsS#FkhlYKhñYKkiU5O EQH#FkhkcKKFJhk+ #OsDc sF5 `  O  uUFEUk]E E+Kh{0(T5OsETF5T E `  O0UCEs  5O< 0SB` SB`!,JT!!!!!d!!-CO +KFFKFp:F C&H*F3F$L{F;B22k VV s8UH0`E@K%c(Fh+ OOxAF F`cF8F `bbbY0`b)FOpvc(H Vd!OJ!!tJLkvJ#c!-OFdFF0+dLKhkTF Aq (V(VCF80vF(}AKHFAF&h j>K(FhS"!`(C"@S f #3FF 2p(O zEغ $'O'N(M;h1h(hB7d1v+hk#H: F87A?62O`^&0X5X6B?BV`+h;h(`d3;`3h*hY1`B#@d!!!!!!J!8F K Fh KhS" H*F#F#BBh8!!JpN3hKMh,hC;+hB 0hvW(hvT#+`3`pT vL!!!K"h pG!-OFH0$ FF+F ChGFXF $ K*jF(@.t0k{0k_oCFOzFB!pI1JFSF J#BAK(FhKh+>ѻB"iR# B#33JC " Di  ZE# 0oK!Fh!jhmKBmKhRoBJܸEKۣiO #aO aHih Q;@hC!Oan(FYJXKTHihȱ ! Q+)  hIoYEIK!FhA+HI`FJF@Jih)BS8QhPAѕH0+bV _;K" @@A`##6H A4H(FGt(JhFa )H (J!`S((jo[(FGFТi"a2FKF(FTa Oi 6O !!!d!J!JK$K!-O\$] hF F`+# `v F(0CpL_ Op$(5BOpq ۸Hh<*qۣF2C *n+)F"  .)FOr :kU(Aq% FFF3B2FZ0@΀+ȀKh8u8@@uD%BrlIm@r ' G BC'bHp+P@/2+/zK"G@A`##uHGtH(@0F+0khCOiHhK"`56 -_Khk#b0+ 4.k #O sCOzaw)t4PwєH0+-w{KK"G@A`##h&H&J1;A11H0+   #o!F(F!Kh˱IOr(F D#p@H(;h+ I" K`GFX!xKx!!!K!!0F FH#r !F(Fx) )HK+0#p#KKK-OhPF F x+$%F F)F $%؂&#Bu8#BB F)F0#ZF FJFO hR Bs>V! .8 &^E(^F0FuFH F)FxF+4EYh!S FBĀXhu|K F)Fh C `gFvI ,\5Bii(YCL|hġLsȱPFM08F cK h*+_KzhB#B\HAFYK 2YHUK" zh F)FB5zm 0 # ACq#@ C 0;j;;b4$;4L3B2$ h:`OR8Khf1Kh#Fa# 0pCOг O?гO#3pi3aO  #34+?|!K9Fhs#3pKh8OO8Fw F)F qKFXFwC"ц#3p!!KT!U K8!!d!!!!! OxD#e8J0  Xm   +HH AFXF-O[ @POh!#'J13A1y#Kh+?>3sp8{b(н Oxd8`0[m   +H HAF8a8baXFO[+KPfx!!-O\FKFPh# 0I#F\Bii&ACCshCsPF0 F FqKh+0+mKbhB#BjH1F$X"! fK@F9F8UcKhF+@h`h\mX(F ##X0+UKh+SIOr(F @F9FJ#pX0+ #  PDJ1;A11,Rbh@F9K9FB05um O- ACq#k\#kT#j3#b4$34L3B)L$hi2`OR#Kihy0iFui%H P P0+?@ !F?7ohohnV I"h!T!U K5!!x!!!8!!d!!-OFoKFFnJhhmkypI~! OO` r!O|[B{B{  $XED XC=A ,uڎIP `EKhk 41FX$/  #h~H7k#h|H0`#hyH)#hwH"i3#hsHhqHt k"1 DB 2 ###hDT@OzsRF  E [Cs+FAl p "# ld!  #RF+F `KF:FLHch+# 2ChcRC#R@ 0, br4Z0 J H DJz80^Cf!8FD-JpF a` #RH2#iSH.N%i-@ #l+<H N%l-@ 0X!!M+MDM[MpMMMMMN9N^N}NNNOO@OGOtOJHch+r%%d%aedl(FhORfhnononFn#p00#0 %ShjBOt#0#z0+(H'K"`l+?i#h$H0"HP(?YH`x #B"IH'd(?E#hH' ;#0Fh-h:#0Fb-hA@ht5N{O`!:Or4O-OFH0v+zF3*sɀ*j8F1FF bJv_J1\A +q@#YHMYKh+sXHXO@F+jNKh+TMH2FKFN kBBS;B2FKh;pO#DH( 0?OF+O+h^kOy0FIF"9hHH)F#o0 QOsIq )FF^'Kh32F)HKF8#'H\#Hpj(@gpKh+\IOr 5+h^kOy0FIF!!@!p!.QK!!!!d!\!PQX!_Q!nQR!0Oв_U5A0 -w(F @߀K G1O h(q X@ F(?tJ13A1`TX(H s(@:K`HH(@7 $  O+EцJh*AqI2;)r:Ңn*7ЀJ jhI# hd xH wKhS #vHUi#J 2FF(00ó U^Kh(5+:By5cJh<.y.+L02CDIEGu -w8 '%) 5G-fn+(IEu0+Bo9kC3WD۱0C##K:Kh+? QFT#WF5HQ*0;#WF F,HQF|2  jo   rñ40C## Kh+?d  T*OFHVQ*0;# 4FF FH2  d!x!!?RP!!!Q\!Q!QQR&R``Kh``O@V F ##p#_Jh3` Sp03KhOsBFBOrF g`g-zK 0 00+C`hLhPmAFkM F ##H0w0+K+hdKh+EmXCC5[H#YHXK"`#p| osL`onP`nJMK"hB#OpCeF @ +hCKhZkSVsC3eDe)uѠn9umF4(4KF3N`p O h#H0# kKD F=2hi U +m85@$@5DAqlRm@q # C AC7 0PѺEњk0@FGՍ!!!!!!YRxR!!d!BB#eH1Kh;H>0FH0+?"#####ػ H (8fI"RX!RJY!K!-OO LMN"hjB3Qk0HHDDLT!OO EpBu_X"! |K% K K 0$jB_K`0>\Bii!xCNFWi NwIhNrKEr1 F F*FFB@Np 3BN  -#F*FE9hCBs 4EBT0!FkCFmJ\5B0{#3hlLCs F0i@F ZdKhdKh*k+kbKh.nx@&`O;h0,YFFd hC h+FYIJFXH#;`VKh+|UKx+xTO0BR3BF5sbF1BAr2DTb)X ?FKhC5@$@C!BBO "F3F>Hii%BC0@z+ AFi0@/H)F0B\0CDOF0"J"7Hq(6J"h*@8F $HFOr;h(I;#0#0 'J;hhCѽ0[0#Jpy7'3#7DB<#hHJHM(?BF F0H!!!+TDTHT!!T_TkTSS!H(?䮠_!FWTF0F8FMBF F~24F3B2nC;C#P tFFy3#DBE.#hkHH0 %~Hc23B2zKhyH;b#{b0JF F(&oH(c23B2iKhhH&6#h   !F8FJF F hX!!U X$X!!!VX~XjX!X!GX5OsO sT#rOr!* fgK" 'h*H`:XрPkO< 84Av8F6@vBq{O j[E|u ")F(\DKh3c  b2HS#1I*c(*F*F2ήBB 3FB#00OR$K%Lhi#Kih)"KhiF%i# 0 =#G#)FFABGr3AG  pe!\!@ZYd!!!!!KhGj9FFd 2FIpHJ#` H # 3\Bii+ACC FhNCs0FO i(FK h*+𙀊Kh[KjhB#BІHYF`0+~H# 0KhK 0CK`hC~KhCv}Kh wK\e . jKB `p+~CN2F0d`hNs  @"C@;CAF8d *<$ AC BsUKhVh/@耔 *;j;E +?g:h)Fi`8h6O  # 3\Bii+yCC Fh8OnCs8FO{i2HYF1Kh{iK.Il(aK!h0in&Kh#i0J\B J&\%KhP(KhB!XT8!d!!!U X!!!!!!`!Y!.Y8 !!!KNhKiKh  , \5Bii+sCL Fh~nnLs  @" C@C j";$5+ݡk0F dj#B("jB("0*kB"/𔀪oB(F!aKB  \K!B @ W0+L53QK5`' IF 0CEXػHKB CxBp;@KB CxBp;&Bz75K nWFOh;j";E餉~F80D02#I;Fm9F0FxK+!3OJ;BKF"@X\CZT6Gx.wH2F;F!T!d!U !RY/FFG BLr \B ԃIBF O   C 23GkBBpщ3+C`n0JB S 2C JBFЂPF`np tF9F p"#JC9F hF @803(0$5+#n &\CTkDJzP5XC@ +Ћ DnIB c[X\!AA#@ F#J$5+ݝn'O 1D2;F0oBK$%BFQ# 2A# $2(PBr22Br22 Br22 Br2O L3" 1F(98JhYF5HXhsh;Fh/I* (gЈ"0F,Nb+KORih\)Kih'KhiFid# 0"Kh+G (FN>0F# 0  8 7+CFOL O Y+$BFQ#0A#U \!oYY!d!!!!8!}K`)F$됹yKB jhBTimI qIV(QЂ(FnNjKjhBThm@B 0F# 0aKx+@[KB@𪀙DjhB5qmI(?mUI@C(?fMKjhB5pm@B AJCK`CE CkhCE5sm[]9"6B؀&:HkhBCEvs+n[CE c]9'6O 5r'IkhCE mF[];A  9DH7/ѻ\&HO 5r'IkhCE mF[];A  9D H7/Ѷ @UK`r!U Y8!l!%ZZY-O 8F8F$Bӽ!F@Fg  HF_E 4ZZRM+h %@񜀓C9rS60RhC/HO;h+oGKHHS$+hDN)hORDi =KihH5F(F mr@20F9F#%Ch ! !  0`pG FpKh+TFH!FH@X!"[?%KјBB$KB?#KB#KB"Kh@CB+#FFFBKBKBKBKBKBKh@CB#!FFFL#`K`K` K`##!F FO0TTT8 !T 8!!!!KJhhC\5JBK\5Kh;\5 JBK\5pG JB KJBK!!T8 !T 8hpF ` FChK`j bˆ6q26pp"200000000mekc#l+dmeH3OrH3L3L3P3P3T3T3l*q*p "dn)F Fp@#[hpF ` FChK`j bˆ6q26pp"200000000mekc00#l+dme&H3OrH3L3L3P3P3T3T3*q*p "\A\@P"4a`h"44444 5b 5cnRkf0000P5P5H5H5cCncc)F Fp@#F:L F$h|@, L5+]K]KIhhB[hhBWiiBSPiYiBOjjBKkkBGPkYkBCѐkkB?ѐllB;llB7mmB3PmYmB/nnB+PnYnB'ѐnnB#PoYoBѐooBBBB \\5 ]KpG !K-OhLOa4??!ѤILOxHOS*FCFihhO1\($ڙI  0F FFOQFFi(1F\(|0KhI Kx IK@BhB@сHK(H0}H;0qNiFNyOORi8h09hi@Kh *2H8F0*GJ `GJ`e(@JDKh#hC0CY-I|2F(F h0;H)F0;8H)FAOs5IP3I(2H)F.X-H)Fh*H)F4&H)F#H)Fp/H!H)F!!!\!\9P!X!\\!!!`!d!!\\D!!!]4H]R]}]]]]^!!ObQFXF#FFFϐ)O*VFɓK6X8SEA1BFHOsEq黐uHG(?sO%Bߛ #8SE%"ɚ@;`p(OлBNeKeJfIfKfHfKfK]IF" O3F)/SBYF0XD[TZF@F YFDJF#ߐ(Fn}:F@Aq[I 59hDHBMCJ+h\7FBѓ0+;.+h 5('18K"hh:76HO04H)h2NOR 5i#s 5"-Kih+KhiFi')# 00++h"H>!J+hh0*LJ/CKh+!hJKH) FF\!I^!^^^^^_h^._d!T!P_x_!!!_!\(_T\!#hLH!+h@b^oRHJO|jEIBCk `"J` "BC:Nr wwDAGwC w`DvG *@ܠ *l +h*@𣀓0+#h+N(H)h0F0"!Wp0L%P%Or0#X30j@FdQF)hOR0 Kh#F5# 0N_!!@`!!!!!0+#h+Hm)h"0P%ORc0#X30KhhKh#Fc# 00+?W+h !1c#{H#H4(')hOR 5#c# 5Kh+Kh#F&# 0+h0+(هHH( )h#(OR0zyKhwKh#F# 0+hkc)'rHpH()h #́ORcNcKhaKh#FS# 0 +hRL%2@A+hL%2@+hlkB0UH*hk[Bd#h+@QH( HOR)h BKh@Kh#FBJ# 0 0+hl[kB0=H]*hSk[Bd#h+@6HX( ܀OR)h'KhY%Kh#FT'J# 0 0+h%KZ\JKFZ)P AF)@R  +F#h+@\H(=POR)hKh_!!`K```YaDT`!|a!!Kh#FxJ# 0 0Ă+hĢ ,%*@60%45BB1НH+h0e4u#h+@H( OR)h,KhKh#F1J# 0 0+h(0+ځx)5ЂHx0++h <"x"(%#h+@ʁxHn( OR)hrKhokKh#FjfJ# 0 0)h8%<5lCBB4bH6+hblCB1#h+@WH-( OR)hQKh.JKh#F)EJ# 0 0)h@%D5lCBB4BH*hlC@5#hD+@X7H( OR)hj1Kh*Kh#Fo%J# 0 0#00k+h *? +h*ǁK 0+@{.hOp@!FpaL(@#H!FK "`ܹH(ԹH(̹!`!aDT!ab:bb!`f`!!!!)0BHT+h" #h[HQ( OR)hKhRKh#FMJ# 0 00+?􂭆H2#h+0B۱CvH+h #h;H (f OR)h|Kh zKh#FuJ# 0 0CsH#h+oH#h+KDkH#h+yrZ! *\BY1R)jB`]H#h+YH#h+<)$TH#h+4-PH#h+mfLH#h+lC8%O|lF(@]IiK h7B'ЌKh+MHH (AO3O29F F ?@Fpp# 0h (F"zH0+gxH(i#[ ܁rH0+ppH(r#[kkH0+xcH({#[B/":*/*@^H0+XH(@# F#qcqziFBRORH};h+@IH|(@iKH~0+#O #rcrr@F 00I =Hb0+#"ct"t@F000# 0y1HH0+?O2O3! F n#@F00 # 0gH$0+?x7'i#8F;q{q# 0o7Tl!!H]!!!!LBALcDTcJYd4dKdhdX!dR>d,aFH;h+?Ri# F#qcq# 0>K"`=Kh=K) OrOb`08Hv-h7L 5s6 #"''pY+ɲ.kp03B"!p",H@S)HR#x%!@(Fn%K!`F(Fn#K`,  "HJ#p`J`JZ!)?HHJ+FHZ BH"8#J( "R!!d!!dp!!e4aKh IpCO س_гOг_ KhK PBOг@OH !\!@eF5Kh5H4I0FF .1Jlx0Kh+/H1F.K p -KxxC ,H1F (Kx+(O(M1F8F'Hkh;k`+"HIJ ,kh;k`+(F (y, Y,+hZ*`x竉ջ+hZ*`x +Y,n,N,X!SeP!!re`!!|e*9hpF KFFh H2F+F!FVHg pX!eP3KOp-A$-`0K`0Khk9Fo-H-KOaaOp @ao(%K9F%NaO @ @afq( F( n89FFOpoF(,(Fn63h4Ean`+`5`]`O 0aѽ,+ѠF!!d!e8!!!-OFBKFFh ;"D;RBKF7H"FK!@Fv2H'=FB "FKF@FF(8F AFFKs#  B)K(FhIsB) 3D@OsF FF H.70DD#H"!eee@O!-OFFF8PZ3ZFDZEK"`H2FCF$HE O!þb9FJs# B FUHsH0DD!ee@O!-CFMi Fu3K i3Oh42I#B9F0H#i%0F Pea#i*KBE)O,F.F:kL3B 0F#*FIFHF8hkH$L4aCCsAn  @"C CH@IFhK0#*FIFHF;h4kD;hPB!*f6f!d!!! 0}pG-AFIO hIn ;h 5C"3;`#CBBK!Fh H{h2F3{`+Fih\e`ad!d!!!-A F MF I,hBdhBHd`  G C!BB$hiF F2 F`Z`+he`#`\`i,`Ca!d!\fpF FF!X"hFhFe p FhF)#  H0+ 2 Kh[ H##`  HF H(##` H3X!tfhffpF N Mi3h)h Kh32hi(hp@pd!!!K"`pG!8FL FTBA H Kh Kh #T0BXhH8!f!d!@-OFF FFFBB ѣ3C F@IO!HFAFx;+6I:F(FT"YF'pEEOHp7$)KFhiFW8(F)F;FF/"G,B'F3C #0b9F(FO!|K1F FFK6iF%?#?;p<#4C0rf=d!\%[K-CB}F F@𩀐0+)U h#O`n(`(hOHOb!FLKhLHKJL5h*8IN3OOx3h)hFOHhF Wq:F3hIFHF|iF"2 E[!;3h)hFm(h:FiFWp3h)hF`020204#k$ \3#j$ 4$bj04#8$j<@$ DH$OR#0L 5L53 #P50"0#"# }Tf\!f!!F F\#IB?ѓ); WpLE40b  WqPEPE@@@ @ Or]K!GOr]KpGT-A0Kh+@CJ`L h(ڢKhA!>IKx+<ПKh+8ОM+h+QНHtKhKhKh+Oі0+KFOPMOR1FiKih0FkKh1F0FgiI h# 0RM& hO)FiMna h)FinZ}h B9iB!H~H((+h+Ф)F hi6n6(Fn3EFpJ#]M`oJ`+h+EaO;h0?\N3h+5hH+h+59hSM#OR0ci #X4jSKih8FQKh9F8FiqCI h# 03hKPHOH((`MKh#MHLK6M"`OR8Kih69Kih0F7Kh1F0Fi=)I h# 0hkB$I1 Kax!SaEs#@ @܀ B@Ȁ FAF&\5!FHBii)XCAqzKhPFvNAsI;h@F pKh+3h+mK B#BiHIF;h FO vs\H h CTZJ0B   `O@D]E  " MHO~2[Br28hL3 kB]0;02;B220n;0AO3AF39MOR9hi6Kih8FB3h9F8F?i&/H ` F `O  I0%D3BD 3h+?T:hAFL$0 $[$04[4 0b $[ 0 Fd!!!T!!!U 8W!!!8!KpFF @P%8 m8 H=CiB iT%0PFaD%@ ap!g KKi i@P"0B@"@FiBa!KFh 5p KBBB BB    d!^F(-OFq X GFFFA(=XF1F(7KhNh[iSE"QFy`h1[A1C3i[iKE K"IFh^0a3i!RA!!A!p!d!!pG-OFFkKMpF$S"0[\OC kBܽ#DJ4K'F[$ S$0kBB 'DX$@@HDH$[R7(Fn*#\(   [@²\@BZ @² @²IHhFn*%\@ Z\"B  [\"\ACIH{hFn*"TX"@ \# T[""IHPhFn*"TX" \C T[""IH&h-GF F $(In IF&n*F +Ow\O ʿCCwTIF o$uQF E(FH! @TFDEB< `F N~8\"@aFqE:ܬIF2B:FU"D.E"U&E&, U$IF{xE$4IFF!B1Ri"-G}FFFFJF F(dI2F (bI@F&`(F(D]I*F@F f0h+XHIFO0 }kk6j`j`+k#akkca#@0#bB0cbklbN/{FI:F@F 40t@I*F@F .0:@IJF \>IQF8"F F"F:I0F&8I0F 6I0F4I0F2I0Fzh"F0I0FB,?r.I00Fl"!8FvHF 0' 0By,BOЪ# (5D*#*#0x "F a#( ,hd@edAChzd@h[hdhhuhhhhh-Am%OcFF)FFyCF*FF@FF F M0:`12(F mF-G] F  .%FFFP *B0`pC_x/!0F$Cxr+b#`dJcOaT!f`FUEB+,F.#. Ft`` F(U0pCODTsh|JOa(F(Fu`F,%&. F (.> F 2(W(΀m-T`lX.` (h5FO`_ph!&phOr@!F.#KERE a(Xp%t#3 F2(ڧ-O ""`=J3F!^"!PIF ( h+ F6TP+I F hhh F&'I F \(mM$## F ]`h m8m2O4m- -Xhm"- ,ۻ- ,G4GBGF F@FKh @pG!KhpG!-OF8KFFF@F9F5KhkOz"FSF6Ew ܀7$$ 48FFO`aq# 0ZY(F]CHKhCH# # #'@#U h*۰mK@FBHi0[Y]CU He( K` !d!iX!,a!)iDT!x!Kh ׺pG!-OFF FUBv 0kBOst8 0(F!Fk @Fi *FIF#FGB " -#FF#$BB*" [EF F *F#F0kB [i+H ^E " ^EBi"a Po^FF Fi#aLid!-OmP` F"C FFF(<F?FF7WEE#љBB*#2FHcKhHp HP(K` diX!,aDT!-AOB F !*NFF3h+Os#FC(F"#M+hkBSi3@F9F3hCKix)h" i"aOR Li| Kih3hiFi# 0!d!!!!-GFiFFPF F;PKhwF8F FFHJHIK` GKhFKhk2+FiRF0F" i"aJPF F9Hؠ0kBOstC0(F!FkiD#8F#`"HFe K (F#!F#"CE i"a*F8F#F0kB[i+ H$ !i!!d!i!iKJ-OLFOKF#h I rOS5QhPnxS+0;O #h9FH#Kh+@̀~H(@ɀ#h9FzH#uKh+uH#hO#hrH# #hFpAO#heH##:F[Kh+\H#h/"HF#]!h kBZi*?O #hKD #hS50RhCGH9FO?Kh+gDHZ h1F #h"#F"#hkBZi*}6Hi4K5H4KFhByB Py0B҈3B)H9F#i#avH?EvH(>K "` H(dH(433d![[ jX!K-jxKNj~jj:Hj!^FF^j!2H!}Kh+6b2F&ltK`FtK B!rLO3 h 8F J(рE ?ā# BGi#a !h. (F k !O 0 lVK!"J&YE 6Z&`O 1 @ 0 8F(H 0 +O +F#k4FF:J2  B0Q" \AO2H 2Khñ1H0 kұZC8F0kB;(H'H(%K` 3h(Jq iD  0kSCAqBO  i#a`4J [i+ FQF!x!)bjX!,a kDT!d!LK(-OKMFJLKKKNF#h#A@GJFJh"#F_#hkB\iD;H)FZ 9Ji%p FE ؀ؐBi#aERF8F  (:S$4#1F@F### %0H2#8F### ?PPF( K` 433d![[!p!j![k!ud&kX!hk8M+h %4JLBH#h 8H( ##CH +h# #C H #h+( d!^FX!nkPkk -pG-GFvFFFIF(F:F3FF8FO`f#TD&O` FB`۽#D# 6P I-G%@F4FFFF F! 0_ H#J ## `:F!q F !F  @mH# :^F: F^p FFFr2Fk2Fd2F]2FVppFF F((*Fmep-AATB A ҅BAӃ Bt ҅BA E|   Akk@P!ABBh-OFiFFF%󅰃@B:K@J19J:HriiBvFF"jF bhB# ( XFG XCFCpPF ]DD#i  (XF@XC!FC)FPFbh7FYGBvF>FVkLki!@BK@}1JH6cEvF5FdF=F|qE$ 5FF EF BuF5Fk\kpF%+K@,1JH;ch BhZ`Bh`l#kYk(bk5B#K@21Jplok+ljFKh[Hjl# Fb#`k3K@!JHx k@l|!Bl+lkjF3K@AJH\@ml F@l[lk-OF-FF# -Nе?9+$+F $<<_<O1Fd0FlWP`hT@Vh3DP0 0O OshBihPFBB$H& FiA B43BFOL IAQpPFI,qBB K@ 1 J|!tlLBAWllklmNBAW_m,mAFPF6I  #k`40`@0  R#`H`B#803800O/FOs hBji&0FBB47BFOL Y AQPFI80+K@1J|;80h BhZ`Bh`ln6I HO$PFF^PFPFXFO l>m-GO CiFF j3K@FQJHO0$k)FF+kS(p_kkCE0Fl' F#1F(F#JFQF(#IF0F#RFF(?h\lk-AFCi&F@jF3KOVaJH1F FY K@aQJ:FCF(F (, F$\lkm-CFCi& F@jFF3K@qQJH~1F(FQK@sQJ4DI "FKF8F(#AF8F#kF2F(F(F\lkmK-sCFh F N3hBF HKFBF0hKF!F p|!!mK-sCFh F N3hBF HKFBF0hKF!FD p|!!mKMxQHN$O+hmB(hPHH( @(hN2hR[m8FS4Rh4!!m|!Ln,nPL h@j ( hS##`!7FHh(j,)F0 F!8F FKhñmJh K@"h`B #BB  8@n !!d!pKsh;+oKԿO@bO`b`lM+h Et`) gHcgHt(W a)7)5aHR^Hc(^HX)h]LOR 5i#s 5#d3#a3UKihXSKhiFTi# 0#$F !$p#x3.h e3#F FCH!PAH:H)h9LOR 5i#s 5#d33Kih1KhiFi$*K" *hd3+7Y)7ؒayK+.HH(?j!HL)h#ORa3d3iVKihKhiFi$] K" + FpHF\!|!d!znPnn!!!!nnoI"B@ #-OF 3FKF F  h3SB/F=FѴO:FIF0FdCF ѰO;hB$@F(]# F#O3 #??FFS kbft-h- a-7b-$НI FXi +R#}c}c}}c}c}c}c}c}c}}} F0 FAF Fn FD#AFF ;hBЫ F k ##F8mBqI2F F(F7.q F F7 hI2F F1F F F' 6mBmB]I F7FF F 0 F0TI+s$$## FFHI# F FAI X F:FcF2SEB FB22B;B2 28$"XF Fd0?o1F FFFFcF2SEB FB00[@;@0 08$"XFY F<0?AJCF!PFG#I F%###rSF2* o|0-oLojooooo-CF jF FF&PNEBF)F F*F!FkCc8FC2F)F F6 k#c#-OOF FF 3:F1F FB јKhB4ЗI mb(#A(%L(АI k kO0c(i( (F0(F (FC#H4pCO O ,FF F  h! FDF2C,mI FWB"ѴkI8p0 +`b \ $vF( Fj WH.UI F'.8Fk6k3QI3x/+0F3FNJNI(#$kFHI0F!0  FDIs0FN0]pG3FS[*hk)FF F'0@pGF04[ H ]pG-O!FFFWF@qI(FO0'nI"R&ih a F\B 4+gIJF;F(F Fj 2$XF@) F (F#Fh0+4+#(FRIYF$m4B +#(FKI@Fjs+ 6AV "#DI(F#CJn#AJ(F>Ie#"B#"(F#JF;F4(?~VO##F(F# F(?f>C@ cVcmXFDp b6Bvb $*J![Fi(FI"(Fi#(?*{a7#mBؾ'Frrs+sOsvsrsshs-O!FFFQF0oI FO0!JU#B4+hI2F;F F(Fj #pFA\)#32*V6+)YI"# Fy#"S F###"#m((Fj ԫ4+II2F;F F{4+DI"# FpBI2F;F FD#"S F##2F;F9(xs0s+ P [ /I2F;F FEр$* ,! FQ$I,0*+rO FOG(?Aha3` JY FFHFQF F0$rss0ts t&tBt-GFF OaFj=F8yԉH1Fp$#Tet@E#!$4###F840FOcvF31FOb F~qI FC FlI~ Fja0gIH4$$pCO(ВbI$Bt0^I$4#]I FHU2C=YIb^0VIU2C.TIdF4Os$4U2$tCc:F#@FIFC EI:F FP#`EFdU#$t@FIF:Fz(Fq FFF F F4Ir4CBF0IKF F2F+F F0?_"# F#'0?Q"# FBF?Gȱ! Fбj#R вBs F0?0 F2e#rttmutd@ttd@ttt(uDuF4BB* I0 I Fz4 I"F F@d@zuu!F1(I FG ! F$  I! F! F4I4ju v1v-AF jFjF&1YCh&ae FAF a(F0I(FO09F(F0I0FKvav$ʿ$ Ŀ9!+OտOs Fp!Ap!AOaOq!pGjXm j0pG$4jjPm0pG $4jjPm0pG-O FyF(C*#MFx!IF0F@2FI&(H FFEF;h#h+FRNEIO0 ZFW&06H#hSCF蠱1IHFFx/IJF(F-I iO0)LO`i`&I(FiTE F#F@2!d裉ZFIJF(FhTE F$ ! @$(p~(F0x(F{| t&NH9$ix{{FF (!FFiX#vT3#3FHCjji F@i-ODFF.,#h  J Bq %  J  FABsD€@F.1SF^I$isiEBEEx(- @ F.QI@Fa%F#bcbั(-IKS -HI@FFKGKS%0{(CJ asF 0 QF(Y bCb#EB aiAYaea&`a`k#M pBB!iMa%a2a iQF2[BB k2ciaCahaeaCi,aa a(FI@F4[ I@F%(F||8 }||&}|-OF, u/"F+FYF^C"F+FKTF;hCD "F+FAFFC "F+FHI FiE 6i2EB [  лz  #4C %-I Fh/hx :F1F F CFv??FF2BB2 A:B; F 0 F0?x F# I#JF|w,NoD-OgFW#F FO#JF1F(F0C ѡKhBРI q( s("F Fa0O0O# F#"#??FFEA6U#I FW#$$rGaHEq s*F|I3F F! FF [ uI Fj! F oI! FkI4! Fjj Sj !  F 4(_I F4hh BBѸUI F Zj2QI B fEzKI*F3FtF"  EI8 Ez FF3 aEz;I} B A0-vCڸ;=F*F3F! FL0?! F jOf)(@#I F,-v BA ڸI F1I F, )II F-vګ|@Suhƒb$+F> I"N>HJ!>m>Hm#8$!HH #RH* |]?Wn{h"6$.6: Kn:f*oB (КmQeppGIh𵽰 FFBg( :,468jKH=@,>CHH1kF  !AJ@Hz=>Hv:H=Hp8:H:H:H2C3H^6H\#jT!p RD EB10),H+J,I( F)H=@Ϳ'H2h $!8m#jFAiF!HJ!#FJH1+є1+HoFH=@~r”Дڔtr-GFmJF H~J |H|H(FzJ{KyOFFF$ F m#@F # @F i.1FgH#!#"ji &j`J!"3F!B3F:FB"j XI""WH"ni+Nр!TKB:FRHB`BHF\OHZ$ O O@#3!(1$4! ?H6 qm#8$!D9H(8H& #R5Hh$idB-HB:F!#H bOaPF#1F#"jiN 3i+;+#j83":F!\"HF#jc d 1bb<0/*18h"6>!ix:8W-GāF FF%BF9F FC`KhB"!0F\H;)F0Fl( `(a8 (    %u(x( NI F FEE0F00FbEEE+s0Fx!xi+ sBB )0Fi+J +H"*J (H(Hd0FK&J'KFFF/#@F  #@F 5 2iPF * '#)F#:ji6 ?iHF|Mh<0/*1C:Ww-APF FnFFC 7F2K    h3ScE2FF(K(N2FAF(FCFı!I"8F|쐱!KhB J;F F"i*T* L*I a+, FE0l*ТsH O09F F0|վ|2Q+B@+pG#𵉰3OF FF :F1F(FbC(+s FK!`i+Ei+BvBB<ԱKhB# F#"#)a8 (!$I  F+0, F, F=H] i|2h `Èˀz rF /0 //B/pG{ {S{{zzSzzӈhJ ]>-CFhF F ڈ z Zz ۉ0sxs+sxl+O&F"iF8FVp#*F FCjF)F FD'F"iF@F:h#*F FB7/67.-C FFx[PD FIF[  7"I"F 6 5  3 2 1  .  ( ѝ0 00**+4'EF1F0#S˄7/O0opFpL&"F@!hF6hF4G. pFL%O#51F8F-pFL#FD F5`ir)Fp@p-A FF(?4;;J044rABOA64N  #38NC0 C8dCS00hF)F#@c0 HOCFI FO0'F:FAF0FI F{0FIBI;F F_D0F0 CC0瀜S؀З-C FFF(0ICP,OȀC +K #    :F1F(FCF KhB#JkF FJkF FU*L* F0a+( I = K  IFhj0$=0|}Qt&  FFIhK8SB@!FFRKh JS BB KSB@Ih$!-OKFN FOF2F)F FzF3 ѠKhB ПI ?OǾo+;hF($$*ڔK!JH6IV(XHFAF8FF(M8F~I(ƁI:F(@HFID(FgL2i;+.FF4jOswI"FhOF1+2F8oIZFP(F6lIHF8F0!(FhI`(Д!(FeIX(Д!(FbIP(Д!(F_IH(Д!(F\I@(Д!(FYI8(Д!(FVI0(Д!(FSI((д!(FPI (д!(FMI(д!(FJI(д!(FGI(иѡDF()F@F(  4r 9IRF8F(?|6i$5IBFPF(q5j1IhF0,?f Fa+J!8)I F (*m*%K!%J%I F (#I"FNt&|8Lƚ$H9VqUҚޚ*+:Grfpy~S}oF(?F(f5jO h$3j3B >IRF@F(QHFI6rBD(IBDHF(rIBDHF(IBDHF(rIBDHF(|IBDHF(rxIBDHF(uIBDHFx(rqIBDHF|(rnIBDHFr(1++ٿʱ O31ȿOs1Ur_IBDHFT(?r[IBDHFJ(Bs$$AF$4BP BF(?HF,FHF.$$3FUCR??@BI"!0,5I0F(?7( F7Io6I0F(?$ (0I$0F(?-I&0F(?*I(0F(?'I0F *$"n I0F(?E<ISF F-rVqfUҚޚ*+:GRvy<9.$:"@DF$*FADBFT$4!??PI$JFADE$1F@F\%FRF`FJCF8 hQhO35 $0 600 40ˌ"## IF P0#T0B)FX@F<3F$$r??%In$$AFT$4B)F@F0`H0L0 $4 !>?? I:$$AF $4BnrpF" FhF!ah"hFphh3SB"FF B J IT IjFCI JB $pޝ'i!!pF-PF!Ұ#.2### C## #@# 0"K,"'K(K)K*K+K,T1F(F Rpi@i!iPFxhFM ]KKpFx +cHJhx Bxm5@C.0@I @@BV>H A i(DА *=#@;@B7УhW iF/Hh`i# Bx3@C0$I @@B#H AiOa J#qFH  pFH1Fh`i# Bx3@C0 I @@BH A6ѧO6!!(<Jwv 5sF J IhI "(FF$pah(FRph[x+ F*h`h $hCh/hB(Fݹ-OFFC BFxJxI (F9FsJtIFbh hdQFhh^oI(F(9ПLlI(FF(HiI(FF<FfI(FF4FbI (FF(1Ѣn# (F0%NJUISI (F(0+ѡn)|"l0F,0onJIF#  ***ѻ YF[ kױ:I9IRF &(AF4I 09F=C"l0Fn"l0F!n0bnl)lckB(Fh1+#o˱!F(FG0mI, "l0F!n0k0Fm0m}ޝH*hݞ-AFF$ F8FFȹ F@1FF8F:F0 F|(FAF F((FF((FI]X -AFFIjFFF+ CFO0&8FF(А"!F"9FpI0F0н #FI@F*\iF0 F@ FFjF0#`O0BF ?#8F"FF(F2(!f FFFDF0#`O0BF?#8F"FF(F2(!@ FjFI@#`O0].pF.IjFF(,K!,J,HJ,I F8^FŔ1)9XBaA;@!F8FI0FF(Fx`I Fĕ!f IFF0F|F F\-O0pC(,mi0,MP IFC  0 7" Oa2J p^M#x7# OaM 2JpN#xc ,M0!F(F F0D!F(F F0DiwŸpIFNF (KV!JH FlFFh3SB"FF IjF(Fx0I pmҟ,iF"!hF*IjF FVC&iIFjF0KOaJH>I F;C!0)PBaA:@ I F0$0O0 &C#(p*iisF FIjFCF0F$T0K@QJH FFI jx1BF JI ` I(FTJ I Fe pn({*x7 F F0J I2I(FhF0 K@A J H0 F I KF80Ơ*7 F F0J I0 I I(F(F0 K@1J HhI F80РƠ*pIF@O5#`(F$pHE@-I (FelFIF I+F0F0 I IjF0FT$FI FeZi5𵉰IF8l#`O0 F0Fe+FI pFI3F8FZ0 I V I8F%V0I Fe(FBWipFPCHHH](~ 𵅰  mIF0I 0eFI`I(F0I2%OBȿB Fe  1F8FJ5xi ɡhsFFMF` 1F FQ0I*F FC(  pFIFFXPFĕ pIjF(FmF&ĕ !hFtIFF0FF(Fj`vi p FIjFFV0K@fAJH!F(F0O0 p2*^BbB;B2@ @e !2F(F I FFF(F&`C C(*8FMICF(F$h0 K@1 J H) FWI e 8Ơ*xjF IF8#`O0" F0IH\ hH  IFjF0 K@A J HR I FM0H0 &8(*i? IFjF0 K@A J H( I F#0H &N(*iRI#jF3I |%]i5 FIF0K@1JHI FZ8Ơ*F08 (٣a*أWA*أ=,#`O0P IC C #0I & ]ipرL ! !: J H` "FbIH(^jFF J Im!H^ONL!(>FHTKI"F(;FH3FBKlƹm!HBJKIDD(F"F H,(F sh(FG6h|pv?A`pGA`pGA`pGA`pGJF `l `dpGJF `Qm `SepGJF `m `epGJF `Ql `SdpGJF aQn `3SfpG8FFH0<#`O080 +$ A;+,#M(F>(" #,T CK \H!JFnpG BЀi-OTOK @@ DP@Ox0GI 2(DIHD@E FTF80gYI :!#pUJOaoxp#x۹:##pOadp#JJo#x+!FPF F0D!FPF F0DchAF(FG$h7I0F @06I 6He-4LH0s(F(0K1I0HAF(FH0I0{@ƀ`@,ǀh"AF(FGi"9FJoI0IJ0FD0@єIJK) FFiޝvi~iiZinH!p&iܤФ;M9NV#9H`#Jd#R2I3HX#R/I.Hh#R+I)H}j#R'HZ#&Hob#Jf#RIH_\#RIHU^#RIHK jP@,?;ch(FG$h0"AF(FG ]ǦΦ&ئ-OF FF` )F F0?I:F TdFF@9J 9I8 FvF4I 8FȐ1KO0  F@F2 'YF8FlꐻYFPFdP IZF Fl K0hՙL0hԙM0hՙN0CO06[AF F F (-h. Ihh,H!X h𵋰FF8FI I(FO PIjF(FM    .0h+I I"0F J I;`;h I"F | 𽆞^!8i(hhu FFnI#FF ^뤪-CF!I FF0KOqJHN4h NF(FF8FFȱFHFnCFJ)FHF$p$(F$dD K!hFhhCZh%"`J IjF Ft0 I %0(K!7is FnFFH0/nF H$ M NnF8  Hp!F(F4FhN$-GFF|I 0FC BFvJvI P"!FhFM    nnIjF(F>0+ј"! iI 0F0bJfIeH8PcKXh !FbHxB:ZxB03 YH!FN!dnFUI jFLI(F0QImnFOHOIKB LH|II@) DM:Hh )h)0?H` m (K F0GdhBьE3h1IB""h.K(F-H6@F5+KW/B3(FmFPF"@F 8hIF #6B 5#'Fd %``ޝ8i(iɫЫh;"6p FFF:(`P1F"F\F(h<.` F8D #`O0h& p F&-AFFFF<*#`O0 ~ri)FF@F0 Fgl`𵥰FF*FF8 #`O0%#+~!z(F #ji!F8F0h Vc`-GF FFF #`&j(BFaC2s3F#Bw#BA "#h"+O0(F9FF #j1FPF=0h@FIs`Fh~PD 4D-MOFFFFFE h8 c;F0$hj`O0FFļļĜ40 40 0 0 pj(86hkbbd-OFF# &#`O07ih)@9jh)@ IhF(@F"n@FF( Ii,KFD/!0FF#;P% C #5#  YF0FF(@ i*p,@O;0FdmК`@FcF(2FQF  `VAF(FF(Fdw?xziCFIF90?oi+/,,YF0FF(@oJ3FoI (^Q(?^K "!-5>\--7UX#`0FO;d'-)UI@F(OrYB?Q)?) A^ [X\0 X eO " F$ Fxr(00FdXպ0F(OsX0| X Y*##0FdO;!"#`O;$ 8FF !YPO;+?2kDҲ^ x X0:,;+?w*lDx ?FF#.N$a- W<+۲C# FA-7<0< ,`!?[x1lF(FdM$JI i"Fx( FXJI FR sh05-AFFFF@F(>#`O0@FTF2 #ji!F8F0h Vc`-OPF%FFFC  GpW;F:F!FXF5g`9hYFhFKFG F5\ F00K+- FB#`O0(  +-#` -GF FFF#`O0:Dj#!ia00sIFPF8 0h($h0-+ PF(( iIaiybh*=C$70h( 0h(HZ #FF)F0F0ck xk`i+a^I :Fh#FFF$ !FFcg8K`T7` FF !FFcQ(KeDa7-AFFF`i0FFB hcaac cF0`ixO05i`ahcaac-AFF (!FFcF K"1F`FC/:Fa0 Fc$ F%w-CF F ,!FFcFFK")F5FC$/2Fb  ;F0 FcSO HF$-OF!FFFFFE8hO  B V"`O0tO  :hO  EJTC<`(hY+ "Fh(FF[FeFG(eh!F  4*h[F(F"FG(eh!F4-G%FFFFE(Fh_h'ig1F hS1FFGFPFk  4|*h"t[hG pGh00O0 BjF*#cbdiL Fj0O0`h$h0jF+##bdj| F h2#Ah+0O0`k$h08F Fce`ciE``a#`a#t F8@O08pư&IF%IF0FF`"I`""Ht#`O0Fp(FF FxxFBI fOr!hF)F/*("0!F/&*("( IjF0F0 H̬ӬHڬJiIHL%1K!-AmxFOrB8< h1`W>v4CK5ͭ)F Fx0+Kh#FB"FH)F@JCxh320x+H&LOBb\20 V@# H]8F66ޭNpP( FC C (7#`%(Fp"#, ۴O,F!(F!A\"T`c?F(2F KL"#F FFCF I n8FFI"(Fm*F1F F@pF FF!"hFjF)F F$p-O<]FF ?J?I 6 {CF9J;I|05J8IOr!r")Fؠ4 <]ah(F\F 0+ћ0YF +"OC 0IF8F 0IHP$h 3CEњ0Mhx[c@CF(ѝ41+ KM I HFޝi!pFHx FCF h++ &pI "!hF"1FhFm"x!F*("L IjF(FF0 bh1+\h/+H" i)Kx;@FHN!9F FF Fgh(F9F$hhKxB8F( IHBHP A F FFCF I I"P( J+yh320[ I"F0F0O0 O0ql:i"F0J IIjF F8#`O0 I F0z0I 9i"F0J II F8#`O0 "FxKI Fn($0 I F50I ޝ9i"C0н0]#HJ®pGh JB ~BB I H JBFpG JB I H HpG HpG HpGPPfPPhJB~BBrB I H JBFpG JB I H HpG HpG HpG HpGf -O EDFFFF(FBBF)F8FDF' 9^). I2F8Ft.#P=$/DYFOD E  c  ءEK<h;Q8FO4F$p%NIF0I I  F0KOqJH0 F ICF H F$i"(,irPI FC   C #C J I6 I F0I 6 ԴiIFjF0KOqJHI F0 I  I F0 I (,iir-ACI OsF0?J ?I?H # #$C c #c`@0O3 1I(FA0Q.I -H ""8"@*JxhY2 R'Bx:*$0$'0;D#DAFPz#`O0` 4 ,x+I n$2F!(#F"3a+Ѧ Ưi8ίׯN$#I F:0JI 4FIhjF I F00I * Ӵi.IH&>-AF-PI°2"F0:69Ԛ9o &&PI .(F$ !( * , . 0 u0𦀝l * pI &&&lHl m."hI(F#`0,0нb0+aH_I(F#`00нb0+xZHVI(F #`0 0нb@)BkQHMI(FI#`00нb@)B`IHP$GI(FF( * , . 0 0(+L &;I(F0@ƀ8I(F06I(F0 3I" F(@OsB-HB*Kx+?{(Hv&Kx+&H#Kx+$HjKx+!Hb H^#6I,2(F:.2>02$+*q0/HH8i(ii1FTi8iii!(;N]dl),.,C0C**+-H xh300[Kx:+* 'H" &H!F&$'i)@F.?<74/?7, ^imH;H L,HF HOsB H 0/Ưrv0 I$jF%DED D D0I(F* F0i8P  IjFM C0I  ]i. IF80 KOq J Hz I Fw0I ڴ(,i-AFFFHF4 FVFEO< hN-O=P I C # D0.OsH0(ڍI vH0'+ @.F##"F(2D !<~(BF'-|K.|H|KFzKzKzKzKzK(!0!!"FV ^멈kԣ2*O |3 SjJ$;2+Fo  O1 BnzqyOa F]IE#\KD pKDOIqDOc1DOCDOPDOSqDOB1DA&k&pCK)F@H|2!0D"0 +v + D '+?o =/ #QJL 33~@B4@B'JأgvA6B$رO &f13?,!!@C;2%2^A$1B٣zcTc2 2PS;I"JoB1FKiҲײ۲߲8$!!#x*+؀H+1ٛ *f;'+mLkmQSkkkkkkkkkUkkkkkkkkkkkkkkkWY[]_acegi+R#7I2+(+fx0+𣁛 +#HJ+F cxR!IFH@cx 3D 0+ЙI0+ЗIgx&H*ĂI7B> ]PFW6"8JFI0+СxH0+#y'FIOHxxcxN;``6vFEݸyyy(yDBPF7FHF0+СxpH.0nJB .r؛0+jH!F{hI^H0+?scHFF`H_IF8'>ZI_F>F  CD ۲+e7(PH^PF  9FJHrJKF0h?KBsBPDJEK`EF@H6\ 9>I@J@J@JBѣys>I'HJ0+?"zy:H@+v5IH80+?!z 1H,0OܐĠ<,6*HOJFRFWFEzʱ±hBN$*7@[PڳfkpұxH$fرP#TJPCIDH0+?oa ?H FF  IF0 K@A J HF I! F+0I h(,m  IFd0 KOq J H ! F0I (&,K"`pGpG O4S+2h @pGSBDSA"Dv Rbb]pGFbFH FSJh+`l! Rbb ]pG Rbb]pGK[h" ##!##3b0HO0]l!SF"! H! FC H!F k0H!F  SSp(eK%[hӱBF! #*F#!+FbW0!FXH@$  % U U F6FHFLHJH$"F DDDK"DIEH4CHRAIBH  0>HB=H"!O0(" b" ^4Hp3N5`"O0Ch+!3h+" D" >0hB+OsB H! FH4h,+OrB+ + O333Hl!THTbTfT5TUTTCUU]U7%SKh#0@pG;>+#`Y T! "D! 0"H!"aVFI aK MF(` IH!Da@([ k`0t! M IFF(F)FHI"F(F >P h?(0TK ! CC !B K`!03 CBKK `0EZ(0TKH!0CC !B K`!03 CBKK `0EZ(0A#!@C%BF#CL`BK`!0K `0EZ(A#ȲC/F۲L`BK`!K `0EZ(ACS_FL`BK`!K `0EZ(ACCOFL`BK`!K `0EZ(A!CCcoF#CL`BK`!K `0EZ(pACS_FL`BK`!p(ьheI!CS C_FI` !B۲I`BKK `0E'ZK"#I~@h]-AF!'FBO@F`)FF:()F4D(77 FhF]I*Fk(Fa `0FkzV-A F xn+Kxo+4'kjL%FAF80Fan(F'x!Fn+ Cxo+0a1(=F a*(ч[IFFH ^V-O]F S 4E3Fh S 3 S)FF3F HQF#@.1FqI0FD 8 ` h+@𩀟I(F(@𢀝Io(@G>՘IMՖIGyՔIAՒI;KB 8A(FF0 Nd!@ k$` h+𽀇I" F4(@𵀄I X `hO@ $4{I 4RF(@`uNB$hhU`"`sh+@lH4ȑ  '0HFS'7B h+FWI `[IF.H `Q S3h+?`!pOER FI"HF #Z"(FFQF FF-C] G%  }H#9F@F*h(0"hK+i )h2F F#sa5DF*H/(I;F2F (hi EOa(F2Jk`h # " 2 h@C(ѣh H2F#H kkKk kjjKj jSi ]L'rn!8F F I"F V#x/+ !FH\)FH8@ 8ȸ޸Bx**I (AF@h#F(F,O3c`#h"!XhO0#hhe`i#"!(F<#h(FiiF(:F1F(FChsFOzrF FhF!ZC(`h#2F)FTpO0pGsFF F#!F`(F##2F(F hJhB`h(ѠhFhF`I*FhHO3Fp!(P(< `0 <pGFFI°B1#>FOR@##" #>#? F!(\h` IF HRH#`O0B B@}o 砆(-GF FFFEIP#m`D3OqB BORD %J%Ih0`J<DOsPFD4.{<#`O0 G K yO O AF!L @aPEq $'FVFF FB&4F_FVFFXGGCdh(FFFFagXFFIH砆/(޽pG-AN} x FF!F@FOr(F)F(OpF"F4$4MND#I:F0F #C h N}( .0F N}A L!D ĕ0FH !-G["F FFGH@!0FnEP#pAIC (Fh kF 蠱V)FF8H :!0Fr5FF3H RiĐĠO3GOGFO'k/0+i+O':FQFCFBF1F?iN0+FimDDcd/iib``ca ph6faa #ai#sa0!n(!#-H@# I F gz ]LY`IFH r-OPF$NC FFC  'FFC#`D`yJ`yJ`yJIFC tKh[ +g8(S CBBBBBC!CACBBB]CBD0hO#F0hh#F0h02hTI ###OI0hiNI i"JIPF(  PF~3x!CIRF v ?IRF lz ##n7I"PF  PFR#x0IRF -IRF-z ڀ' PFH02h%I0hO F9ObY!67ph707Ir4a,b-t&l&|ֿ۾8('V[B8 d(#!FH&0I"F [#H.#H*#H$ ]F H ]F H H 8 h Hh H#4RpDb7" FFxxB(I#F*F j0F]H( FI@ݿh43F]&( FI@Ϳh3"F@Bx (I"F 48F F I"F 4#x/+ !FH:)FH8@8ȸ޸pG@pG8F FhHȀR((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h``lwhd   lm(d  lcd`p`lSd mO(e`mKhemGemCeQ BC p`" 54S+BE+8#FBT#!A#38 FF~xr8F F#T#E#34+g\fXX\\<60|q|pc"cWFgfW FcbaXXSBBczgfp j $d$(^(,X,cWFH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3y)^#JJp>s!tYh_I F>v1hXk2b&0F =GD0pLJFNI 2@UD[BL @r[ CSfd04 @#F#"_h # +u#}+ZJJOzr>vhSC   F*Isd3ddd#s11hXkPFh2@UL[DUBr[ CSR 2Nn   L Jk@L#FD0JjF!!kp2_B@Ѐ;۲#O &@;"FKh3A@񳀎O"F;F !xOzr OAh SCD0@0H0L0O30{C?Fh2@UDl[B @r[ CSR 2NvAYC 79DA4E0%D8$<4BsxH vKhvK 08$<Fx 8Pkw(@DAF8&KFT*FOsPF9F$&\8aBA*FPF9Fba#O3sUHAF!&F0$-BOCȿOؿ#1L 3KALq*O 3BCBsBL @`p  XK#KCXC3G/3GOCGsG0 PlAG#(F1OpK3@,@pIDLsB8F/('Bv8'F !T!!x:FOK<*F AqEC5jBXSBO!T!h!%ZkRhaH4PkR3bisb@bb@5lc@_OSfKhcKheKheKh0cXTcOs0HUP0h40PYF @ 0Dbij8d!!!!^F!5p!T!!!!*O`v_Kh+]I# hX)hOP)ObhObxiQKhyihh0+xiOr!Wpv0+FH0+yhCMj0:4D\Bi"iBCDFhInDr  @#"C@!CF2.J -K-IfC(?ѽJ0+P# 0*F+D;#G.hO`1F F)1FOPOb= "FvF(mOb)hOP[# P#!!!Tht@+hjvL#FhjB@MH 8<O{0GF  "KQEA\%FI +B%a`D%4<`DK B D p0C_CKBuۑH( h!i b iK$I{`ȿ`  h{a`Ŀ@;g)2@Ӏ"2x0t[SEgx#  eH;fpI h;3  #f`0fAH {fBdH^% 1ihj Db-O FXDh[Ei@ʀJhnREvq nJFh$%* ݠi "@nG\:CBTi i2aAJh*Md azhRETzmR 1B zhREP%PCm@P%* @=0d F00 FPC@:Z2:R8  D * , :BYF 9`#{eO3eK!hT U !YYhJB5smxBpijYh:bJB5smxBpij;bhkX0@i3DOO Qk1Qc1FBi򭀚B"Dhdn&hikQi3DB@򳀎B2hi$5+O2fj $jNE3h#jzkF=h!jjPn1Rk!b!Whj!Zk`bh`iik _OW8D03h+aihi9D#hqNkDci 0o+F(#h\%@7cNBii%rCAFhdAq   C #1C OK\%BNN3h+5 PhOBvrn 1@iBj2Bb5ShnKEvqnZFh$5+ ݡi #@n\CTi i3a.Kh+Gd{hKET{mS 2C {hKEP5mXC@+4dFQF"2QFFXC@;Z3;R80  DU !TT! I Sk3SciZiBZhBvsn6B UiSj3SbnO nD#1FoE +?$B FP#1@#  +KFOL O +$eB3FP#`6@#`B @I 8 z @J k08`x`0@OFFEͮfiE>D(F6 @F `i#kDBhgK`f\B ii%YC FFkk id Fv F   ,C1CDF k+GKh+@82D?n. T3h=I=K*FF 6I2"\Bii%HCBFhqFBrxn  @B #:C@'H2 DDB?)3h+hj;[KhsH+ Khs D #|:x* ȹ Kh I U T!;x!RLghcgOKh+30304040JkhSC#oBIOb`i?Mfib!` +hh1F9Kh7K\5h0+WpOr!1KhCF:Fp+h+hiZkFBhPnHtL  Rk'@Ci1CQjcjB+h#hFZk h!jj1Pn!bRk!:!k`ihiYkI D-+*"!!!8 !-G}FFFFJFF(dI2F (bI@F&(F(D]I*F@F0h+XHIFtO0 }kk6j`j`+k#akkca#@0#bB0cbklb/{FI:F@F0t@I*F@F0:@IJF >IQF8"F F"F:I0F8I0F 6I0F4I0F2I0Fh"F0I0FB,?.I00F"!8FHF0' 0BgBOЪ# (5D*#*#0f@ "F a#( ,hd@edAChzd@h[hdhhuhhhhh-Am%OcFF)FFgCF*FF@FF F.M0:`12(F mF8F F I"F #x/+ !FH)FH8@Ծ8ȸ޸ !pG-GFvFFFIF(F:F3FF8FO`f#TD&O` FB`۽#D# 6P I-G%@F4FFFF F!0_ H#J ## `:F!q F !F  @mH# :^F: F^p FFFr2Fk2Fd2F]2FVppFF F((*Fmep-AATB A ҅BAӃ Bt ҅BA E|   -OFFFXF# " `0F xFPx(PI3F*F m,3a,M,%A,!JI+Fb< ,P$}||||-}|||}|}BSFG700F9F`FF$&F V0(0A  6    J J &+FHFQF$&0F9F,"KlV㱴X AF0F0pC O&+FQFpfHF(FG[𴺀"((`:F3BEC FCh`h!(. -AF7N0 0FB FZtF"F+F@!*3j*FBF[ (F[g x2(*] #!3+BD +\C J Ir" C+T06&h+F@qF (F[.06pi D:zB2h;`h!-.8-Oǰ F!FOKKh(@SC;J1#,0I (%"# #O0H0Nd00 @$LPA!aP & #T0KX0R3I *F+FHKh-=(Fn(3Ih!D!PH!x@!%$ `x!X!P!(QSN!`!H")FVL # V0423*<\`8O7 @F Bs 8F388FA#c!FpBXB(8F&\`Kh8FZF0I[:F! 0OFGF1d0 FF \0 0 0(0 ;; CEFyMvyN3h+#1 B2SrI h AqIoHhgJ+jjhlHZC ^ 6" O3HA FD(B]I+6 s@FP8C0 0CE$F  @ )4 DFO)0<D)2 D   PF@F7D?4BaH]Kl2[n Fг 0ObPDTIUZ@m O* %(F(&0HDH6 PF 03CKh6+F!HD!:H9MRF6;B0O [3 , cEO(DO1d'KO O !  \ CT"F 2 *C  0.J#3Pf$&B06D&hSFID  !i"#. 78h!!6𺀳Kh+𯀲H/ dKh.@3Ll;m#n!H\O@U"! (( F zDx0 V6kC 3"z n#06x%s(( &GFB&~('KN@! 6{2Bu# "Z"!jlK#nA#3'4/5Dx0 !znH 3" &#x0#@%((@PaIaH$1FO@F 'O1F" z%"Hx0  3"z 1FP 1ZC"1 DO1BAanDJDIcP(9%C x, 4. 60 2 56J7IGO v@F Z0F-J0I6@FZ'Fh 6*FB,Ӵ0 &DBO%#B@FZ53FRF@!0FZ#"%l+ǮJIF% 5B& JI ;x&00D4H6fiHF 6@KhS9F+FBF0DHD G/ݾD.,S.+T!h!@!-G}FFFFJFF(dI2F (bI@F&(F(D]I*F@F 0h+XHIFpO0 }kk6j`j`+k#akkca#@0#bB0cbklb/{FI:F@F 0t@I*F@F 0:@IJF >IQF8"F F"F:I0F8I0F 6I0F4I0F2I0Fh"F0I0FB,?.I00F"!8FHF 0' 0BfBOЪ# (5D*#*#0d< "F a#( ,hd@edAChzd@h[hdhhuhhhhh-Am%OcFF)FFeCF*FF@FF F *M0:`12(F mF-AFF"`8FF Fh3,x[x+&ICF:F S-"F-G= -S%)33g= +dDTv0F!FDT$D46DICF:F% I L ONF H I Hch5"x9F0F4- f\. -AFFFF`O)F F^BqۆBxI+F"F R-G}FFFFJFF(dI2F :(bI@F&(F(D]I*F@F 0h+XHIFO0 }kk6j`j`+k#akkca#@0#bB0cbklb/{FI:F@F 0t@I*F@F 0:@IJF >I,QF8"F F@"F:I0F8I0F& 6I0F 4I0F2I0Fh"F0I0FB,? .I00F"!8FHF <0' 0BeBOЪ# (5D*#*#0dd "F6 a#( ,hd@edAChzd@h[hdhhuhhhhh-Am%OcFF)FFe@CF*FF@FF F RM0:`12(F mF0# M xj,h214 F;*O"p $T3 +0K"`pG"1FHO0?FH t-OF-h"!F}L`0$#hchh #icii-#j$0j#k'ck80 ck@0B0D0F0G0l,L0)#m T0!+ iH@#*KF((bHC9 ^H2COr@c** bF3 UH$ZcQI " (NH "#h!^F(GHI 2F3 f  ?Hhh+hpC_HCD7H7I"lFXpF_]yrUBUA "AFjPFR꠹AEHF`P H$%QF8FP(<FѰ2C.# #2BB!FHO0D/h04VPJ)F0?EG+bG_G+R 02HC+F@Cd DT%?&Ow+F@Bd DT#!GRI*OF=x$!#B H@4 ,] #H<ػ#л 5HYF # HiD/,hC;;#OC;+yH"F?@%^+sHF6B'HJK +F/!B hJOaVd(?E! F3[f hF(hpCOvF"F8F1FC ѧBvCBuLH? #?@Ga>Cp=g .FBs-FKD[9F[FOs jxDLD-:@phC DSE𜀻@0!F69F /DND5Os]C .DBJOq*WBKBBHq O3#p!F @sXCP!F0OsTz$M} >*9КB8 JBU۹OsB ѰH"BK KKOq>B*bЕBl٦H)FOqBКBѣHB(]O O >@Os@@a XT= "s !FOD O`OPD~F}>:"O GI c@q#Oscf&F=- =  Dй?AzH!FO@N(8 B,>>O 9F0F=@r O @ "BB s#m & Or #\J 0"G+>JF*?0F8" # FBsOHU O f= bC& IA& E OD5AKOuFB3((F0 0## CHf# RF(# IA  #QFE(FE)H@u# @sOrFB#(s c + # +#  @sOrFHZF#B 1 H91DӺ'Rt&hHhK) FF*FdHVFB++##B ;Dvѳ?O OB :FnHڹGF"F!(F. л @߀KOqBӀCEJBӀE@_K+`SS 31O3z3 r+s ks+ +tktt t+uku#!+ka+b Hkb#bIb(1+,1k$)#01b1d3ih3/0'78F# xMKF*F BF  OEcrHqHqK" pOaX`2+F@"D3`2 ! ;jhCWI`S .ձ@ +ih{:+Aqi`h hZBFOrEHq;F*F2 @>N {2W (#谦f2ADIQE23YDB2*H1F ԣ@ &! { F BPEV ;j`pDcF:F&|""]]]""Mb]`p""^""ɚ;"6eH H; jhP [B( ;D Hj`B03;KBj` D;$"ɚ;6e-GFFFF ` q jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B  0  /9FFH&0F ^"-CF#M -FF(F@ h+HCF:F1FHHIFh?  ?H !!h S0+h< IC '@@"/^M^S^[^ K Lh K*FlI#FFH #(VMIFF(F I"F(F I"F(F I"F(F I"F(F 8pF FF+ * *x *##pp\* Cx+IH.(F;'*"*+;.F;B+I5FH8"E FKhhSIC h\B Kh ( !h(OOCOC`O0###FFFP;F0O`#S`O? F`,HF+Jh`)Kh[#h(I; h\B#(FÈ #*##ty*%!%!-#h)9h21 RX^# #=#ctIH ###%#0h!(/#@####Qhh DFMNO FT+hh *3h[S9hO  A L#"`c`y b2 F###h# K : *B ( QppGI  F:IFF (8I" F꠹6I(F(F2F F.DB 0I1H z#x/+ (I)I!F(F+F)F xZ'O/)p,+Fxr1/*+FK/,FK\"FF/))2*Zx.*1FFFF2*9F F`Ih7>I_F*3;D3Q+FQ FAF8^F#CCBQ#TY 5 F( F@ hCW2F(JI#HS]FR*J##G%j,E~;d<##gfffX @(I BH^FJ C @@A,FF]F.SѦI (FWHy0[;hI; h\B՝Kh;h+ IHF6(ИIHF0( I# 0yBDoObJFIH@FHFh"F9FHF26FK"1F(F1bEw8FQ 8bFB8F (  ( 7O  SE=3E6cKhr:FdI[H y D C 2 QIFCw 2 DKEFI N6e  +?Fr*Q"={ՋHF۱hHFRF[F(FLFCJKh+0FjѴ0XCY F)F)F F&C&cy+ F8I*FF8H" HRF(F[FÈFCÀ*Kh+0FHF F_*I+F2Fr!NHFHFHRF(F[FF8C3h+?W  B  B 2h*?B FHF+F"F2##h&L0Z+I F.by*(Ocy+9F F" F F.i,RF[F(FzF/ F{K(Fjb[FbbRFdFKh+?M I+FFHBI*FH`0F I+FF HV^{$#h7K-Gh6I6H6O$܀&#Bv1K2N2Oj F1F4FCy++Ic h\Bjx-е00;(FIFFPF(F(Fi,j mjcy+Ѵ0I Fk3h; Ff9FFH F Fmi#h#$#,#JK-AhIHM ,j&GF4.,jM#j$$$_}r# $5L$#L2CchpCO/#-C 'OF@Hch hOb1Ft(` !Kh I!H%(F2B#c`BKh+IHVDb`I(2EOAKh+IJFH##(rL-OFMFFFF8FX#*F840F#FQF MOG#*F0F#FG(J3F?J@A8F>M8F FFcF5I0d됹XF$0I2F0H|/I2F-Hv,I2F*Hp*IF(9FO F M yJDoObI:FHHFFF@B8Fd"h8F#e 1FV$n-AmFx/*p$O&AFF8x+0F!8$ F m3iFH(FFF(yB02F)F(&h$r8iP F8`"iFF,F F8$FhB F@UK-OhIH~0R+ ьKOaH##KJhL4#+ шHIHOI`HhVIF{Hl~IbxHf烉'J3FI H0F#h##}DOi#F1#$##-AFmFFFFF(@H:F#F=Or@a0F9I2F9H.8HPhVQ5IF3H m*i0NԀFq2h2miF-0F F o/F0FOg:FN0KIHm#\hVIFH B0:F F0KI Hm#<hU IFeJ{$#t#(   ;L4#+ `"#6`#x#+ H"#*@HiPF FFK#BqH"F+FqO F)Fzh;hES"qbC"` Khvj O#BB9F0Fvj#\$#BijB ћibpGiBтiapGF+IPpF F K#Bq Nrh3hS"p#BB@j #\$PpF FK#BqH*F#FN(F!Frh3hS"03*F#FHp@`ZjBB `p$F#\$-A!mF 'FkF@FFkFk/..p h)F@i,$ F m.$j8/!FF$ F8#p(F/##pF(Cy+H)F7FL/'6*yB H!Fn F)h F !5B|FF]h$##MF`+iBli FphiT0FTFha.aK(aImH##2FKh$#K FhCK$h FF`GKh I%"F??KgmhU I2F;F@ Hh(F#h$##:8ML4C0+"mIH0JK$#e###c`* H!4v8h$#n#$KsFh F;H F!F`nhGKhK*F!F(0 KEmvhU- I"F+F`H Zp#h$##8FL hF F8)FT(4D2pF KM`khB NTT0IH l`p#h$.K-AF-NhC5,KhñȀ)O:!(FpFh#(F;u`B(4 I(F^HIHhUJIFpIH`hUJIF\3h33`,F!F HA=#h$#N $#𵅰=L##0:IF:H,22Cb"F5I3H4M8#3K@3I*+F2H7" -M.I+H.h.A##(IF0F2.h2C,F!I0FN8#KI*3F7"(hI(h)hH+h[I JJJ#?hPH#3a#.>O`(-OF\ŰF FNF0# F~HIDLF\E#hEӫzKhCyJzKzIuHLEFt0pI E#y+:pJOq8Fy0S#ykJjI#hhaHN.#..2y"h`y1A:KR#D@F:F!y,\J0/SKhZIOH,#hDy"h`y1A:KR#D(F:F!yOJy"h`y1A:KR#D(F:F!yFJ#y+ EI8FpBI8F(60+/I>H.. .ѢyF(F2B2"D5J y@F1A1!D0J0#y+yF(F2B2"D)J...ly!(F2B2"DJ y@F1A1!D|J0hy!(F2B2"DJh)#@Ndt #Kh(K[h 3pGh$-O(L F#h +9M'h/7 ")$+РKh+'F>Fp`Kh35K(@Kh+)IHIH#0HKxR+jЎK0+e9+7щK(FIJKKKH)FNh)F0F(F `Oa0ԝ4 + `3)FxH')FvH `YFtNO )B  1F bKF(FlI `  )F .FF'80B )#@C9  2FYI(F)FVHTVJVI(Ft(F `Oa0  LI `64 + aBH(-OFL5)B<`#1FBL ih'ch8D+C1F#hF+Q 9B=(@0yIyH !h/O#)b#Ob5!Z%ObHF9399393HQbKF2Fh(Fݰ/O# Y(90/O*v/D.ܺF)'zMKhHILHj#h+rJJ9h`0/_)BJhiAI*F:Hv->I?HH>K ***8I:H<:Kh9H 1I6Hm6I.HP#3I+HH !O*RFch!PF#(hT\&IFH,I#RFOshN?? 3 9FHIOb8Dh$hY###v##* %$##qKFhM+@iNl"BjKBBИB MeMhCdKhdIdH#` Fs(\Kh+ hg ``hc``h_`h[` iW a`iS`aiOaiKa D nZf T  k8 c`k4`ck0ck,cl(dl$d60* xx||!hMK+#Th$#h<hFhF(? Nk#BaBMhCKhIH#`Nk#}yqn f "`"$Z$&T& R N JFB>Ob! FP#`22`20caa 0#$00&00  2 d22Or0fKa4#ca0C@S #`K-a_Kh*Fд$ & +7 [x3\#=#caiNl#B#i2|3 2ch2h2#k2k2#dcccf?H#h+=J+#h+:J;I;H#R8I7H5I Z5Ko@!2N#A1C$9) 8:'I)H$I(H(I"H9-;B#IHI &"h*N*>*K=K F# C5KhF\( hR"F I@F H^ Kh3"FI@HTA#Y#h-CFx2LF.+ FFCx/+!h-HF 2F )I;F h`-A!h%H49!h#H.#J h"ILJk hIFJ/I h>JI h8JI h0JiI h*!h #h[I JJ#rN$I p-ANODFF8h "F<(I X0 +;#0B#H+pwH!Fs 1$CpmFFlF! F#xE*Oa&H)FPF (`O0#xF+K"Z` mpA+ F DB< +#<H!F*I  1$XFF FFt K!FFh|F FjBI 1F(F@ 1$𵅰~OL`OI NI hLILH`KI P aGI#ih\F(Цh@!0F&(a#p?Kqh?+C0`h*F:H#9K3FF `(FRJ.*4K%hpOOpCco h6%AOq h#"! h" h! hC ZҲ7 *_+-+H1FR .FAOqj(c 1$zܝ(1$#0ðFFFJOqK" FZ`*FC0 1$Lbh*IH#c` 1$ 𵉰 FJ!FhFH"iF F DB8hbqI O%* 1$p F JF FhF!RhF: NiFF0hB"F)F0h<!H^p 1$FJP!0"H]&)Fð JOqH"C]O0pGpF FKh*F ZhBZ`C!+I2FI B"h!hOrl O2X` XBXAp F81$8 FEx- -K*F!FF H@h!FFHx8@HK4!FFHh (7((RHpGHpGHpG3@& M FOa]I2 M]hI n; f+X1 mZe "ppG-CFF9,5x--# `PFhFM ><FJ.!HPFhFM C *J.#(FIF@F$kF@F4 ,уhW281$h@1$KFk+%x)ГH@xK)H~!Hzx;+ C+++}HF}J}HR|Ihah@i!iwHB! * tKL*F`ih oI硈nH,ኡd++% hH"!B eH@McHcHcHcH"aHaH"`H "^H ^h+f+ٝ501 040TH3020j;+ @񴾝=01 0 <0GH ;0:09080706050403020j+#5H##硈#H))*H,H+H#!i)H)Ih-(Hz'Ij&&Ht$I jhx81$d2322#  0S44-O$bMFF!FF(l,`0F*F9F&r""##!"FD D dQVBOI0FpQJFKIF!DQ@(FI>DkCDH(+hBH[V\*5O ` F#"2K!F@վ?IFHN HFBMMF.hs+`6(@a$g8FLرh+;+J"2C# hP8@IFH2C#h 2C hPIFH-8L>$`>$g*+-AF("F"0FAFP0  I FPF(FAF0FUP0 FAPK1+K9FHZhIO@[ B 8FV#5 6AFhL>$xjzz"h\-AFLMF F11[/1 Q-0/1#/׹=K>HZhQ- 8!F0FA6K"!F0FA/2HQ-+3+!+ "F1Fe&Ha/7$HA_ H/Hz1F "F F_H"F1F#%aH^_HHV A2L>$xjh*^/hEhW@E6h?h#k J F)h]K3`pGL2]KhH\L>$xJh-AFALm1+?HJ =!&POC #Os3`Os   F8F0 9F#h+ mX"AFOc3`OsK5R# (o@# `#*s3FP 0 <hPFH,+ Hh#C-HL>$qhhh*+-GF:LFF11[/1Q--/1/ѽǹ,K,HZhbQ- AF0FGAF0F$K"G/!HJQ-0#xutsCE/ѽGHƺ1ixHF()1+PF2FAF HG L>$xjh*^EhqW[fh-AFKNFF3h!F#,?DI FȹO2oC##C@FP/0*Ѵ@ 8V"` FB /H"F)F3h+ 2x+:h+#F1+#j!# CoBB?#)F8F,j2CoCB?#)F#8F)FJ #8F#J)F #8FL>$hh-OFbNFF3h!FA'O,P . PFP0RH)Ft%@F FF IH"F)F^3h+ @FFXF@Fh+.PFGPX0Ѵ@ a'F1+Ѵj2OC#)FHF,j2C$#)F#HFPF !J SFd! )FFHF,8F ! J ;Fd!")F FHF`L>$hi,iK-C8KMt}wBEO!/!!AF(F0H)F C^F)FD2F( 8F#$$`>$@$-OF$HFf#L%F!hF F)3h B"8FQP@#9Fn"hI k3`#"YF8FTh! CBAEPF(@#9FH"hI54@$x66iFi-AF4LFajR  2C-HAI+ м*.++ѽӹ!KF!HZh1+ 4)F8FA )F8FK"A+FH*-L$%B  H!FA q]@F6L>$Vixjh*^i[f0% FF#SP0 0*I"F KjC+F F]1 H!FHH>iL>$*^i-OF$`>$ij=jgjj𵋰FF%#UP0 (I"F I#jv#>CF+F FY K]h!F*FF Hp)HjHdiL>$xj.jpF F&#fP0 p*I"F Mj C3F F=1+K!FHZh&1+ORb#HiL>$xjj-OFFhhKh۱#gH# \p (%^U(F O;FH HO6(%6OIF3 F(" D8F P"0 - FOO! !H(;B+HIBF DBBO%F@F&j#C[#(")F Z E9K !8J(5CF^F P( D    B()ܱS g0%E%%SgE%%SgE%%SgE%%SgE%1FPFB#HF########,L>$jikj*^-CF`"*x FAF|/#JH#rP(FOTFP a#O3%F%9FHFUO?0 J F#CO>2B0I2F f0/#C#C  #"F1F%IhjC!F0F3FBF!u# #5BܻO`1H1F+ OD#)F8F5B @FzjiL>$*^kk\0FF%#UO0 0*I"F KjC+F FO1H!F: zH zgzg+z;g+;; ;S0+iL>$*^(k-OFjNMFF3h!FOZ ,o FFF _J _I TRF4!pO FHFXIO FOS AC818F hO&0BѴ@ / MJ"@F CF>h"*@IBF >Ex*;IBFEx(Ѳ?S  T# CYFD# hF#F1+Ѵ j2O CKFOR(F,j2C Q#1OR(Fs)F:F)FF @<0h8FO P0Fn")F"FF @<0h FOpL>$(9[[8kIk-OFMFF FLz@FD PF<$4-@ KJ Kbh JP@3+4KB01+HQqz*@IH!lH#3p+J* @IOrH+KIHOr܂+ pp+AFOrH+p IHOrAFOrH+ IHOrAFOrH+{IHOrdAFOrH+{IHOr<oAFOryH+kv}IvHOrpoAFOrpH+kbtImHOr\_AFOrfH+[PlIcHOrJ́_AFOr]H+[$[O;0mF(0C3OpXJh+@4+}Уm;3y/@#hhF#l"F)F0F@kH/@$*@𗀸Ԁ 0Qq0#C3F@GKJKQrHKH/#h"kyHFakxHF*chB|+jBwHFNF(?p-JFl1fIgH~mC3dH/-#h4;/F?t8 - ORIFTH h"QITsLp3FGAJ!DDDu M"l)F0F"O0 s2I2C@3+:H1{'+R#wEHIIII2C@3+)H 4+Yck O O *oF%0*N9F(FF*YF0FO00/#h`*O CDE[@FO(+L>$zzj_kh6mkxkk`>$*^l.lA$El`l@FO(O h +# F%0ckKEE{h `;h C $QF0F$R:FH  `7ckk`#AF *B   hBЊh:B 2D(JhBъh*O;XF NF( ! 1*)F0FwO0?#AI* F?*)F0FwOx0?# OcO BF)F0FOc0!h +NWF(?ήF)F0FOM0  XGE?8FNLGFGF#I:F FV*')F0FwOHO(0?CFNF0K JIhvF')F0FwO 0?H;F!F F`>$xqlL>$-O$F=!F&`FB<'?+|7F#;I(F&눱xJ&809`*xB𒄨Fa'F.# &`"!@%XPoA(,!0F C U, %P. 0 2  fF[O O3FMFF8O /f+|H1FG=!8FDF0xI8Fx/FCO rI8F(%mI8F(CѹjJ1FhKiHF50+@% l,!(F F(%\H1FfJF(F&BTH*F1Fx+Rh+o II8F0o GI8F(8-DI(F(BI(F #O >I(F #O :I(F(7I(Fx #O 3I(Fn(1H*F1F{0I8FdFع-RF(FB &H*F1Fbx+h+!I8FBF(W-?gRF(F|BFF0H*F1F=lxmlllllpQm ml%mvCmɇamL>$x+h+CoBJ BOs A1I8F(]-? +FD3x*?a)DP!M!N!N!N!N!N!NMN!N!N!N!N!N NN!N'N!N!NN!N-NNDDDdDdDtD$DTyH1F"p"vH:F1FOOO+7qA"`8FBgH*F1Fqx*h*o@BABOA`XL TDdL # @ˀ@PJQH1FB"`8FpBKH*F1F3x*h*+q %pa\LDd HL+# 8FL%,0 (0BDd1H*F1F48F|"`8FB(H*F1Fx+hh+gGL#DdXL# +#H1F L}K H1F%ո?w-JrDd -@𖀸% H1Fmmmnn,nnnnnl%oи -d%3@cp#LH1F +\%3hМI0F (dxJ#0FP908CDtD @ "(PAB (B#+D0@(Fo E#`##`##FN0IhNf1FFyH$и-- sH1F-и-p#.!1F ")F0FOr"`"pOs#aK]J8 p01Fh#CYK1FYH"#4qSI"0F(okz=+ HJ8 Bg $1,DJH $P44OC Ow # FOs+`;K8 : < > R0!FX"AFZX|p4KXS,YoC,`#2F+`c+FN0hN!FF$Hlh#CXI H;+JJ"I"0F((aѫz=+ J8 BYO D=!@F^F @FqOO nlx@o o`>$h6[onovoooikodv 4+H##4K ( Or @F0Or # K04/ )F H)FqO!jxBj=#<I"0FF(+z=+?aJ8 B&1.D+WHɻ h#4$ CF{D@0! F1 yHHPFCF豆hN- NjIFoHh"FmILp0 G#0#T"@ F~,F@B@Ӏ(ЀVH!Fh0 ! F0O T'&JF F8??h"+ hN_!FF>HBx;H!F-0+-++.##;3" #S1FNG0 Ϲ Q2 &C '##&0##XFZh+@,<,+,#I@F##I@F`>$olxlo pA$3p*+!p$ '#F,I@F# &#FX#&I@F###MF(IHFAFFN0G (FqONh+*FHF I## I"FHF3F #CF l`>$qlMIFF(FBI"F(F>I"F(F8I"F(F4I"F(F.I"F(F*I"F(F$I"F(F I"F(F |%@St8FKhIFpF rCF H)F` 8"F)F $*FFH C$:mFFOahFWv I"F LhF " mhpmFFFOa&WZ8H!F mp&iF(ZH!F.H!F&M2C&h k`+h  &2F (h C$mFFOahFW8 H!FT mKh  hiF (h C$F-H'MF&F(/  ,iI F (I F(+*hOa FW H!F|I#(i4 f FvIh FsIhX 0FhoIF( kI(,!(FF " ," FU`I R F+x3ZHb(FM^WK@WJ @E @F *VIF(F(jdKF"FO FIHB]GH!F2XEJ @EK@ *G(F(P@"FO F;Hh4+ @(6H!F'- Fx(E pC%FC K IF0P ?%IF(?.ѷF%FI#F'FH8I#F'FH. 4h8B:m L]X n, C$-O'OchF9FFY\CF!p54 C$|dj#FFHvF0MY+FFF Hh( Fp@MV I FM(1F)F pP9;-O F-" F dܡH O`hCM I X *F JڕIEEДH*FAFV,,,OcMK(FOKMOCKM++l^KF, *+n +k7FDF #HP+F@<O"ch27p<B7h7 pESѐB٢\+ZbE.F"p$+P2F!C K   xx(<#~H+p,FK@:zм[\aм$@>Zxh7py@50*@w@</*R+bbET2*$( \(*XxB)3x2x(3_x0/ٓdEЧ1T$|Dl,7D$|O Ep0hD@H,3B#A$HI0FL9O0p##`- Kh K I*F `-KhKKh*r$JKK`r$%0KO2`Kh+KHh@l%s$r$JKK`xw$ %(p F!'Kh* ""`%Kh+$J"L$I!M#h+"K#I(hh)h!Hx#hKJ!`(]O3J`pNhIL0FL(K" h`J I0FLh0F(jhI htK`K` h%r$:(s$Pf s$%JKK`s$i%JK K`w$v%LK"FK`#hK"` s$%%JKK`r$%-A F(O3(J`(&L'N'O#h+ ###`3h8hx+8F H##`#h(I@FL##`I@FL `8hJK1hh xK- FIh K`@Orih@FJ%s$Xw$r$r$`I$JKgK`r$ %JKYK`s$%p F(HO3#J`p"L4Nh"I0FL J# h`JhJAL!`IdKh+Կ##I0FLuHK`K hhJ!#0F jhI hD Kh[ J h`Jh+%r$hw$dw$J0@KO2`]((JiF(HYh(KhKh#KHh HYh( K"`# Jp J`%ds$r$v % % %8(MO3+`KhK`Hh F 0H!F F8@K(н8@} J Kx1h I#+`hH~8%w$%r$@U KO2`](( JiF6(HYh(K"% %𵅰8*/KO2`(,J()K )I$`!F'HF"M%N%O"FFP  K`hz#x +`+h+h!F(!F0F+)h(K"`);h+K h`h+h3+` K`%K$dXG$r$ %r$@KO2`](+JiF(+HYh( Hh( K" JiFx(%  %-GF hFVI&xpHDD FxPPKhPKPHhG)6UKKO2`GO%H@ݹ*й-)hF F(F:H#(Y6KO2` FGK4I F.3K3O(F F%1H(F#BF3!F-K8F,ѱ(HF FOp.%HFx#K*F(F0F FKh|#r)FF;D#3KBF!F8FMUKBF8Fs%%r$,%!fY&kN$`*-A@MKO2`(X+HJ(C;R#!B#?Ixx|+ (9Hf($6Ihx5K6I` j!F3H/M$1N1O+h+;B3h۹ T'K"`BK&J+(ѓh#3KH,;FR$ `F)hKh{K"`h+h3+`K4%Nf|$dXG$r$$Kkr$r$&pFm@O4;K` mp! FBR$ F4,! /H/K/!(FF F`AOb(Khk'N F1h1hh;`+ -#KJ FhH!FK O2`$!F hZ ` "p" F fB1F {$1F uc H%hw$r$r$B0# 08I8KO2`0(5JiF-;+1HYhx((D.K/Hh<+,HF!F)HaF F^!F F&--h+HzF!FHDF F@!F F -KO2`dh+Hh!F& F$!F F%r$r$p(LO3#`нp@ K NMh 3xK3x+)h Hp@vJI(h##`p% % %r$6p(LO3#`нp@ N M3xK3x+)h Hp@IJI(h##`p%%r$L@aKO2`]((JiFB(HYh( Kh Kh# K HhL HYh{(K"%bs$r$r %@KO2`]((JiF(HYhI( Kh Kh# K Hh HYh5(K"%bs$r$ %-Am FFFObhFX4o$B HiF ( V$ObhFBObAFhF4K"` mh %;@ KO2`](JiF~(!H%@y KO2`](JiF\(!H%@WKO2`](+ JiF7(+ HJiF&(%LP8 L%h0# KO2`8#B#`H\%`IhHVs$%&18C L+%h KO2`8#B#`H8%`IhH2s$%?I8 L%h0 KO2`8#B#`H%`IhHs$%V[81KO2`Kh+H@Ӹ%r$d81 KO2` L#h!F #h!F $%r$!F #0(rKO2` Lh!F H F!F FrHF(%jp8H=KO2`p(:J,(XhF33K4Hh>/K1Hhz,K.Hh.H!R(,I F =[z{'Khd K&Hh F/)F !N"I0FFP0F841D0F " FhLAOh8GKJ h;#`)F %r$t\H$]fr$$%JKK` %%JKK`w$% FOF(O3;`(N#3`KHh3h3h"Ih H33`;`, K"ph"@H?%%r$%%(7&L %M#%H+`%Kh^+h#`0 FO3(,+M !J##`(h`tKhFK? + F !,`hF#H#pOb)h? +Ob!F H| JiF(%%r$r$r$%% ($Jh+ ##`!J`!Kh9!JF(O3J`LhI FK,pK"`KJ`KhKIKhI FK0 K` K` KhI FK (J#`J`KhJr$s$r$% \KJh+K#K"`K`s$I0FKp(&,;Шh,9h%! !F  F5%,K+K`+Kh.%)K)K`QF IF  &&%OOd%JKHhhIJh+ FI.%KK`Kh+J KHhhIJh+ FI.$% ,s$0s$s$4s$8s$r$  "HK`%0KO2`H( Kh Kh# K Hhz H( K"`# Jp J`% s$r$!,! % % %s F(@KO2`pKNh31hHp@(Lhh ")xjjhI0hT#0hRF H Ip@%%r$(%1!O!j!8L%h0KO2`8H##`0%`s$%!-A@O3NJ`LO;h+KKLHh(9+HKh#DKGHh$8h "DNYh`;hSAJ`"@Lc hchEE3%;Mch;c`+L(F( (Nch;c`+O(F (E1JiF{(ѨZabi2`+c` FCK%Hh#hZ"`x(p (;h"bhBZ:`"f#5a,Z=#+p5#hZ"`x +Ѱ0KHhu#hZ"`x +%x$r$!r$!$|$!"7"$08O3J`0((J(!Xh??F FIZhKh,-t##%c"r$08O3J`0((JiF(!Xh??Kh]h I*FF F+s##%r$l"0KO2`(ѽ@HԸ@IhHθ%r"w"O2K F@H2I@hm$r$"-A@bO30(( JiFC(XhF(HF`xK*F(FF0F~D4 F""F)FF"FI8F"F1F8F8F8F#0J0FJM`*;%-O@(KO2`(($J(!HF(7xK*F FO(F0r|#N!FLF;<#)F;`#` H#KRh~(FJ5L%`*%(%s$BH(pF FO3J`phI0FJXI0FJI0FJ($hh1CJ KI`` Hhhh#$%"""|w$w$"r$-AFFF F8K:FIAhA@hJ#c`0FT JhF``B=H"hIAh*r$"s$ #-AO2M*`((AbhAF4*:F "0hB#h+#+`LNO "%x r$ #(NO3 F3`н@߾Hh OF0jh8h I@ͺ@hJO#c`"hI8h#3`%r$")#8 L%h0 KO2`8 Kh3 K Hh8@uH##`%`s$%%r$:#h#8CL+%hKO2`8Kh3 KHh8@K#B#` H%`IhHs$%%r$n###8L* F%hVKO2`8Jh2KHh8@(OIh"` H%`hH}s$%%r$###-OMXaKO2` M(JiF(ВK$M/FEяKrhIh2)Fph "54IOBOP#w&h$;iB+FF+21 TzLF+x˹#p0hhlCFdoKqHhhK`;iB5$+ \+Qkx5;+x+5jxP1@'#O "eF0jx P1@:B  FBS+S+Di*5B B FS&S&DO;H#c`hJ8#`K "`Kh Jd!F KhCH!r$r$%r$`J$ y Khn Jd!F KhCH!r$%r$`J$-AFFF%hI*FFF2;x ;۲+A2FAF8Ft蹻]K ;۲+J" H FF2 x ;۲+@!`(F%FpFh F:!0FT젹I2F(Fh##P+"(FI(FIp@0FF0%!0F4#p I2F(F0FIj+"@B%%%%8F@hIT#c`h=(F!F(FhID#`8FKF FFh(< :F)F0F{ ` #h+I#h+ ;\ :Ҳ*A  Hx *3Z #`Tpw$%0x#OFx !p%).Cxc=hZ5`&Ղx" 5P 7!W![nO۲  7!W!D0RѲ0!0!0-GF FFFoI nI"^(b P#`#0+/!PF^(@PF/F@!(FRh'P+\K"`{:!F>({up:!(F*F(mF#;+x%` "8FN0;x#BOsBn?H3FJF9F.=I"0F(# `#8I"0F # `獱(hF `hh``hh`+#`w*H2FIFh@F FO0 G8Fy:FQFFh+3`b+x%`h++Khgh;hH+8|` 8Fu`` K O&8&`w$_&@&G&O&r$sr$h;`+ڊiB ( hZ `ppG7-OL I"$O3FD D@DJ(@I (F0 x x{H)F$ 6# F L (mO 4Л0+I,%x-/! FB'BF@𛀹@}IJF4|Kh.@Ѐ7FyJh0*!F0ObF `8 c;# Ā gK!h`AcK``Kh+@Ӏ`JYF`HBFx+;!F(YIIXI FIWI FIUH:gTH*F!F4aO ##pmO (F#o@!F 8IKK`b :!(?O#;UG4N F%F6h.>4F7Fg'p>FaF{(F%Kh.7FO Q6h%F.й%F'F&FE6h.йѠFO &x6!I F&DFFO DFFF/x/?&I(F'%F,F/F.F <@&|&&rr$r$r$f&&&&&&`w$&+XF(?#8PF,.}/#x+@OObYF ` c4# 00+#x+|KKhvIIJHp DF/! F FF# F;-1+x+.9I `Ob>C c5N5O A3LOb%h#`3h+70I ` c%`#Kh "!AB(H(56M~I>T0*M FRNOS0FPD-UXT143x+;mH #x+lI FI(iH43A 3A"3A$3A&*+AI3HC3x[-!-TKh0FN((OKhS%%%x-JH(/!H04%%0BK`(ANAK  ?K: hC%D##-@7K8J(8I`7**(5H!*j@#:#(K&L2C*##2)($H`#Kh[#KhO7FF üL(I hK h#RK hnIO2``J$|&(\(f(s$((%0%s$ %(H9(s$w$r$)!)NOr!F0FK`,3,SMH$,KJ`,+,x+𧀏H(Vx+SdO: /F FFI/tF(&-уH3x+YFF0FtEFӨ1F DTF(8FI -?Ԯ +dqJ2C,oH".+ "x0+.x+HEе& F,8%! F0`H!F#O2X3(FWZWl1AYI0?sZ3 WSxCY#xcQI F8PH)FWY FI>WMYM+h#`MPP&0*Ne1f e C Ihb2KhTD1$#H5J8IhT7I(FOR(F3Kh3H*F1K(F1J1Irh9F(F6h*,J ,K) FF)I(F*$+OA,mѺr-KNr$)r$x$$*$r$r$pw$Hs$g*Ly**\w$(%X(**:*I*U*lw$**=(*(*f(#џI*,*0OќH {2јKh+ЗKHh&-ГN%FNKhK2FI4hIRF8F-ІKhñK2FIhI*F8F%NIRF8F-,пI*F8F~M -*&$(h,*h7FF5f(H ! F`(08 "58xF;kJ3h20X@5FO7%FF `J4!Fh8(@4+c[I6665 "BWK)5x+#((ȁ<,?j FHNeJI6h(IHI6b(6x*+Cx6/*ZxX6**+36x+=J2C;Hr9 "  9x-+09 "6F B x99 " F9&I6(IPu6FC } y { ~ (?bO3}x+[u:T%C+s$r$@+X(*,+ +&+hX+0%h+p(%w++I6 6:F!I6(mИI6HI6F(YѓH#,@ۀ&0FH-@Ā+?+뀉J%hB%I(@䀅K+++@ZK#RN??JEs ??@wI??1Bs,qKh+@#!K"3"kI6JjI6EF(?$HF$aI62(ю!ܻ?.nZH1FN FH0FH=r*د#@ +xKNHFI! C\KHKJ2+ HH"L0FH(F~;K@1Eh$ѫMA)FSFp!.0FH#(FH55K*F5Ihb# FH+M(F_!+K*F,IhN*H, F FH %H%x|+!  I%0+++:%H1#++D+,,s$Nh(%0%s$+,?,E,,|,W,`J$,r$,,-%-$K)KHh??I`H` BB%H"%I+++%%IK)I I K2JhBЀK H~Kh(6а?O0oO`vLM uK sKh3Ox VO3O0d",PfM*8fHиO0#"#` # 2BF[Hh"+,"##`OKUH ":3##x *;*NI#PLH3##x* *,! 0;0K9J" D!  #<#"<#Bq<###<#<#*s<#"B AO<#*4F(I*F8"+@Ѐ"+UKh+@ހ*F(H#r$D-0%R-$,`J$w$ s$(s$|---%-%7.,s$J<1A1<#c# <#+pzF:FCh(#(]E%H[?DD}Khs|Kh[|KwOhBr-Fl"+?Hd,?DsKhKrM'9FHDH2[FbJ@;t bp+r (# bKh^KHx"+?,?$-$+ZM*1VHVI TH,?IKh+DK(sDJhFJhBOtA?K h[# W +)?KB&:#??!F\:#b`#)+G+%\0 (K:h|-IF FK#*s (KQ) K BJ!L2BBAݮ Hھ Bؾ <־ 6Ծ s$-% s$r$,s$@B(s$`J$-%.,D.0%(%*})+1 K%hB3M2R/>A(#(Hn#($#$Hg#$&#&H`#&'#'HY#'! m++)+G%+%HE#%s$s" F"IF( I" F@#FF FpI F`FXI" F(I2#F HMHRX Fp@[h++x+I" FF(8&G&K&@&i.$𵅰#!2H0Kh++!F3(I S'I 'ON'M'NB Kh+3!Fp:!R#h(+hB #+`!R#[4hdI F$8#x|+ FH#3`+¿33w$r$%`J$`w$s$N𵉰FFHI "FL8F3h#3F D[F[F]#$3p$x$+h+7Kh+?G1O1K"`IF *QF &*h@BB &L#hk&KE йٹй? G 1kKE кٺк? G0+(-d$p,)-KBi[d,ڮ(-`$%r$%% 8Ls$w$pL$R$-A!N 4hdH~KO2` FApGO I#;` AFF0h:1hH0hKI@F"`@ ;hF;--k G)F x$;/%pL$%w$d-OPLdM"FF#FiC C C #K x2 (hGFBFxH9FwKO2` dMj 4OrYi F@tBFiH9FfKO2`d9F # %S!i@Ci4P\I@B^YI*F0FX0Ki3THTI3Fhh!`h OH2Fi0i"ici[ (F((F#"ii9HH#i$662F;I(F3`0 8HBF9F/K(FO2`dk3h(66+ #"!F#(F~*I(F)L*I*N `(F#h0``'HH h0h(!Kh3K Ih _($"Oq(FJOrOq(FBR$Ps$]/% *fr$))R$v/x$$x$/s$/%-OMO#LMfj#юO;hO:7 hC9"!,( `zH$~K"`"9!( `wH  MtKh#"Oq97+mKh+wlKlHh hO3#`hKh[ܡ03dJԱh0O2 _H+0F(( 0YKh;+QKWHh#0TH0+(ѕ97+6GKNHhEKMJNIh0+EKh;+ٸ#FI ' EH   (2K>Hh hO3#`#;`'0Kh *+'K5Hhu 4I0H ch(K-Hha,K1h Os87h0CcCC2yB"<7R:'&BWKHh7r$s$pL$w$/dw$s$r$*07='<0F+?(;h3#O;`KJIh0+?ڭч?$":` R$S$s$1@1dw$_11 #HO0hZ`xMc& p`nCh;C`+!CР + (,(\( `nCh;C`+vB> hZ`xhZ`x)F`hv4h%t8;i% FOF9FD.!0FF!FD Fp9F0F*F|]d F$$h%-OFLFF#x{I FMhf`8h+ВH!F m@+.!#1&(+0K(F8+p +VCS (}KhFF(&F;+N!RuG58jHQ ++3hn^ bI:(иaI2ȱknD( YHYHhnO0~A(0+IHknBp(DHEH}G(0+8H=Kh[hnChZ`x ( (hnCh;C`+HD1K2Hh (̰)*K,Hh"+OQCT xT(IhnCh;C`+"A#IK"HhhZ`x h 3@ B""p (1)=J$pri2`5Qs$h%R;%p9b;;;r$r$;!$<x$hnBh:B`*BѩhQ`x!J`"qhKBKHhshnCh;C`+"C p (0~ B 30@hY`x Z< O#p4IHF|$$r$Z<h%><KhF;sI FD/xI" FhK"`320[K"Z`I FDK"`I FD  K"a I FD(K"Za<#%<2<h;`+ڊiBò + hZ `ppG@KANh5hO33`>H(6ѕF0bTHH !H\#p$r$%r$Tw$r<=J=r$$&%x$o=s$% s$-A FȀ)M0.hO3+`&O;ik4O0F.`!K"HhF HD(H !8(0 "Nx+J3h20[( Kh;i3#;a,0+L H!h!h .s$%r$==x$%hw$-O FRNSO0O33`NLchk%MKNHhO0FgFHH(dGH !#pCH.!#p@H(2>I"D>\>hw$2!FJH^I Hi>#%>F F !C IF C I2F(FF` I2F(FF(I2F(FF9F C F6>>>OaL F p% K"-A`KL Mh'h.hO3#`Ht('H !xCx"+0AF#@<x cE" '`.`"*Ѿ"0+3+#0 %hw$s$%x$ %p @BFFhFhF`IFR  p E F)F(H!F\ +x/+0Fn1FFF(F((]/(а@ >-O$hF&FB 0K4$hB#!FFp9F8Do O FEB O +hS&6,B8F'+hXhSE  DE /FhQEFFB3 #8%r$NjF KIhhC"0 н0+P#J`6`P#r$ht@8%(FIH*I 4hKhD` hKhD `h+ JhBĿ` h+JhBݛ4s$,s$!?0s$8s$Jxh320[ "x RxJ3h20b; * +  O0]@p7FL#h+#AOq#F0!hH,L#h+#AOq#F(F0!hH0@0|w$K?w$h?-C&\5FO\] GBҞB#;p", , <)ծE5\,М@BDU85-O;FFF$  %*УE#F"TcF FP c-R1/---D%-zBc%!B٣ pM-|Kh+{K{Jh+FxZ#F)m-.)ИBT3m-n-mKh+ƀmKh:x#F)ИBT3cKhkfH.-hфF"_Kh#aH.-c-`Kh+XKh+\H/)2cF  )ј0  FO 1_0  2!FpEsF|/yx/)/F*ݼ{Bh.-1&ѡBCcPB<pB74T8y#F/*?5B*T3sF9BXBc/%BP *O< ݙB9"B*p#+$pB>"\TB02*p K J9{BcP#F)жr$%N % % % pGFFFF1F8FF>鐹 ,o#`J"` J"`O08FC\ *F"T,##`>BNsh;s`+ H ( K#`o#`3hZ2`x +0???-CF OFF8FJCsFBFH [IBF*aB #H9D;U$BKI J K(hhhhB+`  2`$????r$r$r$-GmFFFF & #cIF@C@FP}I@BzI2F(FyKh+6И FqhBi.F2i Fin0%(#! bh1@C1ii0eI `@B a`aHO0 m"! F BFYI+FYHx@! F0TH*FjRO#0;h+ !T29h[Br2JFAF F0ih$+7O ;h+=! `4X4`$ t#9s Ozs""r!CDh+h#+hA+?|"H*FO20"OqA F0;hd #2F! Fh0I+F] L(R<#`fw$?'@;@pw$ *Mb8F Fw)F F8@mKpFFch;c`+ FCFѣZh+ѣ#`h#+h3`(Fp#hZ"`xF FF!F8FCFѣZh+ѣ#`h#+h3`(Fp FF I FF:hI F4#x 0FpH)FF vp@FB I"F @I @ F"0I"F @I NI A,A𵛰#FFF03 FKhB=#HB3#Hm(F(KۊLNKh8FF(FD4 F~"F9FFI"F0F"F)F0FBzH(U(ԀwH<#h*F0h+>sI#rHP"(5oKoI0hnKO2`%B#< F!F FTB#< F|!F FDB(FYI^ h8~SHF F+ FV!F FKHLF(FH!F(F,,BHhF F F0!F F x+?n8H"F(F!F(F,^/K`/KhB" +FF0 + K#`#ob??BpG!f!HX $%K!Z0K<13H1hGpG $%,BKðh#Kh;Kh,@ C|L !F2!F .yH! &! "tHqJ1 qHqI !<hGlKlLh!h!eKkH(F`MxA@+2dLxk#ZK1hG+l^H4xx,+x#Z"p1!h[hG(33MMMI(hFhKNCO"FOq(FH F:)hEHFDHo1Fx8x + F$=H_3(FZ"p(6M)Fxk8x + F0H@3x;x,+x +x#Z"pMJ1h[hG F3 FK!FFh 3p/%/%0%E $%B0%?B0%PBt/%(\ByBB-%K! `0% I K"`0%w!KH`0%%% Kn:f*oB (КmQeppGIch-CFM O"(hl1+`&O V "(h L0s FF HH>I"(hu-%B&%0%&Hx! !  tCF3ИBH^! t! pF j!F fK/!LA FB`A" F^ I H I !FIHIBB%BBK"sLXhI1N[P+x;(F)FFphI"phK "h"0n+Hp/%/%4/%B HP"iF Khs K\A F(H!FHlFCh+% CBF K!h FjH!FbHB /%"C'C K|Al#x[ FnK!FFhv b -% K7FLA/! FvHAJ# F+F0!FBF pFx# + + `F+FKl , ,њB10kSFB10x*p-GFMFF|   *hjhFh!FH$FY$ < ! F4I Kk)F N(݄B!F 3 H FcCsCCCCK-OFL"FFXhI&|I `J!0Ff}K}I"h}=(RyKhyKl1+N" tMBOFFFO ch;c`+@ F0+H .gK1 /?(@ F FF TZI<1+@XK"TIXhVJ! d~ #hZ"`x0+(ѵ1+F Cѳ(Ʋ (1 # & ; (>+ѵ,1+  - & +е1+?~<1+.HAFl1+?n#0z!K"h J!K0 jb+h* "" @BяZBY fHXdHH/%H|/%/% 0%-%/%l,%9Cd+%CLCC0%0%p°9HOr F(@6K"6IXhH! t! p1J! F0/K0I"hpP%,H&FB+K<1C (Ha'K""IXh%J! ! @! @KhF!hkh!0%gD0%yDC0P"MI HLHQC+H M0@-(55Or@!^H M0@n JOa5hF J)FhF M0!0%D%%DyDDD8'P"IHFй HI(8@ I H9 M"FlFl1+Kh8@[8q0%gDD-%pP"m I!Hl MHQYBF*H mp@+mIFF8H1F mp@J5l!jJOahF IjF F mp J!0%D%%DDDEDIH bF-O( K&ĒO~OO45F`OS`;`KO JAFёJNh U)ڀIW *щIHPFXt+"`+ F+L"9+/+0; "6>`a;+W\c WyO8E+0+їP+rKrIh(F(oI(F({(FmIF(kIfK@F(gI ^K"cIh F\(haI" FT(c FYIfF(?lZIQKHJh`dOKhWK`#]0 TIIK/!PFvMNIRFNHrG oB###"#"FF8` (?/ @I(?K"`$統=I-%'J#O1`9J`9Jp$$O4 O5 2IS"PF ,J`+K,I ^*I Z(I V&I R;h$J !$H$#H(N!IQK0%l.%I|x/%JFt&XI^I:bI$I&uFIp/%vII0%I/%I/%-%F06JH*%YI"F>2VNDV)ySN3hCSI2F>0OS3`ONPI2FOO>0Oc3`LN3h+f#3`;h+@HI"F GKP``BO;h+):hCK`"CK`CK`"_w:"I>Z:h#3`*(8Kh`KhI"FX+%JJJl.%.K/%0%/%5KJ0%/%x/%JJJ2Kp/%MKuI:">`sK8 `0spKh)ր0h(8h@ iK:"iI`>gK" fI:">bK"l!bI:">]K"`_I:">YK"`[I:">TK"!WI:">OK",!SI:">JK"EK"@K"!GI:">;K"!CI:">6K"!/I:">1K"!:I:">}8K"p8I:">t(K" "4Kh 3J`3Kh 3J`3Kh2Hm2Kh1Hg1Kh0Ha0Kh/H[/L/I"F>G.I0##`,L"F>=+I0##`)L"F>30 ##` //%0%/%fKjKO0nKrKD(4vK-%yK/%/%/%|K/%t/%K/%(/%KB/%K/%x/%LMIFF(FI"F(F KKJhI `+%t HCh;C`+C hZ`xK[h+ ##@`+%L! %H`v )F`+%:J! 9l,%J! 1,%0)MF (I#`h! d!H!F hLDch;c`+ FVB"p @ < KhXBXA0#hZ"`x (pB3 `+%0h9FJpGB pG pGKu^&\'+)"HpBIxF{YpF1 x,*F@2kZp FI*F^!?!+,%K( K @0^"ed""f"HpG(? "de"`+%-%FHLLMNO < <Kh2ùlF0F4  <T< "*"F8F" 4KLL`+%0 MFl!F}!F}#SC@rp"CCI 2C32""b"$ !b#sCcl! 0#c`+%pMkh FB (Hh+ HH#x+Dq2;p@Hp`+%LK7nM0FKhIJ*xb Bl " FBjx ԝF Hz FhG 0) 5`+%hpF,L-M1 x[@0FA$I F@#k`p!I F#k`6FPI F0@I F*0I F&8I"FHFHh#!FN$M+4,B+! F!#!`+%:^I$L*LXI.Lt-%K1#Kh f0%K"LXh!FK!F"@hH/% 0%/%p°#M "(h&F40 +M##p1빴B"#1y#0K "XhBpB*(h "; Kh( I0FK`n#y#0#1/%/%0%J 0[ `pG!m VN! TI TORI %3h#0;h# 0O2!hF(ݽ0FL"0h!F( #xS+W+B+L08hOb O@ %Kh+(F +Kh+!!FE"F .1+0+к b"F!Zx @+|)84E x ^+ xh:`* hZ `piB (Ѽ/%e5-% 0%d+%0%8F L hF F8)F(Рh )F(4 #KCBA@  F F@y! H@'y;+&!0h&)F0FZ렱P0F?(F`H#y#P#qcyCcqhB`+x !;#B`+x"{L MFAL#h;!+@NX#h"+"`.h0FL#hD+y `;+O4NGNNNX3n;3f+2oB۳mZe "p9F * 0{'I0 ` n; f+ oB ۋmZe!"p)hHX1! H1Fh#h3#`6F#h)FD#`0h `1FH#h"+#H#`@ H1Fh#h3#`(H0%h4M:pFF; B"BF*pp\+ ^+Bx@:Ӳ F;Cx0ֲ.Fx0:ֲ. ۲2x(ИBSxJx0:Բ,"M-CF9IR(=7O ! FF6=! FpF(9#p FF(Oy5["(FFHFn4F`y! F4#h+L#h+Hn##`LAF F (FF)F?! F0pp F\F@y!nh(F#x!+ ` FJ!F!F8F..M0%:M$L%F h\1Oa!JhF IhFFXNO"F@1hF Fu0#u0 M#y`#y4BT<hD<3hiF8F !hF#phF3EMh.%OMpF FFy[ FF(F pI0Fj F|F!F 笽s$MNI"(h (h1FI"(hI(h"<HJ Fp(*I(h("0!H\X HO!V( HK!P( -%f@JNxt yt NN0%0!I$ zK,3CL8F0 j 0KjK "hh FPPB +! H]4B=0%-%H!H,0@ qN0%"%L&I h$ #I" h! h|F?@ ! h|<I" hH}0(3(HH I hI h" h!|I" h h-%xt yt NNNNf@N0F(g=K<1FF2" ;$k . ;$ F& $.$ ?1 ) $; ?% ) $  $. $J 8#og(?H !grF3+;846:@@*ttttt 2%u u;uAu*<и?ɮ2F O36HVO5F i'2H2H2H1H02F#n4F B%HO3F]JzD+ $iV+ظ?H hBH;2 $d+ hB H; 2 +q HWuiu{uuuuuuv;v-OF O0 >FO0>FtHtJP &hQhC +F   "OsjI8#iK& o h   m(Fp`H4F8F?(F?|FO6FFFnF&FFFO2)FXF?PHO4Z8F?\(F?YF 0FQFH4PH ùO2 9FP?H8HF9F nB Jz rF !l(5H68F?#(F? !l()F XFR 5C BH+FO2 m@ H J3O1(FC#OcC#_")FXF( H48FH?(F?ttt:;uOvԩcvrvv-CFHFF 0DH#&o` FO3??e" F ??4H$&F8C0H;F.HBFFH;CLG@@p@BgGG/9!KBv+&C4Oc!FXCzs!J &kD I, ,."H,H)FCg4F@d@pDtv K#vvvvvhZ-AF ( (H%(F*A>$pCO &,$ F>FHK[h;K2F8F#%oFBF(&FAF2F8FA6DѣZ H+ HJ8F!*FA 2%vww-OFx]-+@x(,FOO  FV(<01h+, FH FPD0>qFHhKh# ]Oav!F ]!F2Fnh  fLFH)FQGpCO~H!F[%P)F0F40F>h+(F80H Fh0B_г_г@O ! F H!F|H!FjexwxxFF+ * *pGF xx B0 \ܱ3\ %FA%F/ 3A/ a,٣A( 3(FO0KOh`Z` KhK Kh3 K"`   Fv 2%pn%?%+H! A y>8F!D)FF{ F8Jh3`pGx2%8Fh#x-+4`o8F " F (+hBO0O0KpFh+NuhŹ ! F Fh` F!0I"F`"shu`+`hh!Fzhp-hFJ@!hFhFrx2%lyF@UKh# F@mO0x2%8F F@Kh+)F F8@8x2%FFF1F(` +`#` 1F8F `(H1F `K <zzFs(x08 Kh+ F@`x2%𵙰)OF-J+x+G9F(F(!0J1F(F_y 0FM FkhB F!!l` 0KhB!pGx2%K!i Xiix2%-A F xFx9 KF!a F M' J)j/`_J F)j/`_+hCE4Fx2%M-AFgNsjB$b/,("#b #!hwb kc<#c{2ot=؆(h)K(b!(X2(YН0b03c0sc#s#xC#$0#0 0"0n(5K"8@ؖ(:(/K"-,K"'O;ذ_4ذo-аo$K "_!K "aO'а?'аOK"KK"K"K"K"K"K "K " K " K" K"K"<ĕIx2%&|%7 (IjF'LH%'Hx(1Т b0P+#b HhH"(#jK b`#j+ܿ##bűfHS0(nfn+ܿP#f0H( H;f H(ht@x2%yyyyy%K((8(  #&) 1((2 H]HHHHHHHH(#H(#Hl0p#Cp #2%yyyyyyzzz zx2%𵇰HNL@ 0`H#`K(FF_(H#`z#` HpHkHfHa aH]HXH  p(ĿK"ȿ`KHxKpHM(F+FH<(F+FH< |H{K(FzHx8F->L. (%{x-;۲L+JWVpQCFZx.+CF#X.`"`# o :FXI(8HO1@yiF F(())H޿K[Mb)) H޿ K[M 1)HP)Hszz:zzB8FFF((F!8@չx ++!(F#x++4 F8@8 L H! * !% ! !#`x2%sBKhCCH@ `pG`8"MFF  "!F "!F KhKpo FPF`8 "!Fx2%n% KhCJ Kh4@ӹI F@n%x2%FKhX@0x F@x2%FF#XBXAKhH K! zx2%-CFFFFr B??(H!C dO0 2??0 H!( (FBH!H)FE<,eT$oIGCH!DBLE4B<d-"F"Czzzz {1ebKhB233BpG?%8CMF+h3H! ,`8{-O#N3h+ "OAq:hB 2R*DwO2`(%HYF (ZF Kh("$Dp%n%R{?%,2%[n%dJ%;]{Kh+{Kh(v*?siO 1)DhZFO dCg0+pKh+?? f,2%|% KhsBC kIAA@ApGO0FpG?%L#hO0!C#hAqD"kB2"cC !2A !"?%8L#h+Jha hO3#`L h=z##`8hC@3S Sh>Eli $ #S``=S0hB#+b6ki  (i8h,@O3a=9K!F<`h@»?%l2%Kh@@ipG?%0F hDHh8#hBC!B 0ZR@hBQT20BS -OF1MȀ$Đw?[+K!F(FZB"Olb+B..+A0; + "##O O  AHF!  >B@F!  5K;+#c+$3x0;2 ($$?%@%{{pFFxM)h! FhlhM)hY6H1F r 5 F@hnkh "` p 5 d{FFFFرK1A?+x2*+!kxcxSn!(,F ;^+#x*+ cx[s+d+УkKBKA4;`4`n!(F,FuSBSA##?% I=HFH H H H ,MNO#x+KуKH!4!!8!!FKxb?BKxx?|cCCKxx|3Cx?C|`Kx@rx|C y?Cx|2CKxBy|SCJy?Cx|Cx|2C4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`p?%KpFhh)ݔB ,`pB <)#FBF;)FF x&B F4FF ?%FI I F I Fh Kh+ I F8   A%@%d(o%lFI I F I Fh Kh+ I F8   A%@%t(o%lJ пò\pG?%(FIHy`H( @F0ӲHJ !H#FT!p ! FpH#FX!(Os4$(FK!F"p~|0A%|?%FIU8I FP8  @%|@DcB ѡ"c+ !@%cXBXApG pG pG*-A FF F|F F<`@0FrF(F ȹ(F2F0FO1 J)F((F( $$$PA%FHFHI*FQFI"0FJFxHI*FAF*F0F I@8I*F4F8F<, F<&38FHiFpI FZ I FTp F8@}(F8@ (8A*N-O F F2F(^( pCO5I FrF F<(*FOa8.I("F(J(F F+* * *# p(IFX(YFHI(@0"+Ѹt#h+ ;#`(*FOa(( AF8FGm+(!F(lFF F}X{p(l\(t((HpGHHqPI%sFhF(F!* F"h#R3FF(FpFN F'h "a#i#1F(F'a$h FFO1JFht+FF h:yPA%7L (8B8#D80iF(F+2 8 8 PA%pFFFɹ*6M+iCIJ`hHah(hkjCI`hJpD+PA%2%sL8xhFK (h2DBF(F8 83D 8 8x[ p;B8[x+hF+ 8PA%2%pLXB"8^]k. KO2b 8B x@ p 0FPA%\(K8x PA%8 L#x%X8O2pKb 8 PA%\(pFM F(F@sBD p(+BB KO2bh@ xU;;;PA%\(7F% xX!*F F (0K$ `pGPA%-CF xFF+7KhlhB)! F0Fkh%`c``l`h 1F@FjPch@F0; F;LFh1FX(#h`n%FF"FFpGL$XKjB"!F$8"aPA%\(K-OƲhFL8(h+Z($8+Z!](b*O(h088#h88+;#8H1FO +"+(F +08Y#DB0(h((7 #80&9(.ѠxJ!kBA(F(F(C+tz#=)pXde(#48&#48(؜#48f#488x8x +#488B< + 8Br< +?m:7#488Z#488x+?R#48J#48#48!#48 8#488B< +8B(< +#8B< +#48n#488x + 8x +8x#8$h#48V;@%PA%xI%\(Khj*(b(5 /FB RFHFAF(ѵ`N"HAFxH8x+?48(@΀8 ;#88A8xF EyKEFEF-q8)/ sH#48F!8FFD8x+F )cIdN405!FE)oѺ*0xxFBшEFO x O Eث.F (ЈEFٺ ERF0F( 1D!6E F@+; +p; +R#ՅE +R#7+E+Z/+ѫiFl#+b)ip@Rhq`p@ #x%F4++ ++L h;)+x #`(F `Ax"+ixp@x"+i@xKh+p@ ^x!+hj; FhbKh+ohjIHp@Kh+b I Kh.YF(<1FHp@̽I%t2%,2%ƁzźҁpFKFFX`0F)F Fp@I%NKMi@4@F/#s`c(Frj(Fm Hi, , K!F`@|HZHI%*؁\J%PQ^p+LhH7#c`*h&H6hZ$H0h"H*h^ H$hHhHN%h A+F2F!5-ѣh HK"`pL##L H HI%܁ "\J%q!Kh@브(KXhi8 pGI%COppGKiFH]<%!F KhD```I%Kph\#xK%;.FM%B p]&>#x5 H?%!F VJ#`hD` `FhI%DF F-G#_Le&-]O`]Kh3s[;`O ch 0 C QKhO0*#hOGo ( hP @Kh0k}P6Khܠ0  1+^[ 8#@ch7+?OCOS#;+?Je(EjH")F @ (? hFP0I#" f0+?8e&2+rzJ`#*ssKh K"! i2+riJ`#*s"! i[#*s#"#YKh+ #*s "#*s"##"JK"FhyGK"Fh#*s#"#h=Kh+*#*s$ #*s"##M"!#*s=(Kh+"!j$Kh  5F 2+r;`Kh+ "8hFG2+r;` "8hFU e 02%>$n%n%n%#N*s#"##3`gci+#c 2e+rd;Ck+#d"##ck i*(q (q+ci+ yKh?SqHwnKh+ #}"l hK`blgK`lgK`(?mx bKhC`#*s#"##YKhCB`h`#*s"##g)!i {8hCsh&LCC`#*s"##F!i Z`h&s#CsFPBPA d+K.Hh`*K"dh`)Kbdh`d(Kh+@?&J &Ih#Kh+@5 ۭN0hpIFH.0hHIFJ#I h"ZKh! `0H! n%[l2%K%(o%\n%ln%,y,2%(*Ղ(Q^<2%#*s"## i(?{H0r#H*sKK H!#*s"## i(?J#H*sKK#*s"## i FFH#*s"## i FFHv0F( ???Kh#*s"## iA(?H!L?|Kh0F0F90F#&abE-F(?1F"#a#hIF fKhKfJfHgIh.F0F޻dH!`IF F( -e& %P -??.O1(F!t#QIF> F(u - -?p(F0]#FIF F(^ - -?YB(FaR3Kh+9IF% F(B - -.%(FF(6&J% &I(Ph`.%#(IFx#*s%K`%JhBOvv6!i[`K"` h+߿Khs[2 -zz-@Ln%\l2%P,2%(Q^5itn%K%dJ%2%#*sK`J#ih Dh+߿Khs[2K"`K`chi+?ϩ|0F I#"(F+¹Kh+?#cn%K%2%P*o%Kh0pG@%8FF ^$r!F2(F8-OFFFFhD%FG E[եB< +5#+p-PF4>2F!F3($B!+JhZBB8FZB,<++*)HF.FBFIF4(FzQHF9HF:FIFEK# @%hZ`F`XxpG-GFIE6?h +43pF#xp+3pc!B"l *+*F`xETDFhEEF=?0F+;M&F砃pF FFR ! 98+hD`4D(``` pO0-MFOO O $ò0 *;p&  `Sh 4O07F e 00;+ (ݝ0;+ A-@,A, Kh+B C Kh+C B 0m+KhB# K"`n%2%dJ%-AFFFO d +2F5B$hxxBI)]Xx](g(B 5=`@(/+ '%@,A,,e  Kh+ C B Kh+C B K!h;B# 6K"`D( [d(f(Ѧ縱Zxg*F;+xF0*/*r32i n%2%dJ%L h`hhh@I% FFH(ڽ@!HpI% FFH(ڽ@!H\I%ƒ-GFVKh''8F9Fn(FqF(FO7!9F("#(F?? F9/2F!F(F8F(FjOsKEE F9S  #xCcxM+ѣx++xG+ <<+1F Fv F@Ul2%F xpG%*Zx%*33s*0@0pGL#h#H ` hK#`LJ%s-G!Fd Od O FFsh;s`+ 0F (F'#8F#p3hZ2`x - 2BOI !HF~9FFud8FGF8@F[CHHK(F!-AFf!DUK"xxBFI4F#x##8F3p xBcxB4;;>FF@F#x+5*FAF F,D;;((-OF8&F'FF,K,JFq%!8FFF/3'p-x7BxB&-KJ(/D&O 6 F!(FKJ)FxC KxF0F9F FIFu,D0;F((FHF FF0I F@y8FF(F!D4 F KJ!F;FF(F8I0F F0F8 F}N-AFFF %(Fx+jF0Ff!D4 F8 F( K!F JCFl/!(F((F8jFH!F"@<-AFЀF4F%?s!hFF?C(F#p#+ %+ѧBcx%+#KhB cx#+HD<#+5<%+#+ѷBrx#*F Fu FD%+ ѷB rx%*Jh,#*;,%*l2%h2%-CŰF E$"#(F??Or(F1F(p5lB,Կ  0K)b()F4*F!a0+F F8*F0F8F(4@%n%-A08KhF+]6Kx*F,F(Q2H$FA0K(F@FFF FBDq>6!(F)%K)F$Jx$KxCFF<8F8_SE0F0D߹I"F0FVF0F8J_8FPF8F+x[(F8= F:FAFf F,F80,2%*†(ˆ(vFKh#! F3F!FJF(FcF^)FFF F4F88F8(F8 F$,2%F Ix`I Fr8I Fn@  *,ymF iF F0 F m@|hFy mHK-OFhFF3EKhO0BH=FбFxFF3|*-* F(Fx(F 9H!7I F($C FF(FDFXF@QFD4 F-*F[F!FFJXF8lPFqFPF8e-й *е@ "c Fd((F(O3H;`F F4P H<`(F<F(F#x+ F8(n%,2%**K-AFh F.IO0%HF(?(!H1FA(FF FF8FF(FF0FDD4!D F!F+F:FF0F8(F8@FF@F8, FA,2%'iF|( p@CXBXA'] 0FL#hx(Fd!0S)FFu:I Fu iF(FP((FF F'0$hpCO(F>!*0.)FFuI$n%++Fd((#" F#8pKFh FiF KbBBKbBBѴ??BA &p  l2%@J%8J%HpGF DB F,C/*FFO`4KhB Cн@ n% KBBB Kh@չ@PJ%PF܀@󥀸DFEF F)FJ00hC׀??@ЀzKh+@ˀyKyJhhC@Ā#0 ?? 'qKh+PpK FpIh hC@sC)!O1)FE F)FYF F/|0XKh;BBB  F)FO EcoBBw F)F30N'O kHKhCF(^DKh+(AKh+@H@ F)F??F FQ!Fc(G!F\(@"K h9S(?7PF??%Kh+ !( " !OT# 08K hC K"O0`ON_42%o%02%m%0o%Hn%Pn%K%?%n%+Zn%PJ% KiS Kh( Kh+Kh8pG pGBppGPJ% o%0o%2%-GFF FB(4KhB#3Kh.Կ&&??.Kh+-KhCBOqu1 FO3"F+F&"KhCѹF  F)F:??F FѸOEAO0Ge F)F".F2%n%Pn%K%n%-OFFFf'p  X FO`o??F F>!KhùOK h9"(#"F@F+F,FLO {F F (op??0$%FF F?%2%|%-AF FFP??F F &AO0>C*F#F8Fh8 MFF+hB(hBԿ  8??42%K(FFhB pG+K(FFPhB pG+F @F޿8F(M+hB F(`#IS``#hB Jhh;`7h7 F8@7 Zi:Zah8l2%+hJ%KhpGhJ%-AF F"@FDE/8F78! F0F`0F #BEF#wa#a 3+h 5`\`ki,`3ca#hCE'J Fh3`Bh8FH0FxF@FrB8F7 F@F70F^`$hZi2ZahhJ%+hpGhpG@ipG Ʉ 0 FȄ#wpGpGi DapGipGipGapGcpGkpG8F@k FB7`ec8@kpG-OF FgFF:й7`O #!2F1@F;FIF^F-Ѐ= !FO??# ZF0QF#F(FBF x#"(F2QF2F;F3FXF(> \F< * -O FF  ?? O4%F F)F Kh+sѮK FIh hCEs) O1!)F F)FF F F)F{(ѡNFF3h MB (M @FIF\W@FIFFF\OFBw>DF (f 8CBCA$O4%Fp .q@FF F +H{Kh.I&EN(wKhCѝ8i 0m2F;FF6G(iKh{ к  6G ( ( 6:gw ҉#(е  7F euE[RKhCVBO am 0F"+9F!,@FIF`( BKhk[E FF@FIFFJh? au . .)F F ( ( ( (F F'Pn%K%?%|%K%n%n%n%o%o%?? au/ Kh[ . . +F FF# 0W^n%7F F/pKh*Կ""#(F!F#20"K%-OFF.y#O3  $Kh+ѡKh@BOqy( FO32FKFKhCpi(ѓKh><Fwu , ,ьL0i#hf ( (0 L#hX (QCAm([ O8 FZ # CF?yjKh rcE (FUF!@t`KhC@_Kzh+~#j{o0B8Fao LF KI h)'KK"` :# F"l(+O;h;BTO0 khI "3k` #`"QF船:FOa(8Fh MqI",nI"8!h!hg hI"(@Fk=.-!.*<.Ц ^+)#` 0ZH>.Zx=*ј+&Zx=*ј-& "FFELIMHZx=*ј!JJ 3F<.T+.W-.[ki"=.kiYКB""*?x(?uFFF; +L#+ѓ+<\+# p3x+ *=!0FF(SІBQ,+*M  Jx(f!hkiBԿ""kiB̿""kiB""JBJAH@ԵlJ%<*}mzzG,!B!F43x +=+ !h"0FCx=+:I;H!h !!F !!F3x + !h0FFxFFk . .#0#hhhFHIFHOd IHIF3(PF`x*!h_i!hx(?:!!FOzz xK!B(¿Z`i`D`pGJ%K T@ wYcJ%JF XB0(O0pG.F JhBJhZBJhBKh0;%(;%8;%$;%-C!LOH8F6 !F8F6F6@0F6 (hBF0FO(FIFHF6xh6u epJ%FO FF0BhU;iC$`(J%8FJi]a FFF F8@PJ% JFhp`e  Z  O0pGn%8Kh+Lm!P M 80 L (8"!"!n%J%zHLK0HK0!O`!`O`Oc0 aHH H H H#0#J%FT4E$K%0K%U@UPQ H H~ H{ HxP8hT#iiC"Pi3J%$K%0K%J0hC*0+8F1F5P[ #jFhFF2N%3hBOnF%BQ! <,K `'>F(F!Ff%KOb!0+ L!M +hB! K0??ЍBt JBAJOq+ $! 5 @Q5n%n%J%n%o%n%KhKhKh+Kh3pGn%n%o%n%p LeiiBcia0#`p#iS%0+h0FY]5J%(F FF0@E7Kh#F(bO4 F1Kh (A(: F,Ni($$+2io@G;D)FR#8iD3iS'D(F1(гi (F*'хBJhABJhBJhD$(!F0F2iC;)FR#r(СKho@%J%,;%<;% ;%4;%-OLgF FF0??)1+@Ae#1ih+@O1uFiPF+ÿC!i3#ȿQ#0)F:F%)^r0F9FOG(HCD#??вBADg#1-%O kKh+oѸ| O  1B 8#??08g+xHFFFEr 1Bs SKh 1C1+#1F!O HDX #C ZE  Ѣ1+\1+ј ! "g/  "S#h(F  Y/KhDE F0"!]60B#H & ")F-H_2BZF#aiBܣiN a0 1PBl1h" =}h\T!iQ"2A#3J%n%n%2%$K%n%-AFF FFvKh+ 8")Fg( Kh0D(FKhDB n%J%2%8FF*F#FOHq8 8-AF MF$x$1B  2F;F $4K% O?h/ # F!O8 n%Ki(!h,!pGJ%K(!a,!`pGJ%(FK8  J%(F HK!F8  J% ( ! #3` Ch F) h\) \B\A` h+J\B[$)3`\+#C`O3` F( F(upF FF!*F FU#hBF0F(p-GFFLFF P*01;0#10#0(1F(FF((JF!0Fx 01[h PH JF!0F`F(05YHN0q}0 ` K)F0F 1B qHF 1BFۣimNh0kN+D*FO1B ([^H3`05 #01.}\Kh*[Kh):BF;FIF Gi+*_i+I`iBhD @%i@8U 0BF;F N8 g*9)/)`hO1DcFhBO1aW!iFi2FQ (FS< #h(#`#*) " F*()$+05F-aIhi h\iB"iR#PF_.2ѫE(BF;FIF0FnO3060 CEJ%0K%i $M%|%-CF;TF FFF??.0BEF#p JCc`Kx8HH,*n%n%008(H!K"`pGH@2%(Kh pGn%0L#h++ `n%0 L#h+HiF#V##`n%Y0 L#h+HiF#@##`n%0 Khs Kh[??ѽ@n%l2%(0 x J^+pKxp]KxEiFHX<p()0$NM4`,` x,+ I#H!F0`x,* I3H!(` pK! J FhKhHn%|n%]ϑ(0Z09$?+GK`0R++D+++BHiF0e *'*-03EZ+-+%У1* ;Cr+d+W+^+w+@@@p@`@@p@P KhQE#0 TDF!PDK!DN!DR!DW!!BH H )!BH-#0 piFln%$?KhSKh+Kh(Կ  pG pGn%|n%n%Kh(KJhhDpGn%2%n%FxFFEHiF,F F!D8`FO!xi;hK\)cxS4;;$)#+p.0F|(Rn%xBh+h FHJ*!H]*!JHzm%mrLIF F F"n%n(hS  pG(h ЀipGHpGqo(C H,Kl8 pGm%KliFHH]m%RFh FFx-+0''x0; +,##`O0- HiF "1F(,-H ##`/@B}-OFpNlȱh+ +Ci G#d Bl"iF ` FFx*\x-(W/$( (٠ ۲)F(+(#3e3#F F(#x++Dġ3`s F39(/(z$ 0 Fa O O F F,F,HVn(0+Xx-(3+(@3% FO@!a O O xF=*ూh**5H=J3h;+"F23+'H'H2U`ci!F G,n6[ 2-ѻ;#;#[xd0x +iRF (x+"QF%m%ܒLn%t2%𵇰@#@FF FwHW-hY qH煹 nHoqAx  h;+@e_bi*@h+5F-bi--l!i h[ `*`%h.gУh`*M%1[ `*C%-bi- ->!i h;#;#[1;#;#[+1H!l---!bi+#i`#`bi%H!Rbi* Gbi*- Gy-vh+ӱ#ih+H!#i!h3T# +#iih!+-tv#iihK"`lDSoړdJ%FhFF xF0; +#O F xF10:ײ / "+.`<##`,##`O0.HiF+ܿ3 PC3}KhKh(   pG o%Ln% H: K"` L#x#i h`h!ciFG$4Ln%0FHx FpGBЁh ;B$00-O$,M#FF'FF*xb+A#`O XFnh~$5O 1hRF@Fv, A8(ټ- IEIE 0h7FF#F@DBDAhպvhO # `+?h`0H((ĿK`?d< pGYKhXHUK" "`"RKhBPKhoo ]WHJ#DIhB `G #13BKhBKh+AKh:K1+2!.0 :J&0h"oO293KxB ,JohC`&K"`+Jh**nJ#`!Kh{X 13 1+ J 1(nh+?ghh#+?aO0~ KhB?y(K"!qon@o%Do%|%|%N%n%d<?%X<hn%H!Do%hF]F(h3F(FF0F!D4 FJ+F!FF8FOiF3(I"FHHOPp%-CFGF"F;FD;F"F)De Eu&ICBA4 A#d"#]7 L2EE0@B! K22JKXChF]Mb@BK IhT "FXh`&BK"`h<dp%dJ%FK\`h<K$""$]pGdp%8FM K*hB+h FZ*`p"K$8h<ct%dp%KshK"`pND FFB-4Z4(F|%dJ%dp%D)-C FFF@BaAH Oy#02FKF,F F FS `F--8F-#<!FoRY˿-AFDppFF# 09F#F -(-0F-",!Fo(Y-OFF FO O O :F;0 )٣a)أWBc#C#F`CK A)أ7 O0O1-OFFFO O %BF;0 )٣a)أWBszCFC5CA)أ7 O0-O%FFFFO BF;0 )٣a)أWBs#3C#FC5CA)أ7 O0-AF F$x F%(_^4;FXxn(+c(/d(%(Ns(x("Uk3FF ;CF "U iFhFzhF"D #jFx FFF (CFFFFF fO`29F0F(FK FHEK"$dp% ( Ђ*KAս@8o!JpF 4 F3 4]@)F F]p@ ǽKh YO`K)F FhEDHKhR K44DhBp@޿"K`kdp%n% ;%p<$;%2%dJ%KJo]zzj7F F0)F F0@KxJ)FJF FN0X<8F F)F F5F Kh+޿K"`Q, F8 32%dJ%F'KQFFh+!Щ! "K!Fh!K:h"[ CBF4F0F2:H!)O4)!wF ##F!FFB $(h .(h2.` F(F2 o%|%02%Fh  h2##`@ pG-OFFF(V_MFDPKPDE pO3`+`&F"#FQF xѢA 2ҲEшBЙE!13B ,`3`#s`k`#KV#U# B 3+4+!F: "B"6  :  +!dp F9/ۘE3B#s!``) F#  /F"@ E"\E"@ F"23F*Fo%HpGB Kh8p@Kh8KhpGKh82%tt% KpFh F K.2hOؿ"FlCTp2%tt%Kp FhFKJ)hOOؿ#DD!Dؿ"Fep2%tt%K!hK"rhV2%tt% KphCBq Kh#BO0RoBThqXp3tt%2% KhB $32D*t0 tt%K h9࿘2%K)phڋK$O6h9K&h<U1 [h??1` U1 [h??#pB1Dtt%2%NM2hkhB#,hhF! F2B!0h3hk`F(`^??S;D3B`p 2%tt%K(h( BF8pG2%F"YxX:)ء.)F?)\)љx)И2*pG:pGFpGpF M+hFBF(1F(4"Fn*`"Up|t%Hq8F M??,+h;Bܽ8@4 Fy82% #jFhF] "iFhF]8Fx FP+ b;۲+DB"cxj+B+ b+#+`m+ t+ 4(` F8oO0oKhKn%8HKMhK;* F F p M(`ph`p`8avLn%|t%v<-CFMx..`;'#xC+hBГHH :+8 %+'.+𪀍0 p?+ \+cx+𜀍0F# 0#VxF ظK ظBۀD FFtL,S(YYYYYYYYYYYYYYYYYYY)7EiQWWYYYYiYYYYYYY (hB  X@0 9Kh+4=6Kh5I83Kh+?sC -Kh+?g??]0(Կ  2(KhZ???Ay(q9C?5m(q.LC(a(!Kh|t%t%zzK%l2%*o%p2%#HBF6?tS(MMMMMM_MMMMMMMMMMMMMMMMMMM_yMM9MMOMMMMIMMM)h"B Fр+`"p??, #rCjKh(qfKfJhh E8a:0A??TP !n8aX(qNK8hLKhLKhKKhqHKhlEKheF@F1nq;KhXgP5BA*s(q8aH(wsFF??F F*sHFAF \-PFF?{BA*sqF F5 9 ()"" Hw HuKh*(tQK%n%2%82%l2%XgKh8< Kh Khd -U K KXhXK"`,o%Ln%|t%<p2%Kh <FhhH %i-5`dBsh,vBs- FF FdBsDh,`%dBsۄh, (F`h h\hZPhB S``Y``` `!``#hZhB `S``L`` `!``F@h1# Fc`@pFDhcBv! p0!F0Fk#3kh&``[`l`ch0 hYa` p&,`-AFFF Fi&K`h%K``@h(< `FJ/B$#J`hXBXA@KBF1F`#F(F( `h1j#c`(F*A )F``n:F!1(#1Oe`O0o%|%-AFh F^ iPBp 3PBrڰjBrh"jE|/ۚBj#EEW## MFŔfFBA۲hjBPBABPBEhCEEP8Fhp`Fa `a`#ka.`Ɣ)hѹia3iSQBB8F3i`F` a`5aKi+ hXhB hFBTi4 FHaPa"ZahBсB8Fmh+h"8FZa"h[hBJa ѽAJhBћhB8FhAxKhXhq@ h8 |%-CF FlT# GrE#hbhYBѱEZGs2CB#AiF@FEchZGs#  4|%-OؠFFFh+Y2h*VLO0i[/:!BO$a!*F9F*F9FI@000 y_9FO$b2h*Fl3hBB4 0"#2"F( F|%K""`ZapG|%FKh 1Mj>#bKh&b FM??5 FWd4;h;BO$XJ%|%d?%2%2K-Og??W-J h,KhQh #O޹&Kh %,F0;B(C2O F??FF@F[Es ۱??ІBw XFQF F%DFd?%XJ%2%pFh\ KDD  p`1 F14F|%H|%8F L 58@ $i!8@Hj[ b|%H|%8F Fy 8H*F#Fd(#BA |%-OFF #K2h KhKh_YF FKhFKhBOrr 3OxFAF[FF??+: 2?? K3%F^F # Kh@ 2?? 8J՜BF{MںK4+Hȿ4 FYFĿ34B#SFF3H??K8+:_??FF33S??FF'6sV  B s 6 K ).SFF;hLFFO FHFQF'GFEKhk-mBoJFSFAF FYF(@6Kh39KhU 6Kh 55K5Jhh+l4I h)k+F*F1Kh+E)FFF 20FFKm-O(lH#"!2b(Zz KqV+JEE2%2%n%tn%n%|%o%|n%|%\n%Tn%(o%n%E*)+А)&hb"!HLEK{ iH00MFVFLFF??ЌB{ #B{p-i-l ; +TKh+ KqV 2F(X+H!*E% FBJ[YF`R#` Kv##FEv FYFS(PO Ku##F}Eu ڱE+K `"*K` 5E0h0e5 K# 7+!+! JFWCH7'FFR#` Kv8FAFEvکEO7F7x5FFO3|%Pn%K%dJ%8F F H*F#F(#Bt(F!F8Ti|%8F F H*F#F(2Bt(F!F8S]hB4FF|%FF#;`&Kh %K#??"LEt ۵??0ЖBu,F FHp F FHy(е??#BAڀj(/#;` Kh++Kj+Opn%|%Pn%|%pFF +xKm,K"eK`p%i F F0j,F! #2F)F3F`a#( Fp@0RKm#a|%dJ%Km8  |%-OFKFF Fk[k(?`OEFv+F FCF&B3ѥK??䀸??ЀEx,(LKhC HxFFF??JIFBF5( #8FF6FO7 E|E|򿀌Buۀ}KhCBOpuӀeFFF??ЏBA9FBueډFFjOh&F&A&oF&F c# #JF F)F# CF( #?? Bs򢀲BAF#??ГEzڻzXFQFh#XFFQF??F Fe8KcZcO BsVzFFOs??Bu8'KhCBOru1eF KhC HxBuOpFڜBueFtFeFO F\F]FtFeF2O F\F]F,FF;O F\F]F5FFFFc#;h|%K%Xc(?\#F??FF?qE0!T??o^F F(FO1!FU 0"KbKh+ѽ@|%Pn%8!KFhbF M#"F(( Kh+ѫj  8O0(|%Pn%L#iKh#`Hvh@|%o%|%-OFF  x+LGG8Lh{@ՒH!8FяHO9HF M+h+ЉKh l+h+ѣj#bW#bk(6и@O??F Ff#CF FnMF ##(<(lLmN#h2hC 1#b#h+3h+cKh+ ѸaKh>0F{+ F ѸYKh8@FkVKhF9`#FF F4??06B7O4%FE`@??FF(Ѻ?W8Kh+7Kh 8H!C&FF F??Ѹ&4F5F0FF F FO;#O2)FO3LFx#h+Kh+? { ?? ZF#h+ Kh+?B@E |%֦Pn%n%4o%2%n% IJhC`Kh@ͻ14|%@o% IJhC`Kh@a4|%@o% 6 I J!FhC`-Kh@4|%@o%FбI KI h+!I ! I@ F !F |! x!F t!F4,2%a4144-K-Ah,SСO`'! ZD}}(F)F J)F Ft!fI > tK"`bNM/h3hCE+hB +hJ3s[`C K"` Kh#A |%a4dJ%2%2%d2%n%-CFKFFhHF)FFFHFbp3+] +@F9F! |%-A!F FFF0F!D|1F`mb#wa F(Fx!Dh)FamN8 M,hB K""`8#hS``0i0 F0<|%-OFYMMhWIdF0}.RLPF#`6 F2FOa8FFx0Fh++hHF#`#c` M;x!+BF9FPF(0 + +XFFx+F )!pqx+!FyFHFFkh`C``hh`3`ZZxx^*3FaEм ,$*O3!!pF\2])!pCx0a+[+\+TѐL[40 p!F3)K)J,Ihh[)ѣ.ɲ)GFcpFDF]cE 04FKJIhhFE0; F;n0 # p!F\BpF pB#0 pnpF0%(%XOoOOJ FpFhF F+""p0 JIHh hxd4 F"F)Fp@ *26@0%(%O-GF>K I  %I CF FxJFAF0Fp1c(V1K1Fh0Kh/I"F+F |\,ZxU38Zpx[,[$[%x[,[,ؤ./ * [-<[+%F], Zp3--[-,BPP-OFFDE#~t+b+r+ a+$h{+!h`i030'iz&?Z#P}K JeaIhh{$gaFDkhB8Ft8#8F`/-h0%(%`P|%%-O]KN'H"@-(}/sKJIhh { #`2h0CKJIhhI+v xDJKIhh {B 1LhB JK@ hhI{h )T!uFFMEoEYFDCHeH#HGHWMF;#320\k~Cakv@F;#320[+FC{/Fx+?z2hF;+?sY2@@#+?j;+ `FC~`dCv_H(?t Fh`@F(ń2hF;+?UY2L,+MFDF;#320Y F` FgFP1hFxF2#310[ .i~Aiv/4K4J;Ihh9h=`F@F)?L2@e;) })?'J%K.Ihh@Fu@F1L2@d\)JK#IhhO\42IJKIhhAA QqQQ\ ѓм sF ˓ъDHp#a@F0(amoOI @FIFFDF;320[ԃI FKh(aOr@ a F&ha0C{I"F {BzKzJ{IhhGO3ka3@F;+320\rI@F;C320YkIF+aDF;#320[dI F(aF#x˱B$?ӹ Y* fY*0X4I*NKNJSIhhDD0B0XFi(8CKDJHIhh0 \+:K;JAIhh$! NM"ha FF(1K2J9Ihh4M!FR S3"O`,`<+!KAFAh0,SD89, x)@8)D od!FH R2@`(KJIhh^Q%h0%(%QRT|R#RARR% S|%\)Zи]B@QRxz R2hQL@ FH@8"+QD, hO 89#FO2 0 089+@8I#xg+|9+q0+M+' +$JKIhh2 hx9)/)q&)> 8, e `O\)O: `,,2 `48H8 \ px0ҲH@hBjKhJjIhhB ,,8)P8 xp8)Q8\!p )YKXJ[Ihhm;+I+#0'p+"w+Mi+1h8)x+?o310\i28)DKBJGIhhWO #089389H" 8 "8 Fh"+,/K-J3Ihh-89@;891h48I8)x S38)x T"4pBKJ"Ihh 310X28) )Q8x+ FKh [Or@ a F0?8IMxkjiSaԹ#xF%(%0%SRRBS{SS%xjiSa1h;+?Z1 R;+ F&miMhQhaOp #haF@30 \+чKJIhh 8"HF)F\0KJIhh X8"AFK2hx0#320[ # FF.Fh ! {TjKkJmIhhZ # FF.AЅB`KaJdIhhFcKh+1#T3 c hxѹ1hF;+?Z1 R;+}+?JKJJPIhh*h3`*` "!F%P,"!J(F.0+F#cU5 c ( x* !.nF"U! {(h, !.`F x ( )h xT JD *hBD*`!TOH  +!Q JF @ b)hBFPD(0@X x ]0%(%S:ThTTT-G^$N!FO|`V[p4,Kh+ XCK`Kh0K`h;hHF:hiF(FUF.|%0%%t%%%(%U8F F#`KTh``8>F "B`FJQh`CKS`>KphNmh (F(h1FF(Ch;C`+ ڵC !F` F. phZ`x F$%-AFSLFF"j*8*\%(Fcj.3`bZh*hFITcjb h CI{h%#c%bh!?J@H8>M(>Ikcj%c%hcej9F@FFj3b+ј #*ј n*a.j @3`cjjhcbjcm:x#*Zxn*"a@F:F!*7 ce#pj3b#3`EFxB *+!:Fceej""b)hhBab?jpj3b.#p"ceBp%hV4% VLmchh Ch;C`+ڵCСm~ hZ`x@ %-OFL Fm#hhkchI zKJeX3eK"c#f#cfLMmCh;C`+ڵBСm@ImmCF@"k IzhZ`xmHE p` (;еp0۱~H}I kzI kXyHp4rH d#p0p4m@@EеmH!k(F#egHp##fbn#hڹ[h#`#h+hch c+(!k ZK F ZIZKz<#cfchxObOHahMHObo"k NIz$!kOb(!kOb `({~FF `{BJSFOa(Fo(Fm@EеR8I(Fe(?BB ~m Cxh%fb(I ke( !kHB#aK\#f瘱nD< + E ;F`n0F*Fj 3b @ %Vnlp%h%hp%3V I"F zV F @F. I"F znV8F F-(I+F"F z^8VF N F0h.)F# FmF;F)FF0` Fm0hp%])M)O&khB&Kh@>$Khh+5h.I"FF z #*hsCX+6h!;h@hI@hF(OR#F!hFF FD;h!hF 3 ]t%\%`%sFMF(h#I z`+i" h libF2H( h^IF z p t%VP-CFALAO2DF[ij2B AjbiDba"p&--\-Jx8h 0@0՘ \*&*Fij2B AjbiDba[i2aAF!"iOR Jh??R??i-j2*DB aj)DbiDba"iFR *F1DNi*DF+Dt%FBhFAiF*DFSBAAai a `/*F1F#c`D&2D"e`ZU-OԲ#L0H!3#cKh-c#d. h¹h+@ހak!k@h(@k~.k~-hh*3h+@k~rhB++~=;>+R#!d Y Y Y Y Y Y[ Y Y \'\ Y Y Y Y Y^ Y^ Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y9[Eb[[ Y Y[\7\ Y YC\ Ye^ Y^G_q__9b Y YKbbb YEb"`+v_+ bk"!kph=8 +ph0PBPAk~xhh)UQh BO`"`"dD+ Ah k~B?<%hi~h*Zh0B0`*[h+#d h+ bk2F!k@hk~(?+@h0xBxA(lbhB! hYCZd# `fh #"h!sC(i6Px``f`t%%~%(%#! 1h˹K(ihKkhC ѐM!bk k+hDk)h t-xl+I(k+ek5&kj !0F@#cA0Fbcpc#yH%#xIvH"## tH#qIrH"#kK(ihzd#kgOȑck:hiKB<#03 eHJPxC0s# _I  (ѽ*0+0"!&HC06B9hRH<9h$ 9h ;h[KKhh+h.sFI"FF z -?FP "!x O +8K6hB9h2H9h$ 9h &CDF-FF-&Kh2FB9h&HKBF!VDhL+>F-BF8HK9hhBHVF6HIK\8h\%%%4ė%hjht@$`% >wVVJOhB9h&H| |K+{IhSEDx DvKkhC rN!bk k3hk1h mH!  #c4hIfH#"dH!(&k+![N!bk k3hk+?1h k+ x !28FF8kcc#c !bk8F0k# .?ccc>KkhC 9M!bk k+hlk)h UlbhB! hYCZd `fh "#h!rCki'khjiRhB i %K $IhzXck9FHF#F(#aFkibk3к#i !@Ѐ#i!kHhz#ki8Fj#ihZ9D# >$\%V%%40%V%O KihVhBB ЮH#9Fhki8FjZ"i2BBPDO hF`ڝN H 00<Ϩ H<jaki[hcO!rk0k;hk9h oih(Z!}Jh C`BpyH9D#"#iO J1CDhF"9FHF#F(fR9FdHYBB2A!#Dh #"9FHF}( !k+;i3Or@ a$8a0kihKI z@ki iskBki"DIi(?~h+?f#`mi@k+]ki3 (iOr@ aha0*i hickB.I"hi(?>"m"*I#*H)N 0 <Ϯ 0<6Ɯk+ 4?J&kh*&f3xp(p71B*#"1F!t%%\%h4ė%%3x0; 2DBҺ #"1Hp#"H"! R BE10F7BF!HRj(1O1S 0Dx0 h0<ǜΨ H<h x0h0vK Ihmܗ%\% t%Kh#"I#Hh`~{) Rih~%ė%pF FO6Bp#~w+{+s+ciiB(cih I ycia$h`iC"ifa!h`ih-CFFFF ,FBI y#`@Kh`O>I8F \`X.U(FC-sZh`B GFFFg`F;!+!У<Ѳ) *=<h(I*F yC`hYChChC:+h+ ;x+Ч`#0hBC`.ch+f`:!HFF(#;0B+  HF a%W W8F!Khı`h )F(7h+4 *3!K"i0SBSA3h(F8K"i0B##K"i0BԿ## K"i0B̿##K"i0B##$h%&"0FMFI*F yiF x0 I yObiF F F M0h'W K : * B² *I QppG I0;0+ B0Z "ppG1 ܸ 2L!Fh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@%KphkiAK4( t fx.($x hp|p~pqY}p, F F ɲv!ҲZu"&%Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p%&-A4L#hZi5#2JhҹkC#h.J![ikM,N%,O3hB-%Kh#"hRi( "J!M#"hRi, J!M#"hRi40~HA ޾#h[im)FP"h J!M#h! J5[iM9F@F+&T%fX%7W8FH`3I > I0"FHJHOqHM, F8 !(F#p+x3,IH`L@W%UWsX%H2( rF"Hx?+Cx۱0MFN! FP 0 Fp/!D Fv(ЀhFS+ !F0F F!F(Fh#`! y48"6WfWIFH |WKD |<0BєB4KFIHKh[i1cxB [x;IH@K,IH,؄@I@F H,I H"F I@H%uW&WWX X X*XtIFH X7F F"` F#xx< #`O00h"+@0O0 FF*hiF F0I"F y!Yp<#MU#@BFi3XB0D1DBȿ"2p! h3l@dpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3l dpG2p! h3ldpG h+#`pG H`pG# K`pG`pG8F K Jhh@!B - ,O@EC#8##&8%#pG `pG# `pG# `pG# `pG# `pG# `pGK J`pG%5K J`pG%4K `pGK `pGYK `pGYK `pGYK `pGYK `pGY!L0F %# K`pG!L04 %K J`pG%K J`pG%YK J`pG%Y `pG# `pG# `pGK `pGYK `pGYK `pGYK `pGYK `pGYK `pGYK `pGYK `pGZK `pGZK `pGZK `pGZK `pG(ZK `pG:K `pGNK `pG~K `pGVK `pG4K `pG2Z@s "@O@/g b # "O1_]" h@! IOb@r  P& h"Op5;##D IOb@k  P&"L@!F w%I"Op %I"Op5;##D % h"H F0F:*FIF Fp@ZF)G 6:F=!JOq5;##Di@J@ JOqJ@IHXJ3K@ FOqJ2J@h IK,OqF%%%% %%! b@Q! \@Q!@ U@R! O@R!@ H@S! B@S!@ ;IHx Z8!L#h+87(6=>ZIpI"! IO09XO0AZM(hC``(hC!`(h7@ !`* ap J0C/B<##` 8  `%@& >-OF,򖃟KhB@iS$@,#! +@Os>(Ej#i FG#k FGi+@F P1O ##X  2HFx*@&F&`3i*0B@3O F;FB2FF !0F# _(0FBFF #-omBBF 0 QI KhXFEݼݴDѠ %u@ DB"R!(>x=I0 xIhQ8I8Hj#F"7KBF.&(^F,J  hE&>N(J)Ih2F'HSFD iO  HhX5 BBF  0E? ѣ Oc -Uh-um8DKF*FYFDJa> I;F QDB `%ZX[[NG!7IHO1i9@iO1A#մ YFKF*F8DD bE`!jKhDh F!0D3BۚI Hi@S(F<(e(2JCh20񼁎I 0(FG BТiRԴ DBDシ0+ݢi;RԴ Bej%uI rN0hBF0hB#FF8FDF(E0hkNAFD'0hF?8(FIF+FF+ E60h@7"F]K0hA+F"!0hA"!0hJV0hG&0h<003x(ʁq(Ɓ>(2d(0<(EI *  u(PE аڰo|`D(/;K[h;OE`jO F@SB+x+0K[h;D>Eb0+?  [R#s"ri7"x(c?a80Bi[??z(`(x(8 (8orD(?ɮS ucD&@&[`%+?ɮR#c))͋))u)))))))))1ڰ?(?ͮ?<(->( ("C0hBo `p3D7D pB8FBֿ1ؿ OаBc@00ozwF.?@W&u͋׋(F jiDriE0B+# i7, jiD`iE`h* #c`%0BSck FGi%@6 ja@2%b i 0?t=hKp `ok[e FGB?^(вi7 j0iD j@&biE>i@#aKiS'@>8FiXh *i3D]`3@F>:@FE@F@0h`%KiS 0YpG`%(KhBiS pG pG`%-OFFF*$PB*EF $ FD!m PPO U$()Ky.FFh.=320[ Ը 7I p.F=Ef>>.=320[bvd-nT ѹRFIF8F8FFBnb"D<"##[#C RF9F#;U8F O*ԹKERFIFFt%H$\(FMh౨`BF0FBDC4+hB F)Fdhh*F"##8Ft%F M(hAKiTO3+`" FFBFO0p#"#XN#FaF (` F,hc I F B0b Tt%\@u#BpF M+hZЀ N2jB 0$0iB,hD FplhTt%Lh7:"##t%Khbt%Kht%wFUk F1F*F p@pGSK!F*~F @pG R]pGF F@FHhu@FHٿh-C 0FFFX F8F ZIF*5"F!c+FeL-OFFF@BFB-F'&*)FF(F$FxCB 5 'D3DB%F''+x+ DB,''?dtd  O !(VѸ*FO.ؿAFܿvv[Eȿ3FCF(;+Fi@IBF%F5F*9F# F6!FPFC2PF? FD^(F? F?0D FCfF !KFhC8`F F8@ F F@("F F6 FFZ sC2`F F88F0F8 F`@F0F@]\D&t%L   𵅰F F FS{9F*"F!c+F L-C 0FFFX F8F IF*"F!c+FLSK!F*F @pGI迒8MhAFhA D8t% 7hFLH` T=%h}hF!IF(F h h^##`L%h}hFIF(F| h hL##` KhI HF0%%% -O7IFF`5O*F!hFȹ(FA >jF!+IFF+H6 F)} 9FhF #H.(`.0F(1FFF FF( УD9FXF =*L9F Fv ID FhJF!F&T@F  p$(w0Q# -O#M`F FfF(?0F:F 5 "AF(F(h #`9FhFfIFhFf4)FhFf0hFT( Fn(1BKPF`)00F Mh ``h)(``hF  K*(F`K*-rFKhKKh@^ %%H(pHl / @(Op@ r-A -PM$O3+` F(> !F+h+5B'iF +ڀY!#]" yF(@Ѐ lF(@ɀ    ^!F^ 0!F }(,`6nMF.!F(h0(!F e(h!0(!F ZbKh+  ! N lB+h"$!(6F*hX TI2 W(j+h)A=(a (\ (?uU!)F(LBp"6B(&B5/F.FB>$(OpB>ӷBS(F)S)"BE$4U"B2Yk)"BE$4p3U"B2U& 0(F)]E6V h0G(kՃnczRnhR1 [h 4W (<%&%h( FObF IOb Ob `I `Ob  (  ` I#F"F DDDD!FR a WS FObhFIObhFObiF Ob I  ` `iF )  ]0P$ C FK ` F$ GF* Fɲ(;L#h$*!P*hѓ)ѹOp0*]h0CG0#h$h0G#h$ (>(9"H+(4!H&Fx XKMhF"F!F(hI(h6P(hFiF #_"Z! rp! gH HG HD#0<%&D&@&P$C "K ` c F~ F Fɲ((#Kh*!$AFiF 8S#`"!F FM#0<%&-OFOE 3x3FxF3 **O0F pO X[E ZDD6  B5OL`D %)c Fx* * .Kh#F+*21 P#F)ЊB " F B $B5@5H`\(x+aF1 + Kh#F10IԑFBcc*ѻi :F)FG(?{3P,hC) UhPziS)L7hFLR%hhFIF  h` h##` 0IHZ `xI(FhFIF(F hDh)C J IF[ K%$pi KFh "FIF(Fp@˹ KF %%7hF#L%hhF` IF(F h h##` 0IHF `XhFFIF(F hKh[h)JIF[ h) IF H %%#sF5M F(h5!(hB(h=ZF i!F ?@R _?R@ X!F ?@B1F!H4|@z H? FF Fp@&hH-OF- F F1"1/60Ā1&O ŗO:FMI,+h뱤I*F$F*h*ѠIPFI*F+h+I*F KhKhCFp(@4 0*F!H1!(F<" Ϭ)OCs)&)Fx28h8zIt8hH=`tM(h@uIj(h<#+`rI h:@qIh6`h 4 lH q& ?x ;r 6"hFdH4 RK"`E^KO0`}ZK!F h|d!hXHWKPO`OOR;` 76C   C C T \Fė#YFOpF $(v03.['z $[" B "8FIF)H7$d,$K h3SBF"FhK `h u%^ptbtf@%%pR*%t%*h+VHV@Lh)RIF FT$#"(FpB*OrBDKh\BK$` Kh J( I0F&pO6p%(z#:-OF'RK !F.@ZI"F u@'-6)F !0FF0F5 FOAF(FI2FID3F@FI0FpB x%+@+*!:0\+x'+5<*++/!PFF(@րPFFF@FpC XF(@ȀT'0EPF(XFI(F7.5x-D'PJ3h/𾀝BѸPH>? >@@EB@@ƀ3hB@EH> >E0?HCh;C`+򴀯 <3hB(F>4 @0h50h<!0hAE 2 #pPF0/#;F$B{.*?+ AFFB(  FhE7(F(?ή DISFp?2Oh3`IEn C<<%F(-M rF B:%@u"FS1F#u S5O3U,FFOz t O3+`& )F`+hX4 0F( 6]Kh `rX3C\%%%%8^ pOq"O 8FXI"8F"F(𭀐I"8F(4ьKMF!A`@!Jn#A0hK@-JI[hn ("A`"Fz0vyHA1s+ ћ1l+tJ2h320YypH©{()v v"!PfIC   aCs0@؀]LA]M"`ZI~ #"F)F FIF FбTIQH먱RIOH뀱QILHXOIJH0NIGH(@#:48KY% r(? 0F'BI - U3H©{PF(@9I쨿b$(?5OrF3J#x Fm1J#w Fg!FF(\8# \8-@Ɓ@%J#y FM,!J#z FDI쨿$F(>/%fO-0z%@ri֝%fo:;Bn%%%՞%HOA(? J# F\6+?J# FIHF(?IF fI FbI F^I FZI FVyJI FQ[7vJ F~II~I FE}I FA FzI :yJzI (̮uKAvJOqAsHOA%\X` $%FnI F:4+fJ#FjI (hJA;F (AAAA'Op>(VK XJ\IF(@R\8VJ C\8("QH'NH !T#pKJ ("HHl'EH !>#pAKx+\8C\8>J (":HN'd0s7J ("1H<'R.H ! #p0+\8C\8(H!0 %h\8C\8%$^,FEE%%^w% v%&& %%,MJ#} F\8ԛJ#| FKIx* F,YЛ:ĔJH< FsF F9żFF FW9  Fp  SF{IwzH43( wI"wHpvJ#{ F?+rI"8(pI":gJgHF< FFW  F7SF\I  *SOO;x+=XIXH$FpWKh, !F RIbQI(FdjMJNIF0FX0#KJ0FKIP;x#5J0FHIIHI E 0F3+<,@Los@I ;2'4IF *#hZhBh&`%X6IhhlG(#X6ZF#ZF QF #hP"H:F(FB68% pFiOp+hzFS "FIF0Fp@ؿ hS1PWhF+h(F9FlG(H+h\o9F(FGF!Kh#:F:F#|Jkh! SI" "hLI""!F0B; IcIi298%5;p%h8Fi F[Fh F#`#8@h8-O'F FFFE!8F&&F(6&0F&@F&`h8 U)& 0Bah# "hR3 EBhB3B01F@FlG 76  !8F&F(FO   B;#4K"1FOp<#2#:FAF< (F.+ah h1&(chZ `b`@3S`|U! 0B`h# "h R3 E B3B0HF lG h J  3C, 1 Fh/ *@B(аOp( ))@@Op()@"( KS K(FpGHpGHpGHpGLzA8F K)FKh0B\310[#F9JOq@F$a0(hkh0(`8sk` FWF'+~DjD3l*F:\ )FsO #O$)FMOr~8¨)hN)̿!! 0h:8CHe0h>& k|!F O3 ],Ӏ:Or`"ZJ`O2`"+H ` (# x # ` &1`FF `FO @ B s:OvP#K{K`oC"2:OvP#KqK`oC"2#!3&1 6:#O3CF DO6 D IF 8FQFO30[0X?iR#0rr#"O 2#~<*F3 3FZCF0FO300 P)0FS"`(8F,CqAOp9Lb"F"5K`#""F7aα  OOU H  @%057F3q&: K T>F@"020FFKh*@"`oO6>!F0F(x>Fq10F,1L#$p <%@& _&h+K(hh0(@̀(? +?+h$!hR+hM!JCF48F,K"B`D B@ªOsM$#&F B5Kh+?hªOs$Kh/EK"!Fh#T }1(`0U |(h""0t"!FvHpL/h 1Q$,"01(,48 1R8R# $)h1(1)\L $R ,10pF (LO,148 R $)? h\?EA !?O P O O  X!HFm+h@F$1hJ[CS!m/KhP*h-I2Q H $1hh+h$1hFXhKF ! L PO : YF O30(0+@_@(?-$h0G$G<%%%&@%%P(( K@pGsXBXApG pGB-O L  O30##h*!*@𼁓)Q-@ЙJOa3 `>I `"T`Op(𤁐I b 6!H0#hJOa3BJHBFHK!\ B!F8F p"F}K h@h@8hCE'p"Yh#Xahgk Ct/rj*o:h8F3OcxBkG(Y;hO "8FoBkFOcG;h"8Fx bkOcGcm!@++;+Fx+𸀳t+#m@̀*ȀAI c F%/nB(tcn#5J!h3IL)I1Mcn#0J!ZmC!-JRb#nC!)JHbm+$J%I+ F$IlYI M Jm;"n*SCJ!$IMIIMI&4rI/'-<CJbvQjp55<%(I'M(IE(I'M'I>m&J'K'M)FF%I1!/&%#mAF##e/9#m5-?24 FB"F(FF(?%#F)B" ''5-OM+h*aNHetIHEF.IF0FN7hG$+hI3F8F,脹 1hH!F  FI(h)q/x0)F y|b뜩HFbI F|HF`OH4>FER8F%2xM+x!(FSvI F_uI F[tI FW+x#nJ FqIP#pH#F(@FjJBshJiI F7hHgHgH+xeHeHdI " Ft zYFn(Fbx8F%Op!FEF8F%.NI*F FF}Op  [ 0jhC j+km+k +m7hBa+hk x"#h#2OcxBFkG(CF# +~ km +X +\Q#xl&$7 %#>Z%p$-4t'5+{O 8KFLIPF()mHIFlGH@FJGM2FH0FCH 0F?HFBF F:H0F5F FF 2I1F0I$c%Kذ(F!IPFDO KF5k `Ob K FIKkh[ +RBIcC FIHO kpKFrO hKFl#j NJprt'HA545-OF|M,@g,&̂UFU+AFb64,ѪJIT6v!60F$F0O4 F MԂLH Hh`HK(lcc H,eTDO  ZIZFIZFKIZF;~Ka``~Ia~K ;84vKDM_qw6m۶zp%&hI47z4#Np$2hBAhj-њB3Hk"%$hBU JoOckG(I"F(F(ІB%%K"F",!(q F@%L2Cq" #2%-O"FF pSOj $'F(LF"F `@@Fk$ c F=0F$ F I"PF(:FAFHF FiF 21 z * `QF CO4$O44F#F#`iF[P) hK"O0u-CsN]F@4h 4CPFC ,{!F @OI!$ ('yh0F 10F,1L#/ QA"0#YB#4vE h #kr (FF(k0F$ @C?K"?I>KA#2##Fh h$;kh+Gkz+6 $18F ] A0,!$ X`(32h#F", `$)B@#3$!)hQ3B3 h0G4#BR$#jhBуj+kz $'R$jh0G4#B $%e`iFCz۹P4 @4`j[P3pB3BhF0G4Bؽ@$$&F$F'F%FshB F9F 3hjFS5IhhlG(FG50 cpG-CFFh F%F'OUxxOcG  #h bU1Fx FoOcG(I c 9@ hKXBXApGbJF PT!ڂpG%0 `pG hhO8F M0i(DX0 10`a18%POFt peh/-!1-~ a0-`A %i41.nUuF`02140.55FeFC# `K0`# aKa%0w}F F:OrFD ЉdETAD !LLAPAi#F IF(FA0)2BdFK*"" F:L!:M&h9 1') D aD!DB @  #<1L P D T PaFH0FLFHFB8NFD8FHFB8NFT8FHFvB8F8F8NFn! K JB(7FFz@@FC¹K"{%4{D { FiFD8p@XBXA& OAJxI QK"!H`KJK:K J!H K2H]ڿ ]%%%%d%%OApMdp9bhC#K"F#!30F$p KahA @0 p%\{8H@ =!F MuF(F(FI F F8@#?FR[)Fd" I*F pI#F #0@pG O3 ( K J L`U J!F HLJ!FHx % %d%%MHiFw I*x I* @ M] O0 rv@MHiFw0 M] r0 O3+$ F0K JI"F(K"M!H`KJK K J! HS K@%%(%%%%J%% O3n( K! J H K KJ! HK ]%L%%%%J#3!+ pG\ pG %J#3 + \FpG %J #;!pKD 1C 1pG %%0Q#0Xh K) !ؑ D !%KD 1C 1pG% v} r:OH%A=L"F FD FL7Kh>#F6J!x | ""|!1Hs./I >< p#H"+K !(FU)K #2 #"1#)F (Fp!  }O)Fbz0FO32(Fp! x:J!JH"F JZ|%L& a`FH0iMxzX8F1FVȱ0FF@8F#J!xj| V1H|!"sOs K( i, F7: F@H %`!F@< iF O3]iF O3]hFh#hXh"## 8FLch/+ !h)(F z84`JK( FF%%-O/IFЀ`,O-NȠO =Fİ(F>"FQF HFr(82h[F I %O (KO F FKI"FS%@XF(ѝ0Py+[D0a#0030 %%%4%:-OF-FF$Lh$!F0F\F)"F({$!0FN@=FF,;3x+h1F(F` 0F@DEE_6K@5J6H0   "a V+сE Z  ; $! F "XF a F V*KEҤ1F(F"F,D6 FZ#P)F`(F%$!XFF,p8F d{2-AFFF!FF#jFAF8F)F"F;FG(F# FA#⹽-pC F-$!&oHO D " Fa4 V+хB p$! FpFHS+]pGmFHS+]pG@n Op F'4/puFIFF@q }I~H}I~L F` & +;+=(x8 [@o ~rIoHlqI+) O3+DkO;x+jN3x+#x+hI `` `b~xdI b#F(FT c`I2F;F_Kh.!\L@m ZSB'wSA2F7O3eUH ( h+ CJ9F0F7۹JHQz쨹GJHK)FGIF FF(F`x@ =J8Kh2F!OpO3"3H' %+3N3x+?X2O;x+?S#x+?O"I ``H `b(K bI(F%I c2F;F u(1F*FI lI b f `F(F`qP&f@%%d,%` %%P"M iFH!hF IjF  M]FM iFH!hF IjF  M]Ssx%8% q+ #X H $ N` z0F%<IT  p kK|+H"|+K`HK`HK`HK`HK`H K`%(&T&,&P&VH&6X& F!F cK@h%p#-P!}  V"3 ! #ZZH"عpCOVH"xRI"SH4RISH"0 }pOr! LM!"F>@A"@AaC"2(ۄB?K@'!>J?H>I")i 88K"p O3l(?(@ )(I,H_|(*Kh+!n M%H@%N"$2`B\`t#!Cl 1@33O3JCF tm F F t!Q%%%%%r{2%%%-OFdðFF0qF0IHh.h0FkF0FA#FDJ!`L!Ft0F۹,;Jh3` *F!!F F"R0F"O$(hGF( FC+JSh3S`XF4kh+%I #ICF F0F0F""Jh3`I !F}I 0;Kh#I FjhKD !B !/Ji3a%0&h%4%%7FCh F+ + HJ#)F F#40JI2+ F:rD-Oװ@FHF|KhH8LPJ%N)FD  Sh/+S!`M#Ģ nh/.V8F`h+@ր!i"hB@р  z(IZ:(VF],Q]l{}DpmOc FF!-CF2F)F0 Ѻh F` mp F PNF F'A "F1F(FXB yC ha`"A ` h"[ |d FIzd@ M%OcF)FF-hCF*FF;F0F MF Fz-ںZ` M FIedAh D#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕPlp" pO3 0pGo 0pGpLkP, ыk+#p+##,ыk+-N#" $#+Ѵ 2 #B+#V#1Bт灂 F3"+{p+P F !j +Ah#hhhkGb0#h hh[kGbjlhbbkZeke$* - pB) тB3 !B)!V!(F1")N!#!"Oq" {Kk+ ыk+#pG+ ##+ + г ++#3###jF F h *!ac#hchhkGb0#h hh[kGbjlhbbkZeke  :*K"ac{# 00pGhp!-OFh!LFF&Op hhBؠh!#h`hc`"KhOh1FlGch$#B$Сh ZEPEъl2  kѾJmE jBp"8Fc6p73%-OFNk FO YE ܵ0+ۙBݪiRgԽiO  hb *Z.BZ  Y.AY 'IB&IB&IBг0+#KB$jh+ѫi"h;DhCE hhaihnG(!p ih;D"kQZ"Z KB0Fv(Ѣlm#ehJEREIBѪ3  "  1C " $ > h-OjFOFF;h 8`p#h_D;k.ջk3+єK6h#,n\hniB8$FOpFlJFCFI@8F-*hKBiDs C#s1.chBҹkO hhlG(*hxKPBѪi 0ѡhYD k@CS  iK h#:F#:F HFQF FCF :F  OA 9a r2 hF[Dm +vsh+o(03Opx00 qp0 @BFx;Fh[DkOpBFx;F h#0hmFKho3BFYDkDdFkG8F)K B,ٝpI x)  ##Ii-<#a(F3 4  p iIBxL-#F  ' I #-K%8%Ļ%8P-CFLFF0+@@O:O D0BOp*60B@(0BOp0BOp 0BG 0BH 0BI 0BJ 0B@0BOp0B@0B+hhhZjBE-030iSJ/1kkSh_JB_JB^JB@]Kh1ZKGh#0aj X\j0BhGIBGIBFIB HIB GK GIiC/O/MS'% ]   () Op"0 5I)@@l)Kh)Kh#0 'Ii-NKhKh#0hIBѫjpi @   I#F:F0F-$IB#ѫlpim@%" $ > %8%1C rx  hIB ѫlpim@cIB ѫlm0 _Ii^IBѫln0[IB-ѫl[ns@i`@xTI2F#F(FRJ!Oph!JIF0 i-(F!Y *K0 AIi-ll>Ii-ll;Ii-ll_8Ii-ll5Ii-|ll2Ii-tll/Ii-lllZ,Ii-dll)IiC&JBѫl30hP!+FS+hhdBFiiG+h "hhjSFJB` , , # x" 1C -C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hYI#hai*Fhho3FGh"İh F0GO1#Op"3#' hh0G D𵋰Fl$"(F1x# S"#FO1Kh#F)F+Zpl4'x'I F#+v+m#+e 20 R, F FF///#" "+v!F!F6lmCeN0 F%Kl J !"O1 #Op3+F`l`dXf(F 0-C% F!!F(nOp8N%` `@a a@#b b$-!+#Y#/+Q`7 5!Op #QF3"+@O$-D `K@!JH#"2 !JM 3"2#%"1#!F9AF(F F!  ,|a {Kk-C+F ыk+1Fi +++г +! F()O`FW !w5(aE ˅Op `@ a@ bOpK"!F0#M 2J3"2# "#1F(F F!"|#   -O F h%`h+Fp&(B-h!O O  #3!0Fh#h!h !8Fh-@P"F,#hhh0P"F,#h8hx#hhFXhrF@@iBFg,!+FA B ZEL ! @ P CM"hCJF rC I"h !=JFHFh- >"h !8JFPF\D 3F@.F8F:(8 F@F2,O-̿FO ZFF,3ؿ#3D r  -! "F ,2FP!"U FJ. *kJ !g(H Ah"3k@PGHe%%!\-OF- FKh < $PF:(ցPFKlhg !8F ^F(ǁ/F:ݔKFO`2 B A#KwE$݉KtEAF 0*h2p"pbD  2@Db \b $FOs 3Q$=O3:F<@u!C@eKCA#1#1F#.99[0F p#"(h"#"h0G?F/(h"QF"hlGO8 6dFė#$" % G ;B2G # F9Fg  SS D@ D8S(D D()hS D< D D2@O@F &U X-OFӰFFF?ӲGӲ_G":" :_ :O<:): `!" &O EJ$$#2F'(#@F DDG_#)F<0F FSF "F "*! 7[F6OK 8FK!D|$D<8F #F aORO3Oq~#-A F aklO@Zkeh9FBu9FOOzsCCBu#XCBuOS FA@MOCOC@Ci-AF FñhhmG+hihF@ *OD hB*?н*khp!h `+h1`i h wF (D1F@q  E0#s K`ca3c# FA 61D: bc;q2 -Oϰ FF"!(P|ph/! WET0+ + ##3WEO3 Rj 1FHKh O#F@ =P `eFžžŞ @T0+ + 4žŞ pWEO# 0*F|HYj#B%FWE80HFlG(?@F =`32 05HF0lGO2F hh 11  0"G(F #!###"#hFhkG"eOp "JF$ X @żŜO % #SvWE?t3q h h0G dh 3_kB@5 #i@#p2h[B2p"ch[(DZC)D^ i RDDPs F;s#hh[ ch;c`!F0FsP% B5-A FIhp&Fha  +h`hkhp `Dhp"!@D>i1  F(x 0DDAFPK FH 0ca3bckh3k`##)F F F)FO0%. h-OF+@ A"hAF Fl GrW AF Y I hBh:E"h Fl G(r#Rmi kKB{ ۾B{  EBVByP+L#(FIF"h t #FF8FQFl0 FF  XP!J'h#0FYF:FP:F#F FHFF JP!vT, ,! \1yOy8%%-OFh FFhmG+hh F*M O h!DD@F Fb(qFH#B4рH"P X.21"`",3@`tJ 3C,@uC,"#,pJC,[# mK@lqmJmHF3B @qa"ZgJ 3C,@a"ZcJ 3C,$E#CO|_KBF_H^KJ#S ?!F=T 6!FU .!F.L-A<SkI3F:F(8Fb0F_(F\@FY_K%h5 + s+FXK h#YJ!-&+x+"RI*F#O1& "F#B)F(Bkx+@)x`)@ B#h0a9 FlG(062!F"###h F0GWk;CF"F3 DCv@F1F>fEv jBAFVF2CCEFA8  JI\T a6J!_[F( I\B#F 8%% cI aKh#F F]I16XKG0h#F F&SIQKVh#F F8FMI&7IK!hObF<$Ob9F<8F6o3F9I:FM<5I+F:FF2I:FYE B  RNh &0"#FVF##h Fh&0G3F*F&pFV FEz f   @F1F MO8FFZ8%% p F h#h2S V[BBqb2 p -OVFDFFFEI G hoGdKhD/3dF:F OA :F#FF-fTEE:F#@F!FE,z (,O4kJBvV 0`+Ҳ@F_J!(\KO h!O PF=P !DFQ !<F-_+FLI:F8F(F0FAK& O5h/F6 C3F9J!.<3x+96I2Fz#O1" "F#,0B0F0 ;VS"J|"I\.{FI:FH 0+4Н0`)-B*0.a9XFlG("./g=G7##8%% "20_,OOEF'F#r0XF0G#QCFtZGXI hD  f  ` Ez |  @ JEs r E|  FBpy B At  c F0XFP&0G*F3F"[.KFh#FBBk/OptFBA@ aDvJ 0FQF JFj 3Jz 0FQFjkE| F Bs F3F B A9 ## 8% hphFIihlGPĕ#1h####h)3hh2Brb ppm6 F&Oc!*R"1F")FI F& F^ mp{dЀFx I`I F8I F@  r p#$F F !DB p0Fn-J#!O31!(CXBXA F2KO1-CLMh9`(U-N3hBph*1+K$A,GА)1;0p` LM"h1T# FGF%F$O hB+h!F(FlG  e+h" !F(FxOcG(9hlp`4 F&%JK( FFp%Fx x/(BF]@/* F/*J/**JHOaKd%F!F@ϿF!F@IF ))M)NF((h(?3h3%I"F-0h#`h(h`3h; I"F0h/8F jF!IFFH~(h I"Fx F 'I"Fl(h%%:pAFF"FI@F KF(!F F@} Fb"FhFf FZ"F@^I@jF W }Y0} FFC"FhFF(F;"F@>!hF0DI@jF 1 }0 b F!F@U-AFFFFF0#F)Fr02 ICF:F F0 F(FK$D"` %n%8 M4htIF FF(D8%-CFNOD%(F 9FHFhFF$hx IKFF(FF(#h F$B04%FMF4@q4!  4"9FF@;"1F D%L4[O#4T- TT.FV;4#3F9FF [(Fr)F(Q; 4/(Ff%pFF F8)FJF Fp@h8FF)!FFI*FF y@ 8FO@FO@FO @ۿ@ @ @ K8 pG%0%*F!HU!UFF H I F,x I F&@ @K` F0@ } %  @;-A*L#h(a.K' h$*CF"AFMF  hx0Q##"#G(#h)$rRPBrR#h$h i$(( #h$h0G#h$a &̾h#p$B Op ! Bh"Rm*3  pGsj$ Fp6h#hFXh+F2F!Op#h F0GF(@]!F pG Fб&M$&K!F&J/h$H,`#H I"F H Kh,/`$ F<K!FJ0Fj,!KJ0F`KJd!/`F(I F@1F B%r %+7p%DR pGWH@Hy pG pG pG8F#Q۹ҹOp F8@1suy (3B## 8KP0hFhM    Op #"!#(FjF; 0Op$# % pG pG-CF\F F'Bcm+#~IFF$1h KhVOp5Fg #eOp]#7p4 %pPF F Z# Nz K(`" 0`p+C# @D,C $ ! %8%F IFFX1F("H:F(F!F@ſ%1H[ dZ p$"!FZ#jF!F@c)0Op M9 K!F+`F *hkF^ I IjF @pI%Y0-GFQ#0} Fh(F0T#08?NOra>HZ=I\FB"F!뀻 F7L7H2F)F h4I3F*F h8@90Na)H1Fxh/+I*FF[ 7!F F }QFBnB (F)FFFHFF(0=+BBJ!D|V F L h(IH,I hT%GPhF0 FQ#0h0T#0NOraO8h0 I2F8h2F I H!F(F0 @9Na %/BZKpF F2#K#dFhFF,ж0@;U#0(Ѷ0OrU#0 a Op(Ѷ0 OrU#0apBn K"` %-A°'F F"9F8Fl#OO8iF h+ ѵ0OrT#0 aB5+I J9FH3JI (JIHAI 3x#I2F !@M}0@;T#0%%[&Op"8F F0J T#0ha8L&R!0pFihiF0F#FIF(Fp@e78F F CXI 0T#0 Ora 8OrC8 F0F Q#1 0I T#0i00OrT#0a 8R @@@IiC-COr-F!,lmL%lO&F--9\iK8hhsb_(qeJ9F ;h(4c(n`J  PU,HFZIJFF(F 4(F((F`2@=%dh02(Y@9#a5-6KJ ,KIPJH@L&GFch+K+Dh65HKE<4(>K`@5!<( F(?~a4|2J9FF 'F-J +F OsOs(Ѿ#K$Lh;t"F h= h+ h;h#@K2JF&!JF"!o2F'9FF Fi8%L&n%%[&<%dD&@&MR !R %-AF1HFK0IL.NF(94h<@F=+IF F%H5F&H(4 K#J H$0h8*FI0h"I(FF(F0@ /F HHI*F F FJF V:$%JPh!!npG pG-O%,F FB ``.=-;1 DBt  C Ey Ew # C Ey t7BBt h.6`g Gg@@51Kh"0pG\&-OFF Ey #MF FTFF*#gs#"#.w2F;F F)FCsG2E;F F2F)FeBu4F=F2IO Bu EHF 0FObsE5BA   E  K<K<3BE.FwsG2E;F F2F)F^eBu4F=F\М *X *TS OC BBFBzAیBu2Bu 8Bs TJ.wsG2E;F F2F)FeBu=F4FBul4E eEBr   a0%##"#U#( (F)F 0rpGFBh IK F@`p FF/!(Fz<FH(F2FFй5Djx`*ٴa:BaBp034O0"H0Z * F("HF 0FM+h((`r#BA#-hhB##" F  gh B 4#+a\)3B 0 d&#`FFFBܔK#`ppB,+$Opx ` !tb!PBBt %`E%1h;` 532,8OrPF!0  #P`08-A$N'MV;! F, F)`F"*/`FFѽ}@%Kh H@%%-CFF FE0F*$+F"Fpp'B2B43Eܸ@a4 ؼkh J   Fih JkhJJxF0K@QJH@h F@꽈1~8FMh WB# 2Bز8 J#3"+ K"h KhB (4Bx2F@%\&`&-CFFF0'j0'I Fp@ DM7hQ7I+:+ #;0a+I(F[#0#0#00 ++ ї(F0#KCI0(F7;B̿II ^~8Rj$ N^'?$4}8FM+h'(`# IBs IBsڣh@"Ob#r#8"d&@8-OOfq-FF$M PTnF%Oc)Ft (CF F $M_I0( F0FO1QEFu RF F\Fy!`  X4%F'F+O+  e``` Fo0CE&0F?IP (sд *)#XPBB+[37B܏0;h+` #0h3`5  +,1+01#1#0F# Fx"HF, 0HFBFs C( 2Brڄ[b2 F:edAt-OFVF Ofq yF({OX"t 3+ #O0!VFF 3+#O0!FFPFcf#fSCfK#`VcaV`` F IH"bZl#0 F9sh3`#0x~FmFFF+Kg!JH^mKh!JnKi!JCnKj!JnKk! J}CJh`haOȿO|  `8Rjh-OF Fh"F Ki i S ###X@O9 7Y GYEw"- -r#UC0mG(F9Fzg W g]bR B FFA2 WKErFFFF@ GKErڳ b 0'0O FCE ;JhBcӺ@{OX  h ٸI>*) O1[ jpj D"kx[@ plD(0h3`2Br[b2HF*ѱZF B#1#Fd&-OFFD0F#Kh O phlG(pFk0hK-lFĕ#0h0hho#G$bBBOq1 phjFlG(𵑰%F F.F hB-5џ#hh #hFXh*F!F@ FF(F#h1F FlG h* 5* ڛA####6-#h*?0#iF FGp#hh#hFXh*F!FOp#h09F FG%𵋰%F F0FF8F K"O1g#S 3BFHc](F H-CD" FF! l! #@?F(}TLFŔ 4@Ŕ@F0lGHKPhTxO3FFC     h[kF FG7Kh Th#Bs *F#F#"0 G(J # 1F###Os""K"K6#2O3"#AF0FN # F.0FC0[ h0G0 !8Fh;3O0##|j&8%l wk  Fk#K hh0G@@0  Fǰ(0 h8hkGF@iYh"&'#h"O1h3#h]0s#hhlG0Fa G-GF FD"! N#!00h[j HFF(?:IP"0P7HYj"F#B55Mĕ 0E0QF@FlG Os"(K1F&K6#2#JF#AF 0Fe `32 F?0FTp0s hB h@ G /q(8F O0h[ [|ju jl wk -OF-FhF0G#h FlGWKhTx/xO7FFF@!hkVF[ Fx F2"0 G(FwP C C ## ###hi[k* "!"G#h"0 FGCFR#h FlGF(J#hi*G F#G? ##(#hkG#h" F0G0)  #hE0 0# 8   # Fx#" VG(%(FO &K-OFh#(1+@ +h3K@AJHi.فJh\(FOJ#O~OxO FqJ>F"(O2)CF@I$h 8+hd @ O Xh 0hFph&J#! @FcO@B#!HFcȡ 1FOp  2s )rH0$1hh0$1hXhzPO #C +h " $ & ( * 0+I"YHOq`!Y`@aUHYaUHh(Y22RI b@b#@u3133o O3GF CKb0F0FQ+++@&7F,(FG(##z05K" O4 F-+h9F(FlGp2C !#h;+67hB~@U 8Kh)H(FF @~+h0+!(FG\B\A&O<%%n o 08Ql Yl h&al Kl %g+?!(FUhO#hh0Kh@!Cb@!$ 0F&+OE&O$!(F((?(zaR hR4 Ch(FQ$4 YhB0Fpd 24Bt$$"&-O+հFOs K!O2h FF@! FF@@FMO HFU! F (@8F*5H@~J` C 0+0G( 3 rK hB-#O%FO6O @BiG O ,UFO6 S6FOpL(1D!O !SIHF ! Fcr@od0!FXF8FHF4 0F0 #D 3D FXYFFXXFO ! IFFXHF 1F  X0F> F B*K@Q*J*H F#"AF23*F33#O3AFBQ R#FEѺ F8F@F s?0FTF[ h&l&il -CMF FtH!/# 0oIOb F ixfx[bgJOaF F!'/! Fw@B"8BFx8/* F"Zp|(ڳh(FOb1F Fpoӳ?#&F0FVFpC O(?ѳ>#`*@20Fp(*0/+ *OaBFF F.*Ob F2O0F((*Ob1F"oOa Fm(#x/+0 fx&v  FF*3;DDoFIOb Fo*Ob Fo}(F>( ڳ&h(F> `/(F6 F MdrOp!H F(  O F! "iF ( F .?@ B-OFFFtF(?иO&(Fu0(Ft8FC+ I" FF(#FRFYF}@0H$7m3FIHFKO7 d-GJmH/"F@怜H(jH(e(@߀HObF(( F($I( _(@(F(чI(ObF `I( bIF I(ObF `{I( bvIF qI(tIF F(@qI(nIF(FF(@kHObF `bI(|_I bF(FF(@THObF `SI(c!F `VIF(XPIF(FF(oPHuObTTF `pGI(<FX; `JFOa cT `0 b;FQF S5 -$!@+0F Jm(($0I( ObF `2 `"FX(I(I b$F(F#HObF(I( `DHI(F F$J cI(?2:FUhu&kd `pG# `pG# `pG# `pG# `pG0ii,!F@BdDKh#*J!(FK,h6 7 f!P"FFH F 08%%%-O@F# 2 C bh[0C#kHգk31 %k[0 o S @Kh#KJFJ!4# +@2O3 Khy %[8hkh0G8# %Op O3c{hBپh fk3 ! 0BO1c50@F lG 0#BE1cmѹ ! [BxIiI FKF#!qJ# S #! hI IFm KF# # eK P "O10 ##.+ "PFXXKFFx+ >@@%+@e(qң%CBCA #;08hhlGFF2YC^Cf3I2.D FKFBFPF1Ff#kD##c;0۱P [ chBAO Op E@΀#kC#cUEFNFPШBqFF#k [ chP!cC# mBfF 8FKPf`LO3 F2h)z#;8%H$J%t*DK ;PFhAKh,!<1uFFPFv(R#*s ##R @+>1I@Fb(8F E,IOp94Op E يk2S Jh0BE b C J`2J k4D#;0.B-v 00(h 3  k"c$8%&Dr-CFFjShBgp&h~C#0!k(q ےYdhjJAhhJ!hR\h[mM,?_JdD &!4h4Dj+H@gWJ(!F P$h2DkY񓀓kZ=# # JI& (F)# AJ &!7K@F!Fh#J9J#k 5J(!"~j$m@x+JCF  УnOp\hk&J#F`kh[o+h3Dh3Dm\@PJ(!CF Fn@$B!FkkJИG(+#q@#o8%0QXlJ]e) Feh#p&FFB9(E+O+ F, P!%J#F ""Hc* !HY- JF!hJF . KJ!H)hkԉk1#2 ++ P"F , 4%{@%Bh!-A2Fj|j5 ;NO FB=9HO@P"Z5"a3Ja@b2Jb1"c1Jc#hg2g hhCE$#OpE0 Fgj(ۡji j /k2p50L"BlhjFAFlGHFGkX IhgFF3  ] -OF4FFFO p' E6ѹlp'q*(a0IF:F30 Fi1 x#"kih hb####ice+je8@ii D hjB6* Ѩi@x1Hk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  fK-Oh FF8F$ (th! XF5F(ZI #[E$5FOsO H0t@uO5"AF@GKA#2ZF##k@FKEiqhj1 WF(`qhOp b  h0F(Psh` DAFrh!F  PZFIF FH # #cc/Ff8Ff3hcc0F[ 0sh3s`,O03PY8FF8FB &9 -CF FOp 0@W"O1+OkD/ #3m0 /+ "@/#0eh'B?ij F(ahp'hq(bhP`!bsa:FE O5FB"hFBcc"b "" WNch F3c`(Fh 0쀹Op;!Fm(F}|7<%P-OFF#FFC &`   2Br ڵ iiI BB{ [b B p!```0KhOIO(r2q'#Op B qj(Hm3oO3##K'!hO3E򐀳j+@,O WFh3hRE&l0FGp#E٢hZDk3tM1|(u0A 1mI#+:*@'3+#h Y˱E@p XC;k2:XYh2:PAY`!2A!-y'W 0ByE@PB<[a L#G Pp#SCFhC(DPP`p#hO3BDjVccPQmA3hmkGhhCDb!hhjCDBZm**kB cj+HhXhAPQCQ`hah , *B;F7#* IFȱIFH S)r T R"T "X *%&0%rD7jhBh 9FlG(h+++# 9Fj#Fa'l QF0FGh+ 2Br  [ BB{ #FQF0F9  e#E-yV2f#F"803W 0 3BU @G 0 2VfEW 0 E@p!ACxyX@hYB FOfE@.:E7 !(q1p#hKD S 0 _C8h8FAFhBzF}HjC p Z`chB8;B7APQ#G\FPC2 DBBq򡀫Brڧh W G BfF X 0yhzD A Ez 8k8RL Ez 1bhBhB@p a +FBDH0Q`q )s!#HS`;kH #;ckCc##ByG 0 G PEp pBBлk3 2S9kfF0p7F F_PB4 a D#p"H TC"FDDFhCDH``H -O%-FLhF(Fp& #B#-u(Dp!qF(npFO p70E"ӤDPԧK$\CBTХK@]QJH03nJk՛k35Sh0pBp" Fnc#k)գk3&ѧpO p4 p" Fn.lhS8IhhlG0##W<[hEp4  p7`0! @wKh;Ol&hlG BBO3 H$F0BpBG5p'e[e+X u T B2E # F)FeJ 2+r JBrv[H0br` %Op 0By (`+ sO3 3.@ O 0E1 'Opp#sCk?0F6 XkJ[:FL(XFhlG0DkX2jFF-z ;B2]J #(FQFj -H ,F607?H0m۶% pGD;kYkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504L3h0FlG FFA#0BJp"0k3t+kqjhY+rj 1h b0F2"0G(R##ihY#BqF F#3hjkGa"km!Fam#bmcb+nbknb3h0`a0FGCF#3hF"F0FlG+kcC +c#WG3J2GSFBF(F9F6 g 043t2[ BB sp#p k3@#k@𬀞@񭀣n+lZhEhS8Ihhl"G(S8 hh"G( h   bhX b2"0G(9,FĖ##)F"h0GFHH*FhlG#d D ;B2D #0F!F d ' hRB   o" dhDXB2"0G(  05bhX+r h     b2"0G(9##ahX#BqF F#0jhkGacmam*bmjb"nbbnbha+?^j+?Z#mC"e"~*?RC#eMo h    [B3 fhDXC#"0G(xk3r#knщXbh)rh  +dhhBO5l)F.G5.BB0BB0ih'kjGacmam3bmsb#nbcnbpah0+u"1FGBF2F)FhlG0cccm[j+#mC"e"~C#e706B~#p O4BP$Op 0BP p$p2 [b2VF#CElp!0F9Fp#F O1F BkO Op Ej' GE$p'0Be;P1FFG "3c0.!FXFlG(2!`.| Bk5Q)Qhq EwEicd4z300B@XQhCВk263cp3C(  kCKkB k  +hB Pp">  vk3h.9FlG0 72d0##3hb.##5ce6e7p4XFEcXJhC Ћk3Pp"4JpF$M(h%(h5j+`h!0XbO6 Fb%KOqUKF#1 #c#FHP0jRBbڠj(Fb p#!F00$jj0 V@&9 E %-OFM-(h)1$a#.@X .@S(!3F1FF( 5(h#0Q##"#GF(+h$A+h"0FT#GF4F&FhB8)h@1<1@1V2HChR# V#V#(@5,O NO  ! `zJ#!`!vJ#8F` #h*hhO& O% 2 #hFXh ! [FPFL+h #hh#hFXhZF! SF' EYH#hh#hXh" ##P" `# #0IKO #$"`GJ!GHY`"aEJhYa"b(CJYb ٠j0"c?JYc # 3@u3@73o O3CF 0Kb0F0Fe.?+k+hTjV##0h0G.@vW!h@#EE@0 FG:F3F !F:F3F F)a4h&<%p408I W h&_ g O #h 1F FlGP$%#h+  6 L&.:.h!F #h F`lG"  FG( ####&#!'#FB=&BYO1F;#h F0GO0>1:F3F FGmh+?jfK@aeJfHp# g!F#2F;F, 2F;FY !FqFp3l!#bFfFE@#EF(h "({э 7j+QFF6p4 lkC dhlG(p# ^CC "hk@KFG"3Dld!jp6,3j,,Tm,(vۏBvh?ThF By 3p2p$ \ChDl8Gh C"hk`#G"#DmBe|!@F0"0#0$ 0(?k #"3nTЂrn_W 7FF&+l$jFinhlGH2F[B285B&` h #*s|+ pG pG-OFhF-FhFh (IF F@? i{m%IF#n+#J!iOp@A ifcnFn+J!i@B n+J!vi@C #o+ J!jiOp@E i:coF $.:>HFOpFF"FhFL.3&4@LD)O`T# 40Vp8#*hsC"D lٱD3IDP *hIF BD(@Ё@"YF8F)h@"8FAD68.+h#Dj+ ݌J1FB@"+h#Dj+ ݅J!B@"+h#Dk+ ~J!B@"+hB #DwI3F(@FOaYOx+h#DCCDXBh)r@"!C<!XeJ+ n#y#z@"B~+hCl!#DCDX\J+ n#y#d@"Bh+hC8!CD#DXRK*[FQJP@"BT+hC|!#DCDXJJ+ n#y#:@"B>)h("D\RAJ!(B@",)h \R9J!B@"+hx"3C`#DX+ 0J!B@"Ox+h#DCdCDX+%J!@"B+hChCD#DX+ J!B@"+hx"3Cp#DX+5J!)P&`&Sn4B@"Ox+h#DCtCDX+:J!@"B+hCxCD#DX+ 2J!nB@"r+hx"!#D3`S3##&JX@"B\+h"IB#D 3UD6 x .+h"#D_Q1Z`Fl&082B`R/C23&x2(qBxlB K/D4B } -CǰF FNF@b@ #FJ!IKF"F(F#G "!!{ JCS!OH"_I"FX ,:<#YC-GFSF}dkWX;+π#L1s@I"Fi F}GV|1Op@3hx-чITP3h9F0FlGx1{S'0cxSOpOF  F yJ!Ff###F0#"9F20F"2#G(@phI"P"1FJdI"F""R"ik#h+? xXI&`@Fhtd0i;jS"9F&"QF,7EbjHI0FV@ !j# ##FFi0F F}@ i2F  F#h+Тh/I$&{iv@  2F(F1 @ D###h+#lki@& }IF F F}GVk!Jckh#lFal$hlG#H## FNW nZbhh;FO#h+?t5J!T`Y̠D W<["9FOL膨"QFH87E`Q/L#1 Fx1GEѸ!0F!a!J! @. iBF +#*sJ!"v~,';!Fx"Ob##@##gUd!@ FIƻJrF!~##`# 3O3#cUd!@ FI𨻑pF5Mʰ F+hX @u! "!)"0B(`0+J :@F(h!F Jp4#"CO1#O pj(@5$J! j#"O1 F 3# {l( {h(`j,@6$#k0@7$##`O0PkpAMO3 F FkjX @u! "!("0hb0 +^!BHNTZ.K"hj!FZ` p)K" +cb@ ! #i@$J! #"O1 F 3# {( {(`ciOti@$i@$#j @$##`O0Pk@%-OF$K%FhF (  +F $J!XF#"O1@F+F-0HF5##3F:F&(q YC0D1%J8%00Ű +&(06Cpdjv|1#"@F O1#?K1h#,!<@G O0 k[ c E0Kk[ Kc81#"Op#O1mX@I%'J! #"O1(F3#{ ({ `m\@J% n`@K%Kn[ KfnhOunl@M% o[ȿ# gKo[ Kg &00 FŰ +K/7MUa #"SO1#OpG#{/+ ")FPJ!(F(Fx8 D{/+#s E01[ 11+AJt@! h,!<O01[ 11+ 1[ 1 1+1+$1u@"$(J!@#"O1 F3#{B({<(` 1+1+(1u@#$ 1+1+,1uO t 1+?~1+y01u@%$# `n+&-OmNFF(FkIFTO [ EF ` $?Qh{@ himB 4F*FTI8F" Ophi1mBFC '1cIJDh&GJ!(Fh@ idBf"FF@ hi\1mBF+ S3F1[ 1s G2J!F(Fhh@ idB 1K13$1!'J(FRhOpidB 1K13(1!J(F@h@ idB 1K13,1!J(F,h@ idB 1K1301! J(Fh@ idB@%Nk8%h-O#-F Fװ!J03`OO >h>H1FSKhs̲̒03D[hkK/F6B8h(𰀐}1a3;hB@>`0F$P|h0G$}1 }aC #0x"3D2CQX)RCPQXBh)rI D!3JO;h+BѸ7  #0 Dy1S %1@,"U (1O81r""0j;h[0Op;`mOrAF x 3+fO1"(у}!1F1B11Y,O-L>hO<<i.@3:F!Q2B?Khs0)F F3`v7N  ά3h)F F0g,KhӱOr##6,K 0TF#ά3h)F F0I#Khs0)F F3`7P@0B P3I`OqB PK`Kh+3W@%%P& d,&d&(&- `&% DPi*O3 `+P`)1;#ca3<$q?hO #Fc$@hSE%lQFGջ ##$GF  +_+ݻ'"i3i$1) 6`#Ec09FXFlG(7 0Bؗ+i_+i+ `"/PcO02h-GxFtFF$O3`)hB@ F#"nhF\iXB32DBCFRF!`0N8a.<` 4%%-CFDh,FiF&F'FPhjFTlGh#Bs ,FFX04,Elkj+ܫJIh+#+`(h FF;+<c3 c g &̘K-O}h# }M$(h D(+h!J#DhIFx)IHKhI I O X*h|I0F"DSi#NxI0FJ,#)h !DP0+3ИX.F0 YDSPTJhOFoF#G*h'"DDZDmho#ImGZIF0F  0VI0FO ,#)h !DP0+6ИX0+2F0 QDSRPTKhOO FoF#G*h'"DDRDmho#ImG3IF0F  0*h0F/I"DSjj#+I0F*I 0F B+h%I#D hCT$+h!I#DhF 8+h I#Dh0X+h I#Dh(+h"#DZ`dO(&&$%p6LatChF{+D#*s##` hJ0I h+ &~K-Oݰh+ˀ$O6%FF D(tKh/@s-𫀻x$1hB4Y&FHF~0dJ! 0 DDKFp_K 'D_J) FFSB1+^ "Dh)zUI shIFlG F  F$hKEqXК0+QF S * DI*F1h!D l+$(hOoIlF#G1h!D l$h"  o#IlG3h'I #DhED3h#Dl!2!MF((h(?mIh F0(h(?cI"F]кQFHF(h# 0O%%! ,&&B{@%$1pF FF phBx1x1S%0FxAD%8 !x(PJ C $1I 0# K #3K K ]  & ] h J+ IO2 K JKj]& ] 00X>J`k;+إhݱ1{# 3ZOpZ (^#10K`0Kh0I*k#:*  ,0=!F x 0!F $J $I2h2"K#J#K "J "I2h2 K J K F{J I2h2KJKK JIcih#KKo@%&%&  Q & Q d&- 1 m U & %FL")FPK%`hCOI "MKyh0:qXhhBkD";P! 3jDJF" FJ -H3B>Kh+6=I "Fx:Ny1h0;Jh hB41'D"$#h7'7P#o8G3h,J+DP! 3uqoѽ$Kh"#I`"K"zh0:A^hFhBa"#`mX`2,3BP!Jkj""0cBчO0,&6&T&&(&̘&-AF$AF,)h' I"F 8(8o6Yi̘y0-OOR-FN!PL] `l+ЊOI\;h+@OL;hCOq 8`O4;h+@({O0+@xK"O O`O1XaO|a `mK  1Ox a`fK`H X`1acIXa`;hJw 3Ha`PYI`S03ap0"`d a*FF'd@sEK1FR"DKDKK#2#OpAF1`h+O0 ]Oa (@8`=H! (L8`IJq 8`(KG`"*2d a0F0Fh+Kh$1+Kh+Г|!jOpK (!FT1Pk@%(&T&,&`&&&&d&& = &%&&&P&FKh3"FI@P ¼X&F p$a3F2F1F\F(fR##"# G(K$hR@BrR &k+K@mQJHZhf*X-GF F%@V)@U*Eܽi+XKE ѣk+ѣhh{#{5SEѣk+ѣh|1 F$1{CpFPM    Fȱk$Q"(2b$hikO2 FF\J#|1`p((FK(Fh)FhF"iF FXhiF6hF*FhF(@%-AF-PR$(*,.0F8O60F2($A#h F0G#hi" F"#GF@#h F0G$a4F#h FlGP     FFVXK "hCD8"G(P"!hgc F 3"c0G(# F # ##"#h0GBF#h F'>FO8lG!R2!F$8$"(F$hB/WFFE.K@Q-J.H #hk+G#h 1F FlG`BѸ?F76#h 9F FlGB BBѶ?>F7hBs!20O2F(F/ J#|1`'O6f*f@%-G}FFFFJFaF(dI2F a(bI@F&F(F(D]I*F@F0ѭh+XHIFfO0 }kk6j`j`+k#akkca#@0#bB0cbklbP/{FI:F@F0t@I*F@F0:@IJF a>IMQF8"F F"F:I0FF8I0FF 6I0FF4I0FF2I0FFh"F0I0FB,?F.I00FF"!8FHF 0' 0B BOЪ# (5D*#*#02 "F a#( ,hd@edAChzd@h[hdhhuhhhhh-Am%OcFF)FF CF*FF@FF F M0:`12(F mFO`pG-OFFE ,# uT:E; C "FPF+FYF  k E{RF[F"F+FkBs7\bEsbFFx!Oii@1l a!ZEs B +k#1kEA@ F a9Ex#71 H C,ubF8E9C "F@F+FIFi EyBFKF"F+F J EEIBADrEs 6Bs:EAZA,u8E9C "F@F+FIF6i EyBFKF"F+FZEsi2Cj EzFFؐe0%##"#U#( (F)F 0k#pGB30pGD0+D0pG0%k#F (B05#lB C##d@,hEjB %jjCX@Bl"d 0 pG& L<'BE##`36hh:h7P%pF0K@aJHk=`h% Fp@ 0[`ha`(F5Fx FBh I F@>pFk%O5(FpD1Fz( 1Ft(@5CFVK@JHiF} H! 5F(K`8FX0+V #8#c3#dff# c`VD0`` F 8 FkF# B@3hXjB jBCXD`"Z 8-OF1LFFcB[[EF# 9B%3@B1*F1 hh*F)-*#p(@B l   %*FFhXjB jBCXF"hFl1FhFiFD1*F F: -AFh&F3F20h+CATk ukBuF6  EkkEkBLkt ڸ @"  EkkEkBTkt +`` FFFFĕeF#0 0F ##"###H%@(`O0hkB-@{ # BsO# F -K+` F00*F!FC0 B(;i h3`2[b 20C03k+УB " 0-AFkFF#F\B +i!@3Aȹ2 BBC! F$Kh;` B0#0"!F.04:F#AF0#(0C02[b!a F!)FA+BBL0%pFhV#kFB ОB % K` p(F3P-0й#c04#)Ft(h;`2[B 20(F7Fh  " FF(-OFd]RF ЋK@JHNKh#KOqJ P IfF(@ɀKhx J (@H! F(|IP 4vI P(UFFF&`` oIX +CjI(K C  <0k@08Px+Ц,3F F  "!QFCF@W,6..Н`0#OI"" "!QF "!Q (CIx@ k=Ij8 C  v +?s5I "@! 1F + sWHF d] kD0`"1FcPcE0 [[  "(EP#C0@ 03 0&@~ H&P%4;”5$ 0B !X0  0 0$050#D0OcZ0pFϹ=I(Fw4`#\C FF0F(F^HFe;hZk(F #xF`2pb2;hk+@0I(F(4FFCE0Ak(2kBBk*2kBB !F0Bc"4$|dKh Kh8 H&X&{ {S{{zzSzzӈhJb ]>-CFhF F ڈ z Zz ۉ0sxs+sxl+O&F"iF8Fp#*F F6CjF)F FD'F"iF@Fh#*F FB7/67.-G 2 FFxPE #`,0.0〝00#r10cr20 00 7"I*F 6 5  3 1  . b ( ѝ0 00**+8ONF9FT0#c˅  O0opFpL&"F@!hF6hF4G. p-OF8 zFF By&O P-X(ХMBMADqD BGлB?8DB> M EBhBx  `0{dЀ4-G@4FFF)53B6KhT)|DF2FBtO  s0;PI RFF+ +*!ER@BN+J+4  B*Z BTٻѓF"Oq F(IFO H++%Ѕ+23# DC# D<2D2## Fp@"!O0U#1oU1 ,MO F-ACF=K@1F82B #111111111+h1F8^aq4Bѫi+J`BF2+2224+h43B(2+ѐ!-O,mFO !!FOc  O4 F ,mmI 0s@"! Or!Fp 2K13^K@!^J^H u"h[&pkppqkqq25*ѶJU#O[OJ(&2Y 2FHFM(B,HFjT6+P6+XFP&SCFFF@3E(FO(?hp1?ApXD8FF@3E(FO(?1hq?Aq0FF@FYF2F#8)FHF 2F M"FBBp Or(D2F)FHFMF(FOrBVE?wO4wd@f*GoFR5K@ AJHL)FFFjCK@AJ Bq#`4+F@ @0Qo'-AWN G$EO6FEt qi ` B xc p D6E 4Jh` /&%-OFFFFFΙ Ė4KB"2 #qFA\aEz3()8B,S2*K;`'8FD3B"+*" vFF4]\ ,FEF03+) БB /@j8`Fb t 2FC F#IF iBs4F# CpCEU3&1A\I )ИE36.BF Bu1*+O8AO   ơ2 )iB8F F HEo/?W2KS&!{#F2ƑD1  NE~ Ѐ C EyĀ2*  и#\) * 3+ K@Ta J H1B| /?Op$&.uf*co (B y93ZFq;F!D `F(?Ю2ĂH  @EHFD"06D&0B1E!Kp"!(F2EO32A"\. (2*K@laJt+DADAEOAڨ/?f@a f*s-O FFFFĕ{iJѫB O0!SB<ХJ$4 O4 K@JHD2B#O5FF s\-F2* 4%+$+,Ѹ@K0()SD41 ! +oc^Esp C BAahh C B s ڸ?q@8BT F2 Q!D#RCB вBA By#Oq F(_Ѹ?BPKh!  CBpՁ!FBQ-=v"CF1F]@BB(F,YF8ZDPF< tw#y{B?0*+"*@p4Bi @ |JU"!"!"+;#(FFfCCF By8cC v 1F2CF]@B(FB&o%UB (FIF$i By F2"D A1@B ue1vCF1F7]@B(Fr2B2E sOq 8FJU#1#1F22r-ٸ?)Osn-ٸ? @e1"BqF"2 D(&KEv$+v,# 4ZFF F1Frf\Ev\F&F#9DF@ BOq ڿcCs 44"qCFl <@B F< *K p"!A#\a BrPFD3+PF 1qB?zQ0q#U  - ЎB?i03+1 y"i 1Bp '?Q@ -AFFxFkN(H4 )F0F%(+,O0:FP!P# FtCF+"KO2h#RZEs FF"FQFXFt*FpkCEE@30BFFF@13h0F`!"d!*Fp#FGP@&-GFKFFFO<hRL5E8AOr`FFo-?, Cb#@2?$%BFF;`3hP@@j #BEs җ&MFM+h[3 ќI  +hCK+`(ВI M.Kh+J )!\EJ;+{I@FIF]>z A FYF( ^JA1 q(D! {:#sd+d#F.yKhtK*"-:Dh  * qKqI (DqSmJ[ lJ DkH#BFIFFB|+@#!q aJ0 X1Dhbh8t#as:@ ]@KA0 (q8 b۵ ]A0 Q0 d$ z/CSO"q,I 2 8Jd!q X)KD(qjJw; +{۵@Eq L%JO ~! % 3BR _+#d F4FFY@.A@]&8]& ]&P]&(]&y6 0z]&[]&ߨ0]&Qzz.z 5J9F(F D+ q0JD/K "FhC*N&a]A FYF]#KA0 ! p {jB?rOaa0F.FJ9F(FOaa0Fx Fp+DP#L1;L1+DP#T1;T1+DP#d1;d1(F,52;2b.tb(F,5p2;p2pb.l`lb7F# FFFOF(:H1F! FD12N33@S,B@C,BS,B2C, FBS,BBC,)FBS,BC,S#N#0@_0) FFIHq"(0Ч&#`H!@)" K0IH@?uB ک) FF$I$Hq"(0Ч#`Hj!@G1+ڧ7#||(#"1 KO0IH@9PuD کCoOrF!Q}0H"H ahF81!IVP03 F F033S< lKI FJ@+F7p!FbI\#jF[FH"p1+"033FS< F@ T(FCF!@t13t1c+H!d"K!#*#D )7F F2I2H`#|DC*Hm%!&)F0@D(1D1B0|18\ "T_nHlMQ-I n; f+X1 @"K70I H0@!mZe "pshuB ک8!F HnCFѽ8@ I H)F$0H)F F8@˹N^w@p FFFQ kH0I F3 Br K F-)FF"#FFz##b03 "r 81@?!p@pPgHF<1FCS<1x1[hh#j11Q0C=CEUH PA\A ! Fhh#j Fdh-CFPqj44T<D#SD<T2X#C#D2qCCD0+3D&0 HF2(F5FIF(Fn/AFTI>H(< ((>(D9H)F(S(5J6I6H@=03H2JO1I.H0M+x+#+p81:F3F FAF#+p#JF%IHt#JF#I'Hl!J"IHf F{D!\1)FH1x JI HPxv"!O0e~(m<ЩD&4<ԫݫh]&F F$I$HN", AFH3!<1IH2,,O3,1( I# H<1H!FMyjFa!b#j3 F F@?-CFFF*xFF0@#`O4jC JH{II F2S`h F$`T FxJ`O2iF\F;H!FF O4#`8h(U8FiF0F xIFFj# )H3cjkb> > *** jF9F0F+j(F$2{`h`#c`x1Zh``"Z`#j%Fz`IFH F"# F-2+`h`z`ά\-C "FAOq0NIOH #%LH0Ob5VOzqF(FF)F@F7Ѧ`h7+ЦZh +:H)FW# FF01H  x1hݹ5h%0Fxp/R"BJє>p/%j-Tф>P**F1FA"B+є>pB8-**F1F(#j+<#9F*h AFFH)F<#0F[AFFH5F#j+H ;F'FjS>0#j+ф>P.Ю5FFOi˭~-OhFFIF Fr8I"@F OI FfH00A F!FBI FVF(𯀘I FN(d0C0 S&6p0DB F F(ҀFO EG$1FHF LF0FNKFJ4`8FL}J{KAAO6h81FCC81#x1h/[ "8(@x1h/n81#C81$&S*  F"FFHFD (< # ;k( N(4(6($U(IIp( x( n(O I IYAQO $FF;j FPFS+8  E۱E "F9F BDh;jhPFS+v8  E۱E"F9F@Fd081#C81O0 F0զ#` SXmзB T(FJF!FDx1? *P F "|̏7(FS*0  E+P5R F*F[# [c KDc`> F*> FD8p1pFFcHJF(p1tAt&p?J!?H h+8I9H (6Hw$p>02H ]3hx1hll1+,HQ"1FF>0 dh%H @&Fl11F+""p#FFH(C  "!,jDF IOr(F0I Hl1+?|Ե[%gQKh*hQ`X`pGl]&hpG-CF FFF0&K@G%J&H{#KOq JK@#BѥF#`O0h`''`okg`<`lc4Fb@0KO$qJH{#eT0W0K@!JH{ #T0b pG pG0K@1JH{dCd nPFFC 'K@# 0%K@Y1%J%H{'$DDkB 2FiF 0O0 kS$0;>+٥#`4Z R( CB(<$DDkB k"S$*04y[ X! /FH 40 F $ F"F#4B ?"a"FB(?b"FB0?#bc#es,=%hE+h.hRHh ЈB0jhZ``(F 5FBjhcZ`jh`Cпh;`b`b`l i#UU0hXj k#V0p@pG2+Z`Bh` N"a2+Z`Bh` Cb2+Z`Bh` 8bcO1F F@ *-CFFmN'T0۹3h;3`Xh#l+alGcK@AcJcH{jh+ my F}h+h*A2cZ`jh`0G#+`ckk``ecb.#oB#KFmFU0lVp+5lKE"IF]dh l"h2hh?QhkY`Qh `!i`Q` `"aF7ha`a0@ |HB ,U CF*FhlICF+5oh+?ih@B?\cmW0S0;YHB  5 BqX0G AqAa*-?)l]&F HFZIF |zBc4 FF-AF#OmFF43LOaCF2FAF iFF F m4((@- ICFH2FF4BF1F(F $kR]pGM FFF3F*FOahhFx8F IjFF F` MOiR]pG R]pG R`]pG R]pG RD]pG R]pG R(]pG Ru]pG R ]pGKpGkK0 $pGkpmObiF$CF ( lN2#`O4 F mpMI4dk[KpGk@L  4Խ@ ܻk8F4MOcH")F\4O % %Ր0")F 4V#`O08 k F 6 F E Fw h F@ JF O31CпO31 F@3QpF FF!"hF "hFF+hIjF`Cн0C$ B I#(hjF0O0 $p iiCjFl3`022 C3pG pG-AF>PM@V#O5`(F-٥47#">FF"CF"=2ѝ0>0F#C0<#& F HQ> 1F FF(є> *1Fh F dhhpGh F 1dh#DFB +"*+ ,F$p FF#/x+F" Fv( "1F(Fn(:!(F@F(\oB0# !# "c;`O0p3p")FD!Kh.F;#Z1 R4#oB# "0F# c3px.+i+#oB0#! "x`cO3cc O3c:+}0 FF1$hd6#`(Ff0$E ( F0i+dh𵇰hF F' h۱ah(FhSx+ai2 ich01!0F*F $hh(#` iB@hx1hpGCj@hF"!hF< "hF hI#jFC$~i-OٰF F#!Or OC uF8H1'8FY#0 Fo0ѕH!8F i 0[x+gF(_عHQF$7Bni+yҲ*"#+  *> 0D081%JB (Fm0"HQF++,йIRF  $$+# #(FK(d(FizsdD(FX0#P0lcd,b(F##k`{h`d`5}`@ŷ-AFF - i#\x!hD#` FRzh* - -*FhF( "052i%BD!DB,D#iBdhF0O0 I" 0I" 0O0 04 %#F3S 2AҲ %D"0 !CS!"bC!S^!a"2CS^!A""CS)""C,0-AFF FF0H(FTAFz0F H F 1h"(F1\HH F 8F 3hFZ2`@#p笏\-AF FF x+#3`#` /!FFh1F(FnpH)FO0F! "@F# # " HAF$!F (1F(Fn(/#;p,0h & `ѷ-OFFFFFT+x"+ 8<"+@ :5@/x'#;'#0UE~E$9F*x+F\*@Zx5x*/UEs1FE&7F$F+x\+Q,@5-)F F(F ѤnO77#`8F,@E)F FF7F$3n (76666G666K]1FF,E6E#;E`", #DE$6FE+x\+jxx*{9F+F7FFm*0*Nb**,pѪEع7,иE##p #, #" 3Jhx 0 Ѝ xU0J 0+!UEӮ"UE 6Eg+x\+;U  3" `F*FF20 ؓB F0+?l"!,( F7F+g$(7Fm?'XFxF2 + +pG+FpGXxCx + +pG?FpG-OFhFFF:F(FHO=!FP@IBF@H FO 5O F-IѪF F '@FF( "(F[(U@*@"Z`8F E `8F6F0F  8F E #0U 01FDU 0SD  U*p/=!8FBF!F8FH(O @FF(HupFh% i#jBi% fjUjB `j # 3p, `5, `5-OF1;FFF+m w   | ? + X +Zm=Fq % 9       M W a m w   4'-?(FF{ *F!([" 1[x(N7 Z' @# 0FoFh$+Fh 4- #%40C0 )-40HmKhB !#*FFFG #1HCO0 {(#*F!F0x#I( o#1w@@y-0"p)F450C#0*Fp#!EѐIH!(.*юH4T<"##Dp40C#Cc0)lQI(F#l1I(F#l1I(Fй#l1~Ǹt+_{r)F8FF(?`p HV)FpxtN40C0E-41# 2>I(F(4# 23I(Fx(4 # 2(I(Fn(ФI(Fh 4 H)F!40#0 40CS0m0*F #!FFѐH40 S#cC#040CS0ݻ40#0ӻ40#c0ɻ40C30-<1?3vO:041F8FBFKFZ(ݬ0BF1FKF8FZ(Ϭ#P4S-<1?3xO 04gAF08FJF3FZ(JFAF3F8FZ(PO:JF3FAF8FZ(p43FJFAFZ}-B=!(F4H03I "F(FbF4O0p#0#0 :F(@0#sC0 I "(F8F4p:F(?I"(F F4p:F翏+ù޹I"(FI"(F`I"(F0I"(F([w4!)p")F8FFHO  :FF [0 #0 RFIFO0 #0F0=F(? 4  82F9F(?_pJF)FWI"(F(Bw4!p")F@ :F!0?b0FF(?[ O(P K4 8D2F9F(?pBF)Fq tI"(F8(rI"(F2/?? D"##" F8FI 4+?cH9FbI "(F`H)F幷0p)FR 1͹ *F(/!(F8O3 4"1[(?ש7 @#  'C` *Fg(©/!(F O3 4" 1Z(? 7 @#  'C`s-o40?iX*FpX^40CS0T40# C0HHù40C0;40#01  &@ISXgt40C 040# 02_@@!00##C0# 2RORC `C 0GsP0#S0#T0O3V0OS^0Ѹ4#0ʸ-ƀ<1?¨2#4S470'(?h+H)F-4$ U(F>$(H-81 33S<ԱH?" F(F  I [`40C30d#*F!}( (Or(rcrH)FX40CC0B40#C0840#0.40C0$40#040C042#B"Cc2#-rHQF 40#C04{t#``-к$H4{t4{t4{tXHG-hUH?$ (4(FFQH)F?"p F (F I FFH)FpF0(FF#;:!(FFб" +o@!HF FI F1H0H=!(FF,I(F F08FFF0&HԿFF&"I(F F(E8FFVFF(8HI(F Fh8FFtF(O6&簺ٺ;6SfwI(F Fp8FFKF:FHmI(F sFp8FFv6F%FHXI(F ^PFOщH)F&O  OЄKBфH&v1@H/@Ѐ}H)F|I(F .FFyI(F &FvvI(F FVsI(F FpI(F FfmI(F (kI(F FhI(F FeI(F FbI(F F _I(F F@\I(F F6xYI(F F&pVI(F FSI(F FFf^OI(F FLI(F FFNII(F F&FFI(F F&>CI(F Ff6@I(F FV.=I(F F&:H)FD!hz1,"Z4(x1HN8F 8F-F#p*I(F YF8(FnF(FVAٻHz@8SnOV\dks:0¢ =H+hB@kh+=  ,5EфFO %h#j"`,"3 36 @FAFFF0F0!ܪ >;`7(F2Fк&`"-?H4P7#P740CC040#3040C#C 040##0-?(F@h2+~H)F⼃hh2Ѽ40C0Ǽ40##0-?(FF(#;F|I(F8WIHwI(F vI(FDeGY.>qI0F0oI0F(~IC2S$e40Cs0t40#c0j42#BCs2#^40CS0T-?P0# 0*F!iCMHl4 >40C0440#0*40C@0 -??" F(F 4 H6 +>-H)F-??" F(F 4 H +>H)F-??" F(F 4 H +>ʫH)Fһ ` ˼żӼڼ߼ #-OLFF &FOY 0@6n.<1H [j+Ѻ HOLD'BFj(F8OZ-OF FFF+G%K"`Q33S,S<yH<10FTJZFKH:BFO ""J)F8Fh"FK(Fm22 p!A@ A2 FYPFO |7̏t&6-AF F)4 1+W1+ax1+]"9F0F$   $ 0g47+Y0 8g<7+Y8 z@gD7+Y@ pHgL7+YH f( b(FA ] [ 1Y7(F R' M1Y7(F D'"F8FF(Km T"0F,6p47;470F,6f<7;<70F,6\D7;D70F,6RL7;L7-O=FF I gF(HO4O IU#BCcE##"-/#0O3`P7CP7N#[BU#` F8Km3KOqJHwh@ڿ=FF F1^K@;!]J^HwKmjh9033S<!!F0FFH"F/@RI 5!F 0yѡh+tKH|}$P81 F(($ FBmcmBCobo B!FRhkoZ6co[388E(4"F/@/I ko=)F _0ѡh+(H4!F Q0ѡh+$0F)F(F(cm[jԢooBI*F $IIvco!F 0ѡjh+ HJFرh"Fu(FF"!F(F|cmBF(F!F Fw+١>#`4Y  Q@,CA@+١&#`7Y  Q@,CA@<؎3FRCFO4 F0@pG)F x0F FFjOV?  *F9F FCFF F&B<K!J +*ѣBx*K!JHwR6 {Bq"X({z<FC{B"`)C+Z@+-O {FAFF,@qpHF(3h81Y@;I:F F^008FIȐ(I8FF I8FFI8FFI8FFI8FF`I8FF0I8F%+@ɀ3h81Zڀ FI3 Z<[LJJ 0l+JI+ FI F0𘀲l FI0𐀖P F}I0rj FzI00F wIF F0uЖP0soOr!Q0mI F0_Жx0+@3h8!PAȁcIV3hx1@^I F60=ZFYFF(@ӀF6!FXFw0*DI8F(@ހZ<@\@OAJ Fw IHHKII(FF Fk0 лzDIF Fb0AHO4%2>I  FQ0;Kl*?(8I FD0!-?#@6 1+@Y F FXCF@R%H'J"'Ix F0^ 0+BhoH|1;\,5nh/!XFF(?jBa"FE T FxI 2J0?Q"YFtJ FrI>0EqI8F(|oI8F (vmI8F(pkI8F(jiI8F(?fI8F(`-?`K`J)FFF^I Fl0? \I:F Fd0?0F%(F>0h%(F?ABQI FM0?-? 0+?0+? FEI2F0?Ю F@I3!A06O:F5O3J8I F0ѵ3hx1hG%*2I F 0ѧ8F%(Fh F*I2F0? F%I!0ъ-9F F50? 1ZY*ѦO%CF@F(?k F'[P*o|1=FoQa8F h(FCF F8@)8FFF:*=lb"P$#lc $0۱Ziʱle1F(F0O4 ,(J (J ,( F( J1F(FO40$//$4pFIE<;NB H <#`O0p"1F F4 Fk F0DhFhF1AT1F:F(FAF:H F8I"8FT8!F@!0H #;F6^BF(I)Hoa$.3i y0Fb06I H\6h(" F_b0 Ѡh+IHH# O#I"FHE(OsBk I"FF H$qOiFxxk$KF &F;F+Z[Xr#` &F *ѽB Њ H ch0F (@(Ѡ~V#`O0(яBѠp"#|Qjx C   B)F+* FBDPHE٠L7# F#&O. 9D ;B@BE٠2#O [FFFD,B ",+F+##p-OFF FFF%CB*뱻,ؠ7#`O0TKO X\YF\  (`(iF D8%@ЊB؟^#`O08C% xLx1Fp@;Ly"F1hF  xiFlF(Fpy.x1h#>0B*2F!Fj(mh !FEi!F(F(џ`/#0 K@!J Hux!K@!J@ xHFh FFԟ#`O0Cx+Ё)F1x+x:G0А"! Fh Fcg9FhZ#h Kx+ыyoC@ghX+kgx`e h8h0F"L9Fx+П^#Ix`e(-AFxFvuE5|2xEAFx29FD:xFF.8x2F!D|2 +D|2%O0PF F !F"D   Cj"9F I @@= ,ٟ7#`O4 F/ "F(Fi pG pG pG/J0FQhhz pFO00"%I" F3#OBOq#0IH1#@"Oq#0IH #""!0 H"! (`0 IHI0R"58FQ(hCйz(F3#x18@*8pF>`ư FBПHO5#`(FFpOr!hF "hFOCOS02F)FD`#hjFIOsh> *FD#hIjFOshiiF/`LT  V( d1 KOq J HuvKh++P@B O0SCjFlCXBXApGQ FhBF#cgD#Q00PF" FhFM    ZjF IvB + ")F FoCXBXA 0 8i(0PFT ["!C C"!F"I <+0 :i-CF<]F1K@!JHuKm#KO2qJK@!{JOb!8 F#pHF1p31caso`#`-F@hB`hC`FHFxsmXihC`hC `hC`h/Cso`oDCc`2#j"cC#b#cchP .]5xB Xh1FB ORXC X`*Fsmi"0-W=E5.Dh /N /F 5ǜhY 1F(F:Fv/K?G7=Dh F 5Ϭh 1F(FXo2FX膳>F65D*"!F0O0 <]Cv%IFlp(F:F0/?G7=D''&-C&FF"#Fb!#6"!0bD0F F/.F!F0FF(PF!0 џh +(FO0,F.DBxB ҟ#`(FO0##DBӣh@/ "F8FF HW "IF@FEHF#D5Fp FIiPF"hFQ kM     Xh-Os000h "i 0 I@#jF0Fp-Ii@ih%|2F CC#0C |2""!x2-C]6FOb,A  (н BП:#`O00+ѝ0++ˀ++w*<+6(FL0@뀟hV8O0+)*+:96սxF(н 9> :0Н0+ ajѐ"H "nI0нX0bj FlBKx+++vKh #Zx* [h# #Zx* [h#P 4" C !FF     JOsX0;hFI`0}џ|h+Пvh1+>I>H0+';"(F#Fx*0;+ O1 !(F ]*xHF(?[: d FJ8F F (?8@/ݮ:$B0+ͮ xM N0 D F!Z#F0+Ѷii@c KF#!3 F+  pG+#`$`V#` F+ F#` F$`V#`FF+I"O0pG-G%FF )FF"! F(;#``3I4H~``0ܐ+FJF !2QF5l``0ўvh+`hB%IjFL0 нP-ѽ0cH`hCйv F/$' " I`h *0I`h"0AF FG(I`h0 a`( F.@qB@lBpBfB@-OhFFFO#`eihM"i`hCF+FhsD Fh2RJEFeFhai rDB- B hFYF(F!hB`YFJF0F5iUD%DciaB!hC`?HF"O9!jFI]gBh-AFذF+("L5FŔ x"nhш4(O3jF!8F,I#6Tp#`O0X4("O31F,#8F"缢B0h%-O5P*PI iF @$P#"@h 0! FF@hDh F@!Fw0O0! Fn0I`h0O0 ~B FVű.؞#`  `(Fmx` hBٞ"#(F#;`BhhB9`3,1@pGpG8h!DB xD`@@C8F0[+D-OFF *؞#DKB ОV#`O@F$F#F&F"FB  `+dAFFdF˼Uмl QF, lBБ Eؼ4ѻxFE\DB!F#(DFAFFDZF+2Fў#`cSc FFF0[8+x #pO0 FFF0E8+h #`O0 FFF0/H+h ` O0@mShYhm#e@!nK h nO3#f03F$W F@8F0P33S<-Ր>0+)D&0ke#hx1h8B0YmkmB Rh>0+  H8@ 2 033S<ԓ0hepF F OqF0`X+ha K0#h+0#pOpp@B0 0cSc-OFŰFpFȰFUF3 ѭH O0E HOs: S<VOq KF(d0 `ñ*.h( B "JBћh ћh`#+p(0> kpS+ *p#@R,h#k  q"?qgҀ(+TS,sh`jH $@D,IDB. .d9h0щhB @2C0$00#)@tF@5$p$DB..<0ӹ(1+@c#;`#-0;Op#F狱<0s,@B6#p#q<0 0.Ѩ+8##p#cp0KS BB 4.R.C.њ 5+M0+<Ш+@ 3##p#cp0+@rF7#;0" F2,3"RER:O 07,34'bE@t 5cF cSc3 53B+#; %1 Fq2 5.D..GS<ը+@2##p#cp04D<}S(? S,  ҲќBМP  .ѡ:*DEp  ,3}2x,B&ТBFS( S,#Ҳ|BАPB .ѡ:*DE>  ,3V;0W0Ԩ+@'9##p#cp4 D$ 4˱Y 3B M#; $1 F 12 43D(1x3B=#;( F x2(1x3D.@..􀮗W0Z:F!; 2F+(o!0BbpQ##pa 2PF Cp#p#q .y..CW03 2081Ի~՗Z0Ѩ*@"FP!cpF3 2˱3Bs:<#;1 " F 12F 2.DOs@~+UQ#p#p# q4< #<S`6pI(p*"(1Zp(> 0>! A}jF*@#t FHHO0#p] `FFi0/H.KBBABF!ѝ*h+&Hi '8F ] i H"FY(hBC!Fg(FJ H(h81E[ 5# #F0P F0`Hr"FOi8#F$ Fpx+pF(2F)F#U-OFɰFTI@FRFF(d(hZFQFF(mМ81F`F@EH0FIO_Or3Fi0FV6#RF[F(hv4# RF[F 5FU T0#0,0+A.@ѝ0-N=@#+JOq8F ,6H,$ICF*FHF?hHF(HIO$HICF*FFHF F~;hNdHICF*F`HF NH`"5b@'7J-OF$M F$NFUb FO, ,62B&p%B&F, ѽ0FJ V,XB3BѱFV ,Y,PF6FHF5,6#T ,@FT,5&F0F缣W_*-OFF؝#`) FB1F t0 B O #DBҝx"#1F t0O0*O!FZF\DBH>CFIFF0F0T H2QFF0F0b*F M؝:#` & FS (ћ(O hH 9FF(F03)F+ t8"F@Av0O0 M I(F0#` t04[ 31]aS0[#h( +D(8D 0-OF+`h@p_0՗o0IF0h#FK IF0hy#F(НK+A؝#`T0@$P0RIF0h#F(GC "E=0FF(U;  89F(4$B77W<0h0  oH~W18U\d~<CJm 9 P-AF@F` "hJ(h+F"!A66V<%w! *^!F #(hAi;(Fcik`jG  F&H(F:F!(FD(h+F"!'Uh'`iwciV,Haiw#bR(Fi#3(FcbV#"b#F#A=AF(Fcfh0-OFpPFFi(<5 0#՜J{mH#2F!FxBFhPMO O8xB3Zh*Kl[@+(@#OzrdO`XzsD F"(5 0yJzzH{zgjz {m#xB3Zh*mK{n+$*F F($<и?1cJP#h(^J \ " *" "*F  0zNH  F 0p FMF(a2FQF0#kr>K"6ka(h(FE#+phOp@#+r"!h(FOaOsBF*FkmwF(F6'&H Kh4+/1+#h81I FP h#F"!PFOxH (PFp hKF!7+zDCDC=J&J! Fp&P>`5 h#F"1Fh0 $7S : h1FK_2 r G1FF H F@sHC1FJJ O{8 PFHh# F3d8@J!&a 8FP+h;+h#F J!-hjF FH)# F+`=# Fd8@8m J! p PF1FHA1Fk*kH hJ#!+`#F#c Fd0p@32!a"2a J!5 FP`6h_# 3F F(C0H #h81T,I Fd@H6 F2F9FH#h812  H@9F F!G2F9F 2F9F(a F0K@!JHr  #hf+` (ah F F#$| F@ =Fm0 !h0Ch0"*-CF` F hhiBrjBX0F(h3Y {ȀFIFF&H~ hiIі@0 F)F" FKF!%#F"!I FdN2#C"#[ [C#h!(F h"!K%x 0Fh812>#F!Phih" F# F+`# F 0iZЛO*` FQF2 FH F 0@E8F0P3 FFȹ HI Fd8@ (aH F8@ 28 =8 PF Hd Flh0 FCh0#d8@J! -CFph7X<@N233C23 ,FFѧHCI"KO0ѠIH<<1 23ѝI" 0(F0їH C@ &qdh]fXc(FC7v2C(FCܽ33C. (Fh a3i2F(FyIFh BiX< X,r2CCi#3h*6$#i(F1F#@0ci1F((FFHF`a hJF#i!ffah0Ch0(hhQK B#3h+E(FCBHX<#k3(hiNF(xz?? "k arEv 4H h#3cb#cckDcckDc0KE0@,#h+p##`7dX<C (F/8H CXl?v3C`jF\ F H<1 ک0cSc 0+?]h+?Y0KE2`jF2 FH(F(h+F2F!cX<2CД@ r K(h !G(FC7(hK&Q 9 8 0FP33S<Hh0Ch0# Fd8@H FI hiV@h@t#hc03qr C ]KpGbn"h0BI]Kd-OF0PFFF# x+@HhkmBCF:F1F F'Oe> **(#j+;7 cE85# 2F h;Fe0;#0 ?0"Fx;33FII e" ^"\" B2BF2 FHQ#Rh Bł30|H 'Ox+h+wI3F"Fx (+tI3F"Fx#O L pB:F h1FU@dI3F"Fx HP3+ѹR60X6#2F h;F0VI3F"Fx3FTI"F x$1F h:FF@F LHJ0F+h +#h81FI F^ hi" h!AK*m+m##+e'[<+<##F 0B"1F:F h06+7#3+[RԹ@3iO #I3F"F x:F h1FFH HF4V3i+h;3@3i;3@I3F"FxF " Obl#2F h;F8(+h3+!J+h+х@3ikb0kd#c3FDI"F xu+iBh8FF`( **XFzXH IFRCFRF)F FEdhO-OF FFFB DI DH+F O-! F*F -i'x@*dbz*a`B[.VBR T' $ RF½((B0DB?ӽ& O:h1F F"H2T'½0KhP #i"POS 0ʊ !PF(FFXFXE` F H !DHF:Xrp)`]F FmIHh#`hBBiF F0AF3hCH  I(F ]phiF(F1`.m,dOi-A"hh!F AHuh- xhE *FAF H0+1h;*FAm+1h;*FAq0!]PF FO PX`` C   a` X`` Ba`O0YaIHZ0n "FC H= !] 0 F~ FFh F!8F@|ie`ibh_([ FX,hx1h K jO32BеO324#38 h*[h7FP50j000>1(R<,C#B<#+ +R{nh FF znoCg2@{nh#)F90<"F00("FO 00F-Scj%00 FyF(#yn81ynX1|)F F;F"FhF(?b)FoynXxXCXgW)F0FfB1(FL8( hF(?f")F!FHFIF|)F"00"F!F0Dkx+ (F8 PFFF0FFxBQF8F?8< $B")F+  ЙB"9F瑹hBC,PF<" F+H FF(?Co<CCgiFO3iF8# Fvdg11X"!0FFHIF0FIFME9F0F"!F(9FY\Ȑ?z0`j3S,hBC,PF<"N FH#cTpF0+K@!*J+HpAi )H 1:)F ;CFњh1+Кh+Кh+ Кh+iiJH 1_ki hܱhhB#hhhBaiPah{Y`bh F`5knB#h0kf0FpQ`FOi8F@L dF H F8#0-GFFFFF8?H$ F10 hHh;hhB!` F"9F(FF(M4 #F(;hEa`#a#a 0`0#a8h E"FoJ F!PF~kjKMFE +FRF9FHi!F j0њh+ IHi Fi#i##`shc``t`綤b [6UF@0 aiA3OP3S,S<RSBBДh0;`n(h!l(F&0F(h!$"gn1F4رhjBijB  "H1F"(FFH 8k(1F(F#k,(h+п0"Xfh ?hcjBF8Fu#!h0ff(h#h+ѡl(FH(hhg0 hpGiBa-OFFFVFJx0D#`F(F4#")F8FF"и(2hhB!*`Q`ch`+h;3!F UF FO޻б3h+BѹC0#ai#a+h;3!F O24 F(HOl*hGa`2h`"a` B``3h`(hDF0h F J! ~rhBѸäb0-GFh O Աi'h.hx! RF4CF0F3#3 h`0'(`0X #`O0p#`Kh#xF p40p#x:+bF;+^1`v\+x310[:+,F]&pF :(NxF_3B ,:*ДBBxC@*F -@,:* :,p(FK`pGopFFN/F *|(:(pBFB k+2:*|*FO0-O4M\4!++dєL&h.`X0F(Xdh`FP #`o8F 4M41F,D?cKh/dF'I="(Fn(YFxF32:*FO<\4 3 F(ڀ?À@F;_FO`)F(c#((FO7!+)#"# 'FFF,FE(ObQF"D+ZК$h(F`k"Og#  VF; +/Y<'o:++O \++ + +O ':+ѹLF;BY(Fad(F+?&!FF'CDF#O2 O"p+x+#+?~X(F(v4 ;FT(а? 5F:#'=]&oFxF3:*ћF  <:+:# 0  B*@F De)F@F9xo /V #`DDDFB 1F (F=JFYFPFz DEFNaK`B(F(FoF`qon## FO3=]Lhn#` a``a]&-GmaL#FF#i!ahsx&p#h+6Тh*3"`o' e&F;/*lhXrF(@h(@ щ*`.p\#iEIh~x`(O0 mhXNFйh(Ѓ@щ#i`"a]h(FQF(F~P`(Dl*faxDE1@:(#(ai1<\+#ca,\*"ba:*#*pkpoF+"@FpO3:F}F+=h\*?o+gDla|*:*+]&8F F)F F8@'F="F(d (@𫀚 #`o F^+cx:++:pyь0Fd(n0F\+cx:+o+mУ0 4#˼B0 З0 ۲T+1A+٣B, \$% I ] E = ] ] ] ] ] ] ] 9 ] ] ] A ] M #b_ّ # # ##:# #Fd"FFd#/A:*в+O4p(F8`B #`o F;p L(Fd(FFd#FO4pF#"Xx0+CxX+00$$8"0޲ .١a+ءWB 2 $A+ء7 *`pO0#L`h#`pJ IH~``8 ]&-CFCLFF#hk JybhOa>Hp0 ##`  !HFN됹`hCh;C`+ډ (0hZ`x +AFhFp((-&1F(AFhFpAF,hFp( "pN(x+0B+K"F47Gtx,(  pC+"BJ" ` (* F pC+]&`&]&K[h;"FFe(HF( ]&d&F:K 8G]& 8%L`h%`|e`8]&F "F! 0K87F ,H]&d&8+FO*` Ȅ ,`8 F !F" K87F ,H]&d&-OFFFFȿ`O̿OO8m0@F4`hBh [(QF(LE!FIFB LEE$0O8U B0 pG pGpGpG pG pG-GF-FTOFF;h8cPDzhPFp@ #;`  !PF鐹xhCh;C`+ډ. (0hZ`x +#FAF hF p `-&1F(AFhFpAF``hFp( "p(x+Ѡ`EAFhFp( "p(x+`hFIpa(IhFp~(IhFpx(IhFppa(?|IhFph b(?t IhFp``b(?l:!d(e ld&F*#L`h#`p IH~n``8 d& K[h L"OcFF0 80( d&(e&F KFFF[h["+FFFgH %`(  `d&FK 8Dd& 8%L`h%`e`8d&-AF FFF #F*F! gK84F P @d&JOc0] (e&-AF FFFD #F)F" gK84F P @d&JOc0] (e&8@P@@@ @@0pG-A4F N# u(F !'F09+F% +O8FJhhpGHiSipGpG-O FFAFG@?F@D&WKOz hZhFAFD|CA9FCD QӢB ӴOغ_=#cC ?XFiFFF,i&FFFF9FF 0F1FF (F)FF F!F@F O30F FA Cc">BFܱB)F0љ@"h\Kh:KIGKz #F0o4,i&-AFNh3б3i( 3iwi@FB8GD8FB` TF0 i"FD$!FF(D,i&8? M$?i*j#DBiDa8 F( ,i&𵇰FM$0+DLEKEH&hFFG&hAKCJCIDHG&CJCK%)FAIBJ/z( F@HAI&h/F?HG*>J?K))F=I=J(p( F;H0(,.)&@+iFizHjOiC(D#@S@a j30B P#@JjOi*DC "@b@E! +a3-OKMD+lD(#XC00F(yEI0.h$4FO bkB"O(xO 2( DB(O(xO 2( D*lDB.8F@FIFH 1F04(F4IFk01F+k4F30~F4IF201FDjkF#D4@ dF Kh@K IFG+z klh,i&ؤop$NjulB(hpU$0LE$4,i&K[lhpG,i&-OMoLHP-@b !"#&@F#,#Sr0#bObAF(3 `aZHO3dlC`UMGF\??6.. OHF(#0'm&/A9*t ssssss&s,6ssss?GsTs_esksqssssssssssss"s(.ssss;AsNs[asgsm##r##&0##%0#lkh2B;k`kh+3#$0#h+;`lh:B3h+;`lh:B3#'0##(0y##)0s##*0m#0# 0.KQFG],i&o"T72$0;H}:M&h2BO`@hfe`cc@cl#cA9!dYe@e#jhi@ca"fY#bf!a2*B"f1fn@c`'0CH "#3I&H$ nIg`H j`F`d  Mj1F(`(#H0 U# oi&i&KH0 pG,i&K h pG,i&-AF4LFoB70B3 0BѪBpB 0B hBр`"1F(F2'BF(`cia@FNciD1F(F0ј@"iFh[Kh*KjFIG#z ciBF(ci`aHA,i&o4i&-GF9OFF=il @#i@"#aO3D  0 0&0"nB 030Da`{nBO jHiDaVaciiB !F@Fi!F@FcaiB#ia{h!F0&0K,yi,@yi FG,i&0$BKlD0v44,i&KpiB l@.j&DBЛ@DhXipi@li,i&Jpil  @@@"iuBeO4 D0Da bTiDap2,i&-AF_O;iB lCh@% /DB{У@Dh!BFZ! F2{j2Ѹ%FKD00@*iC !P+a@i Cakii3kaB-:hB##;`i)F0FAO1K#/03 ,KO0CCX AFs+8)F+9hB=`BKi+88)FA!P@*FZ!*F!FlFFl%0#"iZ!h0@#`,i&ؤ-CF>MkiBki3DB*n1F F(Hh3/$ F"F 0F/"9FHFh(9FFHFj0p;`oB0B F"1FFGF +i@FB<F`Bo ٣S@  ј%0+ЬB*8Z!7 )|0B0B!  O2H>FF/H`0" 8FSFCF&HIF FFh0B?o*Fp IFH%0[B Ҫ0Z!.c*0+ЬBbp!N #`h)0+KhKIFGL FFoi&1,i&F K'0CH "#3N, F@6,i&ܹpGpGpGHpGoHpGoK0h3pGK0h3pGK0h3ppGK0h3pGK0h3pGK0h3pGK0h3pGK0h3`pGK0h3 pGK0h3@pGK0h3pGK0h3ppG9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpGξhF;+`ڌiB (]Kb h\ `p]KpGipFN$V4(FZ Fp4 , |K +K[hG pG|F0 S pG0pG(h9!HBpGXK0h30o O0 pG@FFR;BpGFpGF FK0h3pGK0h3pG7Fx M K*Fh@I+F"FH|0L%F(9 xH+ pG pGHpGpJK3( FFpG0;+AA- 3,۲ ٚBГBO0 , 2ҲB+F0-OhF3hCs`,q(FO #"!<&qh B  X( 9"|X0DD 4"FPFDD ` ;ѹ і.` 3 -6$`O0.9,7KFXhB4`3,-$`#\C Y ++$02lкB@F(:F@@-OEҗT #`1k-*`$琳KhBKhS HpGhpKhBKhS HpGU|pGpG pG F H I Fm,Hh IFH|I n(@HSR]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBЗ#` I)Fx`J!Fh 'EhFhBӹh "` J"x46@d(T`x10: (i&FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00X]h;iP!0xCC@! pGh`K3pGi&8FCi FB "iOF( F !F8 hpFFFS2Bңi5C"iYaB#Pp3#S(K}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhFi i$HP&`S/B2`jB2bBѢikR:Dp#iQ-AFZSBF FSA'0ip0iF FG2BҔtu(F)4YB7x\*CZx|*@0iF FGhKiBѣh #`t0+u 1R"B0XB`x\(]Xx|(Z32#`x|*xBoiF FG3)YBxB[xBBx|(632#`*=*7ѝ0+3c Fi DOAA3OAi Fi FSRi"OA F3\Z*ѝ *ЙB! F+  FiRiOA Fi&UiFFAi)DXi#i&i+Da8F-AF FFFhiû/$ݷ.󮀰F#3D+(+++)Y.ݶ@)F F?FFOݸ &&F#FFa2+FROA FCF" FiOA FRBi)F FR"OA F6i" F9"OA FA(V+FrOA F8iiOA FRi)F FR"OA F i" F9"OA Fi2F FGhiF+'2OAR+F F6iOARFF)F F.?>FHFFi F!AF&N FF3h+#OsB-#@\ CTkK52hh*!Oq30B#@"\C#TKh30B#@b\CcTj"j1N 8F !@pjbZb P-AFs*hBPBxB Tx], N ,8x(`!(FA "F9F@FN8@FB0y6!$p#BFӃh #`K31BґBx[)Yx.)3 F#`2B ӣh #` K3"`xYBx.*Zx]*3#`i& HJh0')б` pG pGFpGpFN$V4)F4 p , p)KS<GFpGpF(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(6-OFhBhOkB"I(F\FPOA Fa#h3#`"|I(FJFO A#j@"hh1N\( ! FO##j@"h`i`!(FF#jiD#c2Bx^)3#`#c#hB x]*3)F F#`C-*\Nt1Bx]* XB-*@ׁ[x]+ `)F F(2BXh+KK3U-*@ȁ ! F3#`Bأh #`f#hx-+]+ѣh #`f;Kh"hBx300 W/ ! F#Bӣh #`f2BHYBEx:*BZx]*?3#`2"`:F& '|F(l FQF)F F70:+#OsBij"(j1N !kj(bZjb h #`fMi&3#`Bأh #`f#hx-+]+ѣh #`f=! F)FF Fb#Bӣh #`f2B YBx=*Zx]*?xh+#x-*@ZB@Yx])"`-& FFWE0+5WEݣh #`f0+#OsB ںE׮:F7)F F?3#`Eɮik"(k1N !kk(c #p3kcQF8F(ݣh #`SK3O YF8F{( QFXFu()F F  эZ"`x]+h+:k>#jiBkxCkp;K Fh/8+9*j+Ckk+@kj+=k+:ѫj?4AF FY#jjg(k@>(j7D@"!(FhB"jh;`#`W i\A B2F0#jO@Q FhO0[*Zx:*?@=*?Ϯ F1BF:F)F FBi&j FpFi(KI h1!I h10Be F#`]#0#0 c` se pIOQ F p@۹-CFi `\ и[@HVB+xChBӃh #`K3"h@)S#`xBxE𶀸Dڸn"jOA Fl]d -*Fb2B YBx\*[x)+)"\! F -OA Fid*Fo6BtZBqx\*nZx)*kѝ%`BUٛx^3ܸ"ڸ"Vt<+_Т0O`Q F*FDVVt, F1*FOA F6#j"Zdq/Тh"o(Q!@{E ! FZ#jifh#` c`[KBV@ O Q>"OA F"O Ah #`KK3!! F ih"+ #`@Kh3* FVB$XBXA0*+"Ѣi;F F52OA%`i FOAi F;F2OAiOA FkB+x\+kx{+5 F%`1BF0x,*-Z"`B1J[xh320Z) FBFݢh "` J"*F9F F2BYBx\)Yx})3#`S+Fi&^ ]Os!`#hB YBx\([x}+ ! F!6h #`K3ܸ*?K.?hGi&h^`Fxi?)πء$ڲ * +^) [)Ҁ\)Ҁh+ {)|)!ChBӃh #`K3"jOA Fl^d .2Fb2Bx)+o)! FE .OA Fid2F2Bӣh+FБK3Z"`x)+!0Bx*.@?*@3#`1hK*53i+FOA F2RiOA FRi)F FR\"OA Fi" F9P"OA#`! FP"OQi#j!jBbZj2Zb"OQZ#jjBbj2b !ji Gh` C`UKgO Q F8ChBӃh #`IK3#hZ"`x<) >) РoX Fe"OA"O A!h:K)+*3@𩀢iOA+F F2RGiOAR "`${*ZB,H[xh^0@"`h$K*t3,+Уh #`KZ"`c`h*#` F2BFx,*@Z"`J[xh320Z@ FBFݢh "` J"2F)F F 2Btx})q3#`?i&^ ]3#`)+*Тi+FOA F2RiOA FR}iOA+F2 FRiOAR Fm "` "`+*O 3`?X"**1BTx*(?*{*JZBFJ[xh320[= ! F7?*?{*?e3FOs3#`#hBx}) ! Fh #`K3i&+-GFFFJ ЇhBCL nF KB s "F0F'!W%0 F)FP" GDu O" H)FI+FK%HuPO5" " R""tpOa!hF)#a+DaY#B #}K32BC"OahF"KaaaM``( !hF]c`)@ch FFF !cPFP{xC@_->س_!سo𔀳_kB)Fc#k!cO1ZhFx2*F)FhF_rг _kB@)c#kF D)F#c)1% OسOسOтFOMгOOG9سOeFPF'xGhxCO5гO2гOk#jC#b-?!@`c(@!(FF(@🀠c`kX#cc+k#0O $pB OгOpkB0)Fc#k!c[)F#cxGok]O3#c`h"F08Oг@OTUUuM A UA P i&-F5x))D)e)D_F!c_hbcX+xG_+B%s"T}AFk+"ME##`#ld`s`Oe#3`#j[!hF:0FN[rC_Bjk@!0;X!(F*c8FWj#:@#3B<+FbFG"0Bj\E:3Ҡ Z\B B2W# B$ P#AE@#@#W#03ELLBӫBB8W" 8F\,k+?n3PxAOбO бo+?_#jC#bYB8F; F(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(68FK Fh+#OsB \k AX@8k˱ K4(Fh3( K(Fh3x8 8@p-OF-FF FBԀ2hShS% xCO9س _س_ހ__𥀳`_𣁥L F@_𫀳O𞀳O ā!سOρOiS' B@ˁ?0O:س OM(O𑀳O OOÁOѲh)xIh0FO  SQBF!FsSFqF(ѳh+D8O@O3iB"xS10 _*2Fi++h  h  EKj)bk*8k?_DEw;xR#0+e=   BZљB! @(!DD#DF>7#k+E8F' RFYF(耸cl+? ' RFF(83HFF> |D [\#0R B,?qEM[FSEF8x3 xBkB8F  (ѺE~0Fzcl+C 3 l0. +?L 3l"B\ blcC\ ZFعFYEh 2 F(\F w(и?y ¸Oq1Or2?f $@E( 6  =F(EJ2lX#3 ZFN+0( >F%& &&pGpG pG v pGpG pGpG8#MF`+x %`8Oq(FUr( i&7FM+xD 0(%`i&Fhx[&@(/! F8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!HwHH j&w  (  pG pG$P0/ 2#0/XO-$MP@H`Lp 0p`R0*0S P000a P000T0000S Q^A 3 #Z20#%# TP@P0U*  T0 B2@TPT00#03R0S0 SX00G0S.T0S 0) QX 0[00 0 Sq 10H00 R03S XMX 00 $Ѝ P00#03P 03S 0 S: 00[ T0#3RQ R[#  ) H00P 0K?oR20S 0SX 0H0SX0 ZH 0X0  Q 00 0H[DI S 0g 0z0 C R9S+ ^1 Z 06F@`!   PT @-0CX 0  0 0$ЍS $Ѝ 0 0 Q 3RVo 0 H I00CR2 0% L /0 Y0S100B[T00S SB @ PTP=: ; D   20x0 R03S= "x X @-QM@00(,4`  P#USA\ 0 `U-00ĵЍ~ r0\pFAW`&S,- M rЍ$@-@MQ(`0,0  P#USA\ 0 `SU-00ĵЍ~ r0\pFAW`&SG-M0p`@0W PV P%X P.Y PmZ PNx P4 P 3Wf  3 }3V+  v3 q3X  j3t e3Y5Z! L Z3< U3ЍXYZ-  D3 ?3  63 13Ѝ (3 #3ZVX  PЍG X X  0 P X G-PQ⼔M00R p000`0 ע@P @0S nS a0CSsNU2  0oSm FPN ЍFPZ V000U000FP[Z V070U070PsFPZ V000U000bFPZV000U000QFPZU000V000z@FPZO V080U080i0@q@+FPZ: "FP FP FP`ZL V080U080?FPo EP EPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000lEP TEP  8 ( | @ 0  X t t A-P`M_NP 0@H@>SJM+; D 6"` `0!P P3P0 ᣱp* 0p WEp@ Cp@  㐱p@@@d-H AE'H%H P~HP`ЍH00@pŸO-1MM @PD 0< "( {p C.F D`pY;@D8 (@s0Sn pȱp đ`  ᰱ00$ %0!`Pt0p@ !0DZ ᬱ0SP Q0S RG001ݍЍG0S 0K0S RT Pp 0*8D<4! @P 0 0M0Z  0$0h,R gHp1ݍЍspT  @ H 4 0@-M 0P Pp H*p@ P l Ѝ00 0Ѝ0@Ѝ0A-@@0s- JPP0P 0up` ``0`0-Gpp嶰X`p #G``媰0`0G 00p@-@PCM2 /4P4 @@}pPB ` p@F000儰t2 6 C>@F0F 00 P4D@@80S VS00 SCލpx@@0S@0P\0\ @0  P@1:F?00@F00$P X p@-MQM@P4SY TE /t4PB QP0s* CPQa P0`pH @ @0<qp? H p8 ۍЍp-0si/%@@00p +<@P0 @0 4 P@1:WF?00 p 04KF0#S @EF@BF@,p@ :F00@H h @-rP`O-$p(W,P0-S`@/U'Y1 ? &AZ0 0 AP :[#J P?5#I x@t4 2px 2BzhPY@rUZ0[%J @-DM@ @P- j jBp m>BR* p=Q p>m>BR (@P P rp~AP Q X AP  pp0S00S drdpE~AP Q<AP { $r$p*}AP QqpAP Q?p@0sSL qppAP pQ 0R`0 la`+nAPD `Q .S0 0SQ0 a`En|AP) `QA0.Se00b0SX0}0SO猀^AP Qs00   $5 |t   | ``A-@PU 7UP7UP!A`FFqP ``P 0!Eq1pP 02PO-Ml0 Pp0+ C+ pe p0P㜏㘟|  t0P0 SD[1S 0q!S1=S 0q!S10! R Zq[" X1S 0q!SA001 S'R:p& t  Z0VPt < SJ `.Q  oVyf !0C3Sz1*$s_Ylkq:nmzY\Eg:p}hT\T t0L]qap0PPA(* 3!R̂ \ A 0! Rx ^t0R p <t 0 V1Pt <SC j|h Ѝ  ` 000@<,ADt0 @1CPt0P  t    %[ '[9 P /R  q RZ+  ^x S:pW t0@P0t0 t;0 1<65XPp@0,^0 <P0  0=R  @D%0h0@< D  ^Pp$0Sʀ@"Dx@ D Pʟ !0\VpeS @0 SD P\0sD `0d [@0 000P0S,0@0,0N @` H(00(0C$0Sʀ@"x:@0P06@P0L dSl0 D`00d D0DD 0$0@0$0 0@0 0@(0$S v<Pp=Q j \ LH LXR@0Dh@0 SV<\QH@L^ @0D h@ 0R?AP  $h@` &C0P 0@0?D00H0?L00 v> 0`0 ?d000P0?T00H0?L00/X0\ 00 0$ Rʀ@Q"2"2B S"2"2@0 2 0S,"00x2}$0S"@xr@00l@2/0 S  *($\0<Q0 0=R$ $ @%0c Lh0000Q< .: 6S ^00\$0/,>! 0E  0E $ $Â!2c 0R,,"΃0,!/#1    (  ͌ ( $ 00SP0 0T 'r;b0@P0^@2/0 S *P0 0<R$0c h0000 K; ,:6S \00^$0/.>! 0E ! 0E 0%!E!2c 8P \?H/)L 1!̀/0,0S$00#0S >  0 $  .1A0H L h0E 0C00000S P0 0  V BQ 0_  C00 00S \0 0#+;  +; f= =M S= =O0vo O-Mp`4=K@00=W00 V- 0< PL   ?0\P o 0PP@v> 01? 1000?0 0@  0?0;`: < 0K2[!4+4`0000  000V :0x0P_ 0TPR dPP4`P0S R~ R z R v 0 0E 0AS q ?@$p'@TpET0}Np0A q0^=萝 0PvD HJ0 0I0!|l00R0S1x0R00  C0 (0,' $ QP0 @ "4@RS0S S  x@p X Z 0S0Y|0[x0 Rwt̰ [[<80>C0: :J0p0t 0p@`P V x0S <pt000@@Dp x0@0MPe l  0 0 ^0 0 0 R1 R?Y0 0 0#/!!  . /J㪐 B 0S!0(0S00#0S>0 Av.@ B Q PS000S Q0Ň< 0 rqp  0qpu<0St@T`p VP| 0 ?oR20Sc<00ߍ 0Z<x@r0 qp@p/ Q# 0  pS@#NRp \TPx0 P0,P\000 0  ZR 0S 00@ <x@ 0`<0S 0 0Y0ZS 6  x a x x x xܮ4HZP Ap@;0SD J4)P L@(㏂@"bX02*:"  @b"R0# P!qLPP& @dT0;l70p@6;0xP`؋0@@@DpP ?v  # K R#0P- r 0X/0 U#10">/ 0%)$B@C "!!b0C0!Ϡ \0U͠ @`<!0S @D>! B^ ?  0$oqp9 p@8pይb=;#00:;0S9@̰p.x @p̰[#< 0 "2#@T 0;0 Q  s!P ;T00 ;0S ͠ @<!:00@p:T00:T00LT\@-@ aB֥p;85TcL00P 0 0R/P/ /D ܞ  DP 0 H Sp@-`P P 0@ #  TQp Pp /d X H  P/j.0 0# /P/Px000@-PP Lo>O@ 0" P0 0A-@P @`pP@0% P PPA-`X@@P jNpP@0& P PPA-`X@@DP H@pP@0& oP PP褡O- M` pP8 찟`萟 (PP P oN@ & FP P0S R Ѝz ,/@ W &5 r0p0S4 A-PpQ `@Q P@D 0DB(000S   뜛|@- M`ppPP( 9  ᝬ00S@ 90"S" 0p000S0 7/ Ѝ90"S1Ds\0pT000S @ Ѝ1Ds$ h H  @-@ @O-`P MU PP2S*pPK "P@N P K <10`0V@P6 0nS# =&PP00Q Q mP  K@^ B"  0\Q 0 000oS@d000S dbp Ѝ4  WTR ĘO-BMM@p8X 0 0DP:&PP $ DPr0040P0 C `KP@@'0 PPp 0P0  0PPp p@P$ \zРD 0 dQ`k`V` pP r r| 05P @PP0 PpS nQ PY8 00BލЍP/U ` P 㿡p@C80SS  .PBލЍ .0H 00PPp?  ! 8 P00 0v.h!0 0 0 8D 00 0c.ꐡP`70   ၡI00!7 00 0<.PP{7 00 00.PPo7\ 00 0$.Pd  h L \ О Ȟ , $ -M 0  PЍ -M 0  PЍ >-M  0  PЍ ?-M00 0 T=PЍĜ --( 0P    0/ 00@0p@-P-U@pB7,,0 ? P  5/pܝ0 p@-P U@p*7,,0 ? P  5/p| @-@P 0003/( @-@P 0003/ p@-PU?o@20S 0 003/p蔜l p@-P`UV00P00@Sp$ 0P5/p$ p@-PU?o@20S 0 003/pț p@-P`/@Pp6((0  @p@/ရ p@-Pw@P p 0 003/p( -@- M  _p@(0$003/ Ѝ@ Ѝ/ԚH @-_p@0003/舚 O-$M`Pؤ@ 0 0g(0Sp$ЍJ60 (P@@4/$Ѝl O-$M`Pؤ@ 0 00Sp$Ѝ60 (P@@4/$Ѝ8 !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////ᰘ X | ,   $ Ԙ l D ,   ̗ t ` L < ؗ $0(- C^ 0C$Q :$0S 537$$05 0;A, 0 0#  $0 0@-@$ MP05A05#05!0%0%P$00$0Ѝ0$0Q  S,0 5,37$050$0/S 5<37 $050 0$0/0S/, p@-R@pP$(ASp0$ R05>37$ 5 $ !PpO-0@DMPT؆p 000 \0   C N \0 \%3j?F$0. 4,0 @S 5#37 ,05Q0,0m,0 S 57,05 50,0S R0#0C R00CT,@DЍ%3j8G$0P$p 0\T@d 0S1 `@@0 SS( S R 0C#@ Y0 00 P, Q0Ç0,  0, 0 PX@0S80S ,0 S 5>37,050,0 @Q , 0R0537, 5 05 , RS #0C 0S 0C 0S 0C`V  FV")VU*0FSQONMLKJIHGFEDCBA?><;:98765bV1 ?R/0S, 0 b32 B012 00@l 0 00Q,  P0Ç0,  0, 0Q @RfV ?R0@SQ  b@S9 B88  C# 0c1#00FV 0, Q05 705 5,5, 00 RQ05= 3 7 ,50,P}@f %:u0@$0@@@0TS`VP=0FfR?o20S00:FFRoQP Q P=V, Q05`705,5,Q,0 P,00,0Q  2@ Rj 0Sg [@@  0P[ @  ?RQ0@SN b9 B88Y00@F 00Y-M0 0 Ѝp@-MP`@0 0 4/ЍpG-PRM[  `Tp{PCa@/ P @1< 0p00p. Ѝ80S&  0< 0 p00p20S0< 000@ pp20Sx 20S X 0 @< 200200   Ȍ ` (@- @MЍO-EM MpX@`PFp+( pD0P@&T 0 dD@0PTx 0  Q`  VEލ Ѝ72002200y 8 @-`@M pPJ/P% /C RP$  rR$   0@ P@ rR  Ph 0 @Ѝ0 Ѝ@0rS 1 0 꼊 d $ A-`@#Pp 0P/S /CP @0p S 0 S e (p@-IMM@`PP ~p 0: S X0 0wp IލЍp1O00@IލЍp100ԅ p@-IMM@`PP Sp 0: S X0 0Lp IލЍps1O00@IލЍpk100 -M 0  PЍ 0P 8 Q  8 //p@-@P P`P  4PP u P  p@*PPp-404-0 M  0 ЍЍ/80P --M  Ѝ Ѝ// -- MNP8 00  0 ЍЍ/00-@- M@NP  Ѝ@Ѝ/O-`Pq,Mp;  RP$ Ppp @P$8PX P@ @ 0 PX N ,Ѝ000:Q!0P00,Ѝ<p@-(MP` @k& (Ѝp0 0 0p@-@`PONpp p@<0< 0p@-(M0P @`D& (Ѝpl0Hp@-P@0 @  0`(Npp p@m00@-,MP@Np  @&8 \,Ѝ0\p@-PT0 (M@ 0`Np  @& C(Ѝp|0C-PP@,M@/ ` p`FV`R V `@0@ %T M ,Ѝ00 0:200,Ѝ<p@-(MP` @% (Ѝp0 0 0p@-@`PMpp p@<0< 0p@-(M0P @`% (Ѝp0Hp@-P@0 @  0`tMpp p@yH00@-,MP@fMp  @g%8 h,Ѝ0\p@-PT0 (M@ 0`MMp  @N% O(Ѝp0 P $ Q80 8@-M80@08 Ѝ880/LL0000 0<Q 80880Ѝ/HlP/p@-@0@00S 000 XI t PP `00\B/L00p@4!P,>t0x~ h~ O-PPMt3 0 0 @D ` p@ P P00U tpp0 0C) Y 1ATT00  RF LD@D T\:[ 2 0000~`K L V00 W7 1ATT 0`Fs 0Ry {L 0e 0 B_0SH gL0Ѝ V0  0 J VL 0 @0pHX<0S3 03 ?Lw 0 B(@ 0 B`F   B+LtZ 0 B  BL 0 z L 0 0S B 0 0 b00 0 0 0 0p@-@PKpp p@0RS00 /H0H0p@-@  @PKpp p@040 Q00 0R00 /<0p@-`@PKpT T   p@php@-P X @ 00`KpTT  p@p0O-P!M k 1D`00 S,0H?@@QZp L 10$+10[?Pup , PPDEQ|`0Ap2 @[0S8 0? P PP@[u  ,0 0 L00GC1  00 0P,0@Ѝ Q00 00~L0D0D 0@-00 @T @P80@080,@-@P @P80@080-M0 Ѝ-M0 ЍO-PiMOȡ@̑ر Qp`P P?`K͌V PT?K͌U P?F͌(Z P>F͌(Y P>C͌ 1S PD>JB͌81S P=̌[ wP=^B͌ 0`3@@@ 0S7800PH0`@P@P @P@P@P@P@P@P@(@P@PP@(P@Ppx@PqP'( @Q78 x00C40S000C,0h0PD 00Hp(0LP@ (0a P[ ,0` 0` 0[ k V2 p @T   @T,0[ 00 p @daXh@0 0p@pMP' W 0 V `0 1S@ ,00 0 A1S D 0|0 0?piߍ00Q,,P࠳0A Q X,@<00@ P$8 Z&  B  @R=     pW  PpjW0,PZ  p,匰$ [ !p0@ @pP X 0@0 @RP8<0\(04 0(0R"DHpLP@1H00PXPPL$P0P0 001P0,0P00T0JX0`P `<@@(p08`0P0J0DXKD0T0p`,  @  V f`p[0@0 PU0 PU0V,  @ Pܠ就ZP 0@PCP U ` [p0 @X @X0 0SX , \ @@ , XH0 p0尡_D0|H 0 n>p` p  0W  0Hp `  0V p 0G` P  0U `H P  0Z I P  0Y JЁJ P  0X Kq Pp  0W L^ P  0[ M,00@P0(p08`<@,  B U+@@0, P  , 0T0H 1ʙ D@  |=p+P0(p08`<@0@4  P ! , @PB BZ [ Tb0p㸀`, 0(P0 08@ < DX\V f!`pX3@ 0 P U  @PU 0V,  @ P封[P0 @PP U `0Xp8@(P0@<DX\Y2Z<< ,0pPC`@ U*4 @,0@1  ,Y0 0H 1 DP  |=p}pP`@@0 0 0R> $0SF 0P,00U 0e1$0PS7 0H @ @  Z  @ Z , @ $0Q1B/P`PUP/ Z   `P 0,0 SS,0 P 0`0C 00 `, U# 0 0 B 0!0`S:  0 P 0 0 @ T @T0,00 0 @0,!,0R0@0 @1P``P$P Z  P`$` 0SC 04 ,01 X 0h1 0S3 0 L0 P @ 0T0p00 @RT0 ,00 P @T 0Q1V@` @0P T  0`,0 S\,0 @00C00, Y# 0 0 B0!0@SG  0T 0 0 PU PU0,000 P0|,0Q0PPa-@ p @`p`0P: W  0 `@ 5 0 0R080000SO-`YMq0tcSA P T3? 00K͌0 0u0S3?HPK͌0H0v0S2?p`F͌(0p0t0S{t2?@F͌(00w0So(2?pC͌ 00y0Sc1耍?B͌8 00{0SW1? ̌ 011s0SK1?81NB͌ 0810 @Yߍ 00u0Sl HPv0Sw p`t0S @xw0S pqy0S 耍 j{0S  c1s0S N [ <@-M@ @ 04@P$( ,Ѝp0@-M@ @ 04@P$( ,cЍ 0`0` 0 R/DDQ @Q$00?H/ȷ0|$T0P0/ D @  R #@ R 00?H/P|$0P08 A-D   R'P?HU0`@S,p10 0D C  \(  @U@U #@ R 00/|$0 00ܵ0tP h H ?30 R - D#@ DR<0@ 0D//ἵ|$O-PL4M  0pS4ЍPD0L |c0! 09|@Pa 0`D0ZP`@0PZ0 TOP V@|`@`9P! ?3 R #@ R< Dp H0L |" 00( 29^9`P0S R,@PR @P0 9 R0`SQ4ЍT `@000  0`Pu @|`,|$0 00^Ȳ0`0` 0p@-0PU 0@S  PIpp訲0p@-@P 0PS P2pp0P0% H -? \| 0DR0 0 0R S0@ 00\R  /|$0 00$0 0 0 /GO-,M|R@x2P0`0Vx `":\\ XrX L"LŸ DD 8"吢 唒圂0 00$0 00000 00$0T0  C10l01 0m010p0npp 0@z0匲 0吲0唲0圲0$TX\`lmn ! 1Q0o'0 0 0 0 u,Ѝ|00 0000h000`0\0X0X0T0P0L0H0D0 @000ܰ ( hd0C-pP✂M@ pPP t2j+;0@@ #B*@ @0&`@2 0C @@A3PU C pP pK 0p R\ @B0 @@@N(P9 0 @@@C(P.  p* #p& p0 @0(P  &h000S :3S ЍP ZBT2T@ TPЍh0S0ZpPb CO A-Z`ppP YB&2S@ T{y000 R A谎 A 嫎L1[0@-0tM,@ CS:DkE{] RoBKC[#00:0A+80_00o0 kA{A<0 K [ + A56Q㏊B R 1 R 0S8Ѝ0Q 0 0 0Dpl0A Q Ѝ0 '###|<>*!f><^v@@@?0l 0 S/,?G-MTȤPpk @+(@RT($p 0CS0Sl3XPH$H :k{K[+; @0H`80@ &p % % % %!<%8!%,!#`!#"%("$%P"4%x",%"%" #~ $@!#!#!d""e"#-fh@#`"jlh# nkp{#rKt[v+x;z |:p R 0S (@0800S \ЍQ 82 0 0C '~l J @@\  0(PU(p00Ѝ>A@J@ < ^v#}x:z'w#t #qH#np-k-h`_e|bo_p\rYyVzS{P@|Mh}Jv +,-.`afghijklmnopqrstuvwxyz{|}@Ш K h@\>>@,<=A-'n\PP p  @ 0^(PU 0(`;O-M`6 6006006000Jҽp−00SVF  p ,p PP_ > p?P4S S SV0SpPr 0@p   $ `00 4S 0 0 40 s0 0bR$ 4S4 0P%00Ѝp PP 4P4 $0$ s 00bR 4000P ?21 R R0  ;0k $Q B q 0 ; 0\pP/4 S S040S% 4 000r0  cR$`S ,4051E `v prd0  ; 0, p PP4P0uP0PcRT T4Sz0y$0P s 00bR4S 000V0SYpP 0@  ` $A `00 4S 2 0 yS 2051E ` pJ p 0$ "P0 s0 0bR40 ;0ƿpA P= pi 40 s0 0bR4 4$R2P0$0$ 0Cr?o  aR2$$1E00#?c p p 0pU 4 00 TP0uP0PcR TTe40 s0 0bR41E00#?c0`00$AR r  `R$ $ Q 0 0 0 4 00 40 s0 0bR 440`00T0! P00h PlpOdOXO NpK|JI,@ 0  ;  0@āC/LHO-@PTDM4P0+ 8 `$Qi w :Q|#R3Z 300S 8 pM0@ i0S0:3S X00P00 ! 0*`00<00 ( 0 00З0p@-@P<ppp@D0D0p@-@  @P<ppp@ꈗ0A-PiP @pT $T`0 @@TPp00<V> P@P@P@X@-@'P @!P 7P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o"L: 4: O-P0M(fS`pvpJP ZT0ʍ p 0rr I"Rp 3S(0$00 0PK tTP k 0XS\%$ PT 02P<50 4504S0300SR p0SO 4SI 4S 0d/、 @V㌑T2p" =PT 00@p2Z LQU  P  P *rP ኼᇼoY=t3@x2 P\ 00@x2X>3@|2  Po 00@|2gЍH5S4S 4S0?o20 hD $@$ <% p 0$0(0eX P Y P Z Pp2?;~0p220PX0 0rr H"Rp1XF  P]Z<3@x2Z  Px2?;~0x2V  Px278x2Y P<3@|2Z P|2?;~0|2V} P|278|2t1S0- 4S)xL%R&nZVO  PJx2.#@|"78x2WY~ZA />3@B|2LZV+  yP&x278x2>3@|24p2Z0@p2VZ[ ?C>3@|2*P  ኻ>3@|2P >3@|2 8 l8 P8  t5 0 00`̎00- $ Tx Xl l  \pT 0t 0x|" QRꬎ \:804  P X0 0//O- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-匑\ Q |pPl0@`P QV00` ZP2 _ /0M CR0200pP00 4P 80P ;  Bⰰ +!;`帰 就帱0 B`r㳪Pm㮪@0 <00! 㤪 / / `/ A-@PiPp Pp@p `EPE`0 |2U @0 o 2@ p@-\`P@T 0S1 RT0S@@I0SDp@耆G-l@`pS0 ST0S"Q0S 0ST0A-0M`@@ᐸP+ _ /0@M CS@j0 @ 0K~"  2 0QU  P*# _@Wۍ௺5p}\5, X - LM  R  ʂ0   Ѝ䀈X0 Q0H00S :\@- &o/0 0p@-P0S :@#RA# #p `0:P #c#p# B0:#!BA##괇T0 P-0M 00S ʃ0  > Ѝ܆804  P T0 0//|p@-P:|``p@0@ 0SP0P0:3S 8 L40 0r0 :#p, O- Mppl3 dS0`P\0 *`B'WX p p PT p   r  `R  00/"1 R# @0S S9 SW0C S p2051E `opx  @U ` Ѝ R k  P   Ѝgp P ` Ѝ0 r 1 `R R   S7J @y ` 0  S $q 1lR Q   Ѝ>p   B/oq"`Rm0E00#?c Ѝ 0T0 P00T4  ꈅ111@1H0H/& X.G-@P$c$3`pZ 80$ RG V ʌ3S23SmX " R ,8 hkT0T 00:3S 0 @-ppP`/8kX0X 00 :3S 0- @-ppEP`/j$0$ 000:#Rs/lj$0$ 000:#Ru/8j00, 000:#Rs30/j(0( 000:#Ru30/i 0 000:/ip@-MP@0 PhD`000ss}p 0Sx000 SC q R0 :#Ѝp R 00(00 3/ЍpHi A-MRBP@0Sw RP 0S `b 1 hDP00ppE}pO 10Q41 1`p0V0S  t100V0S  034pp 03, ppqt/'_%ЍP  QÁP 0:| |0 Pl ` A   0 0 0<W 00hh 04@-,@@0S? 00@-$@@0S0 00h@-MP@@ 0S ЍP400   C0 0Ѝ0 @-Md@@ 0SЍ  0R  (00 Ѝ  @-$MzX  p@ M5zSz\ @000:3S Z $z$Ѝ0  b 0 000:3S/@aT0T 00:3S 03@-ppGP`/pa@0< 0@-0 03, ppP`a<0< 0@-0034ppP``0@-PP MP* 0Q@000xP 00 02000*C Ѝ0|P H00 024000* Ѝ0d`l/ P0 0@- M@0:R P% P P Ѝ0P 000 X20i Ѝ0PtP 4000 P_l0 000:^!0\ S0 0 Q/p@-@Pp80pPU,Q (00C 0PS0\@Tp"80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p (@L0pTЍA-PPM Q@`Q00?`FV`V` ,p (@L0pqTЍP/\ , 0 B0/\//A-M`V,P@p (@L0pETЍA-M`V,P@p (@L0p+TЍ@-PP M Q@6`pV00Ӣ?/`FV`V` W 0 @pLT Ѝ(1@ RR( RR T 0 p@-`V,@a Q(0P0C0 ^ S0Vp(, 0R S0/0@-P0PU,Q (0@0C 0PS0 U^00@-P0\0P", 0 BP 0 PU0,Q (0@0C 0PS0 U0\0O-0 lM4P1*YCTb ,P@QC8 @$^;RC 0p0P00@0 0  0P-P<p4S-`0@PP# @ p) ,!4,  [ 0* E  0 4 lЍB 09lЍO/O-0:$M $t00  PU $ ` @Ta 0 `P ֭ W):0`SI   0w@PH$Ѝ@`00S S9 S0PV!W(0004S$ЍO>0 @0S G 0W B20RP  pGP/ V 0pG P bW  P @ G`QO-M00P0SH3 `3S,[*Y> @00! 0@ @00@ TP0 { p @` ڬP @0S  0 `PPEЍ` D ߸P 00 C40/Ѝ @0 T/ P0  0 /400 000S :P /RL0 H0 0S :-P /0 0000TP PR  R ! R! R! R (!R !R 8!R !R  R/L1S/=0 0000TP$ PR  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/<p@-P @@0 0p@ ;0p@-P@y p@p0 Ql0p@-@ 0P00R ^ p@[ p@L;0L0L0p@- @ P$ppD p@:0p@-P@$pp5 p@p@-P | @ 00`$ppT0 T ^ @ p@ @0:0p@-`@P$ppT T  R @ p@@Rp@-P@00S ^ p@v p@oO-`, D | 0P0q00Xp  B PY 0  0CIL0 SP 1 ЍTYS00CS``STZ0JS` ZPZ0 P0C"Z%|0 00!0@-@P`Pp0^0C (,, 00^00@UP 0S 0@//P 0S 0@//P/P/P/P /P/P/O-PP! + 1СD0 , 0S 1H``?c`@ p0 @s'W#갑@W0 8| 0 0p@ P @0@00C W 0 00d0X ?o 2 R0S P 01 //-(^,0R0^Q!R@!1 O-MA0@0S3, @ P `p0S! S#A 00 `0C``P  (0R0 (000C0T0 02/p 0P@S(  Ѝ $(0A-S$p4@`P(0P@SQ Qa ppQ p 0p(0p(0S/p@-0P`@. (0@SpP0@-0^ 0 @ 0 Q@RO- M@`P VTppD0S  00C(000@0 B T0@ 0S `%,0 R@p @ⴀD R`Dp `|ap Ѝ@0 S RQ Ѝ,ܝP ,0՝0P `00V  ppG , B(p!B, A0 T`  `  0Dp4ઝP , 00@Hp`4 0Tp `0Du@U   PB  0SQ 0 0$ PC 00\R =@U 0 BQ 0C R G-@Ph 0pS: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R00 0U1Q0/P00` 0S 0 0V(W ѳ`F`V`0XPU0P`W`V``0 @p 0 $p0PEPUP 0 0PD Q P/$ $\/ P/ A-`PAPQ@P1p0$ VY 10 0 QV$ F 0R U EQpL @10 0 QV$ F 0R U E?p:   0F  Q SC$ 0R U E)p$ 0*$` P0`00BTP @T 80@Tp` 0U0 A-PP0P`00pQ0 0S:@$0P mH00@T 0WP, 0S) 0@- \%@T \8x ƌ8 t ,0@0@PU 0P0U00 S0/0?o2?=X?A-P$@`V0S4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P 0 Q0@ B( `p0,0,0CA@1` :0S( X @- 0B 08SE?080$ 8R  R 00S0!R$R R d1S80080080 O-`QMRDp0[}PPx ሰ P,q ʚP@0d W4) H0X?@S < ``@ `F0+; 008+;B H0|0$T`7 P \ l0 @8*BCЍ㖚P4. ҙP( :"R! 0 RH0SI 0p V0 0 @@  ʨOЍ +) '%P!A-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,BPP D00cD0C 0R p$`!b00P@0RЍPЍ| @-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ`@HP `JU@p_WNVPED 0    PI L1D00S*Y p$`(D0@p`0S00,0UD000@UpC0@aCY Ѝ00H00H0t  P PEP` V IIP ЍP @ |$ 0@-@P0M0 t l 0  B/o"  lPP ;Ѝ0PЍ0 0H@- @  0M0 KЍ, P-00 Q08SM$ 03ЍP8 /-M 0  0N NLN ЍO-QP 0<000DL00 0SE @<000h0S80@0805 L00 R08l>P( 0@y0, 0!0s0 PT% L0 #@?  t@T,0Q0@t@T4000SL0 RT 00S0,| 0Th LLH DR4  , !$  Q$  P  r Q , R  , ,!$ 0  R 40pT@D0|c00 ]p 0SL01H@400 0,0000,00 0Yd0Y 00S 0` S0F 0RW4000,000㓉(0#I0CYJڸP0<0/o"0L0S0 R d 0YP@l00P.P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Xp 0 0S 0 @V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s H  H R 000S9 80 T8( 0`V 00P0 0C S80 @f@0D  LL l80L\ɟ`Vuq 8( 00S;0 5# X0:h2( 8@g0` 024 0 P00P,  p u'00S  @Gp_ 1P11qW@7r<'<0 J<00 00S 0 5# X0:h2b40V @ 03@0S e6( 0pQA0A 00C06lP 0 S/ PP& 11 1R@Y RRQ 0  X %(0 R 00S0 0p!5`F0PAp`P@ 00#?3 1pGW1aFaP `p?0<000L00jP 0P0P00'X X0[P0H0T L0 R {080  400 mL ($4 0 [p`dЍ80k 0cP TD<00 RY 0 R PP!Z k YR  dY $RY  0E0 0pQ  0E  <000$R ( 3@ L000S2( 0<000h0S0C  0 0Wx 4000Vgpg`  #L00 R d1SdЍ40 80@080B.P00C\L0 ^?0SB WX1( 0, QA@`+4`! ,\@XP pp@XP EP0@, QJ   4p@,@ APWp@PT `` |PT \ ؕT؊x@̈l`PTp P0 @`, AV@ TqL@DPP " X @   \`Q  ABQcP P4 BQR p @ p  ,@ 0$8  R p p P p , [!, !`u @@`[m P0 p RPh   $  Q p$,@P08 P LPA\L00 0`, Iy# @A]0,  \' `@0040 b00C80$0 @00C40g0 pPWzp  P,0`  BQ W G 4  DP @ \p 40@ pIY L00I D |"p0TpP:W W0P@ s@DT 0GpG00GD@e00: 40 0Rpp,@0A0W,000C0P 0p00 p0E,0მ P0Ua U R R  W R RR.0 S0@^ 0 R@$8 LD@H ,@NX LD 0B0 B$ B80= 00C 0U40P P0,0a0 00Rh400,@P d1S ( 7@ k <000!R :Q R dP  P@ ``H 0E00p 0E  <000P-,8(  &<0 00G0,0 0000Sy 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S< ` H9( @ 0  `g@ 0 `C0` <000tW + 0 U<`? 0 0LtP6Pj <00p eU \ʕeH5Sp@TL 0$`P@@U= 8#8PP `$=Hp@-P@0 @  0`pp p@*ꀚ0H0H0p@-@  @Ppp p@0000@- 0Pp/ `00p@SL,0L .W @0*S /SR@@00@@@@0 00C@@0`` ؙO-SMБD@ HP 0S p` @ 0Z A 4/  Z8 $Z <RD!  . R !!! > P   @0 0~00  HPr 00 R0S0 0?೥P4/ZWЍ H\r 00 R0S@0刀0pP4/pWȘd Q" @-@M R ! R "R pP^  0 0@aЍ /@-0QM   S S PpP$@4R @ 7Ѝ800- M %ЍM@0<< -M ЍXLp@-0@R P\RQ ^R3 @%c ,R'Rq{ L @RQa0 L !a}0 p  % ?{ R`VD 0 FR;h!@P`   ^0@! cR{E0\R:R '  px @i%L {i{bO-M  zPP 0%  0  S  g ` @s\,S0Td 0@ @  0 S$  QS%S  +0BGSSQPNMLjiIHGFEDCBA@3>=<:s876543210/.-,+*)('&%$#"! 8 0 S{B 00PЍiR%@0 0 `fv`  00S1.R0S*R 0 Sg@0 S[0@0%0dR% @00@  d 0 S20 @0r 0  0 0J0 St00@ s0000  00000 0.0 S0[0@%  0 @  %# 0 Sr[@0 % @0  00%+ %#F0 0@kP0 0 @ r 00  C C0000< @0D@00T0 S\R Z I00 S#0$,  n/  000S0\S 0 S00 C0  4 p@-@PM0P`0S PS   0 00Ph 0 Q00QH  < x0 Ѝp0̋0CCBpBA-M0@HSD!00@0p0S= `H0 z  1N;AƒKa1#bP0 P  8 g=M%02#cQ P 0 pW$P@PW 0fSPЍЍ 0 Ѝ؊ A-M0@HSD!00@0p0S= `0   k<7@ƒCa0#b1 ! 3>C120BQ0P pW$P@PT 0nSPЍЍ0"Ѝl O-M0@S!0 0  0000S, Phqb*cE 0 pƏ⊡ - ?DB%.b CĠ PPЍ 0 O-\M-l`wPPPI P0&040:  C   @P, 5!N+A0 0( 0g-M  0: @Pv 0S  R p$0W% > #W =W =opP[ 0000pPQ  XW   RRl`\xPP U ,00 3mW  .m0SU $@(0 "K%ᚂ!b  P嚃!2c 0P 0 02#c0}0P0 pX00$0PB0P,=p@H@Y 0S`@Ⲁ lw `p`l nY00\Ѝx$p4^(0 ,(k@C3>C lᐡb  ! 120B $P0Q p@00K$p℡ 1(0 d(-8 ?T p -000 Tk@@0A@?SX>T0 p0A0Ds=Q=S9|7I_hm}^0S -00X.00  X@ E0l@! D0 Cr 2;0X'T OP͍ R'R ͍T0   R'R'Rp@p@I@`VtP` 00040tP, 00000V0R 1X!RL 0BS11ऀI PB=&@DQ1VTxvutqqomlkjihgfedcb^][ZYXWVUTSRQPOMLKJIHGFEDCBA@>=<;:987654321/.-,+*)('&%$#"t1S 0C11ऀ, R 3@ RX*P  0Mgp 40P040OU7 =@!1ऀ0100L1S 0C-11PSU #,Q!*P  4 P@6AT @D=AA0@a DrQA DR3@D1@ڕ#0S ?R ;RH p0S %S0 0@a0Ds RA0DS13 DOS !01000@Sl00l0 0St00t0QU PE=@Q1P =OU?=-!1P@ Q @10Ds R-1!ORTP=@1p=1 !T!R   B!!0 @RS^  ?R ;R QeR p0SP %S0 00     00C2"0OQh0͍}SS  0S}S}S@p@r1S 0C1XX   R!#@,Q*P  0>fp 40040@N, 40,qߍ! 1KQ00PQU PEQ1- @@OU=-0@0@P1Q %-1 1OS.00@tP 400@,T 2 sP 400,X (XPPÐ@oᨂPX j@|yvQA@pQA#QU PE!TQ1- @OoBT 2 sPT 400,S000 0 0. 0 n00@200&@D0Q0VT1/.-'*(&%$#"! w dR<*A@00N;!@DOo0B003@000- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/A-pQM@P 0S! XB rP &`V! v00* V U{ ``ЍpPU00c ``U ˥% 0 0 R Ux ཥU`෥?P0S U, ਥ hD>p 0S R s0r (0 000SU00P F  p0(0P wF  p00PnU<h0d X `  $ @  l x  0R@-M  H0S@  Ѝ0A-pPoP U) @T`V 0PS |@P0DpV  NP FoA-PR pQ 00 @`R P0 C C0CP P (&0 ES  qP  0 000Q 0  R0 R  P U Eq0V Q ^`̇QP 0S  0 S o W0C  s0_S0S  0 S  RQV0C s0SPUE P 0$XGPG "# X$@ : 02 0nP< sPJ fPW P00R00V0S   qQ :%pP N@!pPJ9pPL2$ PP q$Pq pP$!W  P P ?V00S    0SP V PC-@xaMt!P`p 0b P 000S; PЍ`P P1 0 p R 0S 0PP  PP004P<Ѝ 0 P @`+`  P *j`PP hO-M Mp0:S*0:SS@ 0PS:S``#E PXP  j;0  0dAiP 0P:S  ۍ Ѝ@ ۍ Ѝ ŸC-P M@M`pttP# 0/SC *}P/gP 0 ۍЍC[0P ! p bP,tlK0P 0S/S }pP 7pX 0{pX P 0 ۍЍC0 PۍЍ p 0RpYW P0L 0 $ۍЍ404 0 $ d L   G-p`@P  ^0@"pT  TP `@P@ @P PU   0!GMM-@- M@00 Ѝ@ Ѝ/+ Ѝ@ Ѝ/ 0p@-S @0  p0000  P S0 p@-@ooo@oo o0o@; 0p@-PS@:pS oP!pn @-Q @fRQ ^nR sRQ 0  \ A- @X p`fS@X P60@P0@nS sS@X@@ 0 0S00@PA-P# P 00`p`0,SS00 0\,\@CmP   `p`@ 9 G-pL@`P P9pWS*nUJ sUA fUH0D Y#R< @ onPF H0D@p H0@0H0vH0nUp@0 H P4 sUC fU; L00L0@P@ XP00W 0 0,00 =m 0S000 0 @ QH0 $H00H0H0@ HH0@, ( H0@0H0H0, 0H0$PH00H0,  O- MP bZ p@ [pY ` T`(080H0lP- 0@   Z0p@   @Y`@  00@Y V0S@P0@ Ѝ0 0@- 0 @S* 0\ Q \R 00\ Q  @00 RER\\x  :Q  R00\YA-`0p @PPUR QmP!0 V0 00pp   0  0 0P>lO-@P0 $M 0fP pm`pV`300 `U m P  p m|PP <oPl0P m00$Ѝ 0 ymwm,`$0V p C,  PY P PR 0S00kPL `V00UmLpD0W@ @ CL 7 fS+ 00   `P pW P`0nS sS Y `` 00 m$Ѝ$00??P}A-P0p @``VR! alPA0 `0 00P 000cf[`FPJk0A-P p@`WR 1lP0 ` 00P 00 0P$kO-TMD0D $00, 0kL;040`P | |@P00PP/ 00lPT fP.b?PPkP  !P2 U 00T 0#$,1P p. 0p0#1(00S% ( .S  ROS= = ᬺ@P 0 0pPu< <00Q4 Q 0/ R$,P0l TЍ# ቺPP9 @ p@t ,0 S Q0S Q0TS 0 000`00,P+X ,ik0S&pk % @0@Sm 5p@tP00 000 000f0 PW ,pp@W 0 W   `i  )\W  R[Y!%P^WPk p@W  0 0C/S Ru  0P ,p\0G| RE G/R{yxwvutsrqponmlkjihgfedcba`_\[XWVUTtRrPON}~pW@ W(&40p  @ p00@%40  6 p`00 L>L00S P P^ 0 Z 0SJ t 0[ 0 00 0000n07pp`i  00 P 0R  S 0Q p`       $ 00 /t 0 S00P?W{ p0<80@PP 00Lℓ^0 4  T800pLS<@PWppp`2 0 0  000s0]P ,pBP p@tu p@t: ,0 Sd Q0S ] Q'>PbTP 7P40  O[ 0 H,p vP00F P p@t0L <00QH Q 0C R 0  \ 0?P$ 0 0 0 0S00P 0 E0  D s 00 0 P  p<@P4S8PPP/$P0 00 //w 0@-M@0 KP 1N;AhLBH gMMl1#b 0 0#% @B4d0!RPЍ0dw P0`0>//v 0@-M@W0 CP k<7@hLBCNCl0#b 2 "0#AB@C1dPЍ0v 1P00&>//v @-M@0 R-8 ?=<;:9876543210/.-,+*)('&%$#"!  " U a  !00 (ЍpP P # U0  0: 0U5!00 P ~Pt D# U0 0 0"dP 0SC !00 cP00200U 0 KP 0Sh !00 cP00|20U 0 a  /PM  cP00i,20U 0Z 0"P 0S t!00 cP00SU 0 " P   rcP00Zʈ10U 0 !="?7D",JP  ZcP00,U 0 " LcP0000U 0"?7L"P :0S "!00 2cP00ʔ00U 0"?7L"P  0S !00 GDBP(lh\cP00$00U 0"?7L"P 0S !00 cP00ʈ00U 0S 0"iP 0S !00 cP00600 0a U  MP\  cP00$ʔ300U 0 ;P 0S !00 cP004300U 0 "P 0S y!00 cP0020U 0"?7L"P w0SI _!00 ocP00p20U 0"?7D"P  \cP00e(20U 0U"?7L"P J0SQ 2!00 BcP0010U 0"?7D"P  /cP00|100U 0 [ P 0S} !00 cP00# 100U 0 m P 0S !00 cP0000U 0"?7L"~P 0SB !00 cP00`00uU 0 fP)  T0 Dt$DcP00400U 0"?7D">P 0S !00 cP00ʘ00U 0y"?7L"$P 0Sn {!00 cP00?00U 0/"?7D" P<  xcP00D10U 0"?7D"P  ecP00Lʌ10U 00" P T0S <"00 LcP0010U 00"c P ;0S #"00 3cP00^L20*0 0Ra U  P  cP00p30U 0"?7L"P  0S !00 cP00 30U 0"?7L"P 0S  !00 cP00#ʨ20U 0"?7L"iP 0S !00 cP00D20U 0"?7D"OP  cP0010U 00" =P 0S "00 cP00ʜ10U 00" $P 0S {"00 cP00<100U 0!    P z0S b!00 rcP0000U 0"?7D"P `0S H!00 XcP00 p000U 0d P F0S .!00 >8XHdXcP00000U 0"?7L"P 0S" !00 cP00ʔU 0 "T P  cP0000U 00"8 P 0S "00 cP00810U 0y"?7L"gP 0S !00 cP00ʜ10U 00" NP 0St "00 AP 0S !00 20 a U "00 x30p30h30U 0?G"&t"00 430,30TU 0?O"c"00 s20U 0?G"4U"00 e20%0UjH!00 X20[20rU 0?G"7"00 GX20P20U 0?O")&!00 620U 0?G"i"00 (10Z10jU 0?O"!00 10t10U 0?O"!00 p10h10`10`U 0?O"!00 ,10$10U 0?G"3!00 00$U 0?G"l"00 00]00U 0?O"!00 00x00x0(\X@ p(<8d,4d$TU 0?O"fr"00 x00WU 0?G"d!00 t0000r00Z00U 0?O"J!00 Z10t0U:!00 J810U 0?O","00   4O R 0 S. o+7N<$PI@'Np LA0P R $ R  R S /0?0P  ,AA40q@aRA- 3 8S1R  -P@. 0` S ($ R +3/PP P4?p@8p0`P $0(3/p@  $ 4  (0 0```0 P 0S $0S 0S P? @4@P/Q Q@ \@!< < /<0C//?O- 4M00,00P 0S0 `0V0  ?/P00{p=?0U[ 0PEt@T7p0pp@>?00SA )0??000CS?0S 0@7sN?0 QP?0 C0(0 S@p0(0g( ;?O2`5?0U 0PEt@Tw0pS =0%T0PEt@TU C0 ` 0,0 SP0\$ @Dʈ7~+D?q@D0D 0B $0Sp0  0p7?@06'8w<#0#Y 020JK?HL0.0DSB?0i @p  |2060q @DS30P0;T0X0CG?0 C 3q@D07~D@N s Pl0{1r0ರ^l[0PEt@[UR!B"0$ 8 S 0l0S>0X p0P0tXp0  P 20 :@j l200@p 0O?0( (pd,20E?l 0T[l0PEt@[fU0 C00St 0 0000 ~$1岐T*Ul $Ug PEt@1岐^ 7sQ0D @C7{D7~D@NqKI?L0e$0SW$   0c@6?p0 (rt0p+@P7~@DL 0@Dⲷ'q"@p K J D<4<H0F?l00`P 000/ S  bP00S  ) &0S R?0P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000 @P`^1@0SS/Q  < 02!0C 0  S"$0M< @0 QG Q0c  B Rp#p2W S Q6 00S/Sa @0 < 0@0S2!< 0l0^pP\ G R R 0c ^  R S R 00S  0Spl0Sp0p0C0pp*x 000 0P,0C4p??0x p0 0 0 30 Ѝl0Spl0@@@lbpP 0S $0S 0S P?,A4 BR/A/Q /@o/A-5PXPv@ 0(+`3/PPs 8pWF ( 0(3/pP00@a  0 Q    +NP04 S:oSS0C0P0T00C0T0p0W0Cp1 (0 8#08pPp00Cp0@0 0 Q    +P04 S*p00Cpp$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-R|MP  80 @ 0 C 0xT0SC0p@X0s\pW0-p  p0 |Ѝ0`\`V30sBJP:P0u;J XS1ZP05 0Xs00R 0xPS0RSCP RT@!T0!01 00P200 0! P0S|Ѝ0W0P0S |Ѝ0@ ?o2,0%R00S020(0@0$00($0,0@?o 200040C0 0000p@ 0SP3:^N $ %30!`P3P'( %!<: 80C1 ( RP@00F#3 0Sx $Q Br $ARVJ  ` V  \ F C 0 Z(  V F*x $R AR  BR ^: 0 Q  R`, %Q  RZ  ! LAS4 @@  010(0! 0, 0( $0XB h? O-p04M0C000 CPU?PU@PUA0PUAPR@oPP 0C R R0 PR \:0S@\!f!glU!1^  RX  p\h$X  p\h, Rl R O- M`؟ 0P0\QpY 0@SQ QKW0 S  RE R  R( (pQBWR BQP"S6Qt0S R: 0S S > 02#03/0@S0P P0W W0S0(0 Ѝ0Sp>00000 S *S0SWq00Q R60@SP20 W0Sq S00U0 00#400 03 0  0#400  0 O0S0c0?o20 Ѝ0 0S&+B(l0S0 B8@ B0 #22c0# 0l0S q000 R0e9S 60 0t0 0  R ,00S0Q01$ QP0 R1 2 00 00 0#400 00 00 S0 S 00R01 00 00 R  00 0#400, R E  Q ! 0P B R PE [ P ! X*H 0 ,0 SR B000 0 0 0 0 0 S0 S 00R01 q00 3 R}0ES IS; [S3 gS3 #0S0Ck0Wi  2RC0SS@ S  00 # #8 00#"0  0 ,  Q R I   R'   0P P0S0  0 P,0SQ4: R 00, R  R [  $ R  9$ 0P P0S0  0 P,0SQ: R00 B000 B000,0S+  Rg00 0 B000,0g  S  0Qf R00 00#40w0q00N0SZt 6l8&`6 &!6ƅ909&tl0QIt0l0" Yt0SWe :W㴖H 6SX \0l S B8 0 l0\000SFK\ R8 C0 l0\000S90 Zt0(l 8`R B  ^C 6&!6ƅ6ƅ909&6Rt0l 0Ct0 l S$t0 SW S Sl 8`0  W 0S0 B000 ^ ^  [ [ [ [ [ [ [ KPo᫲[@ ``S`051:P&0@ƅs04!ƅ0 0!1001  &6`Rt0l 0C` t0l z\0S B80 l0\0-00S=r#  #800#"0 00_t 0+00i*W6F &RA \ R80l0 C0@0,0g 50 0 005 B0 00L0D!C0C  ἦt0S*l0\06\0l S B8 0 l0\000S201\ R80l0 C<:86420A-`pPSq@PG Q00V0SH81 0P1 : (0sQ Q P00 00000 |0 `ap" 0S$t l00\ R6S S L0D C0 C;060P5#0SppꐦPp@-@.PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV00PpPO-M`pH0S@DL 08Q1S00PP 0 0S $0Sx wpVoV`F0HSx0FSRt WrZpFYo᫲[iV @(& `4/@Pn  J@0`A4 ,P*   L @  ` B (6/, ` 8(6/L ` @(6/j 0 D(3/80S6! ( @ R% D PR! 00C60p删$0ЍOxv `fh00$0X(0 xЍ",0  000!ꬷ-M 0 @ЍA-P=PUPn`0@0 0 Q    & 0(3/@PR &@zJ 0, (P3/ 0, 8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 , @@ L DD &!0 0C&006 0&;> 0$0;/ O-Q$M R0   0S!q"$!`Pß@P p`0+0*) `@$z0`&@!y0v0 qp0Pt0A1:SuPPQ "9SuPQ(6SuPQp'P5S>3uPs01+@$ "@QP`0.,Ÿ  "rQ"$ Ÿ! ! q R!   "  "rQ"$  ++ { R+! @$ $rQ"$ S4\@`Q@DPQT`&Qv`a"$&P%uPa PQ"d& Q,| &, "r a Q,d& QP%uPQ&T%,| a Q%d& "r Q&T%,| !%$"C0S 0!^q"$!$Ѝ LÁ!`AV1c/@ptd      P  D C-PRp cmN P  0!\00#@B .P @N1R C 0 @$' C-PRp cmN P  0!\00#@B .P @N1R C 0 @$' @-@P |p S]Np`@` 0!đQ00#B   @-@P |p S]Np`@` 0!đQ00#B  H 00@- S]N^00# @L   0RG- pe Q RLuRnq@W-@He_V @0@0\\ 0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 R 0ɃP 7ᕓi΃7nP"R 0Q ?Yq00H/II7c ? Y?II^NNPV=H10C>@@ P $B0R pR 0`RpR`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0 R`0 0@0@0C 00 Q q00H 'ᑒi7n/0R#@-qHp@#/Ǡ @ V  CJQ-{ O0pG֒\0 P4 @ B^S 2ʵσv p X`^ 0`!`P4[ ఐ`G&f B&S`p 0   ]pWPQ=000?10 K`P02  `;I`;Tt !GXTT;0 X0\s0~060v000 `k%[`P`+ZGp 0`K< 0K⳾0 F 0 p@R 0 q0CR Y> 0 BV0 00000C05 `FR  = 0@N @0 0T00 0SQ R 800S@BC0 R 00Q<ЍP  =p`w\ / !02NX1@[ @೰6:#6\Y I 0 pA-P@`QT0R`PE+~P p0T S#|T` 000U0 S@S |jT00 T-`0R V1|T0000` S +-T000 0`0T00 0``0O-M@T00R!+Z+8ʀP c W ~㸐|㸀iQ6s0 `IP000P#406`0cXfx0Z㼊PḀeY6Ps0`PE000`#406P0cXx0AUVq`U0uPPPP0`#406Pc0CQ6T T0P[Q p@`DQoob`V Qf0W Q@z㷀+}hpY6`Hs0000#406`0cW3sp VfPE0Tv`wppp`0p#406`c 0CUVP6AP0[Ѝp尀 phYp6`s0`H000#406`0cWsw0 Vf[ PEpTf0v````0p#406`c 0CUVP6 P0jP0e觮  P`6e@pE SC0t@0P@@@0PP#406@c0Vdv@Q@645P0V/0P2 `fP, ATq6`f0P0pAT6qv`fpP0bv`wp>ʀO-f6M⼖S0 #`P  #  # #  #  A @b9 Ts0@ Bp000@p#4060c^~00἖&R @ P$ p฀n9 Zs0 N0 00#4 060cXx0qX xq@DphWt@>挥s0pH000p#4060cTCt0 BR@@@CAԕBԅApಐpiX>s0I000#4060cWsw0 0@༖^ hD B@n Tr 9s0=@Np000@p#4060cR#r0&0R἖f b ^9 s0@P B0``00@#4PP06c Qq0&0Ѝ0἖=0἖9X L @ 4 ( 0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4j>0C&&0蔁A-@ s0`P Q!r  pp "$  a AS2s 6  u0U0U$0Q  00  0 ԓ000*0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 S0q0@PP0#4@@06c 0C\| S600@PP0@@@#406 0CS6 S0ظ0@@6 0C606@PP@@!PPƂ0O-Q0  MR@, R 0p&]P+(+0O p ! RDAQ j  &!R:P3 "[y6 S9p3 s0000 #406 c 0CPp 66 O.V G.0 0R0 0xS0  0LS4j>X0C&&, Ѝ O  \ P+R +R ,RE R  Q ,^ &]R3 "[jP ЍOPj 0p\ R3 "[&0 Zp:s00 00 "$ 缦0j JP3s0 Z㼦,N(r :s0s00 00#40缦0j JR#r0{ Z㼦:s0s00 00#40缦0j JR3s0 A Z㼦r :s s00 00#40缦0j JR#r 0 NΌ⼦  Z*r   "$ 缦 j JPp \ ἦ "   P3 "[A r :s0cq#0r  | :Q0@-!DƓPV ƓPV @Ɠ@F !6@o0ƓAQDƃ<  Ì!!ܕ"܅  0S A-@pP `0 C 0@WTUT @,'P r&/@- M@Pp*`P `幕 P    Sp 9 @P ЍU @@ ЍO@ ЍJ@9T  Ѝp@-P{*@P @@㈕p5 00p@-@j*0P 0x000$ 00!p@-MP`V*@P P @c 000p v9PЍpPn9U PЍp0p@-S P@ `0 Co0@T 0 p&y1r1FP@p%0p@-S P@ `0 CJ0@T™ 0 pj&t3i4FP@p%0S p@- `@P0 C%0@pT @圙pp/0S p@- P@`0 C 0@UTp.&y1r1FP@yp/l%0S p@- P@`0 C0@1Tp &t3i4FP@Up/H%0@- M@ P 8p  @P Ѝ0<@ Ѝ07@ Ѝ00@- M@ P p y!r!F@P Ѝ0 @ Ѝ0@ Ѝ00@- M@ P p t#i$Fp@P Ѝ0@ Ѝ0@ Ѝ0- M Ѝ- MtiFx Ѝp@-@P%t3i4FPPpp@-@P%l?o2FP p00pp@-P`y@P  0@$p@-@c@ @-@]@ @-@W@5 @-@Q@N @-@K@g @-@E@w @-@?@ @-@9@ @-@3@ @-@-@ @-@'@ @-@!@ @-@@@-@@&@-@@;@-@ @K@-@@`@-@@u@-@@@-@@p@-P` @P  A0@/$pp@-P` @P  /0@$pp@-P` @P  0@ $pp@-P` @P   0@#pp@-P`0P @P  0@#pp@-P`} @P  0@#pp@-P`k @P  0@#pp@-P`Y @P  0@#pp@-P`G @P  0@#pp@-P`0P3 @P  0@#pp@-P`7 @P  0@w#pp@-P`% @P  w0@e#pp@-P` @P  e0@S#pp@-P` @P  S0@A#pp@-P`0P @P  ?0@-#pp@-P` @P  -0@#pp@-P` @P  0@ #pp@-P` @P   0@"pp@-P` @P  0@"pp@-P`0P @P  0@"pp@-P{@#g>t3GP pA0P 0pp@-P`@P  0@"pp@-P`@P  0@"pp@-`PF@K#aaFP pP U pp@-P`}@P  0@s"pp@-P`@P  s0@a"pA-P @#g>t3GP p<4`P  P `5p@-P@"g>t3GP p0P 0pp@-P`@@P  20@ "pp@-P`4@P  !0@"p@-@R 0@"p@-@ P"l?o2FP p00pp@-P`@P   0@!pp@-P@P "!0@!p@-@ @" @-@ @9 @-@ @P @-@ @i @-@ @ @-@ @ @-@ @ @-@} @ @-@w @ @-@q @ @-@k @ @-@e @ @-@_ @, @-@Y @A @-@S @V @-@M @f @-@G @{ @-@A @ @-@; @ @-@5 @ p@-P`@P  O 0@J!p0p@-P@P  0@9!pp@-P`@P  , 0@'!p0p@-P@P d 0@!pp@-P`@P   0@!p0p@-P@P A 0@ pp@-P`@P  0@ p0p@-Py@P  0@ pp@-P`0Pf@P  0@ pp@-P0PS@P 0@ pp@-P`B@P  0@ p0p@-P0@P 0@ pp@-P`@P  z0@u p0p@-P @P 0@d pp@-P`@P  W0@R p0p@-P@P 0@A pp@-P`@P  40@/ p0p@-P@P l0@ pp@-P`0P@P  0@ pp@-P0P@P F0@pp@-P`@P  0@p p@-P@P #0@pp@-P`@P  0@p p@-Pq@P 0@pp@-P``@P  0@p p@-PN@P 0@pp@-P`=@P  0@}p p@-P+@P 0@lpp@-P`0P@P  ]0@Xpp@-P0P@P 0@Fpp@-P`@P  90@4p p@-P@P q0@#pp@-P`@P  0@p p@-P@P N0@pp@-P`@P  0@p p@-P@P +0@pp@-P`@P  0@p p@-Py@P 0@pp@-P`0Pf@P  0@pp@-P0PS@P 0@pp@-Pg@Cg>t3GP p0P 0pp@-P`@P  v0@qpp@-P@P 0@bpp@-P`v@P  V0@Qpp@-Pf@P 0@Bpp@-`P@aaFP pP U pp@-P`"@P  0@pp@-P`2@P   0@pp@-P @P C0@pp@-P @P 20@pA-P@g>t3GP Ip/`P  `P `91p@-P@ug>t3GP p60P 0pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@tp@-@Q 0@j@-@R e0@`p@-@0 P 00p@PP#0S  #p #0 @- @@" \ XQP 0R @-P Q [o//\?P?P G0t 0 @-| @-P Q @2@ f<0< 0 ( g$0$ 0 ,   0S p@- X@P`@@PpP p@ ( OOA-P`p[# .@P  P` `pph"ԅP` _"  0W" `// POp@-P @`_PpP p@@- [.@P $ T0 0 0 4NA-pP H.@P"  A0 0 0 壋P7.`P  =` P0 /,0, 0< 6@MT X @-@P @ f }0 0X l -A-M `V $P 0P @P-pP  0P  =ЍAЍ/ЍAЍ/ U0 0t $ <  x@-@P 5@  }0 0X < p@-@P x0 0 0R0 P-0P Q }# p@ppK9p@-@P `0 0 0R P-0P Q [# p@pK89P/0 0 0R /JP/<0 0 0R0/P///xJ8@-P d0o0 0QP  00SQ #J88P/0 0 0R/I@-@P \0 0 0R   -0P Q "00pI7P/00 0 0RP///HP7A-PPM 0/o0" 0P R Ѝ R0 p 0 p,`P 0 S  R @  `P P.  00Hd6X6A-@PM 0 0 0R ЍQP 0  0p,`P 0S ` P `P .000( ;$0$ 0 lG5 X P H0-0/o 0"^ R  R/FP/D0 0 0R /@-P ohF4P/D0 0 0R /@-P o FD4P t0/o0" 0\ R RP Q s$Qkf O/E33P 80 0 0RP YVf O/ Ep3(0A-SM`.P@U Ѝ0 PP +pP 0 0 0P* S'P0S0"Q00" +@P X 0 0 0 @Ѝ( ~P 9-CP 00#0 0 P 0S S R/P/ R0/  @-@ @\h V0p@-S(M- @  S  P ^` `YP rP (ЍpX  (ЍpP@  ?(0$ $0 )BPp `@- @,@-$@@A@- M`@p5P P0P!s* 000 Ѝ0"S@- M@Pp` `"$qp  000 Ѝ0"S 00 S 0 P :\03#/S 0 P \0///A-Pa`iᝁ@P {(*pP  nᄁ@P f,΁W@Z, M(0( 0 ^`?L p4 00 S 0 P :\03#/S 0 P \0///-M 0  Ѝ-M 0  {Ѝ0@-M@P0  @0nЍ00@-M@P0  @0aЍ0@-@P ,0 0 0Rp= /P/0 0 0R / 00 !S R!* R0:/ - ^0 : 0P0*  R*/@@/ / $=P $0 0 0R //<<P $0 0 0R //<P $0 0 0R //;P $0 0 0R //;P/`0 0 0R / 0   \ /!s00/S :\;P/`0 0 0R / 0 ɓ \ /!s00/ S ::P/h0 0 0R / ! R0* /0- ^04 t:P/h0 0 0R / ! R0* /0- ^04 9P/D0 0 0R / 0  R /|9P/h0 0 0R / ! R0* /0- ^04 $9P/`0 0 0R / 0   \ /!s00/S :8P/`0 0 0R / 0 ɓ \ /!s00/ S :48P/h0 0 0R / ! R0* /0- ^04 7P/D0 0 0R / 0  R /D7P/X0 0 0R / 0  S /!s00/ S :6P/X0 0 0R / 0 S /!s00/S :6P/X0 0 0R / 0 0 S /1/R /6P/X0 0 0R / 0 0 S /1/R /5P/D0 0 0R / 0 R/ /<5P/X0 0 0R / 0 0 S /1/R /4P/X0 0 0R / 0  S /!s00/ S :x4P/X0 0 0R / 0 S /!s00/S : 4P/X0 0 0R / 0 0 S /1/R /3P/D0 0 0R / 0 R/ /43 P H0-0/o 0"^ R  R/2P/L \ /  JQ\/2P/L \ /  JQ\/ 2P/P \ / Q/S/Q\/1P/P \ / Q/S/Q\/\10PS@-M ppP ` F Ѝ@( RP +B 0R xR#  P 0S t P Ѝ P PS O-MM(@P p$`D1000000  00[ Q`$ 0`;/0 `+ 0S Mߍ cP 03/P 00$ 0:/P 000  0SMߍ@@p@-@0@02APLs07LUa`L~0 0LWLP V~u0|0 ^P0ppO-KM PpO03@0 0 @@@$@@@(@0 0Cs0S[30 0Cs0S[G 0fSI W"S_ [Sz 2 0 @3/P 0`00S 0  0Ls0SR3 /SU p,p`0 S S   S S/S >S S 0 S S FU  RbP0/S4 0(00>S7 S> 0S 0Cs0S` /`/OR3 0As0SQ ` 0 S S/ S- (S 0 S S%`FV0S pW0(00>S`0   $ 00 0 ] S =S`B`0"S0S   0"R R  "RC$ >R|0p G-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R@" tR Ѝ mR8 pR oR sR ;R@' ;R@< tR ;R@>P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮fk]\"R /R@S00S@Ѝ!1 0  0 8Po 0 +r  R7* R0f* \Rc  uR_ #PZ p  RU*6+IP0%0R"R    H       SP Y/ Yy  ͕ 0  YY#*-"-   )&  X$O-@-`p 0Gs0S OQ3p 0Gs0SQ#YWS S @0  M$@ 0S>S 0 @>SSS @@ @pP (0SP  R @"$W' W0S@@W@$_PV `EP @P D :P0SPT` 1G-`-M1dY"@PZ ,ppQ UpQ 0PH h```SI# 0 p hPPu5   p `#Ѝ0p hPPu  000 hp#`|#Ao/A-PP "P`p @!@Pe#@@!@P p40,p0P4080<08  @-u@  @-$@@x x@-@@O-4@T ,p ܀P @Dp@Ѥ@T `P煑Q@0< <0 ^PZ PZ P` t @-R 0P< P 4Q ,  D )@0@ 0 ., (0( 0 % М p@-M@4 00R0SP,0SER 1`V- P` 0 0zP 40, 0C40P% &`ЍpS' R"^"Ѝp Z0 0D p yl0l 0D X cT0T 0D @ i<0< 0D 받 p Lh t(D A-@`,p!PP W 0 !y,P0`C",P0`C-`0M@SPpD  mP)"00Ѝ!0 QP ,0ST !0 GP ,0S(0S0 0 0'P 0S>0S0"S0:S  0}S "S000"S P  P d @@ 0P !, (0( 0\ t X0p@-S \  Q @PtPop 0 0  0S 40 00$  0  0 @-d t40@-S , 0C40P @ @ <0< 0 ( $0$ 0 L  ( 480O-M@ Ѝ@p` !PP @ ` @ЍȒ ^ |vPP0 t004QY  4 R] , 牡 0Qw  ~ P 0YIW  B B!2f,0 P 04 `<0 4 0<0 D|P,UN<U8U+bY&  ᔡ@ W +P ( >vPP) N 0,S<SS> kPK @, <0P` 04 <0x<+! e,0P evYP {,x 2t0t 0F/` W\0\ 0,H D0D 0 T  | |p@-@PP=0S L  Q<0  0p@. 0 0K/ p@-@P 0`0V}PP p l0 0 0@S<0  0pPp( $0$ 0K/h8,T L0O-S M@PR z`40SM x `yP@ Ѝ\P pP 00 0Sq 200PX 0S. @0R*  P# [` "P 0 P 0S 'P' X H` ЍO@P 0  03/P  40R 1#PP 0 0U/N 00C 0P |`<@zd `0` 0U/L H0H 0]/t8 D\  Ld @@@-`@u0,S<SSR 0 0 ؎ 4PG-V `p0VSV@P8 404 S `  S` E000!,0 000,00$ 00, ,0P ?o 2@ \0S0S P`P :  404 SS`  `D !@0@ 0c/=, 7(0( 0c/4l 0  G-PS @- Y`' T 1p 0R  F D 004 00R% TP 3 0S 0 Gad 1`0` 0i/0,S, (0( 0F/<   $|A-@P-& 0 0R!p;4P 40S P,0aP0#   8 ,0040U:8 408 0P 4  Q@-P80080/Dp@-P@80080p@p@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P00S@#:p@xp@-P@@pA-PP 0 0R4p`40S @40S ,0@ PW `A-@P 0`0VpP0S P @T @ <0< 0]/@@m4D A-`P /o0P0"Q@@T @0R pR \@P @T G@ 0 0]/x\ 0P \@- ^ 400\@/ 0 0F/ H0P @-ox@ T\ @\400\@/ 0 0F/4@ @-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0Rp@ S*,P$1 B!b400C40<00<0r p h ud0d 0s/9P vL0L 0s/08 w404 0s/' h 4؄ $ P/4?o 2 R0S/0@ S/0P D- ?o2 ^0S 0 SO /P/0 0@0R/P/0 0@0R/T P H0-0/o@0"^ R  R" /( 0S /A-`@PpP (0Sp 0P  pA `P `Q4O-0S@9 0@S7  ` P. X8qPp@j P d P ^ P HPX0UUUB#1 !0@<  ?,BI PO 0s 0 MX% X@0Pp#r 1yP7 0 03/P0  40R 1#|P' `P 00C 0\P  @ꀐ pG \ X0X 0 V8 404 0 JHX(\l Ч,l 40S 0C40/ 0 0 @-0k 8$0p@-S \  Q @PPp i0 0 8Dk \p@-@P 0`0VPp0S R<0  0p@cD @0@ 0 , w(0( 0 j j SG- p*W`@ V 0P 0R `00 -\` 'V 0S  Gw@ <0< 0F/`0,Si A-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p@-P80080p@-@P 80 0R@ pP0@pp@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P00S@#:p@tp@-P@*@pp@-P@~80080p@wp@-P@r8@o@@pp@-@P 0 0R`P_40S ,0AT Vp@p@ a0 0O/pXf A-@P 0P 0R Pp`28040S ,0X ,0QP<00<0PFPD @0@ 0S/, (0( 0S/de @e p@-@P H0 0R@ p`P@pA-@P1 0R`P4P%80,0!qW&  P  1P ,0P < 0@400<0AkAD @0@ 0W/2, (0( 0W/)Hc d(c ء0P D- ?o2 ^0S 0 Sf/0S /p@-`P@qP (0S p p@ ` B D0 //@-JP0p 0 c O-IMP ? @T `p0 R 2/0J\ P Y  9/0  pfPV @T!1 0 003/Y@ 9/T IJT T @T@" 000Q 1/0GJ' P70S+ 03/P. Y 9/!J@T 0 0( ^ 0 0 UIߍ 0 0( J 0 0( AY 9/Z 0 03/X T0T 0( .b La xDa X a ,xa Т,a ԢP0/O-MM(p@ T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT0 00AP $ 0R000 Mߍ0 #,0, 0H R004_  0/0/@-@@zA-PPMp`2 0S/ n@0U  UU 0 B/P 0CU/PU  U0 0 B/Q 0C#@ T@! i;@04D .00m 0 R* 0 0@p@  V xr0P@;prPۍkr?00@ۍS0p _`])p p Nr0P@ꐟ p@-R 0@S PR :   Pp0P  ,0 `09\ \0 L0:H H0 80;4 40 p\ 4l\ 4L\ p@-@Q PPpQp0@-S MP@PA` Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPUt p0 ?QQ Px, (0( 0 댜PPY ܚ 0S p@-P@ @Pp 0Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ #0 0@ W $0p@-S+@PPU Q PpQp<|Pp/uP PQ mP Q>p@d Q0 0` oV 4$0p@-SG@`PU Q Q EP<@Pp PU Q 4P QPU Q 'P QpPQ P Q/P >p@  c0 0| 8U ԎĖA-PP4 0Q`pp XpW*@P&  P N 0VC p` 8/PP`<``Q# P|P P 0S $P P PPL H P P 0 lT p@-P@PP "k Po0@6o@p xw011/@-@$Mp`PP P1S$80 02P m C$Ѝ P 800p`P10  @80A4 40 U$0B 0 Md`S |@S \@-@^ P ^%QRS  T00QNRS"  TŒ 00 Z0 0 HR ē\G-@R(MP00Q P 0 ` p Pl `m0T?o20S00(Ѝp`0 d0 0000000 0 00Q0/0 0000000 0 00P0/ 0-2/    S-0 2/     Sp@-@P(MP`/ 0S, R00i$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  ZM P0V00(Ѝp@ R 0S V00XPQ0 @0/@-@p00T0Q0R0St@-@T @-@T000 000S/@-it000 000S/@-it000 000S/@-it000 000S/@-i@t000 000S/@-it000 000S/@-it000 000S/@-it000 000S/@-i@t000 000S/@-wit000 000S/@-git @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^ \#踒d$0 02#/ԑ0 00#/ḑ0 02#/ᔑ0S@-@1/00/T0T0p@-@ P`0S PpDmpht/4000 000S-/@-h-t@-000 000S/@-hTtAo//- M0 vH0 Ѝ- M wDPp ЍQ0- M Q Q l 0 Ѝ H0 Ѝ^ B$0C/0(/0$/ M,Y>+,0 m @Ѝ/(/$/R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@l P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@P'0$'^H1H 000D000@^&T P #j0S pdp@ g g  ЍKoЍ @j0@ 0 g g g@<<,O-Mp`@dP-TPk +T @`0Z ǿ  0_e 0 We P ! @00Ds \a0DSW0DA0DS70DWUX: QP S \ jP"00 0U00S 0pS 0F0 0 Ѝ0S U0 Ѝ0T W 0 p@0` 0 XR 0AA B PR W 㙉 㙙 p噉I㙙A p`@Wp p~BX0R"\0@-0 M@ 00 Ѝ0@I@PiT00P Ѝ0p@-BR"^p@5@PiT00PpO-Mp`@dP-TPk +T @`0Z ǿ  0d 0 d P ! @00Ds \a0DSW0DA0DS70DWUX: QP S \ CiP"00 0U00S 0pS 0F0 0 Ѝ0S U0 Ѝ0T W 0 p@0` 0 XR 0AA B PR W 㙉 㙙 p噉I㙙A p`@Wp p~BX0R"\0@-0 M@ 00 Ѝ0@I@PhT00P Ѝ0Xp@-BR"^p@5@PhT00PpO-M@Q`@0@HP8U00B PR"Sa,1,!0 000S 0:S 000+ C#F00@te ` p 0 0D0G0Z10X,(\\\rp\rx[`[@[ZtZLZ1PЍ0 Qp@-@ .T00QUPQ/Tp !T00QUPT00Q-1@R !0/A-pR P@a@T T0 1 !3/pWG /p@-@PT 0p@/p0@-Q-@M4 ߊ- RPPpP 0000P@D0 Ѝ0RPnb00A--@P`M8@ߊ-DpPF T0䏊$ U V2 aP@`P@oP1 0 㼀0p 00D $@,P(`0ЍV `@`@U V `P`Pt@@hPP\PX@P@b00Ѝ\8X0tp@-@0`MP1S ,0S  X$0S  X pЍp0@-S @8S0 P @0P B0 0001 1 00+Sa 0 p@-@0`P1S ,0S  X$0S  X Appp@-@R00C0S0 PRpP--M  =@Ѝ Ѝ/ -- M0 0? ЍЍ/0P0@-$M RV P@0S$  S"\  B0!0 00 0$Ѝ00\L0 @0 P /0S$  @G^tl]FP 4000S$/00//pF4]TF]A-`d!P`1P 8M00400. @  Q ^  @2 bWO\pU 0 0 40 30/8Ѝ @;\Up  EW@p@ pW ^P\ 0 P 0 @2\p(@p@} ,P@r\\ X- M# ЍA-!M@8!000 404 1pP0 0<804pft0P 0 0 <8 300!ݍP 00 Bp  g~PP@T Cn`4 P8T;tP]P @T@>~;~ t( W0!A- !MQ@`0P0 <( 040 004 tP>44p ptP2 P0 p B p ~PP!@T Cn`4 P8TsPI]P @T@0S x }\ H0 0 <8 30 !ݍ400}$ $d`U[Ȟ^^O-FM M@$ĝp3 0ZT0d40X (`d 0F00;&P0S 0F PU 0 P(00B`P =$PvPq$1Uh ,Ph((,&{BP $U , VY "2 0 d4 30Fލ Ѝp 0P1`P\P \P: / BqP@ @U  ;=`W= WI 0! 0 0`0 70 {.Ptto"0$0SP / q@!0 P  00! `0 00 00  `0 00 0 l0* ||#<ԜY(ZYYYYD PY  Y SSXXXX W W WW @-@ M1P ` p0000h^T T& ^/00@ 0 0 0 30(ЍU0000 @W@P00oP 0?s00U00P^P {^P1 븙d O-MMP@@``"t"ĝ2 4,0X0|4040@ `0\   p 28px`00380 z@P!  P}1^00S! -^0=S0`S"`V`X`V `ሀ\P^0#S 8UPU  k800C80^0 @x000004qP] @1P x 4 qP 0 hT$ 5T@$ /T X,UUTxT4TTheQ|oTQPP89PP0S800C80  0<0PPp`@8p 0 wX X0X0P@5P5XP]0 0Pھ5 00xC  0PU0Py0Se Sc $PX (PX ,PX  Po< R1 !1 0 |4 30oݍЍ0@;]  0,  @P <z080t<0 S  P 8pW 0  g0 <    `pP] PY P$\0S @+vT%p40l8pC-qp`q000!TM,P@p  t L ! x0P 00 C0 zP!Q P,P[PRP0 %@jz` P0 0 L0 30 TЍPPz@ 6l^QtI-MЍO-p!1\M 4Pq@0`! Ͽ0T00 |0ሠ倐儰,P 0  C0 )zP80Q Q,P\PRP1P 0S 0 @y 0 0 T0 30\Ѝp:N0  #@Py@ ,X\ PNNDNG-MЍO-M4Go$  0020 8g00-0ӶP IPh 1 S S   t#@ h# S`  000 S ST S0 R R R R B RQ@  BQRS 0S1 @+S7 -S[QUp @Un0S 0S 0  <00_op`R0+S4 -SF XPPUpwV WPR Pp S 0QUp @U40S\ QO 0 000+S_opR0S @S0 PP v_opR0S @S!0 PP`  ]_op`RU8 0 0 2 30ߍ1XPPpPp p~ S!@B dH4 Rt"O-`l2 hŸMM@0 yP08006N M.0A 0;PY 0SV ܀ +Q+DJ 0  0  0P @tP3H0: S4 d10`! 6 ?  p>}0/CP"P2 0@-@Q0\MP0T00 @- 2_.p@0@ +JM 0  231 +456789:;< =>?  ! "#$ %&' ()* +,-. 0/0+ ; DL @0 0 T0 30\Ѝ0!@Pw|P z @-FM0 M `@p00d40Z~!ZPPd@![~+I P V@]V R@8< 40 0 d4 30Fލ Ѝq|zy@-Px dMt0@ p`00\00~ #~0 (0 0 \0 30dЍL|y4y%4$4@-M8@ 4@L0 8Ѝ?90P1Spp// 0 0@-PQ0M@000   M0 @R C0(0L @0 0 0 30Ѝ0)*PPxx xG-p!@1M ࠐ0 U040$e=㠿P&0E W07pPUo0 ;u0+ ᆿ@P   0U0 U VPᐿVTP U@ᆿU@  x p0 0 4 30܍ 0?LQlpxP|`wv- M 0 Ѝ@-Px dMt0p @`00\00 C0 (0 0 \0 30dЍauu0 ,0O- M@Pd@80000@u  @0\80dl: >b@`'9:E`@  `&-L@` 'h@ l "H`4O <!  -fapP,(5_͌b! Dptp& 7|!x 9l '8*. p"pp' p`@$;`,P%` (  `&}`am8 )  " gq-9* $@!@@$ @fa01.' +)$Mb!.p &7 dA(,  0" P%͌9n `* ! o`P%(, *_ᜀ!4$` Pl(P .8  "**!+P.$_p'+**뿠`ꯠ p' p'$`篠pp@ p- 7@$ " *(O0 +ꯠ"뿠, ) `)0` *"`/4)뿠 *( 韠/`,, ( ( *( `菠 p'af! p'  杉 p'`(`& `&珠`&p! pio` `"``&p'` $p͌P%P%nP% P) P0 P% 00(P &,`@$l@$ "P`@$ "oO . ` "P, ;>F @@P%@ (@ P-.a.P P%M b! P %P! ,P%,dA쟠 * P͌ P P௠" nP] p$!( p'l+ p.+$ p'  eQ $@ ,p!-@$p +@$p, @$p'`뿠O@(@@@ @(pM'p%.p'.b!$, ,p ' p, p ,pϠ( P,pP dA],p,,pϠp ",ppn} $ $   eQ͌ "( " "/  . "@ gq  " @ " "@% @$l/     @.- .. @'@$`,A@$P@$P@$P,P%b!O@@`&@p@$PM`& P`&P` `& P P(`n ,],,`,`"`&dAϠ  ( `(` (.͌ )eQ`) $0 "0菠@0 *!  "!0 "ml!⏠ %  "fa04`= , /H,)$P@+韠 +@ +@ (믠 % ,c1,$PaA쿠   (`͌%4P!!_PPP`P P& `. .lQ$   0&0` 0# 0#Ϡ0 a00@0&@ ,`,=O @nA, $&` ͌ c1P&4P` P ,`Pl PP& ` !!``͌`nPP@P `].` .`.l @ 0@͌p'@0p' `p'0@00@@eQ@ 0&$`M0#la  (p0p0#pp p } dA  4͌?))()gppP (P( p( p]菠 4pl `(eq`& `&  Po,``PP@P*@ ]*@@ @n@$ `*+M ( (ePoP菠 $ P 佋P*  p,(,p' P%  P%  p' (! b*LdA`$`<`00͌`4`0`) `&k0_00`=.`.(`. `$ `& l `(`&`& P+柂`P%@@P0`( c1P`& P`&p,Mo``, `n`pp0#͌0#dA `&0.= .lP @$@$c1 @,M,n0#,P͌0#dA0.= .l$ @$@$c1 `&@(P,M,n P0#͌0#dAP0.= .l @$ @$c1 0@,M,nP0#͌`&0#4dA0 .= .ol` @$ @$Dp @-`XTHc1L@ 0#0#\`80m < P`   C$00 0 30Ѝb+ ;0   *@C/ #EgܺvT2A-1`Pp00.!؁0% "0 0%0?S@@h G0hS@H"p ` # *0S@@:p`F AG 0G(+ ;1CdiDi thThp@-&$@M0 P0 00 0~? S `` 0~? S  U E "0 0R1<30L <0 0 0 30Ѝp HaT! t` 0 0@-PQ0M@000   M0 @R C0(0L @0 0 0 30Ѝ0)PP` _G-p!M@1M ࠐ0 (U050,e㈹P&0F W08APUo0 ;u0+ n@P   FU0 U OPxOTP O@nO@  x0 0 5 30܍Ѝ 0&FQSPᮺppP|`t8_$^- M 0 Ѝ@-Px lMt0p @`00d00 @0 (0 0 d0 30lЍGh] ]  13L @0+/ #EgܺvT2O-MH@@P  @0\;\ 0EH  @ @ , p.`dK p' pLl̆  zP "P% (n+PhPdP !lˠ ``'H`&P` PPTg{P%hP(@ b+l@Zh@@@$` @X\a&)Ifk靇pPt e[, .` pȂ`p  n "dK p)d((i茆`Xp|p lˠ! p.p'np`` PPhP%{P`(`&l`b+\hj `@@a@$@' g{ L& +,e[ pfktl̂kh|  dK "  .` L* lˠ!xp+(akh`ppp PPb+P%P p.p'npeY|T``x@0@@a@$ 0@`(`&dʌ` )@hk0' i`@0#e[ , $1 MP3 * 0 0 8 30!ލ Ѝ"9p pPP >P* @D0*@5H @?4p@-+,@@PPpH0Pp@-@pQ-P0|MSR pePH@a@@`P[sD   P(kDP8gDP  (GP*P@@@[VD   P(ND08PIDP (vP @@@9D6D|Ѝ|Ѝ'`' l  @- MP]Stqt1@p`PP@@T 0Q P Ѝ$ BSP @ Ѝ@ 6SP"0S- -S?@0 0000 ` b V RP +R@@D!0DSX  SP0S +S!@?@!@t=-X ?P L0P00 1 R/@P/!R/; @$0>R0 00// ;@-MP `@ pDpPU0D>S 0!3100 0DЍ>SH 0!3100F00F00:/-p@-M@P@U0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0t( $ }9\H=Q@-@B 8XA^^14/.-,+*)('&%$#" R"  @  +S@ -S =S  +AR@00R- - ++  @     0RuS/WS\0@-X0CSLE ;0P0R ^ @@PSPQP@^  0  0 uS0WS+S -S00I0 0+S -S/0 0 O-LM0gS` _8@(P  pᾯ 0 0E @ >E@Th87 00`0000 0 pa0FSX% $00+V@ 0-S/0=V00| 0P@ X B R d \VS  "=V  R   P:0@$9E  >2E R "0@$   Y 0 S:$E@ `=E0S 0"0C$0 WX    `V ,Vy`PZS  Z0P$D $=D R "0@$   : =Vq +0FY?o20S Zk 0W0 00X00@ Z$D P=D0Sj$0"" Ⴁ@ 0 T000 , GR;(I?&I0$0" GR|<ID @፷00S@9D0"SV  T3* 0 S?*-/+  @ LЍ'}`pC~p =V  !00$]D P$/=UD0S  "2 @$~ID00FD@BD@LЍ}$9D P$ =2D0S$ 00C01Ds$D00 0+P-@`X` +B XRp R  0+B p-R +R XR 0 -R p pWp@PPQ`5-M 0  3p`Ѝ 0P P C C C//o`/00/00/00/ 00// /0/0/ 0 /0 // /A-@pe`A1+P=1U PU  0 nP GP^C@XC@PPr,UP ,000sp 00d0p@-0P`@T @T0rS 幬Pp〭p@豬寬P0+Spp@qo塬A-P@`r\ 00p听<0p0 ` @ 00p倬@- M00j0P0@10 0 A 0100S6@p@& P 60 0 00S00 Ѝ0 0 @!0㦭B@6`0 00S 1/B@ Ѝ4V(RT*t, ,@- M,A@! @0P00 000S.ܬp P 0[0 00S&0 Ѝ"QZBt0 00S@ݫ۫LB@ Ѝ0$(t818!0@-Pp M0S'1@T0 `0`S@# 0SV00) 0S"PB0S% ;p t Ѝ|t0@T0S \A00@40 0 T'tdhG-HM`00 0Ppp p@ HЍ@ hpP 0  Yp ثp@ HЍpA0S @W_!0P Rᾫ@O- G1@000 `0 00@s40,0`$< 0P)0$iZ 4A$00 Z< Z00[0SP$04@0 !"H T(02@`0 0,0$00T Q S #.E!b)L@T(\/H0#"A $1?"!!#6 0[ <ЍP3+00(00!k43/0(00!d30,0E [-Kd K { 2\ T$`@ `P40!;P 0[^P$`40@z ^X$:6S T00Q$0%!>!E!2c(\/H) L0T!"0 #1O"`0!0(0 0,00?!D@QS8 5HT1>O0000T` ;0S00@000 10`00d`00@t0d`000;000S@< ?00@pşO-ph MMM`T㰰D0>$5T0$0$*0*U@@ R R00C?o2 00⃰0S U0  S0E0'0Sw0000Sf0d+05 0@ 03/0S| 0@4$ 0000(@,00F$003/P   0S00*  0.S @T0S0V:0S 0S , P8 * R  cP $0D Q01/ 3 D1 0(0P00 0S 0 P80: S 0" $2 MލЍ0S} 0  0 0s00Sz P@T  0s00Sh*>4/P 0 0Df00m0   0D y 0.Sv0Sa 0.Sp] Rv  @% 03/0  00.SJ Y P D0 =P9 @,  2/0gB 0@ 03/=0Sw 0 eUBQ=0/ 0 0 @ 03/0BB?B0cO-TpP"KMM \ؔܤ $ 2 /\@ P@`P\/\  `W!1 0 4 30cKލЍV6/\T*/ W0 /\ \@P  P`P 0   R  ; T/R  * R& R 0 00  0* r  R@  (03/0S0: SW/00Q0=/0`08O-M$MP@ `%0  ~S <    pH 0/SS;R! B00 4ZS *0H 0;0P4S 00C PR IR*0S0;R 0X @H p S  ! ?*OO **S1 @s000S ?S! [S!^H QM00@ S000XS 0H , R @ 0Ა@< 0 0R  R QX Რ@ P +@P[ "t2 0 0 30ۍ$Ѝ@\0D  Sr 0]S!^[0?O0!0?O0-0O]S  s000-S]Q q0 ]S 0@< 0]0?O0o  0BW 0R S0BW 0R S@^ 0 Qu  0A0 00'0Y p 4.0Pե*0H 0;OP 0!^[00  @#Q@b@`w(pQO-MM@`p  @ 2^ @P@\ [\ {\P }\U PE0]\\ \8(~PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S008( #0 }^S0CV 0F 0C   )2  @ ]RR ]RR { 0A- M`Pp 0S0 0#0{S @0\ @{\0 pMP Ѝ0}S0S ЍA: 0 @-MP M`p0 G0000 0 0< 0 ;  S ^00  ލ Ѝ; RPB @^P \^ \P^Yލ Ѝp@-`Pp@0T@D1 0CP@DP t000p0 S. *S8 ?0Cs\#S 0 P/0S /Q 0S 0 0/ 0 R/@-@"R,$ \5 BP   @ R# 0  0 BQ R 00\R @ #  "R 0@T p@-` Q QMP1M0P050  0 0 5 30-QލЍp @0  ̠-p @EOp 0 \PD8  0P0btt<t~ $x5C-0eM$`P 500S E p@#S!90 p呡P$ 0S (%P @ 0Sm90SЍt ` p @0S pG4 0  0Sx t刄刔p 0fS0fS 000S3R0S <$ 0000@SV 0oS 0oS0nS 000S3R0S # 000 96P 000S3R0S x# 000 $6P 000S3R0S (# 000 6P( 000S3R0S5 " 000 0#S 2 0@ R@@&P00Ѝ0 S Sd 5P 000S3R0S (" 0@00q 5P  5P4 000S3R0S+ ! 0 00T 000S3R0S ! 000EtP `ⱪ@0S0 @  5P =Q"&  0P00 t5P =Q&  0P0 0 0 0@0 E0( Hptx x$<dx x Tp@-PT=5P e@T$PPP 00pl@-,@@P00xO-@8QMR0X0008 00TPz 4po)p003 [W  n7U (8 0 0 30 Ѝ`s?0l0` 㰨p Y 2  UM ? 0 0 0000S'  A0 $0p Pm7<000S[ c700@]7@Z 00 V700` PtZpJ A|\#R PA|\#R QA|\#R VA|\#R~ SA|\#Rw RA|\#R  IApP#R HApP#R  GApP#R& LApP#R> MApP#R4 NApP#R* OApP#R# DApP#R EApP #R FApP #R 0X:U 0 RX H 0  P  00   F0 RR ,Z -0S 6 00p6pX 0 W[ 600 @6@ _0  G  0@p0  80   Ɵ0 "   0 "    u@@ß,0 pC* (@(xX  P;00St[v+ 5 r)600n 1o  qid 0(@ 00I `X0`0`  X`H X`F LvA0 50SY00>[' ~X0 _  .&(`HR  !y[a X;0;0P 0t ظ0$- M0ˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpF?pP eP Ѝp8G-p@`@0S&@@Q0)Ȁ\@@\ @ P Ɵp0 R * ᴟp0 ᬟp0 xtp@-p`pP`P@T T0T0 R@@pQP00ꐖhA-`Pp@P@0S |@@K0 R"@`@+%P0040@@- 00 `C-`4MP&@P 0S|0V ! UpЍ  㷧0P;  =R6 0Q*G B&R&>$#"M = -RpY WꘀqꈀvKSБpe0X{FH Y 0$ ر,X(O-BMM5Pu0 %p05 0 0 0 $  G C+0 P 40 4P P@\ P 0S l400#S \ P 0S 4d44`0`\ P 0S d4`0`\ {P 0S 30 B\ l0P 0S (c30\ _0P 0S c`30X3PET`0L + *P\ D@P 0S .PP[[ 0P200xS0xS0Se "\2 0 4 30BލЍlR@P\ Pq 0S @200#SF \ P 0S 2R0P\ PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ 0P 0S bH10\ 0P 0S yb10 ! 10P 0 $0000 0000#0Pxg 0 g f x<}`e ̿d X(d xdT\0 Dp@-d@@0S P Hp@P@P 4P p4p@-@P0P 4P KpPP/P ZPp@`@`dP$p証dLp@-@P0P 4P pPP/P .Pp@`@`8P$pܻHp@-0\PP 4P p<`<`P@tpL4Ȫ@-@@P00ԺO-S$M0M 6P@p0`U 0C   500{0?SN Sl *S00 *Q @Rt50*QLU 00  *QA[SU \S0  0 @ Q8 $Ѝ?[ [2 *[  @[[ \[0S @@0S /Sw .Swu 0W p 0W/Sm.Z\ Q /Q `pP  /P P$ЍQ /QS 300000  ^[![00 0 00 @  p /S \S> S -RE P0 U@ ppᷰ0]S^0 p S x ti p. 0Wn  0W/Shfp @`\2U/000 /ZU0@  0U ppᷰ]^^ \^  @P PӦU@  p^& @@ 0^ @ 4!  p [Q  @ P0 @0  C00p`@0U0  Z 0 P/ZY  /mQ /Ql 00004 @0nP@-@ P 0 0 Q 4Q[?o2cxdp@-@lP-P X-P T00pT 00pX0 0 p(O-Mp!0@  "  ጚp` P 10230Y ߍPT 0 mpI  P: [ ;` 0 0P P) @@ 0  Wp@ 0 <P0P S P &">0  "C0 7p@/ -RO-Mp!0@  "  p` P 10230Y ߍPT 0 pI  ~P: [ ;` 0 0P cP) @@ 0  ϙp@ 0 ᴙP0P S P Y&">0  "C0 ᯙp@X/ -R|O-Mp!0@  "  |p` P 10230Y ߍPT 0 ]pI  P: [ ;` 0 0P P) @@ 0  Gp@ 0 ,P0P S P %">0  "C0 'p@. -Rhp@-`H@P@ ePpPpPP @R p@-`H@P@ PpPpPP Q p@-`H@P@ APpPpPwP Q 0 00 -H- M0 S0 0 0 0 00 00\100 M\  0S08 00 0 0 30KH Ѝ/t-H- M0 S0 0 0 0 00 00\100 M\  0S0 8 00 0 0 30KH Ѝ/ -- M0 0'--M  --M  A-`PdpQp @Q APD@(0 0000A0]\0P R   0//(yǟ 6 O- 0S0 '0@0T9  T04 0R/Q T: T% 0 \/RT0C"/QT 0C: B0PU0P!Th00pX@@PP x"04@@0/S$@@@@H0l ll ^A-MP`&P0PC D!0Cp0 0 0   ! 0b0C S0;.-,+0)('0%,pG+0 00S@` 0S 0S5+0"S D6#@0Ѝ T1r0:$+00Ѝp  㗔@-@P6 0S/ Y&@T3 0T/  0C/Q T% !@# *0P@/S  B3@T@!0 0!  T B3@T@!@@4@0/S @ꔧiiT[-DM0  000הp 800S DЍp@-`P p' P@ 㛕볔p V U phUX  p` V@ZQ?o?o 0@-@c^?c(0C^! ^ P@`c5$pC&5'&`c 05D0c 11P!  "0P;:0 /0 @- / 005D 0-0+CP0SD 0@0KE0 0/0E 005D 0-1+CP0SD q@1KE0 p0 Q/ 0E/ !0PQoo A-@@`T?`(@T# T `Pp`6@6&p`376U8`1010S00#!Q00;:00 /0 @- /003D  0+C 0/ A0C0+03D  Q1+C p0 Q/A0C J_@ @-\p A JT@ @-Qp J@ @-p J@ @-pPP `@-)00 ?0/R//R/?0S/R/P/R/p@-MPP`V @T x00@ Ѝp :    p@`$ +p<<< 00 R ה긤,@-_)00 0S@臓TH|51Ed 2 Cr0b0aR0cR0A1R 00$I"I B``C/)P( L%@  @ "bQ0"G-@0D \ͬ ̬LP `L,@0L0D QW ^ࠓࠃ Yࠓ^ S\!:O-p(BPPX ` $ @|4PPY  @A-`8 41Mp,0P00S9 @200S ^@#@3@,,C000RP0  x0 0 2 30ߍ譵@P PP Pp(P0$0嶵hPO-PC 0C,0P(  E Ϡl b0,0 W0 00 000ZW 0  L0 S0pP( 0 0 0GWp0 09P(0P(PW%Sa7 , l,(,0 Wv>C 0C0P(P 00 0!0W0G|6  00P(,0 ,0$I"I/A!b!b0C 0P( ) 0 Br0 S>P(P&Wp , 50 P(W 0 0 0W  =0 P( WhWp 0 ;0P 0 p0 S 00W((Pg0 0P(\c0 , 0SP( 0%!E0?d"c,02#,0 0/ 0 0 000 0, , } ,00C0P(G 00 000 n1, , g W,00C0P( 00 0a, c0 VP(Y(P000nW{ 0d 0 0-0 0>P(/ j  RR 0s$ @p 0 @00v 0`` K0`b 0$I"I/A!b !b C0 0 B H P=US ZSQ- @ ,2P 0B(0 R0Z  R0P P,X %!E!/0#bbK/) P L@"(@bQ: 7 0@bS0#03 \!  !1  B00,0DSd0,0&0 40(00N~0 S(0| ̜ |@̜L@ `YooO`F_O  OG @DV@ 0 40N~ Q@ `(0ܱP 0(P0 0}5 5 4 yyyxwU@* Ql(PP @ ACLCq| \^JS S  00S3P0S| z H/o("PzXaoT(TQQ] ppp@)CQ( 0 B ,##Pp= (' P%!E"ad2c;S,0<2#6MP P(P @ @C>0P( $(0  @ 0 @N,h2P 0B(0y0@~0S{ 00@w0S 0@p r,0p0 0 0P , P(01(000C.$0O 30a\Mc^ @P$` @P$`_   0P , P(0q0(000C.$00 0&# p  0P% , P $ (0(00c$00M0 00Ѝ1A-0Q M@HPP PM Q%d1 P01$T G@@ Pp ʵ. R! v` PU  Ѝ0 P0  PgfF ` La `ѳU"T 0 ЍX  0 01"00$$ $ o oo oHond@-0M@ 0P 00Ѝ@-0M@/0P t00Ѝ@- P@h؊p@-P 00M @`00,00   P00Q Q Q " 0 x p0 0 ,0 300Ѝp ,Hj ,Hd ,H^%d0@P/ P @/G-X# p`V@P0PES  R D PE0V R  SS0@0D@R@- 0BAs @ Q0C@R !@O-` M( VP? @P>  pP9 Q001Sp Y Ѝ00P@P 0 0P 0 0 =00 !00@-RQM @PЍTT !@Ѝ! 00G-`-pp!p1 lM0M050?PJP @pA @\:^ X0p00 t30 Oo00 TV.qύ@0ˠ (, ~@P  Ph X0 0 5 30 ݍЍT!00@O!00\H D00- $  M  Ѝ̣--M  Ѝ Ѝ/ -- M0 0S ЍЍ/O-R쑟 M@ p` R00?mh;00P @ P p00 P ! !  4X\3?OP2  VP W6 Vp[XPp0P`0 ``f`00 0 004 Ѝ`᰾pP" P.C0 P P00 ЍᖾpP V ᏾pP `(@-@ M(0S2 0 (0 pp1/qpP`0)  0 0 PUoR <0PUo ЍPPT` 0S  0CPo_ 00P`@-P M(0S: {0 "(0 pp1/qp@`0/  0 0 @ToR <0@To1`V ЍP@T` 0S  0C@o T00t 00m e2R/p@- @Tp E2 Rp 00R0 ` P 0S PcP0T 00(P 00 L0 SG,P C4P ?8P ;p@wp@-P$@@ჱJp@|DAh@- @@uJ@o A4p@-,PPh $K@ap@1!0A-M0 @`00S P  0 XR0P P S= p5( U80C0HS60 S0QT.* @DT*T( D0 Qs0U   "Q T #R.S 0A a 0C "T #R Ѝp0@84  R  *4 8/| 0X\S 040:8 R РS /LxB@-Pp`*P@P@0@D尀 °U   ziК[@-P`@0 @- G~@ \\\% \!00qP`\ kqSHX70000D00,00 00#U00 00p;U cQVFP@|dQ ^1 \\00SdQ Vl60100 U =U U 0P060000  l 7PEuP000RP00ES0100C0{ U U 00p 50000  M70Es0 0_00D%00   00Es0$% 0W0Cs0 20M0?Q000D00000>-Q004 ^QV00/00 K 00Es0l0W0Cs0 000ESF0100C0\A#o,%Ao 00&Ao  00=Ao#P 00. 3010pS%;U d30000 00 C10PP 0AnSrXGFEDCBA@:gSKIC:-$ 0PE0P0_00\00]00T 00U 00P 00K 00F 00A 00<007002\00-00"cQ`adQx@0PEuP00Es00<00pL00 8  $ L O-P Mp[ @ `@ 0 H\ QA 00[0SSQD00 00T 0000 Ѝ SQ00A000  00  ׅ[A-@ R`PPo /.#C=1"#BbQqU? 0S$ RV 10 R RQ 2/!1U 0000( 1/P p $@0081003/P !p0  $@V00 p00 R (000P3/P! Up  R  SVp   0S=㧺P00U r0r3q3P3ZHq22A-@ R`P Po / "H0#BbQqU? 0S$ RV 10 R RQ 2/!1U 0 000( 1/P p $@00810 03/P !p0  $@~V00 p00 R (}00 0P3/P! Up   R  SVp   0SP 00U @po1od1 1XXo0d0G-@P P`P $rp^t F 00 Rc</.#C="#2caqV; Y pkPY` $00100S p \1003/P00H 0 $0(100S100S& p3/  000``0S 000S( 3/000(ظP`0003/P 0| p 0000S=|P00~00mHm.l.ll8.-lG-@P P `P $rp ^t F 00 Rc</ "H#2caqV; Y pPY` $00100S p \1003/P00H 0 $0(100S100S& p3/  000``0S 000S( 3/000(<P`0003/P 0| p 000$0SP 0$0~00|kj\,tj,@j(j++iSR: G-P0p`00S 3/0Y @IOP { T0 0 0 0 Y @IOP h TT0 0 H H0 0p`P   /*hhhph*\hSR; G-P0p`00S 3/00 Y @IP 3 T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  /)gggPg(00 @?00 @00 @0000A-@P Q 6P`\Ppᒷ@P 'P`V 0"S 00@p@- PHaM`=  4QP00w P; 00^% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P ·<0 0  O 0 @,c bbP/:P-0SP S:R S 0@S0S S P:P@P :R0P:P 00/"@-@A0 R R:\|\00\0S Q0A|R  :RRO-M M '0pĝ 7 00D40t4!S SP G@`V 0P0  㮵pP 00S D  P R($'  0 00 ' PM0 0P000xP ` [0@`0 S ZK :SP\ \S S SP0TD*[0+ P 0`0 SZBUP@0#SS ZP5@P00S0N0STD0A0:p%5 0 D4 30Bݍ Ѝ:SU @0T:H@DP# @pP@DU  00 0S g00匶@ pP  @Ԫ4@00S0 4 p0(040,P$000= Pw 0:RL p0Rt4@<0 0 G0$<4`P pdPY pJ 0:R2 P0R 0E`F00S:S:00`0H FZ#0 D 0 @c  _ + 0CᖵPp`! 00D=Rp00GP 0H@D IpGzP @ p :00`0000 0 0(S,P p% 0`S `"0 SRC q@ڵm@00P  P1@<Põ 04`40080 p07/p P  0 3 30*ߍOP0 P P0C S 4$0@D 0zSN~}`{zyxwu1lj0 ea`^  [GW000P 0C0PG 0SH00E 00 0 0 0 00Sn 0  JZ 񏐨m:P0 P 0P0C0S0000D S9*0= $0R $ (p0J p 0, 00A@QD?g^Y T0@p Z3p80 P @T0C0808  0S0P 0 p0080 80 0CP/ 0T@0 0  0S0- / #RR 0T000C0 p0 / #RR p0T000C0 SP P0004 0@D }1T@!@=$080 + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Z} 8 00C0S_000@T80:S XRY    0$- 0        00080$ 0CP000&}   $   S|@ @px`& ZʱZ|  }(P {#P 80P# Pp0 T0C0  SP 00C0S@I0 S0  @ p p,0SP00S[ 00C0S000]0Ze p @ p,0ES[ P 0@0C0SQ0Z0 I @0 pES p PS[ R, 0@0C0S 0 S000L @+ D  p@ B R W. @JP 0 p@0C0S[0000WX +D @AQ 00 R @ pNTA 0Te@AQH 00 R p p@XQ[@AQ   R @ p0,0K걬0=0=$0Z #  R #  R4 WW p B PR @  PK0 SH 0iT nT  (p B@R  00[K @ R񏐸D" AR> p@ B R 00W@ NR- p@ B R 00W @_ (T @ B R 00 R@p )T @ B R 00 R K 0 S @5*ZZ 0@0$0pT 0U04 08$ 6 >`00 500S 80SG000:[aP 0@0C0Sz0Z0  @a0SHP0[ 0a P0[ 0`(P$@p 0 0 0[ ,$P0W 0@_p8p / #RR  @T B   8 008 80?03SS1 0@T0C00008000% 0SP 8W pA00000P<0 S9 0@P20Z/ 0@8pQ:8PB0 S? 0$0 __T?o20S0 p@0C0S0 S000T Pl 0  B 00 0?@0KA `0pR P p APZ 0@DpP 0S80 00C0S0000 S @, pWp 0`(P$@"  (p B@R r 00 Rh$8 _00 00 P [ 0@00P P]U t@ 00 @P00P `, 4 ` V   v@P  PP0000@4nPP0WM 0@+P0W 0 @1P90 S6 0p@6PB0 S> PP`9 7P0 S/ /J,P60 S3 0 p,@{P 0Z p PP` kP0Z 0@ W @ ptTTP0 S R" @t[$ S C8 S6P0 S 0 p@0,0:p4ش @-0 P (p m(p` P1 P0 S 0 p p@  (p B@R  00 R P0 S5 { 0T@3p[Np 02P/ 0Pp00[ 00`=<;:987654310/-,+*)('&%$#!  h^0DS13b0 d 8 P 00Ds0S 0S0 S  \00T3`00 01@000@0@PUc*$Ѝ@\ M00  P- R@ ^^? 0 `0  P 0J ZS0 - 0J ZS)X1 0000 $Ѝ 0S0 10000) F0' 00CFs0S`0`C F F F F F F F0\  @`\s\0\a\b\t\n\v\f\rL7 QA-@p`P ᝤP=0D! D?o2]R0S d0T"@=0 !1 U U 0 P0 AT+ * A-P@p`9P .T T!0DI1(0D,TS0 Ar_T $0T"@%0 !1 * O-`'S 7WM @(0無0T1060$010 y P0P 0 rp0P0 [0 0 190 P@ @U1 p00PU`p! X U0 1 #P00? PP P5%0 \PU`p 0pGGq WP1 P! Lt`ƢpP+ @ 0S V L0 G0CSa1  5* 00  R1  4' 0(0  R1 001 001 001 "001@\001001 H\ UG `倡PUB 0 p9/P00P0. , *#3 0 T1 30Wߍ0SIP/3#0 n[CP 1l3zh#h0 ^[X 00圣(0S 0S,0  3Z 0P00CDp(0<@(0X(0- p`0480@ PN n~9@`0 0>@@\@TL 8@,@ Tn*0 4L3>|8050 W (0$ 2,@0 D0R #<`[PPZM* < 000S00Dp P0 SR000傢 倢T PP2,0Z:@1i?F㨀R 0 P P0nSP0S  @PPP(H(@PtLtp@-``@Pbp  @PppPblPp@-M@ Odp 0: S  bp  ^ЍO00ЍO-p-$@`,M @]@300P0PS?o2P[$100 @e0@$0 p @ 0 T  0 * 0H@P p 0n  cp@D P0S^ @Ty0 pI W*@0P   T1P [ 0 AZ Tf–@Pf WP#: 10 001[ 0 P0 0P P 0 S 0S[  pK0@ @`$0,Ѝ0  00 0$00S$0fP0sP  000 b ap`} pz pP pp@-P ԗ @T @ΗT0 0p  O-@Q M0" pbP` @[ P51 5*P@ 6/P  00 U[ I:P PU@ Ѝ/O-RLM<kQp, @<000$0@ P_ 0WP@0`p00< 0G000p 0 `8/PppZh*0d 0 0 `P `RP(0`4``p,0 PV :/P W X(,004`V1 011p1*`G0p 3/P00[ < 00[G   pW: pW0  [:p K (08/(0P <0 0K00 p' R `P0S Pp0(06,00S 3/@Ѝ {\0(p0,003/pP 0S /A-M$P@ 0P 00 `pP zЍ00pO-}Mpl"`d2 (0H010 PP @Pr 2 ! 20 RF \1$@ 0 01  0D00\0  0@00, .48p<`>, PS H0 03/``ҏP%  !0 0 1 305}ߍ          C  @ciP ecP||0cY``'cꝜ |TDH La L a ` P00/ 0@- UMH`00L10p! 0H1[p@N[PO[0P\ p  S 0!8 ,0 0 L1 30UߍR tL p@-M`@ZPPPЍp \P YP YP 00 0P $O-(p,@PYP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV ڎP``nb@P V@0SZ V@减00(^ G-`R p@P8/P @PV!1 G-@Q0MP`000Q UI U .00P!1 0 0 30ZЍ0p )P00 S0 00 00sZPP 0 hZPP _Z0SPUp!0T  \ZPp0p p PPKZp 0 P@0 1ZPB p / B/0  Q  B / 0R B %3 % %//Q0 / 0R  B   2/ // 0R  B  2/ // 0R  B   2/  // 0R  B  2/ //0S :p@-0C@0 P 00 0p/0S :p@-@0C0P  00 0p/0 $00 0A / 00$0 p@-P@YP 0S S pp@YXP p@Xp@-P@YPp >YP yYP 0S SiXP p@cXp0p@/p@-P@^YPp >p@Y tY0@- MP@IXP Ѝ0GYP 0S0 0Yl p@-` F0S pP@&XP 'YP XP XP p@X0S S  /0S0/ R R  /0 /! / CR ! / 00/ 00/ 00/0 0/ @-k/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1M A0 030pC<0 `:0 0LSP00 03/P 0&,`&<808 0 SS0080R0S` ' RDp4pՕuPUK Y HE:,@p 00p(p 0  pC 0pS@P00 0 3/P @ 00SS`SVPy80Sh Y( &<800 Sk&<800SD u0`P I/o"UQ]pIorRI(0S D0Wpp$P@0P@C<0Du\= W^9 @0 C ,0P5 0P,0(00(0'Q? @$4, 0 0 30~ݍ4Ѝ%S00&<800Sg &<800 Si  I'YR0`z XJ]0p,@W(PG Zq <0pH ZCPKﻟh`I xZ2 p0 0$0e   4P $T@r /r @0S S000 P0SEZUP <0LE0S. R00~YR YYY. !Y YD !u0`P&pIorU  R I/o")D2000SR00R$0D4Q0 D wA.<0@RC@|D0.%商Z0@jROt00S000+D0zO4 00Q`PH00 03/P? W  R70  `D )<0.RC@=O&<80@`  40 `@%I 0  0<(5$%0 5s (0Sp ` ( 4 3 2 QP QpQzO4 00ZQ`P00  `J P ނP $Q0 0R Tt4 4S W 4S 0000KQP0000S 0R $RW $R 0{O-SM`$0P4 00D10㗂pP 㓂P  P$0Yp 0   C8000S0  P{ 000 VPw @@PY 0  EP@l#d3 0 D1 30Sߍ00g00MQ @T^ 0 .T0@T RDSS d! Sz*0 D DD@Q00 00000000 9P70=S} Q0SN SB SC 0S 0 #P0s[0Sb Q00Ⴣ၃ @S @Rd! S1*.T 0 Pk  vGP @@`!1 0 0 30\Ѝ0 SRJ 6@PF  0 `P 000S [P`P@P ہفT I P X0 SR @P  0 S`P000S`` P D 8 uP001`//4 tp@-@P@P ኁTpO--P/ Mذx0`?0p020" $ * ,  K    J F X  0S0S pL 0 / "2 !ߍ0S0SP;0S ^01@3> p& p"  0pW 0 Q ,.0 ^ 0S 0G?oP20Q00S0S  00K p P 0P R   L" l1,P0S$0 RSS0 0 0npP<p0 0(0 $@pW g872 G52 0W00S   S  R  R Q ^  ^# \Q/o" SV RW0S!  0 PvQs +0 0Sl QRh 0pS[ %0P,0U ֌P , 00 B 0PpW ,00X ,@8@ 00  {pP  0 Pp0 Rp  RSpRolRn  P:R \ @0 X0 0P 0 0Z. 0Z(0S 0%05f 0ZX @` V0@S =>$PX000 0X@T PP@P ~~TPX@T0 40$PP 00 0 QPb@T 0S S00S0 00 0RSQ  I LHP1x00x0 /}z @p pP`$@P P0U 00P}T0P}O-LM‱P|Q0 P@ C  ] `P00PF 0pp R R R0 T@0P p R ((0( LP00 V pW X 00 4XppWV$@LЍTVVG-XM`@P pPP@0 E0    u 0P 40S0- XЍ oP ||Z  0ĐP k|8<8 NP 4PPI 0 `d`O-M*<* 9j=2+X |z j| J3**?J0VA$Kr~A$16zA$0*4*({4~!"r%kz!"1j5r!"7j5 Jva&)C*0V7 8N,̅0  0! B 0%a0(@0#@,0 L7@ @$௏@|O!dE #.2* ㇇Dta& ,80Jlʎ$ !0 FO8 0.00#,0H IFc5p 8` *pa& 6@@!GDKHꬃ@ @  .x)HOLn # @*, $x \Hǎ @: @$"@F .dE! , 㘽O   * $yJj  .$ !!㴹D  ,bE ,FOlŎ@@ . !@C @@L@ @,@` @$ @Q^BK !  `. ધ 㶩Nn $ , ]/MlƎ  .! SD@ @,@ @$ @㡨MK ! . ȫӧNn  $ , BlƎ  .(! ֧7L j@,@ @$ @դOK ! . ZDn $ , JlƎ  .!  O @,@ @$*H @٢oF K !  . n$ * BOj  , qHlΊ @. @$ `@"FJ *., Ojn ,! D㾤J  $* Dj `@. @$ @`O J !,p KlȄ* .8`B  $*$Nj@, !@DM@ @.@$ @@ dH*. 9 M !,( ۦN lΎ$ *Aꪌ @. @$@eLdH ,!D)O   " *Db-  . Jl˂@ @@$9@ LO@@p !I[EF@ 00@0#0@, /H Jc= , }Ob+ . HȂ !OF<@00 0#0,Oc=   " Jjb+ ,DȂ !SO`00 0#0c=@5:K0   " 4b+L B ,0Ȃ 0 P0## +N ` H` 0UDP  DTЍ  0'C @/ #EgܺvT20A-`!Ӂ000@@hPp0"V>0: [,0hV@Hp` "0S@@:p`F ABp@-PM0`@ 00 00 |!7R8 bx b  D 80 0 0 30X Ѝp@ك ( x LŸO-D @2 M<"0 P00p  `. 0\ @ 0 XS@@|[0 C" T. .0N|0[.\'^V*00[P0@^*0^0 8< 4^*0 8<@   ~ - MaP ЍDD!@- 0(M S $ A \/o"S R9/o"S R L 0 0 $0 30)(Ѝ@P @ B  (  0$\ S $ L R \0  R ( $Q C ߂| | \ A-p4!01rM @`P0X0100^pAtAh0Oh00TAV 2?O 0tP" 0 npP 0@u0P 0` X0 0 1 30 rߍP Dv00P 00ꉂ,{ Xz 00- $  M  Ѝy  -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/xy p@- M`@P @x0`0P0000 @X@0@T  Ѝpy j\ X1! @-`0M000)Ap P@   LFAp ?@ 0 0 0 30*Ѝ?PpW @@T PU 0ScP@<T'00@3 00Ձx w 0p@-P0@ 0p0zu(0Pwu(P,Psu 0\0PP 0P 00,,gP 00plF9TF 0@-@ 0 0Z 0  0 0 凒 0 0 00@-P M @02u 00P 0 =?o02c Ѝ0d1 00 0p@-@P 0U0 0pp@-@P u0PPu(0Pu(P,PpO-P0Pj `Pc @000 S S0 S S hpPR 00 pXpp8 $@P q0p00S S S@ 0A S  Aپ 1 @P 0S 0000tP 0 sP(@$@`6tD55 O- M`p@,0(Sz: (T^ TppV 00SR 0 RL@D@T0PG 00SC000@D@D0P0S, T0X  0!0J0@PH 00S#0AS0偰0  0S000   0S& p0@t0pp t(0pt(p,p@ ЍosP  (,@}(}0  Ѝ0 00@- M@P  0s P  Ѝ00 0 $$ 0 ^P Ѝ0>p 0$ $/ Ѝ0O-LMdU$`@P0 @@tPI$rpPE 0 @@tP:$PPW* 0`Q QD QR Q) 0S:00S} bqP  ` 000@ p R  R/ RY R 0 @T: pPs 0J[0K 0 LЍ   @ Q`A@0S:   P (0   A0  ,0p 04`0 0W G   ` ``@`` @T: 0r00r `^ \LQ  QA@ \V ^ Q\ @ , p 0     S QARU  R  PP@T( Q  AX  " X. X4 p X @  P@T(:;X X X 0`p`   `  Q@` ``  `p`]r >='QO-`p P`PW<p0( w# 7[0` @w$0$ X`(0,`2(-`P p[(0 # 3X, `0!(-0P pQFf&``V0#03 U0S `V:PV Y5XX1!030# 0 q@000X; SP81 `3 `#S41`F2s2`Fs1`FS0`Fh`F0v`4:0;`0Y SP81 `3 `#S41`F2s2`Fs1`FS0`Fi`F`0v`0809``` p@-`M;p& @=p) P0u00 @ 0@;t `0 0+P Ѝp<; 00; / p@-\ ,P@\ \ PQ :\ :Ap00p00$O-\MH @P0( Q04 :;pɁ C$`; -: ^:cI :10喑a @9Ȍ<Ǡ `  ^ 0008` 19P80 @A4ƌ<ŠaЍ0 000 0 0@-S@ 3/@$=@-] Qi7nIࠑP*i7nI P@ Np ^ @ `@D@P V% @D BD$ BPE&"PE@D"V%@D BH$ BPE""PE@DQ%@D Be$ B'"^ r N $`PFPEV%A B!B E BA &"A@!@ B BA!" A@!@ i Q7nIP# Lp \ @ `N@D@F$N B. B@D&"@DN"F$N B. B@D""@DNQ$N Be. B'"\  \ \ , ($`P\ \+ \' \) `P^ ^ NPN `P\ \ \ \ Pvlhd\XT C10 @-0@0 0 0L#d.\ 0@0\ SC@ P p0  0C00 00L  00t@ a   0@- M@Y < `H_ O-M M` ',@ఴ $ `!0006@@R@@0TP06l0P40 ,PG. 8 &0 0 x0L <0pXl6l&0  D < P0H0, 0 *P0 ?oR20S @0`1  H0PU 0P 0U VL p`V.p0S  80Up5P00P 0UG W<0h?pX50= 0X% W00 A`@V800)S T04p P, p/P* 4  )4 0pD 4p0p4l0 p{P4 0psP90SmP l0P40] 0 #3 0 4 30ݍ Ѝ_3P 0`Ga0S 00ST@0`1   nD _4#2 0 4 304ݍ ЍO9X <0x$? 0PrR(_U]" T "d`` `@\ h _@F`DV7T0Ა S?Os t@1 Y T |_ pI I s_ T 0 \㙻2P p 0II 00 .&) T@F`D 0 ほV`@P ꘡ 0  uYx 0 m 0 gL1l`0`0 ppG pG +_T  0 l`O0P p 0JJ 00 .( TʳH#n _HxZ Z d*tO ^ 2N (LN (P(0( (H\'<'LW <'&V &&&&&BP%8%%$$O-tM@@  `2VPPhP0 0 p 0 0 `1弴4Sᾤ,0   (6< 0 V 1P806< 0B>PU  0R408 00^`1S   ;`1S0 ௺0 0 PJ0 0 P7P P P$0 0 xP0 0 lP0 0 `P0 0 TP0 0 IP`1SxYz < P`p0pW  0R 0 ^OpW 0pW  0Rx 0]<pWf 0pWa  0R0 ,0])pWGpWD 0 PS 00]`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 0p01 00p01 00p01 0xx1p0 [~lL c]tЍ tЍ 0 10 |0 u 0 n0 g 0`0 Yx0 RS H#G ""xE !  D C <H(h @-p0 AM@M 0`$0 40 0 7PP0S Y@ 80 0 4 30AލЍ.vK HK 0,@- M@ p  PpX7`PMP 0S <0000 Ѝ00S.S 0S Ѝx4p@-Pt AM `0 0 $ @P 4 ,0 0 4 30AލpvHJ J p@-P@`Q  @Q ZPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P 0`W00 Ѝp@-@MP`0S 0 @S 0S@V00ЍpO00@ 0PV00Ѝpt0@- MPa0@0@0@T  0U Ѝ0l0 0PrU:H@@ Ѝ0840 P0@b Ѝ0d= \!KQp@-`M x00<@'P 0PU  0VЍp_40P 0`:Ѝp @@< < 0@- MP0@0@=@T  0U Ѝ0p0 0PU:L@@ Ѝ0<80 P0@ Ѝ0; hpJ,0@- M@ T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPPdP,H$L0@- MP# O@VP Ѝ0 0( 0P: Ѝ00@- MP h0h@0@B>@T  0U Ѝ0O,0@ 0P Ѝ08 lMp@-@ML `P 0 Q@0P0<00 0. 0T @D \000T H0 0 <0 30 @Ѝp@Ѝ/T.0 a._t B A O-MP`@PP  jp f0 Q ЍSr RSPP 0-S  0+S  0x# P   00C2"0d  .S 0 @ Tᘀ@@ ✀(P  S #3 @ P 0RQ  S  # 3!# 0T#+<'(0+8 +((0'<0'4 0(< p 0(4 000Rp n 0T  @ P  S #3 @ P 0RQ  S  # 3!# 0T A 0T @ \  S #3 @ \ 0RP  S # 3 # 0T 0 0 N 0N 0 0 0 00J 00 0  ;3A O-@Q dM0 R  @2/R>03?1|gO" \ ^mnb`AS N T _.((H<S0c&sf~e~rHpl W E P -b AE#D((H'ᒾ  L>c@L<@<0d0c@02gࢲ"X ;ks ssZX 0H Y J XL ,0@000(0L04 $0\0H p 0P0`0<00T00D0:Z rfY nfX jfdЍ @A  \ @R@0@g x  0 0dЍ@0Y0 0X   ? @-@P0D .R\*^QA@0T.S p@- MP`P`@IT _0w# x'w000 000 ;7z $  kWPc Ѝp l C-`@ MPp䀟@POP @U UP@Wy@ Ѝ *@P@p0 0000 [ P: T0S0Y@OoB@#(. 8 4 C-`@ MPp䀟@Px@P @U UP@Wy@ Ѝ @P@p0 0000  P0S0Y@OoB@#- 7 , p@-@PU00C0S S u P 0` PLp0X`u0 0C0SpSr P 0 /X0@-M@  00000 !R !ܳPЍ0p@-  0S0@Q0 R   =0H04S .Ppl@Q0R Q    R `Q l5 Lp@-@@P@0P`0pp 0,0p@X0@p4 LD D p@-` P@0pp0,p@*4 LHA- @@P`p0p0 A3 LC-P0 M`p0qp@ H0  D@ <8 u@Ѝ 1h3 LxC-Pp0 M`p0Gp@ (0  @ Ѝ 12 L0 00/@2 L0 00/ 2 L 0M 000Ѝ+1 LXA-pP0 M@P`0 p 0 pЍ1 L0M 000Ѝd1 LxC-Pp0 M`p0p@ (0  @ Ѝ s141 LC-Px0 M`p0p@ 40  0 @Ѝ O10 L<@- @  $M0 ZЍ$0 LH0H 0p@-@0pP p@ O'1p/ L8- , M $ 4  Ѝ|/ L`4 R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-MP(@p,` 080PD0 R  P R7@ 00  B0 000 0ЍW Q\.Q Q. 0 .Q ^ ^ 0 0 p@-P0@S` z 00C0p~ 0 pO-Mp<`P@P*W3*00V.:Y `+ 0 0 ppZ,  `0 P P0  0P= 0 0000Ѝ`<0 PFЍ p `@- MR` @ P0ASA0A p0SA0qp00C0 Ѝ@0cP  00P`xO-MMP/͍$08?  `0000=0==0P >0=0 pt?@ 0,0=L 0H 000 0 P, 0S@ P0P40H0⯭0 A 0Pr0(0-0 -H< 0@Pc0 K0吰$H=D0x 0*00d 0P>0  00 PB0( 0IP9VV 0FSO5DM Oq {~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  0P1 R 0S .S 0S 0S00S.S9@0W) t9d @0u 0 P0D 0 ScD0C(9$^800440PI y@0p000 0 0C(0S0`0 @4Z$` @Dp 0 vP(0Ssʈ0 kP0 0`PL8000#8088, 000.0 r  .00Q$0 A BP00D 0Y:0@ H;C'l7  0 0 30 ݍЍ0VWk\7@0hP7W@0e @' d꯭P040H00  0  P@m0 u0P(0c6000#80꯭P040H00  0PM0040 C0PC0H[@0EWt c-@0d  D; 60P 0  P(40 C 0`P H[40P@C@ C+A0W 10"3$ 0;A000;A0200;A====C;+A0W$1 00=-;A>A C0==C;}W 5@0/@ ¸ 0P=40 C0sP30DK 0T*uPp\w `$PP 0(Vj  R @0 Y$ 0d  q 0  P@T0P`$*0@* *JDK1#00X 0 P@  !V5U5E?C0 S 0 kP40 C0P0Dk 0PCUQyD@p@Tp1 W2 0d   0  =PW 7@0~40P@C<8` 0PP 0 P 0  P{@ 0 Ps0D[ 0@CT t80NW 0d  080  0 PY`V]@DK 0RPP `@ Ee=H[p0 0$"᷷- VDKP0GH[0 0S@ 0p  P%0W\ G)`0d  D;90z P 0  P 40<@C8p 0  ?P  0 P 0  /PH[WU )@)@@:2 0D@ ` 0 nP  0 @PU Z 0 P@DKpZP 0 mP[ @ 0 DKHP 0 \P0P 0 D; 05P40 C 0PMp40 C0pP  0 P~lDK`P(D[0d  0  PhP(D[0d  0  PV}(P z(` w(<d 0`P@ DK 0  P@0W>@0 '@'@4@( 0Y00D8?0 P 0 =P@GV5U5E!?C0 S 0 ,PLW`= 0PHK0 k =0d PEP0@HK 0t?0 0 Pl 0DY1*<`8@p0p PYD V 0  PM `0d  @ 0  P?`F@P 0Y| 0 P,$0d  0H>0 0 P B'0d  D=0v 0 PW=@-0 W40 C03P0D[ 0SC* *J1#00 SP 0 yP=p0`PHK0 L=0D[@`FHK`=p0PHK` 0 RP<@0$P(0 PD[ 0U|:cd<@0X<@T,0 H<@0}<<@0y0<@0uP  0`P-V VB {pP@ 0 Px0TE 0 0 Po00d0@D0SV$ڄ 0 P_d;@0?X;d  0` 0 PMU `[P0d 00 0 P:0TDK 0 P. P 0DK P  0P40 @hjPC0`DK@ P0 @GP0DK 0S 0  PP  @PTT ypP`d 0 |P0VE 0 0sP00f0`F0TTD 0 dP$9@09@0 %@%P%PP0@@2 D;80` 0 >P40 C@0PH[V0 H[=0 0w PI@ 0 Ph%` 0 pD{@Pr7d @0  0 @ Pc 0 kP[ 0 PS@}% DK0` 0PE=H{0` 0S:p`F=0 ` 0H{=P- 0 P%FO% 0@  `DkpP=H0p 0S pG=0 p 0H P( 0 P"% 0 `@DK P=H{0` Y0Sp`F=0 ` 0H{ P| 0 gPP$ 0 D[ @@ZP=Hk0P ,@P=0PE P 0`Hk BP 0 P 0 2PH[R 0 (P@0 H[=0 0jP<<4@G8$0 `,4@0X 4@G$0 V 0 $@C4 0O 0 P_sp30= 0#@C3 0:P@ `PVV spP@ᾲ 0 P90TE 0 0P000d0@D0SV 0 P  0 Prp$ 0@C202"0 2@0 0 Prp2@02@|"0 lrpP@h 0 P0TE 0 0vP00d0@D0VV 0 gP 0 ^Pqp1@G!0 $@0@D 0X:k 0x!@Ct1 0h 0 <PLqpWD1D!0 b<` 80pt`hX(d0P@,ltxLx$H<( 0TDy @+I  W0W! ##000 +I W  +I WW" !" +I WW  # +I WR! +I WW! " +I W 0 ;I 0PPUD{ pqD0@ 0 @- MRA T  ,@0 4@(@@0 0404040040, Ѝ@M- (040 1Ѝ03/P A-PS`p@ W@0 V :0?s00@PU O"P(00@V:DG-pPWp:0 W/ : W/ : ` 0 PPϿ W*(00@0S  XT0 $"  P@QA-M{p$0P@S` 0(01$0,0v(`Vj0Sf(0S$P1,  0(0, V.400!PV, 0,0\Q U/  , / , 4TP(0T0(0 SP$PQ0(00,0Ѝ0F AP(,  (`, Q!:0,0 ?0, s0Q:$( ,00(0 SP$PU 0"00(00QA-M|`$0P@Sp 0(01$0,0w(pWk0Sg(0S$P1,  0(0, W/<0<00X$PU, 0,0\P U/r ! , /r !,(0 Q0QQ(0 SP$PQ0(00,0Ѝ0G P(,  (p, Q!:0 ,0?s010, Q:!( ,00(0 SP$PU 0"꒴00ꍴ(00QC-XP@S`A%Q 0<,&?G,q`pP@T`SA%QT0<(,? 3:QP   Q QP@ 0Q Ao0 (0 0 8 30ލp]  0-@-@R M00  BPP * Ѝ@Ѝ/ % Ѝ@Ѝ/l]PRp@- `@(PPWP0 ?p@JEꐱ00pPRp@- `@P`P5P0 ?p@+#n00pp@-@Q `P@PP0 ?p@N00pp@-P@P  p@ p@p@-@P 0PS <0S P 00p"00pQP@- 0R R  00p@-PP Q@ @Q Q QT00A D3200pP T0DS@pP p@-PP @P  T 000YiP IP NP4<@hP <00(S ~ 2010\nP 0Z PtЍ00XS <0X X000Z<00 0S @ tЍ:QPgRPDP R R4g +^ A ^* ~^P%b^1BP^  Pi ^    ` t  CgP 0 SO B ? p@ 04j D t4` B\ @,$ ( ` Z`0  QQK`FJSZ[h0SV|Z i@Pb @IjP] 0 ` 0+j0Sv P2g J @ W L 0?G0jS*k&0B: HKV  L ??GRH0s0  p @Ah?h=h;hgPP!    ! \TjP@ h@P T Q\00`C00A`R AQ6`s (  $ wBP^  P ^ P.< ` DR+P  @b `. V(P jP8P ``^ U P L^ZkeP P?4PKPeH7LLj  @ 0 $Q0H0"00 pW9 @YCpWKQ @<@  0@ X  X<<0@ X*0 00<0Xl 0 00PE p < 0P @d1 @R  <0 @    @ C# AH[ P~R 0 S$0 @B01` Z<0 080p@< p0p@ W\ p$@ @ <0p@0@@ T$@ pHXNKpW@d<@fP %h@P @gP0 @g0[@@ hP@40S Y Q @ g gg ggF}hPP}4PgPPsP e VVL C0?G /G[ 0W0j[0S ૴ {:S03V:gJ J 0 Qk6 C AH{{ *{0?G0 SWv{H0R 00 `: ૴jZ@4fff ffOK+$( ꃫ9 p PVL J J 0 Q{g ` ( 0V:0:g `  0 $\ 0 p 0\0< 0@0h D b0@ SZ CCG IH0S\0S{ ^ ^ NNJ ^MPtP  p`PP^` `PV LqG5@L{G {'Z{PPGP5VLP^  [ A5??|U  5L$0L AH $0G{{ *{0Se??GQp  @o pNWp@ 0 Sp3 0` Z1 <00 K@P ૴J ૴S\ 04@$ @ P@ TPR 5d@eD H0P 0 bSx20AaZ!1 <0 `05&L [ p@@ R RT R  P Ӑ.<00C<0Zde P<00<0b4@R@o04S0S0ST V@RePeNe LeJe 0S  0?G; * 0S5\  `P %46$ $PpL V$(@4R0y S QH0 H ' @ p 5?55?P9P VH0忋SKL R0SG?G 0jS  Q R*k&0B:H @ H H040L R0S0?G0kS0S0SzJfPY fPqL 0@S0?G0< kS:7SVddd ddhs 0S L 0?G0jSS+H0S Q) G H  p@ @/  P5 `PVp 0P P   $$P V0 P pl Ch0h 0 5T DP0P 0 ,< E808 0 #pJ 0ܥdJ ,@J ,0 0A@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-0r0000-w-x贩 00诩000S wS -S rS 0S /xS /  @-P@20 0肩 0 P P//0S/ S S/0S/0S/@-@ᴤ0@0T S R RT/ ?/PP/=?0PQ/?SQ $0p 0 @-/ءE  ??SQ $0p 0 @-/ሡE P P P`/AQ/Q/Q Q/?0 H0pD D0 @-Q/?S0?/0?/E QP00 / /@- 0  p@-FP 0 @C` Ө Pᦡ̨0SpƨP/H¨P`pp@-@PM0` ES aЍp 媨 P}壨0S p@-@PpP Q 0S PPG0SGp@-A-X Pp@PEX `@ᦥP``O- M` V$ p@KV P@ብ0P RV F!00`F `! Ѝ0 Ѝ0G`0-RBMM č dd  @T  { Pi  t ĝv(0 @-@-`@#Ms MP p $( rN TG " r @$@"p `PA0 "l2 0 $8 30ލ ЍSB^T"P@ 0$p 0 B^P.ᣞ!0 H100A@  0 Ù0 P \ AL+\ -L+*)B'&%$#"   \P  h\\\\\RD븾 |i u4i М $|? |dDh |g 0 $\   @010/C. * @    @RA-P(M`p |@ 0 @0@0 PP00T P@ 0 (Ѝ= =  0?G0 5CS  A/0cS#:3 3Q31:0CS! 2#0@-@P S 0\\0 0NO-MP` p @P-Y\ +Y @0G `ãp" @0Iq \ aIQW IAIQ7 IUTPRQ f@ 0T  R0 S` 0J0 0 ЍS T0 Ѝ0Y U Pi piAPpb0 0XQ 0@AA \QUPpbPpbBT0R"\0@-0 M< 00 Ѝ0@f@P T00P Ѝ0 p@-BR"^p@S@PT00PpO-Mp`@`P-T0P +T@`S0T W  p S   00b 0 0?0  0נ 0  Ѡ P @p P 6 Q P  S  R- !" P 00Bs ^a0BSW0BA0BS(70BS%| Y[  Q P  S  R!" m"00f"00 0S \0F00 ЍS@ `?0|0T0q XR 0AA B PR W  pd pp` `@p YWSppSBX0R"\0@-0 M@ 00 Ѝ0@&@PT00P Ѝ0D p@-BR"^p@@PT00Pp r  Q0?0S @-P-- MY ЍЍ/G-`P500PE !R !U5  MG 0SP೛PU pWU@@aPp X 00 00 @CpGp ᓛ00 蚤0 @0 0A-P`PL@L@H0 @p D6U  sI Aذ  qp@-@Pĕ00C0S S u P 0` P㻕p6`u@-@ᤕ 0`00@裕- M?  Ѝ0 A@ 0/O-QPM0p 0 Q0 Pߍ0( 0 A`P 3 0000ᗍP @000 " P> R R R#Y@0S 0D@T:@D0S Y@D k @p`Ś ` V@D[ R 2C0 0 00 R R0 S S ?pP   KoP@ ؠP  V[*0@`[W 1000  S S S S V *@ ` P 00(SB`F P` ``pḞ R @DpS0S CaJ q V p ឞ  T @D * 00B"(B`F Pr `BjxpTnH1H0@-pLM`P,! \ D - @.0 P) V) pp0 0] 0 VP lB 0 |0 0 D0 30LЍVPLpp  @ MBTN0p  0A-p`MP`@T) X ``00  0{VP "B 0 ЍX`` {@BT ЍMVP @길pwv0S/ 0S/p@-P 0@Sp0@` 0K00 Rp F``0Q00pO-p`#@\3OM TQd0 h`0410`1P0 Q 00T/00 Z.` P 20 00 [ .Q  Q\.Q O :!!PH [ 00:[.[<##=[0Q.S7 Y_0IS00X0 0IZ 00 0O 0 P00J `` <0 0C S::  ՘0 ` C:[ 0,$@(00000 0 `P$IP00 0 0 41 30Oߍ Z_00嫡004 <ᖮPPW U.R  :bP KM` L  ЄXs$ O-M Mʟ S0 :pxe0瀕0D50t50 X*0 00 !2S> 0(*0: 0 D5 30yݍ Ѝ90$0(0P @0( 0(0(>Z0  0% N@r p ΍ 0 00X81sUb(嗕 0X0PZ0.P  0 } @PR0 , 0 S<0S0(P@0(0c@T @(DP ?0H %@, ,4L @0(1Q *(@0P(0c P (0(@@C 0L0=0P  @0( J@0,(0Ȥ T Pl| d 0SA-@`M05 S Ѝ0p 0<PP4 מP/ 80 0P"P  0 0P>͞U 00S S 0p=Ở= 0 ŸO-` BM0M 00S0. SP p @0uG#"0 =/P @T*X@$ ඇ P 0 "2 0 4 30vBލЍ 0     ! /<@PH KPPC 8 0 0@P@P 000 00000 00@=T6 0p pIP 00S 0  0pW%  @% D 0  X= 0 R= 0  00S S I И wDw vG-Mp0`ם@P0P0 0   0 p`AP؝Ѝ 0 5PP A-M`pPᱝ@P , 0P (   0@ᵝЍ, 00Ѝ0@-RQ$M@8P'0S9 0S0S9  0 4 0 0 0@PP 00$Ѝ0R R" M/ 0 0$Ѝ00S B 0 00S000s S 04  0$ xsa O-DMPP d$0h X400<00 (:0P ,t@`pu<0 `@P ጆP ,0 0P0ç RR RR$ 0 0 Q Q R R d 0f0 P Hs P@p`@Q Q Q S*P JP 0Q@ (PC; @P 0`@ 0$R0 ?0IPB Z0  6 PE Q 1 ~  PEӗ U!:  PEpn0 Sh CF @`0  PE_ q [p5`᳗@U* @`;;[ 0  0H!41 0 <0 30DDЍ P8Z P2 0 0 0c0 B` @ `00;;  0 ; 000000 `@`@G8 hTS|S p@-MP@`80 00ɠ jЍpTT@-M@(9$  Ѝ@-MP`@pP0P0 D0) 8 00 @  NPЍ茜0@- M|@@PU l@P@@ D T 9 yP Ѝ0PU~00@((t!t A-p0M   `  @P 0S  0 C RA0,,0 C.SU 0 Ѝ R0 XR  9S S @ PE U   RW 48< 03?0 O-@P"P,M $  P / 0 h"`2 0 $0 30,Ѝ@"42 0 $0 30,ЍOqP:[ I= [? q0Pp P` @0 ᵈP00 `V+ @PUVP C `$pV氀0SN V0F S0 s Sb 0:[@  }P 0:UV 0S 0$ S ᰀ`@0S @$p` @.[P `$pVP 00  P @ P 700 0`Y 00 JUP'0S$: 0C000ᘉ<P`T 0S  0C`ÿ0  B0`V 00Y 00P BI 0 0 @0P u7000 00 b^ 0 V܃ SO- $M@H` \0 #p p 00 30@0H`# 0 B0S0 Q6  R00S B 0 PR ` 6 PP ᥎00[U X 000@PL  RWRY 00S ` R00 SR Tu*D00 Sm P^ TP`p^[  C 0P CTs ^a Q `  H`@幈3 QY/ P+ 0S " P 00S U0S S" S' S- PP 0R00S0 0nT $Ѝ`dP`V=W WS SSQ^ d6p@-@0P0FG p 00p0 @p0TSܖ00-M0 3/Ѝ/ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ R R R //00/00/ R R R //00/00/ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ 0@-RP M@ R R Ѝ0003/P PP Ѝ00P03/P 0@-RP M@ R R Ѝ0003/P PP Ѝ00P03/P @-RM@ R R Ѝ003/P 00S00Ѝ0 0S0003/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/ЍR0 p@-@PPeP P0 03/P U 0 xp@ 0/003/P U 0 <p@0/@oppp/A-PM@Qp` Q Q Ѝ0 03/P V*PX 94000  0003/P P P PЍAR X P3 P` }0SP 4= ;A-Pp`@P  R 0 R 0\A/W 0A/0A-@MS`pP  SV ᩏ P RPU U U Ѝ3000SP Ѝ VP 0SPU3 2 P`X;(#00@-S M@P S S Ѝ00 03/P 003/P  0 Ѝ00 00 03/P 003/ Ѝ000@-S M@P S S Ѝ00 03/P 003/P  0 Ѝ00 00 03/P 003/ Ѝ0@-M@P0.S00Ѝ@-M@p@Ѝ R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//0 0 /k L0 0 /j 8p/0/ 40/0/O-M0Sg Ő@P `%!E , ,L R^ Q XY@.PR @PU XM@RAS0SI <  cSB!  S   X9"S`Pڴp@@ P pG -W`W0P@|Wd `@FT0S0S V *000FЍ0X`.00Ƅ(00AQQ!X@R p P\ ! C]R" X @D#cd`!2br   D"2b20Dr 210D0Ls 0;S!S" Cr 9" X00Ls`@S \S X 0@@SQ P`Sp pg 'h0`0xpg '0!"4`0k 00dH!HlHFO-$MhY@ Lt 0`pP`([Y= P @d0Q P @ 0Q㓐) P @ YT* PYw [\Yp .Y0D0CtXr0Q S.Qk ` P@] rPh  IZN0xSK2 000 B P0XY /Qh ]QMP R00   0 ]R' PR " XYnP   R J b"r R Z zA @ R] .RP`@N@ P0D0C X1A(00$Ѝ;00P   Z 4   \  PYX R0Q  S0 T 4* @DT\@YX(@ X00ɅS ` T`4* @DT\@YX f xd0G-pAQ@<*0S% R3 @R`0P0 0W*  0s00ᘠ    P 0 S00NAS 0SP!0QPP00W(00b  RO- MP3P#RP30U p`\ @0I @R: R R& p(000 ЍQ*@ ĠS? A @ G0RP@R\ 4 R @4 S0A Y*@T*0P.0 A\ R!"ɑ 40S0 4 0- M ЍO-pS,M@ [ p 0pS 0S0P^h @^W \bSP0[p0Cp00`p 0$PU P0S @Sg  W@ΆU `PU00 S 0Y* 0 B>\ A XP 00M X"0 Ġ?  0P R SAS"`!0PU`00\ڛ(00,ЍPᔏ(00P0S 0Q * 0F S 0S 0 `  0AUf0S " ! WE@_X0y  ABQ AAE\ Q Ԁ  r  0B>S. 0A 0 S*P R0 S P\0^$p  ?0B,40[p 00%000 0RLP00$H{ p@-P0 M `00 1000qp !@p < 40 0 1 30ލp@:Z Z A- `0M P@(q0 0 100p 0 p0 (0 0 1 30ލy:@Z Y Q:/R/0S/S:00/@-\@3#* 0^ @R R R (000S0QA^ R! Q 0Q @-A?S SAQ  0SLBi00d(00N/G-p@`0TS'  V WT P@0TS P?^ 7002(000QSp@-P@` P@ݙP`V  0R p/pA-APUQ?UU@A`pP W ځ1AP(0000?00Q A@-?S SBR 0@S Aˍ00ƍ(00/-- M ЍЍ/@-M@ ip TЍR/0-S0 \ S 0^C00O- M@P ` P-Yc +YQ0Yd T@ @Q Y9`paTPO9`pTP" [)SQ" K0Iq P0aIQW0IAIQ70IS| V[SQ;+*%0S \0J00 Ѝ`Q0YXP  0LA@ ^P @T@@BT0R"\0@-0 M< 00 Ѝ0@b@PT00P Ѝ0R p@-BR"^p@O@P׌T00PpA-p 0rM @P`0^010X0pA00tAi0O00  TAV ϠPOP $04 @ $00 1 30rߍR8Q PQ 00- $  M  Ѝ Q  -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/P O-QPM@ ^ 0pS000!R !3  {PP E``#Q9\*Q30A 0#1#2#4#8 + P2   0U A 00 pQ%IP 0@pQ 0S  Ѝ 0T @00Ѝ0 0A-@P`pM}0 PN}$0M 000Ѝ*TN T00 0p@-00Sh@@@pXPXXPcQ@P)@P ?P D N tМ| p@-P@ᮋ p@A-Pp`7t@t@0h@ `U  0<0 yh,  ALHM x :@-@*P0S 3/000S@蔋 A-P p@` F  o000 ,*@P p@-@PzPpp@!P1p@- BMa@0PD`040 E 7PU h10S ` 0L!  P4A0@ P; 1 0 w 0 0 4 30/Bލp+P )`P  6/P Q Q |0 0vl0 00P 0 0  `[6K K *(?#cb m!"b[n!3: bQmn! 13c.c0 mA #c[ 3nA3: c2nASm1@  00C@aa0C0C Cr  \< @P0$DHd(T,@VR gR 0` Z` 0 Sx 0W0 `0R C S`` 0 `0 IISQ0C 0 B2:00P/A!b  xW0 `0R C W 0II Q B 0/C!b`: 00PWW0 `0R C S0 ~`0Q 0900P5W0 `0R C W0 \`w ~0Q 0H900PWe0 `0R C^ Wa* *BQ0/800P b bR  WE0 `0R C> SA0Q 0p800PW-0 `0R C& S),0 `0 l_`7Q 00P  W0 `0R C W* *BQ0P / b bR  D' 0 W0 `0R C W Q0P  & 0 qW0 `0R C W Q(0P &  0 WW0 `0R C WU PUP Q0P  & 0 6W0 `0R C S 0Q 0500PWt0 `0R Cm Sp0X*c Pc 0+; x040% WU0 `0R CN SQ 0W0 S0 ՜ W>G0`0QC5 R`1W.x0 `0R C% W(0051E!2 Cd0bSӢ Rӣd B3PR  b0  W0 `0R C S 0X   pXX0 S0R05`0P 0(30}W0 `0R C S0 `0P S0020[W0 `0R C WWd0 `0R C W80 s` 0SX @ Uqp z qpm 0@P1  0S! -RC SAT! P1QH<00ϠPWl  `(,1Q$ `PAP W60 `0R C/ S20 `"> = < |dL$P$0h   0 \ 0S  P  0P W G P ` QBP0l #`0 SD 1hW0 `0R C S0S4 1W0 `0R C S0S$ W0 `0R C W 0UP u! 20LII< @P$D?HA1cd(0T,@X%!E_d2dN`Re0eϠl 0 bSӢd Rӣd B2PR  b0  WF0 `0R C? WB0Q3 00PW00 `0R C) W,o 0P? 0``:#` . A-M@pP`Ă400 p00@00pT p`ᲂpFЍ謂"00Ѝ(@- @MЍT) C-Pd@ M`0`@p @@0  @  Ѝ ) 4C-@`P M\0`Pp <(0 @  Ѝ( 4p@-0L| ^ࠓ P0L|@ T.^FT00p^p=00pp@-@0M-S` +S`P0 P& 0.00:S V00c0Ѝp;0 P <0!" :R P 0 00Ѝp@-@0JS( MS 00C S! m1 P 0/S <0  0 P 0.S 0 }P 0.S  m1  p@0 f0@-e)P L@,(@l^3f*Sk Sq @ B 0T@ҜS_e P#Q@P Q\< 0\QTP@# N$0,@L ^0#S S 0@0C @l^#3S0@0@;S0C^:= 0ܩ0 P /0S/ 0 S/0S/0S0@//O--M014   S j H叇"/[7Kk6 H`<0a/QH#x "xH q~~N`AN0S."w ?'P P00 #1?B! 0/Z0S< # JL"p J㩀A0S/ ̃? , R  " R0 0.1>0 Z0S P * *Ba AdϠ ϬT R @SX@tT)|rLk NQ @\O(@N(  @,\H0@ $ m@q P@P!PP"gף pC@)n$A[ O@:(@`&! P,$3#`_0RS@0@ oS^T\HNQ @ \O(@N(  @, )|`rL$0@ `@H@mHQ!P%W׳ pC  @*n$A Q O@:( P %! P,$3#` 0SoS0@pE)L\HNQ @ pC$  @(T0" R P`[ Ϡ! +P@. PP` @ R  Ϡ ,ό@ ` ` ቢভ` fR$  ` & , Ό(` Y`3`# 0C Qp| , SWT08?OX 0\ cSQsH0;SeER0/H ;0S0 ;0 H0`8 t@QqHPd 80< UTM WVU V0780P@`<0Pp? 00?0S  S   80<  ;/P80< SRS@PV0C~00 3 0S< Hu T~T00ЍWV `VpcK80S Tz! @T!Sz[U0 SR Z 00SJF|Flmph`0 `pQ Y:Q@PTJ#M @A8剱<Ϭ P ;N0Q8 5@0\?5O0(<2@ 0>;N$0S33K051E00)w(.L@x?ᏒL`F8c@c0CV;kYC00#,Ƞ @B@- c 0w(: 6S X00[$0/!+>0 (A O!2c0Xÿ0+" ?00 #2>[?`FW'@ PG`m1%0p:#0  ό"!/ W n13:$  p C0!".#2R> ' @01 30 #1`0U05? B4sppp00/S [U c 0,w(: 6(aS X00[$0/!+>0 oÂ!`2c0Xÿ0+" ?00 #2>`T[j@tc 0$  v$: 6S T00Z$0 *>Â!2c@T0:#I0$BNo :s0c (a  ov(: 6S X00[$0 +>`!2cX0;#0(``8?O0 ` cQ0 R$I"ITY BqgqgpC(1 ? c 00v0(: 6S X00Y$0! )>0%!EÂ!2c0)XLß8\?H)" ?00 #2>r?E$0CI"I0P0/A!b,!b S3 1I B !.50c((H<" 2c0 4S/  `00 \000U PE 0 S0 0(0 P P$0<Ѝ8\?H.+N)<2LQ @ 3 \O!EOό"!/ T(@[:.+N0 pC#". RD 7 0@0 030#!R̂"*h  “5.2L O\, 0C8PC@D10@e-0P00040tc )1 ?00u0):6S Y00X$0%(>!E!2c(\/H)L0Y("1 #2>N<`pc0qzT 0 ~@-M@00P T 00t0(0Ѝ 00p08 O-@P`M 0S7  V 02[? Pu 0PP ΌQP 0`O2%> 0!"R<0  0 S0  Q00v@z00Ѝ0 S. 0P0' V 0V"> PCu 0PP ΌQP 02%> 09`0OR!"3 0V @ 0 Rh!Y0h&P l6Ym&N # ⊡0 GP 0V000 PS?S00SPuu0 P800p0(0i P?S00Y`H UĊO-`p+FMM@PF  0 1 0:S0@/S' t:0@PP?P#5*H  0I0`p0P/S .2gP T0.S0S/SOI@@@P & ?I0+PPP*F: 0 0 30FۍߍP*0p 0 Z*Z:Z4Z$ Z4*Z4 KRo$*Z #Z1 "*Z$!Z$ ! *ZZ *Z$Z*Z *Z$ Z*Z Z *Z$ ZT*ZQ Z *Z$ Z$!1QP}Y*1R @  ,^\- 0C0:0@ A D 0勰S 0 0OI^H@Z pPUxPf0`p00S00ç0s0S] PWUSXUPTH )JD Y@Z <*  Q H m` 3N(@p $P,00`4[`Q0 < P4"<Q$1\p. `LQaPV RPPP@Y ! 0 ,0@~$H \@^ PP>xP  Q`0Q$4 Q$!?8:Z S00C08*S R R P8ZC P00s L p@x̔\& NhCE;E> 0@ 0W㉱@ 10<@W9  *uP0WP@/0Y@0\0B0 pS.0h! /O0 BSP PsP t\<U02p嘮0A  LP@X 0 R 0SZ0Q∑X }Q!爁 000  0P\ 0 # 0 C!@0yn@@F ,h  Q^7 Q Q@Q@QDQQ^"R hNB 僟AhN $0 Hn $0@  Q J0ph@ $,P(0$0`\S 0 * 4"< Q$1 WU [[ P U0 @ p \`0\$4 \$!? K[ (0$@ T F nQ R S  0I0B0 0:0@ 0Sp`@(Fo0 R !0S P r1Q N hp m0P@UG A# 02 ?0cQ00 R"  O-@0MP<SH0@SЍ0S >Sp@0GSh>`P [ 0hS01Ӄ!0 "0SmY,Ih0  000 001Y# <Y60`S0S >S@5S*S0S -S0 C Rp@0GN<)hh0 `Lhlpt mЍ*YY -Y00I S@0IS0   S ,S;SQhAl d ;S,Sc Sjh^&- Q 019mPhjp0 pK19mo\Ϭh6PcRp9l ukt bhp& l&w& 000 @ 0N\hPl@PP l @h P 1 0 0? 10/p00P 0,S0,0P 0Sh lub$ `(p&{,t.Ol6(w60h参@0 l0O ' @< . /O@ 0Tp)0`L4@岷@`p80 `y@x0X 0H!S1ð1Rp0`4@ A-PQ@B 0S !1h ? @p Dh6l6 `N`P 0:S LP XpHPhnW !oP0PT`X\PNLg@_`PaP`T`P sPA-`PA@pP nPPPWpPqpATW  P>UH QP |1`0t!t0V ;00ӏB m``@ v]=D0C0C P S\@0d@D/  @DK0?P0S00#  1PWPࣶ IK0U0h,s&P@P0L 0Hp0 ;0B<X<$<Dr T;$:p` :0@-\$0$0@!R !R T:И @-\F<l0hN 0Q S \Pr 0 \ F<h0 0Q Sp/@-r 0 @-$@@e(@ @-@@ @꬗ @-d@p@-PP  @`PPprP`W0 +p@-PH@@<d0 E?Pp P8p@-@`PT000SDd80 @p蔖 87D 0@- M@PF0 @wP00p0(0 Ѝ0m@-M@540 EόcP00p0(0Ѝ47Tm0@- M@PP0  EόMP T $00t0(0 Ѝ000p06llp@-M@`P0 P1P T 00t0(0Ѝp 00p0lhlp@-@G-dUt00QU d 0P@H3p00 P@ꔔ 5D `p@-@PP 4 0p@0 p@lp@-@QP0 0P 4 0p@0 p@P0 0p@-@PP0 00 p@L $@-4M*b`0@b P `*M$ 0pT0 0Sp`4Ѝ0@-P X\0H@P@@̌ 2P0p@-@P000S 00Q 0"*X  T 0SZHp<02@T_bc `3L3 |G-@pPb0jX` T]0SZ 0 P K0SZ 0R 0  S \Z^ UT0S ˜ ST0P 0  ^ 0SZ 0TUT@@@ 02 ^?<02 P?<0p@-Pp@d000S T00P  0xP@0pbX 00 H0 @D0- P000^ N$ D0@-0@0S $000S 3/k411p@-p?LP@TpP  0 3/P q@Tpl0A-0`pP5@P UP q( p?p `@0G-@R p@@T ` @D◆%:/PPA-`p@PpT  P t`P @L2L€000#S €^"R/h//0O-`A Mℱp@|| P2 0P2LB?0T- P R; S P@T" V0S !Q L/`3/L2 S1P2S? T030# T 03Sp0p0@T@@P20CP2]P2SW pW ЍS @  L3/L2 S @....0.-l- [A- p0`Q M0010.P@ `0xQ80|Q8OO8V@1@@ @V FTAϠO=0@H @0 0 1 30ލ?oT 0  0- 0 M Ѝ  -<0< -0M$0 0 0ЍЍ/H 0--M0 ЍЍ/0 0p@-P@XW``00C`0Sp S u P X0` X PXN`pX2`u \0 X0`00C`0SppSr P X0X /X0 -404-0 M  X ЍЍ/ -4 4- M00 XЍ Ѝ/t G-p R`@:Q !SJ Yp_0"P U U * meJ0`00~+P2P _e 0 B 0 0_ P0PU` ``Pa+P IjpC0 00 _Fn0T @0 0_ Ijp--M  -Ѝ Ѝ/ -- M0 0; ЍЍ/@- $MPw*pp`P3 {@P0 !0P(/S!ʬ0`@0 0 0 0 00  $Ѝ 0b$Ѝvm0000@$Ѝ( 4 @-@0_0SC5_p@-P`@i R T0U:T0T:p@duRRR@-p00p@-@!PR ! 00 0S uP0B`Q0AP R 0 U00Sp]P0\P `\P 0 um 00 RA-` P$@ R0 ,°00aRK 0  a0R00S 00@0A PA05\ &l plL<0@^㖌 1c000A X \00X00S PAA0 S< =<;:97310/.-,+)('%#" wsrq" %: spR V@8VL0V & a0 Q V  T  4ЍPPؠPPؠ0 ## 0B Q00C$RNK P00[  x3 0S0V `1!'  x 0SM0V `1!  x 0S60V `1!  x 0S p 00B S0 @#"00B 0B Q$R8 x 0S p V0`1 ! xO 0S 0V `1!xX 0S0V `1!0 *RS 0B@ Q 00B S@@@ x: 0S0V `1! x  0S0V `1!    x 0S pD 0V `1!dx$ 0S0V `1!W V  x 0S]0V `1!F +  x 0S p (  xz 0S px) 0S0V `1!x+ 0S0V `1! x 0S0V `1!xn 0S px 0S p 0V `1! py yp rp kp& dp ]p Vp"s R 0I0py V@ `1 | x 0S0V `1! | xm 0S #pT 0V `1!t ; x 0S40V `1!e ; xX 0S p/ T- w * p# p$ p7 p#l x 0S0V `1!'P x 0S p[ x 0S0V `1!  xi 0S p 0V `1!$R 0@C p7 x 0S p 0V `1!x 0S0V `1!x 0S cpx! 0S Wp@ x 0S Ipz 0V `1!  x  0S 4pe 0V `1! PZ X PU S PP N pG PD B P? = P: 8 0B Q@  "0 B  0B P$Rh x R 00p V@b P ] p  P Q p pO p P 7 P 2 P - P ( P # P  P  P  P  P 0s 0 S p  0V@`1! P $Ry@00 P  P  P  P  P  P ~ P{ y Pv t Pq o Pl j Pg e Pb ` P] [x 0S pP 0V `1!p PE C P@ > P; 9 P6 4 P1 |/O-MM@` `'L0\7 X006000X!R !00v0d00  0S   R 6`堠0$0h000 D00 찍@C0,400㘰H0l \  PU @%U 0T  `- J 0 R 00S0,U` `0~0-10P(0 0FZS񏐅%~|{ x"#u1jihgfed9b'k}\[ZYWV0TSRFPNMKJIHGFEDBK]"&9'72.-+PVP    RV00sR P+>Rh1RhOh.LQ]T f 0@E` XT,dD|ύ @8Hˠ@`P`dVP``0@ 0@00+00F@ p`4$00F S$V (@HPU" 0T$0$S JUD0S DN0p0@0S0000WW @"2 0 6 30 ܍Ѝ$pGT0GCP P <40    S 0S0q-0~0X4 0 0 @TX@@,R00Sg~0}@0TP<8:P40 L@ * Q h 1 4X P~T0 00 00RPPU  0\n@  dpd` F0 dRK R~0 T P<8P40 L@a *6 Q  1 4 ܾ ,l  954842@21,X W W dV `U V/ ~ 0a P~0 0 @T0P0<080-!(R     Q @ Rj  `AV2S 000S~0000P,-1S 000SK?000,100P,R& 00@DTm 0 00p0000S 0 (0 PCU5@0P00,0080X@@0S 4 1 04080S0  7R10Pp D0P0CH0 i0PD0 0S-0~00s<0 ` $ 0p@PB0tp@`,PpK[ R@ PK[ p@ `tp>Q`000P,P GBP wT 4$0 pp`C,Php@`K[ \PK [pp @?Q@000_P,YKP FBP 6$@DAP0DCPa , ?Q0P0RP $@D+P0DCP@00HX 0Snd00`0 0QHp0@0 SH,  @H0TlP>0  Vڬ>$0t@PAp @,`K[ R PK[ p `t@>^0`0~0O$0 CBP  O0FCP U $0 }`@Cp,p@ PEUW0S`0P  O0DCP l$PEp vO0Ep CP] `$PEp jO0Ep CPg T000Sx<00000P, 000 d00000S00P,@T$000 S0p00+S>l, 0*|P0@ 0S $@D O0DCPl>, 000 S $@DN0DCP, H0p0C0H  @HTTڜz$p,Pp`K  @DT0\0Sa0 S R@D00000 00004D00NS `V~0yp  @ T@ 0 P@<@/P~0,|$@DN0DCPE  P0\00 0<p R Rndp 0! , 00g 0@!0 00 0g @0SQ000GpB gN0KCP RE@< A Q 40PA 0P0PTQ00\0S 008 p0T0 0\80$`0, Sp[Q 8[KJ0CQ PZ 0PLUPU ڜpPQA U@A@TTFPpP p<0@IY QpPPIY  @<0PpT^@) M FBP P F<0M F<0BP F<0M FBP <0Pw lZ0Tڌ5 8p0`$0PCp`@,P K[\P wM FBP b$@DmM0DCPd X< 010R0bB+ S- C S1! N L ccS!2f00 ` a000AF0NQ*pNn0 V00Cl0l T~0 0 0 Dp@ T@0 P@/<@ F<0+M FBP <0L04 00 4  L0OQ 40PQ4 L0404L0X@~@eVQ4 L0404L0SL401LS`-0~0͵X4 +0 0K$PEp LEA0P,~0p 8p @`2R@0 00xP,r000 Dp/ \ @T P 8 ;0\ P4 00<p \0/n}P\ L\ 8\L<P@P`#pI" . @S ,eO&Q!Q@!Z0I Q S 00Q00S 0 08<@P`< p00000np\ dpT S S pR dQ XP xO M M TJ $G vvuA dr> xqL ' ) Q 40 41Ϡ~   a S 4y  Q9 40P    Qp 40 41Ϡ\  S 4S4L10ϠL 00q4p `VDqp0~0.\ RX <A R R R< 0\ PT0 0 @Dp8@/ Gqp 0 P,$@DK0DCP $PEK0ECP $@DK0DCPF 8 00 ER 0 2! 00Bl0IS 1(0`p x08 $@DzK0DCP! et@d c $0`0p`PCp@`,P K[\P $@DHK0DCP 3SL04pL0p0IQ 440L04ppL0$Q 440L04ppL0QS 40P1sSL44 01LQ4L0404 L0aQ4L0404 L0U  Qf 40P1Ϡkp$@DJ DB0P,LupH <@BOK$@DJ0DCP 4 0@ Py `00p 0S2L0 ( L0/ 5R 0@00@pJ FBPM @vp<^/Dp@ TP pI000I0S0 00 @0p\\p00Wp!2 0@0( @ L LPnĎPc. D 0S." 5 0001? PwL0P00L0L0PL01L0 400L0L0 400L0L00LTSL04L0004 'L0LRT? ` RX $ A0p@ 0@00Q 4 P4@,Q 4 JQ 4 P1glD `00p[ 0  0L0PL0P[ 0  0L0PpL0n$@DI0DCP@,~@K SL044 L000 0l0b L 40L Ϡ L0PpL0>L 40L Ϡ L P0ϠL  T P Dt`00F SG@ 4$00A S$Q0"S, ` : SL044 L000b3[ 0  0Y0Sl `4@| 0@00;S4L0 44L0k `00IpX 0SL0L0 @ @-` MDP@pUL8P0 PSL Ѝ訊 A-@P`p=L0 P>LO--0p@j/ Pck] @  O (jY: 0D @0S0C CUZ0S  U #R   CU&b # 3S RUY *CUR"W * W@`pG@0S0@FZ`U00 E000DTY:?C0C1  0OW1 0S  ` 0SQ @e@`}멟P/ P P0SA0D@  R=U0 0U,  sR  Y 0D@ R(U 0U  sR Y0D@ RU 0U  sR 0 0000D@ 0 `?$i iO-`-pЄ4KUDM 0Sp00 @P`U0ʳ?G @ 0 X @ YR YH 8<X`P *:8 R ?CH{0CQ; +c{7! G: A{ ZZ`PEU BBF3 _JRx0$000P(00I W?o2,0BWpG G0RM30 Z70  DЍOa<00C QA@a a40CG{A0$0Z0b000U0P0C00eP(0*@P PDЍIoᩒቐo0PE$0 0p00004 0<0Sv Rsʼ10[ 00Ӣ?+ [ +b +XP97@0000  Q0@DЍ   4 [ 00@P 00[00WY  0 R S~<0SD0SAʴ [4 4 0 @ DЍOaCoc?`(?yPD?X  Te7d^ R  RC086hg0P0]  R00Z00S R0 0HJ B (Q 0S 0P0B P0P(0= (0`>0P5 U ,W   `R `  0 0 Rd1 H;0""1 0 1 00!;R 0Q ` ++$ R +kJ:[ {{+S 5AH  04+C 0S021;Se 0[{ * r0  qK; P4 `a{+* p 0  J+t+Z SP0CTF  s9R  0r @ S0: {{+S 5A 1+C r 'a J0H+0 |30 c0""1!ha+ 300 Q+b P+a+z E XFZL$ R[ RZp `PY  0PP0S0S1 Wp 0pYJ Y 0*`P= 0d0P8X& H Y9R  p e(`P$(0 (0`P 0P  00P0 4 0[ G 4L QU  D $ P,@ p( Vp 0@+P R-  IPQP (0 SY[Q 0P,@P/Z 0SZ ' P@!U 00 G E[ b000PP @  1 0S0P ,W  qP (0!n(0 `O;cD +0{* p@ 0 r  +s  Pq 4J<0 R0?00Su0 00\ `;0  Q `{ A *N pN@  BB*N*0 r  P@y< `  s0R 00P@0m[s$0S@  `P 0Z  0P0 P00P00H Y0R p-0 PP    !M0P P  D0b0$$0$0Pg0 0C0`P 0S$04 R[ G 4W4 #[0Sk 0  g QQ00S Y Y~ R0P,@0`P 00P9UP 1P[ 4Q0:00C00+b {+ { +S 5@0P00   1 0Q Y6 Y p b -* P0 PR Y[>0S 0  7 Q$Y0P,@y 9UPPvp9   RQ R !**R UP0 P@ iP @f 0S]P@^ R `  p 1 @0;q8p0P,@0P9U,@ [1P* 4   6+S#S/\S//P@-@00@ R P@Rp@-@`0P0PR* 0PpP R 0 R VpP0 @! 0O- MPSWPE@!a0p  IQ V`":0  ơ R  RW0  * 0 S 00CX:XPE* R P  P  00S 0S W0*!1R 0CX:XPE* R P` ЍP0.- UM,@00L10WK    MX 0 `P  A kQPDp 0@-P@-P@-Qp@-P` 0E` R @P  K00pQ`0`p@-`hOP@P  Kp-M ЍpFF|~pq1hpqpq1`p- MV ЍP/> 3D-@"M @Ϡ#90c 0ZЍ0 00/$n -M  0 +p`Ѝ  p@-0@Q r P p0 S!P00py PP    !J @0O-M`pD@0DQ00P;5X# @0S S] @   b 0P1  P  0- T@@  0  "W @TQ 0P@020  0 W`h ЍQe @0R AX00@P00  L 0`00R-@0QMW 0000`VBoPQEp0 0 `b| V 0 <T@P@00R"000@000# @^ 0Sd0T 02ax PP @ 0"0! #000 @lx`@P 0Q/ R  B /A-`0@bSP)p`B @@AV * D0 BS   `3R0 pg3701@V * CQ B   R E PPO-p -@|M0;0 0 M0 d p Pl0-P-+*)('&%$ MT000P0$0 00@ S0000S`@ #T0`Cڜ T0 @l@00@ S0\ ( EQ $00 lp0l00+S9 -S40400l000C ^0Slll00S 1C\c,X 0d, 0 A(0S S ?o280jTg@Xpp Xaڐ* 9 g01+S5[X(0S (0vSj( %0hSpHp t0$0pH $h) Pp t0h0t0 pLW t0 h0t0 A<  R Q4 pCW pp Whpw"0h000004 St  <00S^40<000 0 ˷00 (0, S  J ?, D0LL@ Ph    !&Hp0 @P] p0   !HhPtp E `PN R P4,0D0, C0ED PP PE0CPpPU00 S 0SPEpGK,0SaEQ)3(0SoWg[  `P   PP 0S0SI p 80P S X 0S#C W <04 S0d0 p [c0[` KpQ 0Z00S@00P0L0h 0#Z00St0H0I `\@ 0P$0 \QJL[pp  !J $p Pp 0 S B\:<04 Sh  Bh $  XH0h t00@0C?oQ20S K x!)I Zɋ0S     0Sp|Ѝ 00XS PlP0P P0$01p Ql000Sd00d0R cpd d|Ѝ $ ( RiS IS NSl@8P l 0000(S0d0 0p 00nS 0p lpd0P+  ^PJT l 0g 0C ^(^l00l00(0pHpWt0$0@WD  @P {lp,000l0Pl P00W'"!,1HC0 AQ:S:?C0C0  ላ  RQzGpGp4656:H  000 S  QH 0S l00S l 1CQ;l00C P 6&V瞯<(h :T;80Cl00C Y' >.l00C0N YL\,4Q,a,p Ppu h00h0l@ZP3 l00Cl0Q Pl00l000000p d0sS(0pHpt0$0pg  4101 p W'"l1HC0 AQ:S:?C0C0  ላ  RQzGpGp4656:H \ 200 S  U80H 0d000KPt0$0pHW p201 툋 4P^>  OW 0@P0I$Pp  B\ 0S. h 0 h 0R00`P n0P$0 $0@ > P DPp2 Pp <0t $0C B<0t p:00 W0 0P0 ዴH^@UZ80{S相zI8] SM Oa0P$0y  p  d0P 0d00Sh0K0S pPp\  t00C t0  0V TRLPNt0 R# 00S S SJ p? 000 p  d"!@Q*M000  0c2300p S 00S 00P0d0M"000Sd0000d0 @0 pBpPp 0h0t00Ct0!HR00p0  0d0M"0 000000`@!0@d0 0P0I040008000c80  LTIT R0l 000p0PdA 0p Slp 0pD A <0p0<0t $ t X ,00 [d K P p <0h0Ct0 Pp{ !T T  TTQʽ (H^,t0 :( S<10:t$6t00`0l!5S00 8(! d  刋 H P9 J[@0P 0@00 bP :相[ p0000 P (@I @Q X@X @Ӕ(@ XcQ 0ӓ" 208 ,  J1 d000! ` `3P x3d  80(00hA1! 0 ` `` `P ^4A); \0t0$050`lS !00d0K AWW k 0S h0p |Q0x40  0 0Ch t0!0d0,W aZ!0d0!0< 4R0PP @Pt0 p 0Cht00d0Ppp04000P0d0I@  000p d0Sd0S`  p 000040t0P0d00Z!05 d000# [00Sp 0 WZ W0d00  3S 00d0 2Pp  h`1`f`Ph00h0!0d0<04 pSd 0S!0d00S00000t0h 0Ct0s@-}00G-` 0pQ`pp@PO PP`q0s #8z *8 "80 W# G0 BW`E   3aV F@0Rs#8ḐA)80A#Y 0U 1 PP P`P    !YB@P@3ßO-0M@p 00S 21`C`0 000S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WJ:Q0 X  \60QR T0#03\0SuWa* G0V*0F@S3 F\   J0WN 06S ЍW*@DPD@ Q0; Q0Q l@ l@4 Q:@00XS Q0nM)ARo 婒Y" 0^0 n12000 QP0Q0l 1 c0R:|00Q )Q 08L O-M<0 THT8@`00Sp 00Qt0P00Q  EB0SG^E@0= PQa @0 \ ES YH P 0S S SC `Pb@0@00 00Vp@ !IT q Pe 0@S50000S Y 0 @PQb R  BPQa S@0D0CSڣ0SPW 0S] $E00TY0 p0TDX@N S0T0@ T  BB! BcP DRy`0 S0 S C U 0S S S IP@"00ЍRq  BPQ+Q~ -Q  NQ @N AY  ^!#AAPPn(@Ѝ P 0QP0Q 0S00 MS S80S 000 b@0 05I"00@By`P D` 212 Q`rQ  Q P PR  @V 0Sf Sg S @00ЍaF PePft0 S_H@"00ЍP@0M@EPL K`"VpK`W `2 p 1 PE@7`BQ@!80Sj80S 000i U U EP 80S800c8080S `T0)  RP!@L#80SU80S Q0   B @P Pwj 0`e  BR "@`P3 `2d"P1 5 8C RP`.pn3 ^P W0@00 pU 0`PEPU 0 BP @` pV  p0 BP0U`0@-@-P M a@] 0 B 0C2S* Q*KU AZBKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ iG0"S1 1  !2R / 3RS/00 |0 c R\0a X0 c R80A 40 c R/dD؏ A-PU0000`A1 !0T a2!!p(  T2!ERA!1! 0T T0E1 CSB10R 00@-@MS: P @  0Q P~@ЍA-P aM1`p0S3 U10AT !0S 000 @T0  0S 0CЍ0@0D!1S<000S 000(; tHp p@-@P00p R pPQ`00App@dD `r80 0QApp@f9 tHh0  0#10/sP#8s R#4#2#10 0// /A-`P@100("@Up0p 0S1pP@P;pP    !D=`~P081#3S412s2sS/1J //@-@P0@0O-0MZ  @SpPA PaU* F B  E  ^'* 0H X0C0003 00ZP@T   `d`` XZ P` @T@T 06S @ЍG-0؁@pQ$A/ QPiV&10SO`P[ 1q0i000S h1h {0P4 p@ PU `@00SbPP# 000S 0>09PU 0C  pPpd0'iV0S 80 (0R0i 5 txH G-`P塢0P@Tڃ0T P$ Zp !pD0  i )  \2!0L\0C0003R @@JpG \ -0P1 0^$23\ *G-P@p0@DTE1  0\D*32P ::P  @a P@0 0S 0SQ 0PApPEQ%Q  3!!@ V 0 0S03#V`F `F` 02NS @0@PpP 0!QQ!P3 p@- @A`DPD P 0`0R @ *\ l0D1R 56 501 P56 +CpR `C5<5#11C<C-` MYP=@P YzY0W6X0 W   0 C~GpGp50cp0 Ѝ  0P c2# R   W C>C0C012`0S0/0 R /@-?8aPM`8@nPP5 ᑭpP/0 S Q/ p! 0: S(QP 0uPP@0 00x0  0 0 m ЍC00Ѝ\PC00CO00 / 4 ㉮p@-@500C0S0 P5pP  B R /@-0rSL wS aS@ C 0 @0S! e C+Sr0 SR)# @0S@@0S0S0S0S@0p@-S6 @4P00 P! !( 0S 3/PP೼000P @ P 00 00 !!4 0?OB 0pC2PCP 0000@-@!R !P 0C 0 0 S /%2p@-@Q1P00SD 0  QO ;000S% 0'$0 3/0:s00P0p00P @ P /00< R 8000S20 0PFP1P 00s0 0@0 00 pB0 @0 0* t-Ѝ/@-A@QS S S vB 0 6@@0@a6@@0@a6@@0@u0 0 0; B0/0P 0p/@-HB/41S C-@ -  !`0p EMD2/D d0 @"l f#0a 0VfgPx4p`T!dRAbPPa`k{8'<H0L0p&` &BZj XhCVf0T!dPa`C'RAbp@VfBTdA/ CGˍۍ pf APM_m[PQ 0kfPVpQ 0`fPKQ 0VfPA Q 0LfP7Q 0BfP-Q 08fP#Q 0.fPPQ 0#fPY`Eߍ /AOA,aQ@-P @41S + P *P0gAA-4!@ `PP/1S 0L1P@PPPU!RMPPP !Rp V *A`_oR%A`"A``@-@P 0@@A-@`P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ   V @PC@PSSC-`@ Mp. Su$QU II P PQ VV( R0⃐0S (Q R 0DP  Ѝ0C$!o?감Y (avP0 R^ P Pv^UPU _^P`E0Ap0p(a$! $ P$(0Y (0 ^ S :0  P!@, R$!*(y(\(  0 S(剐$ 0 !(1$k0 5kP `l$|O-,M  R0 1 p3/,0 (Q0 Pt @P``^$`P 0BZ@ P@U pWW 0 {`PL @R㲀( PUJ[K` `,Ѝ 0 iPPu/  $`iPB $ 0 R`P# @R㲀/  P^ ^5 ^ 0Q#`[F PP  bP0 eP@  ,Ѝ$`0  ppiP   bP(pLW AT(Q`0@-@ 0! \ @+?00,1 ?00S@-@0 @>00,1R@-@1  0@>,>O-`0`SiM ? pPwy@P Uq  p >Q 0 p q+r; 4 p40*LDĀ `>PB H5 7 9 ; = ? mPP !V  Pp^4Q W!3\@ 0Ҵ\ \@4;P30 D‥+pW $cP G<2N ,0(< X5?PVAC 4 DX Pu 0 6pj ఝ 0k VU 0SR A/ 1啧 $  p(0  ,0 0 4#pcgkopZ|`pZxZapbY|YdpYefX|XhpXiY|jYlpYm^n^x \\ DS^W\[_PPQpPxRPTQUQ QVXYppZY\X]X ^X Y CYGWKpA@WBWtD^E^F^HI\Jp\L\tO[M[NR+;R+ ;3S7[; R$?00S1S42p456: 89<=>00@p K[WW' K[p@XX( 帰R[@\\,嶠R ZK ^^. PBBYY)SRQBBpw 0AS[a@ PV IRR`  ;/@PJp( q PF  1 D0!NB;ḡ !V QU0 aP$4Q$P| @<<%< p@ED p0 (0$,K [pepUJJ 0!iߍOPgC<P 0< 0 ppp<P<Q<Z0  @kA{40t?; pj7 D Z<P  B5 7 9 ; = ? <Z ڏ<<@P<P<P,0ay{<pw<p  O-@(P0P!0`5R5s`(P4QؑP, Ag ( ,0XD D S 1"1 Owcꁡ "P ر   J; ؑ@-@ 13/, (Q0@-@Q )00 2 < 0 O-SMf `& 0[ p0P!W G QZ Z R U UUU  ;00PЍ5 p% 0 T !l@P 0$ Q10!12PP1 0l%S@0 2X5X0 0L5 0  04085080050<0(5  B005000 S S ;00P p  20 2 `0 p 0 0^Wp W|3Wx# 2[ 00 20120GqS  000 G7w? @pP31S 07 0'P0 "  G(P 1S0S1S ( 1 29 2 1 29 2 1S 28 2AR0S " +H ヤPPH0b ”@S „9 LSPpT#0'+p/ SS4!"0X<$0X8X%0&W<(0W8Wt)0*pP<,0P8P-0.X\ k {Q<0Q80R<0R80:Q R$  k{ „SOL0SLPp&00p =&p P P P AP`ppR78@->rspq ppP/P/0 0 0P/Q* AQ1$%&'()0002 02  "00"00"00"002\/0 0O-RMPe @T Rp ?o 2`qAWsp R00 \\S 00Q2300C0 !  !pW ` `  0 1 01  p Spr pm Vj0S0`S 0S\P @ 9"00C 0!@0a`oobRH 0 =0A0@ЍD@P ?PB WpGqX0 0 @ 0A@`0h[PЍ001 A0@0@W[P 001S Z 0I`[P0T !e A = ;1QC/C- MAT' }PT# `P 6 0 AT R0 X 0V@T Ѝ0[P  000 0 1 01 0/p@-Ppp U@ ݡp p6Pv6P@x!x1 @-CM0M@P0,40㟡P9 D10@!,`@  P@*_p   p@ ᅡp#  :p U ᛡp  0 0 ,4 30CލЍh(0P6 P6P@6?00=H xtX O-p@P%`5LM 0Q0D00 $00 2JU  a600 %5 0 D0 30=LЍw 0Q1S4  R#P䁄-  {00! 00 B0R :1S R[00 Pʰἰo 0S !# 0P0 崰0U P 1 A P: C[ *r B0@ 1 A010q 0v0q(0  0R 1SP  X# U{ 20 2](V Tw 0S/*S: pF 0 0S0400000,p8040,0 p1 0 0S0<00(00$`@0<0$0U3 "P 0㸱0 R410C00C S {?尰! 2 ] 0 JpV "0 . PPE " 0 | R[r{/0k0A00CR00 P {1 S0"1!P500 0 G-@( MP` A ഑ p0` 0U 0 0 Ipw0v BRxp \ 1^L br R  Br P~RL(0 . Ѝ0pQ1S  ( @a% 0     P, p 0 p 0 0R1S0C1ŁW+ V10C0S2Q[Q=X@a (00(0qv 0I@1P(00(0< 10C00CVT:Vp0 @aP  0@1PC Q10C00C O!P  pqP1(00  (0!0!0!0 4!Px 1 0C00C1P(00  ! @崑P(00(0 !|p@-@PQQp P 0 0!Q P 0 0s!ppG-,Ppa V0F_ 1 @P `Vᆐഡ 010C0S0SR 0SP "p ;!   J;1xVF01x  0 S001^1 C`fv`V 0Fs00 \~ S10C1 ! R jP 1 ! 1P O-p@MPQ 00 2/U U @300PЍ(P PV PЍ  `P  R  2Q PEP]Z*P0  0S  QᴠPEPZ0J0   [I0p 0BRs0 10C0S00 PP0 `P 10C0S1 1 10C0SPP W UP| 2P0 2ЍP C 10C0S  9 U   0  PV  R,p[ RX 0S0w  뼁W`m 뼁`WW 0H 1 P2 XAA\  !|P PB!! 1 0P 㴀CP1 \PP `V *   NP  T v  8`PUJPg U aU\ 0j200   P , Q Y qW`9 q W `0G 1P WR  BV`FrP! PB!P  `F 0pa P Qv!PEPpPEuPP  K Pp-M0  0P ЍQRO-`p"JM M $ G/'O R  PRLI@IU/ JP |100 "2 0 4 30}Jލ Ѝ >MX00 0TXS 0 I0;i0$ U"* 0S @0C/[00P0: S <100 R I R21?00A@V$ 4- 㞚p"!10S X 0C \0 RK Y P 100W ԛp ӛP 0@ox$ mlR Q0P:Q0Q:'@-@-@@ $ @: ` p@-@P#N-P$ ' p@苛u d @- M@0 @  P 0S  ЍkU` O-@lMeppF P 0` $ (t0 F4<@ DnH C2 bG   p ($,08`LPPpT@ p@P , .PnlȠ P% `p'eX "gx0#@$b* c: dJ ,n P%l̠ e\p'` ```g|@$ L " ,0# ,lȠ.% P< P PPa`PPP p'PP Pgx`@$P0#.Pc:dJ " p'nZb*! ,g| `0a< l̠` 0```0P% "0#,@$ <PL vLP@P, X pPp0 p0004 d 8<`T@@``$` (`\D` +;H`P p0 $(, `048< DlЍ expand 32-byte kA-@p 0XMP `00T00  00   f&@  0 (0 0 T0 30XЍ | h1O-`0X! 0M@ p 8`P   000 0p. R+ X   h   0 0| < 40 0 0 30Ѝ\e(  @-`\QMXPDf0S @P P8UЍḙippePU1  @@P tЍf0S p#P+p0 00 Wp@  ጙp 5TP@  F   O-A@p1IlZdMP! p0 BZP0\00"?0 G0"[@ @ `@  @`T @@000X0SZ- 0 0 \0 30&dЍ  0 0M%[0S     =%@  S ( C-P- H DMH0D@D ` CPT0 +  C  +!0  \ P [pcd bc퍐ߪ  a ] Y $ P(F X$ D Z0 030 07F  P  P @@ P0f000d `0 0 0 30Ѝ`0 0e g  `_T$ 00@- 4MP00,00 @T d 0T T H0 0 ,0 304Ѝ0$ -'  (! Q$1 A-HM0@P0D00 `W @T( 0T  pF `V 0V   h X0 0 D0 30 HЍ$ $ ݾ\ D 0 C-P04M`0,00G*`@ gpW:T p 0T 0*T H0 0 ,0 304Ѝ$ M꠾ 00@- ,M0 P0$00 @jT ` 0T P D0 0 $0 30,Ѝ0$ rl( 0@- ,M`0p P0$00 @:T ` 0T P D0 0 $0 30,Ѝ$ B

[0 s0!\ 0s00s01$Ѝ00 0  r00  r0`Fv`00s0ZS0 ` P0RtXC-Mp`@P& PP! 0!0 0r 0000 00!! 0 04000000@PЍЍA-@p0P A`q080P0P0 00S   L| P00 0 00 0S$1   @p P@  0  P 0 0 0xWO-MPp@Pi Z0 q 0  㲱!-@@^C  0_ 0 `PG 00!Ჱ 00 0@0 0D000%!Ppp!P@Ѝ 08 0 `P 0 0! 00岱0 00 0P 0 001p@0ᰠP@Ѝ pA-LPA u` uP| pa |\ L|挀@ X@  F0!| @0 B 0 0r0 r R  B`r ` PVP0 0 00 000 0O-LMP.x0`tp0 @20 Sp40$0 ,P_ "1p 0Cs011q "  00004P0S q, W $ 0G 1`P% pW 0p00CwprS񏐤S 0`4  N PI E APLЍ 1! BR,*0S00"B pW 0`0 000CS^[ZYXWUTSRQPO71 0X       WR   !@8 B   D0@<8 8/ 00Z1   0`Q!01 B 0C001 0C s0 !1 B1  0 04S[  0S  2 0pPO   q[C P0`\010C0010C0S 0C s00P0010C 0 @Sp  0C s00\000400S T P  N JLЍ1X" 0C s01 1 V00000 : 00`0s 0 P 0 0 0e 2 @0p0 0` U  CW *r  Bpp G 10p100 0  pCp00 0000 6 2 0 p00SL 0P p003UG- `P@PH `V4 2 8 0 ` Q0< R    P; 1` 0C00C 0 P"0 0Rp  pW 0 10C0R p oW0 R  cp0Q  P ` MC-P@$M`pQ @00 WW 07J  (0pGW[Y8WV4S0GS'00$Ѝ(0}W# ,0p110C RB0 s0x 01p崀 mP ,0p1! B Rt 0 jp0 MP ⼁pP 0 00(0rτ⸁ 0p0 (0P=`PY 2 00  0S 0S 0 X~弁 0 po 0S  00 P^ W1 W 弁qQW# W(0X6W6 p  ^W  P7 H⨀Hx긁0(0弁z(010Cx0XW( p  7W  PHx꼁, 1$ P 0WS?q X0G ,p⼁ 1  P X10C0xX弁 X0H 1 0ⴀCሀ !10  ZP p p c0Cs 0 ]각 0H㨀HxU0! 10崀 p 3Pp@-@`PP 0 00(0`0Q0(0pO-Mp@,0 01 PD a`F`V. `s`V P @ `Ft@@ 0P 0+00P 1 0@P@j 0 X @Ht@ 00@ 2P   00P Ѝ 00ЍU= 10C0SQ P `  ᴑC @Pp )뼑0 S00h0YAAS뼑0@ S 0I 1 PQ xP> 1@ 0C 00C1 PP. a0 S00 ,@VTK a 0R% P0F 1HP{ 2  PqQP  Pw a _ AU1PE@D @`@Dt@@! @ 10` PA1U @D0PEt@ @C10`@T0:1 010`C1s 0P!0s0 0B!R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/_ P 0@-P`8@(P  0 0 E DH@ DX@ D+0/:O-p 4M(@,2P$0 ``0p  pP`@%0f#"3?0,"0 \00#0 %0  d! "d! 0 X!p p\  P`@ 0 `.@X!.b!!     !  " !)! $   c! c!,    $(`,!A+ ;K[k{(b a`+; A4Ѝt:9A-@PP$ p$(aV!P90)  B CI0 CX0C0(0 0`0$0d0K  E B03?\0h f# 08R(@R )@ bW#+P0 C C CC)8 bH# 0A-~a@Pp @f(X6 @s 0刁@pG0 0$0(p0$0. ?W?@`G(?`@``@0@ 0 T   0$ < 00T$0?pW( > 0$ q0 00$0?W@`G?`@`` 0$ @@< 00T$0`R @-/ GP 0@-Pd8@(P  0 0 E DH@ DX@ D+0/H5R @-o/ p@-@P X00m]`\  0P "P p4 5O-MB`0PH,P}0< P0P$(P4PP<4 ,P8P<``P P 08 0``( 0 ,44$0pP0&)(Ǡ'Ɍ(@0000&7 @90#()',+$0#+$,   0 ,). *  @0 ! 0 *0P Ϡ) . %̠ PÌ 4@ !$$P $  , @ P0( T,PP38 @0`~?<`008 0<  PP @@  0  4 0p000 !1 !p壠#$ቯ ,)* /3(<ᩃ( *1笩ဦေ 0嬾ᇑ1>*1 96,à+͌ +%7% 9 ,0# $$ɠnj (ˠČ 0#ˠČ (  , 0  ,4  00!(p0 0,p/.!.!~rp'/!!(,#̠p' )Ì   ( " p , p ,8p 8$pp0 $PR (,]< xp|`tdphPP l@\T@0LX+; k{(rK [p xb|+; B Ѝ(41p@-@@P`DQU  0pRPQp b Qo  0P0L0@H 0D0 0p@PR Q b Fp  @0A-a@Pp fPX; @0D 0 @0D # H00H0L00L0pGPPp3WR`G```@0D P;@0  S0D *H0L 0H00L0UpWP @0D q0 @0D #H0L 0H00L0W`GP``` P@0D ;@0  S0D *H0L 0H00L0U`R @-|/A-@P` PA78p@CU < p@-@P X00k]`\  0P $ P p*R @-C/A-@P` PA(p@ U  03?0/@-<P1M00AP@;P񏐽 U L U0-*'<9630-*'\YVSPMoka^[XURO%"1/d]VzP;DPnE@5Py|{xsrqponmlkjih{xi{POedLl]\[ZYXWVUTSRQPONMLKJIHGFEm\7P 7P 7P9@ 000P$0H p H1ލ3P 3P @ @1ލ= @02S, DPUw00   i@ 0H Ϡ 庿p h 0H  媿p ]? R @ 0H 啿p HP 1ލ d \@ 000-P$@ 0Z@ 0| n| l| j| h| | | | `| ^\z Zz Xz z z HPC ]H㺉P= Wn Dn D@ 0h :h h h h h h h h h h &h }h 0 @ 0wa ra @ 0@ 0t@ 0  F     EDCG+*)(&%R <@}|8}{@{{zHy @ 0( ( 0P$ 0H  劾00pH  \@ 0eH@ 0_ B <,Dy$R P/(O@p 00q000S0 0p  4 S  $3/Ѝ v00q00mO000QA 000/0@-S@  R   0 0Sἱp@-P@T @T 0 Tpp@T{P`p  0S S/P/O$(0c03?c00 R  0 0 3??oP//@-@ MRpP:Q !SV@ЍA0 0`I P Fm@FЍ0T @0 0O-0S) P& 0S# p@# ,0aT T 1 !3/Pp@DR00C0S T,0p@2P ?0T` BB \|  i V`! 0  `C``@ 0p0C0S 0T `p@QQ   D R !,03/`PIʼ0@00 "R( Y `10`!P0VQgRJ,03/`PY M 0p@D0C0S T@0T p P@0S*V* 000vP@DS*`A 0`V:0P 00``F0 ``i 0Y0C00 00KP  0 0C0 Z `0005P s00r 00n0% p@-P`V @`0@D0T0@T ,0 3/0P`ʼ0@00pD0Spp@//p@-@P|00 0 PpP 00, @Ǣ [PpHa tR0 q R/ S/0 0@-@00S- 0 ,   0 P @P į0 0$0 s0 00R 0   0  0c04` @-@M`ppP` p {P0 :CRo  S L D0( 0R Ѝ ; 0 Ѝ;0h_ #3 @-lM0@R0d000P C 00  "2 0 d0 30lЍ 0`0S pậ0Pv X"X p0 0R0```ppLP0 ```0S$p!@ ᇠPa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00  00 %  w 0SP ` 0e p pp 00 p@kP ^ ^ h^ (@>p@-@0MP00TaV( 0T1S O<0T1S0`ء00U TX!\!R Ѝp@Ơ\!ݡ00Ѝp@轠00U\!X \!X0 000S/Z t0 0p@-0PUp@0⛠00TQ坡0`U TQUP ⏠pX1P0X1ꌡ0T0`X1hZ th0h 000S/@-@0t0 X10CX1S @kOT1Ƞ0 @dY t0 000S/gLY t0 0 0S/p@-@0PKU00 \A\Q X! BX!R p@;`T00OT!唠00p@0$Y t\ \0 -4M0 0,008 00 0 ,0 304Ѝ|X PX  ,DAyO-M@Q`@0@HP8U00B PR"SS@ BP 0 !#00 P0Ѝs00܎@-0MP0@ >S  @ B"00!,3,0 pP0ЍQ00@-@Co@Co 0p@- M0P@000@`0@PP  OP< (0 0 0 30 Ѝpѯ/ 0/ H/ G-Q `P@ S V @" RpSQ P` 0Ck ?o/o0CS 0c0<ÁVS' /o?o BR  0b0<ÁppϠ0T0S?p?ᬏ0 Q RVP00B  V 00T# 4o 0a08/o?o0Cs! p R 0b10pÁV V50o800@b0q<à)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO$ 0@-@%P  000 /,0,0-M 0 000 0mЍP*  RC/A 0\R#R! R/ 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGO 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 000Q0@- @P' ST0 C0 ^@DP \T0L^ Q^P 00PPQPS@R S Q0 S0 0 /U/ S RQ0 0/ 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@Q0@- @P TS Q@DP  ST PUPQ P00S @Q R U// Q#/ C//s R RS 0 0/U/0 00/ R S  Q  R  /SR Q 0 / 0U0/ 00/0/R - /P0 0Q00/R0  S 0Q 00S00/ 00// Q#/Q- S  BP0C S P QP 0U0Q- S Q P 0S 00P 0| 0 @-M0@000!00nknk00hk jk4 ,0 0 0 30Ѝ < 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/4 40 00S 0M00Ѝ/ t@-@p@-0@ ,pupPl0Ppx|d|////// //O-4M`p P U uP1 0 A  A0( 06/4Ѝ0 S@' 'S㴐0S S7 2S@0SQ00P00^) 00@[0 0 T 00 "R 0SPD @RUh00\0 0 S00,00@}}|||||`|L||/Z/[/O-M$, 0Q< 0000<0p0 0 40<  =<;:9876C43210/.-,+$)('&%#"N TO tpXgX `<<@ 0`X \ [: Q ^ [p4S0CP Z0Ԅ0˄ R*h 00CS0Cc Z  ˄0S*] 00H 1!00H Sa   0  00S r0- b PG *X 00H S` >6&00H S8\4\1 0@T v 0   0 P  BV`f F0 P 0P 0400x00vO 0[SV00`G@ V0N`\d `X [f* QeAQA` Zp˄Q*[@ a 0 0 00 0lX PP[ 0` < 0*P@PPr 000 0vq 0[SV00j@` P0,  v [QV`P/ 0  0 /+ 0 R . 0yPv\ r\500< 0 0V 0T P0v[S @0"".!00d0NF @K< 0v 0 R001&:@,00 `$P(`Pᜠ+ @ R! ⪠$ dVP0  c/* `$P(@C0 N CF @ 0h 0v00 0 e@.10d0Q\ 0@0 N DF @@ [04  AQA0 Z 00˄Q*0\ ZD@ Z>  p Z ˅3] H x 000 0G [00K0D"42 0 0 30Ѝ 0 0 / 6   # 0 ` @`01000   @ 0 0   0]  @0r 0 ( 0 @r   0 0@ r 0@@ 0f F0 0 @r  000 0x0 0`o 0#8T0  0q p `0` 0A-`pP@PU J0PEX@S 8/`upWd x 0SS S 0R / 0R0@o/ @-&oO-p !P1CM M@`00440@  0 @0 44 30*Cލ Ѝ0`P 4 PP ᚜p 0 dPzL+   0/\d 8  $\G-`0S+ S'QU$ pW!@0 S0P@0#S0S 0S0S0S# P Y Q@0 0R!R  "R R R \O-0ഀBM⸏xMXH/ P`t! X' 0 pgP@P Uhh0 ZP"IPD <0 0 4 30BލЍ꿦  O-L!H1 @ AMT M00400?1 Y.: p`x (R5 P_0#s0S"uPU/ 0 0@T gg 0 P PU $ 0  gPL D0 0 4 30Aލ Ѝ x (Re O-mMM?x /| 00602 @x?T080 1S 6 S`1  8 ?,@ X@0q0x |\- @0P0 .0S3 SH0uP`【  R LP4 p O ḐheP* R!Rㆃ7P @`PT 0STup P```0SPU @  Y 0S(ڐ- @ T |- \ x X < l Te 0d<0v?HL00D0< 0h S1S D 300S S00`01D 021帑Y[0P0S|000x0@0<00SsATp D0CPo L0PPPym 0;[@@ 0 ȥP @0PP D0< @0 < TL D0 L dH0S  P0S Q <00ox0. S00P00SS |`P@*pX 0@9/PU +: 0 6 30qmލЍpW? <@PL0Py !dL0P0   8 : X0X 0v/$ W G $   0 T$ 0$ 0W 岏  v@ Š01粐0a 8 4P|@ X00H0  MaP0kL @0P ᎘8t$@$ 0n (0l00H0x8$@# 0X04 2!  `1S 0    0P0H0`PTgʌ PH ?`!!! Q;   <38 @ X0 [ <*0P RB @ haV @*Px 0|@6/P<0+S .0CS5@30P.PtPU a8 L2@ X00`!8 2@Xوl S0d01SD 3h0h00S S`` ``P19 h0 aP0 h0n`P101@PDpcpP 0@ 000 `@00P`00P 㸐D2<  l H |4TL<T\(PDhpP< TP0D Br DR _Pʁ0l0~P|0@w@ l06SV `p$0bc[pY0P0{ D0P TP0D Br DR _PN0l0K@I0P  8D!@! 0| RW00 0R 0`1 k 8 10 XP0[0  (Y8!@H"H 0Ӈ$0 P 8 @2 X@0[0  (k P0SZ=00Ŗ8"0" ेd Gr R000 P T Br DR  R,#;_Pʏp0 P @ 00`PhP 1011S100u8 30 X00<0l0l00e8 4L@" X@0x[0  a({00P8 t4 X0c`mW 0p0h z(0l0^0l0[@Y0P 08%@0%0 0G0+S .0CS"@@>0P 8p%@% 0 `+0l0(`h0 1 7fP0@ 8&0& ц84&0H&H Ć괠8 h6@lXຆ/ /MM  00  C R1#0e(6,Ѝ0/M- 00S  R BC0S N 0Ѝ/M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@C_P$Ѝ0 K_P0/0$Ѝ000 $Ѝ00@-$MP@ _P$Ѝ0 (_P0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-P #3CM M,p@0Xd0,401$D D$ 000 S  - 0p y P@ȡ0$ \0Y PN00A  !< S P0 $\4 0; P0 00 00;  P00 ` `P10,430KCލЍS" ` 0?s0S0Q. Q( Q" `     * 0/?r s0Ͽ|Xຄk`g`d`* X PC-PH AM@M`p0 4" R3 0 @ `! P,8ĝ0  0 0 4 30!AލЍR} PP 0@ .R@@T  @ @ U`̞T \ <pDO-!1AM 堡M0  0 40P]pPLpPG `˄PPB @ t+0MP7 0S4 `  0S+ 00@ p@P00@S 0S0S 00@ K@ @ @_ [D ,0 0 4 30AލЍT X O-p#3CM M`P0@X0,40\@o_0S  .S@0SV:T d10S#0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $'_000$0D DR @@ 0S+ .S& 0P0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@( 4P/d!  0Sx0h 0@$0000]0@P@Tk0!0$  00$0s}0S 0S ^V0 hO0  ^T O-p0\MPl2@0`#T V0 DCg UR3*@ pϿ16 /O 00S 0 \Ѝ!0g'' 0  V X0 F0 0]P0wpsD^@^0崐SUHPP   B RX00 B 0]P '^$^%^^ @ຐ\Ѝ0 `F 0S0  s^w ^ ^0s^0S 0  @<0\Ѝ HxC-@0 Mp`(P%@D T@+)]?Xp]뵐0  ] ] 0@?0s0?0 Ѝ(40G- p@ᴒ`ḂP E0S@P0WU!P ]@], DGp]D0O-䡐 MP0S5 @d @XcYVx7XP //dP //G-P`@>V%0V@Q\ 0\\"  p偣 pp p $@4 O-aM0 MP@060G[0# 0 T =0H0E`,@01&,d!n d! .0A 0`11@05<0ʌP 0ʏ 4 Br@p d1 2d1t.PU `@ F`0H SD@_ S\  S S00 Q@0S SP C0SQ0 0CQS000001P nmFdosmaFaGP P0s/0r$G$0 o t)F s%r&G, / X  + 0HP 2#S;S 0S! 0 S 0SV 0 S 0 S 0 o>R 00sS2 S S 0  i>R2 S S0S 00 S S SS@@  `0ᮀ@_AP@H DH D T̟02 tg\g|l 0, 0S? e2R2$ S S400R00S 0@0 S S00 0S Sl  P }05 C0  C1 0`XF; 0B PRT RN0P $0T $0R@0 $@8P $0 S 0d12d1 AeV| Ꮹ1|WAp 0τ|`0S X `0`H@DSH .S0SX P`.HX00V0S 0 P " 0"002 0 6 30&aލ Ѝ l9s4GRB T T0 SD3H`00`080X3LP0(0 00DpP T T@ TT  ;T R[@T #(0  ;T 0s000@@T  pP 00'P  X0們8h1P @@T;T x4P0 0s000@@T;T   PX h!2/R !R/$0l!0@ S0܃DpH`LPO c8R\2 S SX0SD 00 S S SS@@9  `. _AP@H `0DS \R=* S S00 Q0S000rOP.P `r1  DQ fD@`|Q0 SQP@qP  X0偑h1h13?S 1/S$Pjp0p-PQ0 2 {4[XV!!1 p@-Ph@lHMP ^ T 000HЍpp Qx#r cGVV p  X0xMVPT $000HЍpx,0,Pb+RA-P 00P00S0p `V pP0\\C\ `@`@ ꃃ `` O-@-\4\0QM @|0P0 pὈ0P0  (0$0P0@   MPw zPY' RR - 0 !⌰pG#Y 0`P  `P yP ` R Y0@0 0000 R  pG`o P@T $P $f a` AT #Y  @TpG  0  ljZ00`Qߍ P 0` `FQ* @@Y;8 d ` P叇:@@T:@DAp PP` R    Z@D ` P ^pW @D Up- $ M Z @D 0 q U p 0  W 0  ;8 @0否0 0  B|0僦 0 t{ X@0@ 0@-@P @rE 0 0{ v Ȉ(0( 0@-@P^00 00/v @-@P @LE00r{dv 0@-@P=00@-@ P 0  0p@-@`M 0 0 0I{PP P :LP 0  ЍpЍp 0  Ѝpu P1P0L!@- M` 8Q0pP0 SpG0S `^p4 Ѝ@@xP 0xP 0S@ R @vxP  A0 Ѝh0d `   ЍDD D  D##dеpL8 @0A-0PU" 7U"P7UP!q|@@``FઇP $墇P 0!E`$1(`P 02~P"T"O- Ff M@`0, S0 4 V FPp$@0(RB q0ЖYT0i(1<0 BRQ#)16: 5 0(< ܅ 1ş c p0@00'(p4< P( Pz ph40SgX% 1S H 40SkP6S (% 4 0S00S S404 RR 4 ,00,000S$0ğ 0000( X B2*3Q Pq Q^P( 0D$ Rp (40(s1%40(8p(LoP4040^# (0p Ѝ 0Q 0Q*# 0(sx30!8(p04Q(A%01Rx(# 30<!^ ^ w䂟 S:p 0(" <!%p0(0P^4+|20( p2 0(< \2 0(< H2 0(< 42 0(< 2 0(0 2 0  8 ( 쁟00(0(1 0( 긁(0(10(0 R 00! 0t1t00`10r]p (4p Ѝ<p N7p 0q^(snqp|2 Z 00K  !p ! XXD!   00S@  @ 0~0 T0 00Z @ :P80 0 0Z@ R 0X$00 $ЍxXxXhXdXD(0 $0 @- 1xu넸 p@-@@`V 0 CQpPa1P P `FP @  pP 0`0p@-@00 R \\  $0!0D0 0@  ( $ T$@-@PL  0S  T0S@Qh@Q|P/0d 00 0Q,0/01P/0(00$ 0/p@-@P0`P 0(0 P0S  1T  0C00`p|p@-`0Pᚃ@P  P啃P 00p-븨 A- @0S  P p00   ($ 8PP(p`P0P*O- 슟,0Pc A p` C@@7K蒟`  (huP5 @ R=<`( 01 (0 tP`$ 0@`1@$@ 1`@@~0$@` 1o0`$1X,P$Y (p`|10<0S  \! ^ς~000@P /000@P! 5.0@:S S00  @00`@x S SRRQX,b \$x `x x    h ĞLĞ,IIHx X @-@P00 R P  !$0000 0@  ( $ H p@-l@@`VpPPp=U01pPEP1Sp  (0$ 0pQA-`AP@TpQW0@P k0 PP pBC @받A-p`@PP T  000P   p@-@A@0/W 00(/000/004/00/00/\W 00(/000/x008/d008/PA-``PU 0AP ppT0AP<0< 0 ,(08V LM=M/@- M404 0 $0あ Ѝ(V Xؙ@-@0`00@@-@Q 00 2 _ 0 G-PxsM@p 0TpD T 0S0-00 00(0 040,0C0-PP 0` 2) "Y &= " 2>  #0 0000xqp Z Z 000@YJ @PЍ < 2R"00@D\ 2: 28KP0 0^ 2< 21 0 010010 01001001  B 00l100P 0 R00   0ST 0 2 13/pT`0-00ᝤPP ` 02 2q00@Y@0SwZy 2: 2diPr 2 @0 28001,00 8<,\AC-`@ MpPQ 000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH DP (0$  (p 2 00P9 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p x ЍR @-`@ MpPQ e00U,0`V( 2S * 2 P13/PPF `P 0 pr 2 00P Ѝ 7 Ѝ00PO-1PMS-:00 X0*q`I`[ 廛p@ p W  , 00 PtZ 2< 2Ѝ>~PЍO-MrX>*`00Q̱P@傛0p@ W [KPE ~P0# ̡1PE PU0 Y 2< 2Ѝ1PE P0 0 Pt YЍЍ"1C-S` M2:rBW R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 Ѝ}P"! ЍG-MpZ Rb'*Q* U@0U @ RD0 d P X U 2< 2ЍE@ЍЍG-邀@`ᴑP 07 pv`p IpV`F1wv`010 R 1\`0!B L\ L| P~ \!2 B!0C2pp@- @TP ` PP  pPp@-`P@Q 00T T ! 0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-`P4M@Q 00 Vv 2+ RJ 13/p* 0 004" "0$ 0 004 p`0 9/P 9/P G0  ^ 4Ѝp$  0qp 0 ؙP 2: 24Ѝp`?(0 0,009/P  S0!`$P@  @00CQA$0@D3@N0!R T00@2p@辡8 O-0 pdM@/Wp Ꮰ0P$0_ 0 ᇠ PX $wp0 000 00QI`@0@0( 괰\ G  p ||/0 0K0 0Ჰp`@ Qڴ0SPPG  NK0 |P L@ D0pz00$0( 80@s`PP0<0H00 0 pP`4 ,  BRz r @T 0 ^~pPa(PQ0SEpP  0 000{ PA0 s00pW70H0SB@PCLP ؛0S 0Q0S<0P0Z 0  00` 0000  V0 P[(P:,4 Y    +<0 000 000 P'T0S0# P0X 0 XPUU `,Pm( A0q00L0Ⴠ$000000dЍ4 80@0@ QpN0`0NPP `^ ,0~pS ,0p|0,P80,8@0p,P-,0S?8@p00,P#0p4 O-\p? P0`S0@L$P v uP' Y  0z S40 ̻ 0 (!S$10$10 10 0S0P  0P0 S0ݞP  00S 1$10$100O-P@ M` Xp@pR 00P 0 1 !H0Css`| 0 ~r P PF`P `0LPP X Z `0Qa Q 1 !rY  pG0 0Css00L0 H0H   A 0@000 0@pW* P 1!{0P0Cs0 Hxx!0 pW0qs0 0 Hೀ 00ഀ00B000 Ѝ@000 0@psQ0 C0 0BPP @000 0@p ЍA-0p`@PQ"  0\U@ 8T8 0PX APQPR0 B0Ӳ0Sr 00ô000 0 Ss 00C00000UU800C80O-P0( 0S 00Cs0Z@ ,WPI  0S"᜝@P  0 S 00Cs0 S  p`V S@  0P@@A-`P 0@T@ Tp Q Q\\PTG-@`P 0S 0S  0Q;@PS" 0 00ᲀ\S: 0 BS P= \0 P  0 (!0S 1$!0$10 P P 0 㼐@pᲀ 0p 0 S 10 B\ἐrp P $1 (!0 $1 00 O-\?  M0P`p0CS0@L P ]t sP& 0 0  eP 0{ S0 u Ѝ0 0S0㠜P 0 0P000@- M@P p10 Ѝ0O-M 0`0p  @DHPpC p P -z X  0  ‰r 滰 \ Lpര0 ``p0000S XЍ 0  /P @ C0C r 000P @G-`d"`2(M @0 0$00w?0Rpj2 S:0JS 5PP 2 S p 1 P ZP崀@ Z1L PH: CX ": L01|  p舸” 2 0„ 2u 0 0 $0 300(Ѝr  B0@ h1x p  0000`0p 00 p剩P202]o 4n A-p@MP`Q *00 2   Q `:1Q#0" B31"000 VI VFEXBAF?0PU: Q * 2 13/p1 \* 2<00? P#\0 : 2 E E0P VP V$P 0  Ѝ)00Ѝ0PU Q:(0 $P0PU`PpP  qP 21 ser@--M" # @ MJ<xx  0Sd000S 3/E 2<=pdj 8 80 0(Q/$(0S/ , i L <<00 R/( 0S/  i T -AF hFF #x /! FD M)h1 J#F I H F0khBF1F8FAG5 -OFhF`I \M*F1F FBыK8h$$*m" !   0^рI B(Рb+I+GFF"FFFFF&F+FFFF05FCH" 2h*6H(a5L2h>F O !OFbh:b`*ŀ FAFv )@($*\ -t/@ -@,$Z^ 0]I 0X)F/$*p$'*@ $B JIHd U? $"$ 07 %(F|lt&hnNh$Z$ -  .I/HJFHd SբR )H0" "`d S?DE4 FK' -x'$*- M "0- 0j1 ^ 0-E@? \"hP `x=碉"`0F2hh-OFhFI \K$J&FFFFD!(F9FbJCK^R(7G((>йfO  9h(mH8 (Q tssstsss]tstO Ox(e(X( d(!uI hO sI hB:W" -ђEђx ; `iKh- (,й6*aM F\0B^I"F+𒀅K*kI[hDRoہH\l*j,.6)1F/!#FvId#6] /*,/*/"+ O RDo gH FIFVF^FRFF]I  ` ZKhB,/*,УhRHFpF3m=RrBB%VrBB*jCIKHmhpCOc")F \?IZ `^F(hpCOTpCO*j.I7H! pCO0 س_𳀳_(F!O𜀳 Ol+Ё(F(j+?)jJFH bhjPCѺ)jHZFѢkHSco@"(KOqJH||tPp A)HLq(%J;TpCO#`ѣickJ;c+R# K@?J!(*ЫmHh|)jHch+?Vkch+?Mb| -OF- FhI ["J!F(FF0ШI KMh@8LKP90NH3h+0XԞI"PFV( I p$`k#cKdccH"mK@+jQj^00! J#m@aOrdO@#F(c"m@`l@!OOrF[h`kG#kC#c(cbkqH a00#ica<2Cй~2Cй#mCO "l`lSC3l!ik DG]M#m@\IM6@SBA((F(D(Рj(D a(ъ)FPH8PI ,NI LHOSU`#`3hZ2`+51EJB@#m1 BA`i! ##2C kl-@i(FG0@vh+ -I7%m 2BBBAҫ !0 [jGFPF/ф49F| n؟ hl(  UYm)Bh YHF00"j6#GCLHt#m6214B2223B2#mZ/2# #2b6PEE2<4A 2?RFF4.N 2123B2 "13A:"1F0 D01GJBѸJB宸VU?j! i 2!iDf2CaaV?lkhG0I% Lh%? -OFl]hFI [ `NL<2F9F@FE !kh#j)C|I^G8-(+.?GMS #&047I F(FJ[,!4FY3IF3H ~j0K!hF`cp+IjC*Ij+(I#bW%0+@𨀢l#l*G%F@K #lV<ԣlV<0F`#m @B+k8F$5FE(50 J|tt&k*+#m+Q!&Feccl{@B!(rI `ObOs*@Bck'flYE@&k.@EckB#kcccl(9FX l](9F a `Z"2((@B~F@A[uI >@I#ccV(F( 0hFcm+1hjH 5hpCO(FF5hak(F 1(4l  j(F8cm+TH)FlbZ 0cm+NJ1hNH78FHcm+GK:F1hHHvcclЕ8+h0BF.[ШhQFF,2L,.2L.02L0 212B2242 [B4262[B6282[B82:2[B:2E`v9FL6jh,JshX(,hD#2B23`#p( E(S("IFH  ls( x(фIHKh|K"zK""xK""uK"!3; 2 l(NsI $! pI oHF(AgIlHlH,^K2#hJiI_HZM)iѺ(tUM1+b.@SL]H!Fx\H0F&(S23SK"VI FUI AK" hxh!Fh)( F chx!+"AHh+/I9H0hx+ (7H6H.6Hh4S2kL2+T m |@t&9C  p$(?%4 hhV"M&"L#H)Fa!H0FR(2+?PK(F"IG >8K"IHJI H L H!Fv ((֮J2+?%K" $( ?p-AF hF/! FD FqIHF(BЁ'mLBF1F(FCPjK!hh)𗀠i-! (***BBh:W"P+iF(F `(@pC O@#`RI*F PJ1F(FL0KKh*V#Qh 0{!F w(e(L(2P(3F(,н;f8(S ߋwwwwwwwwwwwan#c`kg`i#'aca`d`b#ga#a^'`\aZ`X= a jai)gcIV#yh"iF(F F(upCO?WB F")FCP |h>-OFhF>fI Zr %C4FJF9F@FC ]KhW#pFFF-h!F8F h  (1h^FQH:7h/U%m(p(OоJL hF "h GI@FPFZo.FFAI@F?I PF(F&9[Oi-GFh F2I 2NZ'O2F!F(FC,KhBO;D&Tp0F*p(v("K'_ ~(!hHF&0 h/%hO /!(F0Cx++x#C(F X( H)F;F0+(F|8U!hp! " O#"  F F B7  L ! p (``Oܿ#c`.LI` Z@HK!8  2(ŀKh++'+шK"% K"!"K`#~Kh+JzJ6 *uJ! +wKhJwKhtK`aqKh+ rK"`qKh _+.#cKxdlHkI#FkJ(F FF FeL hCh;C`+ "hhY` "_HpvhZ`+:#MK6 0kGKxSSH(f#OK"`@K0+cAKh+_ =Kh9K(a7K0S8Kh;AKh?K`v+ .K60+:H5H"8K$L ` #1[ >JSKF0+(H#X#x+x+#r M$&FU 41FN,ѓI V[!V!TV!_!hV! V!V!$. b!4V!-GFhtI YsNtK$tO`3h BY#9FPFTFPFEkJIF(FB2h(.cI Ba+R#9a=]$! (  PI$$MI (KHxJI (HHnGI (EHd,У+h3%=M#3hq+Ff(@6I(عN*hh#x320[ FfFF!F#3I" F aH!FKI \(H f||222hBt @2ht@2t@232.gt3t&h 4-OFhFI YLz&FF5FFfx `oSBSAJc`K9FXF>JCKтK + iֱ+\5h0F 0@uI2F R(&G((1yH8 (Q ŞO%h(d(f(!v(!XIh!O%OO !%%+=5 йFI %EO33.chW*+=:!@FkMW*`3x;#+'6I0F-K`  ")FXFhF(@.I v.!@F((I@F0F$I0F0@Fch ``P0; +onn4nn]nn]nh#")F0F0FF(h+c Id!34|t&33 d!pY9F'FPFFhzHmiB ѠhCjBђh`oТhiGȱ)jHZpY9FFPF',F+(j~'8Fh\aa-GmFFcL``cd5`G5 `c5`5`ac"@C5#aaHHFO&AF:F(F"AѢi*@}I" 0F8h7yh)wI2F ZuOA86(!9'-15VQpī#fB Љ#55#53FF#5#5#5VKVIHFr AmQIHFh@@NIJFJKh "!?F h"+ BI "!?Fh"+ 4I "!?Fh"+( (I#x Kh0y#m#5v#cas##i#1k#j3#bg#X#V#TI #iAB%@AB!Id!B`t&o'~@G!ai BI h\ Ѵ`hEєBػB# `#55KuhO@ # ` F%b-u%*pX#&! -h)cX#&#JOcdڃJI -O%:..GX#X#!I5s PpCO#55>.@k'-@F#5I8F-@FaH`KaJOa`K(F2P2H>K>I(FF22Fù9I \Dh#+ " 3H2  /I/JF@CF0FY FBd(" ."I2F H21FOrHn(FF(F`v@FzFH2 , a#2232#2K/!h0FDF3x+?:0F0Y:!@|0!SAt&??F#;3x;:0F06:/!(FFF! yx9:(F0":/!XF"prx*?:XF0耐{x+?:(Fv0:I LJ#O 2:I8h(:h3h\ I3ocOc3]J N;F2I0h(2h;h\#BٌI*DX2@N/!7h8Fp8F H2hpCOрKa*6hX/!0FzhyJ3FyIyHivHwI 0F! oHH*: 0VBBWsgHcHcIOR0F `IB [H0F  !JU#BVH0F'w 'r#3FK `>Kh3;Kh4?KFX`CB?CIs!cAHO;2#23=H2+?si38H-O #::*F!UX0?WF(?F:!UX07`%HX7`d20i+: 0C1hH0i *O33ao" 0a01hH8?$!t&@"@p!?@I@(!9[f@}@!@@@A,ApAAAV#1OqH1hV+F@C@ !@P\02T7,2P7OsH7(2L7H7'\Ts`L7P'?+钗@<"82.!(2锗P3i`uh;(FWF`(4gI*F fJfI N01hdHaJcI0i B01haHJHF9F-@!@)F BGF`WH0i `5aTJ ! PPJ !NJ8a3023,2 3(2CM\2ӹ#SC#)I1!D RObB\"ZBX23K"Fy()@8h&Fh RO#Fa!iOrPF1(i'hC'0K:F0@H#+b#a"2*E+@EKZiiBIAA8!rdAAedAA[@!Ж!0!!!M>WB02o,2(2?+"\@3?! 2JBYCaw0 L '8F 7-(MPFP:PF(7:: # cR!Ơ aPPCFp2(F1&CFяH02  /ъKd2+ꮈH$K1FF\PF9FCCFE5 L  HF( @3B  23B  lKo(Oe(regJBs®Oc\2:?31*?+?䮗0*(ڮ!*ծ!*Ю1K #L Bs i3a(?1B{ FO +a2"C';O2B+@7N ( Hxi?@)1I1H1J-Hd!~(@.I,H(Ѐ*OOjO &3F8F0"8Or#0#3FH,"(?"#,#"##3F("H(Hf(В0B! B!C@C>8}BBBBB#QF F#2+Db.@uK\ibF2+@pH oH!(mOO O #"F8FFeH(dK6!.!,߿$0c 03+ 2+@TH42O08$)CMH$LH(oKH@JH=#f0FO FI(Dg0FV4\2::E,2:O :TF$8IFXF< : ʹFFS"QF F {i3?B1F&H#C9KXi1,?c!FHn]2C"Cs TH(HH(HqCCCB@!C@DDЖ!0!LCCDD-O]M-#O$ 0F+FFCOka+FCO@E`JIF0FTFXYiYD#aiD#0KhO ;Ȳ OWOajJFa/!(FMF(F,P `KOaJ eHFpFpHFFHME9(F F(2 jOaaF(@׀Ij Vy+c+P+UT+]~xKyIFyH d*Q"q{ aiiCaRiBaYH 09iB iBiB8h7 *?1:!PFfHI F"+CHBFQFBQF( AFN +h 8I:h) x 5In)Qxo)2)#1J1LȀ`!F Fr}!I F 0I  F |  D<`BI  ya;0!+I JTm,  I 4!`!edA 5)5O5dx5-OFP FL'MNBF!F(FJC-$G00EH'DKh"! T(?I N0x+0h+?x3r7 "I[F(px-+1CH FP 7 IZF5$0JF)F FG0 F)Vt&P|\\4pH L I FN F4RI FJ F@]8!-OS}< F!O rHF P`` O O8 C      FH0$ѫI K$h0 2h  2P4ĕi483,Ht0љIHm0јIH@M,NіK/NO O (I@5FH@E`EF8F?F2цKhO0+@P,@M5+@H  ##` *FCKF(@F(@^sJtI ah(Fb$hz󽀻` ܻNs>ܻAZлCAـ`K"TaܻCL𕀛a"+=AEIS`dhW( o@! "! F4B(F I: FI8(FK F8@P!4!8 L I F F4(F I FI(F' F8@, !%LO (9F0F,(F0F0(F8@40F I(F I I F0F(F F@$!(m ] -G \(dHcHx(bHaH! (8D/! [H F!YH XKWIXJXK( FWIWH "0 QHHH! x0 MHv LK"LN !LH$O O O '3`|GH#"!%p#AH"!i?H"F!dO3"!33# 2#"S ##"F f"F DD"F F (F  # #! D VR0h=%K0h]`G U1UUTUUפUUcTUU!l!-OO3N 'FKFL=FF2FQFXFB$ѣKh -πM+h O,h&4khBY?+ 5u(f(F(*R(g8(S ]]]] ]]]]s]]%% h "hxI  hx#+ hT h " x+"hlI 0 " x+uhr h F(l"haI hx#+ h (?\ h " x+?Q"hUI 0 " x+B#?#!F!F8FTKPFTH@F P6 4=+?Q(FZ"` VF R CtQx)Qxc*p*b*IDDDT F?,O &I .DTO EED--O@ F'!F8FF !F0Fh(ـh+I2FN Iat&|t!h!4Kn#F `h C% x3 ^Ihh+53-0VKh TK#B 22 32pA_FZ  EIx h310[BI (F GFF*?b;IF]*FCF!F0Fg+?m0F (KѺ pO#0F !F0F%#CEBpO0F *FCF!F0FpO@#*?B!F0F(-  @3? 0F0H1FpOO0F вt!նh-O%FFFF' ZF1F FC>ѧKh#0B@)0 +w,,@V' qOa`F(𩀸@ЁIV'(@AF FBF@h+I"FA(Ba8(€(< /27K`E}Kh x+ EvI x̡FE|lJSh3S`wEt#O o";B 07idI8FXbI8F0aI8F(@𛁰hAFt(@hYF(@7hQF8FXph; rhQI &gOaq:F`PF KIq &#3h +F (LFY ! F=I  AF(D0% (D2  E$B@F^ QV'F\HV' @V' %I ( i0FHhI0F#`BF 6OaqJF_F(#3:F 0F+F,F|XX!t&WV +'Xr# P3p!CF'5J0F5I0F 0۱̠#33!F PF+F G V(I 0F00F Fd DK$?>I#"EH### h"5K.5I#oB=H### h",K ,I#O25H### hOR#K$ #I#oB,H### h"K(I#oB$H### h"uK,I#O2H### h"cK0|!%t&O(#bfnz5KhK[h FSPJ#xh320ZԝI"FG FVFoBH#!F##"KX`yI#oBH### h"K`hI#oBH### h"~K4V{I#c"H### h"zK`FsI#oBzH### h"mK84jKh0sqII9I"=H , 8N4{h4z-H)F$0'(J0I"*H hAFh( HOr4 AFv( p J !I C04;#X44;h+4IBx"z*B*#C&JId!wA!4!!X*% &xIN@Fh#T4SI@F(KJIT4+сI@F(Kz*!x2zKS#Bq uI`6oNV#KC3 F! D0V# gI#BFpӱ a F0#aHAFOZQFOpURF[I aNN04$$T+D*@)OĮ!CIdL$H4rC"i4+DEH2FKFAFOs.yUVERFy F2FB6I6iy*F*O04ܹ*Oc04@̀0oˀ$_Q%HORKKS Os۱s۱_sOQ40B-*/ F$4*OqOaOaH]!r6!*4 6!f;*04 4S$O0u( 44#0444 0+ @4+#kJkIlH~#@4,4K$4 *Կ,4"F)F@FVk?ХB: FVsh+?xh !2F`/МSJ#Fd! : a j(VLI "X )?bOS$4.FHOb,T4++(Feо?HUd 8Jd!F F  4H\$6/Hg0JR,JC !Zgx#<$6B@*0h P&x ! x`Z"8I v`(? " FDAI vBz Z O ?qUMI "F{ I %Ir!40>-OO3LmTFNF4#FF JFAF8F CFCѼKh43#4/; y"!"!HFX&`́4Os44+@K $[h*sy@!@0F F3@oI2F &Z-;C-D=-S%)OOO OOOOYqOOOOOOOOO ub=--S%OOOOO%OOOEcOOOOOO`K" haJ x2+?4?0\I #443##4NI#"RH### h"yLKX`FM#O2KH###)hOrgCB?*hCI:I#"AH##" h#Q#OR#:H#Ob1h#@ #OR#2H#Ob1h#/#oB#+H#"1h##c"#$H##1h"K`#oB#H#"1h# O2oCH#OC1h"K8!t&|X!w fnz$223h(4x+XI O P#M!!|0щI2F4+F \C#$ t/y6P$#I/ tq oIOcnJQF0F`\iJjIF004dHRF9F>`JbI4 !XF\J^I+ZI"]H \K >  SH" 0'OJTI$"PHg9Fl(GOr49Fx yt0@JFI C 4+4 ?IC1j2C3J;IbC:IlN9K-J9I,NGj2Ie1j $0Bq -I]o $ZС#3(F&0# I#2FEt(F0tH1FOZQF TF(jIRF|A8!4=!~-%R6-fX!i $ 4*@+` 4i4 $+vFPF FAF~*F0FRkB(FJ ܡ$ t0w4+5HJF;F1FOswXFTERFw(FYFJFB%I gwIFOExOc 4 44IFOPExOS+  IFFOExt|IFOPEx;-GmFFh"!pBF9F FNC Kh<,@@85(S 5KMUKKeKKsKKKEKKKKKKKKKKKKKKKK K)K?KUqKKKKIhr#40nKhj}KIh byKh([vHO2wK!hp0C p0KnKh GlKhCjHOrlK!hq<8dHO2hK!hf._HO2dK!h\$ZH"`K!hSHUHOr\K!hHJPKh NHOrUK!h9PHHOrQK!h.RCHOrLK!h#T=H"HK!hp0CV6H"BK!h W1HO2>K!hp0Cu*HOr8K!h\%HO23K!hp0Cp0KHF0.ee8O RFQFHF]X??F F$h+ RFHFEF F,IJF |t&",:FVht4/x+h+HOrK!hmd4W#@/! Fb2CKOaJrFF ih F mt&4-O'- FF:F! %LKPBڡI :F! ()F0љHb0іI'FO5FJIF0FCяJh @ @+@~<;+@2(IC84(ŁgP8#5:T[E_dPhCC`"x ( ZI hCc8;C8;xhCPKh8oHGJ x"  DI8 RS+ ?I"x ( 7I< 7hCshCSh0I C@`-Kh@; hZC~hCzhCv8;C"txF ( IqOsBIhCThCPhCCL`RMb@A"i^~^^_"!`^|^^^_t&2_N_4"xF( I&"xB* {IKyIhyJCcyH`# hsIhuJC tH`# hoJ x* ?q iIO iZ#fI#dI2+aK n(?i\I YKMQ TWJ FQ`S A0 8`( {*(+ LIhHCIH2s<+D>2CKhB2oCEFFOsH h h3SsEbF”FbPC \0~EC 3+H F\z;FF0F2Z +J(+V; NHC;/N'6KF; +; 32H 0 RK'gF":b`P""h_bb"; C H;IFH# K 0B  E܇H FzF0FJ JDzHD zO0E'8FhHF   `;+fYddd-8CNY#2F9F F(?ax): #%')+-/1357bH0 aHaHaHjF_H"1F F|#0'YHYHYHYHYHYHYHYHYHYHYHYH#2F9F F(?խUH#2F9F F(?ʭax) MH FJHJHJHJHJH#2F9F Fl(? FFAH#2F9F FW(?;H#2F9F FJ(?6H#2F9F F?(?zax)/Hq/Ha/H_#2F9F F,(?g!y*Ha#2F9F F (?[&Hbb""cEcMciccccccd.dHd^duddddddeeee-eReteeee fef3FS}](FRFV)X/DDdJ(Y SIF :$I F(цK"@Z`d+ '*!$DtDOvKh DdDD4D$D$O O XF/(FYF(F%)F F>cI .ѝnF(QphUKhb "!RHSWI2F SUN[h "!+OHSRI2FMHS-7OI+F2F SMJMINHS#JJ#IIJHS.!Fh! d! `! \! X! T! t08I8I2F!O0h0fh+1H+L\!hFV-K?F(FS *I"FF R  & !O0604h+H .HN)F FH0F6\#|hN -CY;(-OFMFH0KM(FH&whK(F+`;x-+04RF88Fd0RF! V+8LFFO D+?V;pD>V?D;+Ѥ NF$3`+~r+TR+i+C t+x+ ԑԡV Ob>PFFЃ C#+d0BF;F<~L Fki+ _#HL*sj:FIFHFHJ qj?IAHAH"#U[:H  eukicj1I5H5K"2H#8-H!(k(I/H  Rj"I*H$H"#HHS (8! . MObV ^F FR<"9-h](-OFF0ݞM'1F*F FAљKh,#0*oДH"!@@0+{ڏI v(c(S(GT(ML(7 Ud+R#-5EM]mu#D0#3#3#80#H0# 3#$3#(3#,3~Ik($)LDshx*:B FJF F>/Ik($)ԀLDk@K$33sh (8Fsl+@9F0l"FCF@h7+hFHO4h3+@0+xg+AH0+= I Jh( F H"x1$1$P2$81$XX +_H,@[Kh+XhdFXH n QPQMQJQGQDQAQ>  /FC+Fd#b F- @"p$@I0F1>LO =I0F'O :I0FO 7IFO 4IFO 1IF&h+?TWx+?S +?OiQh)?J2a  h0>$=,?~(F FHlx80 F#)FC(3C<0C ")F FO+B H,Fb 81$ P2$  , = J -GFh F 퀹OOL)F:F0F^A ѵKhBv RWIF D(DРb++R#!!!!!!!!!!!!!!Kh 6#$6#(6#,6#064#6#86#<6#@6#D6#H6}$&B4&< C"<&,&28&rH:r4&r<&Z0mJmKnH) FF(`U#PgI(FQ(ZeK #D#xhaIP(1^MOjO W(@F #+p#kpWHnSMP6jhCM`TFOH8^HP(=h1!oF(f.@9nCF@+?HQ  +x++ .F0F37H6F(F !8Bak,Jhkxh320Z.<#XCKZ`PBD2m 6۲20 Ѹ:(3x$h3yt qCt zg-GFh#FMLD*F9F0FC!хKL1 1h$C!+&#h#4wKwJ`x(`(A(:M(Ua+R#$+%[$$$$[$[$[$[$[$[$[$%[$[$%+%[$[$[$[$$7%h3`434434LKNJZ`0#`131x@33@3r131l131f131`131Z@34+&#h#4O,p%%aTPIF/I Д *F)F#(F hH#IF "h !In O#:FF(FpF8(Fh8 3x+AF0FQ.?0.W AF>HpL>$|xhڒVp}[P>$t&-CFFTIFpFL"F9F0FB/ѡKMh68.I,iLI FV I FR )ML*F9F0FC BF}I}H4}IBF{H.t(p@(A83(S !(&&/(&&&&&&&&&&&&&&&&;(&&&&&&&&&&&G(&S(_(&k(q(w(&&}(((((((&((z(cci+_Osci+X#ca7ci+Q#ci+K#ci+E#ci+?#ci+9 ##c`#a#a#ci+(@####`#`##bKh`ci+Osci+ ##i+ KIh a.(߮#cbqx| C$:mt&|\:ܮ-!#j+?֮chh+Ю&i.̮W)P h)F(ۮqI*F #i+chh+&i-5-gI0F(dI0FpcI0F(@-S4-(-=-?S%)}* '* ' ' 'q*MI0F(cj+?L - -~W)G'3е AMBN(cAF@Hc-ei#"jihZi##"jih(NHhW)W)A" 0(Hh2??#H&OBF HF FKHѲ3 C "4#F4`j(?ѭ i)F F(1F F(AFHh:m\4T-OMRNF\ F'2F)F F2CMKhB<(=4OU/@F MR(f(O#4'*OaZ 9I* `/e a*(@ `(>pCO@гO5 `jF!(> d ZFOa0F40F/Kh+H1F F>0!F*PF~ `jF!( `jF!F( H a Ow*O|hvyRHC$l-CtML%&I POOghKH8X<8KDX@8K`XdXhXpXtXXXXXXXXXHhLhPhThXh\hxxxBFD8O3l8cHC #8FF:F"B? QI*FF ` xL H }K<|HFX{IP(@mK"T(XuIF(@eK"XT(oHtaK x^K^J,\Lh8C<x%fH6hXdHZ(bIpd `KAKJ]K8(B HDM&`h$ dh?K$QM&FL*FCF@8M#F"HJ!|h #<,wP FB ( #Cn(b (@3hPT/IF"F:.I FP<KTQ+I FP3 K"h(I'I FP)0 K"T(X(="H!F8 I F(AK"h(;$_j$ 77x777/7$77748:8h9|C9r$\774D+R#-137133333333c33?133333313333313)23m2323133333333333M1W131.113133331252E2w2233?33E3K"(HK"X(T(K",K"hK` x+?KIh |K,B,,2,~K",|K"H(} zKFh uK,:`|x`mqK"L(hqOObrH9ho^? IFVpx+1K;Hh G"@F0-H ; 5P!K",#K"L(Kh FK"`(d(K"O8h K( :hI Kh?)H  tMHKHhI:Fj$?8t&hk8Qs$N88888p&h889N$L#H<<(x (@N?F(@𢀮L(*@ŀ)@𪀪H K O TI "LFI "(FHL*FFH 8FD"FF8FO 8F<"FF8FO 8F2"FF8FO z8F*"FF8F rH"JFH jHJFH bH"FFH ZH "FLFH Q(FP a!F !FL  !F !F I +@Ā+W2FFdK88+D FzNaF(?V]M<; j(x h UK JOb F&oNL? \P)FFcH~#8GK<+>6^IOb Fo!  :!hȱh #MH!LI KI ~FH!F(CI sBI o@!h0FF F5FKFHOb'F F FL[h P|Px 0 ,8P+ ,*OK",+-:F)F0F Hj$r$p9z9|9#$$&$9*`960$98$9@$b9Z9w$%9,8+AF= ,8+Л-GFhFpLZNhlgI1F(F#3p2+"l!N߀\I T-3 R(:VI 89(/(-08 v(%3331F:F(FAIKh/V#PFJ+xh320*(F(@I" [qh@F=OO O )F9HOr=? 5K5J !4 31I /I -I +I (F (I .p0&I!%H%H$K(F4B!H4KMi i I 0FI4+FMi(??`+%LbL|LLp.%L0KhBg:Kh(^ 6KhV8I(F(6I(F(/K"`n(+b(9(%0(%.J08`c +R#<<<<<<<<<<<;V(JIHzI*F K"`K"`K"Z`JIHf jF! hT?+єx 2%x|xx~:x-AFV;ELH`#`/#`I##a }O`a}o=A_h>>t&~XXX ܀4I0iij\ `0 0*9 2(F"F1F"""""I,",& J! XI:FH>+H"!"#H"!"H"!"+`0+ ii*ݭ0\0 I0f K Iht@(%%XXXXgtYXiX&-O$FF&FJF9F(FC-PKME8.J0FM'(7,C F"NFM  %DIF(5W) 0g(u(G( 0x`3x+"@#x0F"0.I2F FFx+-&I "5K "H0M(F(0I 4@F.0I6PF0IP= (F HKJ(FF+F!F F"F|N$h;YMYtY~YYY4Yt&-O#4$JFOp0FKM`K`K`K`NIKOr!F`,hܹJ#MOH5J5J5#(oўIH@FJh0@EhF@F(O5ihm(P D(C(AЎIH p(Dr(RF9F0FB029H X pCO&+'s7HDFȳ'0F@{+/ 'wK"`%3sKtI@#0ر'0F/'#F@#dI"dH'fFf#FhMIVH{mN(m+O $OHNI ~LI zKI vck@FH8@ # :NW F@ NRF @$ FNT BNL FNI $F@F O1H"!F( #0$-K`" $+K`m##'Kh)ɀ 982"K" `15%w%%%%%%48%`%:n%%hv9-Ŝ%p%%%<%%8%%t&@&%(?k $t,H1H % +I $ (-P!(FNF(?H 0#XD#@#3B #*F!F #O3$CF?%, $(FAF#(F$X F%P +Ѯ H %HP&N^T&NZ6 #5͛-OF˰hLF&FF O3`RFAF8FFhяKWE!ݹN"HFF<HڈIJF Zp-a-b=-   " 4z-->|IoB#{H#" h#V3sKqIO2oCqH#" h#@  hKh`6OF[5 8FH pC_&##&^J#aX)Fa 0YVI(F0"0P##bNF(iNI.л0ѹ-JIJFTIIFGI 2FOqF( " "IF0F((9INh N(5IP3I 9F 2  ! (1F8F$  &I&J3FFx(?t#I(!II@)Fd`!FX*X* I]&|[t&bhht@t}%ISoaeӨ(;I O0>IF8F+O  BF(h+ >+IBFh+ >&I) 2DBr2DFGF+OqB #Bh+5EFV >! HFNz, F8FBІBFFFa1 -O(-OFF3}  0LhI FHH4 3}I F(IHHO(r! $ .K! FVKhO3y3v3U3L0 F?!FD0 ?! :0d OE?@#FFFY1F8FKTJZF:CL{(F0BXC3XAZA0 [vabD # FFDF(@Y@0BgK gJ+!3XC3X0B@$^MV(&M( 6(~?(s4(O h$N8(S Q!PQ!P!P!PQQQf('j8(?v(?sS QQ!P!PP!P!PQ!P!P!P!P!P!PQ4KhVMZNE1Kh.ZD(L%E=$9Y%CcY%e0##*#Y?%H%O |$x$F;F !C(1Y?EH#[hzk̏7zzʲ t&6| !(ђH0B)F C# FV!CF(F;F !CE< сH3 4'0H#X >0wIwHAH Ah+@ԃ )FC탘NN} DjfNw A >fKhBNjY^@@كUDރ",0@׃VIYHAX11(FQX1 30rV#>X3!rF>0IXYԛH@ 2F9F>(.ݗH@X#RCY" !K@m0яIHK@?~HF@XF>|@(qIHIH "K@0&h+xIH@XH[<, h+wH@ h+?h +?ڭX23"SY2kHOq0 h+eJ\IeH@reH@0 h+_JSI]H@a TbFXH MIYH@UXH@_WH @" >:81Z_RI" A0OHtCFMH<1 Cc<1,1"EK,@+0N.IAH@H ,1":K,@0#I6H@0I3H?4A0YCY.H怘@fF+H@Y C@YTFFI%HFoXGԘJF V0AFV#>0:IHRuE@ ю@7}A ɳس 10HP کSP^N#V IV"TJJHLKKB FA.0эIH! F> SOqE0чH@` y"K@e0IH@Ra*XY\CsXb Ah(4tIyHbR#AlPFbS"@?3ahBh Y*qkIL  @ >XfHxj+HFbS"#j)[hhFh AK @vXY >\hh.>N1ZԟF2 TR՘PԋEIL  @= >=)F FCZx1>Nh-?+j;3F"!@Cmh 032F9FHF?)3jK0F>0F@(Ovhx!h:՛j 2Rh*?!K@2k`h F`@ hh,Mh#B`zzjюĴT کд#=dM qI H@Y@C@G@ZMwHPiMqY? ~h  Q/0@-0 ph P ^0n@0 , 0 010D}xD/10!O-bM M b [ !b1 0 0 30`bݍ Ѝ"]\ P\ Et   $ Hp;` 00Ġ80G( Gˠ x7p x8_S0 @G `0 0 00⫪ 0媪J sP x8`@##[*hP 0` l840G7V ` 0` l840G7B8^}|]]??0ƒ S"*0@- R P@ 0\ R^D00"@80 0 0^ 00"@0/[[[@-M @(((Ѝl  \/\-M 0 p 0 S 0 /O0 Ѝ`d/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*//7*/>*/ 4T*///*/@-@@*/*/*/*/xGyxG-KxGxGxG瀗xGryxGxGIxG烔xG'0xG,xG=xGQxGxGixG}(xGCxGPxGxG焓xG xGrxGN;xG%k1 xGxGCxG,xGtxGxG3xGxGxGxG狹xGixG犂xGMxG5 xG纉xGxG1xGxGxGa&xG(DxGfull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.maximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesspaceuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectorssectors/track%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u%s: can't write sector %u1601803203606407201200123214402880usage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mls/bin/shSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. passwordmachineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraecsctbdchfesprdletdvcmiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderr Terminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.0_RC2 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC2 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC2 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC2 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC2 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_RC2 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC2 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. # sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPErelease11.0_RC2evbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicant/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)/dev/r-t xx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/random/dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crandom.tmp/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigmdm >= 0 && m <= n%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c---%c-%c%s %s %s %s %s%s %s %s%s %s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%cr%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEr%sparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2efsnilfsminixfs3vmkcorevmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitiontc/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d Aps{v!}AMՏՏ 1$ѝ*0N 6m<CCJ!NVUZ(djypi}}c!Ne\e  ]5"#A&Q+ ,F}7}7;;;% =* =?/A4E<5G<yKFIOpushdnepopdneS/mAi =@@X ! Y @@  I 5-  9   @@< & @@, unblock and -DNO_CONV?H``x`$ffl`Hؓ0`_100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directoryDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# unknownline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/tmp//usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXEDITORmalloc-c/bin/shre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesAutomatically adjust partitions [%s]? Invalid answerreallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tableQrounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] Usage: %s device %s device command [arg [...]] Available commands: nonerwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grewfalseArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%x%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%#llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %s%s%d%d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): ???CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address boolquad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexNODESTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendormalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<liLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELLlessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETAKiBMiBGiBTiBPiBEiB.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0link#%dsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink  ",8E8EE\pEZ# _ ^ F < >?2EPATH= tZ,f d' s.,c8 m? lMTr \dpnvn v pb    EOF reading here (<<) document""""""""""""!""# ###!#)#/#4#;#?#C#J#Q#X """"""]"!vJ}-+?=x%@$~%%%%%%%%@46BH:>Dt%t%abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'tc!0'b!1(b!1 ($c!8(`c!0"(BLc!0Q(8c!0X(c!0_(b!0h(1([ڛ z K6(2( ( (  $($(#(( ^!/(mB<'4                  *E<*E<)=#**(*c$%A'.*=6*5:*!*=@*iF*=) $H* N*}R*V*\**5a*5f*=l*mmŋt*v*E~*G*%p*1p~*5*!O*  **[(=*J*-** %4Ն*]o-- ----*--- -< - - .2--:.. ...pA./ /5./c/m/c. /J'/;+//0/6/EOW^ekw@~@x   !1bs&1:`Q/!! !M!!!%!+!2! 9!=! Ǎ   C!zI!; "O * 4 = D S Z ` /g l EIt Ny                  w &/8CLW\chox}/!! !M!!!%!+!2! 9!=! Ǎ   C!zI!; "O * 4 = D S Z ` /g l EIt Ny                  /!! !M!!!%!+!2! 9!=! Ǎ   C!zI!; "O * 4 = D S Z ` /g l EIt Ny                  /^+,:(EDEWEmEEEEE IF hF F F FFFF G,G?GyGGGGGGH -H!=H#=H$FH&=H1=H2NH3=H4=H5jH6=H8uH9{H9H:H;H<H=H@HAIBJICvIDIEIFIGIHIJILIM JNJO#JP3JQEJRZJStJT}JUJVJWJ\JaJcJd!KeCKfWKgjKhjKijKpqKq=Hs=Ht=HuKv=HwKxKKKKL$L9LHLZL{LLLLL M$M>M\MnMMMMMMNN"N;N;N;N[N{NN tNNNNNNN=H=H=H=HNO'O@O3QWOjOwOOOOOOOO P(P?QGP_PtPPPPPPQ8QLQlQQQQR=H=H7R6D6H6R6^6d6j6n6r6|6666666666returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readp|D@qKLRPrET@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-qzz$z8zDzrz{zzz,z)X|\@5~<~J~^~s~~~~08DXl$H,@hTh|$5555555 666"6*60686>6D6H6R6^6d6j6n6r6|6666666666!d@Հހ #DW~   I e DĂ0Ui~ȃ !v=#v=$&v=1v=23v=4v=56v=8$9*91:J;d<=@ABC%DLEbFwGwHwJLMN…O҅PQR S#T,U4VLWf\pacdІefghip qv=sv=tv=u6vv=w<xPl}ƇӇ *Jfӈ 4Phˉщ *2r6@Hk~v=v=v=v=͊ߊ#0B\l‹ %:WoČ̌2Mhɍv=v=0Pv=cv=׎ ,\h@}l@t@Ix@6*=||*ս@SFH0eCSFU0eCr6Hah!IdontNeedEFI).(s*K>;8<|nQn- q+GS|nQn- q+bl|nQn- q+y|nQn- q+|nQn- q+6=rGy=iG}䰘;Mt?ƘјmWC 3KOOܘyD<#*=(3Dh&\ M}-#4@Mjy֬EV-чHj6g-чH6|ZIчH4IчH5IчH̘2IчH5ϙL6 %?aۙS'@ )Ѹ*1@ )Ѹ61x )Ѹa@ܛbackupstore_gptstore_tblI@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapssetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus"6Hprintallmaindo_setifpreferencedo_setifcapsRzipryiH*H*H* \JH*H* 88NnQ Z @k@c} j}  éϩ۩@ 0@"+05:@ LR X@Hinit_current_mediasetmediamodesetmediaoptsetmediasetmediainstTG_Tܛjr"6H_r Tr`z@z_rܛjmedia_statusmedia_constructor7@(6;@(6(@(@K@K7J@(LP@LPpaddr_match!?settunnel `print_link_addressessetvlansetvlaniflخsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrtsӴҴM ڴhٴڴ h^h* X  8=* Դ""Uinvalid major numberinvalid minor numbertoo many fields for formatffs@XX XXXXX0Y YY@Y%Y,Y_Y3Y REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@BCFILN%OSRacbsc~efhikmn"o1r@sQub@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:Z@@^@h bpfp jpnp r` w|@  $1м|^t0 Non-system disk Press any key to reboot <WSO@KGCE?;7DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYo      3 [ {     A i    UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_printpe8p8pp8qq8tq8q*q88qJq8Wq]q9lq:zqE;q8qq8qq=q44q.r8rr8r-r8r=r8rOr8[rnr>zr8[rr8rr8rr8rr8r s8s$s8=sSs8qsys8qss8qss8qss8ss1?1?t8(t-t8;tBt:StU3U3rt8}t8t8t8bitmask_scancphpoptp{phw.disknamesk444 ;$;(;,;0;4;***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20260107  " $#!%Z^\`[_]aS5W5: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for datazz}[\ (0<9&@I%V%^%jt`%6_%^%%% ]% {%z% %)1%>%EL%V@%`4%i(%sp%PZ%PZ%v%%%% %%%#v%/%@%KY%k %w%%collectt 7n5555555 666"6*60686>6D6H6R6^6d6j6n6r6|6666666666NAME=55@5mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds5555555 666"6*60686>6D6H6R6^6d6j6n6r6|6666666666 edit_fs_type_ext$ > 1C    " # , , 1L eU uI edit_and_check_label 5555555 666"6*60686>6D6H6R6^6d6j6n6r6|6666666666disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzV ^ -_ 1a ] 7a Y[ 7Y 1` Y q[ Y Y j ] Qg \ Z 5V UZ ca c e 1V -V f Y Y YY \ =Y disklabel_change_geomx~ 8outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default&&&&pm_from_pepm_whole_diskgpt_freegpt_create_newȆ y Y    i  ] j A # = Y s % w 4588)5 j66̘ !qzrz8zz, 55a 455v860j6H]@6gpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eCSFU0eCr6Hah!IdontNeedEFI).(s*K>;8<|nQn- q+GS|nQn- q+bl|nQn- q+y|nQn- q+|nQn- q+6=rGy=iG}䰘;Mt?ƘјmWC 3KOOܘyD<#*=(3Dh&\ M}-#4@Mjy֬EV-чHj6g-чH6|ZIчH4IчH5IчH̘2IчH5ϙL6 %?aۙS'@ )Ѹ*1@ )Ѹ61x )Ѹ@ .F*ƇU^6Afpx mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newx~ i E    y m      A ]   j # ' a )- "   %     u. / mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************zz?CGKOScontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2[dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionìbc~tdefgEhkir{jk½lm̽n¢oӽp@qr޽stutvwMxzyA$B1CbD8EBFGGQHI[JeKlLQMuN{OPQSTUVWþX;Z1ܾ46| ~} '7IWU^\ckpv|UYL:0˿ܿڿ8 (4@S`nzdefault_configread_configrt_compare_proto ۖ ۖ rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtq q rt_buildrt_deleteŖ Ŗ sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initat script_buftoenvgܿn"make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_ost{if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp/:FU^dhcp_boundjs{1U dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa!! !! -! -! ! ! VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B`i8 f8 l8 r8 x8 ~8 8 9 )9 DA9 Y9 q9 BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ȉ`flrx~ D@ljhcs_pathX  bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_max`fl,rxD~С\tD !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_popunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %smemstream_seekrshrcmd0123456789abcdef %x:%x:%x:%x:%x:%x %256s 0123456789abcdef0123456789abcdef0123456789abcdefkMGTPEBKMGTPEKMGTPEBkMGTPE_getttyent: TLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~_fts_readkh?marshal_new_auth_authunix_create_xdr_arraygethostby*.getanswer: asked for "%s", got "%s")& @"NBCDB  d'@Bʚ;0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as5gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef0123456789ABCDEF_xdr_bytes_xdr_string0123456789  %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC 0123456789abcdef0123456789ABCDEFQ !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG @Cisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB 0123456789ABCDEF0123456789abcdef/& ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::o!iL[\j m mN,m`'$4m<H& l\{&0&$P&|@&dx&@q&p&&$l{D&9'&& &}\IP&̆,&$&<&|9'L&t42)'X&h&8&b=H`pJt8`@̄&&&Pph&t&x(_p|& HP.~ >bIjjRcZf_hkkzlmoopppqruXtvjLwwx$%xzzBJCJ+O5PDSKTVVV^XmZkZv}   4(ioieQ9(!oeQ!  /dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin$W!}-+?=###%%%}]!]!\afnEVte|FIjLiLlmCnfpbu&qns hv VV x4_!@=d q:\'gQ<l'!=>'fp<'_?'y<'k;(;((F(}!;H(;g(0 0U&000RE0N0P^+zzN+zzNQ0zz%R]0g0AW,zzPp0zzW{00M/0O00MEE55 ... ...cI[["pTpqBrr|,| Ƒɓ%%$%K͝~M%!$m AabCdhlNsuvW:w:z@HPX`|TX NX <1<:<e2:hX <&:4Z\\fl}|$$}8$ #<$  h|$ .!$.!  Dh| H4}  Ψ      $.!84  w   ,  ,}n  n,)N  N,8  8$(4Y( (4K K4eJ ,6  64 $XX ̬̬ UӬ Ӭ$l ,  $ xL$´0x4 Ӵ Ӵ4 ,A  4Դ Դ,h * h,= * ,ڴ  ڴ$ X@K>EJPX^̇d9kpt]|]X  '@@&L4\.$(*(.6 <D LRx%@^@...... ...... lost+founddA.##.L3Rp J - " 5  $% "NS F ~,;2oNX<n E!L"S#$\%`&h'k(|)t*>+},-/1123456%pppppppppppp. (prog_root)`L#D####pZRڛ(%#$$$&$`0$8$@$J`9IP`9L$`9`9AlL`9]kT$`9uD`99kZ$`9Ʌv`9R*`95y^$`9 `9Y `9F`9i %0`9ɇ:`9uxJ`9]zF`9%|d$`9p$`9uu$`9Az$`9ى$`9 %`9Ʌ$`9$`9t$`9k `9i $`9Yw$%`9r`9=x~*`9vG%`9$`9#`99k$`9y%`9$`9=$`9`9%|$`9M$`9z`9}$`99r`9E|`9}%`9%|$`9LP`9k$`9I*`9$`9UmX`99r$`9Um$`9 Y`9%|$`9]$`9t`9i $`9$`9!%`9%| %`9%|%`9%|`9Yx<`9w0$`9=w`9u `9Al `9-`9Ʌ%`9уdM`9"`9Ց%`9r"%`9q(%`9U0%`9{8%`9%>%`9F%`9M`9тL%`9ՏT%`9u.`9Al\%`9v6*`9ɒe%`90/`9͎"`9Ց-`9tj%`9 lr%`9WR`9R`9kz%`9%`9u*`9Aj*`9`9=%`93`9m`9v"`9Ցf`9@$!x<L$< $B>=?<<EE$E!ܝ<)E$>GE%t`E=%p{EE&|E$ECE) +E) cE!.EEF%#F%#s8F!?EF2#VF"G%@*%|JEDNFX0PJc`%aJl6/sJhJD*% !"$'(+-.03569:0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ\(\(\(p(p(p((\(""p(((( e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<`fko is a directory is not a regular file (use -f to see it)++ ($Љԥ܉">~t֊!;, d74 > G U#b2o8  (ȤŊ!ъڊ9T&7f )!5*e3:=;%EO6X4Md r+,-.*ʋ?uڋE//'F -;֊ @GU Z7fakq y  WmkRkRkYcWbkCkc kG ky wb YMYrWcaP<4o%#AbH<@n%iB@<n%͔c8<0o%##d0<o%Je0<A$o%{D(<(Ye < o%ӕf<n%F<o%;eg<Pn%Ӗh< o%i;o%Aayj;J;!n%ڗk;Hq;HK;n%L;n%5Sm;,o%kxn;"o%o;ژO;Qp;HP;q;s?{nY oYoqppAyQxnS]quq]qAq}yx-qUunTn[n \n.\nmnYynYn?\5e\=\E\M!Uqqqq/Ar-rrq̓)UrAYjk#ir-5En4Yn =nr}r !ςAs)ssrrryxr'u=v-vvMvvvvvv}vovav%n-n5nnun-wwvvׁ߁mm&sw'ew(Ww)Iwww=uww%wwwwwwlx% m%m=mUmmmm\m#]D]T]c]Yh]l]::nq]t]x]]]]]]Y_v_ca}bddeae$f4fFfLfTfif9mfpfsffghj^k{kk{kkkklll " *Ieܨ 7GUBd\hʩ5JNXp<Ƭˬ۬)0>KSf*<0/Ԯ :HYdįw3Nj~n{̳ҳhִ#6^]htvrokµεݵ%Tdz44Opط;͸ u"ֻr>>IrּJBr[}þ$J5J]jr|BP\bju|+:LS]{nx1=HQ^m{n)4IV^r#7<Wfw;X`n5?Pf?Wpɥ188<̘40/!u s  Q0 10&6'()*:+,.1/ftp@7#@ 0=HWc]-Q 6>)R #R ?}R 7@IQ QP AN BN C$N D Y=P E ,N F 6N G N H 0N IsN YiN UN r v ?v ak 1umk 1ey umk ,;]a \ ] \ !  C M  "       E"&*.26:>BFJMQTX[FD `!q"#$%&'()*+,-- . . / /$L0*L1 2 3& 4+ 5(60 76 8< 9E :A ;K <Z =f >x ? @ [ \ \ ] ^ ^ _ _ ` { {3 |A }M }a ~g   -dd-ddTdd:dd:dd \x hx@px@|x`xxxloxooo#o#o#o#o#o$o$o$o$o$o%o%o%Hs%o%o&p& p&p' p',p'4p(@p(Lp(Tp)`p)lp)tp*p*p*p+p+p+p,p,p,p,p-p-p-p-q. q.q. q/,q/8q/@q6Lq;\q;hq0tq0q0q1q1q<q<q=q=q>q>q?q2q2r2r3r3 r3(r94r7@r8Pr:dr4pr4|r4r5r5r r! r" r# r$ r% r& r' r( s) s*  s. ,s+ 8s, Ds- Ls/ Xs0 hs1 ts2 s3 s4 s5 s6 s7 s8 s9 s: s; s< s= t> t?  t @,t!@8t"@Dt#@Pt$@\t%@ht&@tt'@t)@t*@t+@t&`t'`t,@t-@t.@t/@u0@ u(`u1@(u2@8u3@Hu)`Xu4@du5@tu6@u7@u8@u9@u:@u*`u;@u<@u=@v>@v?@$v `4v!`Dv+`Tv,`dv"`tv#`v-`v$`v.`v/`v%`vCvCvDvDwE wEwF wF,wc4wc@wdDwdPweoeTw#\w#hw&xw&w0wwwwwwwwwwwwwwwx xx x,x8xHxTxXxloxoxxxxxxxhntn xn n@n@Ĩnnnnnn n n n@n@n@n@ o@o@ o`(o`4o8o@oHoPoXo `o@do }33333333HH(D\3333ĚȚ̚КԚ|PUTC33pp    A  ' 339'339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž$}0}$}} 33UU33UU33UUd$p}hd$p@ d$p$&xĴ̴dht|wԴxwشܴx   @ 333333333333333333333333333333333333 33 33Ȇ ^^ 0000000000000000 -'33333333833 (root)`33 tCgggggggL@xhjlndжXܱ  h|LhService unavailableȦA4aeabi*7-A A   "D$6l7xܭoAYr+\`u(4$!!AUE"P8 ܼ/;A>q8./Jw*י_՚dIwQkh-:Zՠ{k3\ھSvU+.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BhhHhihiPllVll$bgt(((yPP ppZppZ9'pZppZ5Z^]MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5770 5804 6487 6775 7483 7539 7613 7709 7884 7907 7930 7936 7945 7967 7971 7975 7978 7981 8086 8289 8528 8969 9407 9442 9457 9469 9475 9487 9536 9556 9596 9613 9630 9645 9692 9730 9778 9860 9984 10120 10161 10199 10236 10271 10281 10330 10480 10486 10491 10495 10515 10625 10645 10651 10665 10677 10688 10725 10759 10783 10885 10922 10944 11043 11098 11156 11167 11183 11235 11403 11610 11781 11845 11897 12169 12719 13248 13680 14018 14351 14464 14479 14488 14648 14819 14969 15133 15156 15180 15195 15270 15410 15587 15742 15754 15834 15935 15981 16007 16077 16088 16097 16110 16136 16151 16167 16180 16235 16246 16261 16465 16698 16727 16742 16811 16885 16958 16988 17026 17080 17499 17525 17554 17658 17764 17949 18061 18176 18280 18967 19226 19366 19402 19572 19613 19749 19772 19809 19854 20105 20201 20255 20354 20365 20402 20439 20466 20475 20509 20516 20541 20568 20603 20617 20631 20660 20674 20691 20700 20722 20740 20757 20768 20787 20813 20831 20854 20871 20886 20901 20919 20946 20973 20995 21034 21052 21084 21312 21386 21429 21475 21622 21778 21822 22101 22128 22487 22671 22823 23004 23151 23309 23330 23378 23388 23396 23407 23418 23428 23435 23450 23462 23500 23530 23569 23622 23680 23701 23708 23727 23748 23755 23778 23800 23820 23842 23873 23910 23932 23946 23992 24021 24055 24095 24130 24158 24206 24215 24224 24229 24238 24247 24264 24268 24273 24279 24283 24321 24330 24357 24377 24400 24419 24446 24468 24500 24516 24521 24531 24554 24576 24593 24610 24623 24632 24641 24647 24674 24681 24705 24726 24750 24763 24782 24807 24830 24846 24852 24864 24894 24902 24942 24953 24964 24975 24992 25009 25023 25040 25256 25560 26008 26224 26488 26760 26812 26848 26884 26935 26952 26990 27004 27011 27028 27031 27036 27045 27057 27068 27077 27098 27140 27178 27194 27225 27250 27285 27341 27381 27402 27422 27463 27492 27540 27773 27808 28015 28034 28071 28132 28170 28209 28365 28380 28426 28474 28497 28533 28543 28553 28564 28569 28632 28680 28724 28785 28818 28919 28937 29076 29098 29221 29235 29245 29268 29373 29429 29545 29576 29581 29607 29646 29656 29699 29709 29725 29740 29758 29781 29811 29832 29858 30055 30098 30102 30108 30114 30119 30130 30144 30173 30205 30217 30264 30314 30354 30381 30397 30406 30449 30455 30463 30467 30487 30504 30516 30547 30803 30852 31428 31455 31487 31515 31567 31573 31579 31584 31605 31621 31643 31672 31813 31947 31960 32096 32098 32100 32102 32119 32132 32150 32177 32181 32187 32192 32200 32206 32246 32248 32258 32273 32290 32324 32356 32394 32423 32452 32474 32517 32543 32587 32723 32725 32805 32851 32899 33004 33106 33145 33212 33219 33280 33344 33348 33355 33477 33546 33834 33972 34113 34194 34241 34247 34270 34316 34319 34345 34388 34453 34515 34585 34653 34746 34965 34990 34994 35030 35048 35076 35118 35162 35226 35276 35352 35374 35426 35470 35509 35543 35573 35604 35629 35638 35650 35658 35669 35681 35700 35724 35773 35790 35814 35857 36179 36182 36196 36209 36221 36228 36239 36246 36253 36262 36272 36289 36305 36355 36363 36371 36381 36392 36410 36427 36448 36470 36479 36489 36516 36522 36532 36551 36567 36585 36605 36614 36625 36632 36649 36668 36689 36699 36716 36722 36738 36753 36768 36789 36811 36830 36840 36845 36850 36868 36887 36906 36912 36931 36951 36971 36989 36994 37000 37017 37033 37054 37067 37075 37095 37119 37136 37144 37155 37176 37182 37194 37216 37230 37239 37260 37278 37287 37321 37344 37371 37403 37426 37446 37457 37489 37505 37516 37529 37552 37574 38082 38112 38143 38171 38185 38386 38608 38775 38862 38879 38897 38914 38943 38990 39001 39020 39042 39121 39313 39341 39459 39481 39622 39641 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_RC2. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_RC2 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_RC2 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_RC2 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_RC2 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_RC2 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_RC2 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5767 5794 6360 6660 7301 7348 7461 7554 7588 7607 7625 7633 7642 7667 7671 7675 7678 7681 7803 7988 8216 8736 9087 9116 9129 9142 9147 9167 9186 9207 9266 9283 9297 9319 9364 9390 9431 9509 9627 9741 9795 9824 9856 9895 9901 9934 10057 10064 10068 10076 10100 10182 10188 10195 10207 10221 10230 10263 10282 10294 10404 10466 10485 10604 10655 10707 10719 10738 10790 10994 11202 11393 11453 11502 11769 12228 12894 13317 13639 14064 14196 14228 14240 14418 14615 14776 14910 14930 14963 14977 15046 15159 15331 15466 15486 15598 15690 15713 15736 15795 15810 15831 15846 15867 15887 15912 15926 15950 15962 15980 16190 16440 16461 16477 16530 16598 16671 16708 16734 16810 17267 17293 17315 17422 17529 17730 17803 17887 17987 18482 18720 18871 18905 19040 19084 19223 19264 19309 19356 19600 19733 19795 19889 19894 19928 19962 19977 20005 20038 20045 20070 20088 20114 20121 20136 20151 20171 20211 20228 20248 20269 20291 20306 20326 20348 20363 20376 20390 20402 20414 20428 20451 20474 20492 20535 20586 20623 20808 20871 20907 20956 21047 21177 21230 21490 21537 21898 22048 22217 22357 22477 22609 22649 22696 22706 22714 22724 22732 22743 22754 22768 22793 22835 22868 22901 22936 22990 23015 23034 23056 23061 23067 23097 23114 23141 23159 23180 23202 23221 23231 23261 23287 23314 23363 23391 23418 23471 23481 23491 23497 23507 23516 23536 23540 23545 23551 23555 23590 23599 23630 23647 23674 23695 23715 23734 23760 23773 23781 23797 23828 23859 23880 23906 23919 23927 23938 23944 23968 23978 23990 24008 24019 24039 24055 24081 24103 24119 24131 24151 24177 24183 24213 24227 24241 24264 24283 24302 24320 24338 24561 24867 25285 25486 25726 25910 25988 26043 26110 26150 26173 26207 26218 26226 26249 26252 26255 26261 26272 26284 26297 26327 26371 26384 26397 26434 26448 26459 26470 26481 26498 26509 26556 26579 26628 26869 26902 27157 27178 27211 27264 27290 27317 27473 27479 27522 27542 27561 27590 27597 27604 27611 27616 27665 27703 27737 27794 27822 27867 27884 27985 27990 28067 28081 28091 28115 28238 28319 28429 28457 28462 28478 28507 28515 28556 28563 28577 28590 28598 28617 28650 28670 28690 28906 28937 28942 28949 28956 28960 28974 28986 29001 29034 29047 29102 29160 29196 29214 29232 29250 29287 29293 29301 29305 29326 29343 29354 29376 29554 29598 30300 30324 30358 30377 30422 30429 30436 30440 30464 30475 30480 30543 30664 30787 30800 30934 30936 30938 30940 30950 30959 30972 30999 31003 31009 31014 31023 31028 31055 31057 31070 31082 31097 31125 31169 31216 31232 31254 31265 31298 31318 31367 31467 31469 31534 31583 31632 31736 31834 31875 31966 31973 32034 32098 32103 32109 32218 32277 32528 32669 32796 32864 32901 32908 32935 32981 32984 33005 33050 33101 33160 33229 33276 33381 33524 33549 33553 33587 33604 33628 33680 33731 33803 33869 33967 33984 34015 34051 34085 34109 34133 34166 34186 34196 34204 34212 34222 34233 34247 34273 34321 34344 34364 34405 34704 34707 34721 34733 34740 34759 34773 34780 34787 34796 34806 34823 34839 34887 34895 34903 34913 34924 34942 34959 34978 34998 35005 35022 35039 35046 35059 35094 35111 35130 35150 35160 35176 35189 35207 35227 35248 35258 35278 35298 35311 35330 35343 35367 35390 35403 35414 35419 35426 35444 35463 35482 35490 35509 35529 35554 35572 35579 35586 35599 35608 35629 35642 35650 35670 35698 35715 35721 35732 35763 35771 35784 35806 35828 35837 35858 35876 35883 35906 35925 35952 35970 35990 36003 36018 36039 36053 36060 36074 36089 36108 36653 36686 36714 36743 36751 36788 37100 37277 37354 37371 37389 37404 37426 37476 37486 37503 37525 37584 37742 37766 37896 37921 38047 38065 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_RC2. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_RC2 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_RC2 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_RC2 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_RC2. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_RC2Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_RC2Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Groupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5655 5682 6258 6618 7303 7364 7442 7537 7577 7599 7617 7623 7632 7658 7662 7666 7669 7672 7794 7979 8207 8736 9154 9183 9196 9209 9216 9236 9255 9278 9321 9341 9360 9383 9427 9456 9497 9563 9675 9789 9843 9872 9904 9943 9949 9982 10060 10066 10070 10075 10116 10253 10263 10271 10290 10304 10313 10345 10386 10399 10524 10582 10601 10720 10776 10828 10839 10855 10894 11144 11316 11488 11543 11578 11828 12232 12531 12799 13160 13340 13659 13679 13692 13881 14025 14221 14355 14375 14408 14427 14528 14683 14871 15058 15078 15157 15255 15293 15316 15406 15427 15450 15469 15493 15523 15567 15600 15623 15635 15653 15921 16240 16271 16306 16370 16445 16515 16546 16576 16668 17159 17189 17206 17346 17487 17684 17803 17950 18117 18675 18971 19152 19197 19360 19414 19549 19585 19645 19695 19986 20095 20152 20249 20254 20289 20324 20339 20363 20396 20401 20426 20442 20465 20472 20489 20504 20523 20555 20559 20579 20597 20609 20622 20640 20664 20682 20701 20728 20755 20767 20788 20818 20848 20873 20906 20941 20979 21232 21301 21356 21417 21535 21694 21748 22009 22060 22436 22591 22735 22875 22983 23168 23198 23241 23251 23259 23269 23281 23302 23311 23317 23349 23390 23426 23464 23501 23549 23573 23585 23599 23607 23615 23643 23660 23689 23710 23733 23742 23761 23773 23817 23855 23882 23926 23954 23981 24034 24045 24056 24063 24073 24082 24116 24120 24125 24131 24135 24170 24180 24210 24233 24262 24284 24306 24328 24355 24367 24379 24398 24432 24465 24486 24510 24523 24535 24548 24554 24580 24590 24601 24625 24635 24655 24675 24692 24718 24742 24755 24775 24809 24816 24845 24868 24891 24907 24922 24937 24952 24966 25154 25459 25890 26081 26316 26504 26546 26596 26650 26698 26720 26761 26772 26780 26804 26808 26812 26821 26832 26843 26858 26889 26935 26948 26961 26991 27005 27017 27029 27041 27059 27082 27127 27150 27210 27462 27489 27751 27769 27796 27845 27875 27906 28038 28045 28094 28117 28141 28170 28178 28188 28196 28201 28254 28303 28343 28409 28442 28486 28509 28610 28615 28692 28706 28716 28740 28863 28944 29054 29082 29087 29103 29132 29140 29181 29189 29203 29216 29224 29243 29276 29296 29316 29532 29563 29583 29589 29596 29600 29615 29634 29660 29669 29681 29735 29793 29828 29847 29864 29876 29911 29917 29925 29929 29950 29967 29978 30003 30181 30235 30926 30945 30980 31010 31056 31062 31069 31073 31097 31113 31119 31194 31344 31463 31476 31544 31546 31548 31550 31560 31573 31590 31617 31621 31627 31632 31641 31646 31673 31675 31688 31700 31715 31743 31787 31834 31850 31872 31883 31916 31936 31985 32085 32087 32163 32218 32268 32367 32462 32510 32600 32607 32668 32732 32737 32743 32846 32898 33144 33305 33460 33531 33584 33591 33618 33668 33671 33692 33738 33793 33852 33921 33968 34073 34216 34241 34245 34279 34296 34334 34387 34427 34503 34568 34662 34683 34721 34761 34797 34821 34844 34883 34913 34920 34929 34937 34945 34959 34975 35003 35055 35072 35093 35137 35479 35483 35498 35509 35517 35536 35548 35555 35562 35571 35581 35598 35614 35668 35676 35684 35694 35705 35723 35740 35756 35774 35781 35799 35816 35823 35833 35864 35883 35902 35922 35932 35951 35964 35984 36004 36025 36035 36054 36073 36083 36100 36114 36137 36161 36174 36184 36189 36193 36211 36230 36249 36254 36273 36293 36318 36333 36337 36344 36354 36363 36384 36398 36406 36426 36452 36469 36477 36488 36519 36524 36537 36559 36574 36583 36604 36622 36631 36675 36699 36726 36741 36758 36772 36803 36827 36858 36865 36879 36894 36913 37458 37491 37519 37548 37556 37593 37905 38082 38159 38176 38194 38209 38231 38281 38291 38308 38330 38389 38547 38571 38701 38726 38852 38870 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_RC2. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_RC2 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_RC2 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_RC2 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_RC2 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_RC2 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_RC2Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5749 5781 6273 6562 7107 7153 7257 7343 7379 7394 7412 7420 7428 7455 7459 7463 7466 7469 7580 7765 7993 8469 8803 8832 8847 8862 8870 8884 8902 8923 8974 8990 9000 9020 9066 9096 9149 9206 9317 9438 9482 9515 9554 9588 9595 9628 9705 9711 9718 9725 9754 9866 9872 9883 9900 9917 9926 9955 9967 9977 10078 10140 10160 10280 10317 10373 10387 10408 10445 10655 10830 10979 11014 11066 11283 11597 12121 12483 12773 13166 13301 13314 13325 13471 13650 13781 13915 13935 13968 13987 14070 14185 14326 14451 14465 14573 14666 14695 14715 14791 14808 14826 14842 14861 14881 14898 14910 14936 14948 14966 15167 15406 15433 15450 15506 15568 15628 15659 15683 15742 16088 16118 16135 16243 16353 16493 16567 16643 16721 17213 17433 17544 17575 17702 17738 17866 17893 17933 17979 18195 18319 18387 18487 18492 18528 18564 18578 18601 18634 18638 18663 18682 18708 18713 18728 18743 18762 18787 18799 18821 18838 18851 18863 18881 18905 18920 18937 18950 18961 18972 18992 19021 19050 19074 19109 19144 19171 19358 19407 19439 19487 19584 19717 19763 19955 19985 20307 20436 20576 20716 20833 20968 21012 21055 21063 21073 21085 21097 21105 21116 21143 21177 21213 21244 21279 21315 21362 21382 21399 21417 21422 21429 21455 21471 21492 21509 21526 21544 21561 21574 21605 21630 21661 21692 21727 21754 21807 21817 21827 21833 21842 21850 21865 21869 21874 21880 21884 21919 21929 21958 21974 22000 22017 22036 22057 22073 22086 22091 22099 22114 22140 22159 22187 22205 22216 22222 22228 22249 22259 22270 22288 22310 22327 22340 22361 22381 22401 22412 22425 22447 22454 22479 22494 22514 22526 22543 22560 22580 22599 22776 23060 23370 23550 23761 23949 24015 24062 24117 24161 24181 24210 24222 24228 24244 24248 24252 24260 24270 24282 24297 24316 24352 24363 24374 24413 24425 24435 24445 24455 24471 24489 24538 24559 24604 24848 24874 25128 25143 25169 25226 25260 25295 25437 25454 25503 25524 25540 25569 25574 25579 25585 25590 25629 25664 25694 25749 25782 25828 25842 25921 25926 25980 25994 26004 26028 26114 26162 26268 26302 26309 26324 26351 26360 26399 26406 26428 26447 26463 26481 26513 26532 26549 26706 26737 26744 26753 26761 26768 26782 26800 26819 26829 26841 26882 26927 26956 26977 27000 27019 27057 27063 27071 27075 27096 27113 27122 27141 27287 27329 27839 27847 27871 27889 27933 27938 27943 27947 27978 27991 28000 28046 28172 28263 28275 28339 28341 28343 28345 28355 28369 28384 28411 28415 28421 28426 28435 28440 28467 28469 28484 28495 28510 28538 28582 28629 28645 28667 28678 28711 28731 28780 28880 28882 28950 28990 29035 29110 29176 29211 29292 29299 29360 29424 29431 29437 29536 29592 29868 29992 30103 30165 30203 30211 30233 30282 30285 30306 30351 30406 30465 30534 30581 30686 30829 30854 30858 30892 30908 30933 30981 31017 31078 31132 31213 31235 31274 31311 31343 31367 31394 31420 31434 31442 31452 31460 31474 31487 31499 31523 31564 31590 31607 31636 31960 31963 31977 31989 31995 32011 32023 32030 32037 32046 32056 32073 32089 32132 32140 32148 32158 32169 32187 32204 32217 32243 32250 32258 32275 32283 32300 32324 32343 32362 32381 32391 32402 32416 32434 32454 32474 32483 32506 32526 32537 32552 32564 32583 32602 32613 32623 32628 32634 32652 32671 32690 32697 32716 32736 32761 32778 32784 32792 32802 32814 32835 32851 32859 32879 32899 32921 32929 32940 32963 32970 32984 33006 33023 33032 33053 33071 33080 33111 33127 33154 33173 33193 33211 33232 33246 33266 33273 33292 33307 33326 33871 33904 33932 33961 33969 34006 34318 34495 34572 34589 34607 34622 34644 34694 34704 34721 34743 34802 34960 34984 35114 35139 35265 35283 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_RC2. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_RC2 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_RC2 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_RC2 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_RC2 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_RC2Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_RC2Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..