08P*]wi'&<  '*]wi"OaEP''`'-. -.*]wi'&P@@<@T 08P*]wi'&<  '*]wi"OaEP''`'-. -.*]wi'&P@@<@TU *]wi`'-.yA*]wi*]wi*]wiQ$f *]wi*]wi*]wiRA*]wi*]wi*]wi.A*]wi*]wi*]wi/A*]wi*]wi*]witA*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wimK$*]wi*]wi*]wiX`hpx$*]wi*]wi*]wi (S$K*]wi*]wi*]wi08@HPX`hpxP$*]wi*]wi*]wi+Q$ *]wi*]wi*]wi,JA*]wi*]wi*]wiC*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wim*]wi*]wi*]wi (08@HPX`hp\$*]wi*]wi*]wiu$*]wi*]wi*]wix$>*]wi*]wi*]wiz$*]wi*]wi*]wi~$s*]wi*]wi*]wi$*]wi*]wi*]wiA*]wi*]wi*]wim *]wi*]wi*]wi$*]wi*]wi*]wi $*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wi$Q*]wi*]wi*]wi $*]wi*]wi*]wix $*]wi*]wi*]wi$*]wi*]wi*]wi$*]wi*]wi*]wi$*]wi*]wi*]wi$*]wi*]wi*]wi$*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wiA*]wi*]wi*]wis32eR=cN1 ؝7aN1$ x"n93%$AQ rźC47CQPGW2VGA+K3J%֟,,LV#,H=WGC;F+CЙCpEa  kR-. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4$4 (@@** " "z\z\#,,Dt ,,#,,NetBSDAPaXUSR&ffffUVSшʏ( ,9s 9r[^]UWVS襈Ú(]P PLt,1t&tuAt[^_]Yuڅtft9s1u+z 9suփ 9r}tt~t111us t0#t&wfuUSQE$uԋ}{̋CE29sSU]MȍXE9s1u\tED u|E9rϋU]u9r09Jt*tE9ǍvuUWVS(E@@9s{*;9r[^_]UWVS贆é(E u @-M \8ME @E  -t/tuN,9s 9rEt E$",p$" ,9s 9r "$h"ED$E D$E @$=$ -PMD$ D$ D$$1ɉL$$R$A[$SWD(5u1ƃ5$tЃt]$l_[SW(4uYƃ4t|$]<$kt(?t<$ktЃ_[UWVSh "h "h-( %1t:P2YxOvh-j !XZ3h_%h-y( h-j !jQUEU MsMU HE]tUVS1ۋ %tVPw3ZYu $%C܍e[^]US?Ph!"h-'h-h!"赍`% CtsPh!"h-'jUWVSE tuh!";URhc@5-# t5-h!"j u俞#5!#M𻞍#5!#E躞#5!#WVSQRP5-h""u#E t#5!#RPh/""P# u5-h="":#1e[^_]U5-JXUjhc 5-# t5-hV""jP1USRj EPS xU:t Shd""j]UPEU Ph}"" JtPh""EEEPhc5-{" t5-h""j赖1UWVSSuE H1ۃv>PW1ZYtC%uދ%Eh&"W0ZY1tFEEPhc5-! t5-h""j#1e[^_]US u Sh""jҕ]UVS1%tSPj0ZYtFSh""j蜕%e[^]UWVS ]u} Sh}"" } ~Sh""k1}{EFE} t!v""b1UWVS`] u~ uh""Uȹ1Rhc@5-*E 5-h!"j]P-DPEU Eu>M9Mt66EE1EEEK>tt,uh#"1}}}}}E뺉t9Wuh#"j茑U9Uu\}t }uEEEqEeEEVEEċ]9]}t;$}t)}t(u9ut8Eċu9u}l}uE EEEԅu.u9u<E4%5-h#" "}t}uuu1ۉ]EuM9~VQuh#"j膐k]lSsEYu h#"jh1}E1҉Uuĉu܋UUMM]]}}Ph c5- u EX@1}Wu{5-h$"j%EuPE4%h#$"CE rh+$"=^ElU9U|`-h`-hUW$ XZCtCPh1$_Xj ^CtCPCPh@$" CtC"PSha$" Cts؋C4%h$" C$Ph$"ZYuczXE\1e[^_]UE-]UE-]Uh&"jkUh-&"j\UhD&"jMUhZ&"j>UE E EE](Uhjjjuho&"i--Uhjjjuh&"ni--Uhjjjuh&"Ci --Ujjjjuh&"i -$-Ujjjjuh#$h----(-u(Ujjjjuh&"h--(-u(Ujjjjuh&"h--UShjjjuh&"XhӉ‰؉0-4- u j]Ujjjjuh&"h0 -u jUWVSu-1--1->WQXuWh&"j=S-Y_u Sh'"jxxuSh('"]hjjh %EPDuu뺋(-#H t uhB'" P(-WPZ_(-t/#=t (-(-tt hr'"rX(-ƒtuh'"<ۣt?%t4!t$t (-ۣ (-h'"j8-e[^_]UVS-uX------;--rgj------X=5-u-E -)EU}t 13A}uke[^]Ë-- t --Uh2%hUW$jUUh0%hUW$jUUSË@4URs(PZYts$hUW$jS4K(E%= u!HPhm8@QR @ C !jjjQR Bu@u28uK ]USQ9s SlZSPEPmƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h("j+C4WPs(Xe[^_]UWVS]uVh-j :C4uu s(P(T18jVj9$@18؍e[^_]UWVS-}t -- --EUEUEU}uH*- t?11ҋ}9׋u} ytEU -$-E -$- t(jRP5--P Bu@u 5-h("IuSh-Ɖ 19|4 u5-h3("%508t5-hUW$j谇11 -E $- tKEx- |-5-5-QP1.p-t-P-T-1ɉ - $-5x-=|-9}u;9uu6E9-u E9-tX-\-|P-T-lX-\-9}u9utT-t%=-u-5-hE(" XZ-t5-hi("ju)u}--+EUEU--=- -9}Er }ME EtUR-)P5- --- -- t8X-\-P-T-SQRP+ ujhH%j6 e[^_]UVS]M Eu fft3SQHtlpCQSCAQSCAQSCAQSC AQ S C A Q S C A Q SCAQs[^]ÍL$qUWVSQ- -t/jh"j5 - -tjh"jj5 jEPܢi]eƉߋE׉pti-%-Ɖߡ-׋pt)ptZYt puDžp1t5\-5X-5T-5P-5L-5H-5D-5@-h("jd]S',SX$Sjm4h-l- t7ƃK% tJ#QRPh#)"jdS S$Sj%4$`-d- t7ƃK% tJ#QRPh<)"jdS S$Sj3$p-t- t7ƃK% tJ#QRPhO)"jdSL S$Sj3$ x-|-iቍhltpRPd)Ɖ׍xPjhtpD*WVxPhlSQhf)"jd]S $S$Sj2 eY[^_]a&UuCj9)UWVS--5 - --u3jRP5--P B@;1S0 -v[H0 -S5-5--P$ t)-u:5-hUW$jv-uNu<)u-h)"j#t5-hUW$d!XZe[^_]UWVS-- -u?j --%-RP5--P B@4tAfEEEPhm5--P tS5-hUW$j~11;5--5-5-5--P$ ~fEEEPhm5--P @t;5--s>5-5-h- ;-C;-7벍e[^_]UWVSƉ׉ˡ<-҃Pj h5!#WVRuVg,VSh# (e[^_]UWVStÉ׃=L-t%tPh)"h V h PV =p-ssVPh)" s$s ssssh*"z 0sxs1--tPI5-[1҉-YX1---1U塨-t*P-ZtPAI5-:[1-ZYuUjh(-h@-b2 yj----1-@=uUSUE ---M-Ћ] Ӊ)~-@[]Ã06w $`%1Ã1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HøUWVSӃu]1-2--@ujjh-h-th."hUW$=Y^----`-)--1-2--@ujjh-h-rth."hUW$g=XZSjjh-)e[^_]UWVSƉӀ:0B؍}01҉U"<%]BuʀEt@9uSYthg/"hUW$|9XZe[^_]US--9--RPlQZYu[0a\Ph#h-Bh% 9-H-ua-tjtJj]-- -u -ųu١-P--M 1]UWVSSU-=-CE;U tM-119~149u1ɉs19~H -9E~@1Aˉt-X[^_]UVS5---19| t!-H<u -1[^]UWVSfEp E}u.h"5-4_Z]tjEP_ Y^uD1Gh"R^_FP-Zy }Ou PP x. E uhr/":-| zf%L-Ѓu-h/"RmZYuu h/"6X넋-jEP [_bE --9-=}\SRNZYu[0YPh#h-h%I6-H--tjj-- -u -uΨuً-EH--8lx #xtދ-PRRe yɍe[^_]U-1----5-Q1҉--H-Yu-tjtjUWVSP- t u h/"5X 6ƅu -8u@-S5-Ë=-X9=-|^SYt=-tj jsPEcUjjjRVV;EtGSZyh1e[^_]Ë -Q-y ;-| t-J -Uh-PXZUWVS u1ۉ߃= -tVI NyVYXHF `=- -9^-؁}U|WQKZYU=-- -u-tjtj-u -C1 mCE -9-؁}ULQM5-;KZYMUuX` 0*VPh#h- h%2-H-t -/t1 -- -u- u - KF @t. 0UPh#h-uh/"=2tt- -}-8=-t=-te[^_]UWVSu VE=--E-E1ۉ--X= -t5-11҉UuiEZUU-5-YUt(EEtBD-PPjAƒ u- -t C-tjtj -u -uݨuEVu9uuHtg}tIu-=-tEu~h-h/"U-Y^=-u3B=-u-d-=-tJE -uh-h/"dUXZ-t!=-t9uuu$-Cu -19uu=-=-M -= -t1ҍe[^_]UWVS];!uh*"CP'XZS h*"PGǃ u$0RPSh%h-h/"Ju WYXyh;!u7W\ Zy40RPSh%h-lh 0"4/Wǃ=-uVh$"h-< -+E e[^_]UWVSu] }9tU= -t VP*VP_ZYy0+0QPh#h-h$0".C1e[^_]UWVSQu VJ[= -tW1ۅtW;uRWNZuZW95-u=-t =-u BRUPu xËUF?륃= -tuX؍e[^_]UWVSPu]>!uhr"FP'Y_V u PIƒ u$0PPVh%h-h60"RuSRUǃ Uyl>!u7RVZy40PPVh%h-fhN0".-Rǃ=-uWh$"h-6 tE)؍X؍e[^_]UWVSW11 D-yh@--^u@-P@-s=- -9-؁}U|WQDZYUu[0OPh#h-h%K,-H--tj j =-- -u -uΨu١-u-1ۉ߉ u--0--uL-@t?0NPhg0"h-hr0"+f%L-1--fL-9t{t ---މe[^_]UWVSW-C{ u)ÃE-:TRPx Y^tE --9-ށ}VRB_ZuZ!0MPh#h-h%*-H-t1-tj tj 5 -- -u -uҨu١-5-ljD s} us*Ext-M| thr/")YoE --9~P-߁}WRAYZ= -- -u-"%-25-NjM}t/s2PR_Zt-D } +s# - -9|R-؁}tVQGAZYM5 -- -u-ux-Me[^_]UWVSQ]utuh0"IXZ} 9EueF95< -}h-h'%}M^XP^w<\u7\t.ˆUPh0"'ZYUtF-0"0"/B000CL r1e[^_]UEH!-EPhht@jX x$Efv@ -Efv< -U=-uE-E ---9~ 1;-~h\_%='XUWVSSu -}t69-+=-=-=-t1C~ Ku"=-tn-u=-t[uSPEZYtI=-Mtj jqP;jjjWu/t9-Hh0"Y&X؍e[^_]UWVSP]U u h\_%.&XU19-~BPSYX%KM-uSwP(x?]9tWZu̸1e[^_]UE P-DBuh0"%XP<-u -E@-1UEP-DBt-Eh0"R%XUWVS-P--EDJ@t t E@-޹-0U?& } $`%}^@- P--8f|y@t t@-܃tQ18j h-5-#^Ǎ v8"uh0"A^t-u18UBQ@u^t -uօuh\_%$^q1ۉj h-5-]Í vF8"unt@--.j-_t|%1Ƀ/QP_ZYt-M:+@- FP-@PX.t(@--;u - --9Et9-}؍e[^_]US1-----xL---- ;tK,tF -ʃ~--IuA-H -˃~-Iu J -:;v-l9t-t1[]UVS -11Å t]9@-u 1ۉ@-J@։t -[^]UVSuj4Zu+50DPh#h-h%!FV CS FC؍e[^]UME 19tx\uHPQZY1҅‰UWVS=-ujEH!--Pjhr"h0"/ykh"`g^tZP[=wJ@ P3Yt:WPXZ|3/t 3/D3h0"S5-jhr"SjUM=-tI -QU=-ujEH!-jh@-!UWVSE-1ۃ=-u-9t =-| t8f%L-=-?u1-B-: u)u ?.u tԍ4-WZu# -uo-tj=t[j-t PTCXPPj0à t9u- --u른e[^_]UWVSSu-Z;-|1ۡ-x-@-9t9u SEWá-ZYUSWjq/ u -t$195-~FPVjB/ u)ϋ-tj&jSPh#h-Sh%-H-F-tj.jn=-|- -u -uΨu١|-ЋKS -5|-B9|X-Ё}U\SV2^_U*-|- -u-OV|-f u u|Y[xhEH--5|-?Zu --PPj* t- -u-t1e[^_]UWVSu=x-t-~ x-yt-1-WP1XZuS0<Ph#h-sh%;-H-uc-tjtOj=x-t- -d-uͨSΊ<\uFFBDtF9D ؍e[^_]UWVS1u- -t h0"hjEPV£-XYu (E -5-9-=}U\SVt0^_Uu[0f;Ph#h-Gh%-H-z-tjbjb-- -u -uΨu١-!R<%s=- -9}l ---x=-8\ux=-@1s -< hS<[t<\t.RiZÅu!hG|$ { uh2"-[1C뵉) -=-9-Ё}UtVWZYUu[C0 "Ph#h-h%-H-t-tj2\j 5-- -u -uΨu١-5-lj-=-tj jRPe[^_]US-< u h/" XH< u=-u$h32"XJ -R t8u ӡ-PKXu1-t=-u PiX9j-Yu(0 Ph#h-蠼h%hK1҉-5-S5-6?ƒ -t+h'h-PR*5-1-R]UWVS-P-M-1ۀx%u}M8Huu-h1"[s9}n-P-- -\P--2< -=-} -U8u-ف}|Wu[ZY=-- -O-tj7jm8uCH-B=-du f%L-1-| u6/- -9-؁}tVQZYuV0Ph#h-nh%6-H-j-U5-- -u----e[^_]UVSVu] 1- u 1ۉ-U -< Uu 1w8uA --JπwE1ɉj h-5-3 v8"uh0"1Zgu@-늸e[^]UWVS 5-]-=-}+-;-a&M 9}y;M)9 ڋEE-}RUuZYUu]0Ph#h-xh%@-H-t '-tjtj-- -U-uΨDϋ -M9}}EMELE B19}})É>\GVrω0;UU Mr3)9 ڋEEW-}RUulZYU-- -u-t -M9u}EMELE B19uu)d9|T-ځ}tVuZY45-- -u-_b-Cw}9|T-ځ}tVunZY5-- -u--؍e[^_]UWVS] Sװ^|=-tj jsPlCjPjuMq1ɉ E-}t9U3 9-ށ}V5--_Zu[X0"Ph#h-h%-H-b-tjGJj5-- -u -uΨuك=-tjj   -NjEpSP-  9~U-΁}V5- ZY5-- -u-=-tjj S6 -Nj󤋅  ?u9Ћ)ȉË ؍x-9<t t tjPjuno-=}tV5- Y_5-- -u-~+ uEthG2"TZDžW=-tjj S -Nj󤋅 -f u1e[^_]UWVS--H-1ۉ]1-+-9U-@-Pmuu PuƃU-PP[Z-3E-1SwYu' --tjtsj-t PۭFZPPjƃ t9]u -u -uuE-G-E  Euh0"XE tu RRK x1e[^_]UWVS-E-E=L -t =H -uhb2"NYm=-t -j--E=-ZZk EtTuaPR@POwGHm uu^13^@p][sHZPJJ@BE4qE@E܋]k  9]}3:}z}z}׉}8up}xK Ń=-t聺L --EL -H --EH - -u-tjt j`1e[^_]UWVS--Ht7k X< u'ʣ-B0Z9tSe;S ZY1--L --H -e[^_]US-9-}Pk- -EuCk- -u C-P-k -ZY]d-j Ph-:0 tPPh#h-h%5-? 1--1]UPhr2"h-谭j蜠 -Q-y ;-| t-J -Uh-P薰XZUWVSօt%ˀ9u RPh2"RPh2"让 uqRPh2"虩 `{tZC<i1ҍ{t2Hs!t ,I< ϊG< ĸ>e[^_]e[^_]UPEEjEP5- Ukh4"Ph4"h-~jjUWVSf@8tXu1P1҉hW3à f8#)tSWV 룍e[^_]UWVS} 5-fDž<^1҉hPj[à t[88u 1ۉh/#Vf8uFt"SVW yFu8#u5k1ɉjjP @uL8th4"jh:%)+jWjѝfDž=-t fDž9DžjRj fDž9fDž9-jSVE @u8tJfu ft>(@ufDž=-u#K,-@tftfDžftR@u KfDžCe[^_]UWVSQ}u VW;[[ZÅuzjjXZu h 5"jC;s jEPW#ƃ ?tE8thh5"jx8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19} 9xu90tEEEE1,]9Xu]9XtiB9xt A,9|90uU9P uU9PuACk,QMuZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRP!NY_}ËBt1UjvL$qUWSQ-- -w-ڞw ]]5-5-h5"j 5-5-h5"j  5$-5 -h6"j 54-50-h6"jv  5-5-h36"j[ 5 -5-hI6"jC E$h_6"j. EPP$hx6"j  =8-t>u-1 uj$eY[_]aÃ=8-tUE Puj\  UWVS}u _Ph6"j 3<`-B9tT`-e[^_]UWVS$ ]5H-t(V$VF0Y^ugh6" j0Pu l% yW觭p4$0ZtWVP u Wh6"Q5h%jj0։( y0h6""jju ։ƃ C Wh Vp%ƒ jjWt%‰ Vx%h O_Xuh7"j[^jh h R(|%y RY߉Rt Zt-w1ҁbt#bt!tu h>7"1 Њ Јt u hJ7"jYu Vلƅ/ t jZV8 jZVP謄 djjP7& d-0tS SQPR(&,7kPƉ4W8t t10hb7"jw \9s1BFu h7"jG 1e[^_]UWVS\]ƍ}ZE5x%(,a&V&048vEPSSe[^_]UWVSĀ]p$tVP:V9Y^㋃p tV3:V9XZ㍅xP踕1RPuu衼t5 -9ΉЋt}"Q_85 -VPh7"/e[^_]UWVSP] AEH1RPuu訷ƉMt1׋C|1׋ujQ1RP<t2uPh7"jgE01RPuu‹N tkvkk ыEe[^_]UWVSTE>E8Iu EuEEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉU1EUE}t EșŰU9UuU9uM] E} uWVE,# E: =D-EEIu E5E@1 t1҉ËM ʋUщe ʋ}t}\SQE,c$h#5D-םÃt#EUSjPVHt h7"mXSX -$-E1--E<1EEt E\]ԋu)։]uEEIu EE1 t1WVuu9E E~1҉ t1EUWVRPݳ9E cEEEEuuԋE,#EЃ EtEЍDEȻ8&ELEЍDEȋEۃ0EЋHatE/haQuuPh7"3REЃP2‹EЋ^_9t"ERQuuPh<8"j&E؉E܋EԋU؃EU1ۉ]]]ċEEEЀt)X@}99EEȋ}ȋW:X@9]9EEȋ01}WE9L9U)9E uuE,!EujP1Eă1ɉMEEËE}t;k;xd[}Nj}ljEu 9EcMQRPuEPE]tXpXju5XZ9u9]EE@]k,PuY^Ek,tԉEVFF EUFVEEtP4@0FVGPtP,@(FVGltF Ek,Dԉx(F Ek,Dԉx(@P$]Ep}}EJEt#1 t1EU!X1 t1EUEU9]LEE܃8t)E"9E1EE܃8E\]ԋu)։]uE)‹E#Ju E`Ek1 t1WVuu|Puuh8"jt E܋P @E܋@1ҍMQRPuEPcE0ju31ۋE;pE܋EE9shI9uEtpp E_uuE,#ujP=.EċE1 t1u}C<҃<DEE܋}k,PuE_Zu E}81ۋE܋EEE9k,}}܄t3w 0x}܋t|px u}px}Ћw04/81p}܋tpp u}px}Ћw(,px}܋wp J9utGE܋@ EMk,}D$uuE,ujP,EċEk,E‰r(Er$ t1u}CЋ]E<҃<]DE܋EEEE܃8i}Eȋ];\9E}Eȋ}9x }98EЋP9Ut,EQuRuuPh8"jE]E]E Eu0-4-EEUEԉU}E\uԋ})׋E^EXIu EEEÉ1 t1RPWV詫PuuSh|8"jE}8LEiEe[^_]UWVS uEP F VM]_9EEr )ӉM܉]Fƒu>uFt 11E`E9sWu h8"jN1ۋE1)ډEUF@]t[ ][]ԋ]1ҋM])ӉM]E9Es 1)EU1U9ЋU_U܋EЋE]ÍEeM1SQRP谮FVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW}}EEPhEp%ƒyEqRPh9"jxhj,3W*}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QRPh/9"1ɉM؉M܉<EPURvSE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]<E1Em}----EЋU--ẺEMEPhp%ǃ yNQWPh@9"0FPhp%ǃ yNQWPhf9"j1eY[^_]aÍL$qUWVSQ9qd-X-,h-l-?1<-@-1D-H-1h9"VW| ta#DtNJClp7D-뷃b$%p-P-C8-Ct-u5lp7Z@-e5lp7h-R5lp75d-@T-/5lp7<-L-5lp7X-Xlp7H-h-h9"DYXp-)lj80!h-h9"XZ=@-xh:"!=@-x 8u5P-t hQ:"jtjj)hw"5h+jj [_@u h:"jj hw"hj)00h:"@P٫@ uh:"t|j/S5oZYÅu@}-׉hj迣hj賣j$8`-P\-1urh ;"jj\-؉8hDj803PyP3h(;"jhW5\-OG9=`-=P-tf95`-~W\-4FX烽(ta1(,,9`- <-_=T-tj@-xrP\-0jX-dh1҉ldPh \-p%à t$8:ha>"j11ۃ=`-*6, \-,4@lXRjPjjT($tPhI;"XP :8zJt&Z JZ04z($J 04zh P&1--8Y_9t4VZyPh^;"jPhw;"j 3‰.Ju lxtH'‰`R840Ph;" tH891҉ t1҉Ӌ+049׋0|9؋4}Y 9؋4}s8014߭0ݝ0y11SQRP1ډ߭ %ܝ0v7ء\- 40\- <0[10=t-pݝt{\PSj} ݅y+؉Ph;"j jPh;" \`+EU5X-9Ɖ 9jS1ZY@݅u؉NPh;"h-ܝp %ܝ0 LRjP011RPl$01tZL9rKjQ4#^X0290Q_|OlaGl막 9skQ k4 JHJZH XH J HPW4 D2 D2GlFhjP88P PuPh<"Y[# 1҉D<5p-d-8Hȉ9r09rÉ014#840Ph<"k840Ph<"j04 4111W9m09Ћ4J8JZ8<< 89 +4i۷m۶R<8SPh_<"PDPhx-SW(~LFD\`HP\Phx-W\DHY, X049Ѹ4}u014"80Ph<"p1ۉ898r;D\`j\Phx-W\D𙋝09މЋ4}88SK t+4i۷m۶hQRSPh<"DPhx-SW|$~FL,NY8&D8tx-011҉VPh<"K=98~k,0D$Aۉ7<1߭߭------1XT0 11198 P t$k,0Ћ 9Pu9 tyt_|;TRXR801RP {1RP1F P @ 9| ,PQpQRPjW'k,0Љ1;P} PTQXQ8)Q t p|룋Tșڋቅ044؋ቅ=L-t 1Px-k,8 $98p 9~Љt$DPSh="pPhp%Ã.!JQSPh'="j#tV":t&PhL="jK,+ePh^;"j+, E$) 048<11ۅt9 k"j,5\-(,{jAY((9`-yPh>"jI(5\-~=`-th*>"h%hh4>"V؍eY[^_]aUE UMQ1]US]C Cs4SjS)1]UWVS}uj Zt"Å~{kP‰C X1ɅuS9[1A9}XM1BBB BUWUYMukC t 40YPSXZ1C Es1ɉKE CC{{j8"_u.1{ YC 9}k4GZP|X7p 1EZB|DBAB @Ѝe[^_]UWVS]s$tV6VXZs tVV^_{G 9w~k4FYPW1XZe[^_]UE@H]UE@1҉P]UWVSEXC9Cuz@CPhp>"jkCPs #ush>"j9C kS41FFF FsZush>"jK kKK E UAQMCSEUCSEURPuu萕E UMA Q}} EENjEe RPu13|%yEsh>"j EC1e[^_]UWVSQEXCE19E~4kK qy9u U|Q 9U UQ} E )C@1Z[^_]UWVS]s4FECS,K0UM{ stQRVu t EWEC C C[MEHEUBȉEEbMRPsW6|%9CugCC\MEHEUBȉEEbMRPsW6%uh>" YC$Cs4SnXZ1e[^_]t@Ë@ tËÊtBRtUWRPY_}ËBht1UWVS L 1󫍅xPE;lE,ZYËEtPhEQuЋ}ԉ t֋Et+ +@|)‰1,0,9r 14DP0,us F(tȃ0tBE;Pdr,9u:s (tvRPYY09us,9uih(_tZ t @ (jS#EY[t8(w690u9,GjSXZ (w t WV7^_Ɖ׋E t1 $DH 9|([ (E9s@(ERPWV0,h>"(u  袋9.}*WV0,h*?"j(3fk,V4Z1ɉ0PHD0,hP?"j+ (X k,4 1󫋝,0rrz E(t=@PtȉB DH9v@l9}&E}t8Phj?"4<@E0]\)Hu E1ҋ] 1ҋ] t1RPWV蹅kDt 18x, $$y11jDP4Pu2DH1 9؋$}W $) $119ʉ} @H9؋}{ =8-h?"jY^wM t1WVSPE(|%=DH9}bk,4_$StG(ZjɅ0P4t0$h@"j"MH=8-tRP0,h(@"jEHa‹E1tIu$X1IuEC1 E E t14k,kD,49Et@E@8RjPjjEj8P h PR v%<DHk,49s"4jh Ep% bRP@8tGpBuE- -Xe[^_]ÍL$qUQ --5-5 -%EM MuQQ$RPhA"^cMɍaUS]CtS P S tSPSCr s ZS -X]USEPsH) -- -Hu0-Z[9u -u' -uh%B"jP4BPQ X4CXZ@]UWVSu EEE# --- -M11ɅtJA9~ʳ9M}#t-h9B"h%hhHB"x}9x4u }9x(u9p$t버t-e[^_]UWVS]uuu SO trNj@thjB"h %h1GGWX9w(~6GthB"h %hhHB"wwVw ښG [^WY- -;-X=-u =-uBGWu-GWtP-WGtG4WPZWX-j@jVjG _4E UG$W(G,W0wE # -G8-tz8GC GtWP { _ Ge[^_]USEM PuhB"h%h4hHB"vP ʉPHPPP s E]XPs2H ---1ɉH -H-.1ۉXt -H- -H-P4JH8-9t!tXYX tAP]UWVSUu }uWVRcËECUt-R-EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq= -Y,A0Éa,ڋyY I4 s RPWSQ|% RPWSQ%e[^_]US]C%CSjS]1]UE UMQ1]Uj\UU P-PYtHJ -@ -UWVS] -C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdϼC${s譼 ]e[^_]雼UWVSuE EEEE%-1҅9su}K}9y,u^}9y(uVK0ts4q4s4 -K0ts0q4--C4-=-~ttpRZg{$u{uCuڋ[0n=-~ tRkX--t$;3uEE EEuCe[^_][؉؍e[^_]UW1---11҉-_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE -K,ϋS0c,ʋ{s K4 es RPWVQ|%9Cu CC17RPWVQ%uh>"赽YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPSY_}UVSӋEU tt RP"Y^CSt RP Y^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈS^Z19tPQhB"tX Ћ]Uuu 蕿jNUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPAY[L(ștșe[_]UWSvh2C"hX%h hCC"}mÉЊӃttRPY[LXștșe[_]UWVSvh2C"h%h"hCC"mƉӉȊʃt$uҁTXe[^_]UWVS vhhC"h,%hhCC"lƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8j܉ËEEC1CC=_C_C 2h1C C$hj衉Ehj蒉M쉁j`j耉MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmE貯Epd觯u蟯S虯EE싀}@u jR^_}E UG(W,}x0xdEtFVtRP@YY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u-EE %-S0tK0J4--C4-C(tS(P,-C,-މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hyC"h<%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhyC"h<%hhC"c@]9~ ]B뫋EEP躅E̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuhC"}t/EEtP1uuRPhC"辧]9]tSuuuhC"蟧uu] SY[9t$PRuuh-D"su1҉U uXE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPbMeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPWZYU9닋E芀{at WVhyD"wtC M苉9t.CM苉p9t$1SQ1RPWVhD"蠤C(S,C S$]9UrSPWVhD"rWVhD"^ ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/E"辣}hFE"hL%hhC"[EzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRPt_EuuWVa_9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWV_9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhME"臡EuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^E"Bh- 1Y^tCpStCHuRPuuEU}t hE"hdZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhE"F-6EtM}`d)RPhE" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j]zE1҉PEMAx[A[A [1ۉY Y$XZ}t.hjzËE쉃P^_ u = -ƉE} t hF"b[1ɉM -EPjh WVu*hjyËEp }쉻PP P jPXZtS Su -}URjh  t1RPuhjxEEp }}M쉏PP P jPW^_utCHSLC419|} tMh7F"aY@Et} t#hlF"iaZu uuS9u u0X S'X]=t SXktLǃ1҉l1AǃLcX1҉ \X`1dt}uWj+wƉ_tCtPw^tCtPvFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h5|SXZ؍e[^_]UE Puj - UWVS]FHljL1RPuu _XEUt1EUEU싃C|1EUEU싃URjW1EURPVtPu hF"@ u~ 1RPuu VtDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuV€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhF" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhF"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt PhF"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhF"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhF"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuuqKƉ׀}Mt1׋C|1׋URju1RPQtPuhF"d Ep 1RPuuIt֋F Ft:_vkk փ~t*uuhF" tFVC(S,FC vkBHMQjPjjRt PhF"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhF"ZYEP tu}rz}zP4PR:X17-t C0S4C(jjP0uu Se[^_]UVSUE 9| 19[^]US IPPh*G"h-$1h-haG" -CtsPh"h-0j#USSE] t$uh!#s<ZY¸tr1EEPhvd5.- @u35.ho"jM]UWVSPu }t}~^h"S;Y_DžtFh*"S;_Zt)hr"S;ZYthyG"Sw;[_t뫿}}uh$vH;ZYuUEPhud5.C, @u65.ho"j|e[^_]US}tQ,Shzd@5.+ @u5.h|G"j01ɉj Ps i 8t s hK"=>8"u!@u hL"jޕuĉ}ȉM̉UЍ$Vhyd5.! @u35.ho"j̕VhL"b!XZe[^_]UWVSlj֋ 1҉ -tUPQM0ZYtUBMQh$"jCjhh- -s 5. i.@u5.hUW$j1.-VWS5.$He[^_]U05.ho"jUSS}tE Xh3#Sd/ZYthL"SS/ZYuEEPhwd5.O  @uE ]UQ}trEPhd@5.  @uE O5.h4L"XZUS ).).t ).1Ӊȉ[]UWVSӋ}b'.uƍP'.u(PpPP?P*PpPP?PPJE 7 u9tN7k?9[^_]1^'.x@uUWVS։ˋ=p%. t%.11~B? ʋE[^_]Up%.?t%.jh>RP>=vux%.UWVSQ5H%.Ctt+ t&Pσaw <v ;v ju_{Gfw$k A E1E)й 19u5{$ P-1TtDQt!@ u 9u1 Z[^_]UMU 9|]UWVSƉ׉Mp%.t%.ÉEE1RPWV<E)Ɖ1UQh&y%)XZ}Utt%.H9up%.H9u u9rBRWhL" e[^_]U塨!-=D%.tvPhM"5%.5%.5%.5%.5%.hM" 5l%.5h%.5p%.5t%.5x%.h8M"y5).h_M"i PhmM"VhwM"T>%.%.5!-5%.5%.QRP5%.hM",hN">t%.p%.5l%.5h%.QRP5x%.hN" 5`%.5d%.hnN" UWVSQƉz81ۉjEPV襙 >u#ËE8uN88"u w܉1e[^_]US6P@($5!#Ph5!#Ph5!#Ph5!#PShN"h-,jUWVSEM !-9uh9Q"5!- hOQ"jًEEUMjؙ]!É]]!Ӊ]uuWBuAtV!-!-=PuR@ 3P5P.R@ 9!-uNE!5P.}e[^_]UWVSEUϋE E컙F"ti"EU@uShlQ"芔XZff=Ut+=%.t fuuShQ"ff=u%CthQ"fLJ_f=Ut1=$.u ShQ"Y^$.tShR"XZj(VPY x0XŃ~X %.t\fLJᵃVe[^_]UWVS9).u).5).x1Xƃb'.e[^_]W|$wUWVSDEUȉM̋EGWEUċG WEUEER"EEtEZ"11}=!-Et%.p%.U1҉U܉E1ɉMԹEM]̋ERPSQv7PE؋UEUuuRPY7RPuuȋE؋UEUuuRP57RPE؋UEUuuRP7RPuhMR"j,"uuuuuuuhR"F h@-jdh@). u hR"jSh-#h@).l5Y[@).U슀@).< <$u z Ћ P-DQu<-7j EPh@).yƉ׋EEh%PؖEЃEPhR"u膚 tuhY#uo t L =!-Ήʋ5d%.11WVSQ5ƉuhR"u  ui d%.ω%d%.Ɖω uEt5`%.1Et `%.1Et `%.1)Et `%.1)׋E؋]؉E]h-#S3YZÉ]; t,h@).b"Zƀ?).uh@).hR"\ 9uE|E9Ɖ]}.uuuuWVhR"$uȋ}u}e[^_]g_USE Pu,|hR"D-HD- yh@- Y@-P@-؃ t9@t* D-y h@-R Z@-P@-8 u hR"j覈1Y]UWVSEM䡘!-E@u hR"jp!-EӍEƉωؙ!M!EjuuuBu @u!-!-uhuP8 nR5P.P9 9!-uVjuu5!-Bu@tP.K!Nju5!-R5!-j8 9!-ue[^_]UWVSRá).u ƀA Mz΍). S}8PR ). e[^_]UWVSEыEU u1+ˀ `%.1ۉƉ)߉u}};=).}=). S"EUEUE9).).}=@%.t Ev).KiE9t 5).tމ&ʅu+`%.9UE}M1E܋E9E܋U}t0}t}utsƆj/S"ZS"ȃ[^_]UWVS EӋEEh).@Ph).E 5).t h~S"j觅EU9E|E9u|).] }) VRP65).31fǂU }u@`%.5).֋M)}CsKSCPKSs FSj).Ee[^_]UWVSE}u&b'.ƒ<1IE E#֋EU EUEUE9%.%.M%.19Et\tSMM1ۉ]]9ً]M}3M9MM }S"=@%.]@uE%.˃t ). ).t!=@%.>).1hjwj).[^u hNA"j1fǀUE).EU ).).EU).).).ytbt]t E^).QHu).<=@%./hOT">Y7T"g%.=).).;).KxZ 5).t1;EM |9UE}=@%.t`룅).E 9).u;]t~).H).1+]9~ Fu%uF PPRi ). *`%.1RPEU ).+E).XZEU ).).EU).).S"S" T"S"Ѝe[^_]UWVSË@S t+5%.=%.9u9t hT"Y]sǹ󥉍1󫍍@u'CT" CuF"RhT"覆XZߋe[^_]Ã=<%.u x t"1UWVS|Éס%.tPkYj/S^ZuS5!-ha)%h%.l- S%.Y%.u hNA"jjP1XZy5%.hUW$[^xPSZY@tMuи 9E} 5%.hT"T 5%.hT"?h h`.SB1 9t5%.hUW$of=^.Ut5%.h U"Y^S&2XS2Z tje[^_]UWVSÃ=L.u1Ҹ-#L.f=\'.u1f=.I؁=L.t#H.%.`..f\'.f'.Ut^'.1'.u[^_]UWVS á\'.fEt%.p%.x%.%.11t#f}u&4'.t9r $uɡ).E ).19E~+f:uzti 9t@Ћ 0%.t=T%.uaf}u1'.! 9*=@%.tu7hU".Y=L.t f=.u/hU"hB%XZ=L.tT.!9%.=@%.tPhRU"_XPhU"ZYt 1=L. =L.uL-#t "%1jL.tr.!9tSP5%.hU"[=@%.t1~f=\'.u3 .5%.h/V"ZYu1'. !%te[^_]UWVS(ÉEU EUE؉uF=H%.EmV"e[^_]S)11ɉD11ɉt<u ȉhjhh%PI%tPQRhvV" fu1k t Ph5!#hV"HWVh5!#hV"" =!-RPSQk%PhV"Y[=H%.u" `%.9u1ۉ)11ɉj-j)}XZttC9Eċ]|N1ӋF19Eċ]}|]9؉ӋM}EUG롾%.19}tHt?19Eċ]ȃ|19MċE}]9؉ӋM}EUGu EċUȉEUEU+EUȉEUE Eu hzY" E Et}u9}E}}u`%.d%.1RPuuu 9tۃ}u E9uuujjR#EUEPuhY"hY"h@-jdh@).u hR"jmh@).[vEHƀ@).t'?). t9EEHPh@).hY" uh@).EPo uċ}ȋEEă}t6juuWVUċEP%.uD<=@%.1EjuuWVUċEu=P%.tKt$|=P%.us=@%.t PhUW$j[P]juuWVUċEt)/juuWVUċEu}t }tPhUW$jk}uf} E U u }EfukE } 1E}t Dm:}ta}tE `%.1 ).).9u19tuugZY ).UӁþ]EU]̊EĈC})}̉Guw OWPE̍HPD3}̍_S^_E}tgfǀuEPkE }P,@%. =H%.u=@%.<t ).(hY"Ytfu'uEPkE }P =H%.9=@%.t hZ"ZuH%.}ft=@%.hY"[E̊@EċE̊XEčE@‰x%.p1WVjjjKZ"E1ɡt%.p1WVjjj^Z"Ã(Uă?1ɋ5p%.1WVjjjmZ"^}̊MO_U? ˆWGEĊ_EčG‰x%.p1WVjjj~Z"E(1ɡt%.p1WVjjjZ"ËUă?1ɋ5p%.1WVjjjZ"}̊MO_U? ˆW(} ).uKye[^_]UVSáD%.u hZ"X1ۃ=D%.u Sh"Y^jjڸ%.CXZu҃=D%.u=).thZ"X1L=).thZ"u ShZ"[Y^g ).RP1҉8XZ=D%.tCD%.9).A=H%.~hZ" 5).j5).5).RP 믅<f=\'.th:["^h["[1'.t=h@#2'.Y=uh[""k Ph%["`XZ hZm"RXhH%OX=D%.nPhO[")Y[=D%.X'.PPhk["  j=,%.t>u Sh["XZ9).} h["X; ).RP1҉u Sh["Y^jjڸ%.XZe[^]UWVS ˋDžF" t DžT" @uh["kZYߍ1jh["S t 1/9Cu苅9Cus Pj ) ;Cuă=H%.t.{ t(s$s sh["e[^_]UVSPE!-;!-u*=%.u!URhmdPW y h#jX%.11@uh\"B=H.u111HL.~ ف`.@uh>\"jj^E).01C;).}. ).).).@@uShS\"$jY[1҉U!-;!-u*=%.u!URhmdPt y h#iXe[^]ËU Php"h-jUWVS|E|x*.wSh$q"h-jrSQFEZuhS6EXZEE FEe[^_]UVSSPPVu ujVSh>%ok,@uLtv"t"0LZv"tv"PShw"jXj<UVS]u VS$YZu Sh`w"jX;/t"Shuw"XZu Ew"e[^]e[^]UPhw"h-jUVSPh*"P-[^t,PjPuVV !t jP ZYS@Xe[^]UWVS EEu EE}]EEE1҉t+.%1ɉ x+.+.hw"Vu.C NtJb$@%1=+.+.+.|+.x+.뗡lp7t+.jWh%5lp7u hv"jwWPYY+.Jp-4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjP5XZt1h$9}PZY uċ2jWSh%Fh@uLtv"t"0`I^v"tv"PShw"jUt%@u=x+.p&x+._x+.MDžw"=+.tDžw"t+.t #P=+.t ~%=+.t w"=|+.t Q6$1ۉXPIShw"h%jUShx"h x"Vlu h 5"jTj/G PZYt|E@Shx"h#x"Vtj/C PsZYt|?XjUVS]u VSlYZu Sh`w"j athg$%5lp7`CpX5lp7!CtXDžp5lp7XCxXDžt뀃K|wK|njVh@%5lp7 u hv"jSPG X}tWWVKY^Ɖuu:YYEU0`}tΉȋUʿBUƉ4s {$s({,s0{41{D{@{HUM䉓CPsKC 1sss$S{l} E 5+.=+.}t M U JpD1HӉ5+.=+.}tCS}t#RP?YYCh}t1ҋM M  t1WVڋE BY^1U ~ 9~}t 1҉TpTt1|(@ԃ} }t1E 1ɉKXE HpED1Hy~Fuh2C"h%h"hCC"}t1҉1҉TX1HF붍e[^_]ÍL$qUWVSQXAAA TAAAAA A$A(Q,A0A4PA8xA<@t1É1ɉWV:1҃t0119s#hx"3+ZRPPH0jjjjXSËP%F߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY PCh%VlZYth%Vhx"( u&;s5;slDž:DžDž u;tU('DžuLDž Dž;DžsDž ~|t~(uydh"y"'^_PDžDžt9t h@y"&Y9~Wthsy"&XZ.DžDž9|ċ9|<t hy"(&Xh5+.hy"Džy(hy"%^_uqhz"YI;rhy"%XZu) u 111(4<81L\0,$H1dH@D uj$_t⋅9t PhPz"G$Y^Ht2{{ @D0{{@D#Zt⋅9t Phpz"#_XG1t{${Q!#^t <8(Ch4CpHt ǃ ǃL@tA"ƸY9t Whz""XZHd 1t1\{ChX\Clg{ OtIhz"h-D8ljPhz"h-t@t)1L@t31#LC LClC XkT,Pxu .xtJxHXCdTCT~*0CPPlxtxp1PF ^t1P YttuxPZt*1 t1s{ %1t t1s)Й t1҉p11Ҋp t1Ҋc t1hl t19s hl)ωptct hlCS s{C`hCpC1ɉt‰ Ju s1 t1WVtpct9Ǎ@4pp4CtǍ@pp11҃ʃʃ p t1ct"uM 1FCXS\u 1Huw?ǃH3Qw ǃt)t%@ @ v#vxǃ ǃxd‰9rw~uZ9$}Ldu2Whz"h-+ 9Huh-h&{"/XZdѽPho{" dt$h{"h-OPh|" 7 v$tpPh.|"^_j Y@uhL|"h||"XZ+1߭ڍP %WW$h|"rHuƉƉ1 t1 ‹)ЉʋCtSC8S< C$1 t1OD1t 0 ‰D2耽tC|P>YBu@u0+PhX~% tu `duCPODž1v 1񉅰 t1 t19u9t h|"_ tG ?9|$ tj jh}"q$t*uQ1҉Ɖbu 1҉h t1C` t1)CS\)CDž+x|ƒu Q]1 t1҉Ѝ Ɖ1҉"vJt\9Ћ}x|) t19r$mh}"^t+)CS)C +V ‰Ju 1 t15Q‰扅Q‰扅扅tV׉sX{\׉sh{l׉sp{tC`Sd*\ȋΉs<ΉsDCHK@h Yu jj2@1󫋃@t<<f<%fGXD@<f<%fGdDSP1R_ZtT81RP}XZ1ɉtpxpx t WV1h^_Ɖ׉ t19s=Pd/D ]jƉX PYPFZ@HRjPjjt PhF"N>^_@ Gt3~S@1҉P-HG 1ɉO$)~\@HG~F F <@4PXjjXjjS'ptK KS1P1ZY$~dt.<f%Tf-f1GfFjs ,<f%Tf-f1ɉOfFjs1)щ1 t1҉GW jhZY<f%ffAXZ1ɉ19sDA u҉=v D PjVjj{@ Dž%Dž1p_<҃D 9sh~"5+.ho" Ft Pt#u?RPhaY^f*uGɉf1VfN@ tBh1~"hp%hqfFu=@ A)G G p 6p<uGG9rhK~"h`%hhCC")9rhj~"h`%hՉϋ)1󪊓t@@tf)th|~"h%hh~"LP4PRAH‰ljX1OtVjR1RPQytPjhF"66 H TƸ1tvkk ʃ@u51rrrrB 1z0z4z8z<@1OBB~B1ɉJJ(MB 1BBZN9s1BBrz 1BE]9s1BAJ1B$79s1zAJ 1r@4PY=0.u jSqqXZt 1{@{D1s,1ɉ9\FH|‰1RjQ1RQVAtPh}"3‹p JuI!F u1kF FtL<1 t1F tX1 t1 ‰ ‰1 t1ҋtC@SDC,F t 1 t1҉щ‰8ubvVt \Ɖ 1 t19Ɖs)щ‰jVXZ$t,CpSt'CH\+ƃu 1 t1WV@Ή+tC@SDC,)ȉʉщ‰_1v- 1Ҋ t19sƋ1𙉵st'{++C8S<++C$BHQjPjjR t PhF"/^_A |tVC@SDs8{8tGpBuE80.!-Xe[^_]ÍL$qUQ 00.,0.5(0.5!-%EM MuQQ$RPhA"褣MɍaUS]CtS P S tSPSCr s NZSG 40.X]USEPsH) 0.$0. 0.Hu0<0.Z[9u T0.u' T0.uh%B"jP4BPQ X4CXZ@]UWVSu EEE#!-80.(0. 40.M11ɅtJA9~ʳ9M}#t(0.h9B"h%hhHB"߸}9x4u }9x(u9p$t버t(0.e[^_]UWVS]uuu SO trNj@thjB"h%h1GGWX9w(~6GthB"h%hhHB"@wVw G [^WY0.!-;40.X=L0.u =D0.uBGWuP0.GWtPH0.WGtG4WPZWX40.j@j4Vj*G _4E UG$W(G,W0wE #!-G880.tz8GC GtWP { _ Ge[^_]USEM PuhB"h%h4hHB"P ʉPHPPP s E]XPs2H 0.$0.0.1ɉH @0.H@0..1ۉXt P0.HP0. H0.HH0.P4JH880.9t!tXYX tAP]UWVSUu }uWVRcËECUt00.R,0.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=!-Y,A0Éa,ڋyY I4 s RPWSQ0% RPWSQ4%e[^_]US]C%CSjS]1]UE UMQ1]UjUU Pl0.PYtHJ l0.@ l0.UWVS] h0.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd C ${s ]e[^_] UWVSuE EEEE%0.1҅9su}K}9y,u^}9y(uVK0ts4q4s4 0.K0ts0q40.0.C4d0.=h0.~ttpRZg{$u{uCuڋ[0n=h0.~ tRkX`0.l0.t$;3uEE EEuCe[^_][؉؍e[^_]UW1h0.@.0.11҉l0._]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE!-K,ϋS0c,ʋ{s K4 es RPWVQ0%9Cu CC17RPWVQ4%uh>" YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPDY_}UVSӋEU tt RPhDY^CSt RPSDY^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈSZ19tPQhB"躘 Ћ]Uuu jUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus SC EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPBY[L(ștșe[_]UWSvh2C"hL%h hCC"íÉЊӃttRPBY[LXștșe[_]UWVSvh2C"h%h"hCC"YƉӉȊʃt$uҁTXe[^_]UWVS vhhC"h %hhCC"ެƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPc<YYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8j"ËEEC1CCCC '1C C$hjEhjM쉁j`jMAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmE Epd u S EE싀}@u jR^_}E UG(W,}x0xdEtFVtRP:YY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM uh0.EE %0.S0tK0J40.0.C4@.C(tS(P,@.C,@.މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hyC"h0%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhyC"h0%hhC"@]9~ ]B뫋EEPE̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuhC"}t/EEtP1uuRPhC"{]9]tSuuuhC"\uu] SY[9t$PRuuh-D"0u8 1҉U u& XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRP:MeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPZYU9닋E芀{at WVhyD"wtC M苉9t.CM苉p9t$1SQ1RPWVhD"]C(S,C S$]9UrSPWVhD"/WVhD" ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/E"{}hFE"h@%hhC"EzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRP躟EuuWV觟9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWVV9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhME"DEuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^E"h-SqY^tCpStCHuRPuuEU}t hE"认ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhE"@.6EtM}`d)RPhE" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j裺E1҉PEMA2AA 1ۉY Y$XZ}t.hjbËE쉃P^_ u =!-ƉE} t hF"[1ɉM!-EPjh WVu*hjݹËEp }쉻PP P jPXZtS Su!-}URjh  t1RPuhjEEEp }}M쉏PP P jPW^_utCHSLC419|} tMh7F"ΡY@Et} t#hlF"诡Zu uuS9u uv X Sm X]=t SX XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjqƉ_tCtPK^tCtP%FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h;SXZ؍e[^_]UE Puj!- UWVS]FHljL1RPuu 襘EUt1EUEU싃C|1EUEU싃URjW1EURPVtPu hF"@ u~ 1RPuu tDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu9€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhF" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhF"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt PhF"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhF"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhF"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuu跋Ɖ׀}Mt1׋C|1׋URju1RPQtPuhF"d Ep 1RPuut֋F Ft:_vkk փ~t*uuhF" tFVC(S,FC vkBHMQjPjjRt PhF"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhF"ZYEP tu}rz}zP4PR:X17@.t C0S4C(jjP0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP e[^]UWtBRBR t RPY_}ÊtBRtUWRPY_}ËBht1UWVSӋEU ΃tt RPTY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]Uh"hl%hhCC"UUVSuE H$X(1y9)tNp1SQRP踉 e[^]UVSuE H$X(1y9)tNp1SQRPa e[^]UWVSEEEH@}W4}t D) D)ƅ  Ex 19}5uVSh"j E|BD1H)CNjEahE@ EDžp!-pp@tUkl1ɍ9~ډM}}x1:xURjV1RPQdtPERPh}"E‹Mq EJu KE! E1k֋^ jQ XZE4fHEu_ƋEJƋE1 t1E虋uƋEEڋ}tG`Wd}G@e[^_]UWVSEt1Pl@hEUE1EU}+GpWtEUG$:EPDUME@`1҉Ɖ׋E@H+EU)׉u}E@1ɋ}9ȋ}7UMEFuE^$EEtphxlppxt@DƉMAHE)׋EEIu E3E>1 t1҉MRPWVt‰C0E}Mtp`1 t1s(EAHEpNjEƉ1ƋEURjW1WVQ賹tPC01RPh}"kE‹EEp {0E,Ju I! 1kF t2EC 1 t1Ek( ju!EZYv{0t EEBƉ׋EE 1ҊM t19Ɖs)щ‹E[M t1 ))s(댋Eu})׋EEIu E>EI1 t1҉MRPWVrC0EUM t1C(1E܋Etppxtpxx|E@HƉMALE1CCC$C@CECE‹ER t1RPEPEE}8W S E1CCC E}EEDu1 t1ES Et=p`xdrz1BBaB8C1B8BPC41BHC(})8OE@@B 1zBaE>BvB0C1҉PS41p C(})҃0C(E)ЉC,E@rEx<u0.@ 0.$0.E@@]CjSJE܍e[^_]UWVS,}E @u +FEHPE؋AHƋE X01ÉURjV1RPQʵtPE @01RPh}"‹EEp E @0E܉F uMMЉF <u v0E@4uPu誋E܋E PEHEXYu܃}tC1ɋ9H~@ Ɖ߉UPSUȋ AAMX뷉Oơ@.@.Nu"h"h|%hXhCC"ht5C0S4C(S,C 3C(S,PTPTC S$pCE @0膮E @BBEPuϦ CPCP赦^Zu{ ‰E1 t1҉É։1 t1Yt)G8W<)G$}u h"jQE Xu9utpE MAP9q4u@.@. y(x@.@. @.@.A%AQE@@.@.EY눋E@.W~Z} 1e[^_]UWVS<] E@(E؃} G,u1uȃ{1ɉMȃ{E9C(rC,}t-wSu"XZEtEPt@pEЉUvӋE@HEEԋEYE؋E u1 t1EE}P{}̍OKu؋uЋ}ԉ t1WVR8}̉CPP}M؃1ҀMt)}}9s6H 1B׋}d}9sH 1qBC EsE̋E#u1 t1EE)C(C,}K S$u,C,E Ɖ1u)EЉD1E,C,EƉ1u)EЋUԉD1T11E@.@.EUE@(E؃} G,ub uVh"+ S"j2P耳2 9~#1ɋ!thE"e/:"mZt1sZ9{~c1ɋt Wh؊"6VhP_a uVWh"* j2P該G2 .r"Yt uhc"1ɋ.th"s]PPPPh"V\\\\\]th")&XZ4]`%t 8t0Rh")& $M(p SPl&xL؍e[^_]UWVS]CjP膋 _Z1uh@%h/"k[^F9~?{jWN ZYu Vh@%hL":19~DBh*"u w3Y_uu h@%hl" z"‰UWW'<Zt uƄsh"hP-shŌ"hP- R;$RW< DžuƋSS9VhQj( u RWh"CPPPPh0%Q4GtRWh0"i' ; ȋC AEV)$_4V $^19s~4辍 FY词 Z1e[^_]USRÍEPjhjjj jSwU tShO"Rjr]USHPh_"h-0Sh"h-0Shڎ"h-0$Sh"h-0Sh"h-0Sh5"h-0$ShX"h-y0Shy"h-i0Sh"h-Y0$Sh"h-F0Shҏ"h-60Sh"h-&0$Sh"h-0Sh="h-0ShT"h-/$Shk"h-/Sh"h-/Sh"h-/$ShĐ"h-/Shې"h-/Sh"h-/$Sh"h-z/Sh-"h-j/jV"USRhP[ u ShUW$j]Uuu u+ @uuhD"jUWVS(`؟ԟhV"Rh*rPEܟП119П~7̟hW؟9 ̟u ԟ0F`ܟv1ܟȉܟ9}J̟hW؟8 ̟u ПԟEܟF`벅u؟hi"j蛞e[^_]UWVSlj։1EEjh-$%Q t(jh"S tjh!#S u Ejh"S˭ uEjh3#S谭 t}~Eh"EPhrWh"EPhrW =@.t="}t"PVhˑ"L) }uE4%Vh".) e[^_]UWVSÉ`hPdzlb1󫋅dhx|h"VhrS`h"(|xh/"(0tplhf"o("u"RPh"G(h"+(D1҉¸1 RPh"'0Ph"'XZ"4t"Ph("'84%h;"'Ph"h-F&ShP"h-6&Sh"h-&&$Sh"h-&ShY"h-&jUWVSӊ u@ ttg tbp\uPuh-h"薋XZ dd$ Y[h=jV9kx1ɿ1҉lx9sWPh9ߋlhsߋhlX 9sـx t Džx t Dž럃A.t ~CLADžQwQ1Dpk`9pk<t=A.tw7Sh"h-CG t GkG \h-w}YXt GAG `Njx9rh-j XZK\P 9sX XBtt9+믃9r s(_h-j pY[Vbs gPM ZvPhfY$Pp! uh-h"Ph#P_vPh0#P^vPh$P  dP[vPh"P  0=A.th-h!"{XZ1ɉ A.bh-h3"{_XA.FP!^ v PhD"PD  j[PYvPhM"P  u|3PZvPhR"P uB=A.th-hX"z^_1A.uh-hl"zY[A.YPh"h-;hh0#P_ e[^_]U=A.iu=L.t jhK..h"\Zuj^UShâ"h L.1  L.XZthȢ"h L.DFYXthТ"h L..FXZthآ"h L.FYXth"h L.FXZ!L.]UWVSu }1ۃ=!-ÍF @.s==A.t"}ug"h-PoyXZuWVh"h-}؍e[^_]UWVSl]u }1=!-EF @.r=A.Sh"h-K u=A.iu =A.=!-u(WVh"jd]S }u WVS VWVv YXt%RU "PS MUufJ"uWVS"Ã}uPt^XfKEe[^_]US1ۃ=!-ËE H @.s(u ZtfPfPxtP#X؋]UWVS=A.th-h"wXZjj_Xt^=A.th-h1"wY^ދ[F@H @. s @.sV_Vl#XZu1;5@.@.WVYXt{F @.ra=A.tS PhC"h-{uS^S"XZ"S\s s@L.C$@L. [uWe[^_]UWVS uE H@.EV-Y1ۉ]t7Mp p.[ZuhO"aYYE9Euu XZEECt 9t@Eup9tY}uW]W!_X)=A.tWDPhg"h-W[[YE3}}1}uhEEuIEtCC;EuEt4G;Et+MMTĈ} t:EH$4%fK=A.SxVøW}uW\W XZWZXuuu VBÃ}uPZ_fK=A.t%SVËE\SVPh"h-_}ufCufCECuSVPMTVS/!fK놀{uSPVh"h-GEPuu VyfH=A.gP_UËEV}ubW[WEPuu V2Ã}uPYYfK=A.S UøFSVPh"}ufOfO=A.WTøfCthУ"SuWXZ{uG{t h"SWW_XSZS[ZYuuuu ViPY) uSXXs s @L.C$@L.uuu V&Ã=A.tSVPh"h- 1]uu Vh)"h- EVPhL"h-m  VPhi"IU e[^_]UWVS=A.th-h"q^_1;5@.@.sxWVY[uۀxtV@. s؋X tf{u0=A.tSPh"h- S#YSXZ[5@L.t[^ tO{uDf{t h"S|UY_=A.tSPh"h-F SXS!XZ[뭋v$롍e[^_]UWVS=A.th-hԤ"p^_@L.1@L.t#{ t{$C$SWSFY[مuȋ@L.th"ST[$XZe[^_]UWVSPA.=A.Rut6h-h"[p#th-h1"Fp^_5@.uY[jjQƉס@.EXZ@.9HE.LE.@.WVPƉXZHE.LE.9ƉsIWVYXuWVhF"R S?PhV"h- fcWV}PƉ׃9u9tRPWVhm"h- xCRWVGXZu h"xRYCu h"SSXZCt SVfcXSPvCfcY[@.U9Pu(Ce[^_]UWVS=A.th-h"nY[f@E.j_,B jjOEU@.@.RPOEU5LE.5HE.TOƉXZuuCOEUuu}OEUE9EEEZE;HE.ELE.sff@E.j+7Bm [E;HE.ELE.rj9@.uA95HE.LE.rA- @.S9u@.9(HE.LE.9ƉsQWVrXYuUhO"PXURUPhV"h-UfbWV2NƉ׃9uM11 WVXYuUhO"5PYURUPRAUfbXZ9@.t A_WVde[^_]UWVSjjY[t<Ã=A.th-hե"lXZCtSPLfc_X[u=A.th-h"jl[^1;5@.@.WV!ZYuыXtCtNPP xu StjSjjPPAOfc[룍e[^_]UWVS=A.th-h"kXZ1;5@.@.sJWVaYXt3fCƒfS{ufCf{t h"SOXZ[Ƀ릍e[^_]UVSuVZuVh"h-< 1Suu YXt 9t@uu hL"M {u}t h8"SOXZ19e[^]UWVƉjhRP+P.t9xu9pte^_]UPha"{ZY8u"h"h"5@.hצ"h-hjQUVS@fCdL.=~B`L.)fL.5P.jhhL.Ht &-Z1dL.5dL.CPSL.Py5`L.CdL. e[^]USjjj0K+CC]UWVSƉӉ9tR)ySh"h-z j%RP6^thF P6%F e[^_]áP.t#UPju uHt "-iUWVS =A.uu 9uEffthB1ƒ=df.t fjEPWW Yf E{1;] }ߋW hf.=df.ut'?t"GGȉffWttG%)Wu9rG9=A.th-h"gXZGt=A.th-h."gYXGA.O9st+PQhH"h-|=A.th-j XZ?te[^_]USjh &-!$Y[th T Zu S$Y11҉P]UWVSX=A.th-hp"f^_5@.5@.5@.h"hh &-A.߃Wh"h- &؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃSh7#%hVEVy^NjP ѡP.a5P.kƃt(@hH%P?ZYu)5P.CYu*LSh"h- 7Sh"h- Fh"PYZu5P.Z1Sh"h-j P.Ƅ=FVvhPSh1"h-:hPSx1RPSVH P.;5P.BơP.Xae[^_]UWVSuSr_X؉8/u@1Ҿ1hC%PXZۋtm;thlu1WP ѡP.S^5P.Yt@9uVSBP uȋ2lЍe[^_]UVSu@Y1ۉ tÅtƋS ؍e[^]US]3pX]]T UWVST=A.th-hN"A^[^A. nVUX=A.E}tPuPuS  uSEZY~/9jPuSjSh"h"h-EPSEPS=@.tuuuuh%SC uSY[fft uQ Z5P.Xe[^_]UWVS}E U#ÅuWuu h"=hhWƃ y@Wh "h-h- 0X PhǸ"h- 1S ѡP.P.0mNj[Yځ~RQW @u55E.5LE.5HE.h"h- E 0X Ph "J=A.uURQVd @uG5E.5LE.5HE.h"h- 0W Ph6"h-$j%WfV`XZe[^_]UEU ]U= "-#tjjh "-h "-== &-#tjjh &-h &-l=UWVSƉ׉ˉ t;5@.@.rWVh"; Df.RPWV1 Hf.s{ S$=A.t [$t9{ u9suh0"S<XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh?"Pb<XZUWVu} 1 tC;5@.@.s.Df.RPWVyHf.t;x u;pt@$e^_]UWVu} t;5@.@.rWVh`": Df.RPWVHf.t H$9x u9pu 1pp P$WVh}"i: e^_]UWVSujj[_ÅtJNJ/t tF@PW3wZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P|_Zu1,VeY/txtEVh"9XZEe^_]UVSu>d.F@`.9s%)P6Sjj*9tC/vKSh"Q9XZ؍e[^]UWVS}u hū"09[uYƉ<@d.uE5@.C Zu hϫ"8X)@. @d.9r @d.@d.@d.uS؍e[^_]UWVSu=@f.uF5@.nC Xu h"8X@.Lء@f.19r C$؃(t@f.@f.C$@f. 1ECCDžuPE  EujjY_t Vh "8XZVVT_C[ٸ1Xj/Vq^Z@PP C{G C_ Y^Et5uu XZYƅu h%"7_E UCS FC^1E E t)uu ZYt h@"N7XًE U<؍e[^_]US]SZ@d.@d.]UWVS]f{t hQ"S8Y^{u&{t hd"S7XZ{ t h"S7^_s{ t]WVqZYuh"S7Y^49uWVKXZt-~"ЅtP9uSP h"S{7ZY3@f.C$@f.Xe[^_]UWVS]E ?ƅu h"S27_X9stsF C^ j/u 薟ZYx3WƉW:C$8VP(fCu fCe[^_]UWVSd=A.th-hά"gRXZA.E0hr"u_Xu,0gP Ph"h-Huh"55fc E1uE9@.@.ErFuuZYƅt)GE~SFPj6v}ӃEU1E1}E9@.@.EuuPZYDžttj$GPEPuGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP눃EUUHf.Mt@ESjjEPE Df.E9ʋE E̡@.@.EUMԉuС@.@.E؉Uܡ@.@.EU@.ESjj(EP*C @t,0N Ph"h-`uh""M3SXe[^_]UWVS=A.th-hP"OY[}uXjj5@.5@.Df.jPA Hf._Zu hj"2^jjjhH%fHwjju ƃ y,0M Ph"h-uh"y2xPV|Y[y,0lM Ph"h-Muh":2EЍXjS.A XZu hӭ"2YSWV  y.F0M Ph "h-uh"1j(PPV  xV A.Zj*U Eg.4UVS1ۉxf.f.|f.9s[t 5|f.[A YV8 ã|f.Zt5f.11f.5E.5LE.5HE.hD"Vh["h-؍e[^]US] =A.tSuhf.`f.P =A.uOj1RS5k.Bu8@u50aH P5E.5LE.5HE.h"h-0j]U= k.t"f=@E.u5E.hï"h"j E."f@E.1҉DE.@.@.HE.LE.= k.t1 k.jh k.VUVS]u =A.tVShf.`f.P =A.uHVS5k. @u50hG P5E.5LE.5HE.h "h-7j#e[^]US%tuPC ZYt1ۉ؋]US]@.9(*-}A`o.tP:? Y P6 `o.Zuh-hA"Hj(*-]UVS]@.Pho.=A.tPj |^@.@-j:S#ZYt"k.pS3[j1h#SZYh*"hh"@.Y^udH0F Phh"hq"h-h*"h%H@.u( 0E Ph%hq"h-js.Vho.uXZe[^]USD.D.EU]SPh"h-^ D.D.MU ʸ"tS{ZPh"h-) "=xD.txD.h8D.PhC.5C.h"h-hC.h#h-$=@.D.D.EUS~Ph"5@. D.D.MU" tS~YPh"5@.q "=xD.txD.h8D.PhC.5C.h"5@.:hC.h۰"5@.%$5@.h"EXZ@.@ @t h"jP]UWVS} u=A.tWh"h- EE]99ru4=A. ";]u5!#Ph"h-l {CPCPhȉ"hR^=A.t R3C4,*-h"h- t}t?SHK))PDPPCPWWbK"uSHK))PDPPCPu>b+"<SHK))PDPPCPWa:"@:{Nhα"PZYt h"PoZYtJt%uCDPjW; w"?CDPuŝZY\"CDPjW茜 g"@{atNt)CDPjW賛 w"?CDPu=ZY\"CDPjW g"@t=A.t/Rh"h- =A.th-h"BYX=A.th-j XZe[^_]á8*-x=k.ti0UPiXUWVS s.}tt=h"]%[15Tk.5 k.t=@. 11ɉ1\k.5s.tjA.ڸDn#c]USU x.Ruh"hSڸ"]ËUEPh%"XZffUSfPh+"h-~h-hQ"K*- CtsPh"h-Jh-hz"@*-XZ CtsPh"h-h-h"jUWVS]} t~C7h"V*YZt:h*"VYZt-hr"VYZt#hyG"V^Zt1 @uh$wȴZYt|1j}Wjj5.^e?E? EEEPWS5.$e[^_]US}thjEPjj5.]?w5{.hӿ"@XZE5!#@uG"P5{.h" G"y5!#P5{.h%" G"}y5!#P5{.hQ"֤ ]UWVS(}tE 0iб]ع1XuEEʉUUfEfEu͍Uι 1EͶEjh'jSj V5.e[^_]UWS}t!]U1E5jh'jjjS5.e[_]UWVS ]} t~7h"V賲YZt:h*"V袲YZt0hr"V葲YZt#hyG"V耲^Zt뮾 1uh$wQZYt|1j}Wjj5.e?E EfEEEPWS5.$e[^_]U }tjEPjj5.UЃu5{.h~"XZG5!#tG"P5{.h"蜢 G"Et5!#P5{.h"x G"}y5!#P5{.h"T UW}t5U1jh'jjjR5.}UWS}t]U1Ejh0ujjjS5.e[_]UWS}t]U1EEjh0ujjjS5.Se[_]UWS}tY]U1Ejh'jjjS5.e[_]UWS}t]U1EEjh'jjjS5.e[_]UWS}t]U1Ejh'jjjS5.ne[_]UWS}tt]U1Ejh'jjjS5.#e[_]UWVS] }~j PW5.K Rt$Nuj@EPjW0Ph"jj$pPjj5.rEЃf=t Rh"譟XZ91׹󪉍,ƅ8fEf;} 14zj 0P3'ƒ 08t3h6"jxD,ƅGʉLj Vj5.ƅ914}t1"jhM"s uƅ5jhtj4Pj8P5.<hQ"虞h-[^1ۍ>1ʍu1ɉMfEEE'E0VhQ`5.I @u h]"jE<u 5{.hj"<u5{.h"h-脡 ~<tP5{.h"h-e_Pu󥀽_y-`9%CSh"蘝h- j HRZ<h"hXe[^_]UWVSE] h Zu h"jZ1󪍕 19}J jQhF"  ujQh" u#Fuobu 4jVhK%蠪 ÅtIjVh"芪 u'jVh"h uƅ7fDžjh0uhj P5.ƅp9؍t h"SY_uu"-hF"S-XZthC"SY_h"S XZhI"SY_u hR"SXZS5{.5{.5{.5{.hc"-@tAtif@ffh"SEY_`f@ffh"SXZ(/f@ffh"SY_!u h"jZEVhܒ"TShUW$IX4S׃X9uEe[^_] e[^_]UVS ] }t3h#VۨZYth\%VʨZYu E'j EPVE U:uy 3h#"Tsh#V膨ZYth\%VuZYu E-j EPVvE U:uysh6"j EPhU5.E t hF"j e[^]UVS ] }t3h#VZYth\%VקZYu E'j EPVE U:uy 3h#"Tsh#V蓧ZYth\%V肧ZYu E-j EPVE U:uysh6"j EPhU5.R t hT"j e[^]USUBBPJ R Ph`" uEi"]Sh"ӗXZ]UP}E 0EEPhQ5.託t h"j U}tqjhQ 5.s t h"j U}t t h"j~ UWVS } 11;]}#j4h"" uCPQ1󪍕JƅPƅTJjh'jJRjS5.k jPj!gW ,jPjAP jRjVR VRPW5{.5{.5{.5{.h" rQƅRjh'hVjS5. ȃf=v1QLhW  HLQhW LHtpQƅRjh'hVjS5.+ ;fv1PWhW h"%Wh#LgQƅRjh'hVjS5.f=v1h"辶X1G9 5Ct9C LHD04%h?%hH %V {y0L%`vRh" 4%h_%YXD4@%h "XZ1ҀHu6C9s!DLPh1"ۓLBYXj XCPShS/ S諵e[^_]UWVS,EE܋] h E^u h"jU 1E1E9}t3Vh"'ZYtNVh$"ZYtAVh\%ZYt4jEPV̆ U:u=v3h."j1EGEEjh0uhuj EP5.~Er=vhP5{.hI"聒E1E܋U9UE܋EU܋ Ћ\ˉɉʉىӉ1Ɖ׉ Ɖf1u1u M ]1}‰E M ]SQ5{.hg"qEEe[^_] UWVSEEu EBU܉EP XۋUu hu"j1ߋMEfEfS1j EP6 U:t6h"jpTTdDG9}ujh0uuSjEP5.]e[^_] USUBBPJ R Ph`"赐 uEi"]饲Sh"蒐XZ]UWVSÉM}EU%qtE8uE8At=ʀ@tQVh"Wu%tQh]"Wuӎ WVuN e[^_]UWVSDEU ]utlt"tWJ*P @ VBXHM}P @ j@WE4&h_<%VSDxw!V@4&S HPw$w}txf@Ph"mutf@ʃ@t%"t"QPWh"VS覍>"t"PQh"VS腍f@Ph"VSj1ۉ؍e[^_]UWVS]}hpVjSzPh "v{vTh"cY {yj h,"KXZ,C@tPhA"3YX,C t PhQ"XZCȅt Phs"YX{w j _CȅtPPh"܍ S C h:Vh"躍C t Ph"褍XZhpPjSuj 行Xu'tPh"fj 而 W;} } <;u GVh".YXujh "XZjh "^X>9tR;U }MuRlh "ӌZY1ɋlhlPh<$讌hAlBXXh"蚮Xe[^_]UWVS] }uh"p^X1C9~D3Ph0"TFZYj iX}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`uڋ @u h]"jEtU{.<uRh" <uRh "h- #<u jSRPRh "h-je[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt2uBItu< }[yt ut܊ y_vCm t4\ 0H2N0H2N0HB]9uX[^_]À\um tf\\M t݈@UPhB"h-2jUh"΂UWVSÉ֡d.Pd.uhh`.<1Y_`.h"h"hWhr"W_Zu}h"Ph"jH J. u.h`.Ph"h"eh["h`.Ph5!#h"71X9ډ}Dh.\* $h" ԅ.tWPjh.n?;9}~ڃ<# u5!#P<ؙPh"觋h.YuRh 2jY[j(^@1<$1$jҡXZh9"$XZ?e[^_]Ujh.׈U=.u h{"qXj}USh{"[h2jhh2j\h2jPh2jD$hhh{"购 xVj"h"Ph.(j PSjh$S(h.Γ$h.SS:]U%Ph"h-=j)}UWVSыP-:֍RD{@u1ҊBuT8t9s P-DY@tJB[^_]UVSËHuPs8tIS8kC4`9s `R 1s0s4s8X{Xu1ɉKXCXtP Z1CXe[^]UVSu] EPu36Cx9s)e[^]UWVS`ƉUUP 1ۋE9߃u*E|fE|Sh"j EPEEEEPh1"j EPUfT ȃP-DJu.D=uURP U_Ce} t EPYuh "XZe[^_]UWVSS1}11#tAEtSWh"PoShG#P^ @u h&h!"5We }YCu}u#h5!#*EZuh&h&"jEe[^_]U蓟h+"Ph?"PhH"PhR"Ph\"Ph}"Ph"h-與8jqzUNPh "5+-e. t5.Ph"5+-BE Pu5+- . USÅtNQ@.twRtF .ti$0 Ph.h"QH@. .u=.u2jy .t#ޟ0 Ph.h% tŋ]UWVSEEEEujj}WjVPX @u"e[^_]ËEƒUt Ph"jP ZtjjWPVu @u ]=0.u5+-uhH %I ms5!#M;Ms"VvvPh" E f3#j *X]e[^_] UWVSEE]EEjj}WjPSc @u-u YtjjWPuS0 @t̓=0.uuh "聁XZv<9t's sss sssh'"H ՋE荞 kT؋U9u FE1}h.h="ZYdTEM9Mt?Sjhlj" :1;{s֋TM4PhP"G ,j Xue[^_] e[^_]UWVS}}} }܃=,.É΃=0.tO=(.u:=(.t }u&}u35+-RhH %( . 0h-juVBfN}u!Rh " .Y_~7j X .~# .~}uڋUe[^_]уtut3]ߋMtu*E r4s6Ph%4]ߋMEtPEPhU"b sPh#Ph#5XZM]ߋMtuuEPh\" $M] s SQh@$SQh#~ }uEe"e[^_]~E e[^_]}e[^_]Ã=,.t .URh.4+-hj"UWVS=$.uh"sjtj=PcY^Xd 1Dž\ Dž`hj`Ph.\PVSP@u!ڋ\==.j[tDž`1Dž\YdX@DŽdj`R`PPQV @u!*0 Ph.h"WBuh.h":XZ&,. 0.uPh.h%} e[^_]UWVSWE}u =,.R˃=0.t>=(.u3{=(.tNu%"u25+-RhH %| . .h-jWSbu"Rh "d| .XY~7j q{^ .~" .~uى؍e[^_]it1RE rGK= .tUPh1"{YXUt2= .uUPh"{XZUB9|SWhȉ"{ NuEe"e[^_]{E e[^_]ze[^_]UVS]=.t Eh"S2Y^uEEY1҉jEPSEUE 9u%Suh" =.jhq8u詗8u̸]1PSEPuVuuI @u1t =,.1(.  .u}u}tPjUEPj "UENY^tF(.  .u}u}tjjMUEzjj "UEXZe[^]UWVS]=.t 'EE耖18jjEPEPuu+ @uuh"kjSxW u%Suh/"e =.xjojuVۅ|W8u|1PSEPxPuu~ @u1Ft =,.x|t1p(.  .tpjxUEY^?URVEPVhL"jduVwpPUEG$tk(.  .tjj|UE~XZEURt腮EPthL"jd]SvjPًUE$e[^_]UWVS(+-8.t f./..SV\ZYuVh.e[^_]É)@E̍EӉljDPh.hC%h.uUWVS`Eh.ZE&1]M;>r2jPRU= Utj@uVRPV3hV"WGjEPjh.RU5 UuE Eu1}u+E9Eu#/tj@uVRPV3hf"jGQ1EEe[^_]UWVSEUE5,.$ˋ .(. u'@. .h.hv"[^=0.tu*jtHu!u05+-uhH %u *h-jSu[Hu"uh "uXZ= .~(j tY I~I~uڋEe[^_]1v{9}E0Ph1"?uFYXt Wh"+uXZE e[^_]7te[^_]UVS]EjjEPuVuux @u Be}t Sh"j . (.tjIY2=0.u Sh "tXZuuuuuh"qte[^]UWVS]uEEU E$E@. .=4.J . (.t}jjEPjuV @tdMt]QMU XtMMMjjEPWuVb @tM;Mt W _j.PY}e[^_] }tuh.h " = t)tu*Sh]" uSh"Sh1"Sh"SXZe[^_]UVS]E jjEPuVuu @ul} t Sh"jEUEU . (.tj cXP 0.u EPwP5+-Sh%r&IuRPhLW$r uRPh"mre[^]UVS ]EjjEPuVuu @u}t Sh"jF . (.tjE=0.u5+-ShH %q EU=0.h RPKf t P趓Xuuh"q e[^]UWVS,EE̋}uu<=@.t3EjjEPEPh"E܍Pk((U܉UȉMQM XۋMЋUuwuM1BH(jjURPVWy @uCEԋU܋M؃t (9t$9uދẺE1uh"j 1C(9~ˋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPh+-uh"jURnUUС . (.t7j(EY(}t GE܃t9]e[^_] =0.uuh "oXZv$v vvvvv vv6h"o,뗍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph"d|<Dž|tWU XuJHxjjxPVphH @ut9xt Sh"jl%EpujjڍE_X=@.t=19|Wh+-Sh"jURl jjUE{G ŋ= . =(.t jQ=0.u Sh "mY[|~+t4Wh7"mG9|~ hf3#mZj lXue[^_] e[^_]ÍL$qUVSQ$A QEjjMQuVRP @u}t Sh"j_ . (.tjYd=0.u Sh "lXZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$hA"leY[^]aUWVS@]=.t Dž SXuh&hUW$j1h%RuY^18jPS_ u.ƈ8"uShQ"9t8uShb"j9tҀ8úw܉ h%ji 1PSPVuu @u1t =,.1ǡ(.  .tW EZ)APw<$PUEV tV(.  .tj EvX1Pw$PًUES e[^_]UWVStx|h.Xwl.$@.:wYh@.h)ȉl)ȉ@.u.u|uH1ۋx9t担tH%u5!#RPh2V%PPC뿃} t~|P+-xw5!#RPhH %PP|PH%xw5!#RPh2V%PPU Dž|+-|+-Ã=4.( =0.th@.h "hXZh@.h.hx"h EHv ht $h"<4&h"h_X}uC|@0|psPh"hY^P|p4h"mh |p@h"Wh|0`.XZpt 5!#6hh5!#h`.)hh"h`.%ppu/hWh`.hh"h`.揃%ƀt2hWh`.hh"h`.%s2hWh`.~hh"h`.j% s2hWh`.Fhh"h`.2% s2hWh`.hh"h`.% s2hWh`.hh"h`.% s2hWh`.hh"h`.% s2hWh`.fhhɬ"h`.R%s2hWh`..hh"h`.%s2hWh`.hh"h`.%s2hWh`.hh?W%h`.%t7Vh26#j V*dhWh`.thVh`.d(h`.|p%Ph "2e|@H t Ph"e_X|p(h$"ej d }r=8.=@.u }|xXDž1DžtxTpj`SPPWt @pu\t|@9uߋ|@(9uΉdQpa ^dtNjp󤋅|@XPwP Y|XX=@.uTE tN|@XpHv9} |pUE"<=0.uh.h "?cXZ|@XPvh-"P'X}|ps E z-UEÃ}tP@uj-f Ph.h>"j3Ys u|xtjh@.h.|@@uojjPjxt @uD@. .=4.h.hU"|@@EH{$&|xt$|@8d uq=8.:t.s j|xtjh@.h.S @. .=4.h.hp"Watx\=8.j|@4p\c _+jjPRpx@Pt_ @pt*|p`t7|@4`&R ^KP}8 nЉX1ɉp`9ptkp`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQTZ ZPtރ NjTCXpsR跿 X1.d1ۋ|;X4,F\s@. .t%xQuujPtC`jjPSxt @jjjjPSxt @UjjDžjjVSxtV @uI{8 u3 XjjVSxt @u jٺ.|c^_9S4 [DžjjPSxt @tgjjٺ.|^uO Yuh.h"5+-[a KjjPSxt= @u jڸ.*Sn XZhƀ@.lƀ.e[^_]UWVSƉLH.j=PzB_ZƅTt9sx?u @ƅTGhh#V0Y[.t+-+-8| 8Vs tG=^jh$Sj P` F<=t:+-M  T=$.u h"s 41Dž81ɉh 1ۉtpƅY1j,TZA_ZƅtF1ۉH1DžL1<1ۅkj=V A[ZÉluh-#VjZYu09@llh-#VjZYu D1j,S@ZYDt @Dha%V>jZYHt;"Hua%PTh", =.jQw10jlPSN"!8uv8h%V hZYu10jlPSQ48l 9uSTh\"8uu8u48,0,90r48he#VTgZYuTh" ډlHw^$&PmPaPUPIP=P1P%PTh"1L DžLpB^VTh"u D1މDu DžD<tTh" D$&s1ɉjlPVO<@l 9uSTh"8us<@4849Ƹ8r9u-u F0j PV x;3ue[^]UVS@Ë5H.=X,-tjtSvqWZYuFl6j j5SHFSHU$PFShK-%PH.5H.F PhX"j@]SFSfe[^]USQtP=.uSZ]UVSÉu=.u VSZYe[^]UWVS׉΋]Uu E E!UuUL$t5!#[^_]USt<0„!1=.uSZ]UWVSLEӋu>hh"V)ZY)ƒ?EljDUh}bSPEUDEj URPEU:*u%jjWSRPEP,tEuj>u+ E9h}bSV e[^_]9`,-t3UVSRPjuVD`,-e[^]#.t ú.=ԋ.u.UWVSƉӊ>uuVȋ.HtB1.hp5.V`=.1҉.hp5.SA9=.~؍e[^_]UWVS,E9. ..}]6SP=Y^y#...=.u`. .SyZ=X=&wAKw2iff.7[nRff.7D=,w$==!ff.7=Xff.7=KwJ=w$==` ff.7 =%ff.7 ===ff.7wff.7lff.7aff.7Vff.7Kff.7@ff.7 5ff.7 *ff.7 ff.7ff.7 ff.7Eۣ.Eݣ.Eܣ.eẼEfE1E`. 5.iSj5.E.e[^_]USEPhht@jB 1ۅu E]u+hp"eaZtP^.X .%T~.hk"5aYtP.Zy..1ɉ \,-=. .t.0h{"`ZtP~.[]#~.hv"`YtP~Zy..=. .P]UPUE .1J$& (U"U"lyU"U"U"ۍU"эU"ǍU"뽍U"!u,U" u .!. .1UVSPh"_P_ZYX,-hi<%_[u%1ɉ .Ph .$[^Ht ." t .A"."."؋.%ԋ."̋.".!"y1......܋..~1҉.E .U%td.7UJ#u5!#.U#u5!#.U"rċ.U"`u".U"Eu".=.t8=t.u/U".U%.=.u1..5!#=.u .5!#UE$.t8uȋ..5!#U%.=ԋ.tt8uȋ..5!#Ub#^.t8uȋ..$U"/.t 8u .5!#1҉Ћ.EPh5!#h5!#h..$"EP5.5.hؘ.ܘ.%" EP5.5.hИ.Ԙ.L$#EP5.5.hȘ.̘.L$Y# U%#Uu5!#Ę.##t ._%Uk$ .tހ8tٍU:#Åu5!#.5!#8t&jjPPu6uVIDE".UN%Åt =\,-u5!#.5!#:t+.HPjRPu5uV$IDE"Y.U#6u".Uq#Åu5!#U4"…u5!#=؋.u5!#É.;u  .e[^]Ë..n..^=.tg=.t =`.uMU= .t=T.u..=X.u..1҉.]1.á.t 1=.ú.....USc=.t =`.ul=X.u<..f.8t.8t=.u.=T.u..!= .t.=.t9.~j CX]6]Uuj5. =.uĘ.8t .Ã=.uUjlXË..q.bUWVSu M1+uAM]-}tue[^_]USÅth5$PGZYu "tEPEPS tt<`Ux& "Ux<& "Ux "Ux"]]ÅtVUVSQ覰Xue[^]t<+u;+uC؍e[^]e[^]U5$.Ș.И.|ؘ.m1.]UE t <-@t]USuZù¡ܘ.ڡԘ.ڡ̘.=.ttS蘯2Xڡ..]US=4.t.u ]SJX]US]SZ3.t]]]UuZu Y9Ã=X,-tUh("Xú.UWVSu}]E Et#jYu7u21ۉ] E-"jYut$RPyZYtRPjZYuÉE1ɉM EA" t9Et'hÃu1҉U t EX"Eo"vOԺu Y ̍1EEU҃Ut<9u t0G9Eu߃sڅu}EU e[^_],1E E"e[^_]@.B@@@ 9uUS]t=h,-tjh"XZh,-]Ã=@,-UWVS.@@ˁ1 }1119މM}Z .9t+9xu"9puUpP5@,-Y Uхtjh"FXZ뛍e[^_]Ë .…t8=.u/US@t &11Ҁu 0@4@[]UWVS$.$@(@u9t9pu9Hu,@;Ps D15.%uމuv@E9t(}9~u9NuF9,@<vԋ{9t utt=x.t @td,-x; @~QMh j% ZYMu 1x.0 @@@xCSP{x B C{WG B POE܉G1GE@Gw x Ex.$@(@ EUF1҉E܉UEUEUEU9EM|!@uWE9@u E9@t`?@]juu@1Bu@ujh"[^&.M]艈@@h,-Ft*Th,-=|.1ɉMܻ.@Mt@ &T뾹 )QDP@ià u.u}艰0@4@Et]y*jh"XZ1K@,-yZ=|.u/@,-x&t"SVTRPsU 1E 1E .ؙ@@^}t-=.uAEEPhUW$O.ZYEU艁0@4@=.u2j2X=.t!=8.u+lt.8=.+.98t<WQ Gz8OW Q JMԍJO]É_ y z,@;F0De[^_]Ë .t&US$@(@ ,@1[]ÃÃ=.tCUu/ .,@w B,@$@(@1]ÃÃ=@,-xzU= .t,5@,- V@,-5l.y 1ɉ l.XZá.4@uƃ0@u .jh"nXZ;@t.tUWVSu} .Uy 9}!@u EU@uG@E䋋@9u9t0E%@؉EPE9t8E;BuE;BtREU$@(@%,@1?E9ƉV.@9@}A@4.t&[^_]UVSjjY[t@.9t2ʋqY9t9rr}ы扰$@(@1҉,@1҉Ѝe[^]US.u1Q@t@h0@4@[ut RPPZYs@t.t]UWVS .t @t e[^_]pE11E9t:EP@ EUE@1EU9Ɖ}Ɖ׋EEWVZYe[^_]Ë.,@t H,@cUVS$@(@9}Q@u#%@Ћp9t.9^u9Ntv퉊$@(@,@[^][^]ÃUUx1ud,-]US.@uǃ0@ǃ4@|9t@@@g0@4@.1ɉ@@$@(@,@jjj@*Bu@ujh"XZ]Ujjju*!Ѓ@UVS.0@4@ut@@9} 0@4@[^]UVS]u 5.q.Yh8@j.@1҉ @@1ɉ@@$@(@,@ǀ@ǀ0@ǀ4@XZtSYu .@5.5.pXZ.@u@e[^]UVS.@ t4t&9tPQ P X1ɉ @@uB u @;PZ.t ǀ@P裈 1.j5.*p e[^]Ë.1t@UWVSt/Bt/; r"H19|0<9Osr;s B1[^_]UWVSR1ɉM1.G-t.PS5ZYuFFt! ̅ujh2"*j 1e[^_]1UVS]utO= .tڊt <^w7Bt.}t&<*u{t{tjnCPjnS ZYuހ>*u:Vt3st!dt1k1uUE 0e[^]UVS h5!#j hl"Dhę.o h.e h.[ h.Q ę..ș..............hG"0D1[<=:tjh{"?j FWZPÃ$P&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu= .tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU= .u~ 9sSCM9sICKB~PR_<9r)S{Y"9sC%[tS[Z1Me[^_]U庀.E1uN.Ev¸u61-E^u =.t,-ED]U庀.E#1uN.E¸u601-Eu =.u,-E]UE= .tE].]USQ]uh"h@.zw?SSZt'؃@PCYu@Sh"(S5ԙ.SZt. S YtS5Й.j h@.Y"yE@.SEPEXZ@.]U庘.E¸uH--E]UU 1}Du% ]UWVSSEIuRfP(^X[RVZY1uEV Xt S(Y-h@.jEPVPhuV)ZE8} tE 8؍e[^_]UWVSRh"V:h"J:Sh"PQOucjh"V=Oǃ u.h":Sh"POu0Sh"V O Sh"PNEWz Ete[^_]UVSh"9P9ZYu3h#V)ZY1t=h%V)Y[1t(VsZt ؍e[^]te[^]UWVSlht`ƍxPVtY[{%=eh*"VVy GShV #jh"V'  1҉p1ShWu t t u@h"WO(YZh"W:(YZh"W%(YZt<"u5vptp~HpSPV t!SjEPU)U t1e[^]UE.U .t@]UWVSSuE 8=$.u ^9uO tu QMZYMuGCQp Wp _Xu s xZYt,jjEu VC EC3FC^ Fe[^_]UU Et1ɉME U]6t E]鋙]á.t);4?-t!Ujh@.P.@ UWVS]= .u3.=...uP..Àu.%=ua%=tSSH.%uF .A..9~1!Ph.ZYu(1.K1=.4L.15.=.t1ۉ.UU1;L?-u PS_/EZYKHA$d&}e,+1.#1=.15..t.8 1ۉ..=@.vx u-x .=@.w1ɉ . .5.GZq1..8\<1.I1.E1.:41.)91=..=@.v6x u0.=@.x Z߀x I.=@.w15.1ۉ..8 u.8 o.oZ.Y1ɉ .=.=h?-y.-@.h?-_h?-[} t9s RUVh@.N Uuω_1.ItVh@.e.@.XZ.8=.t } .tPk 15 ._.=EP[¡.u=.@.@.u"z.tމU&U; u C9re?-Ed?-E11ɉM@.9t)9s"RUuV: Uu ta}t%8EEF9rL< u+9sJu/8ENu9s,Eu뾉9suՉx1F\..tPej Xj.)@P,..)RSP%.0e?-8uCSm<XuSA ._WA .Wi Y[. .t{}t1.Ph.o-1ҋE7_Z.E%..9.s.u,15../]1ۉ.Ku5.DY..=@.v d?-8Huh"(ZuC%1.v.e[^_],e[^_]UVSQM1uu@.EQЀ w[jjjj uuuVtjh"Y[11RjjE0RPuuVuɋE@1҉PU8.uEPjEPc EUeY[^]1.9.|@.á.t @@@ Ã=|.uUj11ҸgXUWVS|.t`?- 0?- .1Dž|P@$jjWPVT:QDQhr"Vm XZ$fSftxRPZYx,E%=ufSfthPh1YXh"%Zud PCX~P?-1Ƀx tA ?-x t tlph"h#SC |1ɉx =|.u:pl)ыt)PxG jjxPh"SSWV/V/f W)f XZe[^_]ú9.t9 .t 19.‰USR@.t>BE@.Re XE=@u$.t t7tut g ]UVS=\,-u=.t =`.ut/..u ujjj5.RPV p.u)=\,-u^5...1ɉ .-5...1҉.u H5zY6Y5..e[^]U]UWVSt e9ZƉׅu‰@.D..=.u0t;5@.D.}jjjG 1..ld8e[^_]UWVSQE)ơ.u..ǁt#t1 2ux%.Su5.á.ƒ.. t;x- st jk1j1Ztjh%"蹱ZYtV1VJ)Xe[^_]USVá.$N   tw #5x.jCP7tW6%I/f5d.S5h.5l.q1l.?E4x.؋]`..PS5<+u C< u.tPb Z;u 1.S.X5x.jPCP=|.SB1X];!t.tPa XSQ6.Y=|.ui.uh7"h5!#XZMh7"P=|.ut71ۉD9tt KtXEC<tiи e[^]Ujj#UP1҉@.YYu@. ыuUS]t CPX]UPKPEEUWVS<..@.e=.t1.1x.|.l.=.t=.tj轳_@.t x@jBX.\.Yu*:t!u5.YBZujQ_=.t*:t!vu5.&BYujZ1.=.u1.=p.tjh"1p.:͹t hS#Xt?uh9j::_X Ws^Y=.we{Ã=.Z.$/t.-7iCЃ . jS_Zdteht.x.|.^=.t1ɉ .d=l.ud.u_un`.ƒ@+t2tA!uI1D!-tȡl.=`.uLC1@ ‰d.j@d.]=`.l.  =tSZHOEa<h.1EЍEPEPEP虝l. tDFEĉE=h.u Pw P1_=E@Ƀ}XHNuEЅ:EPh" 15`.HY=l.S贜l.YuSEЍEPh"Ch.l.d.Ht!5d.h5!#5h.5l.. RߓZt5l.j1ɸ/eu;&7C!$&*t0@tg!=.7u-%.=t..=.7t%..=t.=.7g=.7tWjh"j#]S^SvRPσH=.7t(3.P_. tA tS u݃=\,-u yhK5h?-jYO =.t)SZH Fu]EE1҉UURPvƋEY_tPnXi Fc $&j1ɺØ#7 x.19|.}h.1;x.|.|Ϗx.|.X=L.t5\.5X.G^_jx.19|.}h.1;x.|.|mx.|.j1;x.|.|x.1ɉ |.=L.u+;x.|.}5\.5X.YFXZjj5x.1;x.|.|x.1|._jjQjj5.V=jj5.v1;x.|.|x.1|.=L.;x.|.}ze1;x.|.|x.1|.jj5x.1;x.|.|x.|.=L.u5\.5X..E_Xjj=L.t5\.5X. EY^1I+x.19|.}.=L.u5\.5X.DXZjj5.K7 x.19|.}.jj5.8tFm謹G5d.1;x.|.|x.1|.d.Y5|.5x.F5d.q=|.y1x.|.t.x.|.d9|d u=t.tx.d1|.t.5t.5x.H_Xx.|.19|, Gx.|.19| G{RPEv=|.y15x.5|.5d.5|.5x.YG\x-1EȍEPhUW$=.uEtEPZ9%tP.`.L..H..jYj譧8...1;x.|.|x.1|. . ...1;x.|.|x.1|.x.15.Ѓt+Ѓ$5. t .1;x.|.|x.1|. x.1_5.x1FP薶XdW[`.P.15`..L.1=..H.1.h"?맃=|.j 4?-" =|.z5.6h#P u jh&"5.P7YtjhA"ԝXZj ?-$t5d.jPoPt jhl"<;x.|.|x.1|.5x._vt\,t4uj^;x.|.5!#}"EȍEPhy"t jh";x.|.|x.1ɉ |.5x.Zi;x.|.5!#}"EȍEPh":1;x.|.|x.1|.5x.XuMjh"@/1;x.|.|x.1|.5x._u jh"V^ u 5d.RP>1;x.|.|x.1ɉ |.5x.ZJjh"?|15.V`2_kPYt VVT2d.1`.P臇Zu egjP1d.`.j1ɺzm" =|.u) ?-$t,#j=|. jh"[Mj1ɺ"L_  1?PSq'@0j1ɺ">^  Sq?@j1ɺ";4Y u lpSrj1ɺ"%[Ze4 t u.Sp_eD.j ?-$% j1ɺ"^x.19|.}H.#H. .x.|.`.;x. |.} x.=|.+x.Yx.19|.}H.#H. .x.|.x.`.1ɉ `. a`..=.it Dj1ɺ|(%iSXZ=.tp.̯UE= .t@]UWS]Sj"XY1ɅxЍe[_]UWVSu}t ME  u ZE EE EuEE܋EEM9EEujEP5ǃ Ethuc;us^ .EPU9@%=EtPU9rtEt>WSXt1E9EsWQMS_ZHMt QXYKEPU8EtWFI Zt WK YWEP.XZ}tE)}+} MB ZYtXX1҉Ѝe[^_]1UWVS E1E1@< vEtPENUjjjj uWVuVnu&jjUƒ0RPERPV&uC뙃e[^_]UVSQƍEkyex};uÍEP~};uߍE>Jx҃u̓@tAu= . = .B$}mu;.}Rj#;k.XZ끍e[^]UWVSÉU΅!CEC1ɉ}M98P@uBgtB$@ur5X-(@t Att+e= . = .B!5.V9}Pj#Rj.XZ믃DuA1x8tLuxgt;AyuȍIty@8u}O@Gdufu die[^_]U..|.r.]gUM U.y1E E"]7]UM U.y1E E."] ]UWVS|.Et Eju [^xPƉUY9E}jV> XZu W XjjjWSBu@uSC W~ ^_VSWO EWf Mș}9u9tSB 륉 Et;u{Mu {+u{Gt|3t|3uHVSY[|3Eu3|3nu,|3du%{GEtV_u |$WV' XZtu hC%Vh%WS]}tjS&Y^y S~+ ZPX؍e[^_]Uh"ZjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'.<%t.tRPY^CGjCŚXZutKH݀u=9us8Ft38Ft1 .<%t .tQPS*SÃCFe[^_]UWVS]S^u1jjjSBu@thVS ~ˍ19= .t)RP芨ZYu FSW_XSjW]ƒ =p.u9P4Yt"SWP;5Pi:vRgZd1e[^_]UWVSu'X=|.!8u#P^h+":PEyZYUt""RUƉ$YPkL$QMWd?-Pe?-PURh4"MQV$W( tXUVZUtRhK"PHG ShА#PHVt( t'YWY>u VR( Z SI( X؍e[^_]UWVS}1ۃ=|.u\WX$S~WhS"SPVuPǃ VPZYu S' Y1W' V' XZ؍e[^_]UVS]h#S^Zt(h"SZYth4"SZYƉe[^]UVS]SYuVSّYZu]e[^],~V&~Ze[^]UWVS u=@.h|.ZjXhc"Y_?|uC؉E-uEh#V_ZECHtjhW"!u[^VuƉ<$~T$RUF}WuURP WX& VF& YtsfGftjEPVy Ht-W~ZKtcu_E18E h4"|XBEP;E8E 0h#|Y^W$Z;u S% X1ۉ؍e[^_]UWVS}u =|.j֐h"nZY~1E E"e[^_]sVWS)E4$E<$UMT$RU{EWVSURP$W$ V$ E@u$ t]e[^_]!e[^_]U|EPuVXY1xE%=@UVS|u=l.u1V[t&VR$P{VP蹽hB-\|PVVZYy VjXG1ۃ=l.uu#jjuuuulƃt*u Ee^_]+e^_]W|$wUWVS4GE̋G EȋGEċ7uu2,=.u2=.Pkd.RPWVcWV4Ɖ׃ - D.uWVcY[uu}.Eu藊t ub EUcuu3uuEUEU9uE.$ uuP&EU ~ÉEf=\.Et& t uEUĆ t t)E]Xȉslz( 艆E }  Eԃ.g} t}uS*(EƉ׃}s}t$ `._E@)1ۉu؉}Z~Nt;} t1҉U诅RPu%à }tA臅E؉U.襅t u`Ɖ1. \.uM9)ډƉ1ۋM} t} u.Ɖ> t t u* uxuuل)ډƉSDL=\.t)} t} u}t裄ƉE„EWu؉}ܹ11Ƀ}t&=L.tM\RPj =$ Mj}!SQ{&uu+z^=D.tMWVuuRPEU$=.t;}t5 u.t t@t!e[^_]g_鵃e[^_]g_UWVQM1yHL¸u 1=`.jjPWVeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|'EEH=.ukd.9EE}11軁 D.uEU)juuRP蹁EURPǃ[^y=.tLۂւ t u, u.<ͅ u@)蔂.訅 u B@u2E؉Uuu+ZYZuu*_XE؋U܉EЉUuuY[1uuЋ}EEÃ.Ex u5#Å^IJ `.MCEă=\.XmRPSO!Eă J…u =`.~1҉.uȉ}E=\.u  t umU4 Ut u uU Uu uE9ƉM_u}EUI}u}uEę)ԃ=\.t t u}tu}EE9ƉMq1҉uȉ}uȉ}̺1EjuRc"uuvt EЋU=D.t.WVuuRPE؋UEЋUԍeY[^_]aUWVu} ut\WV趀ZYu[t t u݉5H,-=L,-΂Hw t5P,-=T,-e^_]UWVSu} ucWVHb xb)ޅ~j2ajjjRPV tEjajjRPM)S=L.Ee[^_]3rWVEZYt1ۉ] E"e[^_]E\j`EUj`EUEU!YY@tE9ƉEU!ЉE9]}O}t-9uE|#jjjuuE.)HPt%x=u\P-Ux=uOP+Hx=uBP=ÍP^wƅPh"jW"5j PWO‹ 9u5!#%#z4.Ze[^_]Ë.;.~~. ,. .‰.US.X.0.H.[]É19F-t @uUP`iYt.t.t܋.t.UWVSd.UjS EjS }tUuu; YXtP5 .} ljE5$.5$. 5 . E .E$.d.XZ1e[^_]UWVSÉ։9d.~ .$.< +t[^_]UWVS׉ˋ5,.V,.Љ[^_]M=.tt*ttt t XÃ=p.u[USjm5.eZY"t:t1ɺNC=Ц.tl#t1ɺ*C]Uht#讽.PYZt .?"h#艽.PƽYZt .#jh=U .jh,U$.d.h.h.ނh.Ԃh.ʂ h.轂1ܦ.ZU1}]á.Ħ.U(.1.1,.9(.~" .,.$.1ɉ ,.@1...Ȧ...|....Ԧ.Ц.̦..Ħ.h.(h.h.h. h.1҉ܦ.UWV=|.uu uƉXZ11D. .u=|.u u$ZYț.@=D.tʺ@b P,-T,-D.ut79MM |-M9 H,-L,-U |̦.@x@̦.c B.9.H1Ҹ WVY^1 tj uVRP;FVƃ1.)9~1Ҹ G19tD=G1Ҹ ..e^_]áD.t.=|.u .DUS(.9,.~$$.<u .Ph.€XZCԡ(.,...]UWVS]u }Eu@0tjxYEe[^_]= .tW~Z= .tw/P'x_uSQ~[ۃ,.~K1S|YuSWV~_ZV$.t2dZYu,.$.DV c_tW,.uVb^ƒt .V$.tcZYt t.t.t.Ӊ؍e[^_]UWVSEUMЃt.} u)}u#=Ԧ.M.}tuEPjEU RPu ugu=.t[̦.tR E@.D.ut;UE }EU @.D..u=.tr1ۉ.1D=.uf=.uJ8u u1ɺZYG9{Ftܦ.1k .ك}u E1O . ,. E1~RjEPy ,.1҅~ $.TRPuu&Ã=p.u}u9EEEE55.+5Ȧ.Ee;5.'EPv_`.9Ȧ.uY=Ħ.u=.uEU .Ħ.1=.~+9=.~.81ɺGh.w|Ym19}E81ɋUG`.9Ȧ.|1}uEPh.|XZ(.9,.~Չ19(.~= .   $.<<@B)5,.Ȧ.Ȧ.9`.}1ɋ(. JKݸe[^_]UWVSƉPã[=p.t<.+Ȧ.;.~u u1ɉZYuFu1e[^_]UWV։PsWV ~ e^_]UWVSƉ19x.~ .t x.)C1[^_]UWVu} =p.uWV1ZY ie^_]á,.l..h.ál.,.h..UU1wR5.zZYUS]1w%SZ1uS5.zZY]UU1uj jL1҉PPYZUSE] xt+uxxt \tf1҃‰PTx6@E&9tu!ـuJAE&u'@S$Yu SZt놸]UVS] uVjSu 93sPuCZYHte[^]UWVS ÉUu} .Eئ.=p.uuSئ.Zt Ԧ.1.ئ.dSPEZYtJHWVM^_ئ.xt Ц.Sh. yWVMZY5ئ.m 1ئ.Sh.xh.kܦ. .Pdyh.xܦ.@}ܦ.2 .`.9Ȧ.}%h.xX..=`.9=Ȧ.| ,.,.؉ESjEP8tU$ t9r)ډh.w5ئ. 1=ئ.[^0.t .u"uu} U,. p,.~@9(.|  .|t $.D0tu u. u#uWV11ҸJt1Jutq .ЉERj]S*sƃ  .E9s=)У,.RjSsNj$.,.?4WtVL).~뫣.m},. .= .u.PapY,. $. M9u3_u(t M:.t E)M Ma_uM .UK_uFM@t>SrZt .E),. .PoSPYtE u1. .t =.uuu} U .+.4G- \.~9|0G-)ș);`.}sd.)WV|(%U ZYu K= .tw.PmYtu} U؍e[^_]= .t+=p.t"SqZtSarWV WVMUmZYe[^_]D UWVS]u }.t4 u ti5.5.1ZYt 1. .t =.uVuR=|.. 5.=.1p.t._@x.1ۉ|.i뷃= .tH=|. x.. (= .t|.unx..ÀuWV1҉ZY%=u+%=tSl|.5p.=t._1%ul x.Ax..9Ph.'l[^5p.=t.th.lWV.. 0x.1ɉ |.uVF-S݀XZ1jjVM u뾍e[^]UE1҅x F-]=.t&.tUSJZ P+JZ HX[]Ã=.y-U=|.u .1|.jh#A5ZYá.xW@d.UWV1ɉ .5.=.,9Ɖ}jh#5.XZe^_]ø. @=.u1.........1҉.....1ɉ .UWVS EE} MEE..t"C 9Ku}9{u E9C֋s..t . 1.ЉpHMH MHxC;4-=.u`.PHE8}.t'Xp9ډ} EӉEEډÈ}tE죴..@B [^_]ÍL$qUWVSQQEU=|.t E]!@u 111]9؋]ع5..tF U9V}}6E9F uE9Fu N^*..1=..~t-uF"Hh$(V(h"( TEj舦C'j9jWjǩEj蝦by u詩Xh#Xu>h!":tu R5_UVXtˋURU趋É<$謋L$QMt5蔻WPURhNY%MQSB} Ww _urVZ5YS\SX jͥuu轥jVj8}t&u'h#'X,j &u& VC.u蜬X1҉Ue[^_]UUWVS]EEEEuu OZYt jh#hr"SmYXujh#,XZFh$&S&h"&A%j 8jUjj S}u}u)NÃtNN@u,E UM;M MM|E UƉ @tt t MÃuV9jj ؖj`Ujs7B.jTe[^_]UWVSu6EU_}u }tcjT/Ɖ[u u11j:/Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k .GPw'k .1.'t'.#tUEEPh"#**YX1ÉUS.w$tX.'^..1... .tPG X1 ..mNt jh4"g.K . ....jh.{/.. .Y[뉉txux ujh9#5)XZ1]UVS .1۰#4t'5t C'Ca1ɉNF FFFtP` Z1FC6ue[^]UE]UVS E%tYu EP.UEY^u uT@2M5.sS CKCtP Z1C.e[^]UEt*xu x u]?@ @.]U Pu]jEP-UEYYut@ . .$.(.E,. .tP, Z1 ..UWVSPEf=.uJ=(.uA=$.u8..1$.(.d.,. .tP _15 .{u#jPs蓾Cs 1ɉKs {SC;.u RWV UP號ZUte[^_]UQMt.9PtjhF#&XZP@ UVS]u .1k9$.u$90.u9,.uPa~#4t P'@5u1҉[^]UU19$.uǀ,.ǀ0.=u]UWVSu薾[1(.t:PPVa uE$.(.J 1҉(.YS; Xue[^_]Ã=.UWVSu h#uz . C Suu0.ue[^_]j }WRP` su sʽXh#V襅ZYtVWsPh_#u,zUWVSEPU8mEP8 UtYÅE8 u@Ej URP!ƃ xuu=.E8 u@Ej URP Ѓ xCU: uBU1҉SK C9~CCtP Y1Cu,CZe[^_]USE] =|.t1E En#tS_,l.XLt1ۉ] E#u=@,-x1ɉM E#^S*ál.ZtP XS茫P軦l.S 5l.K]s@=@,-y1ɉM E#]J#l.EEPh#4#XZ]p.S-x$Ujh@BRP.RPd.USEtzE 8.MU u4@E Qh%RYS- }t jh#}Qh%RC }t jh#kd.S-aS-yd.EEPh#>Ph%#j ]S~rS貀~P|0uD]EPh,#"XZ]áS-x$Ujh@BRP.RPhH.USEtzE 8.MU u4@E Qh,#R<S- }t jhR#}Qh,#R& }t jhj#kH.S-aS-yH.EEPh#>Ph%#j ]SaqS~P|0uD]EPh# XZ]US] }u!jSŽYZt]EPh# XZ]US] }u!jS^YZt]EPh# XZ]UWVSUE t tP(0.^w=|.t1ۉ] E#e[^_]/ P['PR蠗?UZYt]e[^_]3"SƉ׃utS莗5d.WVe[^_]USEU tXtugR%(S-YYR&áS-Zt=S-tP XS|P諢S-YX]] S-EEPh#QXZ]US] }uC=.tS'.Y,@.hC%rrSlrXZE@]%r]UVSE] ,.E(.*,.#tRGYEEPh#XZ]UEtHw1E E#]x.]U}u= .u]g.]Q.]UEu=. M.]UEu*=.~!EEPh# .XZUEu*=.~!EEPh#.XZUEu#=.t=.to5Bu @u]]UUE t#u?S-^u2@t+S-!S-PJFEEPh #@ US E1ɉ . .E 8,t)EPh 4$E P }t jh- #3.E 8,uf@E EPh 4$E P{ }tjhE #XZ7.05.5.hf$j]Sf]܍EPh_ #u]UVSE] J1 RD+~vQQ r/d~Q wG$E&t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPh| #1CSPh.Y.E sEEE sF@tK@sN@ sR@sW@tY @AuU9uE-EUEPh #XZe[^]ø=`.u=. 1=.áh. .+.UWVS }8uMEPh #Y[1bÉUP s$@PƋUXZt=0.t <\u {t C<$ut PW%KZYtFFC؍e[^_]U@uPh #j*h`.PdPRh #j*h`.8d`.UuBPh #h..UU1t 1BS]UU"t B tB]U}ou<¸#u1]1=.U..EEPh #KZYUWVSu ]E0`_18-u@JЀ v#tuKuEPh #&j uP yu˅tӉuEPh #Y[뾅t1҉t؍e[^_]UWVSM.tFPtu)QjP_XD.ZjPEP 15.1ۉ]1U:BE<-t><$<~,Ht<+tO<9 ~1EM؉Uu7u*à U܋M~ZEE܃߃A<vG}-tA9u}t%9~-7"iZ9Eىu1ۉ] 1ۉ]EFt}u Er]$I}t}t E1EEȋu} t tE Ee[^_]Uh#zYtPZ~S-øU =.u[h.\ZtL1.EEEEjEPj誀 M9 .t._k..;EMMEEE=.t=.t=8.uS-=.tuPjEP EufE=.u);>S-9u .&P\Xʃ=.t ƒftըu1ɉ .uu u{ 1҉.=.u&u.@.~Fj.Y<1҉.y!v8mv8#_M9 .tu1 .Ujh.nZUQEPLEUUWVSLv0 uZfÉ4$Pf|$WVuho"WPW؍e[^_]US]S ZuSh#h.m .]ÍL$qUWVSQ Yq AQEU}WRPq1$qˉE؉UM܋EuƉeWuuRPpu؋}׋EUE؉U܋E!E1҉UԋMЋ]M]E1E9M؋Er1EEEUeY[^_]aUuujjdu uUQMAQ jhi@BЙRPq1U EEUiEi@BEjEPR~XZUSS-@.t,S-@.Sh@.5S-| 9t .]UES-]Ã=(.t 1(.s U=S-?.r|S-PS-M1 .E]UVSP.t .E1$.EPSXZt'u> E$.Xu{ VoYCe[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uu}MQuuRP+rK}Њ# u؃}yC-^SuLOXZeY[^_]aTUVS]1)EM}I#uyA-NQu NXZe[^]ÍL$qUWVSQ 1AEI1EEEM؉E܊PЀ wPwW PwO79ʉMЉU}?jjuuuu}W/;jjEԙRPuuW9 ]F8M덃}tE0ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPwW PwO7;UU}AjjuuMSQuVs:jjERPERPV69 E8늃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPwW PwM7;UU}?jjuuM1SQuV9jjERPE1RPV8 E8댃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%(.e[^_]US5à Hw ot tSRX]UWVSu} ,.ouWV"XZE e[^_]$=4.u`~h.WVhS-n.\B1s9. .e[^_]@UEU E 5!#E5!##]UVS]u .uu ]e[^]S-P-ZE #E#؍e[^]KUS]tu uR4=YZtg=. .j ZQuj>X؋]UWVS]uE %=.t >t:S\$PKfPjjjjSPwf$9twV薯 Xnjjb1=.1҃=t. PSW ÃtWU _}t-jh#[^tP6+ ZY>1؍e[^_]US]tP3 ZY1]U1}]UWVS|}ue( u [[E E.x9s^U xu Yw 8u 9Ut 9t'B@9Uuu>}1҉W1ɉNG랋E10E18](11}$1ۉ]]uuPEPjWu" ƒ1ۅtEUE}yȍI|5xj9E E HMM9|_y1UE1ɉ e(s )؉ùE(tE}|9|u1Au߉؍e[^_]Åu1뎋M1yyuu$5!#E<:N<%<.uFu RPY[ +!@ *u5.蜋_vG9^.1u؍U؉ƋU؍C<6$F& l.1Jk`.RY19. .{9)ISQRPTe[u  u11ERP[_19r .+ .ISQRPd1h.N5.5.P5.PDwS x(t u(5.pRY EӃMЉ]1۹}9}RP薿Y_9nRPZXZH'u70EЉUsӋEЋ}!@ȉ9څSQZREЉUXE E)ӃMȉ]1۹}9}RPϾY_9RPuu@'u j ]SRPlWIx u ȁ.wtl.1&t b$EV/";5.KZtP X@=l...e[^_]U5S-US.=.t¡S-u`.PE1҉.]U5S-*UWVSSË@ 1uuC1uEl@tg}tC E;P p$}p tJ;V ~$}@}tՋpt%lj;Pp|;P p$| putC C 1Z[^_]UVSË Bpt9QuAACPrt[^]UVSË Bpt9QuAACPrt[^]USË@tPU Y1CS5Z]UWVSNjXt 39s|=jjj,VC 31CCGtX_CPSk,C e[^_]UWVSÉυu/1ɉH ..13CP褠 1ɉK^։URMZ9Us&RUjEP!P谡 Utܺ1҉S .t .SuWV>ƒx6Ct P 1CZV M@$jCVPx9{1e[^_]UWVSE֋xtBE3ExMAA ;NF |"Gt=NjEFOW9M}ԋE9G(u։NV ΋O W$9M|-G뿋EFOMOMW(]9]]|~E9G(uˉV;NV |9Uu=NV 9Uu9MuuwG\_ t;C$uE;C u K S$=EÉGxG tC X_ h9UuC;G$uM;O uFV G W$WtNZ9^ u;JuurBE(ÉGx GtCX _;C{u 1szp9uHtyt1ۉZY@9Zu9u E[;Zu;Pu E2[1҉PB;XEu [^_] [^_][^_].uU5.Z1=.UWVSE؉U܋uE)ȋ} )ϋ M]܉M]UUX9QDP9u9u>EU܃EU9EE} Uฬ.9}EU܉EUC뫃[^_]UWVSEUM}EȉE΋E?UtW tP9sFu h@ RPMEUu  @P4E4MEU Cuu h@ 7PMEU9r9ut6F5.jjWuE)PV5.5.$'e[^_]1....UVS=.t 5.}uuf.1ۃ=Ћ.uDSgYuu C.H9RPSjY wyr5.e[^]UWVSP,-ET,-E@u }H,-EܡL,-EH,-L,-P,-T,-=Ћ.u e[^_]=.t11.H9~qWEUwZ}u}tQVkUXE9E܋E؋U|59MEU|!Au#uuoWZI `x t e[^_]Pe[^_]UWVS]3t~v V ZY1CCC ....e[^_]Uh.XUS].#t-=.ujh#XZ]1=..E]Uh.'XUVSu] t1ٸ.t;pX[^]UWVSEUE|E x.p$l.h5d.u.tXsmSϐ Zjj1CCCj y]e[^_]鏐 .C..e[^_]U€u1=.1]UWVS4..EU..E܉UtE؋M܋]MjEPjujuuu $..u}u܉}Mut}9Nju|M܉]E܋URP ZY..9E}|!@uc1}9}}Uuu[^tDjjuuƉ׃t$EUEUu}M܋]Eu׋EU..E܋U..,jjuuEU}u}tu܋}뙍e[^_]U jEPXZ}u}t j)jRPuujgUj1.=.u]]USj5L?-#ZYt8jٸ.Xx =.u=.uS1]U=.u ....]xUWVSU EEt :CM@tE3. s+jh #Eu jh#=.=D.=.1ɉ .MMM1ƉӃu]5d.+PXZe n=.=D.jh?#_XE:jx^@=.@1ۉ..1EPM.Zx. D. j1.#X=.t =D.TƉ.u}tp.xu }@u}uQ.HEP5d.X}tW&jjRP艞ƉӃ*W ƉX}CjYj111 ƉXF=G;=.}W؃&MxuƉYjZGMEPjEPjuujjE Mt=.t =D.tZ}~TJEu2EUutjEU9u9t5d.RPy =.t =D.tjFXEe[^_]UhjA .XZ=.t.UhבjA .XZ=.tUE]UhjA .jjm=.tU}tOhj\AYX=|.uבPj?Ahj3Ajj*AhjA 2jjAjjAjj@jj@ jj@XZUWVS.1҉.tijj@/jNjj@jj@jPMM$hבjw@j. tH=.5.y9=.u95.t.@.h耲.t=<.tj"Xe[^_]UWVS E։ϋ.SRU2$EuUR3 u.{tUM tuWV袠C SXZ1e[^_]UWVSSE։jj)uC2$@PCuPs {E C}u1C%u2$@PCuPk؍e[^_]USS-S-t%CBs辄 s趄 S谄 1...]UWVS5S-'Vh*"Po(V Z1ɉ .%1[ÍhV i!tSV!2 uNJ< t< utZ8tPt u9_8bPjP蛾 u1Px^u ȋ8t6t2\uG@x9tzP‰1Ҁx$‰uH11WQщ‹MS-S-PS-.ZY{X=.tS-..1e[^_]UWVS u!b1ۉ.S-S-@-TÅ515.hQ#AP>AZYqI&STYu.Z.lj4$.$L9QZVh`#PС9tV[ Xh*"W <WG f;?S^YS^jjщ‰S-S-PS-. VhP th=.t@-tV?XGP-_t u Ƅ@t V苐[ uP- u@-DH@ZutfTP@tCu* fLHt@u C@tC fLHuDPttDP@yulDP@tG UDH@cBV>Zt1...%S-S-t..1e[^_]USS-hk#S1.ZYuwhq#S.ZY¸t_hx#S.ZY¸tGh~#S-ZY¸t/h#S-ZY¸tjS\EZYxP0FX1]UZu E ‹E2ttHu jh#jh#jh#XZÍL$qUWVSQ .p x tWV虛ƉY[jj1EUXZ.uBEPEPWVNE؉U܃E EtEU}u}ujh#=Y[=|.tuuuu誗=p.tEUju4P4ESj:jEPuuS"4(eEu5} S/} XZEЅu u؋}eY[^_]aUWVS. .]11~1t2S-t AFKމt . .[^_]UWVS. .]11~1trS-t IFK݉t . .[^_]á.á.Ë.tUrIZøUjL"Zujhh"BZYyjPBZYxU.]øURSjEP5.hU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tP.{ Z1CC]UE1҉P]USUBt XZL[]UE]ÍL$qUWVSQʋEqyIZJ ZrʉWVEZYeY[^_]aUWVS]E EC9C|WtjjWVRPCPltjs3ZYtKljE3!z XECHKM e[^_]US1;]}E Pu[CXZ]UEU 1ɉHr2P UWVSS] EEMȋEeƉϋE EtuuWV4M9u"9uu uEZYe[^_]UjuP3jh.{UE=4.t&uf=|X-tE#]8.@]]UVS.1=p.u.1(h\j2XZh\j2Y[h.^tTjj2XZjj2Y[h##:^8.u 1"15|X-=4.t j[P ֋5.T-t,PV!'ZYu8.8@1ۉ8.#Z8,t@8u݋8tH5.R8.PZY4.@8tS Xh*"5.N^Xuc5.h ">Y[#S$$S5.I& BP5W-P%^ZtbShV Nh%P#^Zu @׀8 uS Y #h-#P#ZYt @׀8 uS X'#8t%8,t8 t@Ћ8tH5.R8.PY^4.t S Z@8.P 0y#Pe[^]U.jj/XZUh1jy/x.XZU!.jh`. -Q-y ;-| t-J -Uh-PXZUWVSREƈEj}W5.$ f=X-tk1x.5X-jW5.:jߔ=x.t.V]"Ph7# Ktjh@.5.# 럍e[^_]USQhN#]6jjQ.jjH.| Åt4EPZ9u< hT#6jj.jj-]jj-jj-X-j/SڅtPjRSWh-h#}hY#jh-h#|he#jUSQjh#5.}8 f=\X-t#E tPE Z+u}f= Y-t WVh? #WVh# jh.5.O/h`.jjAe[^_]hV #+,X UWVSEhVh#F 'jh,"5..jj#jj#h.jj(jh.5./eà yh #+X11ft#j2ƉXP Y~G9uAj5.苑j蒈jjD#jj;#V Vhj #" jf=|X-tjă)RPh| #ejh.5.-h`.jjjj" jj"XZe[^_]UWVSE[hVh# 4jh,"5.|-jjl"jjc"h.jj\(jh.5..à yh #+*X11st#j͂ƉXP Y~T9uNj5.&j5.j jj!jj!$VVhj #j+f=|X-tjR)RPh| #jh.5.,h`.jjqjja! jjU!XZe[^_]US,]S5.h+"u`.u M e`.Sj5.h`.jj]US,]S5.~h+"uEu %ESj5.蚨 ]UShSh # S'EW-[tEW-jh$5.=+ UX-tUX-5X-t5X-5X-t5X-f=\X-t_X-t$X-f=X-th+"h#uY%Y-t%Y-,Y-D.5Y-t5Y-jZEY-t$EY-f=LY-th+"h#X]Ujh{t 5.IjBjhzt 5.0US]Q1ujP+XZ]US]CStu RZYt1]UVSEh #PZYtP,^yh#[Ph #hP  ƅulX-u$+$+X.Zx+$l+1ɉ $Ph"SSjZu*ht"_~X/+X#+X1+$h`.)à *XP Y9u tth-h #lXZ댅yh/#}xuPh #uPh #h- Cƃ`._.8 u =`.vH@`.e[^]USErjPh.h # uxh.hhP).yh.h #mZY?hSh # t h..PX5|W-5.S ]UVSjPh.h!#] h.h.PY[vE!#e[^]#Hu ..5.hhP7(Ãy5.h #XZ+5.h(!#hV$h4!#SVe[^]UEjPh .h # uXh .gh*"P uh .h6!# XZ)j5W-P f=X-u.E3UVSjPh.hH!# h.h.PY[vEO!#e[^]".Hu.Rh*"Pbà uVh6!#VXZ@.f=X-tPhg!#Pho!#hVVh!#S e[^]Uh-h"#dijtUWVS}<1ۉ..x.%1u~11Ejh U-hJ&#u uU=.uh-h##hjt&`'FtrE96/ kU DЉEx.뉃a$J&nEtPt=lp7W Yvh%#Z?95lp7jh"V  jh"V  h"V ^Zƅh%#jrlp7h%Sn ZYkh:#SY ZYLh"SD Y[Åh%#뫡lp7.lp7.Em=.t h%#slp7j/RUHYZUt .5Rh"2%h. EPjhjjjj5lp7#x.U P5lp7h%#R D.teh+&#tMl.p.@.=.1vldZRp-E)t8HuR}t hk&#KE h%RU YZUt."l.p.@.h@jh@jh@jh@js 5x.h&#j h.h.u h&#@u h&#jh-dEXZtKth% h:#h" Xt 1N11҃=.1X-LY-=W-1ۉ|X-=D.t ,Y-=l.t5x.' Yu.t h&#j=l.u"5x. Zt5x.h&#joe[^_]U.jh.rU4hej)EXZu2EZt1.=l.u!ujYX=.h.Zu(j {=@.$u:!ZY.jzY.yuhUW$uXZ.Y=.LjPyXY.tP!Y.!URPXZ=@.uM@EPj5. jh t 5.  jjYX1}UWVSS]=8.uh&#|Yu h&#jmh'#_Zt8/t P% XxV-|V- '#ShtV-EP- ƃ 1=.t6..|.l.1p.=x.u'x.%;/u%.jSY_tt.t t u!hF'#Sh'#XZ h%'# _jEV-9u QRP/ V-Euڃ=x.u hx.h.#P 1 @u x.%ht.h$u0 @u t.=p.y15p.=.u\)j:hw'#u$ 1҅‰p..uShz'#"t%=.u.=.u Sh'#jlj:h$%u$ D.=l.u3.tp.tR5.|ZYl.|.j:hִ%u>$ t X-j:h%u$ t X-j:h"u# t LW-j:h#u# t1LW-j:h_$u# t \X-j:h2#u# t lX-j:h%#u# t |X-j:h"ua# t1|X-j:hO%uD# t X-j:h@ %u$# t1X-j:hyG"u# t  Y-j:h$%u" t Y-j:hI#u" t@.j:h#u" t LY-=X.u X.hV-=d.u d.`V-h.t Ph"|^_`.t Ph9"fY[T.t Ph%PXZ\.t Ph7%:_XhP.h0%u- @u15P.hL.hb#u- @u1ۉL.hH.h "u|- @u H. .4.8.4.tj,SZYt@.4.؍e[^_]USPh'#h-Sh'#h- jU=.th.htjc jU D-yh@-Zuj@-P@-=p.҃ !Ujj |.h"jh .Uh`.jjӕ Uh .jj轕 U E E1ɉ |.hj EXZjj EYXuhUW$gXZh .WYtnE sujF YXuj: XZ=|.uXE M9Hh@-ZtU < tU EE9sE @E D-xˡ@-P@-UE Mtt @8u1]UWVSu..FVtI)~@'#t8u\Q ^@P u f^?봈@.[^_]UEP^v.^?<tP@.. ...]UVSEPh (#XZ@T-;t[Ct =.uGW-PPh(#sC <Ƀ*PZVQPh(# 렍e[^]UVS,u]S5.VS%VS_%EԀ€Uԃ=@.t̃Ef=LY-tMẼeewfEf=X-t %‰USj5.e[^]UVSuU ]=p.tSRV y@19t . @\ 8u h$(#E:%e[^]je[^]UVSPW-EÉ.@T-t68u-Fu#EPPhUW$ SV1%tك 8]tjEP5. Íe[^]UVS!S 9X<uY8C L{ t VWZYtAEPuWJ YVC Zu h)# Xc9s ts tC Ke[^_]UVSáT.H!vd3VYYT.T.Swt^'-H-x&-P- T.PT."~;-}h-j XZf{ u<@T.-H-y;-|-P-!h-j!_^X3hUW$Y[{Vht#T.C ^ZtaP;T.s Vh)#Y>Vht#LT.C Y[t'PPT.$hUW$ =T."~1T.h" Ze[^]UWVSQu E]K:EE<\t<^up{tfKG^KCxЉwŠSzЉw>#)#t18uG(NJKyЉvK KNjUBbM8t1ۉZ[^_]UWVSS]h\%S^_ug@W-; CteE0ƅUB@tUQMY9MU~ R+#QRhH %h-Ãf3#h-j XZe[^_]U5PPPh+#h-Kw.t@th.XjuUh,#hK&hqh,# .UWVSSt ÉֺlL&"h,#hJ&hh,#u :u!USP ZYUu=.e[^_]VSh,#<`jsUEuh1#hJ&hh,#U@0h1#1UEuh1#hJ&hh,#@0h2#1UEuh1#hJ&hh,#@0h/2#1UMuh2#h\L&jTh2#11f3A@=uUVSEu ]uh1#hPL&j`uh2#hPL&jah2#ht0ffPh2#fPh2#fe[^]Åt$1ɀ8u"UJRPRP{p 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4L&ZYt4G (uh 3#h%hTW$h-! L&E24ݠL&h"h-C uh-j G_X<sR@8t54V@W $WV4VEP^MU1e#sj@HEP] susuh03#uhF3#uhS3#uh^3#uhi3#|U$19ŤL&t@ uRh3# 4ŠL&hu3#L[^}tEPh3#6ZYh0)uuh3#NX,01e[^_]UWVS]uh1#hL&h{uh4#hL&hh3#311{ uh4#hL&hWVhPs'u s h14#=ts h>4#ZY1=߶xt uh4#\Xʍuu-WVhPsSus hW4#iT노"=thPs hd4#^e[^_]UWVSSljUQ0 ^t#u uSuWÃu V[9 ZHWKu uSVW9uSuVe[^_]Ë -Q-y ;-|< t-J -Uh-PZYU'PPhA#h->j*.W|$wUWSˉ1҉.M]m %h}fU fUm]mURp pSQh]-0hD#h-$e[_]g_UWVS]E }܍p(}p4EPSY^tShD#s>XZe[^_]UWVSPu} FM% FVFt5RPWà tF^1ۃ8t/h]-hD# >[XRPh]-à tŁftvWZYt#/vh]-ZYu}u2}u$h]-hD#=Y[}te=.u\VlU1҉UtRW7ZY@uT8-tRh]-ZY@u"~lth]-hD##=[XuVh]-VZYt؍e[^_]UWVS.dt2h]-/h]-Epd h]-!jjEp` @EuphUW$<_X-xP=.t . .t 5.t2} F=.u:xPh]-nT[^@} 1ۃ=.h]-hE#h-D-HD- yh@-Y@-P@-0 t+@t( D-y h@-θZ@-P@-Ѓ߃Yt`U_(,h]-h{$Z;`+ DždWxPh]-R[^@t1E%=tEjhGPhh]-à uA 5.uh]-hUW$kh]-GPhh]-ÃtNjOGXW\X\t;X\E@hDžl]-X\ptX \TX9и\T<0XPjj`jjPjTjwXPD X1ɉX\vRLP)TPS L9th]-hUW$K9XZDžd:)։1X\=.tX\hoPTPY^EphUW$8XZ=.Džd1X\t~hh .`Oƃ ~KVh .S 9th]-뎉X\=.tX\htP` XX=.u`XM=.t#S`.Y^th]-hE#7XZ`^du S[z.dtSWLZYd=.um} tgG t^.9GuTxPS}Y^th]-hUW$\7XZDžd$E9Gu.#G%PSY^uSZth]-hUW$7[^Džd=.tWh]-9ZYde[^_]UVS]hVsR u sh7E#'Ƅ} t'h]- Zth]-hDE#x6[^.h]-V ZYtVhOE#١.t jsPZYe[^]US]} th]- Zt h]-hDE#sh]-ZYth]-h[E#5ZY.t1E ]]i]US]} th]- Zt h]-hDE#$s$s sh]-yAth]-hfE#w5ZY.t1E ]]]UPPhpE#h-5j!UPPhE#h-jUWVS|Ӊ΃=,/u\L=0/tLR|Y_u%=@u"|hUW$4XZt#h|V%; =vQZVSLY_u%=@t=8/u^VSK_ZuQ%=@u?V9^uK?XPSha)%hS =΃=,/=$/|8/uVPkKZYti|hF#UhSW6:W5t=|Pha)%hW肷VWKt|hF#B3_XVSuKZY=,/S|r^_uS|hF#讱 j/|nZY|tpj/SonY_xt@xxV_Zt=@/|)~=@/ix)؉t=9|u fDž.Nj|ƄPRIZYkx9Íu fDž.׉ދt󤋅tƄxPRI^_|9;x9 ;p=4/h-FShF#h-XD-HD-yFh@-i_H=@/=4/uS|ZY=4/u@-P@-0t- t( D-y h@-Y@-P@-΃߃Yth-h G#=jj h5!# SQj]S6@u hG#jGShG#ݡXZ=5/FډWVRPռG#=/tG#RPQ蟡 e[^_]Ë -Q-y ;-| t-J -Uh-PXZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpP/tvv RhG#谠Ã=d/=/tBjj h5!#v\vXjUR@Uu hG#jRWhK$Zà L /AF`VdEUQRuuƿG#=/tG#RPWQ Ã|/ x/Et*=/tU]Ã=X/u=T/tF%=@u FaÉ؍e[^_]W|$wUWVSEUEPQAEZuEG#EC u=l/tECu}EUE؉U܋=/} /ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut'C  CtNV [[^]UWVS(]j//X=H/uEԃ}Eԋ@ ẼM AqP=/tvv s hG#=d/F`VdẺUЃ=/tBjj h5!# RPj}W@u hG#jWshK$蛝 K /AEUЉMMuuRP {G#=/tG#RPWQNEPvEԋxvs$EPhG#%=/u7s,hH#  wshH# =/twsh:]#ۜ F%= u9N % 1RPs4%1RPs0h H#蕜dVXN\=/t3jj h5!#QRj}W觽@Ws(hK$S "{(G#=/tG#QRWP/=/tF(V,=`/tF@VDF4V8[|/ x/Et"=/tMUF=X/u=T/t@uZF%=uE@ Eԋ@ XZV@@VY_@u ShE# XZV޷\u󥍽hu󥍅\P@, t ShJI# _Xuu@G t!ܬ8t ShXI# Y^||@._Zt ShlI#a Y^u@-_Zt胬8-tuShyI#3  @^tShUW$ ZYD_Xt Dh?I#Ճ=/t%SDhI"E ڋDSƉe[^_]g_UWVSÉ։ύEPZyhI#G a-y hI#jDt)tSuSu XZu2u*Y[etjujS"jujSI#uuܵjSVV"y hI#ie[^_]UWVS ~1ɉ=(a-u,h~P50a-e ~fDžDžVhm50a- y蛪h J#0j諧 7fDžDžVhm50a-蝍 y Rh4J#h~W50a-賳à  &h^J#h~W50a-荳 thI#`fDžDžVhm50a- '(a-tithJ#jXZ fDžVhm50a-賌 y"bShJ#0jq؍e[^_]HyUPj XZËJ UWVSH]0a-tP襳X0a-1= /=/=/=/=/=0e- D9/4a-8u150a-/ 뗋,a- ShL#0j@$a-/x0Ht u hL#jhM#jܛXZe[^]Ã=/<=(a-/UWVe-wh8M#j薛XZ=//u6~OfEEEPhm50a-i y/~uz1=/]xl15/5/~SuOjjj50a-9xFjWVRP")WV50a-x(a-"1ɉ /=(a- hgM#hM#j蓚XZ1e^_]ÃUWVSPE1҉P1;EE (a-/jjj50a-pƉ׃xtEU =/u/] /9É}EjRP50a-+y%hM#0jК(a- )}W =/t1e[^_]ÍL$qUWVQ1y(a-I/u9hM#9jjj50a-ry(h*N#0j (a-)y11҃=,a-~hWN#ZjRP50a-詜h|N#~"019}oMQRPWVϛU UthJ#j茘XZjfEEEPhm50a- yu4VhN#0jC'(a-1eY^_]aUWVS-=e-t-P+5/= /X u1=x0=e-Oh5#WV5"05"0ERPVhN#hW@}5"05"0hN#hV}0WVhN#hV}}}t^=/tU5\05X0hN#hV|Vh/hO#hV|(Vۊ$Vj =e-ubhr$01WVRPFRPVhN#hVA|V50hO#hP$|0h5#"0"0"0"0WVRPRPVhN#hR{5"05"0hN#htW{05"05"0hN#hV{RWV50,a-HPx00h-O#hPa{8}uV50ho"S%Vo$Vj脡 }*e[^_]Ã=0a-y10//UPT0 <0t@=/u7=,0t 050h^O#5050`j=/tGh@/50a-stZYu1H/%=u / /u5/1/X=e-w=`0t a-~ jPIYX50a-ܢ a-Z~jURP  T0 <0t.=/u%50h"1,050i 0a-/ /u 101//=x0t,a-T0 <0t̃=,0t0J1,0=x0tg50hO#芉ZYuQ"0"0 tjhRPjh5"05"0RPhO#50}j50h10ZYUVS Sh0jx y͖hO#0jݓ jSjL y衖hO#0j豓 5/=$a-B 5/6=0u50hO#[X/hDa-SdZYjhZYu+G/tZuQh/hS#jj膍950h0V豁 /t#h0CSVh/hS#jjK1e[^_]HyUPj yXZËJ UWVSEx0xt 23y gy-x0P,xx0@0EjE܉UX=l0tjyh/+a^th/4Ztjh/\ZYHtE=X0uh/3Xt,h/tp^Hth/fY10PvuEjj50蝘E y,50ɎVhZT#0j؋h/g1jh/$\XZy EPh/=/h/hg =//u(~<uh/w~$h/h/2 t EPh/.h/g =0tuh//ZYxċT0t50J~Puuh/6Ph/"8,0^X0h/EYuyVh/X.XZt5=T0t=,0t0a1,0Vh/!.[^EPuh/x0PDVh/-=T0t=,0t01ɉ ,0xMEU19||0019}RP^ZyRPuY[xWt x0P4jh0jN =\0tm]11e[^_]Uhh06?YZumhtT#0j} h0l|Z01UuWZ@t,hT#0j< US]SZ@uShT#0j][UWVS|uu V_Z@uSċt< tNu3褋8xPVZY@tE%=@u1x8؍e[^_]UWVy x0PHxx0P xjƉX)0Pw8URPh/x0P@ uˋEU|00RPAYXh/WZh/g\Yh/iVZjh/XZYuE=//u(8uh/z$h/h/. h-WVh/2-@t1hT#0jA '|0000RPbZYHx0P(jh0j耒PU 1e^_]UWVS4y x0PHxx0P x"ixjqƉX=0t-5e-誖[tahT#0jq =l0tbcyY|1ɉl0PwMpRPh/x0P@ u!pt|00RPBY[th/UZt|0000h/GZZu؃=h0txPh/xY[tX0 L0tkxPh/T[ZuTL0=X0t/t/409EE80|/@09EED0|Wu409EE80h/SYjh/dU[Zt0h/`|0000RP  =//u(5uh/w$h/h/+ 40 00tgxPh/PZYuP=40t4=00t409EE80|+@09EED0|S409EE80T0t10J~PWVh/~/Ph/1,0[X0t@t=0uPY=xe-t10 wlPh/ XZ h/@!Ylu_|0000RPXZy h/^X=T0"=,001,0=0uSlh/ Y[y;50LW|0000RPh/p^pPRhh/x0P@à =0hu Rh/XZ=T0t=,0t0 1,0u!pt|00RP\ZY0 x5e-Xx0P(jh0jYe$P 1e[^_]UWVSx0x x0t!9t30hT#j葀ZPHxx0P x=X0ux0X t ^y^xT0 <0tW50hU#50j,0 2h/UZt.|0000RP$ ^_Ht#t=X0t4h/d_y#x0P(Ɖ$]WVZYyuth/c^^yơT0 <0t"=,0t50h"-1,0ZY+Ãujh0j謋 ؍e[^_]U=X0u y \yx0PHx1]]UWVS Džlh 5 0W = w u}/t 5 0h>U#h4~/t/CFtP5 0YZy" 0<Sh\U#0jK=|%=@t5 0hU#j&~ @YA%ma=l0u )؉h%'2\yDžlh/BSZth/&ZtX0 L0u#h/%h/XZY )P1=///PV 9hsh/hU#j3}tPWZYuL0=X0t:t:40980W@09D0u40980jh/NZYy'jh0j7`% 1ith/,YYSWh/O xݡ40 00u+=T050h/O*,0XZ}tPh/YZu=40t;=00t40980|@09D040980]0=d0t h/ h/Y+0tE t@wpPh/YZ h/Zh/WXjj50襈l y80d~dRhZT#0j{h/Wjh/XYy#lPh/3h/^W Rdlh/\ dy Rh/ Rh/XZlPh/YX=T0~=,0q01ɉ ,0Ze[^_]US"0$0="0u x0@"0"0=~~ h~PhU#ÁthPhU#jyK"0Ta-5/CZx&1"0"0"0"0‰"0"0 >y밉؋]U"0$0=e-u>"0t5=~~ h~Ph(V#thPhVV#jy@5/Zx%"0"0"0"01"0"01 y"0$0Ta-~"0~UWVS0t hV#jf"0="0Ta-u"0 yI"0+"0EU EUTa-EEuuuuS}u})׋E9ƉM}u}WVMZY+u}"0 Ta-19}d"0 "0"0;"0s5"0PY_"0+"0RP_Zxh"0Ɖ5"0Ta-"0 "0"0Ta-"0EU)"0"01ɉ "0 "0ze-hV#jwXZ؍e[^_]Ã=Pa-US=e-uhV#jvXZyx1ۉ"0"015Ta-5"0ZY~%"0"0‰"0"0"01+Pa-~C9}PhW#jTv yu뙋]ÃUWVuM "0)ȣ"0^_]UWVS$]CDž$$ x$|$x $=@0u15xPu >U^_y狳^yVh9K#0jmvPu UZYud%yhBW#0j(vۉ15Ta-5"0u \ƒ "09|Ru -WQQRu<9uUy%7xVhjW#0j@u79|$u9x$t hW#jtZPu SZYywVhW#0jtNjE49}u;0thW#뗋9}3t)1;x$|$}Ru ye[^_]Ã="0t1US5Ta-5"0ZY~'"0"0‰"0"0"0=u.=x0u"01$x1"0"00]ÍL$qUWVSQ Q1ɉMM u15"0="0)9}Ή5"0)ډ tƋ"0]؉}܍MQWSRPpuƉ׋EUEЉUԉËU֍ ƉύEPWV yEU)u}"0"019<"0+"0щ9|gx t%u؉}9}M؉]܋E"0+u}뢸eY[^_]aUWVSU Ӆ~H"0+"0U U  )څ$ 9~؋5"0}5"0)É}봉[^_]UWVS}x$|$hlGdDžp } xAxPu oPY[u]%tdhBW#0jqۉtE1҉P`1h9Ɖl  "0+ "0 } ^ș9hl}hdSpPtPQ5"0u O]hlS} yE] Cpt1;x$|$5"0=00\t`A9\u\"0)hl} xdptZ;x$|$}L pN;x$|$lShX#0ji̋]UVS]EUdh1ɉlE Upt1x}=e-t =e-|PS^ZuZ=e-u#EUdhEl=e-uap#ƄWVZYp` `D$@$WVu:WVoVhZ#V P"oZYVh[#j_ Uzclt lt)w$V#pZYxDžl=(0tVh Z#RjD`뒉l<$8$VO lxDžl0= 0u =$0tCi<$8$Vy =$0t#($tA$u($(($$u ($.($($tbYX$50hO#_TYZjVKYZxPVYZy+ bthA[#0j_WV@1$H%# PVXZ=$0u ($j$0 e- e-t[j $P3VA=e-u =e-t51$PjL$H$X$T$t1e[^_]UWVSu }SE8uEEME;E~])])؋ME8tR<9rt >8u9@}jؙRSu D`u hY[#E18}t}t:00E06SVu譽 9K`u hw[#i00E0ҍCtPR XY P譚 Yuhi[#j%\XZ>CPVЉUPVEU 0j\̍<+E e[^_]UVSu] }u1NjjjVBy _Sh[#jh0Vg ye_Shw[#0jt\e[^]UVS]u x@PiX=\0t*jjL$H$X$T$xe[^]UWVS(]} $(v(11ptWPu $h ~ pt1@9uNjt9|$up9x$th[#jsZ xPu :ZYy#^Sh9K#OT$9X$u;t h[#jjju CAy$]Sh[#0jZp1$1e[^_]US0tP1ۉ00X0um1 D-yh@-X8Yu9@-P@-9d-uu%1S 0 t뭅u tډӡ0A0u0 @0tϋ0zyP1ZO밣0j50h0贎0 &1]U=D00=H0t0=80t 0@=0u'h 0Yuh[#jjXXZ1x\0t9UVSut>uh%\#j 虖 Xuh@\#jXY[FVKZH~ 8/u3E ؉C1C=0u00X01e[^]á0t@=`0t 0=@0u4=p0t+UE$u0tjP50W US=\0t801t6{u+uhg\#j(WXZ3h#h-A [Ƌ]UWVS]=0u =0u$150yx50M0YtHHQf $O&=\0tȋ@PURURpp p0;9xjjuuuu0pph\#j6Vph\#h\#p jW Rph\#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=\0L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPa y$0pvXVh\#0jUƄ  ǃ$h 0pCP螼h 0rP|50hO#J t10@8e[^_]W|$wUWVS<ÉUMMQEP)u}j腵 9ƉЍM}Qh]#Qh"]#j@Sue[^_]g_UWVS\]uCE=T0uPh#V= ue[^_](}W($pT$X$E(j8$Ej<$Uu5!#u5!#PjRj4$Wh.]#Vt=$ w'@$  R%Ph@]#|$x$hK]#V%=uEPhT%V=$Pw ShR]#u ShI"V< Vj 46ZYV'Xe[^_]UWVST]}T$X$uV($oSWVhZ]#aQe[^_]UWVS]u fVfuP0Zt%t0SRjP}WsVWCۉu ]e[^_]e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVS EEU1} t EE1EED}u^9r^MHYW wY0Xu}u}} }u,HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UWVSS}]u 9yK@G?ș9GG1 Ԋ< u G9r11҃G11ҍO9OYЈ\$ w %Y\$v Y\$w\ D$G맊YЈ\$w0GD$9r h11Y[^_]UWVSUED1}uo9ro]H 9޻r0WHM] M] u uu,HM0Hu} u} } }t9sԍr19r)A9r)‰ð0E E [^_]Ã=P0!u%UP0hc]#jMXZ1ø1UWVSSu] E}MM1҉lp7=0u0K 009-u B0 p-=0u" 0Q0u 001Ҁ=0t7tMM}E] ue[^_]=E] ue[^_]骓UWP`ZYtU:u W3h]#(x:u9p-9}lp7@p-W3h]#h-Y7?e[^_]1UE E EE]BW|$wUWVSjEPS8Ɖ׃EU E9Es 11M9ttuj,VuZY…tUj=V_Y_DžUuh ^#Uj ^ ZUuh]#jJS͑ jụ0 ȣ0Bȣ01ȣ0Boe[^_]UWVSQÍEPSN^_u C #ƋE| t@E]Sˈ Zuģ01 KDe[^_]Uh-h"^#薚j'e-t 9tUe-Uh-h^#`h-hV_#Qh-h-`#Bh-h'a#3 j@'UWVSPuhC%SOZYhC%Sİ_ZÊEhViYXu@MVha#0jOJ }t/1e[^_]UWVSlj/E 0_^_0t@E 0he#PY[d0e#00111҉U11Ejh`a-h7b#u uKzX$ P&lp7"05lp7h b#d "0렸1Pa-덡lp78-uxu1/Ej/[D0Q/!b#Bh0380$1e-=e-u'b#>|1 0У0=У0u  0$0e-c`0T5lp7=Y1T0ol0` e-G/*9%8 0lp70#H0EH9~2MxPVe XZMuh]#jFj2$EƋlp70PM/=$10P0<05lp7E/`e#f/e-W/e-H/e-9/e-*/e-/e- e-lp7/01xe-1ɉ 05lp7"DZ4p00p-E GEt0>}150jP$Y[yRFEMhb#S68ZY;GCjP[^u}uhb#P7[Z_uh#S7Y^@-uS(…u_h#S7ZYtV^=ģ0tShb#zFtjP8ZYy*h*"Sk,XZuSBhb#RUC7ZYt8jhb#URm6 UujjRZYMpjP؃jSu1ɉ Pa-}J/t 88hˢ"耲/Zt 8/2" 0!"11jh`d-hc#u u}z$ R&1d-ă뿃lp7"05lp7h b#t0p0xlp7/fl0 T/!b#Eh0@3d0΀`0 lp7lp7h-hc#5d-h_%h-( 5,e-h_%h-v(h-h$C/*9%0P0lp7Éѣ"0"019| 5lp7h6c#%thhMc#jV=XL0lp7Sh"3ZYuPa- S`Pa-Yyhsc#j5lp7Z\@DH0/D0Phc#j<j/1ۉD05lp7Y5lp7*Z<0 80@|40g00U1xe-I0:lp7/+/=$0 - h-j E)Y[{%E1 u1e-0-nEE ue- Ge%1ɉÁ ue- 095 u e-܋E5 _e-.1 t\50hc#h-H% 1 AI!T&Ph[n$š-P- e-uux0,e-v/t1jj} 4 p-p-9Emp-9Ehd#j9ME M 0PZy$jGj} 4g^_'p-p-;E|1ۉPa-e[^_]ạ́0t P̣0Ã=̣0t[Ux00h7d#jN9 tp0hfd#h-#50he#/ZYu1UWVSM11JqX?tCt*tK[t~=p0ttjMYZF}uvQUtPU!uX1C<]t:m~-u Vt]t:E :U|^:EuĿ1}!9*A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puhe#j7D։9r KNKNp19r)XӋE}tE9r NKFC1e[^_]UWVS 50he#6[_Vh&f#6hVf#|6hxf#r6h W6h"W,ZYuhf#W*[= u hf#&6Y덊uhf#6ZX<.uuhf#5X1t3L@LuL@L%H9s tFCC@9u&>t!tWDh>g#j3|tHL@t<uDhag#h- WDhwg#h-t@th WD|0 1e[^_]UWVS]t K΄u hg#4<\u FFu8ujKq Xuhg#j2^_DžoGjQP t2hVP荋SVhg#jd2 WYy [띍V֊t\uF8t)FW'y Shh#j2YRrZu%Wx hg#j1$N1GtYuh7h#jo XuhLh#j0[^C31CV$ZC 1ɉKECE C=0u0ܣ0Xܣ01e[^]US01t6Cu+uhyh#j0XZ3h#h- [Ƌ]UWVSu0t$tS=`0u S1u=p0uSu$t9ut0}FP^Yuhh#j/C_Zt/1srCt/1ɉK;W#ZC Hǀ?/uC C$c‹@t 9uBSSyv 1ɉ$[:hh#ja/XZe[^_]UVSu1ɉ$0u,=`0u1=t0{C |/t[t0CuPFP33$ KVPZuɡt0u '$tVZYx 1$e[^]UWVS]=xe-tjs{.u{.u Ct:u hj#j/V[[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVhj#j& TE@j$e Xuh k#j&Y[0t;u GM1GtAt0yVhSk#&O}thE8t`W yuhok#j%Wl bGƒWt+G 9OG}Vuhk#j%Wl 1G=0u=00x=01 hk#e[^_]UWVSM=0tPÉֹ=1:t9pt@9u9U}tjc ZUuhk#j$[^1p1ɉH xe[^_]Ã=0u1Ujh ]g 0YZt1hl#j$XZ1UWVS}0$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujsb YtGGPUZt0 $$$CSEC ECECEC1vSj Yh/l#j#XZ\Uh 3 Pы 1$$CHCUwC3Lj SFj [^e[^_]UWVSM04$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3i X]e[^_]i e[^_]UWVSS=0t51ۋ4t#1ɉ v0EZi EPQi XZuC u͍e[^_]Ã=0UWVjhGd 0_ZuhMl#j"Y^Cxl#=050We-Z@u"50%Vhl#0j"50VX1e^_]1Ã=0u1Ujh'd 0YZt1hl#jp!XZ1Ã=0u1Ujh=c 0YZt1hl#j3!XZ1UE$$ $]UWVS(}=0$ $$$EUE 1҉EU苟,$0$E1҉!މu؉!ȉE9u9tE1!É]!ȉEܾ 1EE11ɋEUÅt#@ u9pu u90g@E]!؉E̋EU!ЉEЋEU3E3UЉ Ӊ] O $$$Å}uIE EtAjX^ X11q $$$AQ C AK 1St$0000 u+00M!u!9u^9uZtL050 t:Uj] Zt+UM܉HUPp K HC $$$3GPhm#jhIm#j$P @ $$$E؉,$Eԉ0$1e[^_]Ã=0u1Ujh=Ca 0YZt1hm#jXZ1Ã=0tDUVS100tjjs sss3觵[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ 0=1Et#؋M9Hu9p u M9Hu9xt@$uj(!\ X҉UtMuUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!RTd XE m#Ee[^_];e[^_]UWVSEEE EM}0tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3c Sc XZ1e[^_]1UWVS]}E= 0t";/tPS^ZuShm#j$Z YuShn#j. hS芩ZuShn#j ue[^_]b GFG4W8F VG(W,FVGlFF 0F50e[^_]US0tvC0=$0u{ t s3hXZe- e-tjjssss 3輲=|e-t s3YX3Cb S=b 0XZ놋]UWVSSUE @~ T@119}At41ɉMU1ɉrE1uZ[^_]UWVS u=0FhGSPl <9tjww 5e-;Wu;G t .h1n#*SR5e-+{ 9؍thIn#0j SR; yT$X$G9__W1j=X Xjjj5e-G WxNS5e-z 9u)T$X$GW0W83han# 'hn#0j7 W3` Xhn#j#ZYe[^_]UWVSQ0uhn#jXZohu u Eޅt6uY_tcvj $W ^t;uƉYt#uGZt _E81QVs_ XWl_ _h o#ja[^0^SuHZYtS@_ u补F_Zuhn#e[^_]UWVSu} 0t=h7V t&3V ZYuusV% [֍e[^_]UWVS EЉ1lj t׉ EE1EEL} t} t} uA HA@ AA4AA (HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=P-ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh1o#h SSyEVh9o#h SSy=VhDo#h SfSyVhRo#h SFSce[^_]USSˋ t%RQP}E3Q\ 1U1ɉ EeveRu Pv} ]URPh]o#jUjhoø1҃=Ĥ0t1UME1҉Ĥ01Ҁ<u=Bu} u,J=0tĤ01҃8]UVS]} ~;uqjhe#P  u%=e-u e-ho#j0ZY1e-jjPƺ 9؍e[^]UVSiÅ3ho#V ZY[uh1b#S ZYt)SVho#jh1b#ho#ho#j e-vSVh$p#jtԤ0o1e[^]UWVS]u hVZYy\- 1{ǃ4$K<vCVh00 x Rh00 U jjFdPG%($jjFlP/8$jjFtP<$$jj F|PEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1$$$$ 2t|,1ǃ$ǃ4$($Qw\1ҀKƒ $x$|$ށ$1$$$ǃ$($w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%$1$$$1|/uDe[^_]UWVS]$Hwv$PT&=Ԥ0t_hJp#j hsp#hp#hp#Ń d~ Php#뮋p3Sc~Rhp#땹1jdRPQx1ɉ$$$ u#EƄ5/jj o11_Z1u9E2jd PEPwjj o11wE1Ex$|$ƅz ynH0P t9uon19r)J9r)lj°0󪋅 thq#$%$1$P0 L0t5t0=x0 T$X$($1jjWZY8$1jj_sZY<$1jjgRZYjj {5^_un1jjMZYuJhP٠^_y>jhZYx鋓$  Ѓh-q#e[^_]11UWVS}} ?jhe#Vr ÅulhRq#VY^¡0 Ф0 uФ0hZq#j XZjjPƺ 9tPVhq#j ؍e[^_]UWVSu] hS2ZYy- 1~dž4$1E쀻Yt"h YPWtz/@E K<vM E)Sh00} Rh00 } jjCdPo%($jj C|PлEUUEщx$|$@uAjj P T$X$H$L$`$d$ƃH<$P)PyjjCtP͹<$ ƃ(8$P PZYyjjClP藹8$ 1$$$$@$D$<6tL<5t_<2Pπ2s#hP莕ZYy|jj ԕ[_x̤0u$  ЃH5Ȥ0PC¡Ȥ01ۉ̤0Ȥ0_Yx)ЙRPnZYy넸e[^_]UWVS$ƍ@- 1U ډe[^]wUWVSu>-u~t2h*"V_Xu$0O PVh[s#j[@-1EPSQZYt/G}vEVWhns#jEUt@-u1 SXe[^_]áܤ0t UU RuPN5ܤ0UVS]u F5ؤ0tRPS tD3j SpZYu1e[^]US]}t 0<0 T0t=,0th-j 1,0ZY50h "h-FSu h-Mh-j  ]USjhh" Y[xEhr"Pܤ0YZt&h*"Sؤ0YZt135ܤ0~ZS X=l0thh"hs#j ]UVS] u}t 0<0 T0t=,0th-j 1ɉ ,0XZ50h "h-HVuh-L~S s> S > 0H0 u0te[^]UVSu0@0 0؃8t VPjZY0u 0u0t e[^]e[^]UVS 01؋tJ9tFjPZY0uԉe[^]UWVS0@0ƍP辮Y11ɋ 0tx?tBA'u9t ht# 0u0th3 jVSE19}Vpht#pg-HQP yPHg-H Z J GS谮Xe[^_]UMtA'1 0]UWVSu^Nj7t#vu Y[Åu jWXZ ׻؍e[^_]UShZ"ZtaujY1"40tP{ Ã0X؋]UWVSP}U UWRW"ơ0@0$蚬WάC1҉S UR转C0H0u0t e[^_]Ge[^_]UVSuV[t#sVZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY108u&S;u0ht#5g-XZ0P0uj=CP賿Y_uyjS5_ZDžuSht#5g-m Sht#twng-xWP yPg-H YlJ ]@PS3XZKe[^_]UWVS5̥0P-DCtWjEPVĥ0ȥ0] Ba&:MAEIBa&uV)PRht#Ba&tK00CBa&u)BUP謪ĥ0NjUĥ0Xu,Ƹ^ À~|tH;= ÊV~-t >θ(%)%#Ƹ Ƹ^̥0e[^_]U5ԥ0PhRu#UWVSQ5000PÉ50^=Fg-t ru#uKt;u%1҉jEPSƉ 8uE8t+m8tu#`Ba& tBUUue[^_]W|$wUWVSE܉UM7E܍Hw$U&u# u u#!AuEU Ѹu#t݃} uWVuu WVuu~&MΉEEUM EUEU)?EU t1?EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉM][EU11 EU11 ۉ]1E.E!EE!EEU11 EU EUEUe[^_]g_UWVS }Ӌ7VT_=Х0%us Љ UUEU=Х0&t u#wEĥ0ȥ0S1 VVڋExYtEUe[^_]UWVS(Ɖӡĥ0ȥ0EЉUtSUЉt@ vSUиƉX^MƉׅuGMIt!ElM̍YWVщ‰Y[ƉWVh5"j]SjSu e[^_]US7=Х0)u _[]W|$wUWVS4ƉӉMЋ?E1Eă0HIĥ0ȥ0SuЉE뭃$9 "tFكPE4EȉU̸u#=Х0#4EEЍpًt(SEȉŨwhfХ0SEȉUYEȉŨw><Х0ƒ}'u1EURPh5"juVjV3EУХ0ĥ0ȥ0S]U]ĥ0ȥ0SWڋEXY E1ۉ]ĥ0ȥ0SWڋE ЉE҉UXs}t u#VХ0ĥ0˃'u1ӉMȉ]SQh5"j]SjS5ĥ0  v#똋M̋EȋEċ}eʍe[^_]g_W|$wUWVSEUϋE܋sáĥ0ȥ0EUVU)Х0Kvu^*U&8U&|u0VQ{Х0YYuRPUMY_KwU&9M~ ߉EUce[^_]g_UWVS}USƉ׋ Х0AZwSjƉXZ=Х0uJEĥ0ȥ0MQ1  SUEY 1ۅÉ!1e[^_]UWVS}USNƉX=Х0uJ=Eĥ0ȥ0MQ  SUE X1 1e[^_]ÍL$qUWVSQ q}W50XjLPѳZYt5xIu,xNu&1҉Uj P谳ZYUtB@)։50@뽉ԥ0̥0m1=Х0t v#EЉUWEЋUԍeY[^_]aUWVSRE} 5!#_f-f-00HO;t(0sx&P ωʋ70tx BMסP M҅xJ 軡H+ f-QОX50SƉRPhLW$k1 e[^_]Ëإ0Ѕt /tt@1ɉ إ0HUS]u1Z;/uPhH%_ZY@tEPS^ZY@tҋU9u;Eu3E3U ]UWVS}VVPݛ tS覝0Y]e[^_]kSeZ8"u뺅u03 Ph6v# e[^_]UVSu=0uE=e-t.1҉e-hMv#VPYZtS0Xue[^]3e[^]UVSu4t =0ܥ0tP^+ Y0@00ܥ010jR0H0Zu0tG =0t,j5ܥ0hJv#Lj50hMv#:jhMv#[^1V@$]إ0VP3f-f-0 >/t[50>t'0H0FxFCXVԀ~/u#0Kh"VOZYu$f-9r :ƅuh0K;/u>thH%VZYt 0x/4tX/ gXV>t0H0FxފFC9f-u 0x/C 'X/=0u00@0ܥ0tPx) X0ܥ05f-Ӛ0j5ܥ0hJv# j50hMv# 0H0u 0u@e[^]UWVS} ]0@0uYQYy 0u0tuj;ơ0H0Zu0tut hQv# Y4u1-=f-u =Vg-t50h#XZuÍe[^_]UWVSf-hƅdh{v#cYt ^t>h#WZYEth"WZYEuEE1}}FHπ\ut}tnxP0tB<wV$U&NE1>: 6 2 . * &щǍ@0w\9Eu}g-HyPg-H X JF>/g-HyPg-H X J }u-g-HyPPg-H [ J 5g-g-fBYtfBhAw#j(1e[^_]UWVS]u }g-tg-9tx u hg-X00uhPh "hg- 0t0Ph "hg- t&WVhg- x0h{%hg-ZYxS7) PhUW$hg-g-HyP#g-H X J Eg-e[^_]e[^_]U0usU0jPxUU 100@0tuRj u0t 0U10EEEEjEPj =x0t=f-tjQjjj U=H0u H0E Puj:UEPu u(UEH0jUS]Su 0uUuu 0uUEPu juUuu j}uUS] Su0^ ]Uju u0A UE Puj+ Uu uj UM`V&ft9uPU t@QhB%j h00á 0UWVSPGYuOƋjjPǃ t 3F;ZC jjPǃ t s{Xe[^_]USh5!#ĨY08tNf-g-M0thB sXZ0XjjSP50#j1]W|$wUWVS ƉӃ=40uj'4ik<40X 401ƉU1}m %M1EmPP$hx#jSs;6u{0ujh2$S>F SZÀ{0u K{.te[^_]g_1,00(0$0US]tvUUt[F~#CtVj RPWjEpS:~5j Rs cWE@C us XCX C @C[놋]Ã=80USQjj]Sjjh$f-@! @tBEP80Zt,jjSPjh$f-! @t80PATH@=580J 80f-X80]á80US ]t6;u1Ct*p~Zt0PjEPCp1(]UWVS }W1t@0B0PWDrE_XZsnEX;t.Ey"xVYQ0# Phx#1Psus ua 0u0t[~5jVJXZ}xuju0 jssYX}yjs_XZxVW^uuKYu u|Z upX10 0u0te[^_]UWVS}u g-tu u101E܍]SÌXZ$PW&uwYX=g-m=,0%jw~XZ=g-K0 ,04jwNYX=g-=,0=0=@0t>VW VW=S- =@0tVW=@0tjwXZ=g-=,0u=0uSŋZU ?1=0)=@0tuW =@0tfuWSi =@0tAuWfك=@0t(www+1ɉ 0jwXZ1=00jwY_=0tr0f=@0tW,S踊XZTjVW S蛊6Rhx#)hg-ES{SpY Sgf1S轊XD0t}=f-t0t tPtj=e[^_]UWVSE ǃE܍uV50ju^1jY=g-tKt>=g-u5tUXUt E܃PuRcXZ=,0u V苉X^VZu10tje[^_]UWVSWE} _f-f-00HO;t(0sx&迊P ωʋ70tx BM蓊P M҅xJ wH+ f-Q茇^ 0PS}ZY100e[^_]UVS](01js&XZ=g-=,0tT,0u00H00x1,0뼃u 00Q00 1ɉ ,0MwE50=0; ut-t)E Ps50XZ=,0Ro (050e[^]UWVSu=0=g-u1EPIE؉E܋^Yt$hPSO =,0b[E؋E1҉(0]؅6F0=g-P̲0P莦PCh"9v 1g-xWPyPg-H =_ J=sg-xWPYyPg-H X J 5g-?_jsv E Pv =0=g-uJ,0t:u00H00-1ɉ ,0Hu 00H001҉,0 (0=0EPPXe[^_]UWVS]uV薅E؉E܋S 0jPsiM[=,0{tuG0EpWRZYtV1=,0uZ=g-uQSC ; t0u P 0[_.[0u P0ZYu뇋[g10VlXe[^_]UWVS]} 31EsZ=g-{50̲0P*Phx#Stj RU5g-UR hx#Xu hx#Xg-HyPVg-H X J 5g-X0@0ujSguSPEq}trt8u4guu 0u0t3js"Wsj0H0u~0tunUu;Rf1ɉ 00H0[0e[^_]Rr00H0Zu0t tJ=g-tA{t;50̲0PjPhy#g-Ee[^_]e[^_]USD0EE1EEpX=g-tlExtc50̲0PZYEP$x#[EXtj S5g-X [hy#g[5g-XjEP耯ZYtlE00jXEuKt&:EP$y#X5g-XԋEt0j50^0@0Eģ0j EpXZ1ɉM 0t5u Ep-Y[0@0E0j!X 0t0t뻡0tEt"EPK$#y#?X5g-Z]UWVS}] 1CCC =g-EP聀0@0E^y h+y#xjWfdjWPyu31ɉ 00tu&jujWu E؉s 0H0Zu0tEPwXe[^_]UWVSE ,1@0X0(|0$1`0EP{X1 0E@0ptEXt8sl_u&C0hpPSG [u[ċt1ۉEp :^x|EXtC0sYu|1҉4pjxPSF [븅t4B4닅4P}_0pt0J0H 䋅010T=f-t"=$0u4~0@T40)Љ0=g-u 4fEE 50̲0P}ZYP0[xuvp1s%Zg-Hy`PXg-H =~=WXtNg-Hy8P_g-H {j=WY^ƅu뽋J=뫋J Ӌp t:g-HyP5Xg-H J s^X뽋EX g-tRSP t [HyPXg-H J 5g-h_gxsjhW&V u Xԁ} ``041 Huw)4)400tX4t-X`0QRUR0af}Zf}tJXZ:-{z-uzu apu CSu>E- `tfE=@0u Ext,AEftfwE= t= tˋE@fat50@0ju^[^nf-9tߋM/t/CUuS61ɉ D0U^_}9uBD0<:ttB1::uBMutZD+f-Ee[^_]k1e[^_]UWVS|uj/SY_tAuu VS\ xP6f,_Z@ j6EPǃ tjMy\=D0uSuu VWu>葶8t4臶8t*}8 uxPW+ZY@t ZWkX뀃 h u tCƒv~ H0PSP6ho"jUWVSuU F^fftfftdN0$U jS$PJPj IU yхtvhy#XZWPXtkhy#<XtZhy#+_MtIhy#ShUW$0@0v~P$Pb0H0tShUW$NY[?0thy#,Phy# PShy#M~ t-g-HyP^g-H *Z J*g-HyP1g-H X J e[^_]UVSuf&t"8u%uCVP!ZYt؍e[^]UVSu`f&t8uVPZYuCݍe[^]US,f-1ҋ`0tHft fux@ |u[]UWVS}0@0`0t,Pfu9x fu9=,f-| P[ X҉΍^ئ0t 0u0t e[^_]Se[^_]UWVSSu0X'1E8Et$}u <:uWE}:u uW@u6u#<%uUFPhz#uZYUt>:uGFC딃=,f-y t ,f-u1҉MRM ,f-Xe[^_]UWVS0@0`0t!f{usS) XZٍ݉wئ0t 0u0t e[^_] e[^_]UWVSutA%<`0`0tCVP裣ZYtdߋ} tX0@0V耡$eÉ1fCC VCPٍ0H0 u0th=@0؍e[^_]US`f&tjP)f@SPXZߋ]U0@0@0 P 0H0Zu0tUWVS] j/uy^_t[EtFxPu%ZYy [8tQ8tGffCf1CƋM09tMEthz#Q vY_tM ju_Zt>HftftfuEEu E u=,f-yƀx u91ETtE,f-tuDYDžDž\DžXDž`juEP` WdD0Z?/xPWs$YZ2E%==D0NEWٞLȉ`+f-$]cWabjuƃfx`QWTfXZF FfF CfF fCFC,f-f~tF\`9\HPhz#pZYtuYDž 5D0hz#epYZ`9\~8賭8k襭8]藭XKWuhz#50@0dTujuY_f~udfF`FDžX t@Et$jXPuh%5g-Tf`0@0dTujuXZf~udfF~ 0.0!1 e[^_]UWVS$EE111E11EEh1z#yEZtPEbw$W&1EE1ɉMſE뵾뮻E랃}uutjLY1҃}u/}u)}u#uEEE081`0tROft!ftfIu:}fu.} }tуtEЉUSW>XZEЋUԋ?몃|u5g-^g-@h;z#[EjWZYt[@ft:,fuu>0P08ufHu*}"fu}}t˃=,f-x t0PuЍEPW}t f}uA-tf}tjW~Y_t jPFXZvd]uEԉERuIEe[^_]UVSu 0@0ju!Ë@ZYft&fHu sgXfCFC fFC FC 0u0t e[^]e[^]US ]0@0fEEEf-fEu ?EEPSL0H0 u0t ]~]UjuTZYtfxup)X1UWVS 1ɉM11uhz#@vZt(ptvtVuEEлɋE 8ctu ދM Mt4Phz#Ht}t5hz#40:t/1E 0:5!#0:gz#RPhz#m[&jjV XZu}jV)XZGfEGEEfGfj/V5pZYEEԡ0}tEjVEPGEP\My`uh#XZ0P00Ihz#.j wo hz#wh#0 8g-HPg-H 0P00YV_8uVPZYmIwh {#owh#J 0P000PjEPV1MfHf5!#tuz#Ph{#iY^jV貏_Zuu h=J$FYV`軥0 Ph" 0P00 u%h{#uh.{# uhC{#fVh#0P00_Xt!0P00E.h`{#YEE~uhz#넋Ee[^_]UWVSEPyZ0+f-PYf-XY}GE܊_tkta}t\} C<v2u+:t$ t/t6EP=Vg-t"E u 0xB [P}눃=0u[0f-8uu@h"XtVAZ^E %E1b P YuVZZPd X VZXu‹E|}u5F< v@ 00y8[P0Csu2c& <w 00yZP0fZYMQh%&fZYU9uMjDRXM QA[MtbuEFEE9sM8t8}t!߀u8CuEԉEtCW tC̃W8uΉ֋EԀxAȋE1҉U]}t usu]uM΍HMЊ1uEΉEAx<EЍp[<:Mhm{#V6_ZYEąM9EЀxupx9uBa&EEE9s2>uF9utsEBa&tdU9UvsԋUE͈@ĉƃEM9MUP` YPEP{ EXZt\uuЀ>-utF<]tm/uu}NtFuc=ܦ0Uqxvtu@r t@١ܦ0;}u5ܦ0S[rxRP ZYyZ9tt1t9s'@ZxvttE]S@ϡܦ0;EtP9Uu8/t}G H%C%PDXE9ܦ0t@/Džp>t F1ptJxw@tu@o0tSYpu{F/uSZt߀x .u o.uǍx jWt tptWuq5ܦ0 덋EG@WPu@/VP_Xle[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu0skY@uP0DVƴY0u+f-,+f-EEt;t}1ɻN)ЉE=Fg-8<@.<*&}tE<VE)HPhp{#(1ۅI~@0H0Cx0P0S։MAP0SM뻍G1҅~օ)xu u܋E%PV1ɀ} k0+f-ыE))00 0@} uSyZ}EtsŠc& <w2 0x0H 0U@H 0U 0x0H 0U@H 0UԈC뇻11EԀƒ v! 0xM0H 0CuJ 0x0H 0ĈU7@H 0U뫈U@H 0U뫻1111ɋE%Et>@u=0uM @1 1E @€}E$PX&U50Q80^_Uzu LuЉU E PuY[ExU^1 00yB?P050+5f-uuuuVuu%0+f-ʉ0)@0uZ0uuuVuiƒeuXE)0 Rh{#誩}O#uOQVHPRh{##u EEEPVE)HPRh{#g"Yu9u1ۅu"uԡ0+f-Pu 1Ҁ}t`]uu E]Etq|wt 0 0׃usuKt@뿃uHuEe[^_]UWVS]E %E1ɉME tEg-@0u D0E0+f-E;~uE t u SXZE 1Es}B~< O$X&:=J{s{u{y{@u{=uz10E} t 00ys<P0e s 00yI<P00 00y#<P0 t=0t"0+f-M9~xuH0 uE uE 11 00y;P0҃}u C< w 00y;P0S 0x0H 0U^;H 0U߈ ts0E#E PVu R0pl00VrXU 0x0H 0U:H 0U߈E {~=u}1Eu V[X u0 0x0H 0U`:H 0U߈EE Ru%KZY0+f-jPHP wމe[^_]UWVSEu ]=&g-t1҉0P 0f-0f-01ɉ 0 0P0Sp_Xu&0=0u900 00yg9P00+f-Pq600XtAh0W&01҉00Y_ÀtS50+50_Wj6x00Y[k01҉0tNFe[^_]Ujju5f-@E5UWVS$EPEߋ50+5f-hREС0H0ZYx0>8P0=f-VWW]S60+f-P+550WݔEԉUS6f-0)Љ000 70uuh5"j50蝜0׉Gu}"tj)PV} 0)O0)=0EЍe[^_]UWVS]u =01}DPSXZ0=0u700=0}=f-}t }tAQ;tWh#hg-褛jY&Et{#PV)KSh{#֡jWV肥+0=0)0e[^_]UWVS]u=0CvJQE%PuXZ0=0u5600=0 f-}M  t?9s@UVWQM MUt <CÍY9s1:UVWQM{ MUS9st{u8u@@9r9sS륍Y9rVSQM, SMt9s{u8u@@9r9sS뺉A9SVSQM u;Mt;uCCӈ)ȉ+00)0I9tKCCG+000x C04P0 00e[^_]UVSu]Sc2F 0f-0f-010jv0H0 x04P00+f-P1ju PES2Ee[^]UWVSuFPh#蝘g-xWP[_yPg-H Y J19}E 4kZCWhG#?g-xWP_YyP莖g-H [BJE 4xg-xWPYyPFg-H XC9| J1e[^_]Uh |#Uh |#םUUM 0f-t 9PuH]Ë 01-0f-B t xt 1z10 x0UWVS}u ]0@00f-z tj.0f-J B ZB$B x0P0P|0P XtK =x050 0u0t e[^_]re[^_]UWVSQ50f-^ 0@0{t-WRU jZtUD< t< u g-Hg Cx0C0C |0F $9tSƼ X 0u0t e[^_]ӛe[^_]UVS0f-H 0tBu y8 0xxhg-Ǔhg-轓XZ0f-=|0Xx0hS0f-po qu0|0jx8tġ0f-xux8#ujjj xtPjj΂ xh-|#茔Xu|00f-1p 0f-Px0x01ۉXъt< Y|0t,1ɉ |0 0hJ|#Ϛ)щ 0H|0! H|0)H03=g-t5x0ד5g-[XZx0Px0~e[^] 0xx0Px0U=~u! 0xx0Px0]]U0f-0P |0Px0P4f-Pj8r+0f-@1҉P P$P0f-YUVSu] 0@0hc[ VwjjV tt0f-@~PwY0f-s{uh*CZ10|04f- 0u0t e[^]魘e[^]UWVSĀu0@0jVY[y Vhd|#ÍxPSQ_ZuE%=upjjjSWY u]jtWSa u"jhr|#W uS_Vhw|#jjjS Y tS>Vh|#MSu^9uS"h|#2u Px0H0ZYu0t蟗e[^_]UVSu]0@0} t5x0V;eZ0|04f- 0u0t e[^]=e[^]US0f-0@0CxPuXCtP۷ Y{ t0f-S 0f-P 0P|0Px0@4f-0H0Zu0t ]顖]á0f-US]0f-9t =@0tD@0t h|#і]Á=0f-@0uU=0f-@0u]U}u"0f-@~Pt0f-1҉PYUE9f-uE f-]UWVSU0)i5rO9f-t50u1#f-(9tC߉9} }t}tVǁ[f-t?iӀu.tiրuf-f-XZ[^_]UVSu950=x02f-tPmsYjhh">|f-[Z1@tI5f-rf-hb Ps5f-A0y;"Sf-Z@uCt SMYth|#!g-X4;0t jj[Xjj?jj6jj-~¡|09t PjGZY@uq0x hd5|05f-Y[@q0K hPh/}##d~¡09t&Pj[Z@uHq0 hPh }#505f-謅ZY@uq0 h5f-qf-jjGjj>jj550e[^]UWVS]u+0i5rOCShW}#0@019~Qi@tǃu=uFjRZY@u?ptP Ph~}#9+0i5rOCSh}#輒HJ΃utBƃs 0u0t e[^_]e[^_]US]0@09t P課 Z1ƃ1҉ 0u0t ]霑]UWVSTÉ։Mt&uPh"Sv =E,EtM}~EtEtCzMB9tMtEttt t tM IuɋE0u#E@VYEEHEvE9u]=0)i5rO f-+9t# ti1;J-R@Ph}#jEP舊h%"jEPs UR]ZEUt%‹E0h}#jRUDUR]ǃE@T=uh}#R*JYXu*tQh}#jRfhz%jRTu =t̉UQ) j URP/E@Ut$R9]Ǹ@)$D=Ph}#`/ U:P]lj$URXZKyS赇P Y P G~SEPHXZEu EL}tzKySgP _ P KySEP|Y@P|4M}tWh#S藈 iEM0EKySP Z P EEE}S{X>e[^_]UVSMt.t 119}9ivtC䋉11tJiD} u&ƒuu=tă[^]UWVS utF>%~W..[tW-XY~#*Ft~uH<-tB<%t<+u:f-}#f-i0}#00E1MxdtS~JH~?u(UFPQMv0YZMUt UQW,YZUu뗅uV7-ZtjV,00XJxRt~i90tM΅x290~*i0t"~# }#~#1ۃ} uVPL؍e[^_]UVSh5!#6X=0tYh$~#rg-HP5g-H Y肈Sn0Z8P0xj00Y^u h4~#請=P+0i5rO@PhV~#8 9DiPh# FXZՋJ ;1e[^]UWVSQ111Uh^~#5ZUt$jtptguܿպλǍH~hb~# 0tyt h~#辊UjPYXUt 1t+0i5rO@Ph~#t$Ph"'XZ1tiHi0i0h&#g-BHBCY_y3R4X9H g-z99y9H y:؉؍e[^_]Ã=0u!UjuZYu11á0u!0 0Jxu 1øUE=f-t@=x0t7uR+0i5rO@Ph~#5g-趂UWVS=0t.500NxtS{X1000J0B0uh=ViP*Ë00i߉_19~i9uFP讨 ^00iƄDŽIu0 0u$0t膇t 0@0=Ng-1ɉfǃ0)؃} ~iE PZ 0u0t؍e[^_]UWVSu]=x0tSSzYXuM1x00@0jcjjz10XZ}u*=f-}u=f-)=g-t u 0Vjg_X}u-V5f-MxZY@uc0脮 hPh/}#\SjrSjr{}t0}u`SjzSjzu }um߃u2`u)jmjh%l th%hd|#Ѕt$=f-tSj\rSjTrSjLr_e[^_]US]U M=g-u1t uEM E[]xmUWVS}tE1ۉEPu EPǃ u^b8D0t0@00E1i0M9i MEEM99u]Pu Uu6$уu>t6Uu@ƃP}uuPtуut 1ɉM1҉UY}t-}u tƃ<tƃ1҉[tgu tUP=x0t =f-u;u uEɃ@ ;u uEuEug-P 0u0tȂe[^_]UWVSjjjà ~ jjj=g-tQCtN5f-&uZ^9t7PP5f-tZY@u`0Ъ hjPh/}#訂10950|btPu=0u>SX5E t t&tt M ڋE8F떍e[^_]US1h~#,Zt$ltptZu⻀ۻԻ͡0u t8t PhUW$LcjLY[=f-u =Vg-u@t4j00‰١g-0P0YZxuS5g-?XZ1]UWVS411Eh~#+Xt)ntput h~#&50Eƃ}t1E̅u40E̅trH08uEu=0tO*jjV~ uVh~#jV9Y_t Vh~#蠀=0t}0 0=0Ix.}t ?u1҉1E؋Eԅju4EZYtxu M؉}tDE؀u8jPqZYÅt j7V薃 =f-)ugXE؊u CM؈`08tu E؃]ȉ1}ܡ001Jx8t(t uEuEĿʼntEĉE܋E܅u%}jbjuV贂 OuA1ɉM܍EPjj @usE܅u ߉:tU܊jRU_ZNjE؋U9t}uuRY_Eԅtt h^#'X6jsjs u7{t1hx#Xh]$jsh%1[(hb#js u h#_hI#js { t&u h#n^hf#cjs T u h#H[hm#h"hq#,XjsZYu h#Xhy#js u h#Xh %h"s h#jsyhx#js h~#Cph#s t=jvih"djv U; uh#h#A_vh#s)h#sE#1H#%1i"1K#1N# B#S9tRh#j}W^oWV^w-C yh#}9Us uh(#}e؉[}uE`Y&11114Eh"E\j h%9\ Et‹u}eh"\X}j h%[ YX;EPC P sCP3hJ#[EE|u}eC 1RPWVk=ƉRPh`#[ *C 1RPWVD=ƉRPh`#][ Oj h%I[XZ M؉]܍}WE@ P[ZY@M؋]u>0f Phf#HE}tXEtM]tM]WE@ P謦[^yR>0 Ph#`EԀx udj$0/tM] EtM]uu h#qZY$E@ 1RPSQ0<RPhLW$MZ 5g-eXZg-@th#YXEE̍e[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPS%M t#9t9uƉׁvSh!#Sh #_e[^_]UE0 w @8u1]UVS]1tS,Z1tpVhT%Sգ ¸tVVh3#S軣 ¸t<uh+"S׃ Y^¸t0 vSk\Ze[^]Åt2USf-t1:f-uf-Auf-[]Èf-Uf-PSg-PXZ= 0tM=6g-uDP̣PqG 0բXYc%u,#jPh9#b UWVS}] Fh=#UW_{%1ۃ0t 0u7;0P00jPƿ00XZ=0t6u hՂ#XH 00Pt0000001ۉB9tt 50 0e[^]U}ujjjjuXE0@0jc0Z8tPX 0u 0u1~WUU0 wj jRL Hu100UWVSu}Et8uLu+E@1ۉ1۾E?C:-uލBztՃz-uztĊ] :MtKu5>:u$EEEjEPh#}[à uVh#cJz:u벉뮍Hz:xuWمuU6<:u!EEEjEPh#[à tuVh#hg->Pjh#`1H9ujQh#Zà 1Mjh5!#h#Zà M+E@1?1ɉE11ɋU Ph#j MQOhMQh#_Z ÊEEEjMQu EZ( t1E1҉URjUe[^_]UME  h#UP u0=0u01ɉ 00h0h0RppUVSM0t:u>0u1:-uztX0z-uztBu 0ͅtɍr8tuPh?#9Yy:u܀y:u.zu 0J 02u PhR#T50150e[^]UWVSj,0^_zthh#:8->E 010j0Ytzthy#(T0uD8-u @P50P)Xg09Zyh#9|EPá0@00 0)<}_߉ƋM9sω9s x19r )ЍpkME9s 150 0u0tRS[PY09} h#0B0)أ00ljNx=0tE74s ZEy1ۍ 01u10 0u0tR1e[^_]Ëg-z8U 0x@ 6@g-J8g-z8]ÃxuUSt Pr XK]HÃ8uU1҉P8u]UVSƋXCF~hy1A1ZAf@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉Pg-JHR P UPUSUJtXxv-u~u C $t hv#g-B0+B8PCXe[^_]UWVS4f-E=u6E8t h[&3=f-f-0} E=f-f-0\C0\GNà " 0 G4f-(=k0H}t0G u͡4f-@4f-=-} uE( u ƴEu 9E@E菴t9u& u4f-g-HH FՁt| tf,jE)VP+ &kx\[x 0@x 4f-g-HH 0xO Hf-)Qg-X4f-U)Ѝe[^_]UWVS@} g-B ]urV4Y wVh#Vh# 4\&h#j"S|GSZ؅tWhń#}xM4\&hڄ#jPGGSUWVS]S;5f-MM E,ZY9f-ulP_H= 09s<wDu 9rMW50j ZYt%0= 0M܋=050 ##S>e[^_]ø5!#g-ztGUS 0ttt* ##0054f-P 0ZY]UE 0jZEEU\uHر u"4f-g-@8xtjjX聮jjh0"耮 镱UVSg-Xt 1ۉXX=x tjbg-1҉P Yg-1p84f-P0 0xx0Px00Fƃ)c t,~tŁF $ Z& 4f-g-PP @\ |td;Z=t 蘰 uc?&ug-@19g-@_|ug-@g-@$&t;u,g-@ g-@ 訬g-@g-@rg-@_蒯=t0 u74f-@4f-g-B0ztjj[Yg-1҉Pjhe&Và ؍e[^]UWVSSág-@tuxt =g-,uyGEt7[&t,O8uQPZYu[&^_8Et2jwE.Y_t XSD4$PSd Rt g-1҉P؍e[^_]UVSg-p$ t jjg-ubX(x,u{ upV Zuh$#P: uBPVLg-BC1ɉ ^t‹(wjpVe P0+P8RuF Xe[^]Umg-B]US]V9tjS]UWVS 3t u%j 8XpZʡg-@؍e[^_]UWVSg-@}t11[Wt\&t1MHwRFuvg-@@},jEu-뤃uj p1AXumtCMuj 18XMHXj 1҉WPMHGYljރ}t' }uZߨjE#BW}uGg-}u:g-@@ t\&}t jjg-@e[^_]UWVShEӉMg-@E1E0E豮E+f-]jEP'ZYtujXY>tt-uVƉCY;$0} ;(0~(0}>uQy>u |u &u !Utv&uya1ɉKg-dj`dB(g-@(X4f-PZ-g-@(u @  1҉P 蜘y1sg-X$g-@ Wg-\H,hP SVg-pg-@ X P(Xu1 0GD0r5H"0ǗjhډMX0HXq{t Ba&0X+5f-T 0`X@Džd{1d#kDžd}tmBa&uWP-DruJt?:}u5$0%0jjh$0ٖ 1ɉd躖Džd Ba&0t> 0x`@`H`Ba&uKЃ wC 0x`@`H`iÃdt@@Ѓ v6t'H0X`XX, Džd 0x`"p=d%:t #u)Ph[&[Z…t!Džd[Sh[&ZY…uH% 0x:F p:Džd 0xF p[&{`@9Ë`uBW``Dd u(}t# 0x#F p#Džd詔d1ɉdGfxufxt dTf-Jwd@ ӈd ӈ{dNj@f@f@dK@e&1҉P:'uAW|e&u10X\Nj@@c&f@0X$諓H 0JNj@@bb&@f@e[^_]UWVSSg-1ۅtXC1g-0x tjRg-1҉P YF8Pv v^S‹FP U8tSjg-pZjhd&P`g-HUJ@ B 萘]e[^_]UHu+]UWhPT0lژdg-`0\}1󫡨g-X1pjEPZYE00Eg-Tjh` jhd&Pc g-B t$Pt=^g- hppDžt1ɉxR|T}Eg-jjtP袉 f-pnXg-`g-d蜗Zl0\00u jlEDžp5!#u^j-Džp3#Xg-`g-d.Xl0\0pu hpp}UWVS g-@1ۉ]}U g-u@$x @40$[&j袿jCjj Cu;jiF EjUBjbjUB뻡g-xu jF Y1҉V @j]j ág-x 14$pCjj_Cjg-@A. ug-x,u pr[u hK#j腾 g-PS @0CBg-Yx u`x,uZhtK%p^ZuGu g-up0pY1҉US@PvjjfHu?8j@g-1҉P Pg-J0HCBHYvBg-@-ttjjjCVg-@^Xjk g-B0+B8C j fg-p0C5g- ~ uhtK%v~ZYt htK%CEFug-xjƋE0FEYg-xu;g-x  jj p0‰EEU表g-@Zu UBE밡g-xt jj@0FjF g-@Yt-Pv jj u g-@FEM1҉@{j jeC1҉SY^tNjjLX=Vg-tt3jg-@X&}tg-@uWd^_Tjj g-u@$x@1ɉutt;tj ;XZÉs؍e[^_]UWVSV} uE E1ۉ]1]g-xn g-u*p0QƉXYtաg-pZu1뿋H up$E0FE뢋}9u}} uwjg- 4f-H4^S ZYuha#SZqj/v t h#t g-4f-+A8F%Fg-1x4R@@u} u jj1E1҉j1ɉHEFE F g-@0F[e[^_]UWVSSg-@1uG u=Vg-th#g-@puWj Y1BUjBËUBpXYUj)&C^Ut1ɉ ֡g-@tj)pZƉe[^_]UUg-1ɉHHPtjjYXg-1҉P t/Ht3g-@jg-Ytrrh#n&g-1U11ҋE]FUU Et 9Pt]UM40tPt9JuB]US]j袷SCU PUPUP X]UWVSEPn[y h+y#%u;5g-~5g-ExW Z=w PWV% `jjj uNuZ jjjjjjjj$jj SEpuj$u Ee[^_]1=00UWVS}u }t~h@VWmà VWmZY}t9u9t:W X19t-y0L PVWhy#S SVWh#$9g-}g-؍e[^_]UWVS]{tN7Gu 00} t} t&Wxjw PR+GxP YWD Z1Ce[^_]US400@0uSw40SMD 0H0 u0t ]T#]UVSu40t1u(jS#ZYFxPo X6utse[^]UWVSu] 95g-}5g-9g-}g-9t7S$ jjSV%9tn8V W1K PSh# #؍e[^_]USg- @g- g- ~.CPjjV  x9g-}g-P X͹ؙ } ,0]UVSu,0 ~;$0|l5,0j V à x9g-}g-9tu~tvh#S S4\&ZYt vVuQSh"MShr#EF y)KySP-Y P-Ph#Sq SvXZۍe[^]UVS]0u&=@0u ȯ0u0t]=0uTY=@0uZ0tO08tCt>0D0@D0=f-tu0u 0V0[^]US]SVYt ]]ߴhC%S9 YZtSZu]US]#t%SZuSh#j h00]UVS]} t"KyS P ^ P VPhUW$S  t?uSh" ZY?t.!KvyS9 P X뭋P 롍e[^]US0@00t8t P34 1҉Y0u1@0 0u0t ]-]Ë@0u0t9u=0u 1UWVSu} =@0t=x0t?u;0tۃftGtt;`0Wt2<=f-b0uQ=0uH=ng-t?$=f-=g-`0u> uUt0tY<I<tG<0<#t5<<`0uw EPjV| @}ttKtR1N=g-t tFv =f-u <t9uy PV=ZY@t\u`0u jVZY1E܉EEEN>v  DjEPjF e[^_]UWVSu] uh%sZYtsh6$VxY_uh#B j5g-h h#VH_ZǾ0tl0@00P1 1ۉ0^u 0t0tjW0H0ZYu0tG@u15@01ۉ].{h#WZYth&+"WZYu/p[vtEuEu11j1}h%37ZYDžt}N}u N_}10t@taGwuu%h#WPh_% WvPh_%C ~h"__1똅t h"L^110t\08uPu%h#"VPh_%'VPh_%tC ~ h"[1F@ut h"Y1ۋ0t708t+hȉ#0P SPh0#C@u}u3=@0t63{Zu;?-uu1t 11EFhщ#EXE=}}uU0t0Ph#tY^PƃX?vsh]#5g-- hȉ#0Zu h# 0P XVPh0# 넍Fuuz0@00@0u1 WX0t0PU- Y<0t jVxXZ 00L EEe[^_]UVSuu @0į0tJ8tC0@01P-0P0H0ZYu0t 0uu e[^]#e[^]UVS]u `0u VSYX`0<vjS[XZuƃ`0e[^]á0=@0u t8u1UWVS01ɉ D00u@@u 0e[^_]1҉0=@0u‹0t0}W-50SjP9S+ ,t }wW,50Xe@Ht 0tUS]90t$jjrjjijj`0]US\1ɉM=0u'=0t0t EE0000D0tjEP[Zu Eģ0jEPZYt0@0jEPY[uO8Eģ0=@0uы0tǀ;t 10jSXZ몍Eģ0ZjKtX]~ ~Cvv1ɉMMMMEPj&OXZjSYX1EEEEK>v  DjEPj* pSP{ XZ50U0E0]UWVSh]&PZYj'V赮_Zu <)ș19e[^_]á0@0g-t,UP) 1g-g-Z 0u 0t 0u0tUWVS]߅~91Wu u ~ )Dž~E u F ~) u8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu0CfKS u>0@0s6C CC0H0^uV0tMFfu9s0@06CPRC S)S0H0ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9g-u]e[^]e[^]U5g-uXZU5g-u~XZUPuu EPmE u hw#ouPJu& UEPu u UE Pu5g- UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'Vu_Ztt~tnh#V>FZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h]&VZY<tBEt7KyS'P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KySbP'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9g-u]e[^_]we[^_]U5g-uXZUhg-Mhg-CXZU8ruPh#PhNJ#@UWVSSEPE X85f-f-0j=RUʨZYj=S辨ZYU))9~߉Ӊ 0I 0t$<=t xFU蔗p UCɅxUvU] Ue[^_]A!UE1@u,0+0Rpp h#jhT0yT0UWVS]} Mt t9u t113Ba&ƍCt9tBa&u1@t)؉[^_]UWVSS110tZuA=u܍P襓EY10t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uEʼn#e[^]h#SAZYSrZ9u;ShUW$j'S车Y^ƅu+Sh(%XZ/<'uh #sXuS)Ph#t e[^]UWVS]} sSt"CtS҉XuEs1Et Wh$!Y_}t5uh$ XZ$g-Jy R` g-z9 _F>=u y:Cu}th2 #FPZYg-HyPg-H X J e[^_]UWVS=l0uh0 h8l0Y11ۋ0tJG} tE t8tEt.h09P5l0l0%h0XZl01҉Ѝe[^]UWVSP0P0su"f-s f-s  論YVCƒJujvXZ=StuPF K DPY_F u v ZCFC FCFSh X`e[^_]UWVS111Eh#{Xt2vt&etfuEՃxuп뽋E u0t0}tUP( YUtW2U XZUʉ؍e[^_]UUE  E U?t h# jpp 1UWVSUUu 0@0j臅XU:-u0zu*5f-kf- f-C 1ɉK^1jEPRUǃ UuSj=RP_ZUtRVVP?VjR E81ɉK C1s@C O t0KOKGt u tGG <=uRUVP tjRULXZU w0u1 0< =u|0H0{P0P0 0u0t e[^_]e[^_]US]tu s?XZ]US1ۅuh#'NtxtIuhϋ#貜Yu 塨0P0t SPXZ]UEU )]USME )u AR)[]W|$wUWVS1҉j EPS襪Ɖ 8t98"u/EUE9EsShH#P-9]u ShY#EMDJ@t@E}u9tՉe[^_]g_UWVSQƉ虓ukIe9Fu[~W9uJjj XY_UP(PURW Hx N9 uW XF!؍e[^_]UŠH8-u>1tfzuhd jjh_&1zuHhy jj h@`&BR0.uhd jjh`&hj#PTZY1u`&UVS|ƉӀ8!uxu :\|fxqpftft!f u&P8Z?;*;"|f uPSB[^1PSBZYuNf$^&|&E%=E%=@E%= E%=`qE%=bE%=SE%=DE E E 6M;MU؉!]]U9>(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$_&SV'Y[SV_ZYSV [^SVZYƉ׉11 Ɖ׉11 ylj։91lj։9rlj։g9(Tlj։I9PV?^_xPS?ZY04]E9uc9u_E98PV>?^_uWxPS+?ZYuD04MU9u9uE98f9]PV>^_t1PxPS>ZYu鋅|9u;xu͋ 3E3U 臛>~u5!uډx!(u;)u{u ?e[^_]UWVSu] hȇ$3ʺ_Zu!Nu xtP!zUWٰYu URP-DPtÅt SXZ@tM}th%6·ZYu }tM1EE8%u!Pz^X6h# _Xz\1ɉj EPu螭ljыE 9Et:8u5 t/u u5!# 9uM 8Mt#y޸"uPh# EGSW YZ@u'`#|x"RPhT%$ Etu jW XZMurUVS@l\0@0X0@05\8t j=SȌYZt hSLXZ; Ph#j@]SjSh$#|j hg-h e"k(j h#h#Wcƒ c%u,#j Ph9#2j,h)#h#!j h#h##$e[^]UN=0t 10|0cOg-01000=40t jYg-g-g-g-g-tPH 1g-ZUjR1ɉ 0Nf-10f-Zxt@ۆj0@0jXZ1`0uƀ`0@@u 0u0tUEt]UVS]u tVs XZe[^]UVS]u h&$h&Vs [u CEe[^]s VDF4$VsJVs Vs[Vs GsԱVDF[ ]VsVs C[XZD[*uFE$Eh`&#VظY[EEE8.u(px*u Eh`&#V螸_ZEEu uh#}f?f}‹}G}HE @,1e[^_]UVS]ss 3sh&#j&tVTRPhQ# S S VPhX#͒e[^]UWVS uj:u wZYE u hm#j@E } hk&E P胂Y_8j=Pw_ZqxEPh#W/=E #u=#t">#E#uD#t"E#L#uK#t"L#T#uS#t"T#rk\#@u[#@t"\#KDe# ud# t#e#$n# rm# s!n#y#xx#y#y##r#s###r#s##}#r#s##[T#r#s#2+ r#a'# s##>}w t2#&# u##r#r"##@u#@t"#y“#Àu!#y-“#Àu#PIɓ# rȓ# r#ȓ#' ϓ# rΓ# s#ϓ#֓# rՓ# r#Փ#ݓ# rܓ# r"ܓ##u#t"#~#u#u"#^W#u#t"#70#u#t# u^#?'#t#^#}wu1 #% #u ##u#u"##u#t1#`%Yt@!#J)#@#>uM #*tO(##M # (##^/#3@)##^/#^/#}w s # r#%=t)wt=u&r#=uz# n#v#Q# r#<}vw s37##'7# r6# ?#r>#r#>#F#rE#s#F#N# rM# s#N#V#rU#s#V#oh_#r^#s#_#F?’#sÒ#sjÒ#^}uSf#Pj&;t3CaP3hm#jd,W葀 1 11ɻj&;}t SC8t{$(Whv#j ,(PCPhv#j }(P$A u,P2W,Y_1Ƀ bt,PEPXZe[^_]UTPh{#h-ljXwU0#=0u"PRPh #h-8j$wUWVSQÉ_10;#uCj EPSAtB 8t ShUW$jE8tWShx#j~e[^_]USÊt%<#u"S}Zt@0]UE E EE]ݎUWVSÉU}utj VSs @t 9E s 腜8"u"3O;t)t:EtP-fDB@fO1e[^_]UWSPhʕ# Zud0.j URPsà u8"u hڕ#j1ҍe[_]UWSPh# Zuh0.j URPrà u贛8"u h #j51ҍe[_]USÃ=X0t =D0t?\09t6t2`#t""=u`#QRh(#w \01X0D0]UVSƻs&t[PV+ZYuICƒ`0d0Ch0C$0C 1f‰X0te[^]% VhD#je[^]UVSÉ֋t8uVh]#jURM1YZtVhu#vXZH01EEe[^]UWVS11Dž=p0~ Vh#vXZ1 RPhSȨ =t=p0Vh#&f}Uu1.=p0Vh–#v[^v49tVh-h#Ea6WhR#h-{vWhZ#h-{F (tl#k=l0`PW0%SVhi#qr=0t e$h@0Wh-5(0Wh-"WW`V_%el0 1e[^_]UWVSƉӉt |0tQuډ=|0u1It@0Ե0=,0@09s Sh#jh0P$ډXZe[^_]UVSƺH t 1҉[^]6U=`0ɀU E]UU EtPh0_#XZ1҉UWVS(,0 00 1hSAj 4 h#SC^_th-#S葎ZYÀ;tj:SpU^_xh-#W_ZYǀ?u=1ɉha%S~^_1jh%S ha%S~^Z w&t"SPZYu w&f50|w&uhP11҉\^_thu#vhvSh#Wh f0he#S}ZY1;ph6t"SY^u hAt"S_ZuhFt"SY^u Sh#g c0h#S}^Zƅuq;jP11҉ZYth#g_X 0Fe돍Vh#S HuEt9$0s(h-#f$0f*0[^f*0uƅh$S#|ZYujh0h{%S|Y_ujh0R {hJ#S{_ZuAjV11҉Y^0)hk#S{_Zu.jV11҉Y^0hy#SG{_Zu.jV11҉PY^L0h#S{_Zu.jV11҉Y^ 0lhs_"Sz_Zu.jV11҉ZY0-h#SzY_th#Syz_Zu.jV11҉Y^~0h#S:z_Zu2hV11҉@Y^<f0hՁ"Sy_Zu2hV11҉Y^f0Wh#Sy_Zu2hV11҉Y^f0hÝ#Sqy_Zu.hV11҉wY^uwf0hН#S2y_Zu*jV11҉;Y^u;0h۝#Sx_Zu9jV11҉Y^tWShW#f0Pa<w{tSh#;=$0rSh #b<~!jSh*#b‰40H0]‰80H0h-#SV^ZÉ;uh]#bY[v&1VuZߋt ujPSV uOv&@0VTuYÀ;th-#S豆^ZÉ;1ۉw&]P-DPt7hP11҉ZYt&hu#a^X Dž" !v&ShK#`hz#`1ɉ@0_ Ơ0Ft<$p&u^ \0ì0F H0!H013FfF0ì0F H0taH0t613Fs0H0h0Ze[^_]UWVSP1۾v&#7`XZ]W|$wUWVSƉ׉M1EmF(1҉EUm %$QN81ۉM]mRR$hU#hW^ e[^_]g_W|$wUWVSÉ֋W t>$u ~#EPVAEZY9ud8t/jvc} tu Sh#v Sh%f_X뿃} tu /Ph#H 벍/Ph%2[^띋$t $PxYPkZ}tEGjPS o y hH#XAЃu ƀt/tu1P׮$u ho"K@ e[^_]UE0E 0]á0á0UE Puh-h-j Cj6=UWVS]sc8ށu=0t50h "FYX=@0t"=0u50h#]F1@0XZuu 臭 ZYyWۭPh1$2F t7=0t.j 9 C 8H1u"Wh#h-D Dž CC jhPjVO Ãt'$Phzd@S"A @uSnh [WMYD P-9rDYt)PH0t4KRWQN u <tPȉjMy Wx C1ɉK C C1{;0C00XZ{ t%Vw(OYZuVh*#j9XZ?jx V@x G2x G $x GG1CG8{DžaETuDž0Eu0} u:E 5j >YtshF#j?s _Xtvh_%T?6M 9~=0 1ۋ9U tE 9}?Cԉ a^ EtPs sshO#>…g=\Qs sshh#h-AҋC'BDž 10C0 1F0H0~ + 0(P?^t509F6냽tr0t`5!#:t#h#Ph#h--A0t/";tf3#Ps sshή#h-@͋  Phܮ#x6Y[0F1҉StPVS ssSݜ uU89;00?uǃ tuU E t$9{p1҉ e[^_]UWVS]fU ffCffBCffBfCffBs s#Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssPY^} GWss:Y^GWs$s 'Y^G W$CDȉGDs,s( Y^G(W,C@ȉG@s4s0YYG0W4CHȉGHsNjCSMEAE@ufFZ[tA 10Ee[^_]UWVSu^8C@PvYh#TZu1=01_ t貺f@[^$0  0jj ¡,i-ƅDžǺ Dž1XY=0tB>BBp+BtPR|[^t 0$0 h#qY=0t-5(i-jjjj 0$0 h#Zu5,i-RPjjPt0=0tohȯ#<b5 0=$0 t(jj[[XA!HfAWV#1 0$0XZ=0tj G_ 0$0 tjjRPe$0  0u hӯ#+5$05 0[^f%f=@h#h# ZY5 0=$05(i-jjjj 0$0 xRP5,i-jjy\jj5$05 0ƅDž9 WV@@PP WVf@5$05 05$05 0蹷^_8th(#1ɉ 0[@0D0 tCjj RP3 {C9s#Qjj RP0 N019r)#u 5$05 0u"hI#Ah"910XZ謶fH^_f@t 5$05 0h"u6!@t%h"5$05 05$05 0)Z[@@fA\5$05 0f@5$05 0Chq#<$u th# =0j XeY[^_]aUWVS}u w wTXZCfEE9ucp0t=0t =0tj jjjw w'up0jh#W  w wNYXG $09O u,i-; 0tf%#f=@uӦ"Rh#w wgE)Puh#~=0us=0tRyNj hư#XZ=0t2hܰ#G7_=0tfE)fCe[^_]Z h#eZHt1ɉ 0x밍e[^_]UWSá0p8hSY t& 0q0RP¡0H01z 1҉Ѝe[_]Ƀ=d0tf‰Ã=d0tÃ=d0tUWRP{Y_}UWVS(}M] U P0T0;E] w+EU 90p8}E9|+F]!É]E !ЉEEUEU9}"=0tWN#uVu uh#50}̉Euuu u3 EmEԉU؉E܉U\TtFЋ]!FEU؉E܉UFEUӋEUEU EU9ME FEU}9Ћ}=0tlSQu uh"# 0\Tumq֋]!qISQuuh:#{ZE̋UEU؋}9Ћ}};=0tSQu uhZ#70uuhs#$럍e[^_]ÍL$qUWVSQ0QEU}9Es9=@0D0Esuuh#"{h0l00sx1uЉ}ԉ t9E}rEU9E}\1ҍMQRPuu) ŰEUEUċEƉE؉Uu܁Tt-s։!U!CЉEUuuuu+ K` t1Ɖ׋Cu}ܡ0t`s0WVխ00@x1҃ RPuut* M])Ӊ h0l00@x1RPuuD* 0R=0tЍeY[^_]aÍL$qUWVSQ8QEUX0\0Ӄ X0\0}9u}9u9=H0L0Esuuh#yP0T0E؉U܋E9EEE@0@Ẹ@00\1ҍMQRPuu' UEUEUEƉEЉUuԁTt-s։!U!CЉEUԋCx1RPuu) K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=<0u ,000 4080EUܣP0T0Suu5(05|0腧=h0P0})E5(0=019}VVdf%ZYf=u Gvdv`YYF`VdvlvhYYFhVl1tttpMƸYYM؉DpTtA u1M蛸YYM؉Auv<=X0u 0(1E؉Ẻ}EċM9MSuu5(05x0躧rVVif%ZYf=u+=0u"}uFV c9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡(0`0`0=0`0ЍeY[^_]aUWVS u} 0M]1EuuWV3&  ‹Mt WVh۱#u1H0L01h0l05X0=\05P0=T01@0=(08#AH40=0态1ǣ801ã<0005,0t C<0 =00 ,0Qht(0ZYu h#te[^_]á(0tUP%kZ1ɉ (01(0UWVS u=0tFVFV zEU0H0AEUSQRPo*  w 1҉UtE4PbX30RPuu $ 01{{E U 1҉CS1CC E UC SEC$EC( 01E v 9st DpTtD(D,T0Gу} w0090ub11tDXGu뺍PR:fZY=0u h'#r00d0P00e[^_]UWVu} 0RPWV?# 0t9xu9p tWVhF#re^_]Ã=0tQUS00\;0r 3hX50h50h100ZY]á0@ UWVS$Ɖx@t@VЉ_uDžo v vv 0p0vvxNjH0P0@t 1ɋ9}=؋ÉA빋EU RP" É19r=`0th0tF1ۋ9}&G q1KYYQCG W5x0ɣ[X9}W ʉ@~; 09Ht09Xt~zG=0t T <tYv vh]#hRIRV莤t"G=0t 1ɉ ؉L1҉G 10C|W5x0[X"~@)EU 9GG=0t ȋT tdtJ1҉FVuVЉYu uXZ]gE E H1ۉ0FV RPRPhS¤Sh~#o h#蟛Xv v!ZY=0t@V+EU FV@V z+EU oFV h#&t0gX g؍e[^_]UWVS uE 8t18E 1ۉX0X40tFVFV щ} G$W(ff%f= 0fua(9=X0t;9ظu!t F Fu~hu)}t@󥋅 󥋅 w0NӉWVSQ 10 t 0#8tU@DNL!Ή!؉HT t0@8] C t`d E x@1҉0P @RPRPhS聡Sh~#hl h#^YHE p p^X=00tp0PCSp0_t 0h$=0tCCpPh6%~XZPh#fY^=0tfPh "K^_=0tCSCS RPh#! =0tC(C|1RP_iZYE E#e[^_]e[^_]UWVSS]u }s sEZYOu6f%#f=@uӦ"RVhT%fs s_=0t h#{Yh #辒ZH=0u؃(0,0{@tjjjjsHsDs s Suf^_=0t 0@ 0 }s sԚZYe[^_]10e[^_]UWVu} WVuuuh#fj WV膚$t uB<v Rh#de^_]ÍL$qUWVSQ81yAE 0EЉ tWVZY8t 1u؉}1ۉ]̋E;@0ED0suuޙEZY8t EU͋E9D0uE9@001ҍMQRWuu EĉEE0Eȋ19]E s 9sjVUYXu!Rh5#dXZ1E؉ESEpWUEȋ 9s@t EpYXE0x0uuԘEY[ 0EƉׁ\TtAЋU!ASA RPh`0]5|00}=h0t =d0t =d0t50u5|0, EЁxU tU tuh_#|cXZ=h0th`0誗0_EЍxU uEЋp\ơ01RPuu EH 0ELHh R50讹5050'=d0t0PP膾[^50pf0E%Y=t =t)=@EE@E0p8 Eh`0舖0uuà =0VQAEЉUԋUЋEԉщSpCtZ Ef1{XEPDrEUC S$C0S4C(S,0HT t1CS CSV譟C(Yu EEaf1҉SdEPqE\CC C0HT t1;CS  ChX(0,0=0tE }̈GE؋U܍eY[^_]aUWVSX 0E01RPu uR EEƉׁ\TtCЋU!CQC RPh`0豒5|00}=h0t =d0t =d0t50u5|0耾 ExU t U tuh#__X1EU1E9 EU EURP=Y^=0t@ECECX@pECtECdz EEPS8XZ=0t 0@ 0 u u袓^_}tjjjjuuuu. (0,0}ExU uEp\ơ01RPu u<  E@ 0EL@h R505050蕗=d0t0PPY[50a0h`0A0XZe[^_]ÍL$qUWVSQ0AQEUA Eċ=0GPE0E}t%f%ƋCS0}E#f%ƋCS 0}E}1҉ft1uމU!U؋U!U܉9E؉}ыu}M t 9|N}tFTFD1҉ zuRP襏}ĉ0@0 E1uȉE1Ẽ9Ή|m+u}̉EUE9ƉU|6+u}EEEUEEE9ƉM}E,E#uuh#0[EȋỦEUEE؃}t DT1҉ uRP貎à uuuu EU䡐0EԋKMЍEPuuWVZ u}}MtT 1҉  c 0q0RP,à MqEĉ0@0eY[^_]aÍL$qUWVSQH90E̅tGWGW EU50F0E}tE1ɉMԋGWEUEE1EԋGhE1҉UNPEU t1҉E؉Uܸ ]9ظ]|bEƅu1%0X0EU=0t`M؃ωT@‹E؃T ؙ]UE؋U܃EUċE9EEċu]Ћu)]uċEԋ]Í E؉UM܋E9EEċu|G]؋u)]uċMЋEȋEԋ]eЉE؉UM܋E9EEċu}E,E#uuh#ZXEЋUԉE؉UEEȍp}t/B uvEE̅u"EȋTT tډ1G0X0EU=0t# uUDXuRPpẼ uuuu E؉U܋ 0ME̋pEPuuuu ËEUEUċMtTP :1҉ ueEƅ0@0 EUEU=0tM̋IىTŰRE@ `uũf 0q0RPzẼ 1Mu h߳#V0@0EU=0tGWEUuGWGW ESGheY[^_]aU(Ph#h-@j,UWVSSƉ׉uEPQjU 9t:tWVh#j`e[^_]UWVS É50PUXZ=0t=0t h#VXVScc^_t u=0u1h#YV[p0=0u60Phȴ#GV7UZYt hߴ#2VXh#'VX=0t8=0t h#UX=0t h7#UXhZ#U_=0u h~#U^v(=0u h#U[0=0u h#UYe7=0u h#UZ9=0t=0u h#`UXQR0 $( @8 $(RP5405005,05(0h#T0@Di($ʉ1WVRP jj RP< RPk(dd$WVRP RP ($h>#@=0(0,0+@0D0 0(0,0 50NF)ڋ~,f,0040Ӌ~4DӋF8׉֋ $(+ P0T0 0040 t/SQh# RPht# =09z=0t4h#0XtsshĶ#| j X=0t4h˶#Z0Xtssh#? j RX1=0=0=0=0tm0jb04h 5050 5050脋=d0t0PP[^50U0Y=t0t1҉0jX1ۡ00;Z,sDtPXGXCPNG10X=p0t =t0th#Q0X=0 =0u h/#zQ_=t0t hV#fQ^UP0PhC%3Y[u70t-1҉,j,R PhC%h]%mt=0u hv#PXR e[^_]UWVS ]s{{@u(EUE9E;s WVE܃ WVhr#s sDX0\0EUX0\0 E9U}Xs sh#/P =0th#_Eh#{^u1ۉ0j jC EE}n}uPE1ɉM؋EԋUH0r80040jWV tEWVhu#s sP0T0EUP0T0 E9M}s sh#j ;Zu#1ɉ 0h˸#Nh#z[^px0u001҉ 0 09t9zu9rt9yu9qt0C0S4MEEe[^_]Ƀ=d0tf‰Ã=d0tÃ=d0tUWRPǎY_}UWVSDRPle0t&uff%GW$Off%GW KftGj`h0GpPu urjhp0Pu uNuJG G@j0h0G(Pu u+j h0GXPu u uhtkh߸#Lh #xHu=*^_=0t 0@ 0 R1ۉ0 H0L0 0t04A09؉rEA09؉r#f@u;9ظ=0 h#)=0fh#owYHu|XZ=00@4t GWGW f0H0ASQRP y%=0 RPh#O 0f`t f uf=0:9h0G(RKd1RPS5|0xt h6#H=0t1ShJ#8PG(P8=0t 1GG1Gh/0(0x_ș9rL=X0t;9ظs)(t G Gtht)t 9ظ Dž1~V@tʋ롋 0 9ظC tNDp Dttރ=0u0D(PShq#j|(볋DpTtRPSh#5 0119Ћ}{AtRP C뷋ORPhֹ# t uC~8|X=0euDXPh#^_AWpq[2(0,0GfBf[j 2Yu01ɉ 0h#Eh#q[Zu-jjPH00f@u> ЃW$0  B=0=0tzGf@t`r@GpufGGhtGtSfGyXZ G=f@u1P0T0X0\0FV =0tGFDG FHGXGpFDGtFHGd F@VW[X=0=0t =0G\uG`Wd uGhWl tlh #Ch(#ou 1ɉ 021G\G`GdGhGl f!0XZ=0ub0X4 ؙN0ʋF4f0F0V4=0LGWF 0W\tF@I0D11 0 G\<#8ts@DYL!É!ÉIT tA8F D`Td uDžFVVV[tbGhd19u 9RPhP#mA=0t h#Yh#7mZ_XF0=0tV4CSCh~@jjv4v0vHvD wh#@h #lH ZY=0t 0@ 0 4e[^_]UWVS 0E1ۋ 0;Y,EUu\TtA!A1EUAEUEU11tAu}׋E9ƉU}=E1EEUH0CBHLY4DEUE9ƉU}:E1EEUH0븍U1E; 1ɉ 00 40 (0 ,0M0];X,}|1Eu| 0EXZ\Tu]e.Qҋ}!Q1E]]UuI SQh`0p5|00}=h0t =d0t =d0t50u5|0P =0tE@x 01҉EU= 0t60p,kEd1<SVuPh#h-1 0=0=0ExU t1U u E#uhѺ#=_XExU uۋ}G\M]ȋ} }tyt<҉UEyEE0ËEsM]1EUH뫋u!Ƌ}! uEU9]u9MuډM]EE0ËE} u 1s<}%?}u}9t uuu))xYuuh#;j%1xM󪋅xC|UEUpt|}9r WV/XZ Mt9uɋp9u|]5H0=L0|UH0L00M]11 19E}eu509|]s1-h1l|]+hlȉ uv^00]1t_}}9u}9to<%?u9tSQh#:jM]Wx,Y[M]u Wuh$#9MEsE)lj1VEi1`0e[^_]UWVSEP@EUE@ E}juu# t`0t`}9xuPu9puHEuuhu#Ep p{ `0qyEpxu}qy `090u 0u덋=`098tEUMK؍e[^_]UWVSTU1EE 0`0111E0x,9}= 0t2kEd1E7uWuPhQ#h-1= 01ɉM0M;9ظVSXZts]ud0=0tGuEG.GptEGtEGEGtEVSlZY8tEPWZYuEHEe[^_]UEU @,+B,]Ƀ=d0tf‰Ã=d0tÃ=d0tUWRPOxY_}UWVS EX8=0t 1Q=0tt1;@0D0slj}1RPk@C^_DžE@4} G0.3ChH%PZY'Mqy u9tXY_8u695$0|_ssدFXZC SCS u95$0|)js s]Ahy#,#h#%O 3ss訦1ƅs{Džq ^_=0tBBBpBtVR`ZYu h#["_PsstQDž: ss輥VPtVf@Y[5$05 0~VfHXZ:e[^_]UWVS(EP@EU 0E0RVuu EEmƉׁ\TtCЋU!CQC RPh`0S5|00}=h0t =d0t =d0t50u5|0 ExU t U tuhȾ# XZ1ɉME@ Eܾ}juu |EE1E؋UԋMUMH0EMB0Åt4}9{u}9{tPHSK0PX#E}tlExU t}G`ǡ0RPuu ӉE1EЋE̋Uǃ0040Ex@t+jj0@4 ؙRPEpHpDp pa 0Ez89x t0}t*E@$ EL@ EUMM}ttto0E{89x u^E@EL@jRPEpp K` tPuSYdh 5050Uu5050W=d0t0PP-zXZ50"0h`0zR0e[^_]Ã=d0tUWVS\U1E9 1u0X,9] = 0t/kEd1VSuPh#h-1ۉ 00u1EE1ɉM0MU;9WVWVQEu} 0tCECECXCpECtECd EEP$D}&EXftbWVYZt=0WVh#!WV^YZt!=0WVh=#4 SEP襛XZ0Ѕ9xu39pu.JZHX0Rjh#EPLjh#$tC CC Cu jhe#jhq#EP躴`WVPhy#E?Ee[^_]UWVS0 0|jj'P1󪋅h_X=0xX$=0uh#*G^uh#)[=0t؋1ɉ$0h 5050q5050+T=d0t0PPvXZ50t0XHXI$~6#9)#~$tl<hNjH`ltW,Ћ9G0sVhο#$^_n=0tVh#Y[h#EZC=0uՋB,t|Fl$1~H`F|@ltË#XLS5 0 |^_u h#| 00h 5050Wo5050Q=d0t0PP/tY[500Z0tt DžPLDžHLPP1󪋅lPP TCHX$~@=X0u\t`H`CXDžU X)Xtu{xlLtuQ+HhVHXDžU 1DžPDžhDž\TPh)#1hDž\L1 0׍G@tutL9t G@L9uՍ1󫋅<8tx@8txؙ!lj!׻9tx}^x`1d`dtxH0ttx1tX,9t= 0t4ktd1=VStPhL#h-Z1 0tl1p𙋝ttƉߋ\Tt#@`Ћt!؋C1Q@ RPh`0F5|0|=h0t =d0t #=d0t50|5|0r =0u-|xU tU ttht#[^=h0th`0(H0Y=0t =0uh0 0 0 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP505x0kC 0𙋽l׋pЉ`Ɖ׋`ǁ\TtAЋt!A1qhARPh0E=0tth#XZX0ph5050Fi =d0t5050*n_X0\8 uǀ\T5050KY^=0th#PE_Zu)5050CY^u90u 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP505x0Aj50HXZΉlߋpËlቅlpplp8T<DT9ƉD} TD0Tl)Ƌ|@`ui@,L`tLH9t||`t||`tLH9tușD1ff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU u H1׋h󪍕U u P1׋Xu"xLu DžU t11ۋ;WVBZY< <<tt<<tM U u P`ك⋍`9s WVPh# CVtuPU u PU u P1ɉ`T9lpDH08lp1ۉL1[8L9˃<1҉@<@8 rRځU uT ڋ`Lى4ً4 @LC99hHd`1HU u HU t PLP1~\Hd`11ы1Ƌ1f$H```ktgU u Tjj(R``)ٺ!PMH8șlp`3$\`x`11;dsV`!։lt @lt$9~؃҃u`GCl뢅t$9~ș`l tLjS P1 =0`t'W3VslsQs th#h(h:#PX<ZYtej PSk_h 5050U_5050A =d0t0PP-d_X50 0^1ۉ0=0tP|x\|P0 uT|PTxU u |PTHU u HhRPT0 h^#\P@;ZYtw\S|J^ HU uHڋ|xU tT |GThRP^h`0c;010=0u)|xU |P\1ۋ9PU u P|U u |W\ !8uC<1ɉt[|xU t |B\u0tȉlPhv#,YXlAu1ۋ|@H9=U t | |G`U u T !8uC<1ɉt[|xU t |B\u0tȉlPh#OXZlAu농U u PXRP- txh#P8Y[taU u P|xU t |G\XRPi[h`080t j SV-  =0ts h#腙Dh:#Pu7_Zts󥋅ƀƀh 5050dZ5050<=d0t0PP<_Y[50&0Z10e[^_]UVS1;] s8Sh%Ҙ^X1E0Ph#躘FZYuj ɗXÍe[^]á0!UVS1ۍsrT =0t40i-hO#NYX" #t7#P.Zty=0uɡ0t4象01ɉ Lh P50$Y5050;=d0t0PP]XZ500X150Kt00=0t hg#y[h#-Yti=0uۡ0 h P50bX5050:=d0t0PP:]XZ50$0X10jWjWYXuj]Zuj]Xe[^]UE(0E 0]á(0á$0UE Puh-h-j pjUWVS]28ށu= 0t5(0h "@YX=0t"= 0u5(0h#10XZuu F ZYyWPh1$ t7= 0t.j X= 0t2P5(0h$#躕j5e[^_]UE Puj' UE Puj UE Puh UE PujjЋUWVSx1ۉ$0PhC%u'^_yhT#hVu, ]t Ƅ1PS('ZYyShc#LY[u%=`uz 9u;u$0Shh 0qƃ uShs#뜍xPV&_ZyV끋%= Vh#e= u:u*ShV t ÿ"Sh#0S= [+S1 Y0hV u|h 0hUW$5XZ|듉e[^_]UEPd5ZtPRPhȭ# u uh׭#hh00U塄0tjXj USj0h`}&j7 0jj]USͯjjjjj譯]Åt3USӃ=0tPh "賒YXSh#XZ]USu=T=Tu =Tt=Tt=8 uIl0t=u 1111d0\0 `0h01<=T=Tu = 8u1ہ=l0묃[]UE0 0t,\Tu ǀ\8 Tu ǀ\ 8=0t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXCl0=uh# =uh+#>"Zu"hA#'[=d0t h`#)Y=h0t0PPQXZh 5050L =d0t5050QY[0\8 u0ǃ\T1\T0uSChEZw#= V 0΋0ѡ0ƉϋKdC40RPWVn 000 =0TC,HEƉ׋Eǁ\TtC!C1uCRPh0'=0=h0t0PP^PY[0ph5050BK =d0t5050&PXZ 0\8 u ǁ\T50Q50u tc=0u#EKh#裫=00shX9s΋9tRP+0Ph#eh050*h0 0[^ 0t[h 5050KJ5050,=d0t0PP#OZY50 00X0e[^_]UWVS]u 0x00xPSY_yM0PSh.#f=0t(jS |0_ZyT0PShA#5%= tSh]"wh#p u1=0t x0=0t"hT#/_jS[ x0ZYyShd#跇1ɉ 00 0u Shv#蕇XZ10 0$00001000010h h0h hmǣ0h hW0h h=0  ʅ ʅˆt h}#VS芕Y_¡0t"ujV _ZyVhd|#^|0=0u%RRjPVM8@t00t:0 0 0PDPj5|0S7@u Sh#Y^Tu Sh#h]%tV舔_Zt%h#VwZYtVSh# `LuSh#C\uSh&#+50V4uShR#uShy#f^_uSh#܍X1‰11p~u 1ۉ0}Tu%HSQRP DžTӃ~ ƅtBtѥPD1D1É1P1RPWVk OډSWRPH h#Z1ۅ~;srPƉρ}Tt!1׋ t101t ;r5Ch#h #h)#hB#hg#h#h#50h#@^_=KÅt0\Tu [t1ۡ0!0=0tth#[u h#YY0 h P50UC5050%=d0t0PP-HXZ500_1ۃ=0t0Ph.#ɁY^0=h0uNtJt2=0)#=0tR6$Ph:#XZ=0u h_#X08<P0T0C,@01=D0C0k NKt鉅 ׉ ЉNj׉   =0=00=0x=0t h#^h#[01҉XǀP1ɉh P50A5050#=d0t0PPE^_500[=05=0t h#Yh#ZX0PP #0ǂL1XǂP1\h0RC h 5050@5050"$=d0t0PPD[^500Y0 tyPh#h # Hu^0  h P50?5050 "=d0t0PPlDXZ50V0_0vuh2#ghW#`[^Hu\01ɉh P50?5050!=d0t0PPCXZ500X0@5050!=d0t0PPfC_X50P0^0=0Lu0L~;~Ph#?0ǀY[=0uhW#ZHuqh#訞X=0th 5050=5050% =d0t0PPB_X50n00^=0&9| 9Rh#o0Y[=0uhW#6ZHuqh#֝X=0th 5050<5050S=d0t0PPA_X5000^0BHz0Ph#0B0؉BHY[=0uh9#ZHuqh#X=0th 5050#<5050=d0t0PP@_X5000^0BLz4Ph#0B4؉BLY[=0uh9#ZHuqh#hX=0th 5050l;5050=d0t0PPD@^_50.00[=05X0\1ҋt7^؃t'\t 9t@勍 Fu=0uh9#ZHuqh#l_=0th 5050p:5050=d0t0PPH?[^50200Y0=0u ,u40 9u9RPhG#0 04 =0uh9#ZHuqh#yX=0th 5050}95050=d0t0PPU>_X50?00^0(=0tx<Php#JY[=0ăx0(=0uh9#ZHuqh#觙_=0th 505085050$=d0t0PP=[^50m00Y 08<qH։9u9RPh#q0BHЉ8< =0uh9#. ZHuqh#ΘX=0th 505075050K=d0t0PP<_X5000^ 0@DqL։9u9RPh#0BLЉ@D =0uh9#U [Huqh#Y=0th 505065050r=d0t0PP;XZ5000_0=00PH҉8<PL҉@D1500=00=0?,=0t h#i[h#I Y00ǀ, 04ǀ(<PH҉8<PL҉@Dh P5055050=d0t0PP|:XZ50f00X=0OL9=0t h#lXhH#L _00ǃLǃPǃT\ǃX`B,F$1҅~K`F@#CLh S50N45050=d0t0PP&9[^5000Y =0tv0=0uhh P5035050X=d0t0PP8XZ0ph50503h05x0 50Sh‰L^_u Shm#1׉1ɉ509)~09~NjLWF8HLNd t1RPS5|0 t>t Dž)h#h#^Zu1ۉ0jg=h0tHWSS6 0WA8HLId t1RPS5x0 =d0t WSS6 0@0 P0T011Sh£H0XYu Sh#1׉^,jS0_ZuSh#}=0 @0D0 ȉڃ9 sA0001ɉ 0 0jPSã0j50?0…ˆt0Ph#"Sh 0_Zu!Sh#[^10jZ7&0 0=0u*t!h#P}ZYu X0 0>hSP5<05|0ƃ (0,000<0=LBALt[=X0hF#h9#Y_jjjjjS6:=<0fGW69fG@0CJtejPhe#k =0uh#BZu9h#X=0tC=<0fGW8fG@0_fCff=v]h#Y=0uh#Zu8h#uX=0tfC=<0fGWZ8fG@0_fCffuih#Y=0uh9#lZuDh# _=0tjjjjjS8=<0fGW7fG@0f{f9}zD3<:uƃu}EEUEURP50u u赑 09u0E ;}|v0EUtJ9tFRPؙUEЉEe]EUSQRP9 RPhj#eRPhĶ#~e Fyj dXe[^_]UWVS}u EUEUEE0ؙMʋEeEUMuuuVWj 9Eu0UM"whx#dX19]~KؙEURP50VW 09tؙEURPhĶ#d 0E e[^_]ce[^_]UWVSQƉӋJt,B=0#9u5!#s sRh#C 1҉Sss ssV01E1ۋ09)؋r09~ƋL߃=d0t VWWj) 0VEA8HLId t1RPW5x0=d0t VWW) 0X0Ede[^_]UEU z t]]UWVS]0Hdu } t1@09{ u9st7S5x0D0uWVs5|0Cs{ ECe[^_]UVS 050 0t+NdEU  t19S u9CtCt[ 0uh#uu uS$SPC 0 0X 0K؍e[^]UWVLU1u} uĉ}ȋEER艪Xe^_]US]U tuwtttoPh#9{@uRs s8 RhUW$XZ=0th#褃Yh#Zu 1]UWVE5 00x=d0t50p5 0 * e^_] 0ÍL$qUWVSQQ9@0 D0s RPh#H50 01ۍ}WSQRPy U Ƹ8i-;sAeY[^_]aUWVS\]u EUEUEUEU uEU3E3U u uE C%)uu1_Z=P0u <vuE "]e[^_]WP0U1EEƃE9Eu E9EEUEUEUEUEUEUEUEq ]uuMURPZSil)lj$SW wG/ 9raEUEUE Et@EUEUEǺ E"RPMURPcZC1ɉ P01҉P01P0E EtF?N)Eu ]e[^_]UWVS]\TUH} FE 8uh`} XE u h?#h`SP =0t hf#K_L=h01@J =d0uE PP1$Y^E \=d0uPP#XZ1fEfffE@9uރ=d0tE PP#_XE \Ǎ=d0tE PPy#Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\P UWVS}u=010x0y |0h0P^_=0=0=0t h#v[h#VY=0u׋0 0=0ux șRQHz 00h S50050S2=d0t SS XZ5000x0Xh 05x05<0h`05x05|0$01t- 0t%FS5x0{sйSʹϡ009t )Ph##1=0=0=00=0t h#^h #[u 1ɉ 0=00ƀ1҉PTXh P50L050S=d0t SS(^_5000x0r[=0u h"#zY=0tshH#z0h 5050050S4=d0t SSXZ5000x0_=0tqha#PhFSG yLd8So Y h#j$W?FjjWn Ãy}tWMZt8PhF|@SYG y&hF SGG^_PtPY}}Wt9P̦轔XZtP警Xiut芔ߋu0Pz_t PmYtYZxSm 룅t=X؍e[^_]Ƀ=d0tf‰Ã=d0tÍL$qUWVSQ0EЋAEqy AEĠ0Eס0X0]؉E܍EPuuWV^ UMUȉM̉E9މEsMp1Mȋ])jj`SQ` ǡT0U4ڃr h#迯_W!ʈEċxlEHX0!9tPRPh #uT0u< =0t h#f^h9#2[u 1ɉ 01!EPT@P}ЉWE1҉PPPTeY[^_]aÃ=d0tUWRPY_}UWVS EԉUMQƉ׋] 0H0ș9Ή}EE5EPWVuP0;B0u Exth.#tX0@0RPWVb UBEuWVPuU tUB EPE܉UM9E9u9t/MC E܋UM9Mt}u ƉaE9t }tcM܋EPEEPT@PƉ׋]E9u1 ce[^_]UWVS,E @XEȍ]ܹ1juȋEp ޅtPEp[_E P@#EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0hE#ˬ,=0t h#RdYh9#Zu 101)V] CSFV sC8S<e[^_]UWVSPhjjFƉRP/ÃfC9EPjjSN0;B0u UztWV2K_X5d0u  0QrRP3 E@ `0M ȐȔh P50o$5050[^=d0t0PPEZY50/0Xe[^_]UWVSE XChSlEEUE EE=0tP@P @ƉuOEXuh#1҉0YX5d00@0RPWVqS E@ `ChSlEUE Eu h#蛩0H0ș9M}sE E>EPuuunL0;B0u Exth#PX0@0RPuuY UBEPT@PChSls}EgUBXEU}GWEU G8W<50#uTGPWTEUTE@ U B 9t`1e[^_]UWVS8]tE"# Ej$#00}}{rT 9RPYXJ0ws$Ā&1҉Ut4Vh#=0h#h`Xt4Vh#賨=0Fh#6`YRt4h.#kj4t4+XZf%f=tC0ڔڐVPh^#5=0h#_XEPjjQJ=0;G0u Ext+Crt4ljE G0E1ɉ ‰L_XP=d0%JXF^9t(ߔߐVh#蒧E`QB9uР08BufJEf9uwh #@_uS h #/Yu(h #Zu10}t0ؔؐ,F_X01ɉؐؔ0{rT uDVh#ʦXZ=0t hȯ#R^^h#YsS50,XZ0t4*EEPjjujH0Z09u Extuh#1jW2@E܋E=0tP@P @u4puSQRPV EPƣT0X1}9}~h0X01uE)ù`1j@@PЖ_X1U9} MȉыU @ۍzEE܍Hhhs EPUEk[^1E9E~+u܍Lphs EPUE#M^EOScSZYE؉E 9}EWĊXEEԍe[^_]UWVS]KE{,uh;#h&hF h#AhEY11S04tAFVEUEPMU'Zuv vu uuAu6G9{4sEu Ee[^_]UWVS}]O,uh;#h&h` ؙt,h^#h&ha h#F@U Mgu)u؍e[^_]UWVS}]O,uh;#h܀&hq ؙt7h^#h܀&hs h#?UMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}Y0t5x0WVSht#(SWVu5x0R1e[^_]UWVS] u}Y0t5|0WVSh#(SWVu5|01e[^_]US=0t h#趒?j5\0}[Zt!h #聒h#zZYuj5\0sX1ۡ\09XL~$Y0t@Pp0h*#' Cҋ]á\0t%Ux,tP%Y5\01\0ZË\01t z,tUu uuuRUWVu} WVWZY=0t@X@d=d0t1s#0f`u331 ‰Ѝe^_]UWVS0tH X0 X00!`t'RhW#h# "j)atuhlpx1Rh#h#躼 thr#輐0 ǀdƀah P50L5050=d0t0PP$^_500[1111 0!PRWVjh\0h#h#ZYhr#0 ǀdh P505050=d0t0PP\_X50F^01ۡ0dJatP Ph#h# h#01ۉdƀah P505050&=d0t0PPZY50oX0 Rh#g؍e[^_]Ujh0&P UWVS] 1LPTX\`DH0&d󥍵dh#uS, < @y1ۉuh|#$sYuh#V XZ1jVB Y_y'h#' PV_Z@uh# 5 t&hh# V>C uhSV B ;t!h # VC =VB t{S_{ p10VB ^SB{7{h!# =u@uE/Y<{t[StC t 9tt'jmVj$8PVt)XuSx |t*9hu9lux9C q|9C9hZ9lNh&jyXZUs^SZ@t SZ@uH;Et Xyy^_bhu#uY[[_@uh8#VhU# ;Eu1[Ye[^_]UWVS]} 1uu11Eh#uWx tFft1At1PuJEЃpuVhUW$htQDhdv$v tQhU#W>,jVjhdv$v W 6lQPl/SmX1e[^_]UWVS ƉUMjQRPtuh#V_XfUt+tuuh#VSom^111 tuB t@uمtr} }uWuRJtjjh#V~jjh#VjSjjjjjV pfuuh#V~uuh#VjSjjjuuV,E E܋E E EWOM1ۉ]G uuuh#V ~#1ۉESPuuRRh#V EԊWуt=t8juj1RPEUEURPVi u[]PB2EUE UM ]}uSQuщ‰ @tE9 SmkX렍e[^_]UWVSu} hjfY[u)Vh$#ͅXZÉEEU(,E$E U$0418%jhSPVRuhVSh9#Sb<RP6ZY@uhE#B$D%=u?$Phd@c  @uhQ#S&^_$uhh#M, ((Phd@  @uh#뭋, (h#S딋Eu ǃ$$, (uO1҉MRQWV'  ‹MtQh#SV>& (,u(,EU싋$1҉MRQuu( Ɖ׸9ЋM|RVh#StRVQuuh#SWVS @tEjjEP11ɉ @t_jjjSEtHt*jSZYt`@ P$@ t^9sVu jRPS@u7tP/ Xh#SSh 1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@ @u%h,#SXZuShK#S E]. ]US]jSYZuh#jS YZuh#SXZ11;FN|#~$u~,u;FF |F1҅8tZu"[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu+_ZNjF,uVЉ||t2@|jmURj$O8QJUR|PtijWRĕ uYjuWUu!@uuZYjuPUu@v0sh#us[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h#S 1e[^_]ÍL$qUWVSQ qyAQEUy uh#S{ZY8$E܉E1EuuWV  tuWVh#SBHEPuuuuy Ɖ׋EU tuuuh#뷋]9ً]}eY[^_]aUWVSu 1ۉ^h%5lp7B7 _X1td1SщU@&MYZMtUBuSh'#u} D&H&  Vh%j6 XZ똉e[^_]US1L&@&uhC#b`u܋]UWVS ]} Wh5!#Ss 1D&H&E؋E!ЋM#M t:5!#;tf3#UWPSW@&SUҋE!U!E`uE Et;uuhQ#juVf5!#;tf3#WPS要WVS螁؍e[^_]UWVS]} tEU E U uhX#S_X S^u E@P;E sPu hg#S؋E pVSZYEtu h#S 먋EЉE܋EЉE؋E#G0EE#G4EEU E UG0W4S(_@fVSZYM#H0MM#H4Mu} u }p0x4S^@+u h#Sn Ee[^_]USP] ;u:j EP5lp7 U:u1҅u5lp7hO"u Ћ]UEUitstau+u PJ uPZYUg@Rh#P UE ft*u 5lp74ZYt5lp7h#uA US] ;u#5lp7责Y1҅uh#u%XZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h#PY[E1eRP6 $RPn[ZR@8Zfu%S5lp73ZYQh*#P\ ֋]UWVSu }jj h5!#WVj]S yEWVuhC#3}t Sh1$ZYj 7Xe[^_]UWVSQ]M tu ET"EF"QhK#S'M $jFWXZM uWhf#S 9jVQjjuuS U 1ɅuWh#SKVU[‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjSA_Zth#2jS,Y^ujjjjSbEUE Eu h#SXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSZxt h#PP @9E}}EU u h #'EUjjjS@ $ufUY_u h##jPjuujjS9 uVYhH#SZ p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS1_Z@)QFHVL}$E$9EsE܉FPFTy 1;VPsUWS1ZY@UB߃}uujSu@jp juuuuS u hh#a @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9p-tE &1҉Ue[^],(h#)$h#$1RP,(  RPh# h#\jSm uh#CXrX CRPh#s,s(h#s4s0h#$C8Ph#hxVi-Vh.#sPh@# 1e[^]UU E$E8E U]UWVSVEUFV E܉UEUEUEUE9E EM|vuah#WE UEUEԉU؋E9EEM}6u&uuuu uuuuh#W(1FM]3M 3] t?uuuE Uà h#WEXZ맋M܋]3M3] ut.u}t#uuuuu hj#WEFE F E$F$ku}tR#}w+M &#}w M &#w &RQh#Wx1ɉNE C E$C$E;Eu6E;E u.FCstX^EUEUV#E9Eu2E9Eu*FCstX^E܋U+EUFV vE U+EURPEU }PH SK UMUMUMNU܋M+UMVN VPC^sXPtB؍e[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuum  t/E؋UWVRP щΉE؉UMWVuu*  t/EUWVRP щΉEUMEEċE܋] ؉EE] ؉E}EăxfPEЉUԸ]9ظ]A}tE9E؋E8E؋U^9uEE؋U܉EU}TWVuuT EUE Et6EЋUEȉUWVRP* Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}tE9EȋE̋]9uȋE|E] u?9}EEPWVuu ÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@Eu1EċEčeY[^_]aÍL$qUWVSQ ȋ]yIX P@EUw Uyh# %uh#urXZ~th#O_ ȉFV E؉U܋E Eu.E؋U܉GW FGFtxM؋]\MЉ]uuuu` M؋])ӉM]MЋ]9]u 9M9ME}uuSQh#uEUGW )ډVFV )ډFV uFGFtxM]SQM؉]uu  ‹M؋]t&M]uuSQM] M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U M]uh#u+GxpF)^N^ 9MEu h-#~t hQ#FV E؉U܉ȉ+EUEUE9E؋E܋U} h|#E؋U+EUEUFV ȉ+GW VE Eu FGtxM]dM]O_ ˉȉڍeY[^_]aUU Et 9Pt@]UE]UEt ‹@u]UWVSEtf1yAQ $T$D$T$ D$9E E\$ |I11҃yuEԍe[^_]UWVS@]u }(,EUEh#WV?< t(qtsu&jsEPjjS@uvE95p-th&j[^uujjjSlEЉUԃ}u}t.EЋUԃEUE Euuuh#SE$1RP,( Ɖ׃u؉}܋}9ЋU}uuuuh#SjSEZYtE̋EЋ@E Et h#fEЋ@ EjS^_u h#?jSzZYu h,#!x G EG$EjSG jS9 tu hN#S^XPH UMċM9Mu"M9Mu}u he#SY[1p GPGT<9s/jh0&Vm tV(F,9ŰM}ỦEȃ͋u}+u}9űE|uuh#4E؋U+EU9E̋M| h#U9UEUиM}9|E 9ȋU|&}tE؋U܉EUh#SXZE9E؋E܋M u}uU4}u h #SYX UMH0xh#S{XZ1}9}[uujSD@1jp juuEU+EURPS uh&#S @ r $󤋃p PF V$1FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@.Eu}U؋EhG#S_X}ffuS7Y^@,he#À}|h#SXZje[^_]UWVS]1uuuuu11h#uu 7 btENtoat%itClh?%Y1EPS &EPSEPSZY@kq`1;EE}=S0UU܋UUZt&xuPtM9Hu M9uU@օtE 9p-uEU t th&jZYWVRPuSe[^_]UWVS EЋu} jj h5!#RPj]St yEWVuh#}t Sh1$ ZYj "Xe[^_]UWVStƉPZt 9St[Rh#V *{ Rh#$1s3щ¸#$1s sщ¸#WhUW$hV (Wh#htS SVuhh%VXV SVh# GPh#hS Sh[#$jmSj$G8P7Sh#h#G0W4 uh#X1RPhP?Pލe[^_]Ë -Q-y ;-| t-J -Uh-PXZUWVS֋U} $,&E*#` u>h#X ׋󫋃V6h1#XE#e[^_]hA#X8Sh#htS Sh;#`shP#E_#Em#뚋A t h1#.Xh{##C SX1ۉ019u 9tCuE#! #t5!#PPh% h#_tjmWj$8Sɽ1tttSh#Sh#hWWh<#(ZY?h#Xu+u"E #VE E#e[^_]e[^_]UWVSxhh% h#h#x h#h#xà Džp#Džp#s3x pAs sx p$ Ct Ph#K Cs31 W{ WhUW$hPD Wh#htV*VPuhh%PQ Ph#cXZ{ h0h#hVVh #7Vh:#, he#jj h5!#x$K x$cRPjV! x$K x$cRPhZE" "jmVj$G8PVh#h#wG0W4 uWh#fX[tVh #<GPh#hVVhUW$ZYgRPhPPh$"K Cs31 OC tYC 8P)s t󫋆Rh#hVVh:#c1e[^_]UWVS}] u1EEEEh#VS- t^l`~\a wT$P&ut:xuCMÃM뽃M뷍EPW EPW6ZY@uM딃M9p-th&j^_xjWZYu h#X]t UI;]E}1WUM^t xupt9Hu 9uu@܋Ut4hh% h#h# h#h#W+ƃ E#EE#v6 uv v u  FtMPh#yXZ N Fv6U vXZp h&"-Y볉؍e[^_]UWVSD] 1}0&}E8#uhE#uu h+ tditHTt*PLt7olt Pwb&h?%Y1tukVS_Z@ut6PEPSB @u#tjh0&V^^ t E 9p-th&jZYVh EPS&e[^_]UWVu }^_]UWVS]u 1ɉMMMMMh#uVj* tfitLat%bt0lh?%/Y1txEPS~thEPStXEPS"_Z@uG1;EE}1SM}Zt xuPt9xu 9uU@܅t95p-th&jeZYuujjuSe[^_]USЋQfPfQfPQPQ P 1Ҋ\ \ Bu[]USÉIQHQH QH QH QH QH QHQHQHQ0h#RS.]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk&W\ uu wuCJ uRCu1jSk&V[ u%u vuJ uًU EGue[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh#W;s 4 uEyƒt" ~11|u@ugLt;I)ӉtuߋuIu|u@u1Rh;"XZFtY~jW9! ƅjjhSPWk$thh5!#S- Sh#衬_XF1RPh#hSNShN#wthX#[Y[jLDZJjAXu8/-h%j H1jvSKv Shji R@u81hf#N& jL&Éh{#脫Y_ t 9ÉѺ})؉Rh&y%TXZ h#FXh#;_ t9ֺ})؉Rh&y%ZY h#Xe[^_]UWVSVus _uh&h#j1 ƍEP[t h$j juVzFNj] t>sV肹ZYu+C xu"mt s sFYXj 臩ZuXe[^_]UWVSE @80ƅ77Ph"u t 7uCu X0u: ^t h#0p jVhp(< Ttg81ƅ9h(@󥍅8Ph#jPS0Ph#jPuVe VSh#j| S[t h$j T˅t_S zuR(,WsZY,u1(zu%B sV8ZYu+C xu"t s s>YXj =ZuXe[^_]UWVS@J9sr[^_]UWVS]u)ZuPe8E_@u h,&h#u0^uh,&h#j sP3#s Ws#h$u]} t.P Eh$C$u@} E tZu֋ EYLEPh#u }Chs@Pu @qh#u| XZt Vi Yh#u| XZt QK XMEPh#u" E Mu {hE EEEM؍CU`EPu u @Muh,&h #fEftft5fu6t2C t Wh/#j> }tC(UhO#C0ut3hk#j  t C0sHtS4KL9sщ}t:s@shu誠 us@s`u蕠 @u;4I81t/sl`}t$CU[s@s`u_ @uEsd6CptSuZY@u s\h#s8sXu' @u s\hUW$te[^_]UWVSPux Zu1iu y _tQVF Yt=WO~ EWu { MuS V. [^PQS9{ uV ZSx X؍e[^_]UPEPhqB$u ƒ 1tEUWVSu\Ph'#V t\Mfnj4Zu\VXtd$1jRV,VhiSߞ@tt}f1RPh'#u  1e[^_]US]uu S? @t ]]1]UWVSu uYy [^u 'P辇 Y9Es ?Vȇ Ƌ}M)1Ze[^_]UWVSu ux [^u PW Y;Er裺?Va Ƌ}M)1Ze[^_]UEPhi"u ƒ EuMUWVS8uEPh#V uh7%hP&hh#h#V#x _ZtP迆 ƹ}[E]ShiV5}ĉjS܄ Ph#u x ƃ SK Yt=EUu؅yكۉM]! EjEP腄 XZuVh#u "x V He[^_]UWVS1Rhiu4 @t|j7RPh#hSހ>tVh#Vߨt j7RPh#hS@;tSh'#輛S袨\ e[^_]UWVS]h#Sv Y^tVP Zth7#h@&jVh#V ƍUܹRhiS3@u hY#j e[^_]UWh%1󫍅hPhiR3 t|}UWVS\Ph#u  uh7%hؕ&h0h#1dShiu13 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVvZtÍEPhF$VA uh7%h@&hh#iuS1^Xu h#j$ CPS袁 ZYu h@&h#Ph#u :u uh@&h#j Si1e[^]UVSSu] EPSV @uh&h #j h#V+t ZYuh%h&hh#蟯#Eu$C$PRSt He[^]UVSSu] EPSV @uh &h #j& Eu h5#j h#Vs ZYuh%h &hh#Ph#S"t He[^]UWVS}h#$WNs [^uP证 pY@vh!#VZu h6#jq VPh#$W@u hO#j' xtdPhiWp0 thf#뮉`SX`e[^_]UWVS}h#Wr ZYuWrP pVYXuhs#DVSh#WE@u h#jv 1҉Uu]EPhiW/ @u h#ju SX1e[^_]UVSÉЉʉƃ ι#u5!#QuRPSh#֖e[^]UWVSu1jS,Vhxi P謖@uh# UЉUPXۋUu h#j U]Vhxi Wf @uh#ڋE9E~E1}~ WhUW$-FXZ;u} j <Yj 2Sj膌UVSPuVZt"ÍEPu V @u Sh#j- @P9UWVS$ƉUЉh#Pp [ZtP, ƹY1@]Shvi V.j SM} Ph#up à V輙 HZe[^_]UWVS0]EPh"#S^ uh7%h&hfh#膫MԋU ;@uE̋UЋM]Mĉ]ȅy+كۉM̉]Ѓ]!ىΉЋU!Љ E UȉƉ׉u}j EPv| XZtVh#u p V He[^_]UVSuV[th$V,o ZYuh%h&hh#蠪P} ^fx PS+ZYu h#jP PX1e[^]US]EPh(#S u 艰&juS,ƒ 1Buhȕ&hUW$ XZ]Uh1#聵1US]dPhU%S uh7%h\&hh#轩d|lPhiS+ @u hh# X1]US]dPh X%S uh7%hP&hh#Hd|lPhiS>+ @u hv## X1]U1EEpPhiu+ t hf#j 1Uh#u3m ZYuh%h0&hh#觨Ph#u m HɃ0 v+BwBÍBwBU诮]UWU1ERhiuG* @u h#j 1}W|$wUWSÉЄtGjj h5!#QPj]S螲 S z5!#t#PSh#6 h"¸f3#Xe[_]g_UWVSph uh&h#jL jLhr-+v_Z5!#t#jmhr-vZY¸#u5!#WPSh#h-.=ho-t VW?Xjmhr-uZY¸#u5!#SSSSSPSh\#h-$V jdžUEU P]UEU P]UEU P]UEU P]UE1҉To-To-1]UE1҉\o-\o-1]UE1҉do-do-1]UE1҉lo-lo-1]UE1҉Pto-to-1]US]Shr-tYZt 2=CЃ v؃߃Av hr-Z>u r-1]UE1҃t`0]UUpo-t H9t@]UWVS81ۉ]܉]E䀖500EЉ]ԍEPjJUZY@MЋ]u h#EU׉uȉ}̋}50ɚ;EEtJ*EUʚ;EEt$ӃMЉ]ԉ11EȉẺEЉEԍEPϹ[@tEЋU ЉEh$j2 uGEċ@C t@PYEąt݋@EtCt}tMEU9u2U9u+9u}SEZtjEP Y[=0u4]늋U9ыUjSZju޿j蜃EPjSZY@UE]9u]9u9}~ 9UȋU}h{"j  UWVSÉHPZtP_D 1D1V9"LY@u h &h#&RPHSƃ uh &h#j R1RPh#hWWVh|#$ jVW_WhiL @u Wh#t Ph#ًXZjVWWh~iLË@tt Ph#蜋Y_j 贊pHZ@uh &h# u =`o-j:RPh#hW?tWhA##W | j:h#hWa?tWhS#݊W×| tHSW?YXjVWDž@WhiL萊uh`#mXZjS#jVTWDžd1hlWhiL7 @t|hXu ht#l@1dWhiL @@u h#@lh#踉@R =0t%oA"w&Rh#}Y_HS XZ=0u0=0u'DjHSDP jV`VrV0-{k?PL@uG$=0t#PjJ h%# 0%X th$f3#X thA"f3#oX th#f3#MX tRPh#3 h%# 0j_ th$f3#^ thA"f3#Y th#f3#Zj 谆5Xo-X%SV65po-tjHSVv e[^_]UWVS]S^t EPu S @u Wh#jx u _ S_ Y^ Etuh&h$j EP赲EZt h$j$ u1EVtRUW萕ZYU}tRUuqZYURhqB$S2 tFE= 0tFtj= 0tFu[= 0tFtL= 0uE=0u+Hu)}tj #Xh-v_ZY U6"=0tj XS= u5 uuj3|UWVS,ÉUP(^uh#@h$Sx` ZYucU̹ Rh8i(S @u(8t h$j jh$u uh,&h($j Eܣ 0 0u VhE$j9 e[^_]UVS։P VSPhW$j UWVS]U ho$S_ ^_uh'W%h@&h2hy$&‹ 0ށ؃E u %ERUm NjURn WP)tDPEVfZYUu #9ERE ËE É 0X1e[^_]UVSP]U Ch$S^ ZYu 諠WPBm Sbm VP[)Ãt7EPS5 0莮ƣ0S1Fu{#U 0e[^]UVSP]U h$SK^ ZYuh'W%h &hhy$这Pl Sl VP(Ãt7EPS5 0ƣ0S1Fu{#U 0e[^]UWVSS]U h$S] ^_uh'W%h&hhy$ Ƌ 0%EVk Vl WP(ƃt1PuZYu$EM É 01e[^_]US]U hEPh$SI uh7%h&hhy$q 0%˃ uˁEU ى 01]Uh-h$XZUWVS]h$Sk\ ^_u3h$SZ\ ZYu"h$SI\ ^_uho$S8\ ZYtP 0 00!‰ 0d$1󫉕tVh7iS @u h $jM e[^_]US] u;PhUW$̀E tP踩Yt Ph-$詀XZEPYtPShH %荀 %܋Et Ph6$pXZ]UWVSuV[u h#/VYu1P4Z@u h&h#p 81jS8PH8Ph8i(4@`%1󫍅`PhiVT @uh&hC$j tWphS$X&Ht#t8uP9u QgXVh]$IXuShd$qx_XjPY^u h 5"jn \8Ph8i(4~ @uh$HPhx$~h|(%HH9Tt$h]$~h|(%Tj)}j }P4Z,H%(hS$L~&_1ҋ0t` &xtO(9u 09t4#HɋL f3#u5!#QPhH %} ,딅u h%}^j |YjmZti 119X~M%9u>uW誥Ph$} h$v}h$4j |F뫃 u]e[^_]-e[^_]UWVSӉϋuuU 0 U Zt2tVWPX u3j 1ɉ [u1VU ZVL 蟙 Xe[^_]UVSu]}t wjwk NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjP6uBpWc Y_u ͘ ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URPЀƉ׉‰ 9иr E8tI8"uo:;sC| C 9s} "WV Y^u  볋K(PUE Z@tE}G _C G1e[^_]UWSËtP] X1e[_]UWVSÉUMU1}E;E t[ztMUj8 ^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(P0XC$ue[^_]UWVS1@}u ۖ-E@} uE@ } u"PRT [^uPRT ZYu덅LPhi"E 0 tu 112L 17 uu_tHh%HP=iH,ZYu Dž,%E@0tj/S./Y_0t @0`1DžTXDž\@PTP,Sgǃu.@xuP0 EkTtHu@xPSYZHu.fDžtt0u_SXDž,uTtt,ؔ1҃0u$SZDž,T(j DP0,D (t8t,v ,vL"ScX%Dž,(SJX(jDž,10dr<wWr<w7 0 u0 Ј0E޹Eވ0 A$(P_,fCNj ֋$B$@tPa^(S#] S  LEHVUE [@2Ex0$,S ZYu,Sh̢&h$j @PV\ V uh̢&h#j SEpE0"P uSx h̢&h#j Sx XE}G }xG }G1e[^_]UWVSu]}t W Zv ߐW Yuǐ #NPڋE Z@tEC sF C1e[^_]UWVSU1EX1u܉u؅Cu3}Ej1ɋUE ?E1҉Pupup Y\uu}Wu Pu4EAuUw }uE$EXExtHu E؋Exu[}t1}t.E謏蟏}ue[^_]UWVSQu}umEX$Cu S{0u3PE 0^M YZun?-uGPRU<YZUu{(WR'YZuA{ Cu CuHPE 0 M YZtPE 0L YZu^赎CwH$&P` -w7 w7Y XZ1u(7 _uCPh.$j ȋK 11PE 2Z@tEF EFC4FCF1 Ue[^_]Ujj$ZYt$&U PUPUP UPUPUjjyZYt&U PUPUP UPUWVSu] FtVuVVPX1;}t$jXt0TQ1҉FNG1 VuVVPFXFue[^_]UVSuj(jY[t2&EC1҉SCCuu SB @u SX1C؍e[^]UVSj,jhY[tDÉآ&E CEC1҉S$C$C(uuuMU @u SX1e[^]UWVSPu]1҉U1+Ei̋M ;}|1_t79rGM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EVr EtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S: @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps @u܃C4uu P!Z@u1]UVS]u jZt$pSuCCC]e[^]e[^]UWVShF$uH hM$uH tÅu'j`h &hT$-f趉 VnV SfV Y[@8FthZ$^F1󫍅Nv󤍝tJvr󤀽uCU9 t h$j |t uh$jP jS PhJiu @t1 h$Xe[^_]Uh-h$LXZUWVS, =0 ƅƅF1RhKiu3 @PXujP Y_VjWhQRPt*qpujPm XZpVjRhVpQP.*h%Wy$,h%RyZY,t $tRVRSPh$je[^_]UjhIiup @u h$j 1US]Dt-9t@tu<0@5<0螑 X ujjS(<0 u Dt-Dt-]UWVS ]UUEt ;0uKL-f|JxuEuE} tˆUPu NZYUtC}t:=P-‰EHffUtSUBf<fuh8$E9r^hk$ E9rhO$gbX1_EtE L-WtU0 L-fW ƒF-C+UE9~)1E؍e[^_]UWVS]u ~;0uSL-f|PxtN=P-119} fLOu0t ,@t@ޅtt SVh|$SPhȉ"Jh %hz7$;hY19};Ph1"%hGXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9s萄1LuÍKكt :M؍AMPZtfP׋Me[^_]UWVSQUU} uj[Uuh#RZu h#j jPVf u} ]e[^_] gUWl$1E|Ru ul}UWVS,E u:[u h&h#j6Y@uh&h#j PFZ@u h&h$ݍF1jRw su^_C xyDž@Rhie @uh&h$<ZYq:u]S 0PjjhVPR$u+t"%t$VPh":e Xe[^_]UWVSu FPZuŁ8+u1h%j? \`%1juS t \vSh iRd @uT81tJ8/th$Xpe[^_]UEU =0uRP*ZYE E$3dUVS] t4sVusZYtC P;UuPVZYft1e[^]Uh-h$AXZUWVSSÉ։M1S>_u}uJh$j jh$Pq uWP-DPtVh:iSf @؍e[^_]UVS]u1ɉh@uh&h$j EPh$$SV u)EfEVh9iSƒ 1Bu h,$j6 e[^]UVS ]u1ɉ@uh&h#j EPhV$S t,juV E؀8t-EPh$$S u))EfEVh9iS=ƒ 1Bu h,$j e[^]UUE9@t-EMfuu 8$tURPh?$a ËPt<f$Pt2k$P}$Ptq$Pt "øx$ËtI'k$t?x$t2f$}$tq$t "ø$UWVSljӉʋuFEE9s]19tc  ^w@v|UShz7$W% K 1UvAE9s:2UFPh1")ȉMPM UuRW u9utD7...}e[^_]hm1e[^_]UVS ]uVhiS @u h$j EPh$S uh7%h&hh$vE߉EVhiS uEh$XE1e[^]UWVS$]uӹ!1j EPhH%S?uh&h$j EVhiS @u h$j 1e[^_]UVS ]EPh$S uh7%h&hh$uuVhiS @uh$E؉EVhiS @u h$jV 1e[^]UWVSxhSh2 $u@uht&h-$j DžDžDžDžDžSh@$_Zu?Dž1ɉDžDžDžDžjShH$ u ؉8 P-DytRx:uL҃0jWVh%Pt;9u8tMhQ$j jRVjPdƒuz;t 1҉Ŕ@|Phi8uƒ 1Bu hq$jb e[^_]UVS0]juVh $Sо@u hh&h$VT Zu Vh$j Uf@fEލEPhiS4 @u h$j 1e[^]Uh-h$XZUWVS] 1}EPh8i(S @t&E1r r%1ʹ|󫍕[!RhiS @[< v Phg $j h $[[P\P <fDžLVhiS @t%fNth $=0t h $?[XfDžLVhiS @t%fNth $=0t h $ZXfDžL VhiS @t0Nf=) Ph $Z_X=0t h $ZYfDžLIVhiS9 @t0Nf=) Ph $ZXZ=0t h $iZX1|󫍅|Phi8S @t}u(j UY$PhiS@)_h $ ZEEEEĉEEEԉEEEEE|Phi8S^@uhB#YXr}uMu u uuBEH~HEP-DJtx:t~&jPh@$_ uWh $MY^_Eyh@$5YY111Pt՘hXZGj,(XDYyh@$XXh $XY4t8h $XXZ h#XXj W_PhiS= @PhiS! @jh`&Pe u ftePh $JX[^Vf"fP  Ph $X ft Ph $WZYj WXe[^_]U81EE1҉UUUUUUUUEPhi8uF @u hq$j 1UWU1Rhiu @u h$j 1}UVS]EPh' $SF uh7%hȥ&hNh$muVhiS @u h# $j] 1e[^]UWVSÉUPhUW$VScǸ) 6 9|jwUXe[^_]UWVSƍt1fDžfDžRhiV y h $j% h' 1p)֍H(@!P }_9p}p' Džp h $hR<%h $h $h $h$hx $pph# $RU(G(\G!PO(!W Y`0t `0Ea0tI@tc@tC@tP@ tS@@tB@yA@_GlGdw19~L9}B`fWGu uw%k pfx p@tp d#z= tt= w-g [=wOf?v'k 11?1p%1=$v-- 1p-1ƍG P h`0Sld`VPPpphL $SG"`G!\ƃ0`*w/wNtA2FltU0W=0FQSPhw $h} $RQl=0=< $5 $=0$YdPhUW$RXZi"d9 ʃl5!#y$lRPh"?RC%빀=0FPFPFPh $h $ RF1d^1ɉll9d&j>P[S=0FFPh $WKStRTRPh $QRPh $Q l대=0FPh $UQXZlF=Ptlbh $hUW$QY[=0FPh $PFPh $P^ fdV\D $t5X\PQhH %P\K zm"XdˉX\lT\l` $XtWlI $PtV $Ptf$Pt"PQhH % PlX zm"렊dزT<\t=PuEFu:h $hUW$OXZ=0%FPFPh $O t#=0l5 $h $hUW$JOY[=0FPh $,OXZ1D dD ҃L ll\5!#lte $dRP\Q4&h $NCuh: $hUW$N[X=0FPh $NFPh $tN^V l\lD $Xt5dlPQhH %+NlK zm"dNjXfld\ Td\` $tR\I $tV $tf$t"PQhH %M\K zm"lXkT؃dPh $IMZYkl=0.N=0'$&j $} $ts $ti[x $`} $Y $R $K $D $= $6 $/ $( $! $ $ $ s $ $F)`j }K)hXh'e[^_]UWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh? $}XE1e[^_]UPEPhJ $uR uh7%h&hh$/bME\UPEPh $u uh7%h&hh$aMEUVSjjj"A y hS $\1ɺxBhPSHq y hm ${ZuufiuS2r Xe[^]UpPhiu< ulh| $Xl$Eu h $j袾 EE1UPEPh $u uh7%hԥ&hAh$`MIE@u h $jd 1UPEPhQ%u蹰 uh7%h&h4h$S`M E@u h $j 11 w-USE UUXt=EEEE1҃UjURPe 뺋]UE Puj US]SװPhH $jΆ Sd0P0~ UuUE Puj贰訰j茆 UE Puj蒰膰 Ã=0tMUEE EjjEPEPjEPƒEBuhY $XÃUSPp jh&n jSn uSh~ $6jPoZ@uSh $jwc]UWVSd@u~Q1}=0tC&;Et7EE jEPjjjV:@uuSh $O 1ۉ]]]]]E}W]Sj5cVSj,c%Ãjh $MZYu $ $1uuuujEPj|l E!"1}jh $hv# EPh$k h$hb$j萄 jAbu6h$r[jjjYn jWjebjVj[b_1ɉ w-jEPj$n u5c8tih$Z+U9uU,Rh$jWjbjVja q Ѓu,t$h$BjSl = w-k = w-tjWjajVja w-SӃ  LEEEEEPj Xe[^_]UVS]E pt&I>v b![^]USQjj]Sjjh w-裩th "ua0Zu h 5"jC jjSPjh w-eu‹E0]US`Ph$h-/Hh-h$Sh$h-H j:UE E ]RSUWVSE u}8@D$ 1%$1D$D$ 1 %1ۋ$T$ L$ 1 ډ9t&(  9\$ tl& P&11ҍe[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t&/ $ 9L$tl& P&11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]& $09tul& EP&11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t& $9L$tl& P&11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t&9T$l&uwy|$y|$L$ ˋL$ ˉ$4$19t&9L$t$$9T$t$ P&11 [^_]Uh=u jjh@w-u71҅tPUWVS jEP Eu_X1E9}2uSPNZYt!SPtNZY tG1EEe[^_]UVSQË0tRVh$EPyV5ERfwZe[^]UWVSQ1:nuzouP8wX1҉Uh%P=u ZYt98nuxouSPZYu}SPZYuE1V蟞Ee[^_]UZPPPh$h-Bj5UWVSÉϋu ,PQ ZYu Wh$1}uHt*hOw"V ZY41yG"Uu1u4hC%,PL^_u)w"~u M }jP蹐 ZYt1ih$Vjh$WyK uU jZP,P@K t% 9|\ 뭋QRSK u0 0u1Bh$Wj Vh$<Et!#Etu#EtyG"Et6#%&u0P,Py3 ZY@tjj@ u^_,t#jh$SJ uh$VC5Y[0>w"tSh$ShL$hVX:0 ,Dž@h%,Pb+XZ9 PWtXZڄtVB L<-u.1j=V@ Y^t$S@#S4Q ,t1ɉL=0t>}uh$i:_17=0u卅$P Y@uNh#ѴXA=0u}t2ҋ4h_%:GXZ9j -9X=0t=t t6ht"jX t 赙XP訙=0tj}t0$` j` j( @u h$_w-,W3ha)%h,R7P,R輫 U8tV,Rh#觳 ;uU8uWVWh$腳jgT t ǘ[P躘Y}u, Ex](` jj R WS$^ ~)t}u2h-,P赡XZj P$~^ ~j,P_ @uhH#蕲X,Ѓu ƀt&qttP萟PVho"1H}0 00SV. Y_@uVh$XZ e[^_]UWVSj Ph#$%7;11to&tZ&t =0t>&F]$tf3#QPhH %6 !ǃ 끍W#]$tf3#WPRh6$l6udtj]$tf3#PhK$<6w t 0hUW$ h#6XZ=0KtSp+F=0u=0KtSp]$tf3#QRPhY$5=0hf3#hUW$5sds`sTsPhk$5slshs\sXh$r50=0~chSjjhOw"ju.t%j Sl^_tSh$5 h%WY'"tκ#PhUW$4XZ 5!#He[^_]US] 1t-tPuCZYu01=0]UWVSEt48nuxou 0PX1uhǾ"خX1Y,u@B uP萋_uh 5"訮S[^ljxj,SMZYt X1e[^_]U?OPh$h-W7jC*UWVS]!11tE1҉pp7p-111ɉplh$u u 0r=dS6EXZEE FEe[^_]UVSSPPVu ujVSh]%茴 ,@uLJtv"t"J0覕Zv"tv"PShw"j jY$UVS]u VSA YZu Sh`w"j ;/t"Shuw"&XZu Ew"e[^]&e[^]UHPhX$h-0j#UWVS]E1ɉ#11d111lhh$u u裌 HuLf$M,9tQG.C|g$@&UC| C|C|C|5lp7 CpZDžlL5lp7CtXDžh.5lp7CxX5lp7Xjuh&5lp7Yu hv"jZ PYX5lp7hXDždC|p-P;Ut0ttSxt SxߋM |u4^uWUEhtFlt#uuxPW葽Y^@uRWh6z$j蒟 xPWrYZ@tECp'xPWXYZ@tǃluECpECtuE%CxdupV肥V@$XZK|ǃe[^_]UWVS SVdPhWu u hWdSh%賰 ,@uSVhx"j袞 f@tKRPh|&hSoSh$)0jj USP]jEPSܧU :9uySu hx"jߝ ]US]SdZt@ h"SZY]US]SiZt@ hj$SsZY]USP]jEPSHU 9t :uy Shx"jT ]UVS]u VS YZu Sh`w"jU ;/t"Shuw"%"XZu Ew"e[^]"e[^]Uh $j UDh($h9$hV$h$h$Ph$h-, jUVSQÉj EPSp U:uVSh $j e[^]UWVSuEE@t"0 1VFe[^_]Pc_u hǾ"jV VP ZYuje]e[^_]ćUWVSQ]E10u1w-hk$u u 2F$@&=H0tD0뷃=D0uH0c뛁K뒺alp7C8K t L0hK\cPDlp7jC@K@2K&glp7@P s4K Ilp7C(KK@KEPuh@&5lp7CTƃu hv"j誚 Et L0tctKtK@tK t=H0D0 s=D0tH0c@tKt1҉,x-sc sKsC  sC sh"V#R@0Y_Eth?9%V RC$KXZEth/$VQC KY_Eth5$VQC$KXZEth>$VQC$ 0hN$XZjQ^u1RPh\$o 0hl$^Y[hz$LXZ1e[^]USP]jEPS5U :9uySu hx"j8 ]US]SSPZt@ h"SZY]US]S$UZt@ hj$SsZY]USP]jEPS衒U 9t :uy Shx"j譈 ]UVS]u VS YZu Sh`w"j讈 ;/t"Shuw"~ XZu Ew"e[^]g e[^]UWVS]fU ffCffBCffBfCffBs sY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssY^} GWssY^GWs$s Y^G W$CDȉGDs,s(ֽY^G(W,C@ȉG@s4s0軽YYG0W4CHȉGHs$&1t<16 1Ƀ 1Ƀ 1ɅtuRh~"jQ~ 1ɋuЋ} t1M&8"t$M tM9uM9t Suh"맋E9ƉU}7=|0tuuWVSuh9"uuWVSuh9"?9u؋E}<=|0tuuWVSuhi"uuWVSuhi"jt} e[^_]g_UVS$=0tPh$h-  h$Ph$h- h-h"LrXZ=0&ttsh#h-A  j%=|0u UPUWV=Lx-uHH׉=40t&ɉ HffJ=Lx-u f@ffB^_]UWVSƉ˃=0t/=x0t 1}mQd080Pu% Pסd0RPSu50w3 9t $0VoPWVh"&$j"&e[^_]ÅtUWRP蜲Y_}Ã=x0UWVSSƉˋ d0=0tSu 80Qw S׉ș։ЉEMRPSu502 9t #0nPWVhH&$j$ue[^_]Ã=x02W|$wUWVS#Å=0u0BB400 d0 ;h0l0ؙ=0;|*90_1)։ؙ50pؙQ Y&JtRz!9t !9t ҋ1҉ؙ=d0Q 3Xe[^_]g_W|$wUWVS,EU؉M܋ 0A Id t150)X=40t050PPV 0xU tho&$0'{X0H xU t@\M؋]ȋM؃=40t050PP 0A Id t15000JH,1X9M؋}ruuh&$U 0\E1ҍMQRPuur lj֋EUEȉŰϋEЉUMԁ}Tt.CЉ‰!!SʉEUԋCx1RPuu K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK0500_\T0@xRPuu Ã=40tKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋuAe%ClRPuu Ã=40t]Su,XZ1EtttpvY_DpTtF u1ENY_Fu @ߋud%CP0H050EЋUpXe[^_]g_UWVSQEӃ=$01}=Lx-tBBfCUC)f UZ[^_]USÉЃt't7uFɃu0 ='Sh&$h- ]W|$wUWVSLEUȋ 0A Id t150yY=40t050PP 0xU tho&$1҉U؉U܃xh&$g"_1E؉E0X`u؋}܉ tu}}zU tStX~KM< Ʌ0@8EU܋0J9M؋E܃|R`뮅tGt%b 4!Ή8뗍 ?!8u{!8hvSh&$h- Nt% tSt1\uWEah'$Í Í ? # Sh;'$h-T 0$~?0EE1uԋEЋUEUClM 0EH00EHesE@E=Lx-nKdu؋} t1RPWV }WTU u}WT }U P}t}}}GXE1}EEċKdu؋} t1RPWV MQuuRPk EыEȉEEeƉϋMUeuuRP Eȋ}EЉEeЉƉϋRPWVW }f E9C0u'=40050PP K4EDS8)‹}W S8)‰ }W$D4Ɖu}܋0 09A8~zU tR`˃]1ɉMM]ʋ]؍ @뛋 0A Id t150$XE؋U܍e[^_]g_W|$wUWVS։ˋ@1󫡀0=Lx-t@fxfDžAoxԡ ‰|fDž y-=Lx-t{-0@40u 1ۉ,0@DJL!ȉ!؉ pZ4JdQyt@f fDžAa Ơ ‰P(,iKL04H8)$ 0ǁ\Tǁ 1A0QtAx1AA8A$1A@AD<A4=d0A|ǁǁ1҉XǁLǁP-ǃ\Tǃ1C0StCx50~4F8H GډSWRP ӋRPSQ ȉN8ؙ)ˉ^ <~Ntn0؋ËቅkF0 HËË048<k9}VRPhr)$({ L00@x<8@)׋@8tD11UP0ӉʋKT t1҉ u1RPWV  uDž1WV  9؉s(WV^ ȋƉϹ19s11ۉB,$1~ ȋʃƉ׋˃1ɉ1׉11ۃ~hH` tσ1 1Ӌ@0)H11ҋ)׉ߋ1RPWV 1Ɖ׋ȋʋRPWVP 9sv Dž19s H11WVRPe KRP= ȃȻ)щWVRPf F 041~ H`9))HRPSQ? 1ɉ ؋Fȃ1~H`F9}Sh)$G 0C`Cx1CC8<Hщ)9~)׉8<C,B,$1Ʌ~ @SL!Љ=Lx-(C|HL!ЉjjjhjC4Pj£0uj'0H41󪡰0H000H4 ډ0)ʉ0@`#PL ~ PhHx-P<H0PXD0P\T01҉PTX HfǀƀF0%ƃC4D8<KC,ș)׋C)ȋ1)׉C8HK` tƉ׋Й)׉!lj!׉11ҋ!~ ) 1҃1)׉@D04=Lx->C s(H1 0t ǃ^F=p0s0Kd t1RP߭ڍ%VV$h)$ 0 ؙy8PۅI4%WW$q,h)$l 0A0= @ 00=0u\Tu kУ0jjjhj50j蠡£0u090uh0*$j&Y 01=x0Lh0l09|RPhK*$ h0l050 d0H&[t?t  Lș)FOu뺸2=$0t?jj5(0S$=d0STb d0uPؙVpjV uؙ=d0VY00Xlj=40t PRXZ0x0\=p0~ hc*$XDž=p0~ 0A,XÉƉ׋ǁ\TtA!A1׋AId t1RPh#jj;f-ftRhht@Pg DžPu ftp0=x0tu1'1=01w,10;x, h-. 01҉牅8[9<}Ƌ\TuAЋ!AAA)uky4D1ҁTtYӃY19Ћ|h*$~ (_01=00CU C )C50$~N`Cp=Lx-u*{tFx9sCxNfKxF,H9u fSCf{CTCXȉC\OK`ȃ~:=$0uCh|{lN`Cd9sh*$ %P[00P t+)lj1ɉ1xU u@\€ 0H xU u@\€ 0H ?xU u@`¡0@`0$~%0Bl50F0=Lx-~!{809rKd1VT~U uVT~U t PFXƋP1~FKd1111f30@8P!tx 0)D4)Љ09s?zU tR`ك 20B$C1ҋ9r)0H`艅 00BY89&zU tR`A`0$~%0Bl50F0=Lx-Kd1VT~U uVT~U t PFXƋP1~FKd1111f{89rN050$.Nh񉍸Flx1Dž1҉)D40;xsxU t@` 0@$벋!ʉt:@t@;Npr1tɋ$9~‹GDž붅t$9~‹0B0;0u^=40t0s4PP 0@00Z4Jd150000H41[0Z0 } 0؋50=40t500P504 0X050ދvxx 0\t4Tu[7%FlI7%CPO붡00𙋝ڋÉƉ߁TtAЋ!A1׋AId t10Y\Tt=p0]s80){0ƉK`Cx1񉅰69s)9s06%Cl뀡009rߋ 0A01q8𙋝ڋÉƉ߁\TtAЋ!A1׋A׋1Id t1(Z~==x0j.X܋ 0𙋝ڋËƉ߁\TtAЋ!A1׋A׋Id t1|(%u5!#WVRh*$9]=p0D0P,t,=x0t h"uX1j vX1b~j RX=x0tjtx|m_u=0th+$v5004=Lx-0FF4+=_w h+$jD 0X󥋅`1=40tR50蘾[^0=t0t ǃ\8 50x\d0RP| SMY=40t00r4PP蔽 0X4HdLH t1500Z;0sE=40t0r4PP8 0@00Z4Jd150X5050a0@4P50paeY[^_]aÃUWVSu]tV/D _uVh"jB `1ɉPhd@u 2 tGRhedAu j @u!8tuh؅"HXZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h$˨ ƹ ߋSh"V4 CPhC"V6 C Ph"V6 CPh"V6 CPh'"V6 CC,$C,Ph:"V6 C0PhO"V6 tP X}!uhzd@u  @RhedAu  @uuh^"j4A 41}󫍅Pu_^_@4ȋ99t(Ћ}1ۉ1E1ɉ [Eƀ*Pj PEP j_ e[^_]UWVSu]tV_! _uVh"j `1ɉPhd@u K tGRhedAu 蚫 @u!J8tuh؅"%XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h$ ƹ ߋSh"V) CPhC"V C Ph"V  CPh"V CPh'"V CC,$C,Ph:"V C0PhO"V tPڮ X}!uhzd@u J @RhedAu , @uuh^"jd 41}󫍅Pu0<^_@4ȋ99t(Ћ}1ۉ1E1ɉ [Eƀ*Pj PEPl* 1e[^_]UWVS4}jhPjWtGjPjVWVC u$U ʋMQ؍e[^_]UVSÉыS t%[+Y%$<$+Q$T$,$e[^]US33219~i-@=B'2Bt2[]UuPh1$h-荫jyUWVSSEӉ΍Q1f~WS ZYt(}t{=3ujjW tu SNSGZu5xp7_ PSh1$j xtuh1$j PV}tu 0u( e[^_]UVS=3t!3g PhUW$hh`2å4jjP[ƃ t3g P6h1$hh`2荥`2e[^]UQPȉE1$tEnPhTW$蠦XZUWVSÉU܍Esu{h2$t EPEPEPVEPhD2$HfERf Ph_2$)(EPEPEPhk2$ uf Ph}2$uf Ph$XZvNE9sGGPh1"ݍe[^_]UWVS0ÍEčs<3tEătE<u/<3FVPVPh2$j<u+<3t{FVPVPh2$;uUEع}uCfE<3t"fUfPRh2$ݤ fPh2$ƤXZe[^_]Ujh3j @u h2$j UVS11 2A9ut 2‰Љ[^]Ë -Q-y ;-| t-J -Uh-PҪXZUWVS2~+2\-.2H2$t")2\-]2xt%=2t >1ɉ 2\-h-h-ۑ2 2%XZe[^_]W|$wUWSøth3h3$XZ5X2h#3$5P2h<3$H3t PhR3$_XX2t?P29} hc3$¢[()%MMEuQQ$h3$蚢 j 象P2Z1<3H3EE(2ۃH~- 2]PP$G: %RR$S02QQ$SEWW$S h-PP$Sh3$<<322!]22Ezu%ٞzu%=P2\$=X2$h3$Te[_]g_1Ujj8XZ1=P2P蕗U=`-u =P2ujhuuX2ZY9`2~`2<3ueUSá22xFأ222%w%r\-y1]Y]W|$wUWVS2X2ff2T22=29=2u ; 22f2f2]f21Ej]Sjj5(3U yh4$[jh3jjh25(37 y<3t h'4$!_EjSjj5(3cU y hD4$j h2jf [^2T2f2<3 s$ 2ɡ2ȉ 22s2 23}f2Bf224fpjh3jVP5,38 Ã9t:y h`4$YSVh3hg4$趗h-׌Z1`-X2% X2 `3X2@X22 222 2u2 2 2 22Av.}fE fEm]mE22 %582=<2 222@2U u}fU fUm]mU}ЉEΉ߃ɚ;~ʚ;Eހ}2 22 22H %؉ 22 22E22=ɚ;~ 22-ʚ;2H2rW 82<2 22 22@222=ɚ;~ 22-ʚ;2<3t ;<3te[^_]g_UWVS<ÉUM<3tUUEčs}uyMăA}9}fE؍t E;T2uJ122u5}t4<3u+JEPuh4$C Ѝe[^_]W|$wUWVSEU܉M7C]<3MQURuh4$ۚt h4$ʚXWh4$辚<3Y_t,%E %RR$Ph4$臚=3t"uC-e[^_]g_Oe[^_]g_US%=d3u5!#蘵SPhS=$h-话j蛐UWVSƉP ¡3_tEtPh>$E 39U|} Vh?$j tt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ 31҅w =w"=w'=w?=w W=w F=v=w=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPsX PVh?$ SK PVh"?$ BhPSjPVh0?$S^PCPVh??$ȗh-(Xe[^]Ãt"¸g?$7tM?$tUR-ZøZ?$USљRPQhS0h-S] -yUh-j XZá-P- UWVSDuh-ue[^_]ÉÉh~?$`&aXE1ɿ!t0\Љt }uCEtHP1DA u1tЅ}t2}uKU1ˉj.h3EPjf:U1ˉuV VPhUW$j.h3谔h3h_%XZT53VPh_%ɕG 0=3UWVS @<tPh?$茕Y[C&tRh "Ph?$c^_Ph?$SXZCH<$`&h5!#C Ph?$'C@& Scssh?$C! &<t&<t&COS C #CPh?$躔CZYPfwk$&h @$h@$萔X1Zh@$h!@$h/@$hځ"l_3h4@$Z^!h<@$HY PhF$5XZ뢍A9shC@$% EԍsfCfhw:ffEPEPEPEPEPEPhP@$ғjfEPEPEPEPEPEPEPEPEPEPEPEPEPEPhs@$mF$HF$Rh-G#蓉XZUVS$`&E׉Íu 9stMtJ@ShwF$RXZe[^]UVSU %tYE uLjjEP~à uU1j.0ZnY^ƅth3@PYZuUuRI ZhPh3 3e[^]UUE Pjjhh3PRG thh{%h3Qn 3UVSE UMYt @ȅu˅t6t1R )˅t8u3jSZYt%u %hPh3> VShF$hh3艆mVPRhF$hh3`DσVQPRhF$hh3;VSQPRhF$hh3 3e[^]UWVS$u} KE 0~y111119Bt} |t 1M LtMw tLxw tHuGC@u?6ttxtu#2 @"@Ƅ9t(Bh1u "ω9)51u- uh %h3n[^vthF$*YEPjjhVPPD t h{%VXZSVhQ%hh3=3e[^_]UVSMQ3Q3يۊ@&BZ@&XÃ@.)օ~=3uC3[^]UWVS uE Eԃ=4-tL1ɉ 4-hh3,[_u(j.h3"j_Zth@Ph3 3uhh %h3 F<t^<t<udEԉE FEe[^_]!Uڹ1ˍ}fEu jEP [^uԍEPmZY6e[^_]VPFPhF$hh3谂3e[^_]US]U MC<t,<t<u/MU ]]OMU ]]U؋]!S"PCPhF$hh353]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV _XUЅҋEtuu SVZY SPV }yE EUW$e[^_]tEEԉE E:]#e[^_]΂EEԉEE E+"e[^_]鯂UWVSXEEE EEEEEEE"1EEEE1҉UjjuVjj]Syh&A$)EuhF$= Xe[^_]PXu jju jjVWjSyhF$݋EEhF$ XE9^CU!‹M9A}tSyM9,sxEt  Cy;8-t8-PuCyPP C E1ɋEtttHP1DA uЋU؋uЅ~uE'uPsRV~uEuPjjucE#CP>h#h#hF$蹀-H-$yh-j WXZ-P- }e[^_]]UUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һF$~kMUD8-u^@PZMt$Ut:u?DX,t*DX\}uCNv t4}tEEEe[^_]UjjEPEPu u-h?uuum(USuPhF$h-苂Sh&G$h-{ShGG$h-k$ShUG$h-XShtG$h-HShG$h-8$ShG$h-%ShG$h-ShG$h-$jtUVSƃ=3uh X3U}t褡h3hN$503 h X3UWVS1}uEE PPEu IHt}6hN$E PEP> uhN$E PEP# t}E p,XE Pu r"3 3t!eO$tVWjVjjhRSYySPX X3e[^_]U帥+"}u#]U}u 輖hO$hO$hO$503]1X3UWVSE]uu1҅‰uTpuCE xh+"W~ZYu u0Hh#WaZYu1t/# u븥+"PVhO$503|\e[^_]UhO$h3u uIX3U}u•X3=3t03E EO$] ]Uh&P$h3u uX3UVSE] u1=33u{+"yt @sh+"VRZYtBh#VAZYu 134Vо^sh5P$503i[ 맣33노#PhVP$503=[ =3t53hlP$503[ 503hW$ 3Y[t1҉,3X3e[^]UhP$h3u uX3UhP$h3u uX3UhP$h,3u uX3=,3t13UhP$h3u uMX3UVSE] t~ 軓1=x3x3u=sh+"V觺ZYux3h#V臺ZYu1x39sl3^hsh`3Z t3`3x3 A l3t3#8u-#QPRhP$503gYx3X3e[^]át3t8u503hP$ 1x3ZYƋ l3+"UhQ$h3u uX3Uh&Q$h\3u uX3UVSE] u Cuosh+"VPZYu3 U3_h#V(ZYu1ɉ 3 U3HV谻Zy$shBQ$503IX 1=33 U3t +" 1# U3PQh\Q$503W1=3X3e[^]UEuQX3HuhvQ$E PEPD tЋE phQ$aYZu9=X3uJ=3t503hQ$C XZE phQ$HaZYu3313USUE X3u C3Pt ]酐pYteP Z@u ShQ$@Ͷ=3t"h3hQ$503V1ɉ X3 503hQ$x XZ]]]UEt~X3=HuhN$E PEP tӋE phR$0`ZYu 3USSEu蜏X3HuhhO$E PEP菿 tU3hLjE[Xjh3DR XYE tE ;u1ɉ U3jju 華à uu=U3tڋtShR$^_[Zu 3E =U3u=3t331ҋtU33tujXZ1ɉ U3]UEurX3}Ht}6hR$E PEP` uhR$E PEPE t}E ph"R$^ZYu!E ph*R$j^ZYu 3UWVSUU] 3E=3t5331ҋE _¡U3t@U353uj×ZY1ۉU3EM9t EPXe[^_]UWVS}u <jjuÉXZS"t CYujjEh#X à u$j/S _ZڅtPhRW =3t6503S輵 03HQPY^y Pj RY^ J }~j5H3h"WS<  jWS< ShR$X3jbB~PM Z9uWjd[^WjXZYt1 hR$4XX3e[^_]UWVSPEEu萈X3%HhR$E PEP胸 EwɋE phR$X^_t 503hR$致 Y[}hR$觝 Zu ]E XShR$jXSW1 t뙃}hR$] Xu ]E X ShS$ XSW1 t-U}u"E X ShS$WSPW1 3$e[^_]UX3}t;=3t =3u#踭=3u03E ES$_ h3h4S$503nM1X3 UX3}t̆=3u#1=3u03E EQ$ h3hJS$503M1X3 UEukX3{Huh_S$E PEPa tӋE phS$VYZu9=X3u<=3t503hnS$` XZE phS$eVZYu 3UEu΅X3{Huh_S$E PEPĵ tӋE phS$VYZu9=X3u<=3t503hS$ñ XZE phS$UZYu 3UWVSu huSL 9}1hE4S F 9~hh|(%S GShUW$JUY[Hu jNZ3e[^_]UEu誄X3/HuhS$E PEP蠴 tu uh5!#- UEu^X3/HuhS$E PEPT tu uhT$ UEuX3[Ht}6h#E PEP uhN$E PEP t}E pphT$T USE3u蓃X323Hu hT$SYE ph#T$SXZ3]USE3Pv6X323Hu h1T$SYE ph;T$pSXZ3]USE3u݂X323Hu hHT$*SYE phMT$SXZ3]UE} tu腂X3=3thUT$RXU} t}uIX3Ã=3t jjXZj`Y=3t jjuXZjv;Ujjjc;UWSREEu؁X3=uE XhZT$E Xu]ShS$RStQ1 e[_]UVSEut0HuhW$WԚZYt.hwP%WÚZYthW$W貚Y[t뷻v<Zt03u6hW$R9 tU3tU35U35U3hW$R91X3e[^_]UWVSPU} uRUyZUuUE W$03Ee[^_]O9Ë@t P衕1ɉKXWNCZ=3ttP3hX$5039e[^_]USEU X3t tt<]]r-t8Cu5!#PRj hX$5038jrr 1X3]UVSu X3}t e[^]qvxXuvhW$503F8,Ct P蘔1҉SY3h"X$50381X3 e[^]US3}u|qX3<=3u03E E3X$]騝 3h`X$A3X]USEU 3HvqX3P=3u03E EeX$]> 3Hu hX$>AYrhX$.AXZ3]USMU 3AvpX3Y=3u03E EX$] 3BuPhX$@XZrPhX$@ 3]UWVS @Eu} t pX3AHhV$E PEP tЋ5U3} 19~j kS3Pw@ t*Cu%whZ$5036X3 h@h`3P袳 1ؿkS3X 9XrP-DP@tC`3<$t<\CFC P-K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP`3)PE 4V谲 E 43߿iu6CDžؿ9}~)`3)PE 4Vu E 4>ƃF;rU30oXu 503hcT$u!503hxT$E X3^X~ t=3u 503hT$΃=3t:503h`3 03HQPYYy Pj 47YX J j 6R薱 U3P5U3V =3t3~t-03HQPy;P| J Pj6XZh@Ph`3( qU3EU3E 9XCؿt G9}ce[^_]USËt P耏1XCt Pn1ɉKXCt P[1CZ]USd;3jyX=3t>JPh&Z$jd]S-~!03fJftPSRT jh3P/ USdjJyX=3t>>JPh@Z$jd]Sx-~!03fJftPSRS jh3. UWVSƉӋ:j:WYZuWhZZ$V; :W P]YZtj%WYZtWhcZ$VW C uf{P Huf{tCPh_$VӦ h#VŦXZe[^_]UWVS ERU:ZEE0U;OwuCuRS衱 uCEÊ u w)tu C;OvE1e[^_]UWVSË@t P&1s_stV:Y1Ct P1CZe[^_]UWVSljӋu3u<MPyFE8 u@EuhnZ$%XZ,HEHwuE1e[^_]Å8UWVSH%Pt=P-ufTwfUtePt^ftwftO0Euf]fۃW})߉0ufWӉ)Ӄ@YA]AXZ[^_]UWVSUu u hZ$j覟 ljjhZ$Pa uW1ɉK fCPjhZ$W: uWC fCjhZ$W u WC _t36蟝v蕝Cv芝CF C FfC (WuhZ$# Ef: j/RU^ZEUu R%8)ЉUHQM諜ƋMQURP蓫 { uEuCYj@VZYt_{ u1҉3Mq@P輜j:EpP t@P蜜MAYE@E@tu[uvVj]RU YZEtH:UttWuVhZ$)PERVMV耕u WuVhZ$tEx:u-u%p/Uj:VYZUt>t3 3ׄtK3Gpj EPV >tU:u PvWuVh[$/"/fC*C tt5p3u5t3t5!#V[CZ{uC%{ tC%P;CX1e[^_]USZKJy ;J| t Y RP/XZ]UWVSP1ۉDžfDž1jhZ$P jPQ^$CZY@tt8tt8uVh7[$ uDž8tj;P [_ÅthH[$P袋ZYtChP[$S葋Y_t>hX[$S耋_Zuh`[$u [gVSh[$Dž DžsDžV蝙Éj@P0  t1҉3@PnYj: ^_@PF[H8?u1;u11ۃ/j/S` ZY9u$uHsjhC%SK cu)uR31ۅ%pu'j3u911ۃ=3Džt*1;t%h[$SZY11u @11ɉ>t+h[$V_Z1ɉ=3=3t jj_XZ=3A@hPW 1 t1ɉ31҉3QP33YZu u*"#Hu9 uWh[$Q u Pj衾PjrY_t ;1$j/S _Zu Jx;hh%R辤 1ɉ 3Pj=3u/; =X3h-h[$苌 XZt>ut>uGt>t݃t3hSS hhC%SȤ hVS輤 $hhxO$Sѣ 1 tL531ɉ 3=`3t hhuO$ hhyY$Ss Wj$53Fd3uj/V8 [ZtP1ɉ=`3t WjWjXZX3-1ۃcÍc؍e[^_]UWVSl<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh3 ZYu PQ^$Y[@S^Ւ<$Zffu0t#;th]$SZYt h]$3t$?t?u+u =d3uhB]$W+Y,,d3t <,j/P} _Zt@,PZ PґYd3 t 8uthh]$c1=3=333DžtDžx=`3t0 tRPZYu33D3]$,h*"P˘^_44u ,4Pat$PY[u/tx3353=3 t14P1҉$WVPy,Ph]$=3u=U3<U3 -,Ph]$503! 33 03 u503j E[^RPh]$Q hSh3e 33p8-/@dj VP  9pd8/Pdx*u,j pPR&  pd83 3Gh3`$\`$d+tXH ׉dRs^_Džh8HRYtxk`$dtdE2u`$dt]kN$dth`$Xr`$d`ujh`${^_p@9`$d't`$dƅu a$dutPnYVmZt<oZu&J3 3ha$_t 8uh7a$ڡ83P83~ hba$V^}31uQu2P7ZYu]U;3jGZ=3t%03fPftjh"P6" $;31U3|;3jh@;3e USd;3jUGjdhac$]S~ 03fJfuPSR! u7Yjh63 USd;3jF1U3|;33Yr]tsuAjdhc$jdhc$S} jdhc$SY~ 03fJ ft Phc$jYp PSR)! jh63m UWVSƉ׉1ۅtfNftщUfEڅtfOftщTSfDiPREPl ~1tfEt fT Ѝe[^_]USZKJy ;J|< t Y RP XZ]UWVSXEUMEEE̋EȋỦEԉU؋E1҉EUĉEU} tE EEjEP~[^1҉u}1ɉM19E9ƉM}Puu! à ys8ti8#EEEU 3$3EESuuj EЃ y8t8#ЋE)Eă}tNEԋU؉EU 03E9 3$3]| ʸ#xEԋUEỦEԉUQHX+u}} jEPFEU+EUM[^+My @B19@B)PZD8}tI 3$319}6;Mu}03#03 503X8Ct 1}e[^_]UWVS$1|;3x;3hfjyChݻjgCDž 73111X3113u<PBR5;3iǃ R5;3eiY_= =~ -v!R5;35i_ZsPhR5;3iZYTPhhh $5;3J5;3&5x;3|;3jAX}t9;3@ t.jBjAX311U3jSX=3t21u4&hc$503503lX3jAjwAE 3=3z$5Ht%P-DxkX3 DУX3X3=3uZ03=|3u)B03=|3tnu~tZ03yu&X31=O53hK#503. 03u^X3w7t~*u%P-Dxu=ti1ۃ~UuO t+)t&;3sX@CW=51$du(t9dt5d -uut1X3u )b5E9@3 5u$ 3u03 503sXx u@uhPh;3 u =X3u;3t R_t$X39tu1t1ۉU3j=j=j==X3t ujOY|;3f!ȅ!Ѓ„tt jZx;3ݻ!ȅ!Ѓ„tt jXF(#e[^_]UVSu=;3uh d$ X3[11ۉ|;3hfj<ÍE PV5;3lY5;3h#[ 5;3}U3 hUT$V^ZPƋ|;3Y!ȅ„t tjYSjU<XZe[^]UWVSDžXP36363jj63Pq;3 yh9d$k  U3tjXRjhP 63<t <=3=353=3u 3h4d$WÉ53_~It,=3t#X3-wQ503had$Z Y[=h;3h#503 =3X3-v+3hd$Z=3=3=353=3u 3h4d$xÉ53_~It,=3t#X3-wM503had$'Y [^9h;3h#5032 =3X3-vtP3h/d$Y=3u9 =L3t 5;3P503hd$y4d$ /d$uh/d$S_ZX3$ w=t503hNe$,63<t <flpRPdPRRRP`P\Phe$h 73m , \`dtk=63X3$ lpRPRRRPhe$h 73ߘ #631f63 Ћ Ћ ȣ63lp ff63963YlpRPdPPPPPPPPPPPPPPPPS`P\Phue$h 73踗 \t-503hd$V 5;3 ;3 \u`u dt 503hd$붺631f6363@ulp ff63jh63h63 503h.e$F503he$6h4d$S[^^1ɉlX3-w 503had$ERpRRRPhe$h 73p t503he$T XZ:u:u:u˿6363󥋅pff63j63Ph635;3Xy/;3=L3wPV X;31P3>=63%h63j5;3[_Zy h^f$/e^63=3<<63<63P63P63P63P63P63Phf$Ã=3^=3Q1҉36363=3t f63;3tP9 _jj63Pǐ;3 y"h9d$5d^ 3=3u#jXRjhPZ @uhe$$63Ph635;3赕 y%hf$cY5;3 ;3x U3tjXPjh5;3 Džh631󫍅hPR5;3 @h0f$x=3,3=3 3t$=3=3\t63<u1ɉj j WhStPtPN 53=3u 3WS\h~f$aÉ53~5t=3t37h;3h#503- =3u Iu<t=363P63Pj63P63P63P63P63P63P63P63P63P63P63P63P63P63P63P63Pjjhf$HÃX1st 3<uBDžXjXPjj5;3j 5;3 ;3X1=&503hd$e[^_]UWVSD};3=P3tWPHjjP ƃ HPj5;3 @-;3EfEjEPVxM]ġ3ZZ<ډEUjEP*xM+M̋EZ[+Ey@Biy1QjEPV "8t8#th)g$63EEPEP5;3 à ty5;3v ;3VjS @t?}uEjEPjjSĚ W5;3*Y[Quhf$ X5;3 ;3Z1(d8\V8#Nh g$_뽍e[^_]UWVSu1ɉ |;3h2j.E[_t=3u@"3+3=3W+3@"353333thPBUPe UBC3 6363 󥍺6363󥡌;3<<;3;3@@;33DD33HH3U3LLU3p3PPp3l3TTl3h3XXh3d3\\d3jh43`UPc j`Ph43c jh 3U썂qPc $jqPh 3c `3U쉂`3hh 3Puc hPh 3_c $hh 3UˆRCc hÈSh 3-c uj,|;3 t1|;3EEe[^_]e[^_]UWVSQ}j/Wӗ [^t#9u jhC%jW#XZ/jhH%Y^y WhJg$[nhWh@3b A3ƀ@3. d1.F9t@BUUjh@3XZx9U0t8u-Ou503h\g$ZJ XZ10jh@3yYXy@3F<.u1F@F0볍e[^_]UWVSu;3u/hg$ X=$;3t X31Ee[^_]<fDžƅfPftjjWPet hg$ZXhhg$5;35;3s ;3Ã(t hg$pZX=$;3t X3jD<Xt(t#fVfthWP jYu=X3(ujtZjlXe[^_]US E1ۉ]h`O$u3ZYt E`O$N$=l3tN$E3u=3t=3ۃ93u%hd$kYt!503hg$>H PjSxXZjOX=3u)503hg$ H [Xj,XX3 93uh 73hh$ZYt}jSLx[Xjh@;3\ ZY!hJj(Y[E33 uuuhT% Hu.RPhh$ tԋEPj(XZjxXbj $_XE@E33 uuEu PhT%# Huv ;3j1$1$vE$j (XZjY1ۉ ;3uu h'h$503RPhh$ sjh63% Y[hj'XZ1ɉ ;3h`O$u[Z¡3tt =U3tSjtjUXEt1=3P9X=U3t(MEu PhT% Hu\j[뼋Eu(Eu PhT% Hu/=U3tjY1=3PZ=U3tCjX=U3tqj]g 1ҡ;3~j1$X=3u06u=$;3tX3 h=h$IVXj.8Xj9Yj1[=$;3t X3EPj&XZ]UWVS1X`3pt3U"1\ 3$333,3H=3t}u=3tTuu u E 8-u}tuh1h$503P u hZh$5038 ʡ393u:1ɉdDžhDžlDžLr"jh63q [^u#jPAtXZ뺃=U3j9Xhj$XZhj$Y[hh#u ^_uDžT@-1,3E 8|u]jj }$Y[lE Xh*"S ^_TTuShR$8TXZ]1=,3Dždh*"u u[^TTu u h#DždTfzt T@xRPZYxE%=tu heh$503 EЋUԣ33?jh63 ^_c53=3 hN$uZYthN$uZY3twCTfxu TjWVPT@jWVPhyu h]$RY[L5353hh$ *DžLeO$}tEuuhT%a H3LZ\\uCuhUW$^_뽡U3h|h$h&h6hh$9t53s&p53tPP7YU3t53PIZp53j"_l@ujj !Y^l=3t=,3t =3y 31ۡ38\fxt \PTfyt T@S535t53 p53R uu h14#QXZ?8  3$3P ta\`RPPG @\@ @ 3$3TXRP(GPY^@uzt[pt95 3$3|@03#:503_pt3pt륋\`RPj G @uu!P\@ @u 3$3pt 039 3$3|03 T@ @t,ʸ#Xu h14#pOXZ\@ @t"`Ihh$FOXGjXdtdTR^1T\P1ɉ\ $f[zhPjXZDžh=U3u X3c;3xP X;3\t\PD^1\j[X31; 3$3}jYh@u l@u"hPjRXZ㋅lPj @^_;3xP [;3du \u)TtꋅdTRY؋\PXH,31҉33 3$3e[^_]UWVS1,4(03PT3t$1= 3=$3L33,3 \3h`O$uxZYDDu =3uVu=3t}t}u&E 8-u}tuh1h$503 뺋E PhZh$503 ɋDtE uPu 1ۉ8Dž<Dž@1=T3uDHjh63 ZYt=U3tzjXhj%Y[hj^_<}tWE jP[^E j/Pv ZY8tN8 tDE PhJg$K[^X3$ E h#P_ZE 8|uuU C%t,H%%E 9u jhC%E jPU^_/ jPFY[n=l3t _8 uW@S8 u"E hP_ _ZyE Phh$6=l3t 뽃=l3tE PYE D3uJustYjjiXZ39u&ju/^_33X3ujPiY[=ujh63 $_ZVDu}u-k33 tRPhh$ {͋E8t8PuhT% HYh*"^00uuhUW$Y[ȃ}E h#P_ZuDž(-15,35\3E 8|uXjj j_Z@E hr"@Pu Y[((u E @PhR$A15,35\3Dž8=E uPhY[((uE Ph#HXZDž8(fzt (@xRP^_@tE%=t1ۉ,3\3U3h6b$h&h?hh$[9l53s&h53tP-YU3l53P?Zh53j|X=3t=,3t =3y3$1$3Dt@33 t/(f{t (IjRPQA53l53 h53(fxt (P0ft 0@$VSm u0w8 u 3$3hh$G^ڃD3 3 (jjjP11y4E Ph]$FY[1,RPH=[Zt׃ t;533(|jjjP떃  3$3$ 3$304RP<XZ tl(,RPj = @tz(@ @unz04RPg<^_tA UL@L Hu (,RPS< @uq$u{PT9ȉ03#5503YPT3ډPT 3$3띃 3$3PT 0395 3$3|03 0@ @tJʸ#48 u 3$3 hh$pDY݋(@ @t,E PhW4#FDXZjX8t8(R^1(0P躿1ɉ0 $j[Lu 3$3y3`LPhh$503 503hi$2 XZ뾋D$ u=\3uj6 _苅8=ju)[^X\Bu@j`SB[^_X\lp1tE SPL ZY@XP襶$L+‹E $Ph>i$503`jh63O ZYt$X31; 3$3}4jX Y*hj^_=U30PA[벋<@u @@u" Bu uh^$肽 X3詰 1.63=63u%DžjPjjy h*"<;3hr"';3=;3tuhi$ ;3^4=3t53hi$503 jr[~";3tP蝹Y;3tFP荹Z=jSjhy jShhy 3(X3h Xe[^_]U503hi$F, XZUE }utX3h Z$WZYEt ue[^_]3øb#=3t{l$Phl$503 -t$=3t~ tP3PS2 SQ%YE ]e[^_]马 QMZƒMuQWhl$503KSu QWhl$ދ}u#Uj PMQ!A MMEPjUR rPj hX$503J릍e[^_]UVS@3 U3d3$t!uItJuBd3H31d3P@3-8!- u @ ud3tJt d31&d3H3 tGtBB@"u\uXu@!@B؀"@tՈButB U3@3: U3@3d3tHt d31d31H3[^]US@3`3 U3@U31ɉ d3U31ۉX1U3{P5U30XZtU3@ڋ]UVS 03=3t,SPP' $^Z8tPh$503W 503'jh@h`3h@-*y}uB503hl$t.=3t 03Hy Pj Y[ J ]x=U3?U30ZÃu 503hcT$+u 503hxT$x t =3u503hT$W& [^1ɉ 3j 3uV > U30P5U3S =3t3{t-03HQPy;P| J Pj<XZ{ qhjh3j e[^]UEt]1]US]u ho$jX0 SZu Sh5o$j@0 @]U=-u -03fPftP Z9-ÍL$qUWVSQ@3 ,3 jP N+|33_[+ 3y @B%ڽ߭ݕ 3$3=319}a؞v3߭ٽf f٭߽٭؉ʃ# u5!#1#WPSQhfo$hP(ٽf f݅٭۝٭Q~:Qֺ5!#t#RPhyo$)PP诸Ãօt Ph")PPÃ<RPho$)PPT؉1ɋ9ϋ}'t' @Ńu4(&%%y)Džkdd%1 P%1҉ RPho$)PP8 3$319݅33t53=39H)߭߭ٽf f٭۝٭ho$)PPɵà t!Wh")VP褵Ã<RPho$)PPtË+p3t3Ɖ׃x39}19},ho$)PPà h")PP؃ u03fJftPVR eY[^_]aUS1; 3$3}6=3t%03fPftjh"P jXp]UWVEE왉U1E}ujEPj; e^_]U0E E1EԉE؉E܉EEEPEPuƒ xEÍL$qUWVSQ@@u5jh|3Gp3|333h3l3XZjPJG33 3$3+p3t3_Xx39}39=h3l3sBp3󥋵5h3=l31w~s9؋}g>WPho$hSq03fJftPSR jjj-jh3޳ =,3uh jjujjj =,3l%_h"P| 3Y[tPhUW$hP蛱x3319߭y%ݝ݅ %߭ٽf f٭۝٭y1d~dVho$)P=PNj(3~-3t PZ)Å~:ùdh5!#)Sh@&Pho$)P=P胰ǃ119ʉst @u4(&SQhp$)P=P%+|33+ 3y @B%ڽ߭ 3$319ظw ȉ߭%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4(&%11d PVShp$)PPá339lj 3$3)ލ 9lj݅99Ћ}h6p$VQ赭à +33߭߭ٽf f٭۝٭?~~h)p$rtPh"VQÃhz(%VQà <ЙRPhCp$)PPìÃuh")PP虬à 03fPftSVP eY[^_]aUSzjlX]á3@ `t1US3HyP1Yu1ZJ,ƒ uɍPv"u|33HyPZuJ"\u%3HyP赤ZuJCC3uhip$ Y333HyPgZu ZJ, „t@Pv8\u"3HyP(Yu JCC3uq-=3th3PZYuC ߸ ]UWVSQƉUh3P,[_tHj.V+[_1ۅt6uPZYÅu#)Wh3V/ u1ۀ31ۉ؍e[^_]À=?3tUWVSh*"h?3e3^_u"*8th?3hp$%Y[1$hSS_ZyƅEj.Sb[^pu Džp5!#1btH uuzG uҋp3uSpEƅt1;4 3*%u_3uGE uh3} h3PZYtE thn$P[_tB3fPfttRP|ZYx|?thp$ hp$w$xAE85h3=}X 3fPfttRP[_x"|?thp$荢 hp$胢 E8h3}z=3t53P譠Yt u 3Hy t u503hq$JɋU3u503hV$XkS3S3S33HyP0Zu@JP-DB@uGG9u uU3u3S3C3=3HyPٟYuJkPkS3BS3kS3S33HyP臟ZuJ< u6U3kS39S3u@U3 {u@U3KZCh3hmq$觠 _X3@tR莝[503hq$ XZ53kY 503h=q$ۍe[^_]1US]P-uhq$S, ZYu3DB@tCjhX$S* u 3Uhq$S ZYu 38hݓ%S ZYu 3hq$S ZYu 3]USZKJy ;J|< t Y RPZY]UWVS3=3u 3hV$^tIhq$h;3 & ZYƺ9¸} ;3.uh;3Vhq$5038jhq$h;3) 53tjh$h;3w) uSt 3 313j hkN$h3z& t\h3h-N$503豨 Bt 1313t*j hq$h;3  u503hq$H ^_333333;3h`X$ Y1u<3u 1҉3@u31;33e[^_]U塈;3tPsX1;3333=3u13;3133|3tPY1҉|3=3u1U3U;3j X=3t%03fPftjh"P jh3ݣ UVS]A0jX=3tf;3t-fPftjP 5;3q1;3 ;3x jP 5;3{ ;3 13j舾X=3t>;3t-fPftjP5 5;31;3 1ɉ 31|3j2PZt ShEr$j O0e[^]UWVS]3=U3t =3u$u 1ۉd3`3Pu7=d3uEd3d3Pd3@1ɉ d3=`3h53V # /thhC%V# hh_r$V# VyVhmr$XZ1pP =3Xأ353,313,3} t1=3P軼Xr"EEt!jjRPPh7R$Z"ҡX3-cvt;3} t1=3PQX=353,3h*"V茤`3Vu =`3uuhr$讙 ^r$5`3hh`3% u5`3s1ۉ`3j h`3mZYu`3e[^_]UVSQQMq3=3u 3=3ut9503hr$- Phr$4YZuBj h;3^Zuj UR@P= M te5P-DN@tVu=X3u=3u1ɉ 3t=3u503h;3 03 XZz3eY[^]UWVSQ4MY=3}=X3}=3u 3=3u}503hr$ fPh s$^_j h;3҃ZYtj.h;3轃^_th;3JY;3uKjhs$Vr u7Vhs$503轡f;320h;3hTs$503蟡;3 1}VZtVhgs$503n EPhs$V< tEEP膏_uu 3u\]3gu=X3u=3u1ɉ 3t+=3u"503h;3 03 XZE3EX3eY[^_]Uuhs$j2h 3AEu hs$j+ 3UWVSP}u jjhb#jWhs$V; ƒu&Whs$V; ƒ uWht$V; ƒ USjEe[^_]Uhh3k ZYu3UWVS353X3=3u 3hMv#裩_uSj h;3[ZYtA8thUWS$]؍U1EEEEPSh%u覂 ƒ1uu$ Xe[_]UWVSu] }VuS_ u1N tut$tt$fN lS1ZHˀ; uLUJ9uD D-y h@-ՊY@-H @- t@u҅tu$ff t1҉e[^_]UVSQuh`3谟[á03?vPhu$ juh;u$P#Cƃ`3 1҉UUR@)Ra3Ph@-yhAu$uhKu$503ؕjrU319U3 U e[^]UWVSD]} S\j j VhRuWQ t&hh"R j h"V h3tzW9Vt vuvvS= @uTN8jjjhSvvP thh"S 8Sh\u$ Y[4jjS4 ƃ u(PPh$hou$ PjS @uPPhu$fDž=3~"jP2#3XZuWSԷ @F8$}u28A^PPh^$  >jP"+‹Y_+y@Biy1fDžRjPF uY蚬8u=3~{8#tLVjS諶 ƒ 1BPPh "nu=< tQDžPPhhS@E @uӫ e[^_]UVS]u SS8 1}}djjjtE 1uu11}u/ڋEw=EU]E}uKhuu y h/#qtvPEuuEMș׋EEM jEPZYdKM)ىMڋEt;M9u41MU]E}tJjEP虐EZYvh\y$Ah:%Fu S EEEPjYt%hky$0uS PPPPEPEPEPEPh}y$hSw,ڋEth:%n_EUu$SXZ]EUSe[^_]g_UWVSEU܉M=-t hy$ Y1҉-jjjuwBu11@tGjEPu  uu hy$ thy$X1M1SQM]uuhy$fwE1EUM]Ή)׉u}u܋} ߃1 tL}xA19ʉ}u}u}1 tiE1-Phy$j]SuLLD.Shy$h-@zuh0#v$e[^_]UWVSǍxPWo^Zyh]"[1E%1=uUЋ]ulSYlu h 5"2=l3t1hy$TځvRhQlW1 tht l)u)Ӄu hy$Z/w hz$hy$pPSG VnXe[^_]UWVSÃ=p3jPޛ XZyShi"d[_PVmZYtV肜 Sh0z$0 %1=u ThSP P諁ǡ -9},)ǍW5-臃ZYu5-Wm Y_t3 l3uSh>z$(jPV譚 t@uSh\z$tShw$ljjjVat=t3u[=l3uThh P蓚 ǃ uj肞 jY XZuPhi"[_g=l3t1ɍP3Sjj1ɉUV t hjz$YtWҚ Zt hz$|Xt3u,u#u P_Shz$n[^jjW萙 ƃ u Whz$xPV~kZYtWhz$V7 9u9t2RPhz$V PlS^Vؙ DV͙ jP ZY@uShi"c=t35-ShH %hRp=v -)A5-=t3u:hh RX ƃ uRh/{$h@-g Ix _=t3uVۘ Y@u hz$ZSFXe[^_]US?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋC1ɃL M|$\u0Hr[u@8@!x\u}u\ 8u@ r @e[^_]UWVSƉы=P-1t< t fTG@CtQ5454h`|$g )CSSVPZ/e[^_]UWVSE4EtMjƋEEZ1ۉE\u4xt.u*@EUELu}EPU\U<[u -U<[t <[HҀwDt8<]t0u,["[u#Àz[u[tt:Zt :Zu[1ۋUJM1ۋE@IEuuVz t VPoP5454h}|$j< F9X4sX4e[^_]UVS1ɉ /t,$Xtv+k9~f\@1ɍÅu5454h|$o1Ҁ8IuC1t ;FH@>uj RP_ F 5454h|$jB ؍e[^]UWVS ÉUE9C8uqBhzu0t'Phh3M t Džh3)ȋDPS4F hY[< u5454hS$Ph1hn))=w(SXZDžh3Phh3S 5454h$1_1ss C1C1҃u\#u~nu 444@ fL4L4544 P_1+4=4u8#uxnu 4M 1M I t44t]Ut @uKf 4-t41ɉ 84=L4;G L44t1BJM pЍe[^_]U4@ t=<4t/=@4t@HyPPYuԋJ54Pr XZ1UWVS|u=4uQH48u==<4t h$j 4@-4w$4-4(" 44tQHyPOZt@ J54Poq 54h4h4w ÃYB4=@-u 1~1PM[=@ 4tdh@ 4荥h@ 454݀ t $&\49p4r\4kP5`4`4XZ=p4k 5`414154{u54s Y[ =l4uuu =4z 4t54CPj V< u4H @))Ӊ4SPVI Ij5454h4;jjh"h4j5454h4Fj5454h4\ jjh"h4Aj5454h4) 54s 4<4@=4-uX=-u[h{" Zt8tP -X9TPhht@jL uVft--<=-u -t 11<tR<@PPHt%tv$@P 1DžHP u?F;5-r54h'%襴 ^_54j$!H 54j H 1.WYtKW2ǍZ;-r54h'%P ^X154Hj@0tfW^YtZPh&/_ZNj-4t;-r54h'%藳 XZ1@HЉ0,PhH$54M,B 90uH@)< F;5-r54h'%! Y^54j$F 54j F 4@ @Pf¸:t?fPP54ho"j苽 4 4u45454j54e/=4t54j F XZjh4g^_1ɉ 4jjh"h4rjh4,@=45454j54.=454j mE XZ=4r4=4BHPj W7 ƅt*44)44H85454jW2.=4t54j D Y_84444 4u45454j54-=4t54j wD XZj=\49p4r\4kP5`49`4^_=p4k 5`4CFPTYFG=p4%=4CH@u. d4t$P9Qs@4R54PhN$j 54j1ɉ@9^Z"1ɉ 441҉HLC0tZT4uH 9Hu;Ptj0Wh4CP QT4pP @9u9t)HL1LH9L}jjQh4T4PHσ)HLL'Hj@$YZ"L HjHWh49Q tUAQ )HLLHj@YZ T4QNu9AuAQ 똋 4j)ȋ5T4PQh4~CP T4P @@DjH+@P@Ph48 t4󥸤44444t󥡜44Cxt45454j54^*=4t54j A XZsF uq=4u~uhh Pkj F @t"5454Cph ;4t Cp jh"Cph Ht1 h4=h41h4[=4h{uhh si C @t5454s0h ;4tshUW$ji jh"sh Hփ=4ujjh5!#h4o\4󥸤44444\=44Hw{54=-t 1x4449IFTu@1*jjTPkH<9Hs B@9u[0QPV 0uՋ@9s3<jp$(Pht4.<jjVht4 )H*t4󥸤44t44t4t󥡄4t454h$"54D $4 4u45454j54&=4t54j = [^?Cv1s l4ue[^_]U塀3txt1҉P x{u@jjh5!#h4US];] ttCtE8t'\\1:"u#C@؍e[^]USP~zYt@Uv‹EBu Sh$j( ]UWVS Ek<`-Ex19~BURE@u9 2u19)VD PRkE:{42`b4&t4Ƀ5<|4-aX؋]#]US]E U$H&1Ƀ=k4if4 h4 we44ki4_hq$hi4;YZi4t=i4t h &Z(j4 Ʉ$5k4[`X؋]Q]Uh襷t41U1 4jO1U1 4jOc1Uhh$h|4Q E Uhh$h|4* E Uhh$h|4 E Uhh$h|4ܬ E UE.tgzEEPjjp׺ UE.tgzEEPjjo贺 UE.tgzEEPjjf葺 UE 0^Ph#$jjcpUE.tgzEEPjjhg UE jUE jUE jԨUE j躨臮UoU ]U輬U ]U衫U ]UaU ]Uj7`U Uj!`U Uj `U U踾U ]U@|4,P1RP(U@|4,P@1RP(U@|4,jh(U@|4,jh@u(Ujjְ1Ujjư1Ujj趰1Ujj覰14,Uh($c Uh6$c 1UhD$c U@1]UTo4jo1U跱1]Uj.1UY21]U01]U,1]UVSu] hE#C Zwt @t2E0f~ufFsHPhM!%h"e[^]Ee[^]#UEU ttu(Xo4u4 }4]]UEU ttu( v4 ``4  }4]X]UVSE 0ڸuhX$` hX$` XZjShX$ jShX$ 1e[^]U:{4=:{4uhX$E` hX$;` XZ%jh:{4hX$v jh:{4hX$e 1Uj4&=j4uhX$_ hX$_ XZ%jhj4hX$ jhj4hX$ 1Us4=s4uhX$_ hX$y_ XZ%jhs4hX$ jhs4hX$ 1Uhq$hz44ZYu;z4dOhh;z4h5!#h$1Uhq$hi4|4ZYui4dhhi4h5!#h:$1Uhq$h}r4.4ZYur4dhhr4h5!#h#1U5@|4Zujj5@|4 US] @|4)thkj`XZ0ƀxj3Pjj35@|4S1 ]UE ]UE ]UE 1҉]UE ]UWVS É։M}}} }PfуP19~Pfz fSC9uh$QuR%s5h|(%QuR$CuDSu0Kx9tF( Fat~UCuBEs =})CuS փ9~Of{ufKf9|A)fKsfuu)K9M|9~fs)y1fssf9u|MS9~09},CPuAERuFYXMCu9}ys(unXZ1C9uf{thY$uQs"Cujjs uC}S)Ps4s/e[^_]UE ]UE 1҉P]UE @]UE @]UE ]UE 1҉]UE ]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE @]"U1 4j'B1U1 4jB1Ud4 11]U`c4 1]Uu41]U`b41]Uh腩t41U`b41]UhTt41U`c4 ~1]Uu4c1]Ud4 H1]Uu4-1]Ud4 1]U`c4 1]Uu4q1]U}41]U v4 1]U``4 1]UXo4ep1]UE uU]US] @|4)thkjOXZ*ƀxj3Pjj35@|4]UWVS ]u t/{u)P>vPK t6vWYC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>P|C ZtsPMs 1C s]sm1CZY]UWVSP`-1AƉE1U9}HQG t5fu.O)ljPD PR>k5-76z5-7Y=5L-DBxsqh>tadt\<-u(=tK=tB-wH=Rt/=Su8t4+=4E9s$ X>t 4|h-j XZC}XCf.S K)y1fK)y1fCYCfEECЍP9UK fM)y1s9~fSUʋMM9EL8fKs,sXxufufCVt%z `~x~Ha (aS9USB CfC> =S=VYv1P-DB'h-j V x sLrC Zt sP4C_XsRYtF t!u S_Zt Cx~fF ft\uMsqC ^tsPBs 1ɉK sRsh1C4XZu W_XF u|szqC Yt sPbBXZs&RXCt2Po1s_$uCD0tPoC1҉T0YEC9E|ӋC4tu S_Xs1ɉKC ^t9P1C Z+uuQu5-7pe[^_]UU4U fP]UU1x94~4]UWVSP.5449=  MRPkY_Mu1146444uj-t-t)94r!DPB Zt;4s --؋]U54f144ZU54WXU54XUS]uTu PnSPjQ]US]u+u P~nSPj(]UE Puj UGuPhUW$ UuPhUW$ US ]uuPmSuuu jPQ$]Uh5!#uuu uUWVS}54#54XZun},u4u(PmWPjjǃE}t'E8tE$9}uY|EE$|9}AE6}Et)~%E8tPZU$D9EeE} u)@E }y$uw[Ej PZYtE@M}})ȻEE9~)Ήuu uWQM542ÃMu$u uWQh҇$54Q11MHS3XMtV5-75ZYMM54PS܅54=PSjjjSd$SiE @PE@PWMQ54b1P,S諆 P54zSP54u#u(PvkU,Ru$u uuP$t6SLcXtSV94V SCWPSe[^_]Uh5!#u$u uuuuu u/$US]uuPjSuuu jP+$]Uh5!#uuu uUS]u1uPjSuuu jP$]Uh5!#uuu uUS]uu P4jSPj]Uh5!#uXZUS5454$؋]Uj US]SC{ h"; PՈ slb =D`4t7S螈Ph%5D`45D`45D`4h1D`4=o4t8S^Ph%5o45o4d5o4(1ɉ o4=4uh-h%4i XZ]UWVS h*"P_Zuoh~RjP觌Ph#h-SZ_ j h-#S _Z؉Ph#Y[&tCVhS uW $W t ;u뵋Ct{ tዅh-#R ZY€:=uZh-#S ZYh%S~ ZYWS ;VXe[^_]UEPE 4UWVS 1ɉJ Pd ^z Zp j h%V uՃ{ uC W6 hC%W[3 VWT3 WujƋ;7P  yC9C u=CPW Z_ZuhX YaCPsY_ZtۉC{ CP膣GC VjY^e[^_]Ã=o4u U塤t4t uPw~ XZjR Uh"~ YtP Zt hC% YhjhQ~YZ hZjXUWVS 1ɉM܍}1To4j1j蜇[_ ]߉jjPN =To4u:SZxEPj b_X}cjhy[^1=To4\mcj@|4PgZY~>jh6j@|4PgyjhY^=l4;SZujh_XS^u@|41ɉ$Hu\b@|4PhUW$jXj_@|4)t]SVZ4}EEjPFV^XEE119EtMԋ 1҅t9t; tB F@܋Ekl9tH41҅t9t; tB Fl19t!4EP_ZYu S&ZYG19tPZtG}WfX1;Us=klE@0 t.Hdt'yt!U؋ Ph q1p8p4kUB19t4UW:ZYmUBSY_S}Z^u`S[Ohj]jYju8j]SZYu'S֌SiS jj^֍EPݛXe[^_]UWVShPV6z hh %Vz hVWz $hh)%Wz VNu1EW=Zt/SSSSSSSSSSSh"h4jj*Y[ WVSXZ뷍e[^_]UVShPVy hh %VFz hVSdy $hh)%S!z St VSXZe[^]UWVS}11u܉5To4jj._ZyjVP7J e]@|4$*u u^)uYjhb Y[,u>tPZt@|4$PX@|4$S|^_EScSDZYS<^_%%S^5-7]jj5-7蕃5-7W5-7]EPj }tChj_jZju,jSZYu%%̉SXe[^_]UWVS}11EܣTo4cjj]ZYxjSPhH xpu@|4*u$tPV_XEV\[u4EPj ZY}t!hj`jju VXe[^_]UWVS1HH;E E8u EH1LEL0t < tLEL8PY$}1ۉ889E SZ9$PuS O]1<%rA <%t)P-< u"DB@CC8uj PPS P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< uP-DP@tC8u$C<^_uh %s+ZYu s Xe s h`b4XEt28t(P _tSPh %xf S3B 3h%_f jAt41ۉo481󫋍$88Dž1 EDž1ɉ z 8/hЊ%e _=D`4t 0RPh)%5D`4 jj P 9 X8󥋅 ,014,PjjXPhL , 8uE 1ۉ#XhVSl h/#d ^Ƅu PV$ u1t@ ?uzD`4tPWR 5D`4 8uE h#P) ZYt f W0x0P C 1x=% D`4xt SPf XZSj] ƒt=$  ( D`4^_tP[1ɉ t4 ƒuhMu $t"=th'M Z1e[^_]UShhjhjjjjj jjh -h4y.h-ha%BQ D`4Y[t Pha%,Q XZj: jP!Sa ]UWVSEPuhV }uCxPVyY[tE 1҉Sth*"V2 _XuA h*"V XZ1ɉtu6D`4tVh@&h%P 둿tt txW;>E X1lSV pY@ltJG9r7tuvQxFE 1ɉ^dWQ CE XZtNp1F1}uSS Xu5D`4t,Rh@&h%P }tSk ZS<e[^_] UWVS0u 1EEEPVEP? ] 1EԉE܅unVh%E܍t0SE)Phȉ"Vj h%Sj ƒE9E؀8'uE؋E؀x*h|(%u ^_]EԊp<'uMCj'S^_E؃}u SY؉E؋Eԍ4VuAE_ZOSh%jSY j 벍Jg<%u<@T)IB*E6j/V ZYDžuVK EXuVrK E̍GE/X}uf_HEu"a M܋}ԍYtqUĀx .tx uuWs uˋU;2tEԋEԍRUu@EZYUWVE)Ph%E܍DP y;2tVCXu> XoE܋M1ۉ߾]Shht@j f}ufEf}ufEPEt|e s+-7EjP5-7[p5-7SJ6Et55-7Dj5-7 5-70J-7EڋEEEfmEPuuًU܍Edh@-)Q tE@ Eu ڋEE]^S ESXZ;-7hPjjstS9-7ut h"XuryJ_E@;-7uX]UVSh4l$4^$h4h@4_ =4tR)~4.u4Ph4gBZYt+hhH%h@4` hh4h@4 ` @4e[^]UWVS1ɺ!idu$xtxa jPh4^ 1ɺ%idu$xtx' jPh4^ jjjqà < 1jh4Vu^ Vh8i(S9S ugL8PphPh48^ $8P4Xt*hVh4^ hSh4^ %Íe[^_]ÍL$qUWVSQ-P 4T[hU%(Pj y,D`4t Phs%E ^_h-h%E j h3Ƌ([1ۋ(?RXYX9h$W\ ZYPWV$ h$W[ |P-LDžX@-XtMQD$HDQV uHLDAEXhViP\ C (uV;W;XZ0iƄV:W:^_ujrjoY[ PDž$Hjj$V(Wh%> @u"Dž$ jjVWh%> @u/ ;Psh%jP|YZt,뱸 ;x|s:h%jPP_Zu(hre^t 4DžT jS5XZYt5t4zXDžT 9tf@ @ &,hujjjjjjjjjSXjuRL411PDžhjt`hPLϿh uLX#9_X  4hiPh4AZ jh7%h4 t(jh3%h4 3%7%1DžPh %j@$WR jjPpPW< $@t puh4X&h4hH %h-jct8DžpjpPjj$Vn< @tVh% %e^[^1=4s(u=4lu 4P-DJuPhC%1 ZYt;rPhC% ^X1hH$PY[hH$Pt_ZÅu 1DžPkjv<$1󫍽p!󪍍pi\^@u 1ۉ$Nhh* %tVZYthh4h4jf=4thh4h4hhZ"h % Ãt{PhC %jh\hk %S]\ho %SR\hl %SG\$h %S9\h4h %S)\=4th4h %S \ h %S[^_h %S[h %S[S@h %j[h4h %h(h4h %h$Sp S.h %h4ZYh/ %h4t^_h8 %h4[Y[h8$h4B_Zh"h4)[^h|(%h4ZY=4h4h4h? %jtnh4hZ %$Pj8~ $X$4_hh4h4j~-h;%h441ɉ `4hh %S[^h"_Zh4h %h %hDÃ3P `4h %\Pj_ ~h\h4U \3j h4 thI %\Pj ~h\h|4T \r3j h|4¸ t=|4t `4h %\Vj ~h\h4iT \3_=4u8hS %Vjh ~h\h4(T \2Yj h4_Zt=4t `4hh4zY^u =4u `4111hP$VS hh4h4jxhh4h4jw,PV^Zt%`4Pu*jh4h4jytjh4h4jzetih4 Y=4u=w jh %"P?w jh %-wjh %h4R jh4h4j{hh4h4j}`4u:1llPj豷XZluhh|4h|4j|VDžH4=4u DžH8$DžD4=4u DžD8$4=4u8$4=4u8$4=4u;%|4=|4u8$HDVQRh4Ph4h4h"hV,=4u DžH8$4=4u8$4=4u8$4=4u;%|4=|4u8$HVQRh4Ph4h4h"h(jjjv E%x PX`4RhUW$h hZ^L,XX/h %jktj軽 4Y=|4hr"h % XZu>=D`4th5D`4Pf8 hh-PN8 j^ h$ %jTpW~I W WPhA %h^ %VT =4th4h{ %VlT =|4th|4h %VPT h %jATj̼V=4sh4h4h4h %j5h %h4 hh4h4jjFj jh$<踆uch %$SE h4Sj dh|(%dP賽 Y_t 8tV XZjj`RPPuf=4t h4h4h4h %jPh4h4h%j5=4toh4$h4& [^T=4th4$h4 ZY~=4th4$h4 _XPu΀=4t&h%hh4h7%hhhU%hr  4j蹺 4TXTeY[^_]aUU5!#wH&]UWVS] }Vhq$ZYuu ƅ?jho%yp:jj\f@jhv%M7ZY9t x/t/@?/uGjhv%MXY1iR 4$SRPh~%hu e[^_]UWVSƉˍPhq$ZY5!#uu%VQPSSu4t`d4PVSWh%he[^_]U w4E]ZUS]S+VZйo4؋]9USPEEPj褰EZYt=u45`b4=`b4/uab4SPha)%hhn4 1]US]= 4ujXE]EPj (EZYttu4Kt4`b4=`b4/uab4dSPha)%hht4 `b4=`b4/uab43SPha)%hhk4 1]U _ZExN1jSEp; SuVSuVt~tg`PRQ^[^tEPPRZYtU68t,8u"E@t$RP]^_uh]%EPY[tEXt p$l(h,`d04t:$VSa]_Zt'EPV4Ph%hSʷ \EpFjh%ZY@ݐ֐h%h%S*Vh!%W*Wh-%SX$W!Ph}DSS ?Ph>% t0?u'hK%3[_th^%P"ZYu蒼XRha%Po) tjj h5!#,4,0RPj$W SP- tHLDJ@tSPWVhh%hFP/  41󫍝DžƅDž4DžDžShQVjZ 4Džf=t#fyf4f=NE1f=FX!щ11Ҋ44t'w8X$'wX$$(uJ1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VY^ ?j!jAj.jj h5!#,4,0RPj#Ra (PW#RVh%hS贳 Ijj h5!#,4,0RPj$W WVh1$hSi 0E@8@}~P# $uJ< uuƄ$jj h5!#,4,0RPjWp SWVhv%hFPв 4be[^_]UVSPjjuVjjh&@tbuK XtSjjVSjh&^@u SY2h|(%SZYt PuU ^Zu S[ h|(%j1e[^]U EEE EEhEPOZYtEU 1ɉMEUhEP%ZYtE1UWVS`NjEA w1h|%wŕ ^ZuhC%w ZYth &3[^G,Suh &3ZYt\tBJ@u xt@wt4@|4$t)tVP҉[Xt@|4$1ҍ1ɉ9@|4PSYZtXP,40Sƒt/t#VRЉXZu\RY8pu`$uVP҉XZtً$9jjjjhSQRPx jjjjhSQRPx ho.%P: h@|4PP2 hق"V h@|4PV2 W(Ri[XT`a9lhGPPB2 h_SV32 Aho.%S} hwS2 hق"S^ hwS1 (uYh%V3 hV1 hwS0 Ph%SIf à ƅG1ɋÅthyG"SBZYu!Ph%je à uh#SZYthu#SZYthH$SZYthE%SݽZYthh"S̽ZYtt hh% hh%V0 hSV0 ƅGw PV à {whUW$jj9Z؍e[^_]UE1҉UMU ]UEEMU ]UWVSQ]} E10$hmj6S=u E%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVS E 1ɉ1D󫍕D1҃=To45-7h@-3 5-7To4 Iuujj_AXZ1Ҁt,DžfDžDž&,Dž=v Dž1ۉ11119tD5fDŽ5DŽ5&,H5=fDŽ=DŽ=&,BC8[ty1t1DŽZfDŽDŽ&,DŽBt1DŽXfDŽDŽ&,DŽBhjjjjjjjjjRPj谛Ã4uDžhuhUW$jJDžPS!tuiu5hjjjjjjjjjPj$ƃ4t@DžPV趐ZY^Hy V֛XS͛_u?t6hhPh-'+ @|4-Džc=To4yuTo4Dž<1ۉTo49i8511ɉ9=To4t9i85t4t(~SWYZoڋd4@|4ƀy1҉LPTXjSP* hCP@|4"P* jShXo4) 5@|4,, 0$4(804$ u1҉DHPWHDFP$@|4()l,, 0$4(804 uȉ1DH$=To4 pH DH9jj h5!#RPjV> jj h5!#@|4$P@ RPjP D`48t$@|4VHDPh%R0 @|4$pvơ@|4$0`RRVP@|4Pjj:5Dž1ɉ$Pj行^_u65@|4h_u1Z%$P1$Xu@PTo4P5@|4 PA^@|4$JZDH-1ۉ,048DHƂ(@|448<=To45d4g_t4Yd4tu t4h>£d4a1X@KyuƆy$tP,40WD$͋e[^_]UMw1vB ]UWVSDž1@|4*)Ph%hS苢 ]%t+hf/^Sh%h訽 jubhC%@|4Ph"2%hS hC%ShK%ǃ((hC%ShjlE0p蒀11ۉR YZtsE;klEX{41ɉ Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CL_cLuПXZ=To4CLS9SRV茍ǃSRjj\ 1jjB6u$&v=IC`,tPh%hV Vh%P C`,tPh%hV輟 CXtPh%jW螟 WVC\tPh%jWy WV\STz"t $t#VPh%P_ CH@]%E%GCX,tS\tPh%hV Vh%P %a%h%P XZ%g%h%P _X&%o%h.%P Y^:%y%2%{Tu%PPq XZ>%%d1]]%T%NKPQhT%hcǃ-1ɍPY1e[^_]á@|4*;UWVS ƅh%Nhr"hݭ#聊谇Ph%j$=D`4t"@|4X芇SPh%5D`4& u6hxD`4Zt Ph% ^_jj 3Y[h%W*$@|4[^1҉D)kSPGBZY;PdVr P,P_ Vh&%W#TP,PA$T\L1PL9Phl"HPpZYHuuRSҖ VP,TXhh1TRjPZ*Pn(P V^P1Sh=%W" PAVYkDlEXC uDED;rC,u{Pu C0u tCLtċC4jjjjhVs8PRx 1҉LtL{tCH5!#DžH?%L#CP w$&=11DžPt $L#"DžP%uL# DžP]%hC%H赪ZY҃5!#uhLP D%PLh[%Sy؃RPhu%W8!RPh%h%諄X11DžP&%11DžP%<@hC%HZY@%We DždjjdP,Ph`% ,#u;,0,#s5!#Rhm%Wh%苂h%聂h%w=(o4t h%aXh%Vh %jWjA1e[^_]øUWVSEx14&h%S SGuh&%h%S SFjP^_zق"h%>CCl$C ]%C| Cق"h%V>C C$l$C(]%C4| C8%h%->Cv ExtSx u^~1;s}O19t }?;tBx(u PYFËEx u=Z&1ۋ;sx(u PXC1ۉ؍e[^_]UWVSu1ۀ~ tB~9s*ًx(u1;tB9uPXC͉Me[^_]e[^_]UWVSQ8ME111ۋE;Xs-E؋MMQrPEPL tu}CˉeY[^_]UEPE P0]UWVS}EjjjjhSuPRx u1=jjjjhVu WPx tVSh%he[^_]UE8b]UE$,4Ƃ@,4+4fP +4fP1]UEPE ]UE E EE]KUS]$,4)PCC0@,4Rn C+4C +41C1]UWVSÉM1u1sNуtX44tJ}s=0u%1Ƀs1t0uAqtG-J EE띃}tB 4BB4EEZY[^_]UWVS1󫍵HEPE jhjjh.jh544jj jPSj|Ã8VPlrS}1e[^_]UWVS<Ɖ׉1E1;S sMQRUSPL <]UBjlu5ZY1҅E1EEE;C M9MMQuSPL k}lE̋UЉQE܅t8tjPQm HL >_4EG8EċUȉG-4l)hp ZtgP h9x .tW Pl xPh@,4 @t!4t-9|qP5!4,_Zup Y!41P5!4_Ztã!4 1ۉ-E%=ut!4@ 'D<=@t!4@ U,)PhC%l !4!4<$,4@,4P .!4C!4YƆ@,4!4uF!4fVh<,jRPde[^_]UWVShv# _ujVԍ [^P|-ÉYhØ#Pw ZYthhPW% =whhC%W =whVW =wjWC _ZuS[ S}X1e[^_]UWVSh}^h$>h~jh%*hVh$V5m4qhx KRjW5m4h&h&hSjW5m4(S辒Zt PSV! /RVlV !jh5m45m4S5m4xjjh%Ã(xj VPsSͬe[^_]UWVS։ϋ1׋B˃1t.0uKB1t"44 񈈀44ȍYu1[^_]U1ҋE ]U1ɺE ]UWVS ]ju ^_jdu h%P u h"2%W 19tNi sQWV腒 uΊa<w ~[BjjP說ǃ :1ɉPhd@W u u WLZ`RhedAWԃW,`9< RFaPu h%W jjWéǃF s9"hh#4W臮@u W;Xjh!%h#4 u܁=#4usjOh(#4PZhƅ_ OusƄWĩu hP&%s CRPh1$P $1u2jau hP&%s[ CPPb{ CtC @C wF-1e[^_]UWVSEEuu(&T& @&+41&ƃ44@&u144@9u44j@{44j4{44j({44j{44j{ƣ44=44WË44$U9s}Ë44RU΍Z9s}Ë44RU赍Y9s}V襍Z9rVh5!#h%jjP 44EEe[^_]tU|EPuXY1uE%;E Uh@uÀ=(o4tuUh(o4h'%j5 t1Tu4hd4hC%ha)%hht4~ h`c4hC%ha)%hhk4~ (ht4sZ1Uhu.UQ +4 +4u0EEE jjEPh+4jEP+4+4USh$TzhJzjjN hp$hhp$hhL%j S` SXZ]UVSP]u EPVEPM E u Vh`%j% SSPh%jƘue[^]UPEEPjeEZYtMu4EWgh`b4Pha)%hht4} 8gh`b4Pha)%hhk4| (1US 8PhC%ru [X1u?9t3h0!"SZY¸th$SȌZY]U  ,4Sh@,45$,4h%hh +4s jh +4h0" (fF-~PeXYtSTSXZ1e[^_]UjjAXZE< UEEEEPj[EUEEEEPjZEUS]0SnEpFnEEEE1EEPjZE]US`-{/ttPuZYuC۰]UuZ¸`d4uu4UWVS hʴ%EP3m Y[$5!#EEPn]SuhH %hBnEPWYEho45@`4h+%jn¸uu4u>ZE\URuh`b4PVSuhI%j"¸$KEtVSk V~à E)ËE9tht%h&h h%Ee[^_]UWVS EUˋujQEY_tG UR#kuSPQÃtPESXZEEe[^_]e[^_]USj$u6VZYtD1ۉ]XEPjhjjj EPSU Vt;M rj$S뱋]UEPM UXUEPM UƴXUWVS 1҉<P&jƅ Ph%Vj t#hjh%h%j %!hjh%h%j %Ph}4"i Wj&V  Hvw= 4uj輒_1-Dž-Džjhh$jPj(Uu1 h}4h-Wݢ 5!#=-u.h-hq$}ZY5!#u=-u%WVRh%%h谈VSh = 4uj̑XDžjhh$0iWj'T-= v4+=``4=}4h>%Wpg W h}4Wha)%S: Wh``4h v4hR%jڇ$VSh %jWhS %j讇W VSf Y^DžWj)SXZX=Xo4tZ=u4tQ=}4tHh>%Wf W: h}4Wha)%Sq WhXo4hu4hl%2;e[^_]USڸstjSjs ZYuSh%jʆ ]US13tjS*s ZYuSh%j芆 ]USS1$tsf1EEPj%REZYtt`Huȃul"hH%fX t&j躩 hH%fYXKuh%jTXZ1]Ã=!4uiU!4 "I}4%:ā4%+}4#4L5% }4r "ȁ4]USE] tP7fYSjQxeXZm4E]UWVS18Z^1Dž@DžDDž<jjZuWU2ЉXt0t}4haujPjP_SV t}4uQX} tExuh%j老Y_}tuSh%heǃSh<%hNǃ V VXZt-t}4ShUW$hajj@=u4t=t4tSh`%j E@44t }4e[^_]UVS]u Stt uhf%OXf%C%2up%jjPVSe[^]UWVShhC%o4_Zt Phu% [^}411۸`-P/t 8t44u uA؄t }4Dž`-{5}4/z;i44\}4u1uSZYH0}45}4j5-7Ў5-7EE5-72=3}4}4P5}4h%ja_1u4Pj wKtu44}4uf}4ƅ1N1tσ0u@/u(Ht!ȿ144uƇ44Bƅ뼀t/}4'tju ^_44t}4}4u9uh_j 0VR5}45}45}4Ph%h^ jjY[}u%44h%j}XZ44tkh%h}^_Hu%h,^jY[th%j}XZh&%j}hR%jw}4444hC%LRPl urhn%eLxRPN uT|9u;xt8hs%h%.Q^_th%j|h%h%MҴ\[Oth%jT|Y[ju XZ1e[^_]UWVS-{t0u1#W3(PYZtWhUW$h\ ك1ujhXZe[^_]UWVS1h%$KPhUW$P荃 ytQPXHh%JPhUW$PW xh%JPhUW$P4 y6륋tP:XuhUW$h3[jj'_xP|heO$d à t^ySWhr"P3SXZ1ɉu|SVW"uhUW$h3)[jjBRh-#W~ ZYu_m$un t*WhUW$V$ ShWZ u<=uDžSCVV=V_Xtq豈[^u蚈ZYtCh0Zj^_u2eY[tjh2.XZ1 jh3YNG<1؍e[^_]UWS]S 1E CM [_]"Uu uUWVSSu] V 1EStitcklЉE1}9z4u@lM9ut@FjlP,‰FXYt*1}9{4ukl4 @lM9uܰ1e[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF;s rEtEȋỦEUEЋUԉEU؍e[^]UWVS]u 1V,ZtƍCڍe[^_]US]s Os$GXZCE]6UWVS]1;3s8klCxdF@0 ttW X9sklS9zduBd@1;3s>klCx4uFtWXF 9sklS9z4uB4@s裼XCEe[^_]鐼UVSjhPju蘤t)uu Ps\ @u)y0Sy0Z1 S讃Xe[^]UWS] 1Sh|duw t#S;S t%iSR3莸ZYt3ֻX1e[_]Uu hzd@u)UVSujhPjV辣t(ju jPV+Sy Bx01e[^]Uu hedAuUU EHJ Ju BP dnqEMt0t(t h5!#5U4hQ%vtstZ~ tS4C8u%uh u hH_hPRY[P5U45l4Po41RPss,nRP5U4%5l4Po41RPs$s nRP5 U45U4h`%v=5l4C S$CS Po41SQRPmRP5U4몋P ^uC( PGP5U4^u CH@L؃PGP5U4^uCH@LPGP5T4a|uCHpX5T4|uCHp\5T45U4hn%+pCHP`u&h#GP5T45U4hW%vOEERh%jPK hFURjPà P5T45U4hW%v蘛S軬kfx5T45U4hw%vfCH@Hth~%vMXZCH@Hth%v5Y_CH@Hth%vXZCH@Hth%vY_CH@Hth%vXZCH@H th%v՚Y_CH@H@th%v轚XZCH@HE %FEe[^_]镚fou%CHP5T45U4hW%vmI+{jPMQKQWsPRdk B(0`EMQP5U4hW%v"0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4I8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhH SPXZ1e[^]UWVSu jFHP]Sl jSSjjjjj KHP-E܃,11t]DS@uu@tA^Ht҈Uth#WXZYUu CcL'/t C/jWjWS FHHL1e[^_]UVS u vDh%j ]SH j SSjjjjhG0SkFDVHB`1e[^]UWVS jj%趤[^9hBC _hBCC_hBC C,_ E1҅tuB &tME4}GF _u/UDEjh譌MEZYU}B}$w"uuh@BF _X}$th%h&hh%^jjjjh&_hjj jjj%SjM8ƃ4xu Pg.V9Sاe[^_]UWVSQE @4uE x8u-u uxXZttt =t ujj ^_x 1҉j4&U茋G aUBXYu؍{shAh AChAC h@ǃzpjjjjh`hjjjjj SjM7ƃDxu P3-Vs8S褦1e[^_]UWVS] ;G(S119tuklKI0΃@jj h5!#GOOgRPj!W|g jj h5!# A1҉SQыcRPj'PSPh1$j GPC jD>h> QYÃsV4QZ£V4~ް-T1~CVƄ5T -߉TPh%jPhU4C j.6>hU4P5V45V4GP:P-Ph7%hh U4B Dh$CXe[^_]UWVS] @|4$DV(Y_TV$ C8@@8 QPVRL YB r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhghbjj7jjjjF)ƃ4PV0V)E)PB89B4<藓ZPufLW WPF8PP8 WRPQLP $AZYUMuBy GD tO@E묅u}u4V._ti[yJtpT)Nj0I)WPjhp4)Nj0))WPjh蓾V謺Yu(V螺ZuujV^_ƃu1s$ю1C$s( C(ZY1e[^_]US]t*hC%S=ZYtj/S ZYt xu]UWVS]u}t1҉t1E U EU`& EWEURPh h44uY= uˋO uEuHEtMUjh%h44 UMutt5!#~="54)uMUjhb"h254 UMuQ44 u ƀ44HFu254tt 354'54<:4=Tt~=8 tu=Ttn=T = 8t`=T=54x u(u tyq; 84u;84օtx; 84l;84`ttRh `4S9É$h `4h54O u5454t/u C%54e[^_]ÍL$qUWVSQ y}Yq ]uqyY8u j URPsE؉U܃ tMƒ߀GuMuujh@4KMu!MuujhKƉ׋M5Ct01St$<+meAEyt15PZ4EPEPEPuIC~HZ4wL3Mh/hY CSEȉUjheRP/%Pusss shE!%h(hMĉ PZ4hPZ4j,F PZ4u/EEԋEE؋EE܅t+EPEPEPu,APUԋPU؋@ Eܡ@|4$tuuuR@|4,jhP@|4$tIytCf(u9PH[Ht'@|4$P@|41҉$Yhh^X]9_~GL HZ4AEȾe1Puqqq qShC!%hEX$뱍EPj-EZYDHZ4DPZ4se[^_]雃UWVS5LZ4t/uujP SgthjbXZe[^_]UVSE X(uNpƋ0VPsjhSà uhjj ؍e[^]ðUE1Ҁ=LZ4t]]UE} t=LZ4t[1]U čhR!% h^!%j!EjjEPEPjh0-k$@tEU th!%j XZøøUWVS,uEE1Ho4Lo4uFVEUFVEUURURVЃ tԋ PZ4EUA @|4;\`|.}t1hjq[_uCP@^N t9Ӊ}ډȉHo4Lo4 Ho4 Lo4EEЋEE̋E E11}E,E1ɉMԊ MˀuMJ}uE9tEԋMu}t>MJ}u29Mu-*}tMJ}u 9Mu }ˀuGE }$vE0EDr%=uu r% = uuS% = t;}yhjΏYZ|tTPZ4t&@t 9t9PZ4t@u%}*h7j袏YZ-OOBOu5(O~% E tSE (!%~ v$ t!%~ v t "%!% E uW!%E fUu)8t$EU @|4;\`|ˀ}t4U uWNE (}uƒ ҅u uuth hhXjeZuWhUW$h"%V艎e[^_]UWS0]}ȹ 1E1EEE =LZ4ujjS@ jP4E܍EPjS@e[_]UWVSM 1@|4f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuh "%j]UWVS4}=LZ4PklUVE 0G^ZYE UlVSClP11CC,C0CLCPCT @|4$F( t1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC%%Php%% ` _XVh%%S! S 5]th%%h%%SjBh%%Ph%%Sjh%%P'DD`4ZYtuVh%%P 5D`4ujh4"V/ VUX1e[^_]U1ҋE]UE]UE@d]UWVS$E}Ѝ}1ɉM] u]u]܉uu9uu~ u >}}w1] 1ۉMԉ]M]x(Ã}t*3M 3] uM ]M]U9uU9u y;u U| 9u܋U}U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á4"UWVSLEԉUȉM]E EUE}ԋwu}9UM}։lj]19؋]| E1ɉM;EE}HuuWV" t4EUuuWV);uE}u}]ԋEUCSEU1҉ŰEUEU]9]E9ƉMEEEU)EUEE1EЋM9M#} E؀x @11ӉM܉]3M 3]$M]] ]9u܋]9ƉE9ƉUE9EEM܋]Ή߸;EE#EUuuWV);uE}u}E9Ɖ]w)]9؉ы]}EUEЃEE9EE]|Eȉ0xEUAQ EE̋EU׸;EE3u}uuWV);uE u}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]USQMAQRPRPjjjjU} IuEU11ҍeY[]UE]US]sh%%j ]]PUWVS]} j/W讦 ZYƃti)PCDPW ƒuNV`~EJ9s4t'19ty u9t@e[^_]Uju EDPUEvPEDPu q UVS]=4u %4K$9C |`549s sUjjjjRPRPU t39r,1tu{(u t @9|1e[^]UWVSU}119y u 9;] u}t uz(tt}h~[nЃu"9uǂǂ1J Z$1ɉƀJ C@]t&%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVSZ41ۃ<`&t9jS2FFXZSF w&ӉӉƃ"ue[^]Ã=Z4uU[4]ø[4UWVSUu}E EE9E sX11ۀy u9t 9] tC9] r8@9E}tMa}w}uWrVLn 0}t.1HR}t PRhK&%PRhP&%WV R}t PRh%PRh%ԍe[^_]US]uh^G%hP&hhU&%suLX]]hLUWVSÃ=Z4ujZ4u1hujjhjjjAjjjRVh襼E4URPHu膽V+}51Dž<Dž@;us<`RVSPL t$hl`d<@FjH&4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV;)׉<@8ڋE"C t @]fCEf@ DP:Xe[^_]UWVSEMt]X$[ EXUjS%EZYtI -Ut#E@$19tD BMNju1ۋE Ee[^_]UWVS] Ep+s8k H(L9tWIw\hWKQVs4RPdhWWjjjj@(48WVs4PRp Vs4RPh 1e[^_]UWVS0] K4Uus 0RQPVL Utss ssuu3輥C S1e[^_]UWVS0] K4Uus 0RQPVL Utss3CSuuPR|EU+CS;C {}C S1e[^_]UWVSDÉUEE1uu11;{ sGMQWSPL t2EԨt+M؃9u#F}y tEċUȉEUE̋UЉEUG봅u*}pƋ0VPjhKNtY}yS}ttURURSЃ u1pƋ0VPjhVSRYt }WSЉXZe[^_]UWVSPuIh=1҉UU:ÍU.WVhH %jjjMQR9|ڃRjjh(%1e[^_]UWVSl}1E EEURj-1[_|ËEPRHEU@|4PLEUYE9ƋE|EEE 1}EjP4E̋MEjjuuuuPo41ҋ}9=Po4׋u}EURPjEPQEƒ01EUEUEUEUhjjhhhj6jjjuSj{ƃ4u S$ZkEPVVQS$}u#EMQ]SP @u uXUEEP tB]fCe[^_]UVSR] 1ɉMS4t&uVRP u uXfC<1e[^]UWVS] E@fHPR0_usCthpWD ƅhWWjjjjp t%RWP@ZYuX붉Ɖse[^_]UWVSLu}1E EVUEURj-CY[tUÍ}UE;P s WRPQL hjjhhhj6jjjuSjj4uS"ZwURPEEP7Sh"}u*UE;P s]SWRPu uX1}t UnEx fFe[^_]UWVST]SSPHEU@|4PLEUZY1}9M|EE1E}u{3jjuuuukMeRPjEPS,HEUEĉUȃ}uuujP8E؃ jURS @tQEM;M qku0}u jjuuuuuujURSЃ,Hu1~Uع1EUEĉUȋEUẺUЋz!EjR4E؋juVStVPSRLƃ txtjuuSe[^_]UWVS|]@|4tf(ttuh(%hH&hh(%xF5To4t\Up^4hjjhhrhRjFjjjuPh]4肰ƃ45p^4Y20艹Ep||7oxwajj h5!#jh0jUR,jj h5!#jhjMQuMQURW|xu@|4PjhqN@h$@|4$0ظE@|4$pEEEEEU׉ u11MQMQSЃ UtEfEEEĹf@ @ #@f@@4=4w@ f@*@,EhujjjjjjjjjQRh蹮ǃ4t P苮@,BEPWKW苯Et11!UMQWSPL UuG;{ r"E EtEuEȅtօt1hIjHY_uD`4zPh)%& S3ZujhQ_XO:jS[^JsjhsO@|4@u ǀ@>U1]1EEPVXZ}y1Q1҉u1Hùxt%| q1@ 4S-|GEE;xrB;Us E11ۃ}t E;]sP,C_PYV觭5p^4XZ}e[^_]UWVS0EDž}uEl4jS ZYt jS^_uDY15jS_Zu[^ƅ1;44} tE 9[uE(u)tMQRYu';s{Љ E, UHD9Ɖ}djj h5!# WVjWIhpƃ 3WVPh:)%V;: V6` ƅ3诳P` XZ00@ V_w%tDž111=uhnjj h5!#E,}H,DRPjVE$ho觲RjPESY}Ɖ<$sT2 ‰$SPб SJ[Xf S賱 $%f <$S蒱 WV9r$hE)%h&hh(%wuձZ1hjjjjjjjjjP|Ã4tPS_X19s <19t4U@YڅttV8Z,! tSѨXe[^_]UWVSljfDžv/ƅujhH%mY^yhhH%S8 y蝟t&蔟8t芟WPha)%hSI hWS7 =Džp!j/Sl _Zt-xv9tH9s8/t@Q> YyߍxPWHYZ%=pu>hQW iƄ/u%蔞QPhH %hSM %hQS6 =@uW= ZuhWP6 =hSÄ Y_1Ҁ;/u 1Ҁ{‰hSp<$ZlhЃpDl=w4uhhC%S6 =whWS6 =v Z?Vk _y BVY.VE ZVX1e[^_]USÍEPSvFYZx7Et.jSXZxj `PSH t SZY1$SO`Z=vf u]UWVSEUP ^ƃ}t11ɉMV@0 Zt{fx vX jh*%S uSuha)%EP' @u hi[#- 3Et}tESWuhX)%j+u[zV XEEe[^_]Ujh*Gj\ UWVS hg)%11tY+ڸp)%xuڸ{)%wu#WSDXZuWSDY^1yah{)%觛hPS3 WS E1u h)%聛PSh)%j,Sh)%j7hSDhv)%ShPP3 WPDu'h)%S蹚PPh)%jh)%hPS2 Sh%jtPh)%h)%jjuhh)%SDhPWs2 h)%S'PWh)%j-,h)%S hPW@2 h)%SPWh)%j,hh)%SؙPh)%jMh%S赙Ph)%j*h)%hPW1 h)%S|PWh)%j(hg)%贙hPW1 hh)%SByth)%S# Ph)%j' h)%YhPW31 h)%Sp14-Pha)%hWo vtpWh)%jC utjh+*DXZte[^_]UEt^4fP]USE@k `&t!`&ShWE 0=Cx^4 ]UWVShƍPhW@j@1jh*%V_ZRhW@P贮 11!tVk `&`&u Dž"BVP:ZYu=t^4DŽS GjjjjhA jjjjjj!Sh˞Ã4tjPS`S蠟EXe[^_]U詖x^4tPPRRRh*%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡPo41RPSQRPh#j]S輫 ]Сl4EԃЃ7P٦URjP:jPPh^4 . S  e[^_]UWVSĀE@kl} GNjE @u FuG u G08uw0WEU1EEPj ĒXZ}E MQw8P uEP^G81ۉ]E ];Xwk]lE X{8tIC] su19Mtklu ^c0AO0u uu ]u]u tu9]}UEG0uW+EUu FV}t ]U]EUWE <1e[^_]UWVSd} E@9E Ek] lEpF0t0 tfA A B}lj@&fG G5GG G,G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{`S(xE+C$PR)XZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQPYZuk{8ueEC8EC4FV SVCEpxP@EUHo4Lo419| EU)AQ1&Wv @u1]{]4VNUMEP$@ EU]9]s#kElx8uyP@P b]9]r,1]9؋]|ZEM]+HX M]11~8u(V] ]9E]|V1]9؋]}yV9E]}jM9MsWM]+EUuuSQ^UUMNk]lUMʋUeʉT EUVEM]+HX M]11ҋ]9]sV]9]s kul7T7]9]s kulD7T7 M])ӉM]19Mt1E9t$E9t8uW t G0u)EUAlʋ}9}}y{&к 9ʺsbkEl}GËSEUu}+u}uuWV踵)9uE}u}u}EU)SE};xM] uuSQöы}ϋUʉӉ]u9ދ}|}9׋u}ȋU}MOQ)EUE@EE}EpxPEU19]EUC<S@9Ɖ|]C0EU9ƉE@9Erk9EkElU‰UM]) Z19ʉ|EXH 9|1ɋEHE0xP0tqP0EH0bEUӋEU)uuSQbыU2zk]lu΋Uʋ}TE0xEPuFV e[^_]UWVS@PEU 8/%hWid C@$QsDPRL$K @j[ƅƅƅ;KCPhL/%hPc {@81t 31묃u1돃ty  ?VI$$@c)((A6,,B 1ɉ Ph#jS[ jSSjjjjW*[0S ZSՙ Xe[^_]UWVS(]}h#uV V _4XYu81ɉU&MVP{iZYU9‹M}ƒ$uӃ_4} E $&h4?V Wtjj"V_h5ku2Po41RP {RPh#jEPZ h6&tjjUYh7u)tjjUZPhUW$jEPEZ h8t"u h#jEPZ h9t"u$h#jEPY h:bt"u(h#jEPY h;0t"u,h#jEPwY h<TVP_4PhJ%she[^_]UWVSX1ɉt @@_4t4t=$txuP1$Xytƃyjhn/%裬_X=44|uÐ Dž814ktƒ8B1;8 8.T8 RPha)%hW0X 5t41҅t8t%FWP@hZYu Ɔyԋąd4ƀy1LPTXƀ);4ǀ,ǀ<jWP hWd4"P =t4u/d41҉t4hd4aljY t_t4tByu/t49ut4ы9u􋐀뺃G5t44@k<Љǹ1󫋅PB rsC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB r$CsC C8RPL u;H ruكtЋSO_Wk<<󫋅PB rCsC C8b]1fD @9s=}4t1&󥍅Pg^&󥍅P6[=4tcDž DžDž41҉0&󥍅PY=}4t1D&󥍅PX1B fTB o_4yFHfGe[^_]UU J E]UWVS0EЉUĉ1ۋ9}qGE̋GE11ҋũ<tw9tMBu9uSuh2V%jEPQ 5t4tFURP bYZtEЉChjXZe[^_]UWVSl4ppp h/%V# h/%V_X1l4k,<PXR0PRYJ GPZYtcOTt[8jjjjhRQPWxl4؋QP :jjjjjPqTRPx Ph#VJ 0)h/%V)_X1l4k,<PXQ0PRmI GPZYtcOTt[8jjjjhRQPWxl4؋QP :jjjjjPqTRPx Ph#V^ 0)l4p$p pph/%V*h/%V h %jVkE j=l4tPh 0%hi uql4t负VPh!0%hhuKl4th60%hh u,l4thI0%hh u l4DpC1e[^_]1US]1{u4{ t; |1C4dv"{x[]Ã=ā48UWVS`1Dž1104P~Y5t471ɉ$;H QPRL t tt߀8tPRF RFZ /thC%R؂XZ04 QR/ ZY9st6t-QYZYY99}tt$;H s41VDYD 04$Vha)%hPJ 5045!#t)"PPuE XZt04PtYVPh)%he0488  RPVhb0%he$tt;,($ PRPh0%hbe$!PRPh0%h?eu&04@40|81e[^_]1US]1{u&{@u1C44s" {x[]UWVS_4t4xtt$u ƃxaPYt0$xtEjjjRt1PZu#D`4tSh0%PM pÅtD`4tSh0%1=}4'4P_4p41:uJ Jt @ =u_k 4]ȋủ44BMȋu1k 94u94u94t Bu1҉444e[^]UVSMU194u4r94u;t = u1[^]UWVSGDžt41|?1$%$;p WVPRL } t} t!} tWVS jVSSx k|<$tjjjjjtVRPx|ǹx󫋅tfDŽDŽ&,| Fhujjjjjj |}@Pjj|Ph/Ã4u1}?PS%S0 |9ṣ_4k<}Ee[^_]US<] EjP_4ZxD1k8|<u$MȉHt4t5xt$h`G0jY^tjjXZǃ=_4؍e[^_]UB=ȁ4tuh2%jPO UVSuu1r$ugjjjVyÃtjjHDjjFPt$@|4KS;DH} DHe[^]UEx8th؍#h&hm h2%J@UWVSQ} E@E19u~aEX=su8u?G8.=ru8u/Gx=muWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$r,$zuubPrYtWWZtNjE@ u WV_XWPV. tjVSE@ t VPZYVXjjSƃx_4 e[^_]UWVS] uUYP}Ĺ 1󫃽PuPZt苅P$V_xt2jjjVǃtVYt P$VPHHLd 1Zw j&RjP8x u0h؍#h&h h2%^HR^,t7tPv_XqSeZYvWXue[^_]GUS]sh 3%jPA ]]_UWVS} EX,1t)C@WP5ZYtCWP5ZYt FӃe[^_]UWVS4u}E E th%h &hh2%>=EPuZYtjDj*YXu1K&u CC4C8"C8t@HX11<1t4Q,1t9E t @11tt:[]UVSQMp@19|hT3%h&hh2%49ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s6SrY;C K$}%jjjjRPRPU Ɖe[^]Ã=`4uUhѓfXUS]=`4u1;`4s k<_4[]Ã=`4uU`4]á`4UWVSSÃ=`4ut=;t6`45_419t$USF P+ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}hi3%R+ZYuj ju^_C,S0hp3%VZ+Y_uj ju6_C4S8hv3%V2+_Zu0j(uY^ƅj)Pn_ZFh|3%V*ZYuEh3%V*Y_u j(uh3%V*_Zuj`u@S Oh3%V*Y^u>hf3#EP XZt(&>ttVP_*YZuG C<e[^_]USPQRh3%EPj3~-h"uuQEjh&PH)t2uz[1Eh-#EP XY:tjME+[h"j QEZYuuzX]UWVS1jhPjEpbÍPhd@S| @SAEP,[1Dž Džƅ ƅ tfÃuCt=ut2Ѓ  uuЃ A떋Ex@uS@4tPh3%P ƅEpPh3%j3t1EE@@Ep0Et(pv0v,h3%j\3V1y1ɉH0X,t(Eps8s4s0s,h3%j 3vE@61C,S0Vщ‹VZ*H{09L;C, P{89T;C4 PCP ^_;t' Ps0s,h4%jB2s@\PV'ZYt$Vs0s,h-4%j2q{tރuJtjaYj jVN t*t t/j jVNKj jVN u7thh|(%P菍 hVPz   h_#VZYuDG8PW<G4&hm#VZYu)+hP#VZYu)j h&V t򉕨hje^Xۋu0 jY19ȋWi[j`RC@P$ C,S0C4S8 u+t)CQ RPwYZuƅu_, G 1E u蒯 G1ɉOOO_O _$UWG@jhRjPQƋ_,tjP4tKRPPs0s,V0t'8t"P PXZ@8u ǃC4S8)G W$q1ɉSh|dV? iRy_ZugYSh|dV u܋1;s̋G,tpH,9H0u0;u"H49H8u;t밉jSP菈 BuV.Z1e[^_]UP}4t 1=ȁ4]USÉIQHQH QH QH QH QH QHQHQHQ0h#RSl ]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk&WV uu wu聇 uRCu1jSk&V u%u vuF uًU EGue[^_]UWVSu] t>u1}WEPEPEPEPEPEPEPEPEPEPEPh#Vu4 u}w1M9Mt ]K1ߋH X$9} 1҉P P$ )H X$EE}Uz=tVwAtLw"Q w=RX<Á@1HøUWVS։M11ۉ9uuRjSP07Gуt `d1ɉMMu]썜SjuRVPEЃc}t09tGE}t"MM슌 MtMuʋ0tt9tGEC01e[^_]UU 1tEMh]UEUUqU ]UMEPЃ< u1tE0]UE1҉UU ]U EEEEEEEP}U EXUWVS]xu,P4x1p3?J} @0P4x1p3?J} P PH1ҋuVi13k?] 319[^_]UWVS u]}1u܉]EPU sZu tX5%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EEPEPEPMȋUEaE )EЙ]u)։]u]uEEEPEPEPMԋUE Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋuԉMʋEeƉωؙMʋEE)׉ t/E Et'EPWVuuEE Eu}tE}}5E؋EؙRPuuEU@|4DH~1ERPWVuuRPqEE]ÉUӉыUe9E1EPEPEPMȉEp xKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9ZXeY[^_]aUE]UWVSQME܋A1҉UE؋E܃0EE1Ɋ t.}uÃt&<t" ,1ۅu9ut@u0Eu1ƒ< PWEpWMUE{11҅xE1ҍeY[^_]UWVS,U$}(E,u01ۉ]]]]]]1ɋ]9ً]| E1ɉM܋]]19U}U19E}E1EEU ẺUЋEHXE;E9ME0juQuMU]M MȉE@E1;EE }H1u}u uWV@)׉;u} M}EE)9s U)‰U1҉UM1ۋE1ҋ};}}܃}uu VN^ Eډƹ19 Ee[^_]UVSEP$9p |$1jjjjSQSQjURP>,1҉Ѝe[^]UWVSuMU ];k _(u/ȄtaB 19t Bu,1u.R E@M,9du 1dd[^_]UEUUUUUUEUUURU UEUUE1҉UP0UURsU UEUUEUUP0UUR(U ZUE1]US]MEE k B(u#1tAƒ<!Ѓ;ukE U1uQЃ<![]UEUUE1҉UUURU UWVSÉ΃8t2$41jVRfx $Rh{dЀ3# jhPjR?@ue[^_]UEP0RPNUWVS]E EC0E1xp@u@|4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@u}WuSZ yуtu G{0Ea;hh ZYohS9ZYa }U׍e[^_]UWVSEX01҉U1Eߊt]}tttR<tNwtw A,<vy `4CFU,U9u `4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU P 1]UWVSUE}u NtGtRutG_tvpS GPh%vS FD64t(vtvPSn e[^_]USR] = `4uj EPu5 ƒ =w uE8tt h7X1kD4Đ4u]U U1vEEUEPU E7ZÅt*UVS14LFZuSLXe[^]UWVSQu>xp19|h16%h&hxh6%]9|@89@|ue[^_]UWVS0uU=@|4]ډ@E =~Mȉ\1ɉ`Uډ@8;FF| FP1RPz~ tjURjVPL tWEċUȉḾ1 u@dž9|Ӄ!lj! t9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E E th<5%h&hh6%'hj"F^_&uӐ CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP @ǃEPu9^_t!ẺEЉEԉEȉC1҉ ؍e[^_]US]= `4uF1Ҹ; `4s)=w9t kD4B1=w kD4[]Ã=4u ^4UWVSƉ $41󫋅 EU RPVh.3%h4P E jhPjV0xShydP @u V X1VjSui e[^_]UWVSlu] E EE$EEPSV EP߸ډzXE8t%E8hI6%h|&h h6% 1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}t }t#1A}tPh"2%%uPuyh "}tPhe.%Ph%uu ؍e[^_]UWVS8Ɖ˹1jhPjV.1ɉDž11؉1u51 RPhS=|=ZbƋ!!Љpu9tEXH!ƹnEXfUtƒ<<„t <uh[0101ff=Ut f=u(Ћ,D1ɉNu1󫋽~wRXu[tO ttGEt%,MPP,1RW P Pشx rt6t%F,dDž $t tW9,sAu1hji>^Zt1ɉF1*1҉ X1u1fǃUe[^_]UVS0E E th<5%h&hh6% hj=^Xu1E up CEUY~11ɉKKCSǃ?ǃjh>RPo@ECǃ1҉K0SUE^@uSAhރ{ u_C$9S }NURjSPL t;M܅t44t,41@=tD9u=uSXe[^]UWVSSMӅtY0uƀ1҉8,0)߅uU,)ƀX[^_]UWVSP}U] J3ȃ<tu&`t$[ch\XQ1EEJE,K1CB C 1CtqE1ƀEDtP?1҉TY}`t01`1ɉEǃ<t}tAu1ɉM1EE9`uƀ1҉vN09MuCt:[6%29Mt΋0ukE00,09u/1O0t0uu 10M`0 e[^_]UWVS,É11@jhRPS&yPhd@X @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< 󥋅EE 1h1󫋅,t20t"uh؍#h&hh6%h  u/ƁƁƁƁƁƁ} }t~1É1uvB? ڈD>1É1uvB? ڈ49 fDžU1 uAWVhP#x30J12XuWV)׋1҉!!S9uE9u=H!؍S=S:ș[9-9!X؍e[^_]UWVS]Euh6%h&h .1uEE}lj1Ʌuh%h&hh6% s{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVSÉЋ{1Ҿ44tBt D9u3{u}s{ u}u}u}v}t t4M1;})ωxMH PC u hk"kE UP XZ܍e[^_]UWVSE }Ĺ }Put&4u{}1ɉt4t_41 h6%h&hh6%1 D9t Gu]u1ۉ]]]]E1u)E6%}vuuE}t8tރtu݋M\Z]1ɉMZ1]u뼋u^0]M Mt3] ]tu$}rEdu uXM]M9M]uUMUMUMM9M]uP @x|EUx|EUE9}}}EE`ut.1EUEUE9EE}}ދ0Ή1}9}}U|s1EUEU,Mp1t1ptM9ȉЋM|/9t+E9EE|}E1hj1EZYEfǀUƀEEE1҉RPtpu9uu|H1+EUẺUЋE,ujPE}܃ t"49ttPt5W{ 4Y_E0Z}w1u}RPWV})׉E9Ɖ}ME,}ȋ})1ҋu}׉u}uĉ}ȋx|9E}}EU+EUẺUЋEujPE}܃ t"4t9tP4Wz 4XZ0}9ugucE,9EE}Ohj/Y_uEct4}},fǀUƀ0Ë0}00UMыE`E]}v& }v}b}X]puu;u}ʉUHX M]EEjREpRMUEEE1ҋ]9]ЋuEEM1ۉMĉ]ȉ$tuNEEE1҉UH1ډƉuuRP&)׉}9ǃ}U1UĉEȋEċUȉEUEU1ҋM]M]9ȉ} +EUẺUЋEp0\EX}T>uuuE}܃ t3UŒED4Ut9tP82Wx }UD4_XE\FhqjjP胯 1}?t;_uE@EuՋE1EE1ҊG9Bt<utE0E}tbExt99BEXEtكt&t!9B1ɉME}tX̋E돃E9\=,ujSE6}܃ 49P0W*w 4XZЍe[^_]UWVSL]E EEEuC,t)uC0EMċUw-:PX{,BC0EMċUHu1uĹ 1jjjj1RP1ҋ};}}EURPjEPS,tEUEĉUȋEUẺUEؤ4jVSUE uaduVh`&suuuus&C,u*E̋U19}'SjRPuus &C, X({,tˋC,tPC,e[^_]UWVSdE}Ĺ u^0]H441@=D9u€t 1ۉ]1}t ߃tu‹};} uE@uǃt"9t}h?]QEEM1H1EUȉƉSQRPM)׉u9}1UĉE11҉uts;E @˃tuZ}`tMt;E ti@EMt˃tt9E tA@E}uы0Bp}t E7%E}U1ɉMEċUȉEU1u9E8ƒt<E`EUEUЉEUMEu49MEEE}tIMtƒt6<t2,AE1҉UI1M]‹E9‹EU}0n]уtt@uh؍#h&hT:u09EE}}h}[UUűEЉEuEEE,EE] E9sEjQEpuMUy}$EU7%]]1ɉM1҉]ĉUȋE19u֋M}ẺUЋEuuWME]E EE t];u ǀ]܅t'EDt9tP*S%q DXZEt uDEt ]TE9u/Eu;hqjjP E̋UЉEU1҉}ttBuh؍#h&hl8EM]M]։u1}9΋}})щ h6%k E}uEgEe[^_]UWVS]uh2%h &hk h6% Es0h9tSME M9u㋶0u͋EtP^C,t PY`11d)FZus(X]e[^_](UWVS}G,t PXjhPjwÃt7WjR4$YXtRVSVz(SZWXe[^_]UWVS\E0h^_E0h#jP]S jPSSj S Ǎ@^>w̋E0h#jP]S jPSSj S ƍ@[=wʡ@|4EHDEU}~ E1ɉMRWuu@SVRP/މؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ@|404}81HDEU}~ E1E}u?9}/jh>uu =~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]@|4480h%ht}WuVEPS$xuuuh%hqWVEPS>tuuuSЃS,e[^_]Ujj | jgl j P/US P9 $5!#PShG8%h- j谻 U=(-u (-4fPftPZ9(-UWVEE왉U1E}ujEPjYJ e^_]U0E E1EԉE؉E܉EEEPEPuR ƒ xEÍL$qUWVSQ@@u5jh4V 444444XZjPV 4444+44_X49}944s74󥋅441=4uh(jjE(t!j$jjV =4u`h"PS 4Y[tPhUW$hPr x4419߭y%ݝ݅ %߭ٽf f٭۝٭y1d~dVho$)P=P Nj4~-4t P Z)Å~:ùdh5!#)Sh`&Pho$)P=PZ ǃ119ʉst @u4H&SQhp$)P=P +44+ 4y @B%ڽ߭ 4419ظw ȉ߭%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4H&%11d PVShp$)PPV 449lj44)ލ 9lj݅99Ћ}h6p$VQ苽 à +44߭߭ٽf f٭۝٭?~~h)p$rtPh"VQ Ãhz(%VQҼ à <ЙRPhCp$)PP虼 Ãuh")PPo à 4fPftSVP eY[^_]aUSP jB X]UWVSPu ]Ett v9s 71;uuߋuE9s$;ut:GFFPh8H%jW ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=P-DWtDOt uxue 1!tjjEP:  FCE덉뉉؍e[^_]UWVSujuZYt&Vu PW9u 7؍e[^_]UVSu huà @tuuSSQ؍e[^]U|EPuN ZYtM EUQ1UWVSEE 0Vj S DžuVjSժ ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U <v }D&7Ep V߻ YƒwCljt)1E@EȉC,ub Ex txj(Zu h&M3XYǃ,f@S(P1.1;,s$k(рyus1(D@.u e[^_]UWVSSƉM׋ttU9t7{ t1 ufujuP@ t[뼃 S Vh1:%~2 e[^_]UVSÃHt1HL~tU HXPF 1LXPt1PT~t PYP 1TZ`t1`d~t `XP 1dXt/tV1I,X 1҉Yt/tVH,X` 1Xt/tVH,X' 1Xht/ltVH,lYh 1hZe[^]UVSTjjjVmD@PjVj48@t@сt t t48SVQkXZe[^]US]E ftPh&h9%/ jPG t(@t h&/YE u1҉U E].(Sh?jPe#@uE &E:%]I/]US]E ftPh&h9%7/ j|P t@ v|y 7`x |ZxYZt>1҉Shj"@u;E &E:%]x.h&n.XE E]']UVSĀptQPhhxVj@u h&.XV Sh\:%- e[^]USË4%uXh:%S諔XZ{PtS0Ytp%tSLt~:%Ju+#PS`XZ]UWVSÉ׉΃t t%:%t1PSۮS]jS|Au:%tґ#PSXZe[^_]UWVSÉ֋8 Ph:%,1ɺhXZu:%VS诓Sjj$1ɉK 4%ujL%XZe[^_]UWVSUM8tt^@@tR{ tGu}  t1҉CXZ[^_]USÃlt1u?hvPplPh:%+RPXZlu]Ãx tkUSË%u6S_% Y u=uSmZ S.YuSX]US]SіYuj#XZIpQpcvPh:% +j#ShLjdj"]UVS]E ftPh&h9%* |)RxP uh&k*X;|t xD8t|x苐h-赓 H 1tf -yh-j ګ Y^-P- Sh?j@uDE &E:%e[^])j+XZu Ee[^])"e[^]UVSjh%ZYuh%hj|#)[^"VP,ZY@u Vh:%(ZYSXe[^]UWVSPu~ % tVXtpE&%Et%`u VYE%@u$t+`u#V,Zu}V,Xt%e[^_]UWVSE48ځ` u %t8tf% tW*Yt ߉%@ tWl+Zt 翉%` t떁1u ځ u@\e[^_]US];(%P6(jj*jj*4]UVSS]4@tp%@uft0t0VY%t1҃w`&R Vh:%&SvSZ%tw4`&Vh:%W&[^8%th;%e&jN Shj4u^%@tTS,-1ɉMjEP,o@u h$&"&Z,ǃ,Xe[^]UVS]h{"&48с^t:t0t~ u h:%V莌YXvj\XZe[^] @48]e[^]6UWVSD]u Ctt,PCQPhj@EP藖@uh &E%EYE{ VEPW3buVWh;%$ {EtSj@VCxPi! VWh+;%$3'`U D@RWP_Cx3_UXZe[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3^UM   t*;xMu;0tQhC;%#11҉[Y^{ tHEU  Ѓ t3 Z@uh&#Xe[^_]UWV։ϋD@WVXZe^_]UWVS]%t S &_u Shl;%"Y[ % ڋFEj EPju{ }PWh;%"M1҉1;,sYk(jQMu0 Mt5j EPjQ?PMAPuh;%#" MQ~G럋 S3Z@uC Ph;%*"Y_ t{ uS\2%ZtSdX{ tSQ_t>{ u8u %҃RS虡ZY@uC Ph;%!Y_t { uSZt]e[^_]e[^_]UWVS(]} uS$ESẺ{Ls$S$ ({ }u }s uJS貣Yt?Vh;% SSdSǤj3ooE ;%]e[^_]酇Vh;%f h~:%So11҉ 9C$u/S#Z@%a 8E&e[^_]G jjSn"SH#@u* 8t h& _1EE A]e[^_]2"}{ tC uPh<%Ph%<%Y^{PtRStCQEЍ}ԉƉщUS苢CtZU9uPEPu- t{ t911҉{ t411ɉh+#S3SGES6]e[^_]e[^_]US]C Pt$ZYts$sLP ]]n UWVS];1{Ly)tC$tjjS 14%tutEC$u?tS!Y@u h&xZjjAS @u h&]X]e[^_]US]C][]3UWVS ׉΋U K 9}!E4UQM YZMUtB;u t9{ ;u u{ t|EUh:<%SvjjM%tuuS %tS貞ZSKSX+9t'C jjM$S [e[^_]UWVSS] 84%@tjE1҃ t6HjEP, @hD&h:%_tm>hn%h<%hV<%@t+XRDAtxUhF<%hO<%hV<% UhF<%hf<%hV<% 1Uhn<%hx<%hV<%p 11h<%h<%hV<%Kt [h<%h<%hV<%<J@ulh<%?Y_jjj KPh<%3<4u544%u dW4XZe[^_]USS]E uPh&h9% jEP, uh&j4YuZ8t$h&h<%vj,,̼ǃ, _w$jPh&h=%j6U8tu h+=%mYuSRXZ]US]E U{ u)C щ‰ { t][]~[]UWVS ]]} utSEtXZu J w{ tC Ph@=%W=%^_CStP }tQSSh[1pEPjEPu Euh&YASuxXZu議 ~ WEtKYXt3{ tC Ph`=%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Whv=%11ɉtY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu ؍e[^_]UWVS]DžPPhh{H @uhl&h=%)1XZh=%%Y^1hPqF1׃ u Vh=%XZu輮 87t貮 8 tt Vh=%^_\XPS+ǃuhl&r[ttlHp VW ZYu VjS ϋFVt=PVF PtZYt%VhHjj 7u7W1FtPV2VP~ t11ɉ3Vh6 WtPtStPS| e[^_]US]E ftPh(&h9%a SӡZ@uD7 87u ]]! 8 t 8Vt 8tE(&]]UWVSD}U uMtNˉUMPV ZYUtOMv_責 7 }E X&Eo"e[^_]G(1f9u2W>G(1f9uW>uxG(f9t& tʉUQPG Ph=%UfW(W>8uHUPVG*P7"  Utn uG>j u G>T tGj%qj%O _>t G*ˉe[^_]UWVS,}E EЋEE܋EE؋hZ>%Sg ^ZuEE d>%+hk>%SF ZYu,EЋ@0S. ^@E] EЉEe[^_]h{>%S ZYEh>%S [^u EЃHo1E9}E4ƚ Y\FS3EZE1ҋE9}?E؋ UQM莚 Ɖ$MQu )KEƍ@E UB 뺋E@uh>%uI1p-E 1E111EEM̍EPh&h>%uu&Mtvkt@(NtT4tW6uE븃UuM@몃ptxtnu딃M뎁M녁MyoEcp-E%@4@E܉E1E11ut0tX~ tMڍN U9U~!E4UQM$ ZYtUBM9]uuVju EvjEPEp  uot0tR~ uvڍN U9U~!E4UQM袚 ZYtUBM9]uuVuQu @u414E@t- UE%  9]u%}uUMhjQt8EE̅x ލW u9u~E4RU™ ZYt FUEЉUԋEU E Uԃ}t}t}u}tM 1҉EЋUԉ/tP9]u>t9[E4tY[tEX]9][tSu؋M܉^XZ9e[^_]UWVS] U1{>tNf}fC(ffGfJuj1 ȋuFZK>s*S>+Ee[^_]UWVSu} lhWF%hPVqà t1=whlehWF%hhkF% <襥 8thWF%hUW$ XZhh[u h&r huPY1l>u?G PhF%( tXZ{>u[C PhF% XZ1hDPWhohnRPhnR =nwHƄn ƄoPRhhWF%V׆@u-h&hF%~ YXhtjWhà phthF%/ Xϋpe[^_]á4tU4P4U4]UE@]UWVS]u }uhG%h&hG}t}uhMG%h&hHhG%p tu 褣 "t 9ptIC ujYuTHtAJHt6BXCpf@up MH1҉PfxCM1 K뽉Cȍe[^_]UEM uhG%h&hhG%譜 u t 9Jt͢ BH@MUWVSM Ep}y1yy9s)}_+Yy tʚ;1Ƀ}t}[^_]UWVS$Ǎ]SjL EPGPShEUЋG uʚ;)U܃tHPU1ɉM؋]9ڋ]]s 1҉P1 ])ډPX )9s tJPMىH 봃ue[^_]UWVSU} uhG%h&huhjG%h&hhG% }ʚ;vh{G%h&h܉É΋P t9zuM9Ju JuK$݋S(tJtHK,JjYtcUUrEB zEBEBC t&H9r 9ux 9}sHJP1C$BS$1e[^_]UWVS]U Eu}xx xʚ;vP [^_]É}u M[^_]USEU M]]]] 1ۉ][]nUVS]u E1MMMM i@BU[^]4UWVSUuuhG%h&h|hG%` B 1ۅtI} t} 9xu5}9xu-t9pu$xtyz$x18z,xB,C볉؍e[^_]UEuhG%h&hhG% U PH@LUEuhG%h&hhG%貘 @L11UEuhG%h&hhG%胘 U P0UP4UP8UP<1UWVS(]}1EO2E@uhG%h&hYhG%$ 1҉ỦUЉUԉU1;s4s,C0 I>v D  DFu EPj躦 @u11EEEE1;s4sjEPC04 @tF1e[^_]USjPj[ZtÍ@PjG ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tg>U t9FuV9u@uEFtB.NtH C1҉KNt R衧KXVXs@1s@sDCMYC t6HtJKHPڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]gUWVS]uChG%h&hhG%Օ 4t,4H44C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t0zLu%1t]UWVS\u~>u Ԕ Vv” 7EEEE1]Mu\ EMQUE UJHOuԊEEjPS PF PhG%F>PSV}(u V*N>׉e[^_]USEtS1jS[ ]UE t E]֩ ]USEtSS[XZ]UVSEu Ʊ9tt ut1t 1@1[^]UWVS}] ?jWS s jWV wmj:V[ ZYDžt?EPjhjjj jGPq C8 }t UC8jVCPIP- ʒ DJu <:tFu}Wjhjjj EPV6q C0E t/it.u#Wjhjjj j@Pq C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WP" ZYt[u{ 1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPjURWPVsu ju`(C*WtE4%@u1t(SsZ@uh=H%AS SwC@SvfCDCCHSu @t CPCHC pS_uCL1s@CX_XnƅRe[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[Չ ؃4[^_] US]SvqZ@u:jhj @tjhj @؋]UUVS t=΁u$B Ƅ Ӄt ӁtӃuӃ uӁu [^]UWVSljQ ZuhX&LÉEhf3#EPl[ ZYtfP XuhX&S2[_LUj@PVM UuhX&SUR q7SXe[^_]UWVSSƉϋ]jhIH%RUx UuA}H} L @ð`jhMH%Rx u>MP} Tð0M@} DKS0CPp}7uMU E$e[^_]UWVS EӅt΀9uE1҉1j/QN Y_DžuuV[ _ZumVhTH%2@EEPjj jjj jud }tuhkH%2Y[:t SP[ZuuV ZYt/1tE0Xe[^_]UWVSÉUQMu YM<9"u"OAIQMjϫXZMt3t 9uss 7QS蘫Y[1҉U}u9tEtCE9KEp9ush4#So ZYudžEPjjjjjjS軪 }ShH%ZJEPjhjjjjS[ F }ShI%8%EPEPEPEPQEPEPEPMԉډ 8%CEPEPEPEPQEPEPEPMԉډ jSuuuuuQt Sh7I%fjSuuuuuQujSuuuuuxQ볁111otq;tlj/S)D Y_M̅tU@j/PD _ZDžUuًE#ًE/*O1t1ۉEEEUEPjjjjjjSK }}ShJI% )‰U썄jYu hgI%R9  T uhqI%oj,SB _ZDžtxu ShI%V9u:K j@Yu h" t%Ɔ EPjhjjjjSOX E, }t hI%_ )‰UčEPSpx _ZHUu-by 7L U䉔) jWY ]̈ T <4t{4u  ;6t{6u @C빅EPjjjjjjS }!ShI% ~LHL+j,S~@ _Zt S h P U$UwYUShI%RPY 1ɉWкY}Eu Ƈh5hN%Si ^Zu Ƈhh J%Sxi ZYu ƇhhX.$S[i Y^u ƇhSj\E^ZPlӶEZYuhl&^lSPpY[{u Ɔ 1kh"Sh _Zu Ɔ Nh%Sh ZYu Ɔ  1hJ%Sh Y_thJ%Sh _Zu Ɔ ShJ%pt$ jٺ@[u h4J%1 EEEU | m^O@8%'EPEPEPEPQEPEPEPMԉډ jSuuuuuJjSuuuuuJjSu8%EPEPEPEPQEPEPEPMԉډ jSuuuuuJLjSuuuuuI*jSuuuuuIjSu,^j=S< ZYu h=J%@Ej hXJ%Ske up}u11҃uM#EEEUIj hdJ%Sd u}u:1ۉjhqJ%Sd u0}u 1ɉM1jhJ%Svd t@jhJ%Sbd t,jhJ%SNd tjhJ%S:d }u'jP%XZWEEąuhJ%OE@MEM̍UE@u E "M1ҍE@tE WB#XEPRU,2EPU̍BP2EPU̍B8P 2WURP%$1ɉjhJ%S%c }u'jP$Y[BM1ҍE@EW{"Z61ɉMURPEb1URE̍PRR1EPE̍P8RB1WEPPH$$1ɉjhJ%S[b tjhJ%SGb uB}EPjjjjDjju. }`uhJ%j hJ%Sa }uߋEj/u8 _ZDžtSuj舂 Hu_Suju HuOƆEPjhjjjjGPx }t uhJ%uhK%11Ƀ}^ٍUE`j/S 8 Y[uEjP JM JM ٍUEsj/S7 _ZuEj P9  J M J M \ETPT'E߉EEUEEEU  %EEEU Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ Ɓ DžtG1ҍEj@P b  JM ^Åu  8%t EPEPEPEPQEPEPEPMԉډ jSƐVuuuuA" il 8Sh$K% q $eS $Y[ hl&> 4%tu hK%fF@u ShMK%  s d X @I : + uh]K%V EEẺUЋ4%t%E̋UЉ1tt hwK%E̋UЀPt @_t1j/SX3 _ZDžtGڍEY@uShK% 1,E̊EE19M k(Pu*t,Uf9Pu#U8uU8PuU8Pu U8P A밁  K  @ED1HEL PETXE\EċE18E1҉uZ }tEHM Eą hK% EH$MH(MąuhK%}tdƅu ShK%r EPjjjjjjS蜖 }t Sh L%C FÅtMhL%k1uLƅtFj:S[1 ZYt8URjhjjjj@P(E 1}̃}t'h-L%j=S1 _ZE1ɉMt@Eh `$SZYu)u hFL%p0hU%S詯Y_1utčph^L%SyYZu( sPu hgL%Uph#S@YZu(:u hL%ph"SYZu(u hL%ph~U%SήYZu πEhU%S貮YZu @)h #S薮YZu  hU%SzYZu h"S^YZt-hU%SMYZu hSU%S1YZuhZU%SYZuh`U%SYZuyhhU%SYZu`hoU%SͭYZu GhwU%S购YZu@.h&"S蛭YZu hU%SYZu hU%ScYZu ht$SGYZu @hU%S+YZu @hU%SYZu hLU%SYZumhK%SڬYZuThU%SYZu;hU%S訬YZu"h{#S菬YZ t ShL%7}tuShL%XZ1E s!t@uhL%Xs }u hL%XuShM%urBth#S߫ZYtS Xu 1E}u.j,EċE@PR uBhl&#V>G1EMċ 9sM9 t>{t8@,9tt(MMċJ]ĉ k,1CC C$C(S_YE{ECs Cǃ}t uS ZEủ)1 E}t5E- }t }EEHh1M%`" SX^ud}ShKM%@dMA2Džt @hd%SpT ZYUĉMȅt"hd%SMT ZYth%S%t>%뢺} t*%Ƌ䟉 u }쉳UaUЍe[^_]UWVSQEE] 1 t 8t R褟ZP蛟X1t 8t RyXPpXEtu7jVu| F;$0@%8tjjV txTuxTjP僻DtVr,DX@ڞHXLtVE,LH讞P_TtV,TP肞XY\tV,\XV(KXZ]e[^_]:e[^_]UWVS0uhdj赙ZYuh|&X9Áǀǀǀǀǀ@ `h8&Ps48Y_tt %t 44 04up04@44jjj? tPd 04 44Xjjj tPgd 04 44!D_ 04 44ЃhF+P P =v1 1ɉ} !8%j,j@_Zu h&!Y ǃDj,jʗH_Zu h&Y ǃLj,j螗P_Zu h&Y ǃThh&W =vh&hN%XZPPZYh-#P~+ Y_t u-PP1҉xW H ZD9t t ux\tH@ߋ@D1@DHLPT1HLPTXh\l1X\hP0VA9u0h&ho" ut=w@ƄS0V!91 1} 11PP}YZh-#P) ZYt u t:R)F YD9t֊ t uʀx\tH@߅tC%䟉1h8$G YZ} uj`@Pd u>ju P֟ d` Zuh&_G`hH%G ZYu;}uPF Y_$h#F YZuA}uPF _ZutDž}tuh9N%IF ZYtOPPًU mDžY1ɉLu}tSVS XZ1+u؍e[^_]UE E9r9]UU19U t]UWVSǃEE1fUfQMbZUu8؋Msۍ;ƸE9EsOƋE)Ɖr=89s "@G19r)SEЉ‹E9s )։1e[^_]UWVSSU uJTuhP%h&h~TuhQ%h&hhP%K YLGL9t)cCu)U QM<W<ZY8ËMU t u7F|B|u t  tAH+GHu9r9e[^_]UVSjjVà tSVS ۍe[^]UWVS8}1}عEX}ى‰+E pE؉U EPW_ZuUBtt U Btu VSZYe[^_]UE UU E]rUS]hH&Ph&ØS]US]S$ Y1t S Z]UWVSuhQ%h&hhP%9J Ɖ׉j<|QS" CPqtS8jhP%!G jjSOǃ t:jWS=ƃ }tG9Et G99EuWS}W* e[^_]US]t"jjS tu S@T06 ]US] UHSuZY9tSL X1ۉ؋]UE PTuhQ%h&hhP%+F 2PuUWVSSEuhQ%h&h;hP%E ӉϋBTx t*tSu/YXu-4STZt׍CPF^t1sCT9FTuwFt ;CtulSV* ZYu_FttCttC8PF8P ZYt>CPFPZYu+֋CT@$uFx9CxuR%ٺ%t R%Fts5cٺ%t R%vSj7Y[@u K 8uw롨tCtt&Sj6_Z@toJ 8t hR%زYVj6_Z@u!J 8th%R%趲Sj6 Sj6ZY@uJ 8th4R%舲X1VuVu ؍e[^_]UWVSP}tDjjS1ƃ t)jVSE 9~TuVSqV uӍe[^_]UVS E uhQ%h&hPTuhQ%h&hhP%C 2uhCR%h&h߃}uFƈPVXZt1SVuh[R%j uV^+ ىSne[^]UWVS8uh(&]S=hH&EP/hH&}W!u WV[8$th&hjR%_X14SVZYujEPjEPe[^_]SVZYt1xjjSà jSEPECT x t8hS_tC8PsTt<ZY@u hxR%AXS;U t0C9t ;E SEP0Y_ CT8ESPXZC|twG|tڍEjuEGT9CTuG8PC8PZYuЀ{Yu Cx9GxuCXPGXPZYuWuW <Et(SP聿ZYt`HT9KTu 8PC8PY_ 1ɉt8SEPSEP9tG h&SXZ]PV(;_@uF 8Vt hR%ٮ[jjWà jSWEC S9;U tSWSEP蚾u~CTt 48%u=t=ٺR%{Sj2ZY@uF 8tF 8t h&XSY]';E ASV,SW19tE h&赭SXZjjuVà uUWVSSljӉMЙ1Ʌxtؙ)ѸFE)عy11X[^_]UEuhR%h&j;hR%> Ptt D /1UEuhR%h&jQhR%> Ptt D /1UUuhR%h&j}hR%<> Jttt8jD /1)z 1zuz uzu 1zUEuhR%h&hhR%= Pttt-C / xjh&P 1UUuhR%h&hhR%g= B<t<tt>C /1z'1zuz uzu 1z1U幀U E]UWVSu] }uh֟%hx&h{uhR%hx&h|hR%< Fu#<u;FuFPhF$WS$ @u612WSPFDPhÃVWSPFPZ Ã؍e[^_]UWVS}] uhR%hp&huhR%hp&hhR%< GS8t)R78s<t<t1&vvRS Q* e[^_]UWVS(uuhR%h&h$FE<t<FVU1TF1 G!)JO9tkA B@t8t}19sF8}Єɹy$At}!u}@]9s 8t1s@ /^1ۀ=84uV}ع1E׈E84S}W=WV&thR%h&h'hR%X: 84؍e[^_]UVS]C<t<tp@ /g S؉U Y=84t1584S6Z;E thS%h&hnhR%9 84Ǎe[^]UEU uhR%hd&huh%hd&hhR%v9 fPUWVEu uhR%hX&huh%hX&hhR%-9 fe^_]US&tPh+S%t" XZ]UWVSD1}]S 9Z@j0S:1uuuu}WSO:1;5@&s/D&H>v >  DF1;58&s/<&H>v >  DFWS9u> 1҉u uSjE0EPyƃ S8YEt B> 0e[^_]UVSuEPu V蔈 uVj2 ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWh3S%Vu 1Íe[^_]UWVSU} u19s$@u9s8uh9S%h<&hC؀xth|S%h<&hhMS%7 u1X9s%UjKQP t؋UGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`PXZ- `S/ X4%@t _t^Fhv#TYuS%PhS%S @o PhS%S @uWhS%S @dlhhS%W. YZu@htDžphxDjVYZuGDžphS%W- YZW+ Z|6hS%W- ZYuDžph:%Wk- ZYh+#WV- ZYh~:%WA- ZYh;%W,- ZYhr"W- ZYhW=%W- ZYuh:%W, ZYpDžp Džp_t@F PhS%SY @pL&tPhS%S2 @84t pNdX؍#tT%RhS%S @VL%t n$Ju"<%Ph T%S @ZvHhT%S @BFPPh$T%Sq @(v$h2T%SY @VʨPh=T%S=@~Pt?vtFQPhhtR@ttRhFT%S @~xu=4%@J1h(&tPtXY#FxPhPT%S @uRz u RuARToX,QXtPZYX9Tth[T%S- ZY@jjtPDƒ ttqXjjP% X9u-BTX PhUW$S @XjR뛉Xh|(%hUW$S @Xu^jPSj @Dh:%W) ZYu-dXT%؍#hS%W) ZYh:%Wy) ZYh+#Wd) ZYhr"WO) ZYh~:%W:) ZYth;%W)) Y_twpulelxOpu VZ;puh/hxDpjVpY_؍#T%؍#PhlT%S9 @WhuT%S# @V2uZ%u6u_%u*PhT%S @ut:u%uȞ@t>(WtY%uPhT%S @ubhT%S_Z@Npubll@lq PVh)%ST@d)%h@pt!pNVh^%S 1huvh@Lt㋍hqPPVh)%SN"@urpt)ptptVS,ZYpujlt l@u1d lqPVh^%SS@d^%QNppuA 8tV _yhpHpDVh^%S\!@WpCPhUW$S @tXd 0uSS S_Y^u h0&蜛Z#_tFP`P u,h0&lX_Džp؍e[^_]UVSË2;tPSd e[^]UWVSQ} utu=GL~:%t +#Htr"}tE1@ۅt"a1ۃuZ xut@xt:HHu 1HH}tE-@uCt WhZt!CE}tS%EE@t]jW[^t WYuu"Ep}tS%Eƃuًt 8u1W Zt^}t8EgÃuˉ؍e[^_]UVS]u tPހ~t9x1 :jhT%S" uS6 Si! \ZY9rh- X1e[^]UWVSEE} u |Uƃuh&Y[jhT%W1" uu Ee[^_]E1҉UWPE PhT%EPFƃuuh&ho"a jEPV%; @u 80 8th&hH#&1ɉM^_Euƒut%hiD%hU%WV `PPShd>%hiD%hU%WV u.P9r)ǍGPCP$ZYtۍP9r:)e[^_]UWVS EP EE[tF  >SPn ZY} -];уM I+ѻ}hf3#EP" ZY;tjhMH%S) ujhIH%S uu1;}1u1;} uJul) [EPjjjjjjSV }tG,9uSv ] ZYEPjjjjjjSV }u9G,nFul( d!ukX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9!1E؉EErE,@x ' VuQ9uu' "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms T' 7뎉ߋM_.MIE)M܋E9,}v' M}}9]ttC }Ut;]tC } t}E[^_]UWVS u }EEE]1EE9EEEPs2&&Csy7Ku-y)‹ P-DAt/rumr^s ‹ P-DA@t% t\tFx+B P-DAt/t U% Uu=k% t#w|% 7f\\Ev\0C0C0SEttNCEqt(tsExu EE [^_]UWVSÉ׉U.ƍPSvYZ@WhUW$SK @}uSj= _Z@u$p h"S @u@ s=Vu hV}^P~n sVu SA> _ s Vu SF=  u# V* t.Vu PhV@VhUW$S?sh#S,ZYsE1D0t<0u FuM )tSPB Y_@u|u } 9K;} u@tPh%Sj  ^Z@u3tPh#Su @G루tffPh%t&ffPh#S: @c t Ph%@tPh#S t%7 PhUW$S @sWj.VWj\9 tcVhUW$S @tQ?tGuUWVC*P U[҃VSYm_Zu VSm[^tRXZR YtPt~rVS荌_Zu VSZYtXQ /1 B ؍e[^_]UWVS(E̋A tӉ΀ytu  xVx}WY@$1FCt}ЉF tCUfCF t#UԀzu ztK|@FtC8F t CXUF0CxFftPEtZ_ZF tU tUԋECTt14~t " h~%EtņCTZYuՃe[^_]UWVS8t F1Dž@jB UPPzfDž ˉhPhiUpX UJ>r*hPhip ,؍e[^_]UVS1ƅ@ CtDžC8P^CPƋƒYu9)Zu)CT@fCXP5_u tt uC| t Cxt(1ɉ,uCT1fDž @fp׉މ;tHH tut󥃅 TupVXZtHHt'CstHHt󥃅  t'CXsXtHH)fSP @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP&X@OHuWiSY1CPWPXZ$jjVSjLPW@u  8 넋H؉@D@9DDx9@s DD9@r׉F u]dERuGu:Xu h'gwX?$RuSU ^_u1XZ]]V@UVSË%tJC><vBD&FTttT9t0t&NT9JTuu A 뻋@À{>v P ShW%>c e[^]UWVSÉ։h,j9ZYt:PǀcScufǀ,1e[^_]UWVS0ÉRi^@u PhX%XbY[.Gw*hH PhX%)b %th, Pj8XZt@dtVWv<u?(9x u1Wt cScuGhu @F @(GH>A<wO*󤋅% t&x utmtdf@ tStJSjjPSV9Ѻrf‹fP@TȋG,CD7LJcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$tQ~DcScuHu ~<u|t2<t&)ڃ*f@6Vt4L7Pu"uJƃv9C,m@1;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃f9 ffC tHGY u<)9dCM A 󤋵 \ tC)9C= A󤋵 \tIt @W uD@Wt"@W uv tD)9UC< A 󤋽 \ttRC4%u+@t@Zu)؃fPhPƃ tt)߅tPjVPYY9qQS  C{fCWVY^g0Q COt/t+VW Z@)9 CKt tRG%t4@^u()؃ftC uO t>P)9rNC A 󤋵 \C))=+w/D@ PhRX%EXE3 e[^_]UVS~\jhxPF\ uF 8u!5l-hkX%WY[ Sh'ho"W 1Sh jpK@uh'h:%sWXZ1e[^]UWVSE}uhxX%h'hhX% Ӊ΋S IuN EEE싐%tZt Cts mjSu@ u3@C CXJP S@p@P& Z J(H J>r*󤋅uK%t9 t/hQQ@PPPB PhX%8B>u1DhQPB*PP RhX%Rh '.SXe[^_]UWVS$Ɖ1iu1hX%RfN-Xfth$SPKà 1GiPV RhX%ARh$SP6Ãu 8t8iW Vho"uR!w h' Vh Y%hR 1`64%@u"j5S,Y^@uƅS$Zu h'QX뢍lj󤋅e[^_]UWVSS]Sj8^_t]u1ƀ8tCP<$Ztlje[^_]UWVS$ϋEE Eh"Y%Rj ZYu}]ƅPA $#Xۋuh4'PYuQVhRSV+<@t-P艌P5r XZuE4'e[^_]P1j6j4a@uƅw x, "j@,Ph@hW9u轋WPh "見WPh "SVh7Y%N$v "t$u)RPWVhJY%`N()PWSVh'Y%6N ]e[^_]F*UWVS] 'tPh0#7 XZE1E;s31;Et k, 9t@v 6hWY% PV脹G,1;uts 3hWY% PS^F,܍e[^_]UWVSEvpE E] P1}tEu+SPhQ%u @tBE^PPh_%u @t E9sT;] us< v! Juj  ZY@u؍CT9Ub "uj ZY@te[^_]UWVS]u }~EHt t4PWhV)@uxVhUW$S Ut"9 QSj M ZY@tǃ7PhUW$S @tE)uSj [^@u 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hpuԋ@E܋E E@_tE@o^'EPjyMԋU܋E 5^XtE5!#,EPhMԋU܋E Y[E_Y%EU1҉Uw|MUu fX1E}UċM1uGEEPSsEPCPfEPC8PYSu谖 tEE99w< v YЍBEȉD9EM "1E )уȉEU@t~TCtE@Tt 1ɉMEPj!MԋU܋E XZt؋Euэ<1E9ECEtu !Xu EEU9t M;At;A u1EEIʸy,%=tс1utȉE@uFtEPVԡEPFPǡEPF8P躡Vu ]E@PEPjMԋU܋E Y^u1҉UU9u XEEPW-EPGP EPG8PWuj ]뤋E؋E%u3E @hu$uЋE PhcY%PHE؁ Ee[^_]UWVS(}ƅj4uM{Y[@uƅEXuX uExlSPu hY%u@ujuMH^Z@t'a1Pu hY%u訡@u-S1P蝃Pu hY%u}@ujuMZY@t,E#pVXPu hY%u8@@ ؉P&Pu hY%u@ut Ex,u@GhElPhhS>Su hY%u贠$@ut 1;j@E,Ph@hSSu hY%ud$@up;s VeC,X鋇@1ۋ;Ds Vu,Vdt%F$;BuFhuP)|uPSh[%?v$|uPSh[%?E苀4E%t*FHS%hS%WЦjE8~HuJFt.Fhu(VJ9Hu~<t>t FHza%FH4[%>u FH;[%FHB[%~0uF8F4bWhv4jE77Whyv8jE7(Whv0jE7v8v4ShH[%>$E䋀~@uH%u>ViRUShv[%>vvhUR7 @Uu Rh[%>Y[^hE䋀t=W[2Zu[E苀8E%t]h;%F>jE,7 >vHW<7juWt(tFdFhӉe[^_]g_e[^_]g_UWVSPuE EtuVjj 6(tl%ub  CiP61V}@ t;{t5{<t/s$lyPF Ph[%C=1ɺVjj51s p1C Cs`CCCC 1CCECHt V0Y1ɉKdChuṾXZs1CC C$Zue[^_]^e[^_]W|$wUWVStEUM]EEu\PK?_EPT%[%u'Ht :tRQE Ph[%;1ۉ]EPLt @v@}GLihR Eu>ZYEE1}m5%EPT%[%u'Ht :tSS$RQE Ph[%;MUEE@iEEE@ht 1ɉMExdtj$PuP% t؋E@$EtˋE@ fCC@EffC1ɺZfuE Ph\%9_XfC uShEp\SFupE Ph5\%c9\ [^41~J7tEE4%uh%uZYujjE=1u'*uX}tuuujE0e[^_]g_U幸E]UWVS]Sjj0Fhu,$t#tShPj0s tsPVhB\%7 %mo%t[%RVhn\%7 ]e[^_]UVSuF Ph\%7s 1C CCL ue[^]UE]UVS]tVwLShj/v$0sPC Ph\%6 1FL]e[^]낍e[^]UcE]QUWVS]{ Wh\%6F0+F8PWh\%m6Shj.1FEPWS u{4%t Sh9]%5[^jWS t jP&ZYF MmFuWS uh`]%h\'h hX%  FdH PF )Ft'N V$vX]e[^_]e[^_]ËJh1ɺBUWVSËN t9At E9F$E;2UpPC Phk]%4FiP3EUu~@u kUjRS EtjPn%XZESjjv,E%tBFH:%h:%S48%Y^ u-j,XZShjj+Ee[^_]UWVS(Ë4%Sjj+V BuB EjEPS u2N }vuu܍EPEPWS%BPt3t P)#unP Sh]%2SAXe[^_]UVSËu<wPh*PBP9 uhx  X\`\u TT1ҋTX#DT9 tj`9r7fPh Ph_% \X`#D`9  `T9`rj5dohYZ@u ƅo4\`%th Phr^%)XZn o`< uBHvWdVh^%WdVh^%`  uWdVh^%uWdVh^%1CLDžXXX\Dpt;jXdhZYtWdVh^%.XXuDžX`m\@6@t:j6dth-ZY@uWdVh^%WdVh"Y%!dhƃ tPh Ph_%e(V; h4%u$h_%hCiPh0謢hhsPjhCPu CP+WdVh_%;C@FC$CD1C<wPC*PEP. u%C PF PhB`%euMU[뚍e[^_]UWVS8EE] }uPYt99s&}E EE P'Ee`%e[^_]|)WPS[ nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉgfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMк EUfҋEftuYPE Ph`%#(fEfu)T3EPE Xe[^_]UWVS$}E ^\ftPh'h9% cCubh$RS u#>t=G Ph'ho"_WsPRWt^\ue[^_]UWVSE 0xjPuq* uE$'e[^_]ËOwvXPw Sh`%<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhh'h9% t @`jVP u hh'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuVXt,swsos g \SVtttt:uj@苃t$P臽ǃ tPiǃY1Ze[^]W|$wUWVS tu}P.YUK>vuu{(Ofu  tu%ue[^_]g_h ƉE1Em5%RR$C Ph`%She VjN(e[^_]g_UVS]She jVt~ht j3gXZe[^]UWVS E} wLBuB9{d4G PuF Ph`%yVR1Cdh:%V|V GunC t{@;GusPATPF Ph a%%t VXE@hu5jZt9^duFh1Fd뮉e[^_]UVPuu,jy^uEhP' YE1҉@uUWVS]} SE^uh@' %t Et09Pt jPoXZjWSk ƅu&j4Xt^FFF`EF EFE0pE7HN }WPhQ%jQM† E0H #C$Mt1"PWQ Sh b%@ Vj豕@u,虤 8th@'h?b% Y[FtVZ1Ft1E@F0Epe[^_]UWVSQ]tdue%u=t-htGdt jPXZj3ZY^wHSr j3vZXZ1GdEw$jVS t'W(9P uW,9Pu PC PhQb%! 5w8w0G,PG(PVSu g 8t둋AhAdjVSh ƅu Shrb%K ]}tEW$9Pt jP(YXwdGhj3YXZ?uwHSq3 e[^_]UEt tH]UWVS]E EEU}uM MM$MM(Mutu~ |RP*EZYhPaXuM KUjWuR Ã}Ut} tuMUj4XۋUuE0'e[^_] ECCC 1ɉK BCZ;C t/C 67EVPhQ%jC Pt }t EC1CECcHwnEE] Ee[^_]CtNt;C uCECKtHJSHwuSjà ]e[^_]e[^_]UWVSut=t7;Ct+* PjCPC PSF PtjR$ōe[^_]USEt6t,ttHJHPX]]y]UWU@Euuv. Y_}UWVSQƉ uXӸH'ljU@'9r 9EsҸX'ljUP'~9M9 uZ[^_]UWVShPLufJ}xv聟 #htAEH@‹EEhЍHdfhdZhb%hPh藁Ëh  8th'hb%XZh?w8j@Zh_uh'^Lhǀ@hC @uhShSi =wPƄ ƄPPhhb%hT@u$h'hb%h1҉Y[hCjydwZXETE`\fu `\\@)ЉDa 7RP*RuM UuU]UWSU v/ 11}}u1'M[_]UWVSUt΀yv ҙ u1y tËAdr@t$tt @$u@hb%uX؋U-ÅtF PSYFP}WWCPYFd@t KthX( u} WC8P}Y_XC9@VCXPhYZY؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PV"LXZ?1e[^_]UWVSQEp1҃t<t 19sDB]۹yAt}u1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}EEEHfw EHfv Ef9EEEM) u k@w ¸ w w w ?w xK9~%_ "}u1EEf}tdf}@~9f}? t1҉EUE) t1$t@E) t1u}11ErEUEa ׋UM U MEREC1[^_]UWVS}E uuGd((*1ۃ t%jPG@P{ ut #wdۉ؍e[^_]UWVSu }WVuw)WVu(pttSHIH9JHs؍e[^_]UVS]CtP_V SjjV]e[^]UWVSuFhPF Phc%,Vj@u3Y 81t)O 8tE 8t; 8t h'.XF@t>jVC@P< ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjSu'ƒ ujjS0n ]UWVS} uEtMtGu{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVSu 1ۉ]]]EdߋGdEuu;tGu}묋WtSWuJMQ1ɉ uHJt6GuCu;W_IuWYUOuUJOUjW@R06 t)G9Au!%uFEPQXZ8MWG E1҉UE܃YtMuW Xe[^_]UWVS} Et0t[uvtCPEP_ZY@t/C@3#Eu%CD3G#EuCH3G#EuCL3G #Eu붉e[^_]UVSEt0t.ttju CPP^ t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j|Zuh'YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZfECCdUSǃt_{ u Pu uƍS@ C t@sdKQPuR@u{ s{ u @t{ u j.EPC G{@u RURY^@s@t~{ 1UĊ  L @uj.EPC@Pj tJSRPhQ%j.ChPl jC@Pu t @`C`KdK`C`uKd h'SXZ1ۉ؍e[^_]UWVS EEE EEU}uM M܋M$MM(M؅uE苀t2RP EY[EujZEԋEt?jWC@PS u(EC`}}StP뽃}}WSjVWueP|@u 1C$C {4s(EC`1E@CEX}CPt Nju h(CdEt CdtS` ttSX{@t4E胠4uSuu!uSuu}uLSYMCAe[^_]UUjPR 1t!hRu hc%uItUE1҅t%tHd((uH`ۉ]UVS]u!uu1҃jPS, t8Hu@`tFP^jRPStk1ɉJHB1Hd@ @$ǀR:jPj3w=uhS%SUXZЍe[^]UWVS]C$t1jjSP u苃%uuS^u묉%u^f{(uGC>Pu<{*Vh('WE tVh 'W2 u  VEuU1Ejj@VSHƃ@$@ 1ɉMH P@%t<u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLV̄ V8FHtV貄 FHE88V蒄 1ZMjG@PRU U܋Mt?uRG`t%tEGhPG Phd%VC sj.FhPRj^ 1E@F0EpjV@e[^_]UWVS]} FtHtJN HPZڅt0jjjVtEE Ee[^_]9jjjVVd1SjjX$e[^_]US]-XE]UWVSQEv E 81ۅEjG@PE@P tGd(1E@`G`}u!GdtGhPuG Ph&d%IG` ttGd uCtWZOd }u/GdOdt OtHU JOWX}3u1ۉ؍e[^_]UWVSQu E@EhE@PE Pu[ǀfV@4uUr4{(s41ҋECEH$Q+B9sȉC$}O : v: K vu9F s. SEZ11BCZ؍e[^_]UVSÉփhPC PhDd%zVSt VPZY h'Xe[^]US ]Sj*ڋEXZ]UWVS Et_uVj\*XZ؅tt8;Cdt, PjCPPCP@SF PtjR $če[^_]UWVSEttBu[0tFd%=u1҉vt Pu 0Y_6ϋEu@EtE #1B*Et E @ tt^tTCƅtDGPEPh9WRV =EPFP_t @ FUMvj±ZYUt0Mt&@}wFH r*NjM;jC 1CUe[^_]W|$wUWVS %ue[^_]g_h輹 ƉE1Em5%RR$C Phe%ShbVj(e[^_]g_UU t,t9PuƀRh[ijjUUу1t3wt-tRh'he% UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`PEF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS<1ۉ]]]E1u1EEE9CEׄCdKTMЅtYURQP藘 t t0u5CPE Phf%1ɉKd EEt9sEsxF URV4RP% t tlVdtRNh$S%t$QPF Phf%aVja@ubo 81tXo 8t h'KZ1F$F fdEt9sE6NEtXMPF$Pvu t t1F0PC Ph.f% NtHVujuPECPEЋCL }ffMM9Msun KMɉMM̃щu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u%}uƃEă}v1ɺ1]/tuheWjEH}t?E PhCf%HEESjE0#hS%u<e[^_]UUt&t9PutƀU]\]UWVS}u1-0t9~t6^xtuu S0 u؍e[^_]UVSEu1(0t^xtuu S u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EEP 1ZYtU9pu 1ɺPGEttu4@t$Plvǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`u @tײy1҉[]UWVS@EPjsE _X1EE 9CEuhnf%j uVL CPVhtf%u+ @ursXsTVhf%u+@tuuVhf%u+@tCtPVhf%u+@tC`PC`^E'+"uE5!#fC"t 5!#Au6$" u5!#a#@u5!#5!#y,]#uRWVQuVhf%u+ @&sdVhf%u+@ C1C;s WJF,Z拀H1C;Ls WJF,XCPECLE}EfE9Esh SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQh [PB PEPu2XG UU)U-sx1t8Fd%u'~ t!GFhPWEPhf%u)@6ċ<e[^_]UVSu Ft%tF9CuuVCxPusݍe[^]UVS]Sjjf1҅t#09XuƀلtKj3%Y^u=t hS%S5XZe[^]UWVS] 31<t0h/h%xNj 󥊅zp 0h]i%%11Ҁ+u8B,CdtG{$tA1ɉڋ8u.ڋ8ChP0hi%Z1s$ )t1ɉEP8Q )xdu+81҉EP8V2H4818EP8V2p*v>xdu"t0hi%ֿ *?)t49$8xdt⋅4t4^u0hi%eY[+(뗋4t=4O8xPc4j40 8Y4jj48jj4 Z8@`y *t[j@t/*tJj4>^_@u80hi%耾Y[$*0hj%XZ4e[^_]UWVSp]U Dž 11DžDžDž0ftRh`'h9%趽 jWV^ u h`'|YWSXZe[^_]US]jjS u"C PhKj%μShcS]É]]xUWVSPu} UUjWC P Utۀ8j%u%UPCPC Phj%OCjV UuDt&9tH9Kut倸u܃xdtCEe[^_]e[^_]US]Shcj7Shbj" Sh`j ]ú@ 'Jt f9tUWVSEU MftEv0f9sS 1&f9u}tMf9)WS [^_]UWVSEu} tRU w $S 'fɋ] ] +39sR "1?fҋu1҉]19tu692uA,t[^_]UWVS8EċEȸɂuѸURj uQЉƃuEfǀ<bR GfEfwEă Phj%WY[f>ff}fuEfǀ<R 1҉1ЉЃEu.Ef}w 'Phj%j ]S3 1:BUP_XۋUuhd'賹XߋMDڸuf}f9<t >Mčq RVhj%PeS联Ef]f<KQ 18f}uVhj%Ƹ}ȃlh(Y[Eċ4%tj貱XZE΍e[^_]UWVSSƋ1;,k(f{u{u4{u.{ t&{u&{ u {u{ue{u{tYCUhPCPVUt1ǀާ Kf1ɉHGEe[^_]UWVShEwP EdEEEE@|tXdÀuXdBEAE1ɉMM}qEf9UrZ9]s#O E Phj%職XZ0u<}])Ӎ{}ff}ftftfu f9s#O E Ph k%_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSP UtGF΅uE4%@u+j EPjEPCtPE Ph$k%f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPsuSVPE PhEk%(g1ủuEEPM1ҋEJE[tE2Eƀ>#f}uEȅWeEEEPjuWƃUЍ M))Ufw#sM E Phik%tZYEܹEȉEUʉU9s'0M uuE Phk%qEX|ۍEjPSs uCduCdcd{4u EC$U9S tKdS C E}}uuE Phk%g f}t2}O`MQ9rG`E̅tMqduV9rAdE}E؉E};aV}9GhUGhMjhPu~ǀާEfEĉ{(u 1ECEEe[^_]UWVSljUMu w@ Phk%QK 1҉u1ɋUYt,K E1ɉKhKdK`ǃu uVjXZƃ>VuMUZYuC;u}tG Phk%[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[]bJ 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύK G=DQwWF(1RPQhl%蕱~(WQh,l% EPjSuuAtBf}u;8σ G=DQwWF,1RPShFl%;~,WSh`l%諱 e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@zl%}tQuЋE؃ Phl%u18ujjE؋ EPj$'8u ǃ8l%EPj s@s<Qtf}uʁXsXS`1CdChǃJ8u ǃ8l%8u ǃ8l%8u ǃ8l%8u ǃ8l%{`tts|C`t}t8sLCDCLCHCPCFd rFV t#tFhPF Phi%般 1F$upFhPF Phm%葬 Vd s"1F$F VjjF٤-NtHN rVXV蓮YHE؍p C`;u PVh/m%MuVhIm%,KdSh tRQPVham%u/)uVhm%u RVh\%ujE0XZ}uA}t;WVhv[%hsHsDhWE0& @u Wh[%诫_XE؋_|tACdƒ t ujC@Ps? tKd Cd uVhm%h8u E0 E؋4u$}؋t%uj謣Y[XZ믍e[^_]g_W|$wUWVS,(h1Džh#fDžBDž<"#K8Qff@98tB9rIpr@uHtHu f$8,nt104tj g0\ZYHu" t\10fDž$H8% t#j@wP?(| @p|1(Hx@1NjDC buy(u4tƅ,18$|Dp<@D&v P PhW% DP4BnFDFLVHVP1ɉNDNHt h:%SXZP3c SjjMw0%t11҉SY2~Dt hzl%SPXZu ShHo%M1ZYe[^]US]?S Rhro%P* ؋]US]C Pho%XZ؋]US]?S Rho%PŐ ؋][US]Sh8jƉC Pho%蟑؋]US]?S Rh p%PJShje1҉؋]UWVSƋu5hX%苐fN-XfthWPV2 8PV RhX%EhWP6 Z4%@"PPR @ {TWjj u +)CTSXWjKZY@KhtD1+9}F Ph]%Y_DsDjbCD_Zu h'UY#Nj󤋅CH_1҉tjhj|P蠗P6~ sDj1CDCH e[^_]UWVS] E1E;s31;Et k,9 t@v 6h6p% PVFG,1;uts 3h6p% PS F,܍e[^_]UE@|tPd(t1]USEu1X|tuu Sp u؋]UVSEt0t-uvX|tuu S( u1ۉ؍e[^]1UWVS} 7G@4j.DSFPj< 4wSh>p%`)}tE@<"jWu胚< u h'iG8@Pj48PNj<% tj<01ɉ,0,;(⋍(tx}HlaDP< Phq%<;8BPj48ƅ0tfBu0S@tWC<8uOBQjRPDt8fBu.08r$PDP< Phq%648sunu StHuZ%uGjSƬY^u9ϋt# w~tn0ueeu1t1%thDjVYZ@(@,1҉P|P|10fǀ<fǀ?SjhPsjjS襂u"C Phs%]~Sh[S詉FSX:Ѝe[^]UEtQw]UM E]UWVS É։M苐t 48UMtSjjPMv u EU S蛀Zt~8 1pp@1x xx$3@u Sh'ho"h}:SY(h*s%SXZP3YXt jjV|P蛅t j3XZwLXGDGLWHWP1҉WDWHYt=t8E%Uu=t}uE$s%uSrZYwLWw4WwPhs% YX؃t w t u F17tA9MuuUM7Ph% XZUM΃`Ѝe[^_]Uh-hs%[j 44t9W|$wUWVS41B41x-% @6f@6 s f4.s f4P s1f4f p4f 446 1s44 ut/44 44 4f41=-Of44ff4f4=4tjV諃 Eȣ4Eȣ4ZY-XT4 6X4U1E4]5\4`4jhT456_ƃ x9u h/n%*k XVS54ht% @6Hujh-jw 44󥸤44 4u4󥺼445|-=-u؉}mrq-E؉ 44 44E44=ɚ;~ 44-ʚ;444 %we[^_]g_UWVS4ƉU)'ht%l Y>^ ht%NFfVRVRPWSPht% j.]SFPj/# uj.h"S+p Shu% j.SFPj" uj.h"So SF^(ZU)ڃ<,wJ<w1tR<CSPSPh]u%<+h5u%"<:tI<<tG<T@8Phy%P $ '<uT@<w*$ 'h*y%BhBy%;hky%4h9$-h9$&Phy%,T@t <uhW<$hy%^ Phy% Y[THLhz% T@Z<t%w uhz%<uhRz%h)z% _h=z%Phwz% [^T@8Phz%f THmhz%hz%hz%hz%hz%hce%hz%hz%vh{%lh{%j.STPj uj.h"SX Sh'{% j.STPj uj.h"SX Sh7{%hG{%m hf3#c T@f8fZYfw2$ 'h^{%ho{%h}{%hx{%hx%h{%}9Huh{%nh{%h{% S1ɋHU t Sh1$h{%&uj.VSj h{% [h{%r hf3#h T@fHfZYfw-$ 'hix%!h^{%ho{%h}{% hx{%hx% XA6t-T@<m4 'h"Ph =$ ^_@6 A6uh-! [g v狝t݃{)!C2t!#t1 h{%3th|%^ C Yh|%F C HC SRRPC Ph|% HbPǃxPhA|% XZ hO|% XCPhb|% Y^19~gVHPYZuVhk|% XZCj.RPj uj.h"RU PVhz|%v F땋L 9؋44t9~B6 4t494 =4Pk UWVS]u#p6tP3^1ۉp6t6S t6@$ +p6Yuc U1҉l65P-t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSUtWB<:u1<2E 028uFut<@t*}:u<:t"u}:t;EuݍG1ɀ@t1ɉ[^_]UE-]USE] u:À|u%u@C8t9EsHt:t @|u1[]UWVS4}!}u[=p6tQu Wn[^u<5t6Pi)YtHWP`D3XZh5)^1u?{ Dž)Etw}xjjju| !jh@PE xDž1ɉ1ދ9rqhQu6ƒ ?tu0Z} 0S0p 0HЀ u%V1It 1:u4:ut75Dž\t&Dž t t11҉V9r)ډ)ށVSj,ZYu"S/^u[Ɖ‰,1i<#au SZYNFS;/XDž-K1j=hδ%S Ɗt F:uFHX)ىMQRPu[Ë tK}t uXWt.^tCu F:^DžBDžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QWU*ZYu:W-Xt uXx-P _<ljljƉlj )PVQP SR= ,Ymt u8^)؍P9s&PS:)ZYuS,_ XË Dže[^_]UPjujM UEUh6tPq 1҉h6Y1`6l6d61UWVS1=`6uE `6=h6uYh$`60 h6^_u=`P5h6%Y[t?Duz1=d6p6t=l6ul6h6u@ @uP 1h6`6P`6@Zu 1Uh$PAڋ P-f\Yf:u#t =d6t|0\Ld6E|0\u d6N1ɍt:uf:Y\tAߍP5h6Y^u'h6tB @R 1h6ZD돁NJ|Äu :t@PFjWjM EÍ@ wCe[^_]UVS]u uu ][^]UWVSj=u uj Pjd ^Edu!9 l4uEdUz}<:<^uFC<:{Mu])CdPV%ZYuV([{<\ůCt}<:tyHЀw1GOD9t0v뛍{1e[^_]UPEPhh7h7uƒ1uEUWVS} uHu7uuW1ɋUà =7u u1Ɖ>1e[^_]UPEPhh7h7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ`&#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס7EС\7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSPU} u]RU $URj(W $WjV $Vj$S ZE] Ee[^_]UVS@ÉjjjQjRPN} tN9tLtHVPO ZY@u:^ j@]S0? h"Shہ%P-=7t被 1e[^]UWVSSÃ=D7tO1t l7<!j4ơl7!p7)Y9sRUD7Z9Uu)@uÅu,7!1ɉ1ƅtÉ5,7(71e[^_]USX?,79(7r,7É,7 4t1[]À=7UVSh5!#h5!#h5!#h%-h5!#h"hZm"h!%-- fC"=7t"%=7t%Z"=7tP"QRPh-%Ӌ5-s$=7t%#=7t%i"=7tXs"%=7t%SQRP֋-U㡠7h5!#h"PhF%Ӌ- Uh5!#h"PhM%Ӌ-Ux7ih5!#h"Ph\%Ӌ- U|7Ah5!#h"Phk%Ӌ-Up7h5!#h5!#Ph|%Ӌ- U㡨-h5!#hκ#Ph%h5!#h5!#h5!#h%- e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVSS777k(0hp '@PM1ۉ^,7~0XY1;7s6U1h` 'GPTMKGU C(XYk(|0779subC[^]á 7uÀ=7>UWVS 0DžDžDžjjPh7jSu@u 7Cp 7P71 @H7hSh҂% tƄ181ƅGh%AXt* uʊt͍B<9;$` '7R7F7:7.7"7-7B9H-@-77-H-7J9@--H-7J9~}@-u7l7c7Z7Q7H7?767-ƅS h"Rh%P-C7n3{ 0=7t h6m Y-9-}-=-‰|7 7 7s5777)I 7x7H t7tH 7 -p7Xl7 h7Ɖ5d75`7#7tA `75`7)\7=7t*1҉j Ph 5"q h 'hL7D=7tMjRP&6 M95`7sxu@)lj|| >;d7Fs"J| u| | DT>| T 9Ss$EExSWHED CSWF;sss{uISC PHXZ=7uE@,t p7EX,p7؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC 7‰ى[^_]UWVS¡l7!9t> 7)su܋tu 9t)D @!u܋D UEPhL7D@ZYe[^_]UWVSQӋl7!‹ 7)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS$E܋l7!9_C E؋ 7E)puЋ|7Uׅu9u)Ӌs V}t Z}܉E)+F$Iu*w  'w) 'wT '1;SsS |C@C;Fu ;u1ɉHt SFPUFXZN]H9t9sxt PFP/DY_SVDXZ{EЋT }t Z}܉ыU܋E؍e[^_](E܉EEPhL7BPhL7E=7t KZ{ SC $7$7e[^_]UWVS9p7tp79kjjh07Dǃ t؋_ jWh07DEWh070E$7=$7;H7r;@7rw1ɉ Åuj}먋 h71ÅuP=D7@u1j责Njl7!‰)[9tP蔣D7Y9uō3@7t]EPh07AXZt>G 9r7 39s0jWh07CEWh07SD$7=$7}뾉؍e[^_]UWVSÉU 7EC1t}9xts@Ƌuzơd7EF}}1U9s< u 1 Cse[^]øÃxu;UWVSÉ׉΋P9PsSCHK 4BRu[^_]US]E xtK1ɺ C H @([]US];Cs 8^u@1ɺlC H @$[]UWVSuxu^ËxFS<L$9rAL$LL9rALL@ u CP PD PT C< e[^_]UWVSÉ։M1E!ЈECE1EEt URS_XS9s\Ku{tt/t$H9rEPSS|EEр8\u!x|u+8|u$u9H9s9u@}9ut URSZY{ u"E9Cu{uC7C7{tK1Ҁ{ut'9s'x9s38\u.x|u(B8|u@B9rJu}u#Ju }t9r'm}u$Eܹ)KPxE܉EEXK+MHKAEU)щCE1ɺEY}~!UK)щK+Me[^_]UWVSË@E)щMt2֋Sʉzt SC} 4ECEZY[^_]UWVSÉ։M}K{}~2}u}D~7v}E}~}t}\$"'s`A)VxVu>K)K)21ɺCPY^y)VxK)]K)1ɺACPV*MKZ{uoEA)VHXK)P؍e[^_]}O}M&؍e[^_]5e[^_]UWVSSlj1=-H9s?MjB,@Pr(N6 Mu e[^_]C(S,z{,f P{<t[FL-01=-H9s H-29se[^_]UWVSfU0P9s'H9r f8f;}ux]u)E -HuVQMq t uMQ ZU9ufG}uf 1e[^_]UVSË@9r{uC7C7KP9s+9s'8[u"x.u. K9r !f3r9s:.u z]u{uC7C7[^]èu'B P-fAf'f` ЃðUS1u4@#' ZYuCC u1]UUE ft҉U<#']1]UWVS É1=-H9s33C8C,EL-EH-E1E9t*C(p{<t@}f;t5}f;t,Ff9{419ts04f;|f;V~ @1 1{8C pPWZYuF;s$rC8e[^_]UWVS Ë0F;CsGjhք%V u 1ɺjh݄%V u1ɺmS j@B@Pr 2 u ؍e[^_](K A QrqЉE1}C @t E@<S9s8^u @E@89]u @]-@-9H:9<]<-3KP-9)BC9S9{uC7C7S9]p9rD-tN[@3K9ȉu,M؋U먀=Vʀ-ux]Z {uC7C7{uC7C78Dz@U׉DRO^fE11=-H9}"uQMBZYMt UGjE@$E@PEp 20 u j}G W$JO$f4PY{uC7C7EH9G8:>x]49r{uC7C7<]t<-u{uC7C7=ȋUC9r{uC7C7S9sH9s8=ux]u {C~8-P9x]x-t  -f9=-f9~0{uC 7C7f9UG1=-H9|f9jE@4E@PEp0E. u MA0Q4f8fpBQ4EV~{uC 7C71E, U%Gu48-u@-U;Cr{uC P8]u 7C7{ Ex8tC @tEH-E11}tf~)f=t#M9tFfE@fNt/Ex,x4uzx$utx<un@(ffEf=t^U܉zC P U܋pEp(Ep0tEp i1}U܍D2 9Eu'C HC M+H 0؍e[^_]Fe[^_]UWVS$@ @tbF P-f tNt L- t< H-ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]UWVS]CE q39\t[p;sr{uC7C7Bׁ)>t~+90y<1ɺE {*.MC @+1ɺ(1ɺ4~t6BЉE8NdBM@a C @Dz({PUCxMu*@uC 7C7{ 7щ3S9ryn3S9Y>*ubF3CHE)PHAKE)PCHE)PXKE)``[^F9>\~{3ƋK9sI:,uDz;9s6JP-DJt%9~{uC 7C7PU:SY9s"H9s8\ux}uDH9r 9r 8\ux}u{uC 7C7 1($S B@pr@ wML(h/S9s#H9s 8\ux)t)\ wCDLpS9s(H9s!8\ux)up39Zx*{uC7C72SUEECE^ ]k3US9֋My*CU z5{NGe[^_]UWVS]x;s?SB< $#'^[m\p{|;{r{uC7C7S B@xz@ wt(hw;Cs8)t~)p wCDLp@;Cr{uC P8)u7C7 1E1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ]};US|1ɺ(N`g;{r{uC7C7Pu1ɺ1ɺ!Cxu{'{9Jր?u#@}{C {P9sx P-Dyu@<,t<{uC C77}{uC 7}~{u9C 0@}t{tE7C7+uN+ue7C7-7C7C 7C7+tv *t?{CH)VH$K)PrCH)VXK)`L_X5CH)VHK)P^CH)VxK)K)o1ɺCPO^MNj;SsE:,u@BJP-DJt%9~{uC 7C7PSY9s8}u @48}t#@9r{uC 7C7 {9s9r։v!?t{u#P9sPP-DPt o1e[^_]UWVS} U0E tEp9) W[ [jLYt3SUUw$@@EjP|1҉UYZuSX ]lp1tEEU1}Eu63&Džh&1:11h1xEEMU싅hE1C CE$C1C C$C(C,C01҉S4S8S qAG9r 9YP-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋP-DJ<_P-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,P-DJu _9wu G9w NDJ_9< u AЋ P-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h[%NC0Y(9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV uE @MC9uEƉ]]uuu uMrE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMQƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB ;E!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS4ljUMȋEEЊEЈE׋G(E؋G0EܸMjPh{PM UE}tEfEE9G t9GuGt E@fEM E1uE9GtfEE fE1ۉ]̋M9Mu }tEEf} u@uIf}t6f} up`@(E}Qf}tPP-1Gu@$E~1ɉM1f} u @uDf}t*f}tr1w@(E}{Gt f}tByf~u"| f}G1҉U}@(E1f}u1GuEf}t}u?f~gGuE1}uf~@}u f~u7tÉEVuuuM UEMuf~u;11ۡP-f}UfMQPf_tIf}tAf}uf})E@P-Buf}_uڻzf}P-EDBu#f}_uff}thf}u4fzXf}tLf}ufztBf}E@Buf}_ufztf}u;rfzu"yVuSuM UEf}tAf}tY P-E@Af}_ fE@Af}_ 8uY8EP-DBuf}_f}u7EP-DBu&f}_tVuhwuM UEUąUt }udU܋E9UtxM9MtpEU9UtNM9MtFЀ}tEVPEPuM UEuuEfEEGE@}t)EG1EEf} P-1Ee[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUEju uM‰9EtMIFEEjSVMU tUU9tESVMUjuVULEju uM‰59EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9YP-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋP-DJ<_P-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,P-DJu _9wu G9w NDJ_9< u AЋ P-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h[%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0He=XSw =H=PM=@=`=h=wF=w=xU=o==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEfflEffEff}yPTfEff<@-/f}$(f}UEMA k MM)ʍ M ыEEHM)ȉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tTP-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU^ tYU9UtQ}̋U֋M}HtuuuREPűM U‹}}f}}t4EC1E>t$E@Ef} P-fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUwEju uM‰`9EtMIFEEjSVMU: tUU9tESVMUjuVUEju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tTP-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U?‹uuf}}t4EC1E>t$E@Ef} P-fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVU|Eju uM‰e9EtMIFEEjSVMU? tUU9tESVMUjuVU Eju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9YP-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋP-DJ<_P-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,P-DJu _9wu G9w NDJ_9< u AЋ P-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h[%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=-lt1ۉ]tMEAEW?M YE}M9M) N,F4EF8EtwF6 Uu;EYt'BE.gD$$5 ME멍gD$$U5 U2D$$U5 Ut gD$$U5 ULM$t['PgD$$U<5 UD$$U5 Ut gD$$U5 UEt't&t&t&tr&j1[^_]ÅtQ&It7&,gD$$4 ygD$$3 ZfffffffUWVS . #}UE DExw@<zA /19ĸ [^_]ÉUD$ED$$蓥EDžDžDžDžjDžUDžDžDž >}׉ƍWOt%%"F9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$!U6DžDžDžDžDžUE@fE@fMIL$D$ ֞D$D$$ t$ D$D$ 4$ EDžDžDžUE@MIMI Ɖ ȉ } Dž UE$HD$D$Ɖ$蜢D$:4$ Ut p9EDžDžDžDžZ DžE@fEEDžDžkzR%KwҋD=V9s%u9sF?V?4 r9i_oJgNN9sVu鋽D$ S~D$D$$d V9sNu鋽E@D$ D$D$$ ^V9sNu鋽*N9sVu鋽gNN9sVugNN9sVu=Exi @t>ዕt9gNN9sVugNN9sVu ygNV9sFu鋽Dž6pSgNV9sFu1fTA D$(A D$$AD$ AD$AD$AD$AD$D$ D$D$ $ ȄLN9sVu鋽AD$AD$AD$D$ D$D$ $W lBD$D$hBD$D$ 멋AD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ $D$D$ $O dAD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ D$D$ $ N9sVu鋽N9sVu鋽}nȉN9sVu(@D$ D$D$ $ N9sVuA D$A D$AD$ gD$D$$ {V9sNu7@D$ D$D$ $ N9sVuD$ D$D$ $6 N9sVuZD$D$D$D$ D$T$U$;"N9sVuEDžDžDžD$D$ D$D$ D$L$U$tN9sVu*})mUE@D$ gD$D$$ EDžDžDžDž DžUyzUWVStt ó{U11 rEEEEEEEEEH>U DEED$ED$$P:U}ĉ|$T$E$0 ƃtdE$/ ƃt'D$ED$$91҃ډJ1 MD$|$E$-0 )1 M1 8D$ED$$90 8t[^_]0 UWVSP Ls AzDž/devDž/XtyDžyXXD$g$S:t-ƍD$D$FtH4$ 4$;D$D$ D$D$y$N@Džgpt0ƅpD$D$<$s9ƅtȖL$D$<$=uD$<$=tg$9nC./ P [^_]/ 8u)΃wΉ<$:uD$D$<$8`S9EE ut|$E$ Ut#ED$D$ $葳EtED$D$gt $m 1P [^_][DžUVSxp mwED$ED$ E D$ED$E$tK ƃt?uE$L8E$c8[^]ËEUE$%8[^]þ[^]UVS o vLy ;l D$D$L$8 t@l $,^ ǃl L$7ǃLƃl 1 [^], 0ǃl L$[7ǃLƃl t, 0ǃl L$ 7ǃLƃl d, UWVS<n ùuuD$/4$ D$@4$5ƃ%D$T$$a5+ 4$j6Ƅ=D$D$D$D$ D$D$ D$$ tVuw: ul<[^_]Àl uM) Ɖt$ XD$ gD$D$4$ =* ?l * UVSDm 9tuL 3D$/4$ "Lt$l $ 蓴 l D$D$L$X BD$ D$D$L$p !Ѓl D$D$L$}1[^]YLRD$D$%@4$b3LD$t$l $ ( Ɖt$ XD$ gD$D$4$% =0) ?)1$! tƃL Y) 8#t( 0z( 04$ƃt( UE$]fffUWVS k rE@ E։υEE y ]]U ] }ED$D$ $D$s&ЉM;MM }$UM T$L$ U$D$=&ЉM9ureMϋE eƉϋ]ڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEE9EE }E2MϋE evUWVSPi ÉpD$T$|$$|$D$$D$,H*)R)L$L$|$}<$teEU +D$T$D$T$ \$,K)v)D$T$)iD$T$ e[^_]øUWVS8h Ǡo}܉E؉UȋP-8}tGC@%-Z+]E[t_E@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }KtO0)Ӊʸ9иbv-t9+E]܃}thEȉE̅um 8[^_]E@ta(uk1f)uAÃPt((uރEPXEȉ 8[^_]18[^_]Éc}ȉk}ȉ^}}Љ}9s]tSÃPuހ.tEȉEt,}L-UЋuԍLDFt uf}am}a.m.f}pmR}p.m.1EЉ$]\ 1E܍ h'D$D$EЉ$]] t#tWuՉD$EЉ$] u݋FV }؉WF2}S1}؉}+E܍,}̉hD$EЉ$] tu}܍0#D$EЉ$l K,hD$EЉ$]F Hu݋E܍L}ȉhD$EЉ$] u݋}Љ<$] |?sE܍LD$EЉ$] uE}u8}DGt.E܍D$EЉ$] u1ۋEЉ t.u}.E}Q} auD$EЉ$] usu̅u#D$EЉ$] uݸUWVSb iƋ'<'wwEVN)щȉMEED$$_t_FMȉFD$F$_t:F]؉F>FDF 1[^_]ÿ'E {UWVS)b iD$\D$`D$dD$hL$tL$D11rD$DD$xD$|$$1D$TD$PKD$LD$T>,M\$XD$Xtt$T=qw 9?D$Lt$Xtt$T=qw 9?tD|$P\$XL$HD$TD$dU ID$Tb\$XL$HrEOT$X)Ћ$‹RD$\T$`F3W>D$|t$xt$X$1?\$H\$PD$Ptqwt$H<g9D$XrD$TD$X$`$$`D$Te[^_]D$\D$`CE@$@@(L$XD$|)ЉD$|$)щ$P0lPT$|@A$D$\T$`AQ T$TeD$T!,M\$XL$XD$|)ЉD$|$)ى$PiKtсqw 9?lN;$rD$DD$|PT$|X$A$D$\T$`AQ ND$T\$XL$HƉL$HD$|;$rD$DaD$|EPT$|X$P$T$dL$hPH ND$PtD$PD$T$L$HYЋAԉD$81\$(9ډËT$8QˋIL$0;T$@9щ‹L$0ً[I<9qUD$(B$L$HAQD$ D$<Y $\$щ‹EL$XD$|)ЉD$|L$H)ى$PE@ $T$HJZ@U@pHhXl둋$L$HAQD$ D$KE^D$xD$XD$T݉D$xD$XD$TD$dU DD$TD$xD$XD$Tt$P\$Xt $D$|;$rL$PD$DL$PYD$XED$|PT$|t$Xp$B$\$dt$hZr D$XND$Pa,MD$H&E@ $D$H$D$HD$\ E@$D$HE@$D$HvE@($D$H_E@$@($D$HDE@$$D$H-E@ D$8_$D$HX4""""9ȸ"""3ȉ)L$8 I] ApAhQl5$D$H@MQ m$($,$u@yރ1D9$($,DŽ$\$P $D$$0$$L$$\$($ \$$D$,$$L$D$DŽ$DŽ$DŽ$DŽ$DŽ$$\$,$à $  .D$ t$$|$(5 D$ t DŽ$L$$$$\$PD$TT$XL$$D$L;$o ;$b D$D;$Q D$<9$@ D$,;$/ D$;$ t$T|$X! $D$DD$D a$4D$P?D$L%w\$Tt$XD$\D$\ t$D9%Gtԋt$PV WL$T\$XL$l\$pӉD$DŽ$DŽ$DŽ$D$T@D$<uS]D$D$at 4$K t7D$4$f`D$4$V`D$4$F`w 1 [^]É4$`fffffffUS&7 >бt$M̱ Pt 9u[]Íi[]UWVS6 =Ept`E%} tcEl%u1Ɓu u%9tJtÁuσ9uȃ[^_]ËE jȃ[^_]ÁUVS>6 7=ut+ 1tut Xuۉ[^]UWVS5 <] pt+lt 1ρu %uVuہ1҉ [^_]! [^_]UWVS 5 ~<EuFt7>t ] 1uUT$$]=:tFuɿ [^_]UWVS#5 <t: >t M1uU T$$9tFu̿[^_]UWVS4 ñ;pt:l>t M1uU T$$o9tFu̿[^_]UWVS U4 J;E $R{ ƋE%EEgUuUT$$ …plU>t M1uUT$$8t1FűuUEEu54$?4E [^_]ËUt }1]uЋu9t!$U D$UT$4$) E0E렃}tE1҉UWVS3 :u Ex}u 4t+D$4$7uE)E@ [^_]Ëp t 1[^_]Ét$QD$$GUWVS2 È9E D$E$P D$ED$4$ QNjE8tB 8"tn-p uOt$ E D$rD$$҉[^_] 8"u썇v.뱋p t[^_]ÍvҋE D$rD$$FUVS1 Ë8uF$'2F $24$2[^]UWVSZ1 O8E 1t 8u$M)E]M $)x NjExlD$4$>-MA XEU PMgEED$<$Dž?nED$=<$螶 HE u M D$<$P5uM+E UR V tMV}9~t!Љ1OMV}9~u oSEK1ɋE gp t&}G$v0<$n01ɉME[^_]É|$QD$$D$<0̉<$20E$'0뷐UWVS8n/ c6u D$rD$4$SuD$:4$+ DžD$D$4$ShF$ $&D$$輏D$D$|$ D$D$Q4$3$&AD$D$|$ D$D$4$s3|$$ƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $I  $D$$ |$$?ƅOD$E D$ ED$D$$$D$E$vPtD$$}$c-$U-- 8[^_]À>/uEt$D$<$ t'D$<$^ 8E D$t$E$'N}8[^_]ËE D$bD$E$ME D$D$D$ ED$D$Q$ 1BE D$t$E$cNg E D$rD$E$eMDž1D$ sD$E D$E$Dž1` E D$rD$E$L10$j t$ 'D$E D$E$'<$1 sD$E$-D$/4$h E D$D$E$ALDžDžk E D$W E D$WUS() 0EEED$D$ED$ ED$D$E$.x E([]øUS() v0EE>ED$D$ED$ ED$D$E$}.x E([]øUS() 0D$ D$$?D$D$D$D$D$ D$D$D$D$ $ .x D$([]øUS( Ñ/ED$D$ ED$ED$ s$Y-x E[]øUSC( 8/E$iU&( /U\t \]Í\]UWVS' .}|$E D$E$I9s [^_]> ?|$ t$D$$\[^_]UWVS' t.}|$E D$E$!J9s [^_] ?|$ t$D$$\[^_]US ' .E$ n t []ÉE2sT$$\EUS & ÿ-E D$E$m t []ÉE2sT$$\EUVS|& q-u4$t[^]ÅtEt$EsT$$\EUWVS+& -u} |$4$V"t[^_]ÅttE|$ t$@T$$\EUVS% ,u t$E$"t[^]ÅtEt$_sT$$\EUWVSs% h,}|$E D$E$K u[^_]É 0|$ E D$hD$$\[^_]UVS% +uE D$4$t[^]ÉEt$|sT$$\E[^]US$ æ+ED$E D$E$uEsT$$\E[]US^$ S+ED$E D$E$duEsT$$\E[]UWVS$ $ *D$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]* L$ EUD$T$EUD$T$E D$ ED$D$$\$[^_]UWVS$G# <*D$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]h L$ EUD$T$EUD$T$E D$ ED$D$$\$[^_]U" )U!QፀL]Í]ÍS]Í]Í]Í#]Í]ÍS]Í]Í]Í2]Í]ÍM]Íۤ]Í]ÍS]Íf]ÍS]ÍJ]Í]Í]Í]ÍF]Í<]Í]Í]Í]Í ]Íi]Í]Í]Í]Í]Í]ÍA]ffffUWVSP X$Hp)9s L H 9r,P 9s P P P$@(@,[^_]Ë #p VpUWVS 'ƉUx HEU D$ T$ED$9s)L$><$ ~F [^_]D$$ۋP Hx,tP(9s ,P P 9s 

S S KC S$T$ʉs[^]UWVST &E}>11L܃r׋EEċE EȋEUEЉUԋEE؍WỦ< <<] E;EriEE؅eEU9s UEUȃE9sv ED#UȅtEDgET[^_]ËU#EE%ju}ču܋EU$T$?uẼƉE wt ~ 1ҋM!E! tE̍PUP v)E;Es MĈEEU̍JMR wډuuUtE;Es U>EE1ۋE؅EyUE9U9v UD#Eȃv UDEȅUDwMaEEEE}ωu΀FE:j=*}_]̋MEU$T$ڋ}i]EE߉]̃{u]bO?_]̋EЋU t1҃EE̍PUt'E;Es MĈEEU̍JMu܉E}ESfO?~w<@p]fEЋU t1҉EU<@t$ t1!E!UGE̋EFE̍PUE]Ȅt&9s MĈE]ȃEU̍JMu9s U=EEEU$T$U]}EEf@E%#jxE%#joEUE_]̀}FGG9U}1 CEt'E;Es MĈEEU̍JMu܉E }EEEv_]̀}fGU}1 HE;Es U=E]̃EQpEЋU t1҉EU<@GE̋E"0]̉EUD$EUD$ T$ED$E D$E$p]fffUVS2 ' uED$ ED$E D$4$5D$ED$4$U[^]UWVS4 UEzlj(aED$/<$螞 t<|$a7D$ED$ ED$ED$4$/4[^_]ËE AE|$ED$bED$ćD$ED$ ED$ED$4$u 8upED$ |$ED$ED$sD$ED$ ED$ED$4$|M/ 8u 6EL 8t ED$|$\D$ED$ ED$ED$4$  US' EU M@]]] ]][] USEU M]]]] ]][]fffUWVSt óD$L$<$8t$#D$<$m1 Dt$D$$mũED$ sD$D$$Yrt UWVSQ FD$ED$$t{NjE88/tbD$/4$j…tL)JBU=wsG|wdD$}|$M$u Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVSF ;}UtlƍxD$4$F tD%=`u'6$U tĄ[^_]V O1Ą[^_]< 1UWVS Ô}U)tlƍxD$4$qE tD%= u'A$U tĄ[^_] O1Ą[^_] 1US( EEED$D$ED$ ED$D$E$x E([]øUEM tP8u ߉P81]à ]UWVS e Z}tc$fUT$U T$$ ƅt/tV$/ uDt$D$<$MƉ [^_]ÍD$$u [^_]U  U T$UT$-7$]U EtUT$U T$$]ø]US H =E D$E$`=u$ED$ED$-7$ []øUVS  uED$E D$4$x=uED$ED$4$H [^]øUWVSL ÔE uUŰPUЋPUԋH M؋HM܋HMHMHMH M@$EЅ$EPU@E)99}W~E}ủuĉMEU1NjEĉD$ t$EȉD$E$qE9}u֋UȋED$T$E$J<E$e1L[^_]€ 7Eԋ U2bL[^_]UVS4T IuЉt$E $^ED$t$E$y4[^]U   U T$UT$-7$D]UWVS uEE}ED$E D$4$Z;t}EE u[^_][^_]UWVS4 t-78ủt$E$聣E D$t$<$4[^_]UWVS6 +EE}-70E D$ED$4$:t}EE u[^_]?[^_]UWVS4 uED$E D$4$U:t%}̉|$E$轢ED$|$4$4[^_]UWVS4r g-70E D$ED$4$9t%}̉|$E$YED$|$4$w4[^_]UWVSH MU }Aq)9y}ȋ:}̋z}Ћz}ĉ}ԋz }؋z}܋z}z}z}z }R$UUątj~;ƍỦUĉEuƉϋEĉD$ EȉD$t$<$!nE9u܋EUȉT$D$ $M8M $1H[^_]€ 7}ԋ Uy'H[^_]UVS4 uЉt$E $ED$t$E$4[^]U U T$UT$-7$u]UWVS tuEE}ED$E D$4$7t}EE u[^_][^_]UWVS4 -78ủt$E$!E D$t$<$4[^_]UWVS EE}-70E D$ED$4$L7t}EE u[^_]p[^_]UWVS4q fuED$E D$4$6t%}̉|$E$]ED$|$4$ 4[^_]UWVS4 -70E D$ED$4$6t%}̉|$E$ED$|$4$4[^_]UVS  äEM thP8t P8-7@:t1 [^]ÁP8DD$D$37@<$GH8붸 [^]UEt @:]ø]UVS  -7t^d-@-T$XT$$3-7tE$\1-7$S$-7 [^]Íu$2u뎍s$ $蝞fffUWVS0Q FuzE$z~}UU}} M߉ME؉4$#aƒ  UFD$ D$FD$4$蟉U9UX9UF?MP- DQEmML$D$4$34$W`ƒ4S;} E8E}E;} tu}MMD$ FD$FD$4$fD$ FD$FD$4$fMAE9N~D$FD$4$!3mFM9ED$FD$4$2EE9;} tɀ}TUD$ ED$FD$4$fEHU9ЋUE9F M10[^_];} D$ uTED$FD$4$eED$FD$4$12xD$ D$FD$4$eeFD$FD$4$GeD$ FD$FD$4$&eFD$FD$4$1}tE9} uD$ FD$FD$4$dFD$FD$4$j1D$ ML$D$4$dFE[^_]UWVS0x qE}GDEE-798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$] fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]虁MEE9G~0W,10[^_]Ã]1^E:<$]?}1Uc \-7$]UVSA 6-7p t4$u N8@[^]ø[^]UVS ut4$nu N8@[^]ø[^]US$ õE UD$ D$D$D$T$T$ D$D$E$$[]US$g \E UD$ D$D$D$T$T$ D$D$E$$[]fffffUWVS } uUE%tUG$Ul 7tUF$U/ 7tBU$U 7,048<@DHLPEtE@$ 7  $(EtE@$G 7TX\`dhlptxE tE @$w 7|UUUUUUUUE}$tE$@$,X 7U UUUUU U$U(Uċ,Eȋu(tE(@$9 7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉ`T|t ʉt ʉ\|Mt ʉt ʉXUUt%  TŰE@|E@hDž$G&' E@,8@1fN9 4>ff~~ tωv$suE@,8@4F uf~n${O HG 9u͋940f|0yW}$G,@fD00f|0y.GDfJT$G|$uĴ[^_]Ë$#E@,8R|)4xLlx9kf+fdG9R)fL29R4 ʋ fbJr tv$;uE@,RD 9YUR, rfVAtωp$+HN HF 9u͋tp9dl9h0\d$qxy DžxEP$Lty DžtEL$'y DžEԉH$y Dž4$y Džx|Ƌ)΋)ȉlp9`l9E@,H1҉tvf~94>ff~~ t‰ljv$u}O, I4F uf~0r$4O HG 9u͋9 Ƌ9p9pDžAlxE@,8@xM8MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bff~~ t‰׉v$Cu}O, 9I4F uf~k$Eb O HG 9uϋ9 p|9|)ȉ9xE@,@u0F,@‹NHJfB91ЉNDfHD$F|$YuX-7}9Gx E@,@1fF9x4dff`FF tƉv$%uE@,@4F vxfFXl)\N HF 9<$u,9|?EH,|f+f49@)fT094‰PЋLf`\Pp tv$uEH,@D gE@,pfFE^*LN HF 9-$utE@,8@1fF9t4PffXFF tƉv$uE@,@4F otfFMh&LN HF 9;$u9|EH,|f+fD9@f+f|094xH8f`Txx tljv$9uEH,@D8 KE@,pfFEЉM,LԉN HF 9Nj$u3-7}9GG800D$E$/f1UWVS| ÓUu}}  7M  M 7  7  $( Q 7,048<@DHLP ,,} 7TX\`dhlptxE% TT} V 7|UUUUUUUUEE % ||}$€ 7M MMMMM M$M(Mċ,UȋU$ UU}( 7]̋]Ћ]ԋ]؋]܋]]䋙]苙]싉MM( M̍M̉L$ T$D$|$t$D$ D$D$E$|[^_]ÍD$E $tUD$$t1D$4$t,t$<$ct}-T|$E$Dt} |D$E $t}$UT$E$$s}(EM̉L$E($syU$o hU$T$ U T$UT$UT$UT$UT$ U T$UT$-7$w]U$  U$T$ U T$UT$UT$UT$UT$ U T$UT$-7$]US E-7t0ÁtZD`.7tuX.7 %BH[]USx aUE t0ÁtZD`.7tuX.7 %BH[]UWVS Eu] %tFDU`.7^HFE~TFU1~_V,@M}@t~D8x ߉xf@9uڋ}9}uD$4$]]1[^_]Ã9}ufX.7 Y[^_]U# UT$-7$]UVS Et=PHӁ`.76u @D [^]ÉցX.7;1uڸ[^]UWVS< ÑU Etzu<[^_]ËB$VE@DE̋E@HEfEE@LfEEẺED$E@|$dEx|U B$U BMADBEȃvgDE9tKuU M$8@MąɋU  AxDE9uU <$U %`.71t MAHALQDUEfEfEE}}ȉ|$A|$[|$E$1ҋEH~]E@,<1E@~=U E9p~*W DtL$Eȉ$E9p֋UăE9PD$E$ [<[^_]ËMA|tBfX.7 U $h@EH|U U! UT$-7$_]UWVS }-70t=Gt6G$&|$4$D$4$(Z1[^_]ø[^_]UWVS u} t=Gt6G$L&|$4$D$4$Y1[^_]ø[^_]UVS& EM tlPHց1`.76u7PDQAP|tA\Rtu1[^]ÉցX.7;3u뭸[^]U UT$-7$J]m fǀt UWVS8S Hu-7E8`-…2.7E̋2-7E؋2-7EЋ2-7EG -7EG$-7E܋GT-7EȋGX-7EԋG\-7EG`-7Gl-7EGm-7EGnE0Ћ2E̋2E؋2EЋ2EV EV$E܋VTEȋVXEԋV\EV`FlNmEĈVnE4$"F-71ҋ2‰T$$V -7V-74$4$ 8[^_].7E-7E-7E-7E-7E-7E-7E-7E-7E-7-7E-7EUWVS& }D$4$DƅEdž3E Fdž2dž2dž2dž2dž2t 3ǃt džh2džl2F`fFddž2dž3F FFFdž3dž3dž3 $;3dž34$6t$<$}o2PJpdž2D$D$D$D$ D$D$4$TFD$D$D$D$ D$D$4$F4$a4$譏D$D$D$D$ D$D$4$謡F tjD$$4$$4$t4$4$6HH-7t 3t4$#4$A[^_]Ë2t$fd2$g29tDžu拆3$4$1[^_]ËRhD맍u$rDžUWVS }2t$c2$ig29tƅu拇2$g"<$a3$+3$-798t<$ [^_]<$[^_]UWVS: /u +9uǃ8 >ǃ< <ǃ@ ^ǃD vǃL #ǃ :ǃ$ 'ǃ( #ǃ, #ǃ0 #ǃP -ǃH -ǃX _ǃl |ǃ oǃL -ǃT -ǃp <ǃt >ǃx *ǃ| !ǃ f2E@tgt.Ex tAu[^_]ËE싀t(VT$VET$ D$D$E$ 1 Tp=u[^_]US ÎM1Tp =u[]UWVS,h ] EƍME$+FF(9u݋uD$$8CuxuAD$$$3T$$ǃL !ǃ8 +ǃt !ǃ< ,ǃ !ǃ@ -ǃ !ǃD .ǃ %ǃL 0ǃ %ǃ  `ǃ %ǃ aǃ ǃ$ fǃ ǃ( gǃ %ǃ, hǃ &ǃ0 iǃ$ %ǃ4 jǃL %ǃ8 kǃt %ǃ< lǃ %ǃ@ mǃ <%ǃD nǃ< %ǃP qǃ #ǃH oǃ #ǃX sǃ %ǃ\ tǃ $%ǃ` uǃ 4%ǃd vǃ, ,%ǃh wǃT %ǃl xǃD ǃ ~ǃ #ǃL pǃd #ǃT rǃ| d"ǃp yǃ e"ǃt zǃ ǃx {ǃ `"ǃ| |ǃ ǃ }E2xU U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$VEL$ D$T$$Ep }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$>L $<t $^m $v[ $#I $:7 $'% $# $# $# $-< $- $_ $|T $oD $p $rqd $y_| $zM ${; $|) $} UUS  ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0! EU܉M-772EE4E fEE$ƒ=4M4%y 4 44fǃ EDPf~M䋑f8>@E fWfcftf.MlU܅-7Q)ʉ$1E$ƒE@ @M M4 /UfB 49}} 4% 44;4yf  "7f1҉Ѓ0[^_]ËE44%y 4EDPf y4D$ D$D$$ 4449)‹4L$ T$U؋MȉD$E$4;4U}dž4…f 4xp4fǃ +E$/t3E$=Ec0U$)4fǃ E܅U 0tE@ U؋4 E44B%y 44D$ D$E‰T$E$3y4%y 4 494114M%y 4;4$fǃ Mԋ4D$ T$U؋ED$E${U؋M ~4y 4 49411x 4Wy 4 494"7ff @}AEE܅U$D-E$ƒUE@ @MM MtU-oE@ U؋4  UfB 9 4)fǃ &E܅{-7Q)NUj 4}} 4Hx6 44m4%x4|뿃ߋ 4}} 4%y  44;E@ }fG Ef` @-D$ D$!D$,$G $WdU ›Efǂ ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSXR Gu-7MV8у$33`-EEt-7E(V8t@N<)tE11iE}uDX[^_]ËFv3@-7D$-7$#ǀ3E AX[^_]EE] (.t&KEEED$D$ F@D$EĉD$Ủ$UuQUT$4$ M)v4$ 33} `-!EED$D$ F@D$EĉD$}̉<$P|$4$& E1EE$E%V88uF @t'z 8t!F }fG %E g3t&-7D$-7$M1҉3E@ U5 .UT$-7$]UWVS u}ED$E D$4$t} u [^_]r [^_]UWVS 跻 ìu-78E D$ED$<$3tu } [^_] [^_]US` UE$ []fffffUWVS 1 &Ɖ$h $2…t"ׄtN<$tȃuЃ [^_]ÀF$@ Ut p@뮃$<UVS蜺 ÑƍD$4$#j sD$4$ j 4$g vlte110B<1ɀ;Pt0tD~ȃu9mt(B< v-1ɀ;Pu1[^]ø[^]É묀;tD01ɀ ɉ떀>uF[uVmtÃt0ZcWKUWVS0_ TUu :uH2tU$9LUF@fu2ML$ MD$T$<$S2MEPJ(N$JN 3\s$,JD$D$$XFTs$D$D$$'FXV ~$-79-7NT-7 -72P3B0ozpdH12džp2E苂E싂TEtU܉Udžp2ELɉME*EEUwD$Eԉ$U:E܋U؉$зMԉ $ŷE܅t2džx2EtEJdžx2dž|2UtE.dž|2E؃0[^_]ËHt1@@Dǀ@l@hǀǀǀ<HHpF$B(KE`U܋ED$<$e U|E>U܋ED$<$pe Uu p2EU܋ED$<$Be Up22@@ ,F@f`L$ D$cD$<$2E41E$D$E$d u džx2EED$E$od u x2|$E$Jd x2Et ED$E$d u dž|2EtD$E$c u |2|$E$c r|2c~ LSMt|$E$gc u x2dž|2EEdžt2džx2dž|2džp2MzEdžt2džx2dž|2EbtW|$E$b uDx2dž|2džt2džx2$qdž|2EEdžt2džx2dž|2E&UK D-7D$E$]US# E-7H$ -7H -7HT -7HX -7Hl -72 p2 t2 x2 |2 2$QC[]U脱 }M-7tJX-71]ø]fffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS 谰 ǝ}ƉDHfx 4 [^_]Ëf=tnfDN4f>tM$]gQPf9uǀFF [^_]ËEFf\Nu]ED$$])MME$ ]ӧUMtbf@f@@ f@@f@@]\]X ]]UU9uU]p$訳$eF]@-D$ D$D$P$5 $)F]$O$ FUWVS Ǯ üƉ׉M$S\ ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS# Eu^9t)fxf8u@$9u׋~1$]j9> $]R4$J[^_]UWVS X9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS }fǃ $Pf9uǀ2ǃ ǃ ǃ lR2@tL$Y =w4D$T$$N2D9u[^_]Í$c$ CUS ҲE E-7t+2UT$$UPE []ø []U xUM ~*-7t2t 1]É1]UWVS 5 *-7te3339}}<31 [^_]à D$$,‹t!3333뱸빋33D$BD$$v 33]\33o'U [ TE-7t%2UT$$1ɋUE]ø]U M-7tJT-71]ø]UWVS٩ ΰ}<$荺ƃuOG @tI8g 8u?-73t--7D$-7$yqǀ3[^_]UWVS Z OEU-72E EE$3= %y   fǃ LNfu f9q fmffjMUU$ E$mE@ @ME@ M  %y   LNf   yt鋓  9f y [^_]ËE$At3E$8=DEMR [^_]ÃUfB   9| <  9f [^_]Ë %y  ; fǃ Eu-E$E@ @aσufF -7Q)=  Ef` [^_]ÿ@-D$ D$ D$$, $=UWVS$إ ͬu-7M~V8у$?p33`-M MEt-7BEF8V<F11‹F 3uED$E D$4$t?VEF,ED$ED$FD$ FD$ED$4$@[^]USȜ ýEHEP,UD$U T$PT$ PT$UT$$A@[]fffffUSc X-73t`3$q[]1[]UWVS # udž243@fu|$$^5 t%F@f|$$=5 43`3<3h3@3l3D3p3H3t3L3x3P3|3T33X33\3383d3Fl83Fm4322<32D32H32L32P32T3222@3%2fdž2432<32D32H32L32P32222324832@3%g2`33@fuT$D$$ [^_]dž3-7-71 [^_]ø|$$3 UVS蓙 È-7$LtHl-7 Pm-71[^]UVS H =-73ug-7.7ǀ2233t9@fuT$D$$ [^]q1 [^]UVS 誘 ß-73ug-7.7ǀ23tE`33@fuT$D$$ [^]1 [^]UVS -73uc-73tW2u<23@fuT$D$$e [^]Í291 [^]UVS腗 j]C=w"Dt-7XUS 2 'E U 37RtI|t7DT$D$$x-7ǀ3@$ 1 []ËxtDT$D$$/-7ǀ3@$ 뵸 []UWVS i ^E-72tt_ [^_]37@tǂ2DT$D$$@$  [^_]37@@ttǂ237@jǂ2U菁 -72$]ffUS]E  }t J;}R ;~1[]ÃUWVS) }tG8 uZ@u[^_]ËtG~W,EO(G\p;}@ ;~E9uՋu뭉<$VG8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtTx^F9}WҐxR)9H t7~,}߉ˋF(D$NQT$$U191[^_]É봸USEt"H~X,19t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًUI9u1[^_]øUWVS}] UuG9)9UtYW,G(tX] UG(uU r9|_9}G(r 9 _9}"E E9E |1[^_]D$OL$$bE9oƉ\UED$ PT$D$$]UWVS}G~CW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]t]{tVO~Ww,19tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]UWVSĀ| R433x,}396F8 ,4};~E<E1uuuuủuƉMD>EED$D$ M3@@D$ED$E$OV,UD>UЉ$~UЋM;4ED$ EF,D$D$3$bED>$~EENjE94~WD>D$E$$BE!эP$U( D$UT$ ED$D$4$;EE[^_]F,D$D$E3$EV2MD$ T$FD$4$D$M2$ҸEE[^_]ErUWVS8y òƉU̍R4EԉuЋ4M8<$&' ƀ?tqE4EEEEE'E$6}M9ErIUU)ր?Et7E܉D$ t$|$E؉$1{Ey8[^_]EEEԋ@tCuҋEԍPMulEEЀ4uŨ8[^_]}E)9ǃEԍPtt$D$ $U> U)uMtMȉ׋uԋ6sRtftE‹u)uEmut$D$ $U UIuE)muuzEfUWVS,w ø~EօE93}ʅDP-?@tDG@uM$U$ MɋUM4M׍MMu܉ƉUE$xUt7)ր?t.ED$ t$|$E$yEyĸ,[^_]Ëu܋U)׉|$$…tٍNDvu4]Xʉ1,[^_]ø1ɍA1USqv f}Ew"dD$$=3[]øUS.v #}-7t3tUT$$\[]øUS u |-7t&3tU T$UT$$( []øUSu Ô|-7t3tUT$$[]øUS [u P|-7t&3tU T$UT$$ []øUSu |-7t3tUT$$\[]øUSt {U -7t*3t ML$ T$UT$$<[]øUVSxt m{-70toƆ43u'3tU$}3${[^]Ë2Ppt%T$$ D$2$[^]øUS s zU-7t$3tD$T$$ []øUs zU-7t~;3TR4]1]USZs Oz-7t3t$U[]øUSs z-7t"3t$Ut DY[]øUWVS r y-70Ɔ43uj33~BE14u_uE;3|Ճ}tO3$y [^_]Ë2Ptt&T$$D$2$ [^_]øUq xU-7MMM ] USq x-7t3t$Y[]øUWVS q Åx-70E E4ED$ D$MML$$"ttiP$URiDžtUU UED$ UT$ML$<$st&E$U%Ɖ<$q [^_]þUSp ýwEt3t$gS[]øUWVSp Ãwu3t$"3~#14$p;3|ߋ4$pd3ǃddž3D$0$5l4t`2PtD@@X~:Ɔ3$G/2@PX3@$41[^_]Ɔ3UWVSso hvu3t$3~#14$o93ߋ4$o[^_]UWVS]r3Y3KE ~443 u} })u}}11]]9t0z9u}9u]1~39114uu;3|ى[^_]B,B\4u u )lj<)} t7ƉL|G1[^_]ÿUVS{m ptutNFX32@@T%D$4$ E D$FX$1[^]øUWVS m tEExD$D$<$pƅt,)‹M tEt|Etuu)1 [^_]ËE tmEtYutREM`.7 u)1MfT$|$E $pE 01f%и [^_]øzUWVSl sEEuE $oƒw]}E(1M149rEtfEt1[^_]ÉEE $co,} E9tl$UVSi pUE ӁttH@[^]Í € 7ʋ JHJHJ H JHJHJHJHJ H R$P$ [^]UWVSCi 8putv4$}uVȉ‹9u F0$iF,$i-79pt]9p tJ9pt2t$$mi4$ei1[^_]@u@ 9pu@9p uUF4$i>9UtU?$9Uu~X24H90t…#ȋH90utJ$h2UWVSh nlj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVSf mƉ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u=uAuIu 1[^_]37@@8tf@ۃf@t4$t4$뭸[^_]USd kMU -7t%t X@t @@f%f1[]ø[]Ud kU-7M u]]]U]d VkU-7M u]]UVS7d (kE -72Uu0ÁE% úډ1[^]ø[^]USc jU-7M u8tHX2H@H@[[8u1[] ʉP@[]Uvc oj-7U]QUXc Qj-7U]UVS9c .j-70tFFX2@Ttf@4$4$37@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]g]UEU Mu]3]USEUu2U Á ӺEڋE1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]_UVS|a qhutFFX2@Ttf@4$4$37@@8tf@U 1[^] a h37PT1 t t t@t̀t(t t8t ttLt 1M` Fg37PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS 2_ 'fu4$ D$t$-7$) [^]UVS ^ eu 4$ D$t$E$ [^]UWVS ^ ñeuE -7:x1u 9t <uЉD$t$<$ [^_]É4$ UWVS [^ Pe}-70E D$ED$4$׋t<$ D$|$4$7 [^_]UWVS ^ du}ED$E D$4$肋t<$s D$|$4$ [^_]UWVS] ád}u-7E D$ED$$U"t/Ux0u 9t<uƉt$|$$k [^_]ÉU<$ ƋUt$|$$C UWVS ] d}uED$E D$E$葊t1x5u 9t <fuƉt$|$E$ [^_]É<$I UVS \ Îcu Ex2u 9t<uЉD$t$E$~ [^]É4$ fffffffUWVSD1\ &c}EUċEG,4@4E@U }` jE EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$譾uD[^_]à E1D[^_]É$/_&EEFEȅZE@$_EyEGM+M9E O(U @9~F t$fF E@ffO@E % ЩOH ȉFEfFE@EȃvA}$wRMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$fG UMȋE@A%GGfGfwu}G9uOT9 pO(LE @ 9}Gpt$ EĉD$ED$<$9EEGT9tBuW,u P GG(<$FEP1Ʌt=Uȉ}$ QkMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$a&A!E$K\BE u E;GTuO,u u6uč @4E;GTQG8 |<$w<$ EE uUčJ‰Uĉy19zuĉ)UBHFBLfFMEy19@E0B,4v4BDfFt$B|U$bu 4M+EOT9E M MO(ʋH93OU9U+GHFGLfFfFUO9UGDt$G|$au3  GHhUMʉUȋu6O, 4I49~X}uEFDfG|$F|$aFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 E 8W9)ʍBE G8  -78u E<$\GG8 <$BEuĉ׉EċE MO(@9E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM E<$0EG8 <$}YmUWVSkT d[8uE0E,EP@,Dt@ 1H470RM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]Qu`E9EuM܉r9M׋GD$ D$t$<$]9uuE7fP 1fUE LUT$-7$j]UWVSE89tZ@EOE)w~>EP,G(UW,΋M4}y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS(kD `K}GDE-798 GH%EWUOMG,E܍40UunыpG9UfFE9svffEF%M ȉFt$G|$Nu¸([^_]ËOU9~VUEEGGE܋D01E_GD$ ED$ED$<$%<$ 1([^_]EUC J-7$]USC IE] L *t&tl AL p 1[]øUWVSu} ^(1Ʌ~&1 ~у9tT,y)у9u[^_]UWVS0iB ^IE,E-7EL l E1-7EED$D$D$D$ D$T$UE$t!UB UUB(ɋU~CUMT$$Vt=9L ~#tyڅlE)e)UǃL 10[^_]UWVS_A TH}W$G(E~w1U9w(~hD,tO L$y؉D$D0$tuED,yD$UЉD$D0$ tD,E9w(E[^_]EyUWVS@ ÞG}G(~"1D0$9D0$=#9w([^_]UWVSh@ YGuL 1~019t% 9p uDŽl 9uۉ[^_]ffffUWVS @ F]ƉE׉UM$2L]EPt MA +B A(EEuFF]^]^FT4$]j 1ۋNv]uF,MzF.1ɉU܉fGU9VUGfGFD$]AG |$F|$3Ju [^_]ËEED$E@,$]E-7ǁ3~^U ~W;A$t^U T$$D$-7$t [^_]ËE D$$t$1[^_]ËQ 9U u1UWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVS6 =}M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$|$4${D$<$茸1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8u ⿉P81]Ã@]UWVS 5 <E} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]7BFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HR$x9tC9uՋMQ ztɋQuut duH8 uX8UWVS(]4 R;EUMQI$L,ƅ1ǀǀǀE܉$,EF,D$E$0ljF0MF4EFXFF]^EF^ F$EFE F F8F8~xfHf@uEfx~SE@uJUR#h2u`.78}}$J t$JutE1[^_]f~E@t܉-7fy~ӋUBvuGfd묅t}$:J {뎁T$-7$G}$J G_UEPT$ PT$P T$P$11f]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]뭉U델[^_]UWVS  #-7@@MtƠ37J yDED$D$Ơ37@$6[B@"7#B@t2ED$D$@$ZB@"7#B@~`.7t $hD[^_]uW~udtƠ37DEtDD$D$BL$jZ`@Ơ37DE*Ơ37DEED$D$@T$ZB@"7#B@&ED$D$@L$Y`@`.7[^_]UWVS) !}ƉӉ$N,4;]u;} t;E"D$E D$ ED$|$$]6[^_]uUWVS  E-7Eԋ3 ]-7]ZJx< XHUE@8@u B8@B B@ ]Dt$D$37E@@D$XEԋ@@HT D$u4$]Hf8E@PhtfEԋsEHȅuvϋE-7EP,11M~9z_{}~r}41҉9} L$M4$]MuՋE̋K,SB9E}E@@%ƋE}9})EU*Ct}EU9/EEPB%9uUEuE}ċE)DžyE9U)E9EEE}ӉʋuEEȋEMȉEЉ]u]9]1MEȉE܋ZE@,}܋xB,p1҉]M؉M9}L$M4$]TuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9Ex$EaE̋K,E؋mEăpSBE܋]؋}̋7N,"XV9EM$^E@8MEԋP]CD$CE$]CD$C$ESPSPU܉EE$]t,M؋E̋E}Љ9}9}r}h}ӋBM E]ȉ]ȋ}MӋBy9nE܋U9~EċEBDM9 tS BDt$B|$]gFfFEBLfF9uE̋sE; _C1ɍ UL$D$ <$]U€w֍V)‰։L$D$<$]S‰EЋE̋@  EȉE]9~]E])؉E؋UĉЋ])؃EEH,E9p]]]E])؋UЋUЉ֙Ӊ]1uu܉1M9| M9]9]9]E؅& 9]܋KȋŰrU9Sf E䍐 E̋@=vuEEE܋Hىωָ   tftEE =wEဃ)ȋ]܋Kωփ~ tftE܋]ЉXE̋BD$ D$ED$$]蚇EIeWdIt$D$$]D-d]Dt$D$$CMčGED$D$ E؉D$|$$]M U܉ MDD$)ȉD$ ]؉\$EȉD$$] EE@T]DL$MD$$CU܉E܋ML$D$E@$BE܉؉}܃}EUqd^]̋R, ]9]uE]E@,E]EE9E|EH,EE}؅EX]@E܋}ȋE)NjE@X0ppuCpM}UčJŰ;JSHFEĉD$ML$$](dDt$D$$AD$D$ D$M܉L$U$t$D$U@@p$6AD$D$ EĉD$D$$U@|$$xct$1|$$@E̋@D$D$}@@0$]9ct$D$$@D$D$ D$D$Eĉ$&t$D$@@p$O@D$E܉D$ ED$D$$t uD$1D$ ED$E܉D$E$]1DU؉t$D$E@$]?U؃9uHvtHT1҉Ut$D$E@H$];?U9uUD$1ۉ\$ EĉD$E܉D$E$]|$E@$waDt$D$$>E)ED$D$ D$D$E$]TE@|$$at$D$$c>D$E܉D$ ED$D$E؉$] H } D$1D$ EĉD$E܉D$E$]1DU؉t$D$E@H$]=U؃9u" 1E@Ut$D$$]}=U9u ppu;t#t}učNŰ;JXLJEĉD$ED$$]_Dt$D$$<D$D$ D$M܉L$M $tt$D$U@@p$<D$D$ ED$D$$*U@]؉\$$]^t$1|$$5<E̋@D$D$}@@0$]^t$D$$;D$D$ D$D$EYučD>ED$D$ D$E܉D$E$]TE@t ]̋ ;qtE؉D$$]]Dt$D$$C;D$D$ ED$D$EЉ$]E@E؉D$$]DT$D$$:D$E܉D$ ED$D$E$]SEDỦt$D$E@$]c:Ũut$D$E@L$]):u 3EDt$D$E@$]9uL> E̋];X- iEDỦt$D$E@L$]y9Ũu)D$D$ ED$E܉D$E$]|$E@9E؋]9Efuucfr 1t`u 9}tQpt$$]uE䍐 E܋HcfwZ]䍓 T$Uu܋F$NU 1ɋE䍸 E䋀 EE܉E9EBEEUWVST A]-719X‰PtAC:uf11ɋCD$ CD$C D$C$KtB[^_]5C9u-7 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]U y-7$]UWVSe Ru] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$t[^_]FF9u-7 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVS Óut$;#vu[^]UWVSk `}GDE-798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$wD$D$<$"1EU. '-7$]UEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVS ïU} w to1t6~RutF$u1[^_]ÉU$rt8U F@RuDžtÉv$uG 멃UEU  HJHfJHfJU @ E]UVS utv$au[^]UWVS ØMq~X1Q,zQ~>1҉EM׋q tMv$uME9xԋEM9A [^_]US] t.UӋE ȉt %1ȃ9u[]ËE[]UWVS]} 111 ȉt %1ȃu1Lȉt %1ȃuڋK t4u14Ɓt %1uۋIuҋu9h[^_]1[^_]US# EL t$D$, $膹x)P 1[]É$1[]øUWVS0 üUL P ` E싃\ EǠ37HApEЅ-7EE䋳X utayFEԋE%Ey E܋EԋuƋUE99ЅyBU)u܋UE)‰U.E9EEEƋEU)ЉE9gFEԉu܋T u)y ‹u)֋Uu9Guԅ+^-7uu܍t9B~ Eԅ3D$D$ $/ǃ` EЋ\ EE1ҋX EMM܀}EE-7>\ ;T ЋM)ȉEԋHAEЅzEEE9E| E9AT$D$EЉ$$/@P#\ ǃ` ;T ^J, U.7UfT$D$$.P >u Eu@@l8 \ ;T J\ AluL (D$ E$C…yP )ЉP pL t}쉻` }艻\ 0[^_]Ë=-7EEU싃X EMM܀})y uyFȉE-7> .7ЋM)ȉEԋHAEЅ \ ;T }xM9M M9ML D$ , $)P ǃ` \ ;T t` X E܋E9, E"t$D$$,` ;X ~aP p` @@xuL XD$E$\y)P ` ;X \ <\ t$D$@$,P \ ;T ` u؀>X u)ʃ-7E䍃, EԍEfșƍry )ƋE9@M؉L$D$$V+` X EE0u9~1$ P ]$uXE܉E\ ;T \ -7u܋R,r@E؍, E0L P P u` R9X E܋EP,\ 4v4F‰EEu@M؉L$D$$*` P yu9D$D$EЉ$)ǃ\ ǃ` UNE;H@uRFuLf~-$` D$\ D$F $?VP f=` @$ ` P L tD$ Eԉ$…yP )ЉP 덋@lT$D$$(\ \ E9T EЉEԉu($ \]L t'D$ Eԉ$Ty)P $ ǃP L D$ , $y)P P E)ȃ9u@D$D$$'` 9X , E"t$D$$^'` ;X ~b` @@xuɋL t5D$E$y)P $ f0$U됉Ƌ\ L t*D$ , $躮y)P $ 1ҋX EUWVS E苃X -7M19|T X ` \ 9T -7EǠ379T 9.7EDE)$ JEu ǃ` E98.@@ltˋM t‹UT$D$$%뵉T \ PBh9}dX T$t$$GƅtDE;` t4$X U DD$D$4$%uU1T \ X ` [^_]ËX .7Eu@@h9ME4M䉋X E;0 GE\ ` Ǡ37p >u~x.7UDt$D$$I$mtGUt @@tut$D$$$@@lu$ gmu\ ǃ` -7ET 9P))ΉT \ $ 둋T xǃX U UX UT U ` U\ 11]U UX UT U ` U\ E1]ffffffUWVSm V%-72-7E-7]19u9uV~sF,E1҉MEF~PCH1U 9F~59uuS9~S 9}͉9FˋU9VMIg[^_]Ë]S~Cs,~DUMڋXCӉu΁9u9uu9utɃ9u 37BH8~NHD~GBlthtËuu拐tt 1 37@ xUWVS(| uƉEY37EBH8ˁ:u-7u@D*= }-7LJd -7Y\A`fAdBt%]DD$D$ $N EBt8]DD$D$ $ -7p2!P@EBlhzǁl2ǁh2BxT2@@Tƒth2t h2t h2t h2 t h2 @t h2@t h2t h2EHA\$fǁrǁt"fǁ~ǁfǁǁfǁǁfǁǁfǁǁtmfǁǁtLtfǁǁ~/Rrff@f@@ 9uǁp"ǁt"~&p"p"ff@@9u}苇d %ȋtp"xt"LJl LJh 2-7E-7E E9tE9tE苘d ZHB~UJr,EEU܉}؉ϋ~HQE% ؉9u9uuҋU܋}D$$]_j1([^_]øE-7ȋtǁl2w-7Ћtǁl2Ntttǁl2)UWVS& EU MfUfMf]-7;7Lftv-7949)-7l2tot"уt>]f9p"t"]fp"]fr" 1[^_]Ét"ufp"ufr"fMfvt]fufEftwft8fXfEMfCfE8fufEfEfE}f9r"*t"BfEfE'UVS ŠEM ]f-7;B`N4f1Dfl2t1[^]ftf/ftTfufft9#ft*fuffuffufffff릸yUWVS$ ìU} uEEEƉEljEf-7;B\ @ frftufv37 I ytX2RtE}|$}|$ ut$D$$-;DT$D$$1$[^_]øU Efx?-7;B\}1@rU f tUf vEf1]ø] z-7ǀtǀx-7 t%d ǂp"ǂt"l u1U勀d %1]UWVS }M -7l2t^ftfvǀx-7 t)d fp"fr"ǂt"l ug1[^_]f3fthfufto'ftVfmcfuؾfLBd %1[^_]þ뜻닻 -7h2UVS ö-7l2tu? 37Rt*DD$D$$"7M!A@f@d [^]UWVSI >h t-7} 3x@tOu f-7f9pdt6l2t*-7fpdQ@E % ЉA@[^_]΍N} f_f|S-7UL$2@$7DL$D$$UUULf`L$2@t΍N} ff|-7UL$2@l$ 7DL$D$$bUUULfL$2@h$6DL$D$$UU-7$UM fxGU-7$sUM f -7f@dUWVS U-7pFFy ;F|# tH4$b [^_]Ét$${UWVS ÐUu FFy ;F|# tH4$b [^_]Ét$$zUWVS> 3-7x|$E$(Ɖ<$6b [^_]UWVS } |$E$Ɖ<$a [^_]UWVS U-7tJ } xCH9M ;X9}4xp,9"49M uM HP1[^_]Ë#ָ[^_]UWVSEM UtK xEpu9|;p9~4Xx,9"<79Uu7PH1[^_]Ë4&ָ[^_]UWVS Uztzr BEuNjEBw u)]ZڋOM)ʉ x=_]93O9},_w,9~ ! ΋M9u3GWGu [^_]fUWVS@= 6E}E E EE E @$]ÅxyGEGE؋E @ G]% upE-7E_E))9@L$ED$<$]؃@[^_]û놃 uG1뼸@[^_]ËG,U؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9r)UԋAFAFA F AF9sڋMA E @EȉE E%AfYE HvJM܉]ĉ}}$]yM \_ XG E9u͋]ċ}EԃUt1Mٍr}}ȉ8)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]Q<$vM1 EGy1G1 <$] E9GT G8  <$]T1E D$<$]v1 UԋUЉE  E9:]ȉMĉ:BD|$B|U$]-UBHGfG9}s*w tUv$]`uUG 뜉]ȋMĉU UT$-7$&]UWVS c Xu}ED$E D$4$t} u [^_] [^_]UWVS  u-78E D$ED$<$tu } [^_] [^_]ffUWVS| E}}M E $]gEQw$]yE1EHMGEȋGEEċE @M qMMM-7M t[E2 $ ]ÅyEEę)EEĉEċt& uE9GTu G8 )EȋuڋwGEM)ȃM9EEċGEȋE ]EM-7MU rUUEM  / m$ ]DžyE]ĉؙ)Mˉ]ME Et MuM} EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9ZU@t)G$fE9r)UGFGFG F GF9sڋEȋUUċu}ỦUUĉU]ȉ]UUuEȋ^,EEEF@ED$ED$ED$ ED$ED$4$]&mmuE]4EȋQT$ UT$D$ $M]LE 8 MQA(TE@ 9}E <U1UĉU uKEEEEE E E$]lyVMmEEMmEąy1EămyEF$]y)EE9EbEWMFE EĉE_$]ymEHU8mEąy1EċF$]y)E<9e}U&FHGGfGfG9}FD|$F|$]luE$]|[^_]ËyQUEĉAEȉA $]{MyUQE9ATtNEȃE u{}ω4$]U<$qE1|[^_]E $]xyMEu붋E$]=U O HU T$UT$-7$q]UWVS uEE}ED$E D$4$t}EE u[^_][^_]U D$E D$E$]U D$UT$-7$]UWVS g \u}ED$E D$4$tE} u [^_]h [^_]UWVS EE}-70E D$ED$4$t}EE u[^_][^_]UWVS Üu-78E D$ED$<$#tEu } [^_] [^_]fffUWVSQ 6ÉUMP-ljEDWp1҉]]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}‰ DOu냉1sUWVS(G <EUM؋ufUވM݋U 1ɋU EEԋ}P-Et$$UEx}P$u܀G$H Ut}EMU E1‹E Et~MލAf qC$WЙDžNE݉Et$E$Uu0Eu1([^_]À}. G}ԅ~Mȃf wC$WDž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVS UE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ ոt$D$$E[^]ûu111[^]Ud ]p r D$ ED$E D$E$]U p r D$ ոD$D$E$]UWVSݿ Nj2FEF<\<^t{Ѝ\P-r7%Ӎru<: <&~Hپ!J'JP'EE[^_]ÍFFZ%PP- QuJ{E< v^]v.F<P-]1DsD]}MMލ[{D~Dyuu}M؍\u2<\u7{ESȍэf  ΍ f )ʃ0Qfv)f )ڍ)Ѓ0P}E[^_]ÍJ{P]1TQu<.tt]<*yMl1nVU}uf%p}O0J%}d J]܈ZQUdEVU}f%p}O0JJMf%ctEF =8}Ef%pPU}W0PUEtEHM%+%c֋EE&VU%p0%Bp0%{B2}%*fB %-}O0JJUECVU%p0%B{10}B%/%{B 16}%B*%p0B%{10B}%m%B+}O0JJUE'UB\E%p0%@p0%?}W0PPEUMU܉ȉMbËE%>%tEU܋EFt E%+%;E֋EEL1<1JfKMC|D7<\F=]EPU\EUVS蕸 ÊƠ37t| t~9t $sK| EED$D$E $`uI| tG@t  d.7 x @xt [^]É댋E[^]É| @uUWVS(ʷ ÿUEtBEE37E}<$/e UT$ D$D$<$u蹵N)) _U܉e)‹M) _UѸg4 )3lD$<$f EtTH tCp$1҉}܉ 9t-~fuUE܉D$$]f UuF([^_]1([^_]ËP 3l([^_]UWVS({ pUEtBEE37E܋u4$c UT$ D$D$4$襐}kLЍB)^UeЍBM)^UѸ>Љ)<;kD$4$Je E܋tRH t>x$1҉u܉ 9t(nuME܉D$$ e MuՋGy([^_]Ë;k@x([^_]UWVS(' UEtBEE37E܋pu4$b UT$ D$D$4$Q}-?L) RЍ)ЍlXGEeE)  IȍE) GE*SRЍ)<;l_D$4$c E܋;p_AQ tJy$E܉u9t(~suED$${c uދF E܃9u؋E܅tЉ)EkD$<$^ -VUE}<$\ UĉT$ D$D$<$肉Mĸ-?L) @)ЍlXAE-?LeȋE) @E)AM*SRЍ)l_UD$<$^ Ute}tu}cu }uFEE3l$z<EEk$J=p_$0>렃}u E$z1҉UffffffUWVS豭 æE1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUj Uƍp@Hπw09}맋E D똉Uj UUWVS ۳48,.օR@08G4<11$rD$ \$4$01󫋅0t=1(}J90t <u 90u狵(P)1~u,H]Y8^4~!%u~V%8H4X0@,q9r0t$$4٨8C,s0K40u4 8$4X8 @0@4$4$8G,_G0Gƅ`%4P- Dž,Dž$Dž(Dža`0:~LJwDɋ4nXKJw! .ʋ DNt{,4ʍ\qЉ,'~>aDž,>~`B<=w^4nW0)?(t9,> z$t-.(M,Dž,Dž(hDž$YilP[J߸ V8uo'dwEOI PDEG/8W,G4G,[^_]É,] CEP0 ]P,&Vҋ4xoE EP(, B08H4X0@,T9BtD(\$ `T$0\$ȉ$4Gt8C412<'urR1҉,,0O0PD]PEEP08P4H0@,Z9PJ8K40U{UJP,0$4.T 0,OPDŽPUw}7D$$襙>D$t$$-‰E$20UtYEE[^_]Íu$WƅSE1ҋEEut$ D$$腱M$-@ x Utb}ut$"tD$$IEJ\ D$$($'5 Ex t;MEt$7tD$$ݰ D$$ǰED$D$ht@E$< tEftUft IA(Q|uEt E1|$t!D$D$$RB($tD$D$$RB끃}, D$$tD$$ͯUVSך ̡EtD$ E D$ED$E$ƋEt$Q,[^]fffffffUWVSq fƉEωD$$I tB4$G ƀ?u1)9tXzzt"D$|<$ …uۉ<$G 9t 1[^_]Ét$ED$<$[^_]ÉUt$ED$<$xUu[^_]UWVS 赙 ƚuEUt E<t]V  [^_]É΋Ex %1ji˃1҉9rExtftEx(1}fWVu~9Vt"VT$<$]踕ljFVEptft]CPSD  Ћ]XgËuVf;h{CftMWҍTRӉEf}]}^ Qu F 8vE9uڋE}f8Pf]s} H u yf}uHD$$%]k]C ExD$$!]8‹EPn!f8t;Pft2]{u0 ftXHt݉f8pxE;x T@$`|$D$$] & Ex E@$E11MȍV HnsffvrRPMu v@@1҉P 9rjD$$]]C(11ɍ&mC}G G$t$] G$uyf fE@$$]讕Ex D$<$]3]C$f$ffs@sU@@Jru9U@}t*JrHUznnJrfM6fy'bUWVS, E׉MT$ MtD$D$ E$73=v(FQ ;Q 8,[^_]D$E$jƅtʋE$A UU܉T$}|$ D$ED$4$FltJUMt@:tOE$Eǃu(EPEǃu E䉃 14$7m,[^_]ËE܉D$ |$BD$4$*ku΋MUD$|$E$觴E=D$E$iƅUWVS։Dž)t Pv9s:ut<:t׃u)u͋[^_]ËrtftƄE$txDžiDžUWVS 茑 Áǃ Ut$Ѽ8/u$U… ${gt$蔼t!4$‹ [^_]Í$at,D$ utD$D$<$/04$t [^_]Í_t$TI/@$wlj($<$uDžD$$Nj$詐OmtQ<$)4$‹4$|$$)t4$$<$t^t 눍Tt wUWVS EEE EUUD$$rtƋM‹E1lj4$itKMUEt81ED$E$1> t' uMȃ[^_]ùȃ[^_]ÍHPEEE[^_]US3 (K Eu[]ÍED$E $9+[]UWVS֋N ufS[^_]Ë~Of JN fJy8VӋ6s!uu [^_]äftuutYyZfUVSD 9Ƌ$׍F$̍F$F@$趍F$諍F $蠍F0$蕍4$荍[^]UWVSӌ ȓ}wu G9r [^_]Ått$$tw[^_]É4$褄UWVS背 pU MuR u+ftO؃tXf;0t&nt(suXDuI 1ۉ[^_]ËEx DC볃UWVS E 0@ Eu Ct8t\tɀ^tăt8uH[^_]ùx1[^_]ÉdUWVS赃 êuNE|F9sXtd|$$ՀtH~NU fFF}t<]fFFF [^_]Ëu1[^_]É<$G{렋}<FUWVS< E@ EE@ 0t$$sM4$rE@E܋uFX1tftE$9u}D$|<$ HM|$E@ $E$/ xDMED$E@${M;UBNju`P0@|$E@ $k$Ep/ Ǎ@ED>D$E@$~Uu$GEE<[^_]ËMAOMփEtfEtǤ$E܉$EP p,@ @(@$@,׃ EtU?Wx0My ɍL L$ T$D$E$$t8}uWfUE$5Ep@@LEMA@AHADALudfx= 111D$ T$L$t$D$ED$ ED$D$E$tam7GED7Mnts{HP|1뉃}t>px111rx@11buE4$.E<[^_]px1113u܉4$֨u8uDMUUu$wEU r}fm몍t$8E0GU7UWVS~ ȅUJEtB9swt$U${Ut]rJ] fBB ]fBxzE:us:u.u'EBB [^_]Ëu1[^_]äftu%u0tۉ4$vU]EfUWVS} ýuVzF9sHtT|$$zt8~VM f FHNMLF [^_]Ëu1[^_]É<$nuUWVSX>} 7ED$,E$} D$|$]_xD$|4$] PU4$]n* = t<$W* = E$]>* = D$$P]xÉE܅F@ t$$<Et E 2t E D$,E$qEN EEEP-E̋EE u<.tjDy@u붋}]5 D$ED$4$]赖ËE8g E E܃x f_EĉUED$ EԉD$E썈tuL$E $@EċUڍwEJЀv)ύ)ȍLD$4$p u [^_]ÿUo §vE=w l]1]UWVS o yvu4$ UT$ D$D$4$I}-?L) RЍ)ЍlGEeE)  IȍE) GE*S)ύɍlD$4$^ u [^_]ÿUWVS4n ÏuufF(}ȉ|$$ t4[^_]É<$C1t9,ufV(4[^_]UWVS7n ,uu  f.7fV Ed.7 4$@V(EfD$FD$ $U诏=UwDE |)ʉM싆t7T$UD$E$nU9sUJM|M))‹FtIT$UD$u4$0U9r4[^_]1$d.7[^_]ËUыU|UVSl sutgF$zmF$omF$dmF $YmF$$NmF,$Cm4$;m9 t 1[^]ǃ il bs @]l Ns @tÍAfffffffUWVS!l slj$U D$$ & Et$UT$U$19UuED$$ r& 1[^_]ÉUED$$ R& $3UD$3UD( UWVSdFk ;r 8EE1EEƍEE> tqE9D$t$U$1Utˋ$2$2UDŽ/( 5Euu ;t1< tHv0FIU$2$1UDŽUWVS<i Øp 8U11ɍˬt6u& E+<ȁ<[^_]Ãu@W@0ƃ:uVƅ/lFu$9$ґ  Ή$k0D$Y0D$D$ D$D$o4$k{qD$@|$/$蔉:tRP:uVpƅz빉1$L/Ή$[2Ή$*/D$/$ /D$2ω$.D$.b$:e$/u$ƅD$/4$U/tY1ɉL$T$/T$T$ L$D$4$tt$uD$$ {B1҉T$T$ L$D$4$/빉ouvFUWVS e ñlu}D$:4$t!D$bT$$` t|$E D$4$, [^_]ËU t考 [^_]UVS 9e .luD$:4$!t!D$bT$$ tE D$4$=  [^]Ud kEwt ]1]ì]UWVShd ÎkEu 8MU1ҍxUED$ uD$D$@U$UUƒE9~ЉEΉ )t$|$ʉUM$*MUӉϋʉU$+uD$+UD! !}|$t$$X*uU+u h[^_]ËEvUWVS`-c "jEM 8U1ҍpUMED$ vD$D$@U$U.UD$$ Z EED$ML$ED$A(;EUT$$ u@" f!^ut$L$$'U+uW`[^_] U$5*ED$&*UEDm UWVS`a hEU 8L$\1ɍpwbtNT$E UD$ T$ vD$D$@T$$T$T$1t>$uT$ U MT$L$$ L$\+u`[^_]øGUWVS ` gExw|Mt_ƃtAkƍU$(ED$(UED [^_]Ãu$(Ɖ [^_]UWVSpW` Dg}EU 8uM1ɋ]p3MmQm8@E~Eߺ81xEM}E )|$t$ʉUM$]M&MUЉ΋ʉU$]P'}D$A'UD !\$T$$]]U+p[^_]ê0f%.t&CD$D$ ]#D$D$@}<$Gj뉉f>~$E~LSC9u1Uf~7g] ];US] dEPw*ӐtV -[]ÃӬu$([]US] ÔdEPw*Ӑt -[]ÃӬuU T$$[]UVS B] 7duD$:4$*t!D$bT$$ tE D$4$ [^]k - [^]UVS \ ÿcuD$:4$t!D$bT$$q tE D$D$4$# [^]ËE D$D$4$ [^]US D\ 9cEMPw*Ӑt - []ÃӬuL$U T$$# []US[ bUBwÐt1[]Ãìu$[]UVS [ ÎbuD$:4$t!D$bT$$@ tE D$4$͎ [^] - [^]fffffffUWVS[ b}E1E xt=1}t ƒu@u[^_]UWVSĀZ Nja}E| 8xƋE, 1@ E0 E|1E]EH Eƒx  EB A ǁE9uʋE%uL P \ EpxEPMHx }1E]uJ˃4x MN K u9uʋ]uE%BzBE9yxE+?1[^_]ËU 1ۍU @t?ELt鸓$I )9uu1믋}@ E1ۍLE0 EEEu1}}}8KtDAuEƃ@E}t,ى%I$))9D E9u }u _]uE^@],1҃DD [ u̓E9uE, a:!@t$EDu۸@u܋} Ƈ ,E}8L8 0u} ] ]E M }~Et M  ЋU 1ҋMDŽ  r1ɉ]] u]U1 L ȉу9uMՉʉ EMU1 L ȃ9uMՉʉ MEE@ttM Љʃ Љ Ѝ Љ ЋU‹ELt 1itEUEEt @FEǀ, ]0UWVSXT [uE EM 8ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE, EEEƃ4x  EF A Eu1E1EE܉}ԉEEƃ4x  NjF A E؃uĉ}EEHEL EEˉuEE܋E؋uu؉EEuuEE]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ ]3 ]3 ]3 3 3! 3" ]3# 1EEԋ$ ]3% ]3& ]3' 3( 3) 3* ]3+ 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u u3 u1E䋼$ u3% E1ljE3 3& 3 3' 3 3( 3! 3) 3" 3* 3# E3+ }m1]E%MɁ ȉEE%MɁ ȉE1E1 EEE0Ãx  NjC A EuċE8upuE+u!1X[^_]ËME 4UWVSPP WE̋uM M 8EЉNjE19$}܍]]ȉ9u<$…E<_t:t< t<:tMAE̍v}ЋU+ZP[^_]ÉUĉ}؋}1D$ D$E؉D$$u+EҀ09uE؉$tEԀ8*sx0iE̍vdEEEEEyD$ D$$<$]g9tD$ )D$|$E؉$Bf}2ae}sha1f}1 }argo}argo}argo}n2d}M̈ _ȍ  MEE Ȁ`QŃ?}<9E ЉEE9uËUċEEԃEM̍ MEM̍M/^Ń?}t}<9U}Ĉ  ڃM4`À@~^뿍^҃?뷀@~Q>Q҃?3}EԉD$4$p< .t&U<:MMEM̍ MME&}n2idN}DEԉD$4$대}EԉD$4$ nEËED$ T$EȉD$}̍ $,EfM ȃ?9K?9K ?9K8EfM ȃ?9K?9K ?9K8CEf?9K ?9K 8CC EEԉD$4$I2}n2i]UWVSK RE 8EEXUэuuUS1r 9uZ9MuߋU$U+u[^_]Ë]~UWVS,1K *RE؋U 8ENjE1Z}uU܍S1MJ 9uMZ9uڋU܉U} D$ D$|$<$uEUZ8uECу9uF9t܋E}U+u,[^_]ø]蝐UWVSDMJ FQU uU 8‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$N @D$$ t@D $9sÁ t׉D$@BD$ <$L$ $?293?!~9.?J9)1?߲9%?+59#?x}9#DžTDžJD$$KD$$K(D$$HP489ȉ )ڋ09<} D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$n$D$$AtD(,481։ 1 <90Dž|Dž@mDž ^DžODž@Dž1RUWVSF LEu 8‹E1D$D$H $TyDžDž4$襌8$u ovt$4$Ɖ$DžD$$8vu[x=uUT$$ D$$p DžDžDž DžDžg|$4$3ptjtmt2$D1U+LĬ[^_]ÍT$$x*tT$$y6OT$$xۋ%t$'v$uDž!t$/v$DžID$$ƉDžDž|Dž[<Hv2BIڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/Ӄ? ЃA! = ЅiD$$?t*D$ a7D$D$p$$A 4$|$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$sD$D$4$sD$D$|4$sD$D$p$s$%D$7vD$@-$UVS? âFuv$sD‰)Ѓ[^]øh`UWVS4g? `FÉED$Kvut$u 4$"u3D$ ED$$EE8$E $]Ch`)‰UE E h`9tt$u+E E܋E$]RNjED$ut$u t$u܉t$ RvD$D$b K E$J t$|$ ML$D$E$_}v/lj|$t$ ED$D$<$/9]uىE D$E܉D$ED$ED$ ]荃[vD$D$b}<$=U^D$O O ȉD$$9EPU9uD$]J J  J ȉD$$EPU@D$D$4$pE4[^_]14[^_]EWfffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSƉEfM䍾}܁H1۹1҉}f;]ǃ? u}19uEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uu9Muƃ[^_]ÉǻLUWVS8 ~?9ɍL  dH USEEԋ} 8E؉‹E1}  D$E܉D$<$ƋE988"11}M7tuB:7uMЋu$2a$L$ fvD$D$F$'F1M؋U+uF4[^_]ùqgJ|UWVS L6 A= 8E1ED$ D$D$ u4${t$D$K 4$HtU+u [^_]1|UWVS5 ¿<HE@E 84֋U1EOrphEeanBEeholEderSEcryDEoubtx2CP$Pa-xƅ?a$G$H‰,8w4$@?W8G`EȉDËH̾Fxp tct^f Ј9`tFFx>Hlf`TEPƋ@D1\f;`6 uދ\19u111ۍhXdLD1` Ѐtfu Ѐu拕`1Љd1f< Ȁu1hXLTdPhxP9GTP0`DP1\f? uዽ\1Љd1fH Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@D98uԋX1ɉ`T1f|=؃ u9uѻ@TXO9uu⋽`E؉`]BbJ9uߋHfǂK $2?ƂK aHK ƄK $,T$ fvT$D$$7D4$`D$HD$T$c14U+u{[^_]Íxƅ??tOlEȉDRHuUWVS/ u6u(}  8E14$$?$u 1H$9u勅)ȉx  @4$+$D$(|$4$D$mvD$4$kT$|$4$O}<$$D$(L$<$(T$T$<$ $D$(L$<$|$0, $ $lj~T$,D$4$Dž0Dž4Dž8Dž<$,D$4$Wt&D$uڋ(D$4$1uڋfǃLL $1ƃNL $ D$D$OL $ OD$xovD$ B$Ot$,$1s$D$(D$<$ ɋ D$,D$<$d|$,$B<$ʉ)Ѹ%I$))Љ)‰ :D$,D$<$ ɋuo$D$(D$<$9$D$(D$<$ D$D$<$Z $D$(D$<$3p D$D$<$  ?LL ,L D$06 < ȉD$$,L ,L D$17 = ȉD$$=,L ,L D$28 > ȉD$$,L ,L D$39 ? ȉD$$,L ,L D$4: 5 ȉD$$w,L ,L D$;T$$M,L P,L @D$D$,$&]E+[^_]À$')MDž0Dž4Dž8Dž<Dž Dž Dž(oUWVS( /MMUu 8ƋE1@Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\E[1ۍT009u$ND$@|$<$豣E D$D$<$蘣|$$¥<$D$@t$<$jD$t$<$P|$4$耥E+[^_]Éu4$莢UT$L$4$t$4$Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TkfUWVS$ +utJD$ED$4$'NjE9t.8u)8"tE 81[^_]Ãu1UVSk$ T+EU ]~Í у? H9u[^]UVS,$ +EU ]~Íу? H9u[^]ffffffUWVS8# *ƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$t8[^_]É<$5uEĉ|$4$Eă8[^_]U,# *Et t&t1]ËM t6zv]ËE tv]ËE tqv]Ív]Í/v]Í'v]UWVS" ï)u} 4$9uw[^_][^_]UWVSdr" g)u}$}(E($mEEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$a…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$ <$"UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$)8UtE(D$}<$} E0D$E,$k <$!jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVS $u4$xu1҉[^][^]UVS ó$u4$@u[^][^]UVS x$u4$u[^]}[^]UWVSG <$}u <$ …uA}wLU>…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSX û#M $NƉEE$ljE4$ƉEE EEEED$ML$}<$1t.1EM $M $4$EX[^_]ËuE$2EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVST I"}u <$ …u8T…u+t"11U2 у9uUɃy Ѓ[^_]úUWVS !}u <$b …u=…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSm b!}u <$ …u=h…u+t"11U2 у9uUɃy Ѓ[^_]úU E##+Pፂv]Í$]Í4 ]Íl ]Ív]Í x]Í#x]Í6x]ÍGx]Í ]Í8 ]Íl ]Íw]Í ]Í ]Í ]Í ]Ív]Ív]Ív]Ív]Íw]Íw]Í3w]ÍOw]Ícw]Ívw]Íw]Íw]Íw]Íw]Íw]Í ]ÍYx]Íix]Íyx]Íx]UWVS  ÜEwrE$c5NjE $V5ƋE$I5E|7E$ 5EU׋E$4ƋE$ 5 [^_]Ãu$tffffUS  U T$D$U$sK []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVS]u 1ɋ΋T11Tu[^]UVS u Ee…t5҅u.URу+?҃/ [^]UWVS É։ϋMER)Ѓt$9uuE [^_]ÃEE9sDE11փE? كCwʋE9EuljUt)?UZsEE9rEE [^_]UWVSEUEEEEM4u}Ov(}W];;}}UM0~^z) ҍ^!ڻZ) ! ڍ~л9) Ӄ! ˃+Ӄ>΃/փ? ҃A! ځ}w ҅Uu}M[^_]1[^_]UWVSE0 wG׉1w7  r-у0 v9t}0t ؃[^_]Ã9t1ۉ؃[^_]UWVS ßu} FEFED$E$O?$ug$ED$EUT$<$/u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=u}tUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSX }EE 8UE1D$E$wƋẺ$-E+} f$OME Eĉ4$U9PMMȃ/MU)ƒ$v=yM}BEŰB8D$2YUĉT$ D$D$u҉uȉ4$J4$n‹E9\BPBMыE)Ѓ+$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$I4$9M@}uȃoMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$H4$\‹E9JBacMыE)Ѓ,p=yM}EŰB0D$UĉT$ D$D$uȉ4$mH4$Փ‹E9BEЋM)уf$xqE̋H@$i)ƉZf$E̋0QG}̋O $N1}E+/EX[^_]Ë}ȤA}f}ȃ0f0ft&"ffvE}}qM^rEM)M(W}ȃ}f}ȃE҈AyuӉfE҈AyuӉfE҈AyuӉ fE҈AyuӉ$fE)UMR)уtu]UVSU ṽщcw[^]ffffUWVS |$`Ѝ$$X03ps$X$\2z9uً$XA$\A$`A $dA$hA$lA$pA$tA $xA$$|A($A,$A0$A4$A8$A<$A@QD5т歁RQ$$AHQL5l>+h$$APQT5kAكD$ T$$AXQ\5y!~[D$pT$t$X$\D$PT$T$x$|$`$dD$@T$D$$$$$h$lD$(T$,$$D$xT$|$p$tD$T$$$D$hT$lD$`T$D$06_D$4:OD$8+D$ $D$PT$T$X$\D$pT$t$$D$8T$<$$$$$$D$@T$D$`$d$$$$D$0T$4$$D$xT$|$$D$(T$,$h$l$$$$D$HT$L$$D$hT$l$$D$T$$p$tD$ T$$$$D$XT$\$$$x$|ȍ$$X3J3Z3 3ZX9ue[^_]UWVS]u {@1ɼCg jC;ʄC gC+Crn+C,hC0kAC4كC8y!~C<[ڍ~@M]u 01pq]u11r9u]u 1[^_]êCf8fUWVSL uE 8U1҅P?EEEEEEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$tFXF\FPFT UWVS]Es8U -ST SP!<}J`)ЉE< u zeSC@SDC@SD1EU19EsH{LS`#ǃE}} =%M ȉEC@SDEUC@SD1U9иEs11sH{LʉMM逋E)=w}U `< u s,uu1[^_]äftuauit11t&fuUu<oҹ`^PffE pE땸+UWVS[ Tlj(UE u 8, M1ɅH?fM?W0E1Dž2Dž6Dž:Dž>0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$$&$p 1߃}rMEuQEuHD$\$$$D$$(e1,U+[^_]äfEtD$$$($tBXB\BPBTD$$D$$$Ǽ$t맋(`UWVS\ ML$} 8D$‹D$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$T΋9EAT AP1F@VDF@VD1FHVL%t$FPFT)ȍT`D$D$$^V`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$~n!D$0 n"D$0 wn!D$06 Yn"D$0;n!D$0f n!D$0Hm!D$0* m!D$0 6m!D$06@ m!D$0Im!D$0 im"D$0qKm!D$0v, -m!D$0Xam"D$0:bl!D$0l!D$0|l!D$0gl!D$0Nyl"D$0[l!D$0=l!D$0h6l!D$0Jl!D$0,k!D$0k!D$0k!D$0,k!D$0mkk!D$0Mk"D$0x /k!D$0Zk!D$0<3yR"yj"D$0j"D$0j"D$0j"D$0j"D$0j"D$0oj"D$0[j"D$0Gj"D$0r3j"D$0^j"D$0JzAكԽ\$02كԽJكܽzzكܽ\$0@-t$D$$5t$ D$D${$2\@-D$ D$D$ {$28@-D$ D$D$y$x2R@-D$ D$D$z$F2@-D$ D$D$y$2@-D$ D$D$nz$1vh!D$0@-D$ D$D$y$1M@-D$ D$D$"z$o1g@-D$ D$D$y$=1a@-D$ D$D$y$ 1@-t$D$$!t$ D$D${$0 @-D$ D$D$y$0@-D$ D$D$y$d0@-D$ D$ D$ $20@-D$ D$D$z$04@-D$ D$D$z$/l@-D$ D$D$z$/@-t$D$$貲t$ D$D${$Y/o@-D$ D$D$3z$'/e!D$0@-D$ D$D$z$.5@-D$ D$D$Yz$.@-D$ D$D$y$}.@-D$ D$D$z$K.@-D$ D$D$z$.]@-t$D$$/t$ D$D${$-@-D$ D$D$y$-@-D$ D$D$.{$r-@-D$ D$D$@{$@-@-D$ D$D$Fz$-@-t$D$$$t$ D$D${$,@-t$D$$t$ D$D${$,@-D$ D$D$z$V,ffffD$1ffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVS< %]E81}8CC twS(s$tbD$D$$ЉƅtpC@8@4?E D$$tEt$S($S$CE[^]K$C C(1uиɸUED$ E D$D$E$]UVSEM tYX tRP$tKPtD;u@B-4?w3t)x6(r@1 w#EB?EEEpD$D$$]}}GU܉B0G??E VEX}E؉mE؋E@N?EX څ}wOE ]UԋuM؉]]BƃvUԋU]uM؋]EȋM)ȋuFMA :E@O?EЉEEE_ E}M̍}WPGX WTG\GG?} mmEԋE@H?}uЁxE܋UĉP pUԉxuUVߋuԃItftE@t E@ \ )UUԋEHDM)щHDE@uFDF:?9EP UR$tB1ҋ}G9?E@;}W$tB}GDG;?}wCE@Uԋ]uMBƃvUԉ]uM؋}EG< }E̍%XU܉BE@Q?UBD?mmEԃ} wCEUԋ]uMBƃ vUԉ]uM؋}]SdCh s`}mw ) }E̍ U܉BE@Q?Uԉ]uM؋}uȋE)} 老B??or]ԉu}벋Et1] 9uE|0C$tH$MtKD;H(s ACDEuEP)uuԉ E@??E21] 9uEE|0C$tHMtKD;H s ACDEuEP )uuԉiUԉ]uMUԉ]uM؋}uȋE)}ԉ]u}W4])Ëw89)W,ƋEPD9sȋ}9s)E)‹]SD}9u}ċEPD @E@R?E&А{9UsBE]ԋu}MCǃ9r]ԉu}MظЋ}!]CDCD})U:f*EEE@P?uȋE)EJ c M)ȋ]]]MYl]ftYt]9]U}E؋UMyQ?x ft }E̍ U܉BAQ?EE1UċuЅ2 E}GDuGH?Uu ЉEE!ȉp@U9Us|E5]ԋuU؉}}xCǃE!MMȋMMHfM@M9r]]؉uu}U؋Um})}؋M}v]ԉu}EǀXPHX׋E!Hp9Es_UԋM؉}؉]]ZBE}E!u4E~v9rĉUU]M؉]m)E؋]艃sD 3Eǀ@??Mu)ƋE@D9E@#E@ u}UU1Ez@ t$EԉD$UB$]#cUB)uuԅ=REǀXPHX׋E!Hp9EMUԉ]E@`E@ 9t$EԉD$UB$]ybUB)uuԅR"EpHXL@K?9]sB}^Uԋu}MBǃ9rUԉu}MظЋU!Ћ}GHU)]m)E؋U艂rDE@M?U4}wC}]ԋu}MCǃv]ԉu}M؋Et }@$t@0NEB))9E}E̍%XU܉BE@Q?}/]ԉU-}E̍T{EPD@B?} EEUԉu@}E̍'|]܉CE@Q?QqItDUЋ])ڋ]ډD$T$ $]̅`EHU܉J0X xEpEu99E̍w|U܉BE@Q?EЉEE}U̍{M܉QUBQ?mmE9s55]ԉƉȉs9r]ԉȋ]M)؃1u]M؃w-E̍Y&]fDSt9uE@lu荆4FpFPFXD$FXD$FpD$ D$FtD$$]n}{]܉CFQ?]ԉu}UT$UEԉD$}G$]F^GUzU}E؋}uȋE)BEԉu]?EED$ED$}G$]]G7}E̍m{]܉CE@Q?} ։uU! yf}q<9}swU}]]؉EEIPUuU!Muu4NfMvM9rEԉ}ω]؋E]M)ȉ])E؋M艹EAD<"E@l@E?1EPL@I?]K9s5\]ԉƉȉs9r]ԉȋ])؋MF]tKrM}uMEE@G?} }uȋE)EEP$t EEt E@ E@6?EEfvPjEfED$ED$}G$]c[GGEE}UUԋuȋE)EE>Eԉ}]>@ WlaE@l@F?1E܋UĉP UЉPUԉUPEUPuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS ;} 0}u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$q\ML$M L$$[\9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$6| /Eԋuu 8E܉NjEEFE~@@}S?}GS?wH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃUEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]fffUWVSt {E}Mx11 rtE xfDU9uEExfG0UofxZUWVS4Ye Fl}̉ÉEЋ@,E܋{t-Ek@^S,s@JBBF|FlF\FtdžFxF`FhFH [^_]US]t+S t$C$tuSzu M J[]ø[]UWVS]} ut:S t3C$t,u!tSRt S[^_]ø[^_]UWVSUJ NQE]S C$fu{{} G9rrU )9~։U #Ef 󉟼<$]?}U )uU E [^_]E E [^_]E US]tDS t=C$t6…u)CM MMMH|[]ú[]UWVS}] DЉ ЉECEtƉ ƉugWBteJ0zPt9r[^_]Ãu߉ MʉЃ[^_]ËE9rX[^_]ËztfGtiGOt )|uO$t )|uO,]U뤃zl =uR+UWVS4G NE܋EE؅Y} OE@EEP &PE@=u~uN(] ^(v=* EPA@qE@ EM$  @M L$M $MPct'} fN}  E;EXu E@(E؃4[^_]ËE` -@MAEЃ} n] ۍ ~ 9=EHE@Extu nx} WEPEH0uFXFu ^EH0VFX^,EH2VFX^ EH3VFX^ EHVFX^ EHVFX^,EH VFX^ EH VFX^ EMA~؉AE@Ee]C0E _E@lt B))ЃuNVZ^$NVZ^Fl6D$D$$] $MA0]CqCE@9ZD$D$$]MA0uVFHNVFHNVFHNVGB,JA:Zȋr$}_OqwЈ GHWGX_ GHWGX_,GHWGX_ GHWGX_    uNFX^FH VFX^ Vzt*JVFX^ FHVFX^,VZ, E@ @E=}  VFHNVFHNVFHNVFHNVFHN   uNFX^VFHNFqE|~@FEtsIk[M gE@@, E7EXۋE@I} ?E` -@MAEEPJ]{}s B)E[ ]9kUotftB BJI,t 9E EB UEUBGMu)M]z }JIr 9EE])ZE߉΃tSEi uE@0NVZ^NVZ^EP0NFX^4NFX^tM)ȉD$BȉUԉD$E@0$]MA0UE]ڋE}x΃Ntft]MKKSB,E@ E@IBuN&ZV z~ ^x~t4FV9F uՋz,t9EFnV1묋EPZ,t @9E@ E@[J$ uN*Z$V z~ ^x~FV9F uыR,t9ruEFV1묋MAhE D$E$0Pb)ȉD$NL$E@0$]MA0)ȉD$NL$E@0$]MA0b W]C@,C9CgB,MAgtsE@P]9S sECMI0uVX^ EH0VFX^,D$D$$]+MA0uFqEFjfmEK1ϋGtG`W8GlZZZfGtGtOlQWl9p_t^M }Eǀ} (M7A\Yl])…A8D$ T$D$u4$]3FlF\M@G\)…x9G8t$ T$D$<$]O3GlG\ P1ƋEPu^VFX^ EP0NFX^4NFX^E(E}E(G`GlO8MtMLU:QMZZZfotGl9_tS_t=E qG`GlO8M;9MhE)L$CD$E@0$]MA0V7D$ D$D$E$]U.} HEEP~@B)ȉD$uNL$E@0$]2MA0V<)ȉD$uNL$E@0$]MA0F@,L:Q1:Q(U썔UЉ}]]׋UI:Y:Y:Y:Y:Y:Y:9~:Yt}]ԉUU)сO`9_`ٍAZZZMff G`)GtGlG`9xG\Wl)…G8D$ T$D$<$]]/GlG\@E<EuFD$FD$E@0$]MA0VK1FEǀ} `MA\qlu)…A8D$ T$D$u4$]`.FlF\pEPE$],5'uFDVLfDPTT$D$$]Nt[FlF\dž>ɀ @\Yl])…A8D$ T$D$u4$]x-FlF\4@u FE@@\Yl])…x?A8D$ T$D$u4$]-FlF\1n1N1w1fEP}]ԉU}]ԉUt}]ԉUc}]ԉUR}]ԉUA}]ԉU0}]ԉUUWVSz4 o;} EJEqEp3 Y}OE@ M苔M9~(uaE9tF}LDDF|EE[^_]D$E$E@FtFl9F\EXYtYVDFLfDBDD$D$$dž   9TE,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS 2  9EuE EM}EEEEE U$o81f8]vEFF ^$}uEEG} }UD$D$F($V ÅUF0@*P@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]A|A13u3 eEF$EF F( [^_]øCE` -@F4$}U ED$ED$D$D$D$ D$E D$E$]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@ CL{DMqD-{uvuju^CMQ+QS $ | 0 E[^_]älfb.t&ft.t&`fV&ft&fu5AfY{8f3f+0f(-f%*$ E1E%* 1UWVS8* 1EȋM }׃}TuĉU 2A3؃u߉߉UθEEEE]ȍỦuEʋ1E؋u3ruԋM3JMЋ}3z }}3z}܃<EEEEE܋EU U҉3tRET  }9`U릋}>X8Xr‰]f9]s‹EƋE܉D [^_]ËEX8Xrf}U냉E܉D [^_]UWVSLÉ֋EЋJ9}A EǃPǃT=1E1M̉ыU"P\ ƄXE9tf<ufD9uM̃YẺMM}ȉuK}11҃P\ fƄXU)‹}}t T7)t4}뤉MMuEFM̉uȋuЉuM̋uȋPM}̉uu9B3XEfpfq~` UЉv}` UămẺP` ` }Љ6` MȋTMEUĉX MTMȉT Ѝ UȍUffXEX8*%MuET` Eȋ}P FE̋AEAEAEč< 1mu1 9r EЋ}fD}<ET PEE]<)ދ]4 ]EtD9}7]Ѝ DD]9}EfA9u|‹]fC< ]9{11uK: fNuExBuЍ|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]ȋ}tEčPUȍ4C: fEȉC< ftfC< fK< f< Uą$=uS< }ȅt>uă\ 9M|uЍ<L9t)fWmuȋuĉ뤋MċEcȪf1E*ȪfUWVS ERfDHDE1E69t*9}tuf| 1]9Mt>9|9}6}f| tK9U19Muƒ [^_]Åt49]t Ef| Ef u1]z E$f u$1ENf t1E*]1UWVS BE%Z]\ ]1һ}܉fMMc9t|~ | Uf UU)9fGHOOGPWW )UUDu  ډU ʹ)9fGHOOGPWW )ڍL0~E fOWZ_WGX_ )fEu99E1EM9MUUUUVU9D$U:^NjFD$U$0tE 8Q [^_]1 [^_]UWVS â}GtUD$U]ƋGD$U$0t+4$P=yarauE 0ܺ [^_]É4$r1 [^_]UWVS 0 %}GtUD$UW]ƋGD$U$0t+4$Ӥ=tciduE 0_ [^_]É4$1 [^_]UWVS èED$E D$E$UtSEt4}D<$\ƋED$<$/tE01[^_]ѹ[^_]蹹[^_]UVS ut$E D$E$œt.yaraUFƅu [^][0[^]K0[^]UVS æut$E D$E$St.tcidUƅu [^]0[^]ܸ0[^]UEU E MMM] UEU E tcidMMM]UVS E D$E$vƉ$Ǣ=tciduE0[^]1[^]UVS éE D$E$EvƉ$w=loobt 1[^]É4$ŊU[^]UWVS [ PE$ډt,ƉD$E D$E$vlj4$M [^_]1 [^_]US E D$E$uUT$$dA[]US ýE D$E$YuUT$$A[]US ÄE D$E$ uUT$$A[]USV KE D$E$tUT$$)B[]US E D$E$tUT$$WB[]US E D$E$utUT$$`B[]US àE D$E$8t,ƉD$E D$E$`olj4$( [^_]1 [^_]UWVS E$D$7t,ƉD$E D$E$nlj4$ŗ [^_]1 [^_]UWVS w lE$D$y7t,ƉD$E D$E$nlj4$c [^_]1 [^_]UWVS  EU$T$7t,ƉD$E D$E$9nlj4$ [^_]1 [^_]UWVS èE$D$6t,ƉD$E D$E$mlj4$蝖 [^_]1 [^_]UWVS O DE$D$6t,ƉD$E D$E$qmlj4$9 [^_]1 [^_]UWVS E$D$66t,ƉD$E D$E$mlj4$֕ [^_]1 [^_]UWVS }E$D$5t,ƉD$E D$E$llj4$s [^_]1 [^_]UWVS % EU$T$q5t,ƉD$E D$E$Illj4$ [^_]1 [^_]UWVS øE$D$5t,ƉD$E D$E$klj4$讔 [^_]1 [^_]UWVS ` UE$D$4t,ƉD$E D$E$klj4$J [^_]1 [^_]UWVS E$D$F4t,ƉD$E D$E$klj4$ [^_]1 [^_]UWVS ÍE$D$3t,ƉD$E D$E$jlj4$胓 [^_]1 [^_]UWVS 5 *EU$T$3t,ƉD$E D$E$Yjlj4$! [^_]1 [^_]UVS E D$E$eiƉ$藕=gntst 1[^]É4$'tU[^]UWVS w lE$'%t,ƉD$E D$E$ilj4$j [^_]1 [^_]UWVS  E$$t,ƉD$E D$E$Gilj4$ [^_]1 [^_]UVS ÷E D$E$ShƉ$腔=atadt 1[^]É4$vtUEt 4$vM[^]UWVS Q FED$E$tt,ƉD$E D$E$uhlj4$= [^_]1 [^_]UWVS ED$E$4ut,ƉD$E D$E$hlj4$ې [^_]1 [^_]UWVS ÂE D$E$gƉ$P=gntst 1[^_]É4$$P$U`DžtڋUT$D$4$$t U:[^_]É<$UVS E D$E$fƉ$ƒ=gntst 1[^]É4$A$tU[^]UWVS ÛE$V"t,ƉD$E D$E$flj4$虏 [^_]1 [^_]UWVS K @E$$"t,ƉD$E D$E$vflj4$> [^_]1 [^_]UWVS ut*t$E D$E$%flj4$ [^_]1 [^_]UVS ÕE D$E$ʉƉ$c=loobt 1[^]É4$yU[^]UWVS G <E$xt,ƉD$E D$E$lj4$9 [^_]1 [^_]UWVS E $jxt%ƉD$E$蟊lj4$[^_]1[^_]US ÍE D$E$ˆUT$$/[]US_ TE D$E$艈UT$$F0[]US& E D$E$PUT$$0[]US E D$E$UT$$0[]US éE D$E$އUT$$0[]US{ pE D$E$襇UT$$0[]USB 7E D$E$lUT$$%1[]US E D$E$3UT$$p1[]US E D$E$UT$$1[]US ÌE D$E$UT$$1[]US^ SE D$E$舆UT$$1[]US% E D$E$OUT$$1[]US E D$E$UT$$ 2[]US èE D$E$݅UT$$ 2[]USz oE D$E$褅UT$$2[]USA 6E D$E$kUT$$2[]US E D$E$2UT$$2[]US E D$E$UT$$$2[]US ËE D$E$UT$$12[]US] RE D$E$臄UT$$22[]UWVS " E$D$#)t,ƉD$E D$E$lj4$ [^_]1 [^_]UWVS ôE $D$(t%ƉD$E$llj4$豈[^_]1[^_]UWVS c XE$D$d(t,ƉD$E D$E$lj4$N [^_]1 [^_]UWVS E $D$(t%ƉD$E$譄lj4$[^_]1[^_]UWVS ÙE$D$'t,ƉD$E D$E$Clj4$萇 [^_]1 [^_]UWVSB 7E $D$D't%ƉD$E$lj4$5[^_]1[^_]UWVS E$D$&t,ƉD$E D$E$膂lj4$ӆ [^_]1 [^_]UWVS zE $D$&t%ƉD$E$3lj4$x[^_]1[^_]UWVS * EU$T$,&t,ƉD$E D$E$Ɂlj4$ [^_]1 [^_]UWVS ýE U$T$%t%ƉD$E$vlj4$軅[^_]1[^_]UWVS m bE$D$o%t,ƉD$E D$E$ lj4$Y [^_]1 [^_]UWVS E $D$ %t%ƉD$E$蹁lj4$[^_]1[^_]UWVS åE$D$$t,ƉD$E D$E$Nlj4$蛄 [^_]1 [^_]UWVSM BE $D$N$t%ƉD$E$lj4$?[^_]1[^_]UWVS E$D$#t,ƉD$E D$E$lj4$܃ [^_]1 [^_]UWVS ÃE $D$#t%ƉD$E$;lj4$考[^_]1[^_]UWVS 2 'E$D$4#t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVS E $D$"t%ƉD$E$~lj4$Â[^_]1[^_]UWVS u jEU$T$w"t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVS E U$T$"t%ƉD$E$~lj4$[^_]1[^_]UWVS íE$D$"t,ƉD$E D$E$U}lj4$袁 [^_]1 [^_]UWVST IE $D$!t%ƉD$E$~lj4$E[^_]1[^_]UWVS E$D$A!t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVS ÈE $D$ t%ƉD$E$?}lj4$脀[^_]1[^_]UWVS 6 +E$D$ t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVS E $D$ t%ƉD$E$|lj4$[^_]1[^_]UWVS w lE$D$t,ƉD$E D$E${lj4$b [^_]1 [^_]UWVS E $D$_t%ƉD$E${lj4$[^_]1[^_]UWVS íEU$T$t,ƉD$E D$E$Wzlj4$~ [^_]1 [^_]UWVSV KE U$T$t%ƉD$E${lj4$I~[^_]1[^_]UWVS E$D$Ft,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS ÍE $D$t%ƉD$E$Ezlj4$}[^_]1[^_]UWVS < 1E$D$t,ƉD$E D$E$xlj4$&} [^_]1 [^_]UWVS E $D$"t%ƉD$E$ylj4$|[^_]1[^_]UWVS { pE$D$t,ƉD$E D$E$xlj4$e| [^_]1 [^_]UWVS E $D$at%ƉD$E$xlj4$|[^_]1[^_]UWVS ïE$D$t,ƉD$E D$E$Xwlj4${ [^_]1 [^_]UWVSW LE $D$t%ƉD$E$xlj4$I{[^_]1[^_]UWVS EU$T$Gt,ƉD$E D$E$vlj4$z [^_]1 [^_]UWVS ÎE U$T$t%ƉD$E$Gwlj4$z[^_]1[^_]UVS? 4E D$E$iuƉ$}=gntst 1[^]É4$}tU[^]UWVS E$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS |E $7 t%ƉD$E$FtAD$$UaU [^_]H4$l [^_]1 [^_]ÍAUWVS  utJ 9u@~ G$…t,Ft/D$$U`U [^_]1 [^_]ÍAU Et 9t1]Ë@ ]U uEt 9uP@tt ]1҉]ÍA]US< 1Et 9t1[]ËU tH Q9Ur@tD$E $`[]ÍAU Et 9t1]Ë@]UWVS Ü}t; 9u1G $螽ƅtGt"D$4$_[^_]1[^_]ÍAUG 8Et 9u @t]1]ÍA]UWVS ut 9t 1[^_]ËU tM 9uFtA F EP$UؼDžtŋE HɋUtOFt@L$D$ TD$T$<$cF~}~ t$sA븍AUWVSD 9ut 9t 1[^_]ËE FtE $qF EH $M…tFMtI} |$D$ TD$L$$U&cFUV}~ t$IoA믍J}D$ `D$D$;4 $zUS\ QEt 9t1[]ËM tM 9uL$$)mUS Et 9t1[]Ë@tU T$$r[]ÍAUS öEt 9t1[]Ë@tU T$$-r[]ÍAUSm bEU tG 9u=t99 u5Rt@tT$$q[]ÍA@uፃAٸfUS Et. 9u$@tU T$$wq[]ÍAfUWVS èu~(Ft  [^_]D$ED$ D$D$4$1tȋUBU$lDžtFD$ED$ UT$|$4$t}M9Muu>uyF8"udF1M Z$ ƅt' D$4$eFF FE 0 [^_]É<$ED$,fD$4$ctՋMofffUVSUE 9t4J2Ht"JZxPx3H3X1 [^]1[^]ø[^]US :D$ $L $蠍[]USٿ L $z[]UWVS4豿 æM EpAQAtp]}D$ T$L$D$ uԉ4$^D$|$E$ipt2t$E$5mt|$E$^q4[^_]Í14[^_]ÉD$ T$*D$D$ uԉ4$D^y D$ D$D$ $uUVS衾 ÖE 0t$ M $\4$!1[^]USg \D$L $ƋLD$ M $1[]UWVS lj։M{ML$ED$G$YWVEU9ErfEG[^_]-{8"u1UWVS蔽 Élj։M{ML$ED$G$˥V!ЃtNEG[^_]z8"u1UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS谼 åƍ:D$ $XL <$7t$ M E$ t $E4a<$ UЃ[^_]ÉE<$$ NUt֍lD$ $M`MAFAFA<$證t$E$Mt+$E`<$脉M $iUЃ[^_]ÉL$ME$M9uE<$HUЃ[^_]Íd}D$ (D$D$M $rUVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS= 2utl9u4$^[^]1[^]UE@]UWVS Et l9t1[^_]@t9H@1һ9ˉr|9[^_]ËP@Ӂw?Ӂ19ωr-9[^_]ø@[ QU& Et l9t11]ËP@]U Et l9t11]ËP@]U̸ ½Et l9t11]ËP@]U蟸 Et l9t11]ËP@]UVSm ^Et l9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVS ھEt l9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUSh YEt l9t1[]ËHX@uȉwދE []ËHP9ȸsUS Et l9t1[]ËHX@uȉwދE []ËHP9ȸsU蛶 ŒEt l9t1]ËHP@txE P]USX IEt l9t1[]ËHX@uȉwދE []ËHP9ȸsUVS ޼Et l9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVSi ZEt l9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS ٻEt l9t1[]ËHX@uȉwދE []ËHP9ȸsU肴 sEt l9t1]ËHP@txE P]U@ 1Et l9t1]ËPH9иrE ]U Et l9t1]ËPH9иrE f]U赳 ¦Et l9t1]ËHPwE ]U{ lEt l9t1]ËHPwE ]UA 2Et l9t1]ËHP@uxE P]U Et l9t1]ËHPwE ]UŲ ¶Et l9t1]ËPH9иrE ]U耲 qEt l9t1]ËPH9иrE f]U: +Et l9t1]ËHPwE ]U Et l9t1]ËHP@uxE P]US趱 ëEt l9t1[]ËM tM 9uL$$[Uw hEt l9t1]@tHxUxU M3P3H ]U+ Et l9t1]@tHxUxU M3P3H ]USް ϷEt l9t1[]ËHX@u xExȉ3E 3U []US萰 Et l9t1[]ËHX@u xExȉ3E 3U []UWVSA .]1ɍuEEESt [^_]À{(uSU-tn+ti0u UzxtmMMti;t D$oD$$~tU [^_]ù RAu_Uu>fUWVSP. #<$evH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$)fuP[^_]Ét$D$$_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$GeuP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPw W ӍPЀ w 0 1UWVS<豬 æ4$}cB BBB$BBB(B8O)Bf^.t{BDžT$T$4$Є\?D$D$ D$|$4$D$D$ D$|$4$Jcut)B wB8|<[^_]ÿ"[upBSxauZxluTxsuNxeuHxBJB(zxru"xuuxeux̃+)D$D$ |$D$4$D$D$ D$D$4$bu1<[^_]ÍHJx"t%>WlhBB(>Wуzc<$N1USEJv[]ÉuUS U JE ;Et1 []ÉD$ED$E$ []UWVS ]u}E E $V‹FUJv<F H!uix-x-PVHt|B-ttlB-u<-uz>tBFv1RU/}u*}~,Fǀ  *fu1[^_]À/t>t t  ủ)N] t9uʉT$D$E $]bu?/ F(<>tt uHvf~ t{ lqG u\.x$E]n}D$ D$D$( $!^ t=u)Vx"xPV HЀ"u c"tXuEF(>FFF F$GFV1u)щN$x><UWVS0" EEu }8X1t9s]<<{<&uKatAlt,gt{qu({uu"{ou{tu{;u"례{tt;10[^_]Kmpu{ouހ{su؀{;u҃'`{;u<M{tu{;u>4EMMt<".E<\tdMt&ȋM)]9t 9rD]6U멀{p'{;CEt)<>tuE${p(r EpD$}t$$t}(u GtXtA1(u~u EpENjE$[^_]Á8versuxsionuE tE E D$E D$}<$t}DžmD$t$E$z<$D1k~WIUD$E$m]UWVS艟 ~$Xlp$~thD$D$E$zfp0xD$p$c8$MЋEԉhl!tW91!ȉh! D$D$p|$D$ D$T$p$Ƌt0<$fplD$T$4$KkE D$4$NjtPD$T$p4$kpT$4$-t$裞Ĭ[^_]ËlЉhdD$D$p|$D$ D$D$$Ƌt0<$ehD$T$p4$ajD$D$D$D$ D$lD$p$vptdtAT$4$t$葝1p$dt$n1UD$E$]fffUE 9E]UWVS耜 uƅtBD$$蠘Et E$@cDžMu% $ۜ1\$@BDžtED$<$@D$G$?kEG,w0G4G8G<[^_]US õM $ai[]US蚛 Ï]D$,$DlM $#i[]US\ QD$M $hD$8M $1[]US ED$E $J[]US ܡED$E $jJ[]US跚 ìE$(jE $j[]UWVS(聚 vUM܋p4@,EEGEt@E<E t}D$ ,D$D$ $KUWVS耔 uuFt09u&x<$cƉ<$c[^_]Í D$ D$D$ $RKUWVS Ƅt1fƅtptC[^_]ÉUx<$Uc1ɋU5ƅtpt<$4c[^_]ÍD$ D$D$ $JUSo dE xt"D$ D$E$C[]Í}D$ @D$D$  $PJUS UB4tB4R,…t8$ 8[]Í}D$ D$D$ $I}D$ D$D$ $IUWVS4x mUM@8t 14[^_]ÉƉ׍@E$aMt9pE}<$6Ex4$C7E$a4[^_]Í]D$,$bM ljE؉$_UT$8M Mԉ $\E܅$6<$V_V09V4E$`6N4F,E؋U<}Nj2UЉMԃD$E$@MԋU|A)D$|$E؍D$EF,}܉8MHF4F<E؉$^E${>E܃,}<}ܜ$ĈEMD$ $I5}|$MA$*EU܉PU؉$^|$}ԉ<$E܅$5U؉$]E@,vF~D$ hD$D$\ $FD$ (D$D$ $EUWVS蠎 Õ}Gp4$^Gt'9uG@u1<$\0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PUUE܉4$<E܅UT$ D$4$3~D$4$<4$<U܋T$4$P tEO49H1gEq<$@[D$4$>Ɖ0[^_]Ë}4$(<E$5mD$4$v9n}э D$ D$D$ $uB}E$l5n 4$;EԉD$4$J=~D$ D$D$ $BUVSʊ ÿE 0t$8M $F,v Ƌ@$F8,uUB딍@D$ D$D$  $>1UE]UWVS3 (U9z<$VUB4pEthUJ4tR1}Ǎ ΉMr,Uv$E+4$+EMH,EqUJ49r}uN4B8F8<$ VE[^_]EE[^_]Uc TEt9u$t`8]1]UWVS u~<$UF8uF8<$|U[^_]UWVS ֌ut 9t 1[^_]Í~<$8Uv4<$-U[^_]UWVS萅 Åut 9t 1[^_]Í~<$TE 9F0r<$T[^_]ɉUWVS( u~<$TƉ<$T[^_]UWVS uth9u^F4$_"EFE$=TF4tD1;~4s8F,D$E$k&uߋE$TE$)E E$SE[^_]UWVSI >utB9Uu5~<$SU9u/U Ɖ<$S[^_]1[^_]1US ֊EU t$9ut9 u 1[]1[]UVS蛃 ÐEu Mt 9t 1[^]ËP49P0r [^]@D$ D$D$  $r:UVS) EU ut 9t 1[^]Åt9 uH49H0r [^]W@D$ D$D$  $9UWVS,襂 Úut 9t,[^_]Í~<$RF8t<$Q,[^_]ÍMU tߋUUUHMN4MtpM9MV,U܋MM9UM)L$M܋U؍TT$$n4F<E$'E$&T}D$ PD$D$u $8R~D$ PD$D$v $8e~D$ PD$D$w $8USF 7EM t 9t[]Åt9uM E[]TUS Et 9t1[]ËM tM 9uL$$*U輀 ­Et9u]1]U蔀 …Et9u]1]USd YEt 9t1[]ËM tM 9uL$$1*US D$E$4[]UWVS  }U uFt  [^_]ÉU15t~(Ut [^_]ÉUE$wMUt E [^_] $$US` UD$E$[]US 3 (D$E D$E$:5 []US D$E$L[]ÐUWVS ~ ƅExU(E P $D$L|$E$/E p@ E4E}pM9D$E$C+E}D$E$!+ED$E$+trmEV0MM<NʈUV?UMD$E$*.1 [^_]ÍLD$E$0 [^_]Í D$ TD$D$sX${4}EE}FU}><<E]E tE $[^_]Ãt}E9E)>E1}E9E)><<Nkr<[u1R}GEt"E9E7E)ȉ >}> ~D$ D$D$eX$!0=2D$ D$D$,X$/UWVS x ~$p,D$$UUBB BE u Ѓ [^_]ËE $@pUtJNju} s5E u%E uBE B Ѓ [^_]äBE B fE tM $1UWVS w î~u} tEt=$ot%,T$$EAE@px [^_]11UWVSRw G~uE u@1$HoDžt,D$<$GwE G [^_]ËE $ otDǃ} s E uE u뛤ƐfE tM E tE o1UWVS v Ê}u} tEt=$nt%,T$$EE@px [^_]11UVS/v $}utG,9u=Fu!F D$F$tH[^]É4$[^]1Uu |Et ,9t1]Ë@ ]Uu œ|Et,9u@]1]UWVu r|Et ,9t1^_]ËU tP 9Urptt} suuɤfuufUWVSt {EtH,9u>P pt0t{$Ult!NjUs*ut[^_]Åu!1[^_]ftt鍃D$ DD$D$X$y+D$ DD$D$X$O+Ut {Et,9u@]1]USs zEt ,9t1[]ËM tM 9uL$$US s ÍzEt ,9t1 []ËM9H uU tL$M L$@$ []UWVS ;s 0zu>t=~(u7Ft=D$ T$VT$$t F$ [^_]ËFD$U$11tՋ}O $MjEtFVT$U$MUK9}D$D$4$I$gjƅ,D$4$FEF~ E 0%/D$ED$F $jljEt\UF$F 9:" ~D$ ,D$D$X$(E$<&D$4$Xu1<\\D$\4$-tӉT$4$tŃtaD$$Buύ T$ T$D$# $Pt][^_]UVSM T]u {u3vut&D$$}t,u[^]D$<$Su 1[^]D$/$6t6u Ht>D$$u뼍 T$ T$D$D $E >][^]UWVSL S]u {uZ~uvDD$$t4u~ tku btXD$$Yu1[^_]D$<$;t6utwD$$u븋vt%u tD$$u댸[^_]Í T$ dT$D$c $D$/$;E >][^_]zUWVS pK eRUEx } $UCƅ$?CtzFFF E Ft.ED$4$ׄu`$K14$K [^_]Í<D$4$u뵉4$?K1 [^_]D$ 4$ztFu2D$4$kD$ 4$ESD$4$-;>@D$D$4$-D$ 4$Ex UWVS I PED$E$5t>Ɖ$FE U4$*JU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVSH OutFwyM MJ]ZMJ [^]$@t|] X]XMH ]X뼍D$ D$D$Ap$qD$ D$D$Bp$G1fUWVSG NUu }t`t`tAtA}tA uutA} $/H[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍D$ D$D$Zp$5UWVSED$] u}څu59D$}t }GȋT$[^_]9sut E|$8XD$1σL$uT9r9ڋD$)]t}W뗉u 11҉ËD$\$Z D$)‰$ L$t$ ؉։L$T$ ދT$L$T$ÉӉd$ D$T$9rFt>Et(D$+D$\$ $|$ }_D$9D$sq+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )D$T$‹D$ ‰T$D$ L$L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1MD$9sFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$uy9r9,)|$ȉ뙅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ ЉD$T$\$\$ L$4$Ét$Ӊd$ƉT$9r SEEu Mt MxHMH P UP UP UP UPUPUPUԋ|$0}|$,L$(}|$$UT$ ML$UT$M܉L$}؉|$UԉT$ D$D$4$ tKT[^_]1EEEEEEE1E1YEtET[^_]USM] CfACfACAC A 1T T u[]US]M CfACfACAC A 1T T u[]USM] ȉCffACffACAC A 1T T u[]US]M ȉCffACffACAC A 1T T u[]UWVS4< B}u ?Mt E<$s$t4[^_]À-uFD$0FD$,F D$(F D$$F D$ F D$F D$FD$FD$FD$ t$$D$<$ uFx,EtEtED$4$24[^_]Ƀtʃ`[̀rS[>`[̀rS[ä>`[ḛ̀rS[Ä>`[c̀rS[d>`[2̀rS[D>`[̀rS[$>`[̀rS[>`[9̀rS[=`[Ḇ̀rS[=`[ḵ̀rS[ä=`[8̀rS[Ä=`[Ḁ̀rS[d=`[̀rS[D=`[Ḅ̀rS[$=`[̀rS[=`[ ̀rS[<`[̀rS[<`[̀rS[ä<`[0̀rS[Ä<`[Q̀rS[d<`[̀rS[D<`[)̀rS[$<`[{̀rS[<`[|̀rS[;`[#̀rS[;`[)̀rS[ä;`[=̀rS[Ä;`[̀rS[d;`[̀rS[D;`["̀rS[$;`[US4 ;E UD$T$ D$E$-X[]US3 :EUD$T$D$ ED$E D$E$X[]US3 È:EUD$T$D$ ED$E D$E$W[]ffffYXZQ̀QQrUS33 (:ED$ ED$E D$E$[]US 2 9ED$E D$E$}X []fffUS2 û99E[]US2 Ô99E@[]USy2 n9dp7u1[]$C1[]US?2 49dp7u1[]$ 1[]US2 8dp7u1[]$1[]US1 8dp7u1[]$1[]US1 Æ8dp7u1[]$[1[]USW1 L8dp7u1[]$!1[]US1 8dp7u1[]$1[]US0 7dp7u1[]$1[]US0 Þ7dp7u1[]$s1[]USo0 d7dp7u1[]$91[]US80 -7lP ?jItM  @tM:u DŽtM с?x"lP ] lM \U1[]ÃӅ~tM 1  9~:u뙸#[]U/ ‡6E@M lM 1]Ut/ e6E@lM ]UW/ H6E@DŽpM 1]US]Cu U C1[]US / 6dp7u#ED$E D$E$u []$I []øUS. ä5uS[]US. Ê5dp7u -[]$\-[]USU. J5$zUS7. ,5dp7u1[]$1[]UE 9E]1UVS- 4ut$E EED$D$vt4$~[^]ÍD$ 0D$D$;\$UVS}- r4ut/ED$D$wt@4$x@Eu[^]ÍD$ ) ‰L$D$$菴yX1 [^_]ÉM4$vSM랹č`D$ D$D$>$넍UWVSL$ A+Eh+l}ptDžxAEEEEEE|(D$ut$$;]E$D$t$$Dž<Dž@DžDDž8H|$8D$$dDž\Dž`Džd1|X}t Xuĉ4$_XD$4$|$4$D$04$5U\8D$hD$t$ D$ D$0$"G,&V4$G,48D$t$0$tD$(D$$D$$D$$pD$|$$4[^_]D$ $[^_]Dž4c ,Dž4GD$(D$$yD$(D$$D$$D$$UWVS@ ! 't$0D$T$L$4D$4t "|$GD$8UT$$\$0uL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$rD$L$8D$9\$0&"D$8D$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$D$L$8D$9\$0M"D$8D$UWVS l 8$1D$D$d|$|$EUD$T$ EU$T$U E|$u$+ u'Ą[^_]É|$a7D$$#UUWVSEU u}M] $\$] E M$M] $\$M]u} e[^_]: {ilmNA90l%UY RUl]UE]UWVS02 +EԋUD}} u|E$]EqE+EE] U<9} ]ߋE;} r`}UEƋED$t$$UU~o VC9uE<9} rGuߋE;} s UED$L$M$UMUxGEn]?E EU‹EE܋EE؉+]]؋}ރ}rM]܅tfM؅tuǤ9um } #ӉUE48;] r1uʉϋMύ 9u9] rGE48;] sωMUEML$D$4$UUMyC}}u럋]uUփtO؉MljMED$t$E$UMx&9uU׉փt뼉EߋustftUuxu_׋E}us#tftE$] 10[^_]tfvEr]ԍjD$ hD$D$$Í\D$ hD$D$$fUv6] Ub [UT$D$ ED$E D$E$]ffUWVS(! ƉUM}M)E])ˉ]tw؉љȅuE)E~Suu~GM܋u1])؍ M9utً]9}݋UۃEE9Eu([^_]ËM둍yD$ D$D$$QD$=u4$w7)EE8EE1҉MԉU*}D9FEE>tHED$|$M $޴uى<$蒳}9EuEEE>uMԋU܅{UWENjp,t-t$E8:tED$ED$$XGxtp70E<-<+<::gB9FB 9F <;uEz8;EAxt-0tE8:tD$W$袞tp7WE<-QEx:T?Fw E؉Gw t01]E8[^_]ËMԋUEE$ȱEMyt$ T$UD$_<$EUMt$ D$D$<$>u4L$ Mt$D$`<${EM:L$ t$D$<$O3D$ D$D$a$  <:z5E*E!w p]ẼuE MЋM؉u|[^_]ÍrP :u>u|t E8:?부xt|A됋|>uTx:tL|9MAE8:t*|$ D$h1xP A|[^_]ÍyD$ D$D$R0$貵uD$ D$D$S0$}臹|$ D$D$@-$芡E 4=:dUVSutD$ D$4$[^]ÍCD$ D$D$/$ѴUVSìutD$4$fe[^]ÍÀD$ D$D$/$qffffUSSHE$1[]UWVS,!Etut4E@D$Ex E@t$9r0E@ 1҃[^_]ÉuU 9E׋EP @D$E@t$9s뿋E@D$M);u ED$1E U9Nj]C E@t$9ANE E ڀD$ D$D$$5׋EP @D$0E UdOeрD$ D$D$$űTUWVSncUB EEEu1u}u}9}EE}B269rz])9ErEË}u sHu(u J J ZR9r [^_]ÉftEË}u rucuk량UGD$4$ƅt[UB)ǍD|$D$$'U0MJB E4Xf넃BUWVS u} D$$($…0x@@ D$D$D$ D$D$$UDžt)D$$[^_]е18U$$蟵81蔵8US E D$ED$@-X$ []USÿED$ E D$ED$@-X$[]UWVSu} t(ED$ 1D$|$4$gC[^_]Í0D$ D$D$4$0UVSut'D$ D$D$4$B[^]Í0D$ D$D$A$îUWVSàu} t)D$ 1D$|$4$B[^_]Í0D$ D$D$6 $PUVS9.ut>D$D$ D$D$4$Ut [^]1[^]ÍD$ D$D$0D$̭USëED$ D$ E D$E$8[]UWVS{puttE D$4$~7肍F0u D$4$胍[^_]tIF0uҿ0F0뻍0D$ D$D$/h$ج]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVS#E0x$tu[^_]1[^_]UWVS} tE}2tGfp f@UPx$MH,UP(UPDUP [^_]þEu1UWVS k`}u$o‹EE Bzr EBttpE tZ@E iEU<1UtnMfH f@PM H$x,p(@DP [^_]ÍiE뭋M t@E E딉UU$'1 [^_]UWVSj_UE trB0~4r,txM q J$tE D$ E 0xt$|$$Q[^_]ÉUD$ D$D$<$軩UY0D$ D$D$;$艩U US mbED$E D$E$ []US<1ED$ ED$E D$E$j[]UVSuf~ D$4$F0tN@9t $dF0ǀǀ FFF t1FD$4$ψ1[^]ËFߍ0D$ D$D$<$KL軭 UWVSEU tdP0~4p,t} r H$t} Lj $>M Q!Ѓ[^_]ÉET$ T$D$9$}Eg0T$ T$D$8$KE.UWVS-"utFD$4$;nx$P8D$4$D[^_]É4$Oڍ0D$ D$D$7$踦US ×ED$E D$E$9 []USqfED$ ED$E D$E$7[]UWVS,7,Et8uj}ԉ&;$薛FFF )t$|$$d,[^_]ÉEԉ$QE؍EEu}w끋uUpaEx9]Ë]Í]UWVST0%UE }} 8}M1ɉցE- tM9utID$2@D$u4$4$OPEu2}E+ЃT[^_]Àu3p4$PEtΉUED$t$E$JU밉t$ D$D$2u4$蚋4$̙PxU@E 7t"ED$G$胛ut$ 눺}U|D$ (D$D$X$蒣UE4T$ (T$D$X$]uE7M,E|T$ (T$D$X$E=1fUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVSut;F)F3E uF F[^]1[^]ÍvD$ TD$D$Y$蔡UWVS|qu} Uts~F<FF DWPWPW P F F 1[^_]ÍD$ @D$D$v$ԠU`U+D$ @D$D$w$蜠U+UVSxmut~u@~w:E [^]ÍD$ (D$D$$/뺸UVSut~uAF u9<.w5[^]ÍD$ D$D$$ǟ빸UWVSÝ}u t5u%G u<.w~9|D7[^_]1[^_]ÍD$ D$D$$AUWVS)u} t*~uPF uH<.wDx>9؃[^_]ÍD$ D$D$$͞몸UEu E D]1]UWVSÉ}utQEu@D69E r4E D$D$<$v6GfGG[^_]1[^_]ÍvD$ D$D$.$UWVSu} t;~uaVL\WQWQW Q F1[^_]ÍvD$ D$D$M$茝뙸UWVS4ibƉEԋE} 8uЋU1҅x'PރT$D$<$]FGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍT$ T$D$h$WE܅E܋]ԍT$ T$D$i$Em]5*UVSut~uEFu=:Fr6[^]ÍvD$ D$D$$蟛뵸UWVSuu} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍvD$ D$D$$ffffffUWVSƉׅt18u9s1[^_]ÍF9rFލÃD$ D$D$0$萚=uUWVSj_t ljփu [^_]Rw%FGT$D$<$q[^_]ÉUσD$ D$D$0$UUSE x[]ÉET$ T$D$T0$蜙E[]UWVS}ru} Et,tYPσF)F 71[^_]ÍvT$ T$D$b0$EuET$ T$D$c0$ErUWVSEu}UxE ;Eà EME9؋M)1L!ȉ)1׉E8E 8t@‰ߋu s}tftËM؋})p)ƉnE0)F=^EX E[^_]EE[^_]ø‰ߋu rbEX]荃D$ D$D$0$?ÍD$ D$D$0$W]荃PD$ D$D$0$ܖf;{PUWVSEuM}~ 9)1UD!ЉEUE)‹E1UU ˉM] E )P)‰U|U)G=Mw]_^ ȃ[^_]1ɉȃ[^_]Í^^ÍD$ D$D$0$茕MM]荃PD$ D$D$0$TMkUWVS6+u} tt~)F1V J 9\ t+9sw[^_]ÍFፃD$ D$D$0$舔]D$ D$D$0$Y*UWVS1&E} ux)ubHQσwWvPH Y 9r>\ tHډt'9s89t9t!P9r P9sݸ[^_]ú߉1[^_]ÉET$ |T$D$X0$XE6T$ |T$D$W0$&EUUE ttuB]ø]UWVS EEEM<v}wwٸu [^_]9]rE}t81ɅU t9u rEtuutit9A=QMVVD$D$$]iMEEFE 0 [^_])Ӊމq̉M]썃tD$ hD$D$0$轑M9ME]썓T$ hT$D$0$肑ME.UWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉t 뭃먋E[^_]UWVS] U}EEt6u1]t7U9s tCB9rr9s[^_]ËEP8Mt9s܉ uM1+E[^_]UWVS] UЋ}uރstft[^_]uuBfUSäD$D$ED$ ED$E D$E$:[]ffUWVSP^SƉЉ 8U1҅SƅD$D$D$D$ T$D$4$5t1U+4P[^_]Í1ɉ  rFDžDžD$ T$D$<$ eutjƅD$D$D$D$ t$GD$G$5ut$$軄tu<$1b $b*T$ T$D$8$輌rUWVSTÈƉ 8E1 ƃP ƅD$D$D$D$ P D$|$4$4D$D$D$D$ L$|$4$3;DžDžDžDžDžVDžDžDžT$ D$D$$btjƅD$D$D$D$ t$GD$G$2ut$$膂thuGtLD$ D$D$$$_1U+uXT[^_]Ë묋$_ʍ*D$ (D$D$8$AjUWVSϋEE uE 8E1 JD$D$ D$D$<$$=/D$ D$D$$2t6D$ D$D$$rk*$D$$D$$o$詘D$=$[;$u$g)y$X$4t$D$D$$AU+Ą[^_]ÍU @$*%=D$ $uD$<$~!D$/$&Pt:D$D$$i'oD$D$D$D$ D$T$$ D$D$$$蝊@D$D$߄$$l$ D$Ƅ$T$4_D$ D$D$y8$ mD$ D$D$z8$诅}D$ D$D${8$wD$ D$D$|8$?@$8u D$/$#D$t$ +T$D$$4$D$D$D$D$D$ D$T$$D$D$D$D$D$ 뭋|$D$$f-D$$&эD$$ D$τ$$͇UWVSÀEhU 8E1pl 1} t2} 躈/E+Ĝ[^_]ƅpt BtE qD$D$E $DžxfDžrlD$<$rfhkƅptBxB |BEBEilD$ \D$D$ 8$Bl謇l<$;藇l>U D$E D$E$G]UVSutD$D$4$[^]ÍD$ pD$D$8$脁UWVSi^ljEE Et 8|E1;DžDžDžDžxD$D$$詎VDžDžDž@-D$FD$$DžD$D$<$辏FD$FD$<$`<$T80F8=f~4$Dž,8#tf$v D$xD$$J|E+Ĝ[^_]Ã$`똋F?UƅD$D$D$D$ |$FD$F$v&|$#$vƅD$D$D$D$ |$FD$F$&u!|$?D$$EjD$[D$<$D$[D$<$A>$D$ @D$D$@-$i8tD$FD$$DžD$$ D$ D$D$4$\d4$rD$t$<$蕊Ƌ$er9fDžfDžD$D$$荋D$L$$jƋ$:t0<<4$qD$t$<$茉4$^qD$t$<$k4$=qD$t$<$JD$D$<$pD$xD$$\D$D$D$D$ D$D$ $"u(4$莠=4$=L$\D$AD$<$bDž D$ D$D$8$dzC_D$ D$D$8$,zmD$ D$D$8$y}D$ D$D$8$yD$ D$D$8$y~M$$m<$e!D$t$$ tD$t$<$tƋtt$뉍$ $ڈhD$a7$뛍$$rZe$UWVSlSHuEEEEEEEE 8E1MGUqEE fD$ &D$D$ UЉ$U4_EEEEEEM MEEML$ D$UT$$O=EPt%D$T$T $U9UEML$ML$M $MƋE$ELE+l[^_]Í_D$ |D$D$8$vMmD$ |D$D$8$vU}D$ |D$D$8$tvEeD$ |D$D$8$?v6$3KD$D${$X>UD$ED$ED$ED$ ED$E D$E$f]UWVSl赽êuEEEEEEEE 8E1xMUEE fD$ &D$D$ UЉ$U\EEEEEEM MEEML$ D$UT$$xLE@t"D$D$U $UU3D$$ttM 9HtCED$ED$E$MEƋE$IE+9l[^_]Íu$D$ ED$ED$E$ME 멍_D$ D$D$i8$sM^mD$ D$D$j8$sU4}D$ D$D$k8${sE D$ D$D$l8$Fs$:HD$D${$ UEUD$ED$ED$ED$ ED$E D$E$ ]UWVS蹺îl}dE TEPEX 8@E1D$pD$yPXDžHDžLphlP-`L-\dD$ D$D$h$lsSD$ h4$l?:p< `\?.< t.dЍLDSt< B< u< t< t< u< t< tuh9>uPp<+<-iq<@pHLDD$ D$LD$r$l؉DžH<+tj<--t$X$lgPH;v31@U+%[^_]ÉFg<@qs<@PHLDL$ D$D$r$l DžHhUTd [4$lL uCF)<@t$X$lf DD$ XD$D$4$l?tthKqUTqUT؉DD$ XD$D$4$l臓ADžHDžL1bUT%LUT LƅplD$ 8D$D$8$qm0lrD$ 8D$D$8$|[^_]1䍃D$ HD$D$N$W UWVSt葟ÆEUU 8M1ɅtBE}<$WM L$ED$<$XED$<$U+u:t[^_]ÉEɆL$ <L$D$h $ WE3USE D$E$[]USž÷E D$E$[]UVS藞ÌD$ӆD$0W 4$bD$ t$ED$$3s[^]UEȅyt ]%]]UWVS0 E؋}u 8EԉËE1tstX|$}܉<$]1| F TFuF(}ԋE+uS0[^_]$)]蛕ƅuՋ]؍D$ D$D$F4$RU[]xUWVS,!EE EEu} 8U1ҍ $D$@$d \19ȋ})׉ 9}PD$T$$Cc~3D$T$ $19|v(|Y0$ dgY0t 14RY0$c=Y0D$ $U+uw[^_]D$ D$L$$F<$pc1몍D$$4tыptvSUD$D$D$D$ E D$E$]UWVSxΚáEUU 8M1ɅtBE}<$M L$ED$<$/ED$<$_U+u:x[^_]ÉEɆL$ pL$D$4 $GREpfffUWVS ]4u 8$ËE14ENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ |]Ћ~$x}ԋ^(p]؋~,l}܋^0`]^4\]~8X}vh}l1u1u1lj]11ωtdn߉Љp}1U1׋|1ljh11ljpu2n׉l}1u1x1Ɖω`11߉lhnlj}u1u1t1lj`11׉hnωU}u1U1׋p1ljߋu11ljd`2n}U1׋U1׋l1lj}11ω`n߉M}U1׋|1ϋh1ljNjU11\Un׉u}M1ϋx1ϋd1lj}uM11ߋMXnlj}M1ϋt1ϋ`1lj}11׉T1nω֋}U1׋p1׋\1lj߉u11ljPu2nE}U1׋l1NjX1lj}U11ωLn߉M}U1׋h1NjT1ljMϋU11HUn׉u|1Ƌd1ƋP1Ɖu11މDnƉًux1މ`1L1ÉމM11Ӊ@Mnى|t1ً\1ًH1M щˋM!ˉ! ً];ܼىxp1X1D1M !׉! M}MܼMωutl1T1@1Ɖuu !! }ܼ։׋ph1ڋP1ڋ]1‰U ӋU!Ӊ! ڋ]ܼЉˋld1ȋL1ȋM1E !! ȉEEMܼEuh`1H1u1MM !! u>ܼΉ׋d\1D1u1‰U ֋U!։! uܼӉƋ`X1؋@1؋]1E !! ؉EE]ܼEÉM\T1ً]1ً]1MM !! ً];ܼˉىXP1ڋ]1ڋ]1‰U ӋU!Ӊ! ڋ]3ܼӉƋTL1؋]1؋]1E !! ؉|E]ܼ|ÉtPH1ً]1ً]1Mt !! ً];ܼˉىLD1ڋ]1ڋ]1‰| Ӌt!Ӊ! ڋ|3ܼӉƋH@1؋]1؋]1x !! ؉pxtܼpÉlD]1ً]1ً]1tl !! ًt;ܼˉى@]1ڋ]1ڋ|1‰p Ӌl!Ӊ! ڋp3ܼӉƋE]1؋]1؋x1E !! ؉hElܼhÉlM]1ً]1ًt1Ml !! ً];ܼˉ]}1}1p1lj} ׋l!߉! }7ܼމu}1}1}1Ɖu Ɖ!׉! hul>ܼhhl}u1|1u1Ɖ11߉ubhUu1x1u1‰֋l11ʉub‰Uu1t1u1‰։ډh11ulbщMu1p1u1΋h11ubˉlEu1M1ȋM1l11ЉMh1bƉ֋UM1ʋM1ʋM1‰ыl11ډM9bU|1ʋM1ʋM1‰щd11‰hlbӉEEx1ȋM1ȋM1ld؋M11lM1b|t1ȋM1ȋM1E11Љ|bӋxp1ʋM1ʋh1‰щl11x]bډtM1ʋM1ʋM1‰ыl11‰t9b׉ :dpM1ȋU1Ћ|1‰11؉pl bȋd]EU1ЋU1Ћx1‰1؋d1؉l2bƉuU1֋U1֋t1Ɖu11ΉU:bM}U1׋h1׋p1ljىߋ]11ljU]b߉EU1ЋU1Ћl1‹E11U bЉEu1|1u1ƉM11؉uMbȉEu1x1u1bʋE11UEu1t1Ћu1ubʉ؋U11EU1Ћp1ЋU1<bËE11؉Ћ402މC(lj{8 F ,EF$E+u~[^_]Ë D$ D$D$\$.<4< D$ D$D$\$; UVS˃ut7#EgFFܺF vT2FFF[^]ÍD$ D$D$\$e;UWVSMBE[U Pu щHs H?J]Ӄ?@)Ӊ]<u EEu|UHL$$EU);MEƋ} T$4$dڃ@;Ur)]] U<u sRtft[^_]äfEuMEC] }|:}hT$ T$D$\$9EU xEɆT$ T$D$\$9ECfm2u KM &fUWVS( E}u 8EËE11U1ۃÉу\u݉UD$]䍃D$4$>F%=Ut,D$\$4$F%=u݋UD$T$4$t!1уu}E+uo([^_]Ë]䍃 D$ D$D$\$7]䍃D$ D$D$\$7]UWVS0E؋}u 8EԉËE1tstX|$}܉<$]1 F TFuF(}ԋE+uS0[^_]$)] wƅuՋ]؍D$ D$D$F$6[]UWVS~æEE EEu} 8U1ҍ $D$@$E \19ȋ})׉ 9}PD$T$$D~3D$T$ $k19|v;0$E:0t 14:0$fE:0D$ $U+uw[^_]D$ D$L$$$D1몍D$$ tыptvUD$D$D$D$ E D$E$]UWVSxS|HEUU 8M1ɅtBE}<$vM L$ED$<$ED$<$_U+u:x[^_]ÉEɆL$ L$D$ $3EfffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8puX]H MPUHMX]HMX ]P$UH(Mp,uX0]H4MP8|@yZ<3 h Ӊ 1Ή\uh3n\  1Ӊh]nh  h׉ ؋h1|9n ׉ 1}:nh \ 1ڋ}h;n ҉ 1Njxn \ P҉։h 1΋}\;n <P hӉ\ 1Ӌu0nˋh Nj\ 1u1nЋ\ \1u2n 1ڋt7n \ h҉׉ 1Nju\0n ҉ 1΋Unhމ \1ӋUhn  h ҉Ћh 1Un\ h 1Unh 1!1‰hUܼh  ωh1!1ω}>ܼ<2  h1!΋h1֋UܼƋh 1\!1Uܼ h1!1tܼ\ 1!1ًUܼh 1!1‰\Uܼ\  1׉h!1ω}>ܼ<0 1!1֋Eܼ h 1!1h]ܼh 1!1hEܼh 1!1ىhx ܼh h1ˉڋh!1‹|ܼ 1Ӊ!1ȉËEܼ3h 1É!1։\uh3ܼ\ 1!1Éh]ܼh  1߉h}9NSh  h։ 1t2NS ։ 1ʋu0NSh4h ։ ʋh1u0NS  ֋h ։\1ƋUNS>h Ћ\ 1؋UNSȋ\ \׉ 1‹}9NS 2 h׉ 1ʋ}>NS \ډ ׉ 1Ћ|;NShlj ׉ Љ\1؋}h;NS  Ӌ\ 1Ë}>NS ˋ\ Ɖh1u1NS4  Ӊًh 1]NS h PӉ 1ʋ]NS< @։ ʉL1x0NSPӉH pm h T։\ 1׋]h>pmNjT \Ӊ 1]>pmы\ 1؉hE>pmh‰ 0 1hE>pmh 1Ήh|3>pmhh ։h 1Ӌu7>pm h 1Nju1>pm׋h 1hM >pmh  1ډhU>pmh  1hE>pmh 1Ήhu3>pmh \҉ \1ӋU>pm  h 1Njt>pm \ ׉ 1U>pmh \׉ 1ڋ}8>pm\ 1!1hEvmzh 1!1Ήhu3vmzh 1!1Ӊh]vmzh 1ljh!1Nj]vmz  h1!1]vmzh h1߉!1ڋ}8vmzh h1!1xvmz؋h Ήщ\1!Ƌ\1΋t vmz 1щ!1ӋMvmz\ h1!1NjM\vmz  1!1M vmz  h \1!1ڋ}h8vmz \ 1!1hEvmzh  1!1Ήhu3vmzh 1!1Ӊh]vmzh 1!1ljh|9vmzh 11hMʋh 1ډM1ʋx M1ωx1׋U ߋM x1ʉ1U Ƌx ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11EE 11؉E|ME 1M1ȋt U11‹M UM 1ʉ׋U1׋U U L ׋XUzp4 <UrU1ЋU1Ћu l@؋uF ЋL ȋH1P]NSdыUȋUBU `HEĸ[^_]UWVSE}O_M]ʃ?@)Ӎ41u}Mqy9rdun?v91۾@ω؋]E D$<$Ov@9s]ËE19s-)] }|u s~tft[^_]19rӃ[^_]Ë}}]}|u skEu[EuREUED$E$U)֋E9r{}؋]HuVu=ffEtuVu$ [1Í&T$D$ Zbj rz $RPS[djRj# [Xt@US ]õdED$E D$E$誂 []US]ÄdD$ D$ED$$G#[]UST]IdD$ E D$ED$$[]US]dD$ E D$ED$$[]UWVS,\cuEEED$D$}|$ t$D$EE$aEE ED$D$|$ D$D$E$a~EEED$D$|$ D$D$E$1a/EEED$D$|$ T$UD$E$`UEt2E <wE)Ѓ9uEEED$D$|$ t$D$E$T`؃,[^_]v8 u>ƆUU`D$ LD$D$<$fffffUWVSZÃa} 8E1}D$D$HtHE$t=ED$D$<$$|;Es1U+[^_]ø"㍅D$E$ktt@D$E$1u[ED$bD$<${;EsED$|$ H%D$`d$T$UID$ TD$D$B$S|UWVS ;Y(`D$LW \$E$qƉ؅u [^_]É{01UWVSpX_UL[ ut$$L[ @B1E}E1uNjU:ME1uEHt$$xxL[ @B1Ƌ}E1NjExME1EH D$E$Qu(L[ ]ٸ@B1E1؃p[^_]øp[^_]$'謣L[ 8D$ `D$D$H5$UWVSWx^D$7sD$E$|uE0-@t&tD$E$u܉[^_]D$SD$E${t 1[^_]ËEpD$D$4${E@<-u?EPP-DPtEPD$ ED$$U7uMU9p9g^My+th)ƍF߃1BD$+D$4$zE@t<+ !M?!UU\E?w0-t u]Ë u@u1]UU\EP>w 0-]1]UWVS(jU_\u}܉|$D$4$xINE uG>wl8EظE! EED$|$4$~([^_]Ã>w28EظE EH;UWVST×[uD$ toD$D$[ <$y)l[ @-t@l[ [^_]ÍU T$ t$)‰T$$H뵍a7D$D$[ <$dffffffUWVSSZƉЉυV=vlot ufus  E ] ^}+}-}=uFЃ[^_]Ã+t-uuXE #EFЃ[^_]ÃXtguy-t~F+։} RF F+֍R먉} 룉UWT$ T$D$t$ EFlFaUWVSRÂYu ] EEEE}|$EԉD$$$v$EvD$|$$E5D$D$Ẻ$vMẺE0EUP-DPuHщMEE1Eta[^_]ù@MD$r<$3Mt26L$E$%mu1빅t p1봍R8u$F$o81rUWVS ELƉUc tG$ ?uE8rt;F$ u [^_]D$$pn$ [^_]Ë$ FuEx+uD$$/nD$$nF$B Ex+uUWVSEKlj֋E8rMD$t@G$EGF$ MUVN c c [^_]Ë$EFG$ UMUVS(yDrKEu] WU EUE"Edp7uT]\wmƃtK]wEU $Udp7E@([^]Ë]썃$뙍EU D$ED$]썃}D$ +D$D$ $$]0wdp7t]썃$E$]CE$Z E$O 01([^]Ë]썃$]썃D$ 0D$D$p$w]썃D$ 0D$D$p$:UVS BIEu2]YUEoEEdp7]ktht1EU$UEdp7E@ [^]ÍEUED$E D$E$] $ ]S0dp7t]썃$gE$]IBE$ E$ 01 [^]Ë]썃$"]썃$ 9]썃D$ (D$D$p$-]썃D$ (D$D$p$uUWVS@G} dp71c 19~uMU<$}UҋM}8D$|$F $t։4$@E[^_]ÉM썃$ c M[t$ u밍$ cc LD$ D$D$p$4$4@UWVS\?tFEE}|$ ut$E D$E$t$t$E$eƒЃ\[^_]ÉEEED$$H;Ut։|$ D$EE D$E$MtZEEL$ME$2eƒMtU $Q?UЃ\[^_]ÉM8MtE9uWEE뤍D$ 8D$D$>($UM$M~9E~L$$d‹MfffffUWVSP=DEu}b]DE E AEEEDE{~ 0jM_U tEExGz;EGEkMddeEUMEEE EE܋E$] 8MԍD9E 0>EUM]L$\$ $T$] 9tu׉EUM]ىeщٸ9и| E AED$ExD$E܉D$ˉу2΁ȉ%ƉƸQ)1ʉ)i)\i(\ø)\ƋE؉E]ʋUʉD$ T$]D$E D$E$9} |P[^_]ÍnEEEE`EEAElj։MEuEE9r[ff=?txf=[f=*t!f9tc]9ttg9s>18[^_]Ãf~*t{uE9sfu!f=?tf=[t]]uuf=?uS`EuLCEFfEf=!E؍FEf}!&f}]AE܉EFE1]ԉ}ЋE܋}]f9uxf]t(fx-uf9r f9Prxf]u؋]ԉ}}ЋE9Su]`D$ D$D$ˇ$5AD$ D$D$ˇ$ED$ D$D$ˇ$FEvfuf]SƋ]UWVS5w<u} ttFD$$[4[^_]ÍFD$ D$D$Dˇ$4uD$ D$D$Eˇ$UWS4;ׅtkt/tPWu 1[_]Ãu[_]ÉMET$ T$D$qˇ$ME뙉MECT$ T$D$pˇ$PMEZUWVS,4!; 8U1҅tWF @D$$tV$U+[^_]1g㉅T$ T$D$Eˇ$n T$ T$D$Cˇ$K/cdyUWVS$3:]E։M5_VЍEF t =F}|$$]0DžF\~MfyuE)E $M]*ÅM‹EiFJ‰F u $[^_]Ë}E=v]ԉUE$]*DžUt߅FT$D$<$]'D$ D$D$ˇ$]썃D$ D$D$ˇ$vo$]2FVNUWVS11&8ljdhlE`E XuEpEP 8<E1h`XphfX9r9f>*uf~*u1f~*@DFH9`PD$pD$ HD$XD$`$lhdDž|hfDžDdf8$pD$(D$<$Qp@ @<$P TTp@ @i6Lt4l8\T$LЅpQ tPNy~ x .5 h\9lHfOfuት\9lD@u5p4d*4|%=H`h#W89sfG/fPD$pD$\$ld=hfDžHDž@DžDdf8tpdHu|%=@1P(X|%=@B9pp/%`BX븋` D$ D$D$Sˇ$M`:k`v1҉p/!UWVSD$+ 8ƋE1Hf~uQ@ *΍f}f/sP9uݸz0fd"f*ffʃft@f?f[uZx!#qf92f[ʉfuffP u:!N f?ʃDW Ӏ_ Y9t fx*f*ʉك |$|$<$U+D[^_]ÍJfzuf[Qr f2f]u답f[!Vf]tI։ύOf%ff-uFf]fG-Of%fG^Vf]uH Af]N9D$D$ D$D$$.P f 9 9sVfPfu9t.P9fx*P9fx*ʉW 9B {T$ D$)L$pP$薞f[!ʃoV- 0!$K…DD$D$ D$D$$Y@xf@!EfH9'?|$ D$D$ˇ4$R|$ D$D$4$4jMeUWVS%Ɖ׉MG tMA PQ f>{tBEEft>f{uED$E$quۋE[^_]f~}uf~uM[^_]D$ D$D$ˇ$IMUWVS0%)9YË)ډσˉHPftDΉ1ۉff}tYFftf[tWf{uFfuM `E10[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1=f[uSf]fً9CS{f{f,uvu91ҋLf fuM }1uLfAf}=s-%qQf]tyىC)D‹΃tfFT$ |$D$ˇ4$ ɋT$ |$D$4$T$ T$D$ˇ$u=$SًfvSdfPUWVS(&!u} UDžDžDžDžuBB EBB]uR} UfP9~ʅ\uVtM@ɃfH9Nuft ([^_]É\@x'([^_]B&} U맍JD$ D$D$ˇ$U} UhUWVSÌEtXEPtF@3tƀ8u^AUD$L$ D$D$c 4$UE tE 8 [^_]D$ ED$4$ &xT}untHuG<&wHt$$D$׈$t$$ՠc WuA@9|w뵍8=9,@뽍?ЉED$׈ $@EEUD$׈ $MEbffffUWVS  ljD$\t$<$Jt8t [^_]UWVS8ö  8E11҉g rc  h D$ D$D$$h L$$cytzg t8#tg g g h D$D$$藞-g 8#`g Qg t8xuxxu xg 8sxwx|Lg <$h $h U+[8[^_]ǃh ǃh t)$0h lt$h D$g D$4$:%g Dž<$詰u؋ܳt΍ܳ 7tt$$ouታg >x~x~6%1g HT$$t&HUVSMB  h tftKg [^]ǃh D$4$貦 h ut$|s$.1[^]UWVSuǃh h t0$ɟt$g $2tHu1v>D$<$ h uΉ|$|s$1g [^_]Í`D$ D$D$$GUWVSuǃh h t-$t$g $ZtEu1>D$<$= h uщ|$|s$1g [^_]Í`D$ D$D$$@JUVS&ǃh h t$([^]ÍD$4$荤 h u҉t$|s$ 1USé h t$荖ǃ h []ffffffUWVSLqf]ԉljUĉM؅uą]1EP-EEu؃EĉEGET]DCtEL- ?*WЍL]DS<*EL-}<* tЍ\]]DStڋEЀ*Ҁ[i\U؃B] ȍ{}}\\ ]]DKtEL-M9L[^_]À?*vG[\U؃]]Oh}눋}].@렋]у]}ы]]}L[^_]Ë] ȃ]_]_]|}܋}D_]}EL-M‹u}[}]ԍ4D$ D$D$|$nJD$ D$D${$?}L-};EӋ}E//E/(EEEL-EE؃E}}tÍLUDBt EE$ME/uEtveu؉D$/E$]>~gEEÄ[^]UWVSRG}u vD$<$զt*]D$<$迦u t1[^_]ÅtwUWVS8 8‹E1D$ D$ED$E$E…uZDžDž$$E+0Ё8[^_]É$? T$ D$ED$E$Fƒ$nEDžDž9~&t$$t$|$ D$ML$U$ƃD$|$ D$ED$E $9D89trtftƄD$D$ D$ED$E$ƃɱ1҃8-DžDž1DžD:1UWVS@UE 8ƋE1D$ D$ED$$Q…uZDžDž$ $E+<Ё@[^_]É$AT$ D$ED$$%ƒ$wBDžDž9~&t$$t$|$ D$ML$$ƃD$|$ D$ED$$9D89trtftƄD$D$ D$ED$$ƃ迮1҃8-DžDž1Dž:71vUWVS@UE 8ƋE1D$ D$ED$$Q…uZDžDž$$E+<Ё@[^_]É$7T$ D$ED$$ƒ$wBDžDž9~&t$$t$|$ D$ML$$ƃD$|$ D$ED$$9D89trtftƄD$D$ D$ED$$ƃ赫1҃8-DžDž1Dž041vUWVS }"D$E D$<$utuFtf [^_]UWVS wl}"D$E D$<$Sututf [^_]UWVS  }"D$E D$<$ututf [^_]US î\8D$E D$E$v []UWVSv}U 8E1EteMyu )čD$UPtMP}y:u}D$<$'}U+ue[^_]ø+2UWVSEEM 8E1EtgEǺu )ԍT$ MJtJx9uD$T$E$XxU+ue[^_]úE1US=2ED$ ED$E D$E$ϲUS ED$E D$E$BUS ED$E D$E$kBfUWVSæƉUtb}u +t"D$4$uM)[^_]P-DPu 1[^_]É4$[^_]ÍD$ D$D$$oU Et8t 1]ø]UWVS\u 8EE1*t$D$Ẻ$"i,h }e1󫍃4h EЋM̍Ch |t:tEЃ9s EЄuDh t$CD$Ẻ$;oFD$tD$Ẻ$oEЉED$D$Ẻ$ox,uЍBTD$4$sh 4$`D$:D$Ẻ$Zth EԉEȉD$ D$Ẻ$sZEԉTh EȉD$LD$Ẻ$st Eԉ\h EȉD$D$Ẻ$st EԉXh EȉD$%ZD$Ẻ$gst Eԉ`h ED$ht$Ẻ$mlEf0h EЉ$EEȉD$kD$Ẻ$rXEԉdh EȉD$iD$Ẻ$rEԉhh EȉD$)D$Ẻ$rVEfth EȉD$6dD$Ẻ$mrEfvh EȉD$/D$Ẻ$=rEfxh EȉD$cD$Ẻ$ rEfzh EȉD$HED$Ẻ$qsEԉ|h EȉD$D$Ẻ$q>Eԉh EȉD$/rD$Ẻ$qEԉh EȉD$PD$Ẻ$SqEԉh fEpxEfEbxEfEfxEfEoxEfEtxEE`ah E؉EEEčEEEt}4$ďT9u f9t]:/t9r 9֍vtJ:/u9u .t&8:/u9r)vi 9u(Ƅi [^_]Éր>/t>(i ǃstftƄi [^_]Éڍ#ffffUWVSQFE$}|LP-DBL-fkfbfg@_D$ ED$E$*zEUE8E9t8u|8"tQ]ڋEƍ EʋM Q1[^_]fmuAxn1bM]9ȸs 蠝[^_]þUSD$ E$蝧[]fffUWVSö}tz?tu<$HD9u p9ti8/t9t`sc~/t9u)=vm ׃rtftƄm Ѓ[^_]ø(€8/t Ƹ봸#US<EEEEEEEED$ẺD$$tEMt<[]ø<[]fffffUWVS v7ƅt $茚UtE t [^_]Í#$8E uD$D$$CǃtD$$D$<$D$<$~<$ߥzpUSØEt=tU T$؉$[]UVSXMutE D$D$4$u[^]ÍD$ 4D$D$1 $ fT$D$Ít&T$D$.&&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  .&&T$D$L$  .&&.&&D$ffff̀rS[ä`[Ḯ̀rS[Ä`[ḭ̀rS[d`[̀ffff̀ffff/̀ffff^̀rS[`[̀rS[`[Ḥ̀rS[`[<̀rS[ô`[̀rS[Ô`[ḇ̀rS[t`[̀rS[T`[ḓ̀rS[4`[̀rS[`[`̀rS[`[R̀rS[`[2̀rS[ô`[ḩ̀rS[Ô`[P̀rS[t`[ḷ̀rS[T`[Ḷ̀rS[4`[ḉ̀rS[`[̀rS[`[Ḛ̀rS[`[̀rS[ô`[Ḩ̀rS[Ô`[1̀rS[t`[Ḍ̀rS[T`[òrS[4`[ìrS[`[l̀rS[`[t̀rS[`[s̀rS[ô`[r̀rS[Ô`[p̀rS[t`[j̀rS[T`[m̀rS[4`[̀rS[`[Z̀rS[`[ ̀rS[`[S[þ`[.&f*̀r׋L$Q1fffffỲrJ!QۓUWVSlaq q D$$q q +q q s$uu[^_]ä[^_]ft뻋q Pq D$D$D$D$ D$ D$$6q 31q D$$LD$$ $qGf?US q E)9q t$[]à T$$[]USúD$y$q u !$k[]fffffffUSúQ)‰э)y )ȍ BЅyBut*$I )Ѝ)‰)[]i)\P ףwƒUWVS ÉUB< we΋EE11u v4B< w-ύLzЋuU<9EsNju9r9MrE؃ [^_]1 [^_]UWVSLAEU1U9} t?E $M迀ƉD$ED$M $uˋE8E[^_]ËUt E1UWVS$Ɖ 8E16P-ʄt/}9tBt DK@t⋍t0DCu1U+u]$[^_]É $<`Džtҋ0F D$<$_F$F(<$_`떋UWVSXE؋}E }x EEEE]P-]wu8EX]E]܋DJ@u.<%uEUMYC}Ѝ~}E@}GEЅ>MUЅM E؍oE@-D$ ED$T$<$ƉEMEU$c1ɉpƉEE M]ȅt)ExQ)؍)MEH}eMEoMMЅGEP$1ɉƉEM =MEU$nƉEE}GEЅMMU$5xƉEMwu?%}ЅMEU$ ,ƉEE}GEtYMUЅKEP$ ƉEEx @uMEЅM E؍fuЅETMEЅE؍]M$=1ɋU[ƉEEMEP$1ɉ.ƉEE gMU$ƉEM踓$I )؍))ыEHEMPЀ E MEEЅMU$c1ɉoƉEEȅmEHQ)ȍEE}GMEP$;1MEP$ EEЃ} uG' MEP$1ɉƉEEUMuDBuMU$c1ɉwƉEMEMpMElU$'1ɉ5ƉEE-l}G}eMvMEMEЅ7E؍4=%]ЅE ,}tz]ԋEpE@El‹}̉)ЍH$I )Ѝ))ыUčD)֍D)}G؃Eԃك}}}Gw}Dy@&V؃DY@u] utU܋DB@UЃ@)FUDBb3v%ME)EERUЃAD$1$E؍ډ[t"UB M)i]D$1<$EǤ-ډM]K U$8cU<5@-D$ ED$E D$E$b]UWVSDEu q 9PMP lM܋HP UPUPUElS *DT$$ML$ ML$ML$ML$M܉L$ML$ D$|$4$^9D[^_]ÍMP MMIH??? F??? F?? ?F ?:??F:?? F????fF =|늍d9gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ D$|$4$]9{T1D[^_]Uq D$E$]US8EЉD$E D$E$LtUT$$8[]US4謽áEЉD$E$LtU T$$m4[]USodE$CLtq T$$4[]fUWVS@1&UE u 8M1ɃtHMċNMȋNM̋N MЋNMԋNM؋NM܋NMN MN$MN(MMuăt,tSt9$zU+@[^_]Ét$D$t,$1]׉t$D$t,$]t$D$t,$]뫉E UL$ L$D$; $tE UL$ L$D$: $sE UfffffffUWVS豻æu} tQt!1t  9t)ʉЃ[^_]ÍD$ D$D$8$Zs볍D$ D$D$7$.sUWVS MU Etx $MhxMMEpEt';Uu"|$t$F$V9UtމuE tH9uMtFE]ȃ[^_]E千D$ D$D$I$Dr=D$ D$D$H$rUWVS uU Mt;A t+ ÃutF\$D$$mI [^_]fUWVS 葹ÆMtU D$E$ED$}|$E$0ƃE $fEL\80t6Eu1 [^_]ÉL$M$UdUM $…tU $fUMȉ׋usYtftE|=Eu stf`Z뉋E|떍`D$ D$D$C$oU bȉD$ D$D$D$oD$E$uf5Ef,zE UVS E UtuD$E$E [^]ÉT$D$E$Hƅu E [^]ÃTt Gt01EtB[^_]ÍD$ D$D$M$;f?et[^_]Ft$譮V tQFtB1ɉωMT:0$艮V T:($zV D: $kM;NV r$UF,t$FF4t -$2F8t$#4$[^_]ÍD$ D$D$K$LeUVS2'4$zLr D$E$s4$z[^]UVS4$zLr $s4$xz[^]UWVS讬ã<$OzLr D$$JxƉ<$0z[^_]UWVScXuED$@$iED$E $qj…t?t$U$[Ut'zu Ńtt$$[uUEHutU$BEUЃ[^_]Í`D$ D$D$<$c7UVS|q 4$yr D$E$h4$y[^]UVS7, 4$xr $h4$x[^]UWVS <$xr D$$iƉ<$zx[^_]ffffffUWVS0衪ÖUzP-E܍uu<0 1E1M؋MLYtyu 8<|EuȋM؋uԍE99)11 ؃9ruu\M؋uu9tzwr<.uUy<0BÃ߀Xt\E f)Ǎ|uԄAEDX@30[^_]BD$ D$D$F$`UTuԍE9t11UWVS ödD$D$@-<$LE tED$E D$<$mD$$ FE$?USJ?eUT$ U T$D$E$oUWVS UEtaEEt88 [^_]à "EE ,獃;D$ H D$D$$v_pD$ H D$D$$G_:}}43k } ;cl uuEU}#Ћu0u9dtt4}t>}9tȋEE TP-EE } =Y n}E vU P-DPueE 7}} Ј3E TP-&E 0}E E}E } ;U P-DPEE DЍPE}} #}}E1EEu } \Et } %Et } &Et } =uE E 0<EuЈEE} ?U  Ћ}E} } U P-DP[u VɨEE IEE 0<}Ј@E nwtlEE TP-ME 0u Ј} -} ^EP-u DpuE EE 0uE[EMEEXE+E E6E E"E EE EE EE EEEEEE\EEEcEUdugs 1cduYE 0E E PHL-WEUEL-WE EE1FEzElE ^UWVS,*u }EEqE/O]}}؍}}܉MEމU)ߋED$ E؉D$ED$E܉$Uw{( GAM ǃEE@uUD$ E؉D$D$E܉$/U+E,[^_]ÍD$ < D$D$$ӉUXUs]9EC6D$ < D$D$$ӉUWU6D$ < D$D$$ӉUoWUXEE؍EE\QFtM ƃUED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$s]UWVS蕞Êur />3)Ѝ)Ѝ:~ 9w$&r umP"U$Ѓr DU4$Ѕt?w$WD$ D$$UֿUЃ[^_]É4$Duw$Wt$ 2YD$D$ $U=E Ut1҉Ѓ[^_]Ër t;U$(腕NjU4$DCЃ[^_]ËPǃr 뫋U tuW3ǃr Dr ^D$$=r Jǃr 1+1UWVS蚜Ïur ))Љ):~ 9w$&r um`"U$Ѓr TU4$Ѕt?w$WD$ D$$UڽUЃ[^_]É4$Tuw$Wt$ 2YD$D$ $U ;E Ut1҉Ѓ[^_]Ër t;U$(艓NjU4$TCЃ[^_]Ë`ǃr 뫋U tuW3ǃr Tr ^D$$r Iǃr 1+1UWVS螚Ó}E$#HDžr fE|81ɃP9u/>3)Ѝ)<7ɉM~=~}|$E$IMAF$U 1[^_]Ër VD$ ED$$譻E$H@F$맋r uP$Ѓr $(肑ƉuE$H@Or aPt $Ѓr @~Pu㋳r uED$$=)Ɖr lǃr ǃr IUWVS蟘Ô}E$$FDžr gE|81ɃP9u𸿿)))<7ɉM~=~}|$E$GMAF$U 1[^_]Ër VD$ ED$$譹E$X@F$맋r u`$Ѓr $(肏ƉuE$X@Or a`t $Ѓr @~`u㋳r uED$$)Ɖr kǃr ǃr IUWVS蟖ÔUELtЋr t'Ǎt$9uǃr ǃr r t'Ǎt$9uǃr ǃr ǃr EPE LEHED1[^_]øUWVS贕éUE\tЋr t'Ǎt$9uǃr ǃr r t'Ǎt$֕9uǃr ǃr ǃr E`E \EXET1[^_]øffffUWVS躔pUE DžXE/tBD$E $p,E $Auv E t E tDž`Dždxhً]/]=Ut Ѓ/u.t+M L +Mkt/l+]utftl+EthD$E $p)%=l /=@_Ot/t?+Mu~.׉ڋt9E щ`p\`d 5lD$D$E $p-YDž`&$`p?D=`=A߉փsetftdl /tf\`Ut9E etE Ĩ[^_]Étzu \`l5pN?t9E tX$p辑1nىf t~uf.륃8/utщ$pňE tE XfE pME /t/tpMpMwM?paM>OM1UWVS貏ç}E ttrD$<$3'xX[^_]Et$<$}賌DžMtAt$$&ymt L8"tƉ<$ۏ1[^_]L1fffffUWVS}<$<r $r ǃr 7tyP-E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEuE1[^_]Ër t$Îǃr ǃr K yEUWVSהu} u <:tu1[^_]8ut$8tu<@t΃}:t& u}:t;UuF~@t[^_]Ät<:u[^_]ÍD$ D$D$$#EYD$ D$D$$DUیԓUd]UWVSöu} tb 8u$ u|:9ƍt&s :t|tu[^_]Í`D$ D$D$$%DoD$ D$D$$C:1UWVSlڋǒƉE 8E10}!H Mu0r t |$$p$;Dž DžUD$ D$D$4$*D$D$ D$D$@4$%D$D$@$QE8DžDž1ҋ9slxȀ %:Dž\1҃ t t DžN9 ΋9rD$D$E$P5xȀ Mp@<#D$$2ߍFdkDžڔD$=D$<$… <:Duz)ED$T$E$EƋt'p<:tu))|:t:Ћ)ȉ)9 )؉D$\$ $MT$t$<$7$y?@E<$艇Dž:΍N9))t$$0r1eN1nCȋ)Љ)Ћ))ӉL$$ÉNjÉC:{DžtE$oM)P9rg8E+~l[^_]D$ D$D$E$%DžD$<$xr $|Njhr D$<$D77dlNj4A0<$譄A0Dž$uD$ D$D$$;D$ D$D$ $X;`D$ D$D$ $;E$KE$KƉ<$h6$<0D$ \$|$4$V tBt(PuADž4$VDžDž$/H $zDžL$T$$4$V18X`D$ D$D$$W9<$ہtE$ <$蜁t> 4$VX> $\u!$?냋E$HUVSmbEM ut.t^UD$t$$P[^]ÍT$ T$D$$ 8M EuM ET$ T$D$$7M ElM E`T$ T$D$$7M E1USshr t$Lǃr ǃr ǃr ǃr 1[]UWVS0ME 8ƋE1Dž]r r P-r tr uD$r $;D0Dq@:#r ux|\u ǃr ׍:\tWut$r $:lDҀ|\tǃr ǃr r $<#Ƌr u$8ǃr r Pr @&L$$!r dǃr ǃr ǃr f:wu<:tAt<|uD$t$$ƍ@E+0[^_]Ër $"uhr $ǃr +r r 0D$r $t r 5r t$ǃr ǃr ǃr ǃr D$ D$D$$N3tvD$ D$D$$37ǃr ǃr ǃr ǃr $ǃr UWVSzÝu} tPtzr t$sǃr ǃr ǃr ǃr } u[^_]D$ D$D$$&2uD$ D$D$$1WUWVS$yҀEu} (TED$=|$4$ƅl$d]qDž<:9}d]V<\ֈmt>}<:tkOML<^uF<:mu‹M])ىύAdD$$]BvljEEd<:u]WF<:XЀvP2MҋM FE1]MVD9ut 0v]M :]U})rtT$<$]UuEEM$[^_]Ë]뽸 y]䍃CD$ t D$D$$/ÍD$ t D$D$${/]䍃D$ t D$D$$F/z1*E$]w<$]w]u4 UWVSv}Eu} uE0D$=|$4$Dž$d]nƅ<:d <:tCZtsu)Cd]D$4$]sUn‰ƹd<:uЉƍX)Ӎst4\$$U]AsU@Љ)ӍsűE[^_]Ë]썃D$ h D$D$#$-E]썃CD$ h D$D$$$_-ÍD$ h D$D$"$.-Z]썃ƏD$ h D$D$`$,)D$4$]%rt-M14$]Yu։4$]Bu]2 UWVS}tr{}E uD$#D$<$R80tN 1G<w/G9~ƒ9G< w91[^_]ÍG<wG@tftƄ/ DžDž)S$O9>:hf . 81Ƀ4uA )čD$ pxr󥋵t$D$$7D$D$$5|$t$$5D$D$$z5`D$ 8D$D$EL$'udurP(1(rBvBDžqfzU nu\8D$E D$E$]UWVSnÙu}U 8E1EtqMyu )čD$UPtMP}y:u}\8T$D$<$6U+ue[^_]øBffffUSmtD$$Dw D$ $uL w []UWVSHmÖtu} }ԋEE 8EЉE1 D$l$*>w u}MfMUT$U܉T$ D$ UT$$FuM vU܋9Eo} u w t%9w t1uЋE+H[^_]Á} u w uD$D$ $\E؅tDEċE؉$`KfxHuPPM3J$z 1 uԋM3JʀuNjPD$EĉD$$UDžuED$UȃT$Ẻ$;EsE؉$^ % ЉD$D$ >6D$ED$Ẻ$ ;E1B9EBf9EwB U؍yM|$D$Eȉ$lEċMQUUȍD 9E89}r5M̉ωփs1tft1HE؉$]3")UuuB r EfUSjqD$ s \$ ED$EU $T$u؃[]1[]ffffffUVS…D$LT$8D$h$U9T$8T$4T$dNL$84j|$t  D$hD$D$tD$ L$8L$$t$D$<$TT$4D$<D$hD$$UM T$8T$`l$LL$P^D$<1D$dP5D$d|$PD$<D$\L$(<$;nD$LL$(9YT$@JL$P2t$l.L$diPVT$l|$Lt$Lt$d5T$l nHJL$lCFĉ4$tt$LT$l9-)D$\D$PD$@UL$8<$OL$8ΉL$8sL$(<$,L$(u D$L9LD$\6T$@r:|$l|$P|$Lt$Lt$dT$hT$$u7nPD$lHL$ltF~뾉4$t|$Pt$LD$lD$l)D$@T$<D$@D$,1 D$4D$tD$0}D$<1|$h|$$ Rt |$D$<$ RtT$PT$`l$LD$8uD$<D$,D$d1@|$LD$h$KR9L$dVT$P4i|$t t$4D$hD$D$0D$ T$PT$$t$D$<$Q(vt D$<D$dt$P@WD$d$7|$,%L$8D$<D$\D$@T$<D$@1 D$4D$tD$0D$h$-Q9|$dV4o|$t t$4D$hD$D$0D$ T$T$P$D$D$<$PT$PtvuHT$`l$LD$8uD$<D$<D$d1H~1T$LL|$8T$\-u3D$d֋x'D$d$ttNjD$dfH @dT$`l$Lt$8t덋T$<΍yGNL$dAD$<AO9|$LlQ:|$8IL$PL$PT$pT$F3M}D$<$PED$ E D$@-D$<$D$<$G[^_]fffffUWVS ELU L}7D$$U U z0u LJB usxfB EEJw9hJ@U 9{<6}|$$kBEU 0ulj΃}EEJ0u1uqH MHBD$$ E [^_]ÉU #U fb ߋrEt9spE94JøEE$ t:t4@t-UT$ U T$UT$V$Љƅu;E[^]ÍD$ \D$D$8, $N@0E[^]U >E@-D$E D$E$2]UVS=DE$ tAt;@$t4UT$UT$ U T$UT$V$Љƅu;E[^]ÍT D$ DD$D$p, $u@$0E[^]UF=?D@-D$ ED$E D$E$$]UVS=DE$ tAt;@(t4UT$UT$ U T$UT$V$Љƅu;E[^]Í D$ ,D$D$y, $@(0E[^]Uf<_C@-D$ ED$E D$E$$]UVS1<&CE$ tAt;@4t4UT$UT$ U T$UT$V$Љƅu;E[^]Í D$ D$D$, $@4#0E[^]U;B@-D$ ED$E D$E$$]UWVS(P;EBuEqVt M>$ I}|$T$UD$ D$D$@$ыU'$ tLtF@Ht?|$T$UT$UT$ U T$ML$4$ЉƅuGE([^_]Í}몉U썃P!D$ D$D$, $?@HU0E([^_]Ë$ 1ҍ}QUE썋$!L$ L$D$J, $EIULT$ T$D$} $E]WD$ D$D$[ $qUUP9I@@-D$ED$ED$ ED$E D$E$]UVS 9@E$ t:t4@8t-UT$ U T$UT$V$Љƅu;E[^]Í!D$ D$D$, $@80E[^]U i8b?@-D$E D$E$2]UWVS:8/?KD$D$@-<$QEt8ED$ED$<$?|$ D$D$$跾E $@D$xD$$E$US7Å>D$ ED$E D$E$J[]ffUWVS8M7F>ÉEċ}u t$E$5Eȅuu}EEEE̍Eԉ t1 E U]M!ىˋuM! u t뷋]u!M܉!щME܋UM t1҉EԉU؉ƋM̅t_Mx+Mw&EEԍHwq{E@N4$]7tEԃ0<Eȅu tEtJM\Eԉ0҉Q0A0q AEЃEЃ8[^_]E@uU\UƀtUMƍBEЉ4$]6tU@^GE@uQ4$]6uT tOFvGE Fv5 *-UЉrBEBEP-DptGEЉ7EЃ8[^_]ËEԍPEP-PUȅE\@sEU\B0E0<UE\@aEE\@nEpE\@vEUE\@fE:E\@rEE\@bEE\@tEE@0@ 0E^?iE\pEUWVSh3]:}U EEuEE tu$U 5UtT t! tT$U8$1Ut==lGG W[^_]ÍB߃]wʃ=uËEEuEEU }[^_]SUWVS2Ù9}u EEEEEE4$3uI.h v.%GG  O[^_]ÍN߸?tċEEEEEEu }[^_]_uUWVS18ƉʋEE 8E1x}} EuD$$-^ D$<$e-e xDžE %@  1)ttu䋅D$ v D$T$<$Z2x9 tvu1ɸ)u)lj9usu$yD$$,p 1󫋅Et# 9uE t *H uE t 'H uE t E t E t E t "E @u \E HE 2 !L$ L$ U T$KL$$ׅu͋$.$.$.$.E+DĔ[^_]Dž:D$ D$D$$D$<$)UDžpuD$ D$D$$LEj1UD$ D$D$$!D$ D$D$$$/X 1󫋝8Dž-t0)؋t9D$t$$-9.9Ëϋtft6tt$V+$H+$:+9&!Ɖx!։|x| t1ҋ9ÐD$ D$D$$ $+…t01DžDž1 t1 !! u e눋 09Ћ!ȋ!ȉ t1ҋ1YD$ D$D$$*<$+t 01s^!D$ D$D$$MD$ D$D$$ "p fEqX#111҉mldUVS&i-EE 8EE EEEMED$ UT$UT$$1!xEU+u [^]1BlUWVS &,EE 8EEEEEMU ED$ }|$}|$$xEU+u [^_]1kUVS}%r,u t44$ D$ UT$UT$$1ҍE=[^]1UVS+% ,ut54$U D$ ML$ML$$E[^]1UD$ ED$ED$E$M 1ҍE]UU D$ ED$ED$E$ME|]UU E D$ ED$ED$E$MEI]UVS>$3+EE 8EE EEEMED$ AT$UT$$1xEU+u [^]1 jUWVS#÷*EE 8EEEEEMU ED$ A|$}|$$kxEU+u [^_]1iUVSE#:*u t74$D$ AT$UT$$1ҍE[^]1UVS")ut84$|U D$ AL$ML$$E[^]1UWVS"Î)}u t74$D$ AT$UT$$1҉N[^_]1U9"2)D$ AD$ED$E$M 1ҍE]U!(U D$ AD$ED$E$ME]U!(U ML$ AD$ED$E$ME]US {!p(EEEEED$E$E []UWVS$5!*(DžE = tIƍD$D$ t$|$$%tyDž 9AD$E$uƋI} t9rcJ8 uv9t<$ $Džf9t4$e Ё$[^_]ÉUE D$E$K]ffffffUWVSqf&ƉЅtK Љ Љ Љ Љ Ѝx|$F$xtBF~1[^_]ÉUQT$ XT$D$yِ$E냸UWVS%ƅ9N rn~PRuF$D$ D$L$M<$褜^M΃ډE:BGuETB[^_]ÉUy(MED$|$F$DMҋMUu~ LЃ[^_]ÉMUQD$ @D$D$ِ$MUMD$ @D$D$ِ$M9N r~y(MED$|$F$CUMu~ 1UWVS$ƉυZF(JJrPf~Jtt$ $ uKLPthF%=@=\=DĔ[^_]Ott8t$tB$Ot9z |1tft Ĕ[^_]fx t~B8z<~ ^z0Z4FB@zT.IBpDp@PDH41ًP01 uH<1t3P8 uҋpx9t<|1tftFĔ[^_] nĔ[^_]ÉtFD$ LD$D$ِ$ttQD$ LD$D$ِ$tkzUtBT%=.8t f{f{UWVS E։ʅE@(tvBXU$U@PxTZrtftP,}WP@ @J@ @@[^_]ÍU$ptxTULYHP놉M썃QD$ 4D$D$ِ$U"U썃`D$ 4D$D$ِ$U1]UWVSîljօxlxD$$tE3G4U3W0 u|3G}F)uGHf fű~t$u} EHDu@8/tF(t`F[^_]ÉUD$D$@($ǃUtq#F<$b<$ufF몋E@[^_]ÁN(iQD$ D$D$1ِ$oF1p1UWVS:/ utpdp7u4E4$u(4$E$[^_]ËF$$뿋F$$F$$F$$d뵍D$ D$D$B "$蛻aUS t @-D$ D$D$E D$E$l$]]US ;0 ED$ D$D$E D$E$l$]]UWVS8 Ɖ׉t,M=U= =T$E؉D$E܉D$ L$|$4$[R=ƒu܍M؁ ʨtUEԃ8[^_]1EEkEhEEMdҺ뱺몋U른s"كؽ8[^_]1U@-U E]UMU E]ffff̀rS[Ä`[̀rS[d`[ ̀rS[D`[US3(EM u Et9u[]1[]UWVSu} ttB|$4$v[^_]ÍD$ D$D$BT"$諸uD$ D$D$CT"$}UWVSeZu} ttB|$4$[^_]ÍD$ D$D$BT"$uD$ D$D$CT"$UWVS@t$0D$T$L$4D$4t "|$GD$8UT$$\$0踪uL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0藹D$$T$ D$(T$,D$T$ $D$ID$L$8D$9\$0"D$8D$E $]D$@E$,E EUP ]P]썃ƏD$ D$D$"$被uu1]uUWVS^S}G $wt6$uG[^_]UWVS u} t"tL D$ $荢[^_]Í"D$ D$D$:"$ªu-D$ D$D$;"$蔪UVS8}rut&f== = ED$E܉D$E؉D$ T$E D$E$A=t3w Ef>@fFE܋UVtfNȃ8[^]FfF1E@EÿE?EEURҸFfFFfFs1]fffffff̀rS[$`[UE]UWVS$E։ME}E؉Eut[E9UsH߉։]EƋE D$\$4$U~" HS9uE)9ur‹]ڃmu$[^_]Ím=D$ 4D$D$r"$KEQD$ 4D$D$s"$"UWVSXEu U E } XE EE̋EƉE$]Eȅ EE MȍANjEȉEԃ)֋]ދuމu؋ED$E$M#EȍDMԉED$EED$E$U1ɅM9uREEEȉEEEE؉E܉}ЋEM4u}؉9_u E9s#ED$ED$4$U9Etщuă9UM]+uED$T$U4$U}9NjUt +EMC1ˉUE‹E9rU]}M9MrED$ED$+E$UEEE‹E+EMȉEuM9M}ЋE9 EEE]ԋ}čGU9Eщ}U܉EA‹M)ʋ}č M9xȋU)Ћ}lj}ԋE9E9EM]ED$}|$]$U}]UEE؅:U!ED$\$<$UU9~ ]E9rՋE9M̅pU܋E 9r}G9D)EE܋M܋E}89uM܉E}9}M9M M]E̅uU܋E}Ћ029r}GU9CЃ)E܋}EԉE9DEԉEGED$E$MEEԉEȉEċEEȋE9EEĉ$]1X[^_]Éˋ}M 9sWEƉ}Q+ME }uڋEE‰]MĉEE HZ9Eu]M9r}M8E}ljMĉ]XJM9uˉM]9sMˋUMUuދM9U]3]M9ËED$\$<$UM9Ӊދ]19ME9Ms?}u}9us'<3ED$|$E$UU9~؉9urً}uE9Zu̅U܋E 9rUB9)ӍCEE܋M܋EU‹9uM܉E}9}[M]U9UU̅U܋E}ԋ029rUB}9G)XUE:}܋u9rUB9)]E؉ËuEߤ9uu]]Uމ+]9UED$\$<$UU9ЋUlM9se}؉ߋ]M ֍E9}s8)1ÍED$T$UE؉$UM9ȋU‰9}rȉ}EE%}܋u9r}G9r))]E؉ËuEߤ9uu]]Ҹ}܋uEԤ9r}GU9s/}܋uEФ9r}GU9rщ)EMċU9EȋMĉMȉEU9UrEЉE}ЋEMԉE؋MuuEU)ЉEĉڋE]XJ9u]uE}9EŃ}tuED$}ȉ|$Eĉ$]H}!]D$ DD$D$&"$z]8D$ DD$D$'"$HÍD$ LD$D$x"$E*]D$ LD$D$y"$ߝ]LNUUT$D$ ED$E D$E$y]fffffffUWVS ]VEuNt4~^ȉMtH1ًP1 uN9H u [^_]ËMM$]%t"N^HXVP MF [^_]ÃUWVSudp7uu[^_]=F$$V4$*NjF$$A[^_]UWVSti}E wuq6tk9uFNW9V uW1ʉUW1 UtGD$ D$L$$GWG1D$<$StG9F [^_]ÍT$ \T$D$i#$輛E LffffffUWVSÆu8F}9FiF FD$ D$D$$$FVFD$F D$$FtotfxWFvthV uAzN)91FJ u M ]z u F MЃ[^_];1})81F u1UWVS}}dp7t2G$$D$<$ƋG$$[^_]D$<$Ɖ[^_]UWVS  莟E脟dp70E@$$蓯D$E$,ƅ@ ‹} >HE@$$(tlEM 1 [^_]D$E$ƅt[P } uuuF脞uy}8눋E@$$藮_uJT}8E Y=If뱤&fvft  [^_]E xDE xfffffff̀rS[`[ḃ̀rS[`[UWVS$utoEEE E-8D$D$ED$ t$D$E$ƃt 1$[^_]8 uۜ8ፃ`D$ pD$D$< #$3bfffUWVS0 ƉE̋]E 8U1xu2  t8u)؋U+0[^_]Í}1 r}̍]ȉT=Ѓu]t; t\="t]y$]Ջk1d]̍U$fffffUWVS}U utrt<Ѕt .t&HOtuxu)Ѓ[^_]ÉU 6D$ D$D$=H#$艕U 뒍6D$ D$D$<H#$ZU \fffffUWVS1&M} UthtN49t8u)Ή)t3ttu)[^_]1<$[Ɖ[^_]ÉUM6D$ D$D$A#$膔UM]6D$ D$D$@#$QUM$US2'Ey |b(9~)ML$D-D$E $1[]ÉD$ FD$ED$E $薘1[]UVSòEy |b(;}.D$@D-D$,w 4$r[^]ÉD$ FD$D$@,w 4$[^]UWVS=2u} taEtHL-EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]ÍD$ D$D$?#$誒uD$ D$D$@#$xFffffffK̀rS[D`[UVS5*ulimNA90%[^]Ëtph9rltp[^]9r싋lUWVSǪ}l^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓tp419|[^_]Ë]싃tpu޾ UVSÕL4$AulU4$$[^]ËE4$ [^]UWVSC8} lEqLE$ʥl@}j}wMǃǃǃGlhEG1E$]E[^_]Ã}?vB}<6lp)ȉЉA[WlЉU艃hEPpU)ЉB}҃?}Ƀ}Ɓ}tWD$ D$D$Y$$蓎`E$0EUWVS aVlEEẺEыE)ȉE䍃LE$ǣɋUl@EHlt)̋Eʉp1thE$UT$D$E $;Es17[^_]"썃`D$ D$D$V8$$<N謐UE U9r 9]ø]UU E9r 9]ø]UWVSlw lw ulw \8E1ɍt-ωD$4$&t lw PEu׉MD$D$4$ MtMljMuD$|$E$ lw 8Ftt$E$ 4$uMEtw 9t$$ǃtw ǃpw [^_]Épw TD$D$$aa[^_]UWVSu} t%>D$4$Itt=t1[^_]À=t[^_]UWVS0%ut4t$<$ƅtD$<$ 4$[^_]ÍiD$ D$D$\$$͈UWVSê}G$ƅtx @D$$f[^_]UVSh]ut/t$$tU 9P [^]1[^]ÍiD$ D$D$\$$ UWVS U\8E8s7i1}ƉUE D$ED$<$~u E <=,ED$<$Åt:<=t4D$D$<$xU \8D [^_]1 [^_]UVSþ$:u [^]É 01[^]UVS{$u [^]É݉01[^]UVSC8$贛u [^]É蚉01[^]UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu#B[^_]ÃHPtJ ȃB[^_]UWVSӉ΋t B SuUtBu{QtBunQu Q9tW[u믉 St2tAu(t@uAt@uSI[^_]ËtBuBB[^_]uUEU P@@ ]UWVSEpVUu 3t)+~E D$|$F $EЅu׉[^_]1[^_]UWVSExOtX1҉UM~]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSExOtX1҉UMy]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSEpEFM ]M19MƃU;\tkCEZE [^_]UE [^_]L돋 u{Etu>E닉Lt9ur 눋}bM υtIMyED1uLC yvyEE)fffffffUWVSvƍt$<$Bu[^_]D$ FD$t$<$L[^_]ÍD$ D$D$X$$g떍D$ D$D$W$$fcUWVSȮý}u tt$<$u 1[^_]ÍF D$<$ftF t6u$FD$<$苚tăt$<$x뵸[^_]ËFE }F[^_]nD$ |D$D$x$$fRD$ |D$D$w$$eUWVSŭúu} t tJD$|$4$_[^_]ÍD$ D$D$g$$seuڑD$ D$D$h$$EeUWVS-"}u tet$<$,u 1[^_]ÍFD$<$˟t~uD$D$ F D$t$<$'뵍D$ XD$D$$$dqD$ XD$D$$$ddBUWVSI>}u FFt 1[^_]Ét$<$&tFD$<$ϞtӍFD$<$tF D$<$tt$<$ڗ랍D$ HD$D$$$cVD$ HD$D$$$ac'UWVSF;}u  GtNu$G tWt)FF[^_]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ ,L$D$$bE GFG F[^_]ÍD$ 8D$D$$$$-bL$ M썃8D$D$%$$UaGUM6G EL$ L$D$ $aE   FFufffìrS[D`[v̀rS[$`[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVS聨vu} Mt}t]MF9tDJuMtL} XU tz9ut@[^_]É11fu1[^_]1MD$ D$D$;$$_MND$ D$D$:$$_MfUWVS(ncƉЉ 8U1҅D$ |$D$${z<$T@9EED$|$$Fu1U+6([^_]E @NteulN u`L$$ $SHN tD$ &D$D$ $XE4t9u΃tft%D0 `T$ 0T$D$%$_]2T$ 0T$D$%$$]FD$ &D$D$ $>Du-uFfUWVSdYƉЉU 8M1Ʌt=~t3 E+ȁĈ[^_]ù۹Dž9FfXtvEtoEfD$ &D$D$<$B<$Q9E]ED$|$$-Vu5F~uN uF=tu ~tMEEhED$ t$|$$rw4$"P9E}ED$t$$M1@FȉC:9DžM9FF ftV ffuu҉T$D$ D$ȉM)D$4$=Mx 9=EtEȃiviD$t$E$ڿ1T D8D$ &D$L$M܋E$=M܅x9E4FD$ )뻋EYQEE@DEԋ}1AE؍1E܍xEЋE؉M؉u E8EЉT$D$ E܉D$t$ $M[<MH9@)ƃu1q҉Ű}UT1AE؍1E܍xEЋE؉M؉u ET8EЉT$D$ E܉D$t$ $M;9M)ƃ9}u1MFD$ &D$D$}<$s;<$IM9L$|$E܉$ԽMUU܉D$ D$ȉM)D$$;M}9nD$T$ ֞D$L$M܋E$:MUWVS@VKlj΋E 8EG uY$ato|$$bt9wuҋtD$G $kJu1ffh$tOEtPD$ ED$4$O'PPuEt8u x[^]ø[^]ÍFD$ <D$D$X%$JqUWVS(f[ƅt Ftt 1([^_]ËFy ([^_]Ãu ӉM܉ЉUUMxy=fuVfǃ8 8 f|M܉U9D$ HD$D$X%$IM܋U0u?FtTtG1M}|$ }|$D$$*B0@MQVd&<볍3UWVSƉׅt4tdvu 1[^_]É $GuM8T$ $T$D$X%$HMuM9T$ $T$D$X%$tHMlMCT$ $T$D$X%$…tKX MH GBG B GBGBZJBB!F^ ߋus%uu Ѓ[^_]äЃ[^_]ftug+D$ 4D$D$X%$QA0DD$ 4D$D$X%$"Af mUWVS&Տ@<ϋE E( 8ƋE1  ( @/ 11 r} !8} t } 0<Hf@fPffL< 8Px HD$ |$ T$L$$蒇…L?@@ u+DL<$0ЅLDHDL} t!} t} tDDž6H<$4=HD ɅLP9yHDžLDžu4 =81HP9H4D)ȉ,D$L$ t$PD$<$Dž@@ uD$0Ѕ[<$f&G$ƍG$߈W 8f &} } l} 9U qf&! 8$vf8G $df,G$Rf&wD$|$ t$PD$<$…c@@ ։<$2=>$}…(88,,D$|$B$触8 ,&Lt!9 ft LL1.Bvq'tlH$9}NjE $,}$]~|$t$D$ D$ %D$D$$%81H L)Pd8pT48 DH8@@11HrLXDž\Dž`HTtDžxDž|$@(4)L$@P#LP3者1.} 1-D$|$ 8D$PD$<$ƅ@@ u<$0Ѕ8Ɖ<$}/P9,| rGL"fǃ8 DfGljfWtuˋW҉NKE+&[^_]Ía0DD$$jZ(FF FFFFL 9u8΍ Gt‹@u iDD$$t!H󥋅DD$D$ D$D$$%81Lx $&臂15M(18<pf1f14DD$$SW 8FNN uuD4$,DD8 D$ D$D$X%$"6PD$ D$D$X%$5 N_D$ D$D$X%$5($8D$ D$D$X%$5D4$ +DD8,D$|$D<$"8ЉD1_ <$}w1#Lu .8t189 u拽,t t҉11UWVSpw|lƉ 8NjE1>$\tB$Bt11 rFFtGGFUF19~1ɀ.уu9`d9@ HDPDDžDžDžDž<$Q88=}3G u$1ҋ~`{Y}$z$z1xƋND$F D$F$Ƌ@ut2OD$G D$G$tF$-z$zU+p[^_]Ë넅tJPd9\.$1ҋD$ D$D$$qu~d,@}뎃1@<tE12Dž$1ҋ. {u@ z81.늍`D$ D$D$ X%$/$1ҋg{z@u6mGzHDPDE$wy1jUWVSvý}EhpPt%={4DžthE11҉ rMd11҉`d r`VtA<$q49y.yt[^_]ËhMEEdUMEE$1u`11 rU؅tkhd<$3hE[^_]ËhMEE뀋hMEEd<$c3ЉddiX2\P}`1}dX  rOTdDpPmHXLƋX9H`D$ PD$D$L$%hL$P T$ D$HD$l$6xWE11҉ rlUEE!$\X;l$Rt9T#X\dwc\$1U`U؉h<$1h(‹d뎋DA‹@uDsu[^_]Í9D$ pD$D$rX%$k*UWVSn> t1҃me9Gh9wGw9uhtQl$|dL 9u`q@D$%l$h[l$至…hl)D$L$4$|XdX`phHP HLT v~u~hxa G<FEu11 rE@t`EEEE<$8ML$ML$D$ |$D$E$twEЅUp[^_]É<$MML$UUT$D$ |$D$E$t?E$X_p[^_]ËUEtFE$yXgMEԋAE܋A EAEAEAEAEEUԋEg{EЉƋ@uj~ZUWVS\ RWG^ 8NjE1x D$ D$ D$ $jƅ8#3D$4$D$4$xDž< < D$4$cxt$$yt띋AAA AAAADžD$ D$D$4$ ~#|$$u@D$E$1ҋE+Ё\ [^_]Ët։։vt.ttދ$닉8D$ D$D$ X%$a 3`D$ D$D$ X%$& IUWVS4SZEȋE0xU11  rŰ]ȍD$E$mEЋ]̍EЉẺEEtCË@uE)uEЅt $]gEU4[^_]UVSNSCZuD$F $uOtP PH p[^]UWVS@SYljE 8EG ut$t$$tӋD$$tD$F $ue$@=wI$‰@=wЋЉ==1U+@[^_]Ë~D$<$Dtu狵1DžЍtftȍtftD$D$ GD$D$@$)9OtD9AD$D$G$!t<0L9_YB 9@3t9'9uۉD$D$ $藃ut$ D$D$$+u9u [u3fvfvBfUWVSOV}utHt$F $E $UF t[^_]ÉE4$zE[^_]Í`D$ D$D$&$fffffUVSÉ1   lLLLL9r[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVSGÌNut0FF#EgFFܺF vT2[^]ÍD$ $D$D$ '$8UWVS GNEWU P?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPE=E);UEމE} ]7E@9rE)uu U<u sPtft[^_]äft.t&N] u]tugT$ T$D$ '$EU |ET$ T$D$ '$[EGf2u S'fUWVS$DKEE} 8E1WEEG?78)‰T$LD$<$ND$ED$<$7EX1tftE+$[^_]úx)r D$ D$D$ '$D$ D$D$ '$WZfP轉UWVS$|CiJ}Ћ]E E 8EƋE13P-8}DGt`EE؉<01E 1҉M܉MLAt;}t^}׍T3y1]E+$[^_]Ã}u-t( fɃa) 3믍NȀw볋M܉<.u9twQ3ЋEDP{<0#s߀XtXEE1҉3)AtstEt)Eԅʉ s1EE EM M 뗁EM tEF]Ds@9o]xU ED$E$u ]ËE]f ̀rS[G`[UWVS0@GuE 8M̋U1xu1 t8t)űU+u0[^_]ÍMЉM11ɉEċEȉ rEčۃTЃut( tۃ\"u|1w@UWVS?F}E 4UE0 8E1;q,hEED$E$ D$h8$ hǀPǀTǀXDžDB$M78H"Dž@DžL0D$ ,T$4D$8$ƒ8B4D$H$;4E+Ё[^_]É,CD$ D$D$<T'$^,,D$ D$D$=T'$ ,THt$>r BU=DUT$ U T$@-D$E$]UED$ ED$E D$E$y]Uk=dDUT$ U T$@-D$E$B]UWVS$5=*Du4$uE荓UEEEEED$@-xX<$ E؉D$<$D$<$ $[^_]UWVS<ÒCEX 8TE1D$D$$ƍ`$1D$XD$$P^PT$D$i4$4$t'pTU+İ[^_]\$V\t~։P6tN~ tu틅XD$F$"uԋPGX$XcP$1A$]UVS; BuF tF 1[^]ËF0$;F0F($~;F(F,F$e;FFN D$ē$FtF 뇍D$ٓ$t F ^YUVSI:>AuF uu,F [^]ËF$WFF F tԋ$F F [^]UVS9@uF uetaF0$_:F0F u9D$D$ D$D$$gF0[^]Ë$f 뷸US] $)1U C []UVS+9 @u4$F$9FFF0$9F0F($9F(F,[^]UWVS8ö?E@0}  ML$$Ԭop< t< t򍃇D$4$褬?x4$fM Ay EpE pED$<$[tbP1tJ< t`< t\E@H9tTE xFE7ED$$tgPuuE @4E [^_]Ã됉U }OD$G$4DžUtBExE xzt7@ D$$ 3ƋEp0E$01jUWVS$7=EuUE@ u*x(9P,ӃCtftEp(ff} GуbF9SNO F|>L)/9!A)‰UtEHE HU1EE.E HFD)ЍtEx9EEPB9uҋEPU@E]?ED$UT$E܉$ \MuTMEHE Hb@ ]D$D$ E$[]0E$E@$5E@@@0$5E@0@($5E@(@,T01$[^_]ÉT$<$]2DžqEx(UP,ӃuCu*E $[^_]ËEH!fZUVS.4#;u F tcu.tR4$(tEED$4$+tE[^]èu?V$ED$ ED$T$F$ t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$b[^]ÐUWVSh]3V:E̋UD$D$}Љ|$ D$D$]̍4$^8vEЉ$+cD$D$|$ D$ED$4$8U"}91E1EUxu0P)uftf9XP 9rUEMȃ_UMEȉMȉ$]J*EMȋUzUċE]މuL$D$Ɖ$]uUĉfEU{u7Su%uftf;s+s up9rU$]12MAu9rAE01h[^_]@t`X Eub MȍLM9Cu8fE9$e19OK fMču11҉  ruu؋SUU΃EtfEtMtu}ȉ}шUvtft}rMȍTUs!󥍊M9.oEE$]0~E$]~0eH MEM1ɉ}f]}tZ߃ uЋ}]E1ɉ}E} tEuЃ̋U؋uVU܉VFSVs u1ɋ}tփ uE1҉]ËEt-EtMtm7E u؋]uV U9t$.t&tZ봻u}ȉ~ utftuN yu MuNEjM}ȉyutft֤Ӻ}E9PEƃEIEuȉp1MrEtfEtuuȃEM}ȉyutftEEfÍD$ D$D$]x'$}]]wUu'u M3fmJM뿉$]=-!UVS,v3ut4$-[^]Í0D$ D$D$/x'$C4$,[^]US ,3ED$E $)_[]UWVS +2E}} 'v?NBCDt]U1 [^_]ÁB u$<#ƋEEFGEFWUV O MN$W$=WV(F,}E=V-~U V O(N1t)NEȉF99U9} 9U4E E= =w=w=?w=ED$D$ 11 +D$$D$]WF4N:V;m]4$*P]ۃV(F,}EF-~E F O(NEEfE= =w=w=?w=ED$D$ 11 +D$$D$]PGV0N8F9/r<11͸11UWVS(/D$E$ƍxD$4$}и9ED$D$t$D$ D$|$$葉t4$SttFD$D$ E D$|$$t Ĝ[^_]É|$t$[1߉4$R1ȉ4$1UE@ ]UWVS'.EEU ;P snH,X<3t;t-?19r09Pr+HE)E1[^_]?SӋ?̋]Ӌ]UWVS$'-uF$ED$ F(D$ED$E $O~;N:]f4)ЉMЉF$)É]]]f4)MЉF$)É]Ef4E)MЉF$})lj}F-VMуtitT <ωf0ED$ ED$)N8N9^ )߉|$4$K$[^_]Z D$ D$D$ 4$-{|$D$ D$D$  $z|$FD$ D$D$ <$z( D$D$ D$D$4$z}艽EЉT$UT$ D$'D$$TAP-9D$$)Ѓuf~fffrD$ftD$$謻1|׋D0D$D$$f9|ҋD$ D$D$=$Н1D0 DAu.L$$Q9|ȉD$ D$D$ښ$XaD$$ vD$ D$D$k$՜fD$ u;D$D$t$袜lD$D$$m1|D>D$D$$茹9ԋD$ D$D$=$1P-D>DBu.L$$u9ċ+$D$D$$ǸZUWVSh]EĉED$ED$E $b&D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,yaD$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,aẺEEfEEEfEEEfEEEfEEE`t2 u&FlUopU x;uED$|$ `-D$'D$E$E`t jED$$;E`FED$ D$D$Ȕ$8D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,_(D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,"_D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,R^rD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]ND$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\*E`Yl‹w puED$ t$D$E$l‹w p8uED$ t$t$E$訲kWZ PH8uED$ T$t$E$ekWu Wz?uED$ T$t$E$'E`t tED$$ ED$$1ɋuEED$$ EED$$@EbED$$EEEf Ef Ef EĈ[^_]Í T$D$ D$D$<$.o D$D$ D$D$$UnU D$D$ D$D$4$n D$D$ D$D$$UnUP D$D$ D$D$4$NnK$\D$D$E$4Ĉ[^_]ËED$ D$D$$詒ED$ D$D$$ED$ D$D$$UED$ D$D$$+ED$ D$D$ݔ$dED$ D$D$ٔ$בED$ D$D$Ք$譑@ED$ D$D$є$胑ED$$ IUWVS$l auE } 8U1D$L$ t$U‰T$$ xVD$t# $U+u#$[^_]$."1OUED$ D$E D$E$]UWVS v}ED$|$ ED$ED$E $ x8Ɖ<$uH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$E 8E1D$|$ D$E D$E$&…tD$<$E+u Ё$[^_]NUWVSj_}u Gu 4 Gt*D$4$趞uUt E[^_]ËEtE[^_]UWVSuZe~M u ( ~t9uUt E[^_]Í L$D$ D$D$<$iEtËE[^_]UWVScXu} dVu + Vt!9>uMt Ev[^_]Í|$D$ D$D$4$#iEtËE[^_]UVS u,d\l Bt ;2u[^]Ét$D$ D$D$ $hv [^]Ét$FD$ D$D$ 4$\h[^]UWVS U} tdUfc~U ~t;u[^_]Í T$D$ D$D$<$g[^_]ÍlUVSÁ ub Bt ;2u[^]Ét$D$ D$D$ $^gv [^]Ét$>D$ D$D$ 4$g[^]UWVS u6bw$ wWvK B v|@vF[^_]ÁvfT[^_]Á 5[^_]Á v,낃@t9u~FjtucoOeD?9.M#yp &1t$D$ D$(D$<$ce)9#[UWVS }>`YD$t$<$`x [^_]É|$&D$ D$(D$4$d[^_]UWVSi^ }_ rt;:u[^_]Í |$D$ D$D$4$:d[^_]UWVSL 8E1E <tmD$D$ D$.D$M‰ $McMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$MoGUWVS4&EEEE$襮E܍U}}؉EUEEU t 14[^_]Ã?uuU<-E<+u JMBP-DK~r1ɍ LH>vD{uU 4u<.}DCuuŰMэMܨ@uM1ҋMDK@u49rMԄMDC@&E DS@tc9rEu ]Ԉ^^FEȉFEȉFEȉF EuuEE9sEiEԋ}DC@u>1ɋUDS@u%9rUȄQUDC@NE9>DS@uE9&ENjUDC@ub1ɉUЋUDS@uF9rUċUЄEĉEDC@Eu9sEDS@t|9rz}BDCz}4BDCu;uJMBEcEE]z}DEBDC1.t&FUWVSǎEM HMHMHMXˁHɁ@ =+-EAE-ENMb֍)É]؉л))Ɖuԉމػ))ƉuЉ]̅EEMbӍ)Mȹ))Ɖ))MUĺQEM)U)MEJ$)CEE4$CEE $CEUM^]EaE}d\$DD$@ED$<]\$8T$4]\$0]\$,]ȉ\$(t$$L$ uĉt$ut$u؉t$uԉt$uЉt$ ủt$(D$u 4$\E$Et $Et $E Ĉ[^_]ú)‰UiEESEW)L u RE ; er@ror:@ unk@ nown@ LOC@ RR @vers@ionE Ĉ[^_]ÍsEs}\$DD$@sD$*tQ<.tAx[^_]ÉȅyET$ ( T$D$\($^E[^_]Åt<.1[^_]UWVS0 VE荰EEEE$PlPHH8|$ x|$x|$@ D$L$T$ ɕD$D$4$ ~ Eƀ0[^_]UWVS{pu Gt-D$4$Ŏu?E tE [^_]Ë?D$D$4$ukVP-DPtMrD$ ED$4$JKҋMyE8m1Ɂ]1VUWVSÀul\ Gt-D$4$Սu?E tE [^_]Ë?D$mD$4$ukVP-DPtM肴D$ ED$4$Z[ҋMyE8m1Ɂ]1VUWVSÐu D$4$譎FFy ;F|/} t)P}D$4$衎[^_]Ét$E$襝US$EM QQy ;Q|< tZ[]ÉL$$W[]UWVSEu E$\EEEEED$4$ÍF0u ǀED$4$2}D$4$贍[^_]UWVSH=mRP8uWV@tWufFuFuFf~@tJD$4$`lj4$$R[^_]ÉV@ut"Fu먉F룉4$hfF@먋FuxUVS{8Fu t$@-XD$ D$ED$4$[^]UVS2'8Fu tE D$ D$ED$4$[^]UVS8Fu wtED$ E D$ED$4$2[^]UVS,Ì8Fu *tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$,[^]ÉED$4$;EUVS8Fu t2ED$ED$ED$ E D$ED$4$[^]ÉED$4$EU8U]Uxq8U]USZOED$8$[]UVS,!8Fu t$ED$ED$ E D$ED$4$[^]US8$[]UVSç8Fu Et2ED$ED$ED$ E D$ED$4$[^]ÉED$4$rEUVS ?48Fu t9ED$ED$ED$ED$ E D$ED$4$ [^]ÉED$4$EUSûED$ED$ E D$ED$8$[]UVSx8Fu t4$[^]JD$$dUS0%D$ ̕ D$ED$8$[]fffffffUWVS E8tj׉ƅt|$4$2Qt@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVSVC}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$E#T$ D$D$x)$ -EE룤u9sftuu_SfӋ]KUWVS0A6E׉΋UU܋U؋U$TEM9L9My2E荃EEuuE9D$E$st4$ME+x4$MyuE$EȪE؉Eu܉00[^_]ËuE$Exu)y9uωE)T$ $T$D$x)$ؤE1UWVS$î]Uϋu M MUL$T$ L$U‰T$$EEdËUv‹9EuC9@@EJ}B$[^_]Ë]t*]t .]{<|.B]9Z.EM9s;D$U썂#D$ D$D$x)$ -Eډ)؋ux$[^_]ÿ뛉댋]썃6D$ x$D$D$x)$뷋]臨EE}8UWVS(]Ӌ}u UUS9)ÃEM -U썉#M u2D$ED$ D$D$Ex)$EJBs1([^_]É4$Ex%([^_]Ë]wEEUWVS+EuE(M,} M0t 8xU1҉}$tt$$JNNƀ?E4$lDžU4T$|$E$Fƅ9s9D$#D$ D$D$x)$ -7)U4E$NjE$|$D$4D$ D$dD$$VJNj $‹>|$ $}Mtq}whM 򋽤;qt#t<.)z<7|0.M$bU$AD$T$L$3D$ D$dD$<$/I‹$9|œ|P-f @)ȉ~ DžƋȉD$D$<$<9u׋)$$|o|$ $1ɺ0yf; F01x JDNu.9uҋ‹)‹<$9VƋt)xE+1Ġ+[^_]Á}e}$# M$RU$[=VE4$(x2D$$1ɺA.:f; @tE4$I~벍D$D$$U yƋt)9MD$ $D$D$%x)$Wn}$<$wWD$BD$ D$dD$<$+E‹4$t$D$ }$4$fN~F$$T$|$L$D$D$ D$dD$$RD‹ $$ 9*4$3 $D$|$ D$dD$$C‹ $$Z4$$+D$|$ D$dD$<$dC‹ $4$PD$BD$ D$dD$<$C‹4$_t$D$$U b)D$ *@t$L$$94)51E)0~0 $09&4$a‹$Ly}$<$WIL$T$D$D$ D$dD$4$nA‹$E$HD$ *@t$L$<$2'M)(1E)0~0 $,b09`(4$ ‹$y*D$Bt$ D$dD$$D@‹ $GGD$t$ D$dD$$?‹ $DzG$D$t$ D$dD$4$?‹$&wG9D$|$ D$dD$$?$dy$Fƅmlj$2}u9$wM$)R|$D$ $U <$N|$T$ $<$WD$Bt$ D$dD$<$i=‹$D$t$ D$dD$$=‹ $qGD$t$ D$dD$4$<‹$']99D$|$ D$dD$$K<$y9;$kEƉ9$!yV}+}$B<|$D$$U Z<$|$L$$U <$T)ƒ=эR;}$}4|$ t$D$$.4$9s?D$#D$ D$D$x)$ -։)׉}4GD$ٜD$ D$dD$4$9‹$IG9Q$Dž1pƀu1$Dž |$D$ D$dD$$9‹ $^QP9N#$ 6@t$D$E$$S24$Ë$k}$L}4|$ t$D$$譪4$e9s?D$#D$ D$D$x)$ -E$ VUUU)ȃ=l$}$fr@<h  }$ZD$Bt$ D$dD$$6‹ $BxGGD$t$ D$dD$$6‹ $!GD$t$ D$dD$4$F6‹$GG<}4|$ t$D$$膨4$>9s?D$#D$ D$D$x)$ -։)׉}49)=G$B}$"4$F$$QD$t$|$ϜD$ D$2D$@4$~4‹<$|$D$^}$c<$AWD$BD$ D$dD$4$3‹<$P|$D$$U Q<$0|$L$$}$}4|$ t$D$$.@t$$=D$D$$U ) 1k9t؉4$nD$D$ D$dD$$K2‹ $yED$dD$ D$dD$<$1‹$R|$t$$U J<$-F$t 4$p4$eD$D$4$4$|9E4s3D$#D$ D$D$x)$ ->&D$D$$U `9kF09\Gt1Gt`$D$D$ D$dD$$/‹ $LuP~F$B=  $u|$t$$U <$Q4$~$XD$D$ D$dD$$.‹ $<$|~$D$T$ D$dD$$.‹ $s<$fF $F $D$|$D$ϜD$ D$dD$<$-<$G$|RT$D$t$D$ D$(D$4$"-‹$}U$r VUUU)ʉЃ=p $-^E$XRD$AD$D$3D$ D$dD$<$^,$}$fR<$0G$"D$t$ҜD$ D$2D$@4$+‹$']4$9lj4$$lj$k$T}lj<$L|$D$$U xt9HMD$ $D$D$Ex)$<x}$R=t9M $i)_}3$.x$YG GGDž====Dž$Tlj9kw>9Gt1Gt`$D$D$ D$dD$$'‹ $4juP5G GGG GG GGƅ=G GGG GfDž==ƅ=W GGW GW GGW G$,Dž====fDž==e)RRD$ @t$E$D$$ y 1E)0~0 $309 4$o‹$yD$D$ D$dD$4$$‹$p?2‹9@Dž@DžDDžHDžL@)‰t(19rE4D$ T$t$$˕$}n9s3D$#D$ D$D$x)$ -)U49V<$ |$t$b|$@D$ D$dD$<$"‹$s7D9D$|$ D$dD$$! $yD$ @t$L$<$8  P1E)0~0 $K09f4$)l‹$yI)R 4$lj$G|$2YD$ D$dD$<$ Nj$‹\T$ $1ɺi$ B4$Nj$u4t$D$<$Dž9s3D$#D$ D$D$x)$ -)u4t$$1ɺ`4$ ?$裿Nj 4$u4t$D$<$Dž9s3D$#D$ D$D$x)$ -)u4t$$1ɺ]4$<$蠾Nj4$u4t$D$<$Dž9s3D$#D$ D$D$x)$ -)u4t$$1ɺZ4$ 5$虽<$u4t$|$$9s3D$#D$ D$D$x)$ -lj)Ɖu44$Ut$$1ɺm24$ Ĝ $_<D$D$$U i}$M$R=O$F:L$ @t$T$$ …4$ȉ;D$D$$U 9Ћ$|"yWM$r=/E$HR=E$HR=$=NR=}4|$ t$D$$螋4$Vd9s?D$#D$ D$D$x)$ -։)׉}4$(~'$D$D$ D$dD$<$$ :k$=DN|79$=Ni$=NRvD$ @t$L$$1E)0~0 $094$a‹$y)R$=TN;RD$=D$L$3D$ D$d1ɉL$<$‹$sp$œwUWVS8E  U8u(E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]UaRM8E#ʬʰ]UWVS0%u}'|EtG9E r'Gf|t+E D$<$@y]o([^_]9} r+Ey;}uEiT$ $T$D$l)$iE뵋E9E r1UWVSg`EEu} lj~P9rCffVP9r1PffV 9r1Xff\V t9s]n(?1ۉ}D^ fu61ɉLu}9uF$F(F,1[^_]ÉD$ \$ED$<$XxUWVSzsEu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$uF,F,^(NMD$]\$ D$ED$$]良7F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~GF$gF(F,b lM]k]k(UWVS E>Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$F,F,^(NM]T$D$\$ D$ED$$]臻;F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9ErgMF,F(F(T~ 9~GF$hF(F,ciN]i]i(ffUWVSEu)M} OV~^m M0ȈE<ƒ?ك}Ou荶,%ULWm ]0وM<O ]O?9E]U\]\U]TT} uU u ;E}[^_]} Oσ*$ˉM[MrUWVSɣþ}u 'MYf0x}~E~p1M ɃT 7  ҃{T 7SƒuM9}{C.봋]9|Mȃ[^_]ÍH rȃ[^_]ÉET$ p%T$D$g*$ZME#Ǣ UWV豢u o^_]ø1舢 ÐUWVS\qfϋMM 8uM1t$D$ED$ D$2D$M $MQƃM9r,ML$$$<7M)11}U+u\[^_]øUWVS ʡèEE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EE >u}: w( ]u#M EÉ$Sr?E}~=Ut3}P-L-w\DAtu܋E Ƌ})x [^_]9u]䍃D$ %D$D$e,*$cXÍM U$WEM E$DxgEEM E$HEmx>EM EÉ$MMCxEM UWVS葟Æu4$!MH9MX} slu^uVt}} Tр:.utgz\t,р:.tU ƒ.} 1[^_]Ãt=z\tפftu?u&xU 몋E Pf} \(qUWVS|qE 8E1D$|$E$xFD$T$$zxT$<$z4U+u [^_]fffffffUVS÷EuUMx#L$ T$t$$<x9s[^]ÉL$T$$%[^]fffffffUWVS QFutcEt\E $F&ljD$4$'u?|$4$#u%džt$|$E$D [^_]É4$#f\ZUWVS 远ôutcEt\E $%ljD$4$V'u?|$4$"u%džt$|$E$ [^_]É4$"YUWVS /$u t\E$+%ljD$4$&u?|$4$f"u%džt$|$E$  [^_]É4$!CYUVS 觛ÜuD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVS?4u} tAv-u3D$4$$tD$4$`%F1[^_]kXUSӚȡEU tttu P1[]&XUWVS艚~}u t' t:@trt0 wvONuIW[^_]D$<$ $tD$<$y$wFw71[^_]D$<$#tD$<$<$71UWVSřú}u tPD$<$#t3Ɖ׉$n)t/Vk)Ѕ~?D$D$L$e[^_]UWVSݘҟ\$tD$hT$pDŽ$ $赙D$H$IFD$@t*\$t=b= ==?D$Xݜ$D$h|$`ÉD$|-wыt$t%\$T|$`D$D0D$<щӋD$TD$`11/f|SЃD$|ىڃ/~I9D~كڋL$`LSЉL$`Ƀ]\$`D$ptt$h0D$`e[^_]Ë\$H8 Ct$HD$8D$PD$0eED$,\$HD$,T$0)ЉD$D$$D$,\ZЃL$|P/~ȃ9~D$$)D$,ND$(\$,eED$8D$< D$P!L$8iDI4N\$tD$t$|4$8bD$|8(D$tـ\$`D$XD$XD$XD$(D$0D$8D$< D$P݄$\$`.D$(FT$H)‹D$<ЉD$PD$X~T$D D$XD$P/bD$P؉ƒtL$tV(݄$4ݜ$D$P-otj݄$D$t&1ҋ\$Ptut ݜ$؅ D$P݄$ݜ$|$Xu DŽ$\$t>M"݄$\$`$n݄$\$`t$TFD$`ƒߍFXj‰D$|@H0tT$TD$</[|$PT$8T$H 8t|$PT$8}D$hD$|D$,$x D$D$5$<$\$t$$t$ $D$|$$$\$t݄$\$`t$ptD$|L$DD$`\$`D$`e[^_]Ë|$PȉD$|t^t$HD$PD$0JЃ w(D$PL$8\$| CD$|SJЃ vD$8D$H-0t ˃L$|0t)ÍCD$PBσ\$|BЉD$8D$PD$0\$TD$H|$8\$,Nq$$\$t D$`$ D$h$ D$8$ D$T$ \$P0D$tـ܌$T$`ݜ$D$d\$t @"݄$\$`\$HuD$P$%k)~&U1҉$4DŽ$pD$Pj؋D$tـ\$HL$H\$LـOD$,D$H$%u=D$0[D$H#$$T$P=܄$ݜ$m1ҋD$tW(C$D$\$td&D$4$$ $$$1D$XD$\𿃼$us$ue|$Pt%=/D$D$T$\$tD$T4D$hD$D$T$\$t1D$XD$\࿋|$P$$\$tL$X܄$ݜ$$C $/$%= D$Txu xD$D$T$\$tE D$T|$h|$$N$ځ$|$P3'p$\$tnD$`$bD$h$VD$8$JD$T$>$v|$0$T$Pܬ$ٞwq؋$ݜ$!$1D$XD$\?6$%=+|$\)‰T$\K)!؉$^$DŽ$M9D$0tS$$|$PtN%=w@k)9t:D$0ut$HSD$H#$u΁tz%$1ۉ$$D$Hqݜ$$DŽ$DŽ$$hD$,LDŽ$1ɉ$t'4$*$D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USu|EM t.9t*0D$ d'D$D$p(+$,[]USuÆ|M E%t.9t*0D$ d'D$D$p(+$,[]UEt t]ËE ]1} ]USt{UE ~;u;t50D$ d'D$D$p(+$+[]ǂ[]Ãwǂ[]USkt`{EU tt 1[]1UWVS*t{$ 4lEtc@@x1D$D$4$EW1u E[^_]A184$Zt218EE[^_]UWVSsÃzuthF~O9tHNM 1[^_]ÉU0ED$|$E$蠙U0u=FUF맍ND$ 'D$D$ZT+$*i|UWVSry}t;t-M tWt1$Is;wr$7s<$/s[^_]UWVStriy}tJWt7E1U9}t#E4E D$4$!u߉[^_]1[^_]ÍND$ t'D$D$T+$)UWVSqxE@EEE19ut|E%D$t|$ 811YD$DD$8mE Uwx9rUT$D$E$ []/USflE D$E$[]fSL$D$ &t@AuD.&.t&€tAt9AtAt9Au΋D$[fUWVS aeVluMD$E$]E@0u ǀE EEEbDUT$UD$ $MMU)֋Ep}Ћ}΃s-tftU)UttEp~)EE9|u6u뺉$u)EpfB뺋E;E%ED$E$lE [^_]ÍP))Ƌ}w‹}΃sbu$u}D$E$ 벤fvt8!EfH @D$$1 [^_]z0D$ 'D$D$C+$HD$ 'D$D$B+$D$E$M1\fhPIUWVS bòiD$D$@-<$EtE D$ED$<$ijD$$  [^_]UWVSGbf-uix. fLD$:$(1flmUWVS\!Za׉u UuU 8E1Dn} t>M1U+y \[^_]I$(nQ 9ƉyfQffQ 9>f4ED$D$ T$t$ $X@ u1$ЅD 9MPPHDžPGO9=uDž Dž)D$t$ D$D$$XWDž@ u4$Ѕw8L8 9v<$ZfG$ZNj$YЋ9f}}$} )Q t$$D$t$ L$D$$VDž@  99uQ 04$=$\VC{GvT'tO<$NNjE$N$O|$t$D$ D$%D$$%,^1t9s;)d}dDž1 019tl!9hu狍Ƌf4JuZtJ9}A9p@ ‰))9~V׋2$T<))9zrtft1mDt$$*x9P ]u,04$tx99v8Љ΃tft4$b=ȉB9}PD$ L(D$D$0,$b _D$ L(D$D$0,$* cD$|$ L$D$$P…s@ 899EP04$=+Ɖ<$P)9| t$ D$(D$$%X4$p)9T$T$<$q8f<$Ѕ%WDž$O 1q΋9 GƋȉfpfJ2r 9t H0f9ًF9}랉t$ FD$|$ L$D$$M…@ 9-<$P9D$|$4$o1r@ yyy )ʉ (D$ $tJ‰p<$%O\/D$|$4$n01911)fR9s<04$L2)׃ (D$$IljUWVS$KâRu}5EGBt $[^_]øEB $rCE!= DžD$ED$ED$ D$ED$<$gE…xkF D$FD$FD$ D$|$E$MEEE$pK<$ Et;$[^_]øE9E$8K<$F trD$ X(D$D$0,$BE$JF UWVS@ JQMu 8‹E1kFB FBPƋ}ۉ\$D$ D$)D$4$~HƋ9s < tW< tS< 9sz~D$ $9H< u땸1$YB@ "m)փ (D$$>tƉKD004$@9]‹tft‰)‰ODžNtftR :)944$@9o‹fBf 8mDž1 גD$ (D$D$^0,$3P$@9%f)փ (D$$;<%Ɖt$k?df\UWVS`>ÂEE‰Eu 8E1FE D$ .u‰t$L$E$}EE4$ML$ML$D$ t$ED$ $耩t`E$t>E@ U+`[^_]ÉM $˨M>ʍEbMUEƋE$>u녍rD$ ((D$D$0,$2[UWVS(=DuE>FE苳 }teUE<$kML$ML$D$ |$UT$4$Gt,E$;=E@ ([^_]Í뙋MUEƋE$<t([^_]Í $lt: DrD$ (D$D$ 0,$ nUWVS;BƋEtvF u>ED$ ED$ED$E $E1lj4$[^_]ËED$ ED$ED$E $EDžt뼍`D$ (D$D$0,$1[E1UWVS;At@ËED$ ED$ED$E$ًU EfƉ$[^_]ËE1[^_]UWVS0:ÊAE}u  t/10[^_]Ã} uyMMUUUUu|$M L$D$LD$žD$ JD$ D$E$&iuE0[^_]Ã} tRa8t{bPWPtD@ 7 E #+T$ l(T$D$0,$OEx{UWVSX9@}E EЋEEEE 8EƋE1$(01 E؍EEȉMԉ}܉<$U9D$D$ D$D$E܉$iDžE؉D$<$譬ƅtEȉD$|$$ MЋIt9pMЋI t9^Mԉ}UEă< t< tM܋E؉D$4$&MPE tJ< < E}9yE؉D$$ЫtPuϋEЋUĉP MH}MHAMQM)ω}9}ЉG)ʋ}9nt1ɉU؋}U9rU؋}ЋO E)׉UA4$@9‹}؃UЋu؉2Ɖuԋu)ƉűEEE6tftuЋVuȋMԉ 2M)ẼEE؋}9SE؍UȋU܋4u4$@9Ern‹}ԃrjwt%ỦϋU)׃E (D$$!3t 8E܋U Mԉ}M܋E$T6E܉$I6!E1uU+|X[^_]ËEȉD$|$$!Kt@ EĉỦ $iŰEωM[fPEЋPEEE$5E܉$y5E>fuE̋E_M#Mԉ $4EEfbD:z1E܉E8US3:6D$D$@̟ D$ D$ ED$E D$E$[]US3Å:6D$D$ @̟ D$ D$E$g[]UWVSN3;:D6)tDÉt$ D$@̟ D$ $ًU EƉ$2[^_]1[^_]UVS29 tpǃ ǃ ǃ ǃ ǃ 5D$D$ @̟ D$ D$ $,Ɖ[^]Í $eY t55fUWVS029ƅP-8DGty]]ԉ]]]܉U؀0tv\G0 1 4H\Gu6.E]9tEprBDGu10[^_]Ã0 vNȃD$|$$Umr9jUЃ}Mt9u }U9P}91:u}zEt }_}RM)ыE U U$UJuE+|UEČ[^_]u\ǾP}t u}tdPu9shx)‹|9rSt$D$u4$IJuE1E‰xEEjPu9 1`)x,6D$ ET$D$I<$UExUt7H)D$ t$D$<$uJ:fE6L$ H)t$D$<$E룃}=:UrlUWVS&Ä-U-7qD$E$膾E@(t/}}tD$ *D$D$&-$CUWVSu} tft1tEt 1[^_]EFUT$4$P[^_]ËFUT$4$tŋEf[^_]ÍD$ *D$D$E-$TpQD$ *D$D$F-$"AUWVSu} tft1tEt 1[^_]EFUT$4$P[^_]ËFUT$4$tŋEf[^_]ÍD$ *D$D$d-$opPD$ *D$D$e-$=AUWVS"u} tft1tEt 1[^_]EFUT$4$P[^_]ËFUT$4$tŋEf[^_]ÍD$ *D$D$-$p^D$ *D$D$-$XAUWVS=2u} tft1tEt 1[^_]EFUT$4$P[^_]ËFUT$4$tŋEf[^_]ÍD$ t*D$D$-$p\D$ t*D$D$-$sAUWVSXM}u t/tYEED$<$t E[^_]ÍD$ h*D$D$-$uD$ h*D$D$-$xUWVSã}u t/tYEED$<$@t E[^_]ÍD$ \*D$D$-$MuD$ \*D$D$-$xUWVSu} trt7tQt 1[^_]1EFUT$4$P[^_]ËFUT$4$t1U[^_]ÍD$ P*D$D$-$`dvD$ P*D$D$-$.5UWVS u} tdt0tCt 1[^_]ËEFUT$4$P[^_]ËFUT$4$tƋE[^_]ÍD$ D*D$D$-$}rD$ D*D$D$ -$KCUWVS0 %uE }t )щʋUt7uzN|$D$4$Q tuUtQFU+U u@ 1N|$D$4$QUt?tFU U u@[^_][^_]1[^_]1[^_]ÉET$ 8*T$D$*-$2E ET$ 8*T$D$0-$EUWVS u}U 8E E|$4$_tz9Ur0tpt+uc1T$ED$4$6>t,[^_]Ãu[^_]É<$E [^_]ÉЃtE륍D$ *D$D$-$E nD$ *D$D$-$R}!<$bE 10UD$$NjE 8Ut E?*D$$ 1UWVSSH u} t tJD$(#|$4$ [^_]ÍD$ )D$D$?-$unD$ )D$D$@-$ӼUWVSð }u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]ÍD$ )D$D$W-$ۻ,D$ )D$D$X-$詻UWVSà }u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]ÍD$ )D$D${-$论,D$ )D$D$|-$|UWVSaV u} tt@} u[^_]rD$ )D$D$-$uD$ )D$D$-$UWVSu} tt@} u[^_]D$ )D$D$-$苹uD$ )D$D$-$]UWVSE:u} tt@} u[^_]VD$ )D$D$-$uD$ )D$D$-$ϸUWVSìu} tt@} u[^_]D$ )D$D$-$ouD$ )D$D$-$AUVS*uED$t$ ED$E D$E$~>.t[^][^]USED$ED$ ED$E D$E$B[]UWVSËuE D$E$t })x[^_]9u<-D$ +D$D$\-$?E)UVSEPtY.J.tQ.t&.tPÃ߃Aubv-0 [^]ÉÃ߃AvXЃ wrÉȅu[^]û.HvHw@B.̃v XЃ v-u(rÉȉdJ[0 v1nUE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]USyE D$E$[]USZOE D$E$[]US/$E$r[]US E$@[]8UE Mxp7]UEf]UE]UEfU f]UEȋU ]fffffffUWVS(qVu}E EEGE؋U L,uу<9M E9syQ.tf@t|E E9sT@AuwuFcO} o9](([^_]"E E1ɍL,EM[<U|$M $}Ut~UM)ȍ<FD$ $}UUM)ȍE(\.uЋM)ȃE%E}9}EM؈vM؅<.U܃uwUD$]E$|UEE})C~x9FP-}ȋ?DG~ruE9E9EEEE1ȉU}f]tEE:UD$ED$ED$ ED$E D$E$y]UWVSD]VE܋EEpu؋EmE@u8uEU1Ã@;؍sL`uʋE EEEEȋ} EEEċEQuE;EM}ԉ‹EỦ]}?wxEËu)?fpхt@}E]Љˁ?@ ‹EЍpхuEEuEuŨ;U]M}ԈM]\MEFFEE]ro+E d9] [fEp}1EpBf9utBt&M]܍D$ ,+D$D$-$*MUWVS$E 8E1D$D$|$ ED$E D$E$t>ED$D$<$&tE+uЁ$[^_]ú/UWVS$gLE MU 8E1D$ D$|$E$t-T$L$ ED$D$<$cU+u $[^_]É.US]E M9r 9s9su[][]UWVSwpEU} E9slUP0ك@t$tNt<]败([^_]9sAAu@u;!E!29rUUX9r1[^_]ËE؃EȉӋUUWVSǦuE t*X?w#9r6 )ЍXt9Aхu)[^_]É[^_]É֤()[^_]UWVS1*EEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]s uU270:ۅt9u1[^_]Ë] [^_]Ë](1[^_]UWVS J?u}E9E |2&6D$D$$ umtF;Gt1 [^_]ø [^_]UWVSU2E uuW1[^_]É?wZ9rBZML$ ML$)D$D2$x(9E~9}ljr[^_]É(뗉բƢ?UWVS9&EU t_Z1?w%9r8D)ӍV[t9хuލF[^_]Ék[^_]ÉT(F[^_]øUSäE D$E$k []UVSyuD$D$$tD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]UWVS,uE܉U؅Ot A"}܉MGEML$$]ߎu]NjM-+E0 EEډU1709~Kt$EU9)ߋE^SЀ vSW9U؅ttFE܋E؋u܉0,[^_]ErEJ0AUT$ U T$@-D$E$]UED$ ED$E D$E$]UUT$ U T$@-D$E$]UWVS$EU}&u EE@0E@1,tftE@E)Ћ}GUi}‹E0T$UED$4$]nEUt)PEEE] ] 9sd=sFt% É ؉ É ؉ ƃUt$ $]teEE 0E0UЉσueuLE$]vEu[@]螚TEfH @$[^_]fBǀm@ @u}}tEt8E$[^_]ËE #Í0D$ t,D$D$@-$w]AUWVSI>}D$<$[t|$ ED$E D$E$WD$<$Ut[^_]USD$ $茫[]UVSïdp7u [^]ÍD$L$I $ƅu$}ƅtD$ $诫FFF US 藘U T$UT$$ []UWVSD$D$@-<$E t8ED$E D$<$|$ D$D$$faE$D$xD$$~[^_]fffffffUS3(E D$E$p[]USE D$E$`p[]UVSƋ$iFt)VtF D$F$ҋF9pt$ؗ[^]UWVStE։ϋUt%T$ML$$2;[^_]ÉD$4$~ƅtU1UWVSu} GD$F$薈uD$$Xo[^_]UWVS,ý 8U1DžDžDžDžDž$t3D$D$ D$D$<$w=~j$   T$ D$ T$$U1U+,[^_]D$<$x T$$T$T$$Љt6t,"L$ D$T$$TU;pt$]Dž$@DžUWVSû l$axD$G4$ E9  ELh$D$4$z,8dJ$ ( Džp`tXOWt11t΋ t $tP9uዽt$oGt$Zpp ;( r`t4$0ǃ( ǃ$  t)1tto; r狅tt$ǃ ǃ d$k( u;EU  h$dl$膢1Ĥ[^_]ÍT$ D$ D$$ $RUWVS(Åu} tmNV$FED$D$  D$ D$E$|l1ti([^_]ÍD$ ,D$D$~-$i6D$ ,D$D$-$迋:뎸UWVS É}bGKmL$ D$D$+$ tG EkE썃gE荃jE8.t&E$sEE;GE4G0D$E$sGD0t‹E$jsGD0u=$QsGD0oO$4sGD0Z_$sGD0Jp$r7$ r [^_]ÍAD$ ,D$D$-$oUWVSu1ҋ( ׅu;( $ UD$$ hUuˉ׋Jt=BEt$1uƋt $O9uuu $GD$ t$<$31[^_]$ ( $ t7$ ЍD$ ,D$D$-$߈UWVSlòMU<Edp7ET P LE$EEčD$D$ ( D$$ D$Eĉ$}hPU@EEEEEU<Ћu  E u D$<$'fuNFPUT$L$U$ЋUBuM}#TuEM9MuE$۞E ul[^_]lE(4$Μ 5U 9PuMEA  E4$芜d}ED$D$  D$ D$E$ftMHtFMMЋMMԋUT$D$ P T$@D$EЉ$ftH @1(4$EtUPU4$ԛEE1U<…uEEE p 8D$ ,|$D$`-4$豅EtIEtX,-D$ |$D$b4$oʍ,-D$ |$D$a4$CEt1MEA  E4$迚.4$誚EtUPU4$萚;EEfffff̀rS[ä`[UWVS<Æ]܉ƉӉMЋ}}ԋ} UUUŰE 8E؉‹EQ)‰э)ƸQ))4Q))Éxy}tUMЉT$]܍OD$ ẺD$D$ u4$^kE9NjMsU 9Fu}uw]؋E+a<[^_]Åtd}tՃwE9E܍] 9Pu뙅~ud}t.ȅxYD$]܍OD$ ẺD$D$ u4$jE9MUF99u}*룍v}A}}tΉ؉D$]܍OD$ ẺD$D$ E$j띀}؉D$]܍OD$ ẺD$D$ E$i]PUWVS EMuE EEE]] 8EEEu R9uthUEP@t4<%uE11ɉ]MBEZCkL$X\$\1ҹ1)ӉL$H\$LD$@.D$ D$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$ ׋D$XT$\19|ID$XT$\D$HT$LD$XT$\m1뷸n1뮁lL$X\$\n9>|$0L$X\$\L$X\$\1҃D$HT$LD$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$@.)׋D$XT$\n9}8D$XT$\D$HT$LD$XT$\ m1미n1릉$D$PD$@.D$8t$X|$\؃!|$\֋T$\ƸQ)ƃt$X|$\)i)\i(\ø)\ykddڋt$X|$\)׋T$\i)\iD$X(\ø)\d$XQ֣p=T$L9ø ףD$LD$H\$XD$0 |$8-9R9~&)уD$P t1ҍR9ڀ|$Pt$$D$XT$\D$XT$\ƋD$XT$\9L$X$uD$t;ÉD$(t$,EaŃ\$(t$,D$t;D$PD$T1$D$HD$dD$8D$tD$0t$X|$\9}Éщ\$dL$hD$HD$ ED$D$8D$D$D$D$`Љ/T$0D$H]D$dT$h\$\1Ӊߋ\$X1 t$P|$T11 7D$PT$T|$X9Ɖ׉ӋD$\D$dT$h D$XT$\D$PT$Tt$X|$\1Ӌt$P|$T1ڋ\$X9؉ӋL$\D$XT$\T$HD$XT$\D$0D$(D$,b\$ljT$( 8D$Ë$@1΃ ~G \$`D$D$D$?D$$D$E$T$(щ€|$?t>T$4L$8\$;`\$T$4L$8\$$@+7Љʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$11ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0>$@L$ @D$ D$49t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Lщ€|$?ED$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G D$ 9tG +t$\$49t$ \$ ^T\$]\$UWVS R?}썙]| uu [^_]Ë}|:dNu쉼uMTډ0 ?-00tċu! [^_]UWVStǟü\$XT$T˅. 0xt$\|$`IXPL$d\$<É s {9 l$dyD$<D$dD$<D$ t$lt$D$QD$ D$\T$`$T$\$X[D$\T$`E.‹D$T|$T:)؍))׉|$d)À\$l|$<ljύ))É\$$t$D$:D$ D$\T$`$T$\$XP[D$dT$ht$lt7k9)ʍJ)Љ)))șD$dT$hi"D$dT$ht$l7_u)Љ))щL$\D$X.D$(iT$h)\iD$d(\ )\d$dQ\D$dFEVED$ ED$ED$<$HƅL@U܋M;WW+EỦ9‰FA1EdF1Xn]؉E܋؉0 }<$11ƅE؍(/F(EỦ9sUWVSPcX\$|ljD$xT$pL$P 8D$TƋ$L1fBZ<:\$t\$X4\$x0>D$DD$\$|$ljt$ȃ|$dw|$H1 ڃ9t$xuD$hT$l|$HyD$hT$l\$tCL$\qY؋T$p\D$HTT$8D$h9ËD$l!΋D$HD$\L$pD$hT$lDT\$d߃D$tD$t\$x9D$D#|$t$D$p>11ۉD$x":tt$p>t$x9Kp9|ѿBG|$xkfat&Dߍ$D$xD$|D$xD$P{D$D$x$\$|1[\$| H8T$4<L$@kD$0. \$X))D$Ft>8t$|$pG$D$\t$pD$`k XPD$H1$$D$P\$xD$X($\$HL$`t$t ;C suyt$tD$tT$hFP~L\$t9\\$h}4=}H\$t\\$h\\$PL$x ;>VD$\9]\$x|$dD$d|$pdF$ tftD$dËD$pXT$`D$x$\$|1ËT$`<|$`1>|$t @ϋt$xs&tftt$`D$x D$hu+uċ\$|8f1D$ht$t IlPӉȉnu6u\$xD$p@f$ $ f |$pdNeND$@1ɉL$8~$D$xUWVS\$dD$tT$pω<<FD$tp@u1e[^_]Ãt>u)D$lJD$ht$t|$hwǍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdP`tftߤ1eD@t$p`Pp@D$HD$pf@D$`<9PHЅu>u)Ӊ\$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$ttftt$l0e[^_]~~1D$HD$`*t -~0 wËL$`)ˉ\$LL$LY\$4\$X\D$x-D$|"D$dݠ$|$$58,,$|$8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$d.D$D\$@t$8ti)\‰(\= ף|$D4)D$XT$\9D$Tt$PtD$XL$\t뺨1ɋt$pD$dtlD$TD$P11D$Hy,;T$|| ,;_D$pD$TD$P|$pwt$dD$xD$T>7> 9iFuD$pD؉D$X1\$Pt$p>iF>kFuL$T\$X)ىL\dFuډT$X|$d9u\$PD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pX dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0ɨ뀋|$xT$|1{2D$Xf ndPt$pdPePeP@f2|$pdNeNT$hfM|$pdNeNT$h"fQyT$4\$\$@t$8D$XL$\D$DD$d.D$8L$\$0t$,ri)\P(\wf= ףt$8)D$XT$\p:σ|$@p/|$T9׋t$P}D$X\$\L$@t3빉L$\$0t$,D$,|$,9|$|$D$(D$d.$\$t$i)\P(\= ף$)D$0\$@D$d9)؋L$09ȋL$d؋\$(T$DЙD$XT$\D$8T$<D$ D$8T$CD$(D$DșD$XT$\D$8T$<‹t$FD$(șt$9Ћt$H}D$,D$Dt$0D$XT$\D$XT$\puD$DD$,9}bL$T$$D$@L$T$D$dD$03UL$@D$drD$0;L$dJ\$t$pD$(Fu=|$plFpFdFhFG\$\$@t$Dt$8t$)=D$pf@D$,:D$,D$p1҉PyUWVSvǎ}}ƅӀ:tyɉ‰Džt;:1ɉUF E荈M1= ||9}~z>dN$]#=v޿T[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]ËE~퍖dNE荄dNNjE.9tUD$4$]|Uu_ɉ1DžuUWVSZu?|Njx U$"=EU~|$ $$4 5}#4 ,/dž0 _y>u, Ex [^_]ÅxE4 P$RHlÉ4 2(/dž0 1뒋WZytىugb1ɍA /dN}D$|$ $UVSysnz4$B8 uƃ8 4$B[^]UWVS4s-zEuM V~6hFhF1P9u dN9ut [^_]Ë]g01[^_]UWVSrǽyUM Z~/dFdFP9u09ut[^_]É0[^_]UVS`rUy4$A<$话4$A[^]UVSry4$A14$A[^]USqx<$D[]qUWVSqưx$Rit6ÉǹUu [^_]ÉE$r.U1US]qRxE$q[]UED$ D$E D$E$1]UWVS qx<$~@<$\L D$ D$ED$4 $Ɖ<$:@[^_]UWVSpÒw<$@x u<$E D$ D$ED$4 $ZƉ<$?[^_]US(pwE $11ҋE3t (/P([]USov[L $11ҋEt (/P([]UVSoávu L $1ɉEt t,/P([^]Í(/UVSloQv] E$1ɉڋEdt t,/P([^]Í(/UWVSovD$${><$Y4 t1$eEgƉ׋D$$9>[^_]$1ɍdE/ƉUSznouME tEe[]$E1ɍd$[]US#nuME t@ tEe[]$cE1ɍd$[]pUEt@ E]UWVSmƝt]} tC }1ɍd[^_]UVS0ym^t]D$CD$CD$ C D$CD$CD$C$D$(D$D$$D$$1ɍdL$xLL$ L$KL$ KL$K L$KL$KL$KL$ KL$$K L$(K$L$,K(0[^]UWVS]u } IXP ;r B}y[^_]ÍIlP)׉[^_]UWVS Jl?su} D$$;x t[4 t$RXPL$ ;p H}yD$$m; [^_]ËL$RlP)Ӎ<$*\UWVSET$RuXP$M ] ;H pDyE U $\$ ;A yyƉ;u ]|o9u ] $\$ ;A qyƉ9u ]|͋M ]11 1ڃ[^_]ÉƉ;u ]}# $\$ ;A y}'yϋM ]11 1)ڃ[^_]Í [ulPƉ)뗍 [ulPƉ)J [ulPƉ)RUlPE UUWVS jqD$ $y9x t<4 tOUM T$L$$Ɖ׋D$ $?9[^_]Í<$C4 uu} UWVS{ipp}u tstCL-t(TSNLKf9t)ȃ[^_]1[^_]ÍD$ 0/D$D$BX.$!둍D$ 0/D$D$AX.$ ^UShòo u#$ tЋE$$UWVSvhkoe=t:F$V FtD$$W(4$huƃ[^_]UWVSho}ƃ $`tCƉxtD$<$'E FEF e1[^_]ÃUWVSgÎnuE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍjD$ ]U`gUT$UT$ @-D$E D$E$]UED$ED$ ED$E D$E$]UWVS`gD$@-FX$(F`F`y ;Fp|4} t.FXPVX}D$FX$[^_]ÍFXD$E$US_ÌfE@-Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US ?_4fE D$ED$@-X$g []US_eED$ E D$ED$@-X$5g[]fffUWVS^öeM } }E EEED$E$E@ E@U~5M19E}EtfEtME)‰UE$uUE@몋U tE eM`TEfH @1[^_]ËUu G)77wWU<$UtًE)1u EEPCP@@D$$E[^_]ÉЋ}tftE@9y6U /D$ |/D$D$/$ E@U)ЋMAD$ $5E[^_]ÍD$ |/D$D$Q/$.0D$ |/D$D$=/$EurMuMu4UD$E$qEU)1u =fBfmyMyHMXUS [åbED$E D$E$c []US[tbED$ ED$E D$E$c[]UWVSE[:bEED$E $ƅPDžD$ED$E$0"=ifGfw G$G,FG('G Eu [^_]D$ D$D$<$[^_]É$"fG 1[^_]ÍOD$ /D$D$>@/$0UWVSZ a}t5D$<$#w fD$<$1[^_]Í0D$ /D$D$;`/$ffffUWVSYÆ`u 4$!9EU9s 9ru׃s$u8u:Ѓ[^_]Í 9rU9tՉ׃ru$u,tftƤЃ[^_] zfUS X_E9ErD$E D$E$蝺 []Ԟf!̀rS[Ô_`[UWVSXv_u F0u ǀFFF tHNtA})xT9VnHM9VtnF t tc[^_]É4$N})y9u/D$ /D$D$W/$+Vr4$t늉4$uS0D$ /D$D$</$_ fffUWVSAW&^Ӊʋ} MM tau!ƒuމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]B{} x|1utv҉)Ѓ0CUtʋE9ut OsECExtE1뙸)0KыEÿEX0C[^_]UWVSU\ljօt:Fu1F[^_]Ét$<$fFF[^_]Í0D$ 2D$D$/$n UWVS VUK\UM9 ?p9s΃ttUUED$t$E$y{MU)UD$D$$E}E01 [^_]ÉUE4ED$t$E${MuUEU JHJHJ H JHJHJHRPVU0U$T0`UWVSLT [ljT$ L$L$,11 rL$$D$(D$ D$D$L$uct_GЃ%uD$wPZw0/1ҍTPЃFHЃ v$uЉT$…L$t$$|$9|$  |$bD$D$tZFT$| |$t$L$8w%01L$1L$ 9<΃t$  9D$uʋt$L$9t4$kS1e[^_]Ët$6뼋L$1L$ 9<qt$ 붋L$1L$ 9<IL$ 랋L$ t$ ~64|t$ t$ xL$1L$ 9<y|$ ]t$뽋L$1|$ ?<L$ y|$ 6t$ t$6t$ t$ t$ .t$6<t$ t$ L$D$D@$IL$L$-~D$|$UUUED$;D$(i D$9D$sD$D$$L$D$ AD$L$D$|$UUUD$;D$(_D$9D$sD$D$$L$D$ AD$'L$D$K|$UUU D$;D$(D$9D$D$$L$D$ AD$L$D$|$UUUT D$;D$(BL$(T$$D$(OHЃ  1t$|PЃpЃ vt$L$<$|$UUUD$;D$(rL$(T$$D$~D$9D$sD$D$$L$D$ AD$L$~*K PЉ FPЃ vD$|$UUU D$;D$(D$9D$ D$$L$D$ AD$ED$fD$|$UUUD$;D$(rL$(T$$D$iD$9D$sD$D$$L$ D$ AD$D$ D$L$L$D$tL|$UUU{ D$;D$(D$9D$ D$$L$D$ AD$9|$UUU D$;D$(D$9D$D$$L$D$ AD$L$ |$UUU D$;D$(ID$9D$TD$$L$D$ AD$D$@࿀ D$|$UUU D$;D$(D$9D$eD$$L$D$ AD$,L$FD$D$i|$UUU D$;D$(L$(T$$D$@D$L|$UUUKD$;D$(qD$9D$sD$D$$L$ D$ AD$oD$D$f|$UUUP D$;D$(D$9D$sD$D$$L$ D$ AD$|$UUU! D$;D$(cD$9D$sD$D$$L$D$ AD$|$UUU D$;D$(D$9D$sD$D$$L$D$ AD$oD$|$UUU D$;D$(L$(T$$D$*|$UUU D$;D$(fL$(T$$D$]L뾉D$vL$|$UUU D$;D$(rL$(T$$D$tD$9D$sD$D$$L$D$ AD$oL$@D$D$D$D$0D$LL$(T$$D$L$(T$$D$oL$(T$$D$PL$(T$$D$1cL$(T$$D$+pL$(T$$D$QL$(T$$D$2UUU? ;|$(rL$(T$$9|$s|$D$$D$ t$1D$|$UUU D$;D$(rL$(T$$D$=D$9D$sD$D$$L$D$ AD$D$ |$UUUD$;D$(D$9D$sD$D$$L$ D$ AD$DD$ |$UUUD$;D$(HD$9D$sD$D$$L$D$ AD$D$ |$UUU{D$;D$(RL$(T$$D$8|L$(T$$D$]L$(T$$D$>9.t&14$Gf"L$(T$$D$}L$(T$$D$uD$  |$UUUD$;D$(rL$(T$$D$DD$9D$sD$D$$L$ D$ AD$D$a|$UUUD$;D$(D$9D$sD$D$$L$D$ AD$KD$|$UUUD$;D$(nD$9D$sD$D$$L$D$ AD$D$[|$UUU"D$;D$(rL$(T$$D$)u<$fnt$1PL$(T$$D$PW|$UUUD$;D$(`D$9D$sD$D$$L$D$ AD$6|$UUURD$;D$(L$(T$$D$rD$|$UUUD$;D$(rL$(T$$D$0D$9D$sD$D$$L$D$ AD$|$UUUD$;D$( L$(T$$D$(L$D$$9$D L$D$$9$DL$D$$9$sDL$D$$9$VDD$@tb|$UUUD$;D$(rL$(T$$D${D$9D$sD$D$$L$D$ AD$vD$ |$UUUD$;D$(rL$(T$$D$ D$9D$sD$D$$L$D$ AD$L$(T$$D$^L$D$$9$ACL$D$$9$$CL$D$$9r$CeL$D$$9U$BHVJЃ |$1tBЃD$D$JЃ v$q|$UUUD$;D$(rL$(T$$D$yD$9D$sD$D$$L$D$ AD$L$(T$$D$-L$(T$$D$xlL$(T$$D$ ML$(T$$D$.L$D$$9$AL$D$$9$AL$D$$9$yAL$D$$9$\AL$D$$9$?AUUUwF;t$(rL$(T$$w9t$st$D$$D$ t$L$D$$9?$@2$|$1댋L$D$$9$@L$D$$9$@L$D$$9$l@L$D$$9$O@L$D$$9$2@4$%@L$D$$9r$@eL$D$$9U$?HL$D$$98$?+L$D$$9$?L$D$$9$?L$D$$9$v?L$D$$9$Y?L$D$$9$C|$UUUwTD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$D$$9$j>L$D$$9$M>L$D$$9$0>L$D$$9~$>qL$D$$9a$=TL$D$$9D$=7L$D$$9'$=UWVSP<C$]$} |$Dut$L}|$P 8D$4Nj$L1'D$L'$@0u ǀƄ$D$D$$n=D$0$G wf DŽ$D$PD$$$$$DŽ$DŽ$|$L$D$lDŽ$$D$HD$,D$xDŽ$$D$<$D$8$8-$%t >u$)؅$*$$A$$$j$$~Ƅ$Ƅ$FDŽ$DŽ$DŽ$FZ $1ዴ$4$$J+@F f B$fx0\$L<$$DŽ$DŽ$D$$$$D$$8$g$ǁPǁTǁXy 1B<,<tft$F f$f$Ff$F$F,$FD$$L$$DŽ$DŽ$DŽ$D$PD$ D$LD$D$DD$$$$Z5$@$fH @1ۍFЍPwFЃ v$>$FZ$/$Ƅ$$$DŽ$1ҍ$$D$|D$`D$TD$XD$h$t$$؋$9}$D$\s'$$u$$)tB$\$8F$$S$f$$tJƄ$0$t$<3C$$V$O$ǀ'|$|)υ$$$;Kȉ$$W$$$$t$$)-t$\$ZDŽ$$$$8$2\$ltD$l$$6$$@ @ft DŽ$t$(9t$$6\$4$L+=$e[^_]9.t&S$$K$$r$D$h$_)D$\$${$$j*[,ۼ$D$h$T$$T$$T$ |$\|$D$$$$CDžl6$)D$HD$lt$$V5<$${D$lv6<$w$$$tƄ$-$D$X=$$߃Gm|$h-($t$X\$\ É$r$D$xt D$Xf)$y DŽ$D$l$D$|D$`D$TD$h$k$D$h$D*D$\$FD$h$D$\$a}/X$3D$hP$$=$$$_$$"a. ,ۼ$$D$$D$$D$$D$T$ <$$>"$$$~|$\$ C#-vL$$$$$1۾ $$$$$$st$\$ 5$+[R$$Ƅ$1ۋ$?D$`$$ D$`$|$\$D$`$D$|$$$$$st$\$ !+[R$$ $$$y$$.,$[$$$$$DŽ$$Ƅ$1҉$$Ƅ$ $t$D4$$0@$4$0@D$x$H@87$|Ѓ01 Z0 4Jу0 vꋔ$$9+$N-v$$$ މ$$Ƅ$+ލW7*a4FЉ1҃ /PwFЃ v뉔$$$$$W$ 0!) $H$p$$$_\$\w*1҉$$$ǁ$Ƅ$x% ǁ$3D$`Ƅ$$p$/$ $$B%$$t A+$D$|$PD$|$y DŽ$D$\$D$|$$$1D$`D$TD$XD$h $ $$$$D$|$+$)$@$D$|$$$$$t$D$$<$$')$9~$Ƅ$$1p$$$$$$$D$|D$lt$$ ,$($@$$$^*$$$$$$#‰D$l*$$$L 3 t$Dt$$LD$ $D$$D$$-/L$lD$|$$E$@⿀ $n$[$$$4$$$$$K$$L$ 3 $'$ I|$D|$ T$D$$4$$+.$y DŽ$$$W$ $N$$$5$$$#$$3$$$$ʃT$\  &#ʍRR$$$$$ D$` $$3RƄ$D$x@|$h$h|$lt$H|$|$)t$X9~~@$$7_؉$$V$$y1ۋ|$X)߅|$X$|$x$ $\$0$$$3C$$Q$$$\$|$)$9~~@$$7_؉$$V$$y1ۋ$)߅$*$$$ A$$vω$4$$$륋$$)߅$&$$L$@$ ~UA$$vӉ$$$$$L$@$~$$$|$|)υ$$~$L$|$ ~UA$$vӉ$A$$$$L$|$~$$$ $$;$S$N$*$^$$\$0$$$7Gp$$X $D$HA$$^ $\$H)ޅ$|$,y$$Y$S$t$($ȿ$T$@L$ $T$( ~W1A$$vӋT$@$@$$$$L$ T$($2։Z؉$T$($I $$^L$@$$&$$$L$@gL$@$$s$$$L$@~$$:$$$$T!$ȿ$$ ~U1A$$vӉڋ$&$$$$$3{$$$$I$$$F$$W$$$ $tB$t$07G$$Q$$$$\$l|$H߉|$|$$$3C$$8$$$$$$ݔ$D$h$T$$T$$T$|$\|$ D$$$/ǁ$'DŽ$$|$X L$\9l)L$\D$\L$zL$|$$ $$$L$|,$$~$$B$$$$$$$hT$ 3T$D$^/$$'D$l8N$$`rx$$$$D$\$DŽ$D$|D$`D$TD$Xc$$|$||$\$$PT$xT$$T$ $T$\$$D$`e$)~Td$$D$|9}$D$|$D$`D$TD$XD$h$9$u$$1۾ $$ $‹$ǁ|$X$DŽ$DŽ$$PD$xD$T$ D$XD$\$$$$K$)$D$|D$\$$$ `~UA$$vӉ$($$$q$$?o$ $@$  $RD$`$ D$`DŽ$DŽ$ $ $ M$[D$`y \$`Ƅ$-$$$1۾ $b $ID$`,$? $[D$` Ƅ$$11DŽ$DŽ$$$G$$$s$$$$$p$\$h$$t$`l$`t$h2B$$K$dt$xt$|$)9~΅~9$r$$K$Q\$x y1)E$\$TCL$`C$|$|$9h$\$$$ ~U:B$$vӉ$ $$$$2Z؉$$t$x$$$$ql$xl$T.$$`D$x$$ȃ$|$||$\$$1h$$$$qD$|$$/1$$$-$$\$x L$@$$~$$$$L$@$h$$$A$$vω$Z$$$륅 |$hD$h$$(D$ 3D$D$4/$$0D$ 3D$D$3/$D$\$$$D$@$ǁ|$X$$ :$Pu`$3$$$$ $u$)ȉ$D$|:$$|$|0 u䉴$|$|$` )$D$|$$$Ƅ$-$ $D$@$%D$X$$R$D$\$$$$$ DŽ$$P|$|D$xD$T|$($\$`t$d$$ T$|$$ʁы$)уș׉L$`T$d$$)ii̍D$hȿƉ׋D$hljD$p%D$tD$pT$tyD$pT$tT$pD$`1L$`\$d|$|W0G$$D$XD$T<9 $$9~D$|PD$@GD$TxtD$T\$`t$d$$DŽ$V$|$()ы$D$|;$RD$`$BDŽ$DŽ$$$DŽ$$$~$$$L$@$$3$$$L$@ $ [ݔ$$D$$D$$D$$D$ T$$$/Dž%$)D$H$yD$HD$\$uƄ$D$lt$$<$$AVD$l<$$R$$$Q$$[$$$J$$I$$ $@R$ z$ID$`$@h$ $ID$`$$ $R$$$ D$`$@$$$ $I$$$$\ $ $0$$$ƶP$$$$$葶$$$$@|$ 8  $ID$` $D$\D$h$+L$X$ $R׉$4)0ȉуcڋ$s0O9$T)ډщ$$ǃ> tft$$)ЉD$,D$\\$, $$y DŽ$D$l$D$\$D$|D$`D$TD$X(D$P( D$PD$PD$Pn$`8`$Ƅ$1%t$x<1\$X$1<9)FuދD$\$03$@0)ً$D$|$^d$$$v$$$\$Xt$xȉL$T|$`$$D$l$D$|D$h$؃|$||$\$$1۾ UD$\$$3$$$̉)1ҋ$$$)iiщƉσ$0$O$$DŽ$$OD$|$P|$h'D$HD$\D$HD$\D$h$1\$P\$PUWVS}D$<$ED$ E D$@-D$<$豺D$<$[^_]UWVSÎ}D$<$諏ED$ ED$E D$<$QD$<$襏[^_]ffffUWVS1&Ɖ׉Mphtt[t@[^_]ËUuD>ttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVSXM}ED$E D$EE$ą3E܋|\$D$D$D$D$%-uMAU$T$ 7ƅXT$ DV 9‰T$ s )HFL$D$$ND$ NT$99sH\$T$9rڃ9uT$9Ѓ9uU@]} ;tL$E$UE tE C9rwN9ue[^_]ËD$%-uMEED$E D$$6Ɖe[^_]ËED$E D$$6Ɖe[^_]ËED$E D$$~6Ɖe[^_]úT$U~ t^E|tEXrUWVS,~}m|$D$%U <$p3m܋||$D$$%-BuM7U$T$=5ƅNT$DV9‰T$s )HFL$D$$菂D$VL$ 99sB\$L$9nك9uL$9ȃ9uUB]} ;tL$%ɋE$UE$tE$C9ruN9ue[^_]D$$%-@uMEED$E$D$$-4Ɖe[^_]ËED$E$D$$3Ɖe[^_]ËED$E$D$$3Ɖe[^_]ú$L$U~t^E|tE\pUWVS`E(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$&¿3፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$ 4$.U:ue[^_]ø랸뗸1ffffffUWVSxt&=E= =D$TEU D$HT$Lu 1ҋE%=D$HT$XzD$T~D$TD$pD$ D$tD$D$X$ D$DD$pD$PD$\% ?D$X\$`t$`D$$t$`D$dD$`أ܋܃݃T$`L$`|$nD$n fD$ll$lT$hl$n؋|$P)׉T$h<V(\$X,D$(D$4D$hljD$@D$,} <$00D$`D$tD$ D$PEExD$0|$@t$0L$$ 3t$4$ wD$8xD$0L$4ȅt~9 ))D$4)NjD$,tXT$0D$D$8$zxD$8"T$DT$$vD$XT$D$sD$XD$D$nvD$XD$h }~D$0t |$TD$,D$h   )ƒ& <)t$LE'E D$E D$$.D$`D$`e[^_]D$( D$4L$hD$h)D$4މt$,D$@D$h} }~1|$Tƃ}B }}}D$0UD$@‰T$ MDD$P$-D$`O}F|$T;|$PwHL$t |$@ V(D$@ƋE D$HD$`P|$P|$nD$n fD$l9 ؋Ƀl$l\$hl$nL$h‰L$XL$Xv ɃL$hɉD$hH0Jڞzu؋D$D$AqD$`9D$@}U E 0D$`e[^_]ËD$,D$D$D$XuD$DD$`D$`e[^_]Ë|$P|$t2} x )D$`D$dl$`\$`t$`D$d-D$$D$TD$T1|$TD$TDD$T@)捊 ym1}} }t=ED$0T$hD$()ȉD$41D$0EED$ D$P_D$hzIl$h?ED$E D$$*D$`D$`e[^_]úT$4ׅMt$(vT$PD$0t$`L$D%D$D$ $oD$XD$ $L$h+0FL$hQu y 9|$P‰L$D1ɉT$hD$Tt@L$TD$D$D$tD$D|$X|$$uL$T6|$`94 vP9t|$8L$8=D$`0D$E D$$)D$`|$PwuD$t(.D$0L$@V(ȃƉDD$XD$t"W(T$t Ƀ ɃuT$\$8D$8T$ D$PD$4D$,T|$8D$`D$4t$PD0D$(t$DD$XD$4$a'D$,0L$hT$8T$4$rD$P|$D$X$r…@ fT$T$04$WrD$DT$0$jD$Dy}T$HL$T T$PN~}~L$TT$ht$D~HD$4$pD$D1t$Xt$$qT$hV9zT$,1t$4FD$hD$X$iD$h L$8tt$89tD$h4$iD$hƉ|$8D$8$iF(MZD$PD$D$D$X$djD$XD$D$D$pD$`p1D$@D$X$!iD$8lD$hD$D$X$^mD$X86+D$p[T$XBD$j¸ )6D$XD$D$D$;pnl$@D$D$ D$D$iD$DL$0D$ D$P8D$0~)T$4D$HD$`DD$8|$nD$n fD$lt$0l$lT$Hl$nd$HT$H0qٞىt$Ht$0T$Hكڞ.D$XT$\D$HT$LD$tx |$@t$4D$0D$8W(D$Xr D$D$D$8$mD$81fu T$hvx0t|$8L$8 t$8F$e…Fz tftD$$mDžYD$PD$4HL$PD$h9L$("D$D$ 4$`gƅ`D$8D$D$ 9D$8$.gD$8,D$D$ <$ gDž D$PD$4D$8L$؃\$HD$HT$LD$-@D$D$8أD$|؋t$`D$XD$8EЉD$@A$feD$Px}ND$H D$P=N)ȉD$41D$(D$HiD$LZOD$,DD$@V(ƒD$X T$T$L$T$HL$L?W(\$81tD$8 \$8uT$D$8T$0t}D$`D$D$D$t$!PD$tD$D$h$V|D$lP1D$DD$d T$`D$t$ND$HT$`L$`A|$49g)lj|$t|$8D$`)DŽ$D$\D$D$t$RD$t}t$tFD$zPƋD$dD$\rD$0=P}ST$LD$4D$tD$8ЉD$8|$PE@9E  D$8D$LD$\D$0D$`u؋\$TKD$tD$HEЉD$DT$lD$d)D$8D$LD$,‹|$4)T$\t$`$t$LD$tL$8Ήt$8D$4t$tt$D$H$YQD$H#L$hL$$OD$tL$h $LD$tD$h)t$4t$D$H$ SD$H+L$l95vB<9tD$< |$PE@9E D$8D$LD$d|$HG$KKWx q tftD$$IRD$d~D$<؋t$lL$dD$D$h$RD$hL$tL$$SuL$dfD$hx,D$<D$DD$l1D$< ezfu D$tSD$dƒ80tND$<؃\$TD$TT$XD$$-@D$(D$<أD$$wi؋D$8XVH؄tJuU tu ؃[^_]11USEHP$C[]UWVSD轼Eċ] CE}9G{}ELM܋uűUDE0EH1EЉE9uEEEEEgEU؉Ӊ1ۉMԉ]؋1ۉEE+M]+M]؃EEN9}s] }uAG9Es0uV+E)‰؍M9tGz q s7u/u(UE$]UBEUE다fuuJ z Mq ffUWVS<}vE@8Ex0E }Uxx}؉EԋE@EA…uA…t v0uAE)Ɖ9ME܉pE)E؉p$] )ƋE 9m1E ]9XE pE9)9E @ E؉$]S ]A"P0[^_]Ë](EbNF10[^_]ʋu< ǀ0^0tʋu<ɉMEJE?$]j E@@E}؉8E @}]@"b?)։Ut$E؉$]DžUt(N}#bUt$E؉$]puU3]K 8 t 9u~2U)49t$W0T$D$ $Du1[^_]Í~ u u 9}t$O0L$D$ $u뺋}}z1HUWVS0}ք}u D$(D$<$\$ D$ T$$D$T$D$,D$4$c\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVS|уEM]E TsCD9sϥ9r)؃L9s&)D$D$ $]7 [^_]UVSEPXM 9} u#9r1[^]Í~M t09tݸ[^]UVS|l0)ˉލL u썊a)ˉލL u썊A)ˉލL u[^]UWVSU} EZ]9BB[^_]ÍBEuLMuttb )E^M9uUM ЉFCU9rߋUM})}Lt% 9bE9rE})} E)B>[^_]ÉB$MUVSzvUBJT19r & 9st9sEE$Ɖ[^]ffffUWVS !zdp7} w+l M4tetB-$G2E$qƋEFEFuFF [^_]úMUEl )ȉE w|-$F"t-$F|UWVSyut"F w"dp7u&l 4[^_]É4$ny[^_]-$UeFN?l 4tU$CF[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɉu}u܋EDEd}EUƉ׉1u}D9Mlj t"E9C~$E}|C؃[^_]É؃[^_]ËC$2tKSx s stftE$]u2uʉE$Efx s UE=w5=w=w=?v=]1x@u ]Ã]Ã]U$7t UP@]UWVSM CFM9r}ыU܋]9rB+M uUEPE$E$[^_]å9sܥ9rչUWVS}u F_)u)ODT9s290tۃ[^_]UWVS0u] C~)u:NDT9x9t] sމÿx1F$E؅3x F~}ЍUȍtu܍suStuquԉu}11Ẻ] E]EEK1ۋ@1))ڃ1EEʉHM9MrÉu}E̋] {}̉)ك9 }ω}uΉuu9]Mu}EA1)EU1USE9r׋EM܃})}ωuʋ}) t}؉GE؃0[^_]$UE؅t@@E؃0[^_]ù9u9ur }ω1UWVSEx|$Pt~^$2 )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS $ƅtc] %t D$ED$uDD$$&T$V ~tbM5)NjE8e[^_]ÍD$$T$tI ) |$T$~V~u-2MD$=)딋|$UEM Q tJu]UWVSlsutD$E $wDžD$D$4$E4ptt ʃ9t*xD$4$t|E%=at`fx ttpu ffx fp@P$P,FP('P Ĕ[^_]H)1Ĕ[^_]ÍD$ 8D$D$E1$#)1(O1USZkOrE UD$T$ D$E$[]UWVSkrutFD$4$-nx$P8D$4$6[^_]É4$Aڍ0D$ ,8D$D$=<1$"UVSjÈqut&nxP[^]É4$[^]Í0D$ 8D$D$I<1$>"ffUWVS!jqu\1$!fUWVSiouf~ D$4$F0ǀǀ F 1F t V$ЅxF F0tN@9t $"iF0$ iF0ǀǀD$4$FFF [^_]ÿF tF$hp4$_D0D$ @8D$D$8|1$D% fff̀rS[Ôn`[UVSgwnut8F0u ǀ4$uAnP[^]Í0D$ H8D$D$;1$뜸fffffUVSfmut%V 1f t[^]É4$)[^]Í0D$ P8D$D$;1$UWVSf{mu'7FF <ufJ.t&fF FF uwFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $ufF0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$3,e=<1ɋ8tBD$D$ N|$\$4$I y8t6D$D$ ~D$L$4$W8t6D$D$ VL$\$4$W8t6D$D$ V\$D$4$w?O8t6D$D$ NT$D$4$3_8t6D$D$ ^D$L$4$W8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$ku7O1$[^_]Ë@O58,UVS ]ÌdEU uMtTp4u 1 [^]D$D$4$f-u"udž0UWVS]dƋ4D$D$4$ -EtE$d]Gu͋$C]tMtf~ 18t$]9⋎t $p$4$\uu&E[^_]U98}]EUWVS\b]tCƉ$}\[^_]þUWVS[îbljUD$@$W:ƋUu 1[^_]ËOD$M$W…1]~˃Mt|tatOt=t+tt9EGX<tE[^],[^]UWVSQX} D$$MƅǀM]8bL$ ED$|$]$"mF8FF F FFFF4- ~D1 󫍾󫍕xT$E$豃]~^ $]F]Um]StV4EHt }Gu]Stt LV1v4s$≕@DDDHN F$D$ D$ IL$4$葷BF0F(LN,NV<~$Q9~s~]WEP IT$4$0}M1Q\$E$KT$ ML$|$}<$$ ÉX TUMQ D$t$$xËVnNNFVnNNFV n N N F V nNNFVnNNFVnNNFVnNNFVnNN F V!n"N#N$F$V%n&N'N(F(V)n*N+N,F,V-n.N/N0F0V1n2N3N4F4V5n6N7N8F8V9n:N;N<F<V=n>N?N@F@VAnBNCFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Z1=x>alV]D$ <$ ;F@7NF(șdž‰Dž=N V DDTNꉖD$ T$D$8$]EP D$4$0}4dž$$$B>pXPLx UH X՞Pgp[^_]ÿO$J4$J81Ë-ftT$ ML$|$}<$48녋%8" 8F8FF F FFFF4- ~D1 󫍾1$F~ jM<811! 8ED$4$Bdž08!81UWVS$-H"OuF(x~(V0!UN9F9MUD$N $DMUF($N 9} TDTDF F,9sF0 F,|$}|$4$蠸$[^_]ÉUUE$n?EEtlE܋UT$ML$E$ME)UЉL$D$$M $GEUVU(_US]ED$U $ #C,9C(}#C0[]fffUVS FÇMEpFtD$D$$F u  [^]UWVS)FME0LHPH THxP@X~t=i`TIX=DHD$$$AƅǀXHdž$$A=ljFXDt dž wGYGlG G G:GGE UtAtCFt$%Et$ 4$ E1 XxD$ ED$E D$E$XE EuM L dždž QXPtt!ЋPDPP9X1XA1T=+ff]fXD$ L$D$$ 4D$D$$Rfxuu fx!D$D$$E t @E@t Ey [^_]=1DžT1rvDžPDžLvDžXDžTcrvPDžXZT t$ qT$4T$$D$$ 8D$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$D$PT$$XxD$$( X%=3D$`D$$ q` =b1щX`abcddefghhijkllmnoppqrsttuvw `b1uYduPh=w=u8t_u+X Љ lpOX vrvFTT$ p8T$D$)2$TUWVS$=DEpFtD$D$$FUED$E D$4$MiDžEtwD$D$ED$D$ D$|$4$ !@uFЃ$[^_]ÉED$D$$CUЃ$[^_]D$D$$Ѓ$[^_]ZUWVS<òCuE U VfFFVVfFFVV f F F V V fFFfFFfFF=*F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\N"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]Í̡D$ |8D$D$b02$F xUWVS:uAuE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\NɉHɉH@tH ɉH H ɉH "B9uȋF w̡D$ |8D$D$b02$F ƒv1UWVS(H8=?EpFtD$D$$QFE  D$D$$譺Eb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$蒼$u 1([^_]UWVS#7>}wFtD$D$$,FD$<$tr$'tcFt$e7t$S7t$A7E4$07<$(7E$[^_]øUS Y6N=E9ErD$E D$E$ []M|UEtu]11ɍT9r]1]fUVS6<UE X81rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS45<u|E@Et M 9H 1MEEEEEEMP}GA у@0fuft utpfu{Uzu@G GGBPWxG8GBWO ME9Oft DAfEtD$D$ E܉D$L$4$VEE@Ex#} EHU ꋀEUEMƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$ /E.E@ D$$.UBct MMU Q AUuth}OAMOMW:D$UT$D$ M L$D$E$}E4[^_]Ë}GMOUW:D$ML$D$ U T$D$E$赓E ]M؉0fufE@E܃!‹EHM<E0E@}IE@wD$ 8D$D$T2$|Ex QD$щT$ |$D$E$* E@E܉413'U܍D$ 8D$D$T2$OUB$0USEP M TH}[]UWVS/6E}9UNFt%O L$D$$]UF$.0FA4$]0E9t-F uFtUt NuM u6E9u1[^_]D$L$ D$FD$<$]萔tUSUE @@ @HKYXBP[]ffffffUWVS .Ö5}ED$E @D$E$t7ƅt|$$t [^_]84$f8UWVSD&.5uE 8‹E1lt$D$ D$D$<$+=5DžDžDžDžD$D$$<$$ƃtI<$D$D$4$tntD$4$itSD$D$$E+uqD[^_]Í܆$>X<8D$D$$4$8?rUWVSld,Y3E EċEE 8EEEpFtD$D$$QF #}&Et&u}U+rl[^_]ËEċP}O9 E&D$D$$\DžFfN @EW)‰UEċ@UB 9EGfFED$EĉD$4$LJbfdž~ f}EF(EċP}O9E}9rY|$ED$4$赉EEEEȉEE@EME؉EEċ@E9s]|$EĉD$4$\:EEEEȉEEċ@EME@Eă9EЉEJ}.D$FD$$蛬DžFfEEGdžD$|$$謮ẺD$EĉD$4$%UljEjEf}}?}EEEċPMQ GO)MJ9MsLED$T$UT$ML$ EĉD$|$4$<}  1=f9Ms(UɋU)ɉL$DWD$DW$_UfGG)fGUfDWMċAE@BEB AD$D$$U UBD$D$MċUQ$F(tu 9Fcu4WwGu"f}udžfdžD$|$$Ҭ  YEED$ |$EĉD$4$91D$|$$腬aD$|$$b>E>}GD$D$4$hR1E=B҃9=FED$EĉD$4$聃~ f}t f}f~ }fFf;EfFdžG=w~҃E9džEfmMU̡D$ 8D$D$b02$MU?eUč̡D$ 8D$D$b02$UMUM̡D$ 8D$D$b02${UMkffUWVS0M%F,EUE@(tEpLB< _Gx ZU)ىL$D$$]Ćf}Ufz|rrEXft)ۍLZ]f9sf]f9u]t^JWf+Eft" F]Ff9sf9ufjE@(u 10[^_]èuE9PuP9Us݃UfBыM:9yI;MMA(  UEfEUED$D$D$D$ D$ED$E$]y~UYDMUD D$E$]較tՋUMOMUG D$E$]菃t_MUUE]䍋̡L$ 8L$D$b02 $UEkE 1Et8UUEfEED$E D$E$]qUB=wbF9EEu!BB=^ƃ9EUEfE^EH(U]䍃̡D$ 8D$D$b02$ƃ9EUzUUEfEED$E D$E$]~UE,2BLU1ۉ\$D$E$]UƅEfEED$E D$E$~UE@(EUUB(1ɉL$t$$]KUEMAEfAUUEfEEE D$D$D$D$ D$ED$E$]{UUD$D$E$]VƅE@U=UUEfEED$E D$E$]|Ut]U1D$t$E$]9UU]䍃̡D$ 8D$D$b02$UjE@(E|EH(EH(]䍃̡D$ 8D$D$b02$xUU1҉T$t$E$]}UUWVS 5*&}u FuIFu 1 [^_]D$D$$ӡtYVPD$D$$ D$D$$蛡t!VPD$D$$գ|{UWVS0{%ljU܃,E싗E9BD$BUD$$ƅUBfEHMTFEDtU D$<$N~UF=w?uj>t$<$ut$<$;0[^_]ÉU썃̡D$ 8D$D$b02$~UE EF )‰T$L$Eȉ$(EfEfFEDFfENUBft?ЍDVEȉMU؉uuMf9sfUf9uMU؋uԍLQF=f+Eft2Auu}}Af9sf9uu}fnD$t$$襡E܃8tRE܉D$<$t#fFfFF 묋E܉D$<$WnD$D$$51QD$t$$1UM䍃̡D$ 8D$D$b02$UMUWVS@Í"}EpFtD$D$$螠F pt>tȃ@[^_]F(tިȃ@[^_]1EE䍃̡E؍8EԉuED$E D$E$FƅEM}$f9t$E D$<$hwFD$ ED$E D$<$ E@  V=vE܉UE؉D$ EԉD$D$b02 $1E܋Uf9b~E@M=HfNfTf}܉u |$t$E$v,GD$ ED$t$E$GGHfuIfGE@=UEOfO`D$FD$$Dž@=FD$ |$D$4$G=@MD$|$$ҝMYD$ED$$话4=jU 1ɉȃ@[^_]ÉM썃̡D$ 8D$D$b02$MKD$|$$"띍̡D$ 8D$D$b02$D$ED$E$ڜNuG}1f;}uD$|$$蘜FEčMML$D$4$ CN9|fE̡}Ѝ8}̉ωщ>9RAEȅ,D$L$M<$F,EE9NjM@9ED$L$M$ʛEE9ƋMTFD$FD$$6FEQvMԉE؋EЉD$ ẺD$D$b02$MԋEA̡D$ 8D$D$b02$D$ED$$hD$T$$ӚD$FD$$`Dž5̡D$ 8D$D$b02$AF8@xf}܋98}fxXDy|8f@D$L$$D$|$$蒗1jmЃ}uf}D$L$$躙D$EȉD$$G!VF̡D$ 8D$D$b02$9/}suuD$D$$(e5D$L$<$ED$EĉD$4$h?[F,E׉J9OMUD$|$$蓘U싲1M91D$T$U4$bEM9΋U;EFD$FD$$ɕ…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$${D$ED$$Dž@=wU܍̡D$ 8D$D$b02$UBU`fU܉1D$|$U$1҉T$ED$U$oDžUA։ffffff1̀ffff ̀rS[D`[UVS2'ut5D$D$ D$ED$4$Ot6E[^]ÍD$ 8D$D$5|2$럸fffffffUWVSÓUE pu 8lE1ptEuAx=EGu4Ѐ:U)hx9׉drD$/$t)1lU+Ĭ[^_]Ëdr 9d`%$>F 9dgƀ>Xt։`dD$ h)D$|$`$Jpd9r9>/utD$$d"B/|%=@dt~{8u)сS?hD$ 8D$D$C2$hM+X\pD$E  D$\$8Xh9Ƌ` 9d)@u08p9hD$d$输u6Et)D$\$@JltD$\$@.89d`iSfffffffUWVS  Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfRfUVS r g,4$D$$D$F $? [^]UWVS . #}$W$W#1$WD$$D$<$x?t$<$> [^_]US ì,$X[]US, ÆEEVEEED$D$ED$ ED$D$E$t}u E,[]ø,[]US ,$[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EU܉EEE̋UUUUĉM؋EEȋMMЉ}MUE te kE2-byEnd 3Eexpau֋Uĉ|]11 É]1uM1EMEu1]1 M1ΉMˉ]1uԋM1]1 Ήu1U1ىu؋uU1M1 }11Ήu11 Ɖu1UډU1ЉUE]؍E11 4u11E1]؋Eԍ8M1щM1 :]1؉]1ωE̋E}NjU1]1 1Ӊ]1m}uuUċ|UexpaUnd 3SUԁ2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C(8w68)|>)1ɃtfTȪLB@t@L>))t 19r\$4$)ߺ81tfff녪gf uhuW6ЃE1U U9rU6DfFf\7Ef렉ȪUWVSӉMp x$?tn@)։u|(9uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$G W$@9ue?Mt)ʍx(5tftM1H X$[^_]Ã}?$x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S+B,hB0kAB4كB8y!~B<[zP1uUuFu-u%BHBLB@BD[_]êftэt&f볪UWVS \uFPEVẺUЋFV EԉU؋FVEUFVTXF V$N(^,M]N0^4x|N8^<`d^PP:}܃L}쉽HEĉUH]ux|]ċuȉ]u]u]ĉuȋ]ԋu؉]u]̋uЉ]ԉu؉ẺUЋE HE @GEU$T$\ Ɖ׋PSE EċUȉEUMċ]ȉEU11ډEUMċ]ȉEU11ڋ]3{Mыx|!ω}M!Ήuu}]!ىMu!MM]3M3]`dEUű}Љ11ڋM̋]Љ11ډ`dEԋU3E3UM̋]Љ!Ɖp!։tEԋU؉ƋM]!Ήh!ډlpt3h3l`dTXu}M]PE}܋M]TXx|`d9LE܉UEPpp)|>Q1tft:7~Qo1uDuQ1s^tft\$4$;ߺp1uwuh"t䪃ުn.f0uGu8rуM1ɉUU9rUif둪ofUWVS ÉT$ʋp@xD)L$|P9L$t$KD$-D$/|$41s@{Ds@{DsCHSLTT$T$T$CPD$$T$D$,CPD$B|$D$؃D$T$ |$ָL$F&tftT$D$D$$is@{Ds@{D9T$rCHSLꀋD$9wT$ ovjBL$D$1T$L$L$$C@SDC@SD9ƉыL$rCHSL逋D$9uT$t<Ѝ{Pt$tft1C@SDC@SDsCHSLe[^_]frЋt$ru^zfD$u[u@L$D$tCP{QBffl$L$L$BKUMt U E]UWVSh] } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E"]UWVSǴü } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUUʋE ]fffffffUVS EDžDž<|<s,>z DE5N ?=' ==D$D$D$D$ D$t$$&D$D$D$ 0D$T$4$Mtp0[^]=t*=uy늸۸ [^]ÍHúSu,t돃DuD$b$oo̸ XNDd :0&iDžDžDž D$D$D$ 0D$D$$ D$D$ 04$T$Pmz1vpDžDžDžD$D$D$ 0D$D$$ZyPD$D$D$ 0D$T$4$׵0[^]ødj낺FsGdD$D$D$D$ D$t$$"`&C0D$$0D$$h ~ m ^O@E3D$+*)(&%DžDžRDžDžm G6D$D$D$D$ D$t$$ /D$D$D$D$ D$t$$O D$D$D$D$ D$t$t$ D$D$D$D$ D$t$`$BB DžDž DžD$D$D$ 0D$D$$薱t0 ><S,BD$D$D$D$ D$t$Ϣ$1D$D$D$D$ D$t$$Qup3fED$D$EЉD$ D$D$?$u}u tTE E E t UWVS sh <$tt V6u=c$Et+%t V6u<$sE [^_]t V6uD$<$[sE [^_]US$ɥþ t$[]EEED$D$ED$ D$D$E$貪t u#D$ @D$D$A03$9] mUWVS E U}0@DFƅtIFEM 9GJUD$F D$ $UBUtRFE VJE}9OT$T T$$GF]CE1[^_]ËM!@`B~ :MtEuVMQlj9~ MQT$L$ MQT$lj|$E$u;E]넍GD$|$ BD$F D$E$UME!@~ `UD$ $ĠtljGUL$$裠tMVJ}OUWVS/$ uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9rt% 9t 8t)؃[^_]ËE)[^_]UWVS]E xS9sHы0t/}U x9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS 辡 E}E pE0EEE90EuNEU9sщL$MFD$E$]=D$t$$x&M)Mt2MVD$T$$]#ƅu [^_]1 [^_]ÉUt$E$]9Et͋]E0U=UWVS(Ơû E }}8}xEEE3UHD$D$E$%U)MMuE؉D$E$ƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$$1([^_]ø([^_]UWVS褟Ù }E pD$D$$U"tW@ u^JM"D$ED$$$"t&M)΋PUD$<$b9ur1[^_]ø[^_]D$D$$1$fffffff̀rS[ԥ `[̀rS[ô `[US 裞Ø EU D$T$D$ED$ED$ ED$E D$E$a []fffffS[> `[.&f̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVS耝u tMƋuA~8t:F4@9s3`V8F4@9r$՝F8[^_]ÉUWVS E}}u 8ENjE1txF8t1ɋ}E+wȁĘ[^_]ËF4E@E$]謔F88]E F4F0E|U1E} OxD$`|D$}|$ F8D$L$$]YUF8)UV4V0]l[D$ D$`T$ $~4V81}׍ @rPu B8~8BX]9uE~t$]F8]R9Ëtt]X8 t5UF8M]kX8F8$聛YX8F8M$]גF8tgD$`|T$|$ D$xD$E$͟uUN8]Wt?]W{]xUWVS<,! EE M 8‹E1%;E = 9ƅDƅdHD$$ BƅC8DžD > BD$4$)D$ |$t$$Ƅ=D)VD$D$$W>Ɖ׉Ug 8X9;-D$BD$d$诺D$D$$菺 {tD$D$$Ot T"U+ <[^_]Á}$ @ Džh1Dždd <$覎D$`D$D$ t$D$$蚛~ 9WǸ։l[D$ D$`T$ $! $9_Q((1ɋx9zz11ɋ)Y99vЋu@8RщT9PuQ(9P(\n$tD$D$$訶t RR etD$dD$ $>tUt=6tftt\1Džp8H41`9t9F@FD$$Bu9;dt9FD$FD$$覵F D$ t$D$訴 tD$t$ $o9eu d3D$BD$d$ٴD$D$$@p8/tD$D$$蘳tOBDž.D$BD$d4$ 89:y``9_$躑}d$>4${9HN8 t릃O4H4W0P0W8׉P8|tP ILP`9uM$=|tD$DD$$t_M?I‹uB8`9r勅9s$4`9u닅 $$'$<gt{LtD$D$ $诰D$!<$`膆Nj@8@P1f^$;FU$;=D$S;,tLtD$D$ $m+_t΋$:iUWVS  <$ZE D$ ED$ED$E$MU EƉ<$Z[^_]US Ìø EU BJ  D$T$$ []UVS od utEىM)E}|$t$lj$UED$}|$4$UE<ML$|$E$UED$\$<$UED$\$E$UmED$|$E$UM܉]ZGu]E؋} 8MED$ED$ ED$E1uD$E$uMED$ED$ ED$1uD$E)ȉ$@ƋE]XQu]E)ًU)+U9xNuUT$ML$E$UUT$ED$E$UEEML$ED$4$Uut$ED$<$UuML$\$<$UML$\$}<$UU܉u 0sHuuʅ#ML$ED$E$U(EEED$|$E$UDu:}"MT3T$ @T$D$lt3$%:E aE T$ @T$D$mt3$9E 7Uсʈ UT$,nD$ ED$E D$E$]fUVS 蒁Ç EU M9Mr/9r 4 9r$9fu49rL$T$$ [^]mfffffUWVS$1& lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$"AM1 ЋMu`EUD$ T$L$FD$$L;u<tVT$VT$$$Ѐf1$[^_]=UWVSJ; Ƌ; rEu =[t6CuudKStqPCS t[P ؃[^_]ËD$$|Åt@C؃[^_]Éډiu1V룃T UWVS{p u xD$4$E%=D$($t{Džts@@@9uE ED$D$ EЋUԉ$T$5?EČ[^_]@<1Č[^_]UEU U U$]UVS~n ]ts tWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D @-D$ D$%D$3$ U D$E D$E$]UWVS}à E HMxPpt)rP@t3B E$}1[^_]ÃMt P@u͋MAUWVS,} }u ;VЃEljE@uyts;puXY LADTPPX Z O@H PWEuH@,[^_]ÉKE苏M1҉E܉UL$D$ $T$<1 ЋME܋UD$ T$ED$AMD$$VH9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA,[^_]É\ LoD i81o81~BEH M]8O1WUE PMt ʈP1]UVSzÕ ut PtH J H ${u4${1[^]UWVSZzG uu #[tCtډu[^_]Ë$A[^_]fVSD$ L$t 8trtl@͉ .&vލ1΁ €t8u.t(8u!t8ut 8uHu1[^UVS xy] U Et7Mt.ZYutD$D$ $E [^]UWVS y } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Ku#ED$E$E܃ [^_]ËE+E15TEfH @jUWVS(.x' E܋})u UE XBE@ S]KE] :}Z]ru}_]ϋUfBfBKMʋE9s‰EЋutftE])XEUEUE @E)Ћ] Ct8E@ MY ]ϋUlu>}~}uC1([^_]É؁vD$|$$х~~)ËM IM)‹E PtEH,Pu>^E$]AE@ 9E\$ED$E@$EP,…EfH @HE1E‹]9sڋE@][}9Os9~‰ÉϋutftU]$]Uq)UU)UE @E)Ћ] CE[UJЃtUMEED$D$ }<$]e)EE9xsNMʋE9sBȋutftUE}8$])}UEHE9m1)yD$ED$E@$EP,…K)EMu9EPp)׋E 86p9rD$$]q]+SSUSCslj;C ЉϋutftE)P)UKUE$]1ɋU-[;Q]؋usStft]E)C=EE\D1$. *Í0D$ @D$D$G3$*u ]܍)D$ @D$D$H3$*yfvBvBfvEfXfvEf]>/i]+/ VUWVSqÅx utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]0D$ $@D$D$V3$([UWVSpw utLD$4$F t$4$D$4$[^_]. -4$?m$[>lj4$?[^_]ffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSAo6v u7t`F t4VtGF uuQFF1[^_]FF؉Fu(VfF u4$.t&;1뮋V0 t~@9t $AoV0F FV륍0D$ 0@D$D$<4$\&DfffUWVS.n#u u}E Fft[xT$$<xEE%1= ‰UtIM VL=u*F9F(uČ[^_]E Č[^_]ËE 千0D$ @D$D$,4$V%E 45D$ @D$D$,4$!% ED$ @D$D$,4$$UWVS|ls u 8E1F t)fF FCFFE+O|[^_]ÍED$ED$4$0EF u 9vEE$kdk€8|U FUEFEuE f F vFft$t܋E f F Rߍ0D$ AD$D$|,4$#FfJD$ XD$D$@U$U U$EF։D$ AD$D$,4$h"2a$辕XtUWVS+j q Ɖ׋@0$7F0PEB;9EED$$;F0Pt$T$8$8F0PuD$E$];V0U:U쉂PF0ǀTu Xt$7[^_]ǀX\D$$:F0NjF0TXtXU ip Mdp7u]1҉]UWVSho udp78u [^_]ËF0$h6F0P9V09t'Pt($66[^_]ÃT1݉U9UPV0ǂT1UVS=h2o udp7u[^]ËF0$5F0Tt$5[^]ǀP8$6F0Ugn MU dp7u]É]sUVSgÔn udp7u[^]ËF0$(5F0U t XtTt/$4[^]D$\$8F0ǀP8$"6F0UVS8fm 8E1EȉD$E$KU+u 8[^]fffffff̀rS[Ôm `[UVSfwm u tt$D$t,@E$[^]ÍD$ AD$D$9P4$5UWVS4fm D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"(#D$#ED$ t$|$D$($v D$$"8"L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]I"MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍D$ AD$D$Kh$(L$(=D$ AD$D$Mh$E"UWVScǾj EU uM] $\$M] @-}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVScj u} 9vtGFfuUT$|$$)xFP^T[^_]ff [^_]ÍD$ PAD$D$Cx4$덍hD$ PAD$D$Ax4$X9vVwD$ PAD$D$Bx4$%'UWVS bh u} 9vV Ft5ft\D$ D$D$$!Ѓt<V FfV fuUT$|$$?'[^_]ø8V F뱍D$ DAD$D$Vx4$2@hD$ DAD$D$Tx4$9vwD$ DAD$D$Ux4$;UVS`ág u9vu`FftAȋED$ E UD$T$ $M!уN tFPVTfN [^]ù뻀fN [^]ÍwD$ }1thTI|$ D$t$E D$L$T$ $7D$D$4$5D$t$$ &AljUED$ D$E D$E$4UWVS8GN Eu} 8E1>'TIT$ t$D$E D$D$|$ $7D$D$$u(u~5E+8[^_]:|$D$ D$D$4$D$t$$ t,JH󥋅D$ a7D$D$$O:AǃV$q…1A<+wLKuىD9u˃u뷃z럃b뇃Jl謋UED$ D$E D$E$R]UVS<9E.L uE EEEEEEN>wN# t$ED$EȉD$4$UxE<[^]EӸ<[^].UVSw@ D̍ED$EȉD$4$x E<[^]ø<[^]USDJ :UT$$K[]CJ -f̀ffff7̀rS[äJ `[>̀rS[ÄJ `[USsChJ D$D$ ED$E D$E$[]US0C%J ED$ ED$E D$E$+[]ff.&&$D$4̀D$̀fffffffT̀rS[äI `[PS[ÍI [USuBjI dp7u 8[]&[]f̀rS[4I `[US#BI $1[]UVSAH t [^]É4$ ^uD1f1ø11AH 1øUWVSD$ Y+t .A40G]$D$ ѫGG<$Dž@(@t$D $J<$Rv80@1<$LD$ ѫD$ܫD$@-$U<$f D$ b뿋D$)D$@-BX$ͳff̀rS[d `[UEU UP]UEU MHUP]UWVMu}u }E E=ɚ;~ -ʚ;1yA^_]UVSUEu M ]+M]9|) ZB[^])ʚ; ZB[^]UEU +EU uE+Ex]ø]É]UVS aV uED$$uuEEFEF [^]D$E$SAx(E EUVN [^]FF [^]UVS ï uED$$uuEEFEF [^]D$E$@x(E EUVN [^]FF [^]USMEE UQY[]UVSMuMb)E UQY[^]ffUWVSL ã }E E 8‹E"|%W`D$$D$ D$D$D$ED$ED$ D$D$<$ ƅIu G$@ED$D$ t$D$<$XƅZWу @ 1 $ED$ ED$D$$˫ED$D$ D$t$<$ ƅ~QG D$D$D$D$D$ T$t$<$ƅGD$<$ E+RL[^_]ËD$<$` ‹Pu@fffuGtwp fHfHff$at$ɉL$ T$D$08$\PtGtftPD$<$ <$#Y$D$<$_ D$<$M D$<$; NOUWVS,  }U ME 8E1GED$ED$ L$T$`8$PL$T$ rD$D$$ȧ=E D$D$ED$ ED$T$<$fU+,[^_]Åx$蚵=wttH|.uT$L$ D$D$$UrD$T$`8$8qD$<$ 9MUWVS(H= E E 8‹EE@ I<x$f2&T$$舫EP-D$ D$D$4$@ DA@tD$4$guDJ@utSFNu tDJ@tEpt$|$<$v7$ʜ$踜1U+u ([^_]KUWVSLÌ }u E 8E1D$<$m11Ҁ.փu9rMd9G GDGDDžDž\x.uED$D$ED$ED$ D$D$<$zU+L[^_]DžD$ D$D$<$dt9^G#GDGD}1DžED$D$ED$ED$ D$D$<$+GGDGD1DžDžDžDž.UT$T$UT$ML$ D$D$<$t~8=^G1҃‹Otth uAED$D$ED$ED$ D$D$<$RtD$<$IED$D$ED$ED$ D$D$<$PG tD$<$낀xbV1@<t 1ut$t$ut$ ut$D$<$moGDGDDž0ED$D$ED$ED$ D$D$<$)Dž;D$<$eDžDžDžFfffUWVSlQF u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt[l[^_]ËE$EE$ML$D$ ED$`-D$8$U($},~r EEML$D$ E,D$t$E$FjƉt$E$oEEFD$ $WU(fBMЉU(E,) }|$}|$ D$t$E$Ɖt$$ FD$E$FD$$FD$$ U(fB )Ѕ9}ET$ MT$D$8$ EHE H E, 9/B B U(D$E$,U(BD$E$U(BD$$U(BD$E $E U(t5BEE ϋus3tftuu )fB fBl[^_]ÃuuBzE fUWVS  U }E@4E)Ѓ FD$$)FD$E=h$VfFE@ uN1T$$F D$$ G fffG )~ [^_]ø둨u+9u1 [^_]Í$žU *U$謾U뿸UWVS M uU E@}ω}EE‰EPE)96UB9E'9}}|$4$GD$u4$W׋u$sxuXuQ}׉+u9ED$4$^+E~[^_]äft.t&9}u1[^_]uvkUɭ$]UM 9}y8D$ MD$D$=8$jJ^MAyEpfhfffUWVS( ljUM܋EGlE8u䍃ݭEE썃 E< t< tD$ED$4$耨D$ED$4$aD$ ED$4$B/D$&D$4$ G#$ܻu< tt < u>:([^_]ÍF$~d ʈdGtD$$a닍F$E~GjD$$,SD$ ,D$4$9tD$ D$4$uEO F $~GGD$$諘D$pD$4$踦tjD$9D$4$蚦uXO@E܉D$ED$9$BOWL$T$8$#yO >D$@D$4$$t*D$ CD$4$ugOD$yD$4$Хu O@D$5D$4$覥u OD$OD$4$|uZUm D$4$Xƒ?v?T$U؉t$E$|EUƄD$WD$4$uZE D$4$ƒ?v?T$U؉t$E($c|EUƄ(D$ `D$4$茤 D$kD$4$gu OWD$*D$4$=5g)UVST;0 $@Xt<|xEEE%EEEEMD$D$D$ D$ED$t$=}tT[^]UVSÇ Et4D$E$'EEFEFЉT$L@$mLt׋$ˆL,D$ $L)&D$M7D$4$/ D$.4$HmD$D`$HDǀtǀxDž0Dž(<9$蓩D@Dt$D~DD$4$cu덃$T< tt< uDž0<4,LTDD|$@$0l<NFVe9xDw@ut;u㈕$<,t$$C<$t]TDLD 44 $4,LTDDDLD<ȅy_%=tdwL$,D$ $股L{;$1!$tDž0pvLusL@DDu|uc'z*D$D$J1ɉfLu LVfqUD$E$#]UWVSXÓ }u hl3 3 t;D$<$t  F FX[^_]Ë 9puttl|E*9EttIMD$D$ED$ D$D$t$OkBt  F F1X[^_]UWVSU E@ E~tE~mEX1&<1|1t_Bꀃ9E~E9Et=}ù{u֋ KJKJK J uv uꀃ9EE[^_]Ë OJOJO J uv uf̀rS[ô `[UWVSdÓ TD$4$]@$]DžDžDžDžDžx@ N L$T$ VT$D$$艧\T$$w@ 9@ωփsUtfth@ lj)#Pd덋ptŋ t|$$vuf떋P04$@9‹(tft‰)@0DžuY tftlj)@4#tF4$R@9r1‹rf$Vu@ $ś1d[^_]‹);Wh@ 1ffi$,t00P@~~ <9V) 9kVʉ)ȉQ1ҋ?tftH<@ lj)99h΃r뀍`D$ MD$D$d9$}x@ $r4$U@9>‹ytft‰)‰DžHtftR<lj)944$w@9`‹yUff^f# PD$umuTk@ $f+ f넋$xp@ 6UVSf[ Ơ7t$pw[^]ÍD$4$}[^]UVS Ơ7t$o[^]U U4]UVS ut$v[^]ÍD$4$B}[^]UVSt ut$Yo[^]UWVSMB u}t5W¸t[^_]ËF [^_]ÍrD$ ND$D$|d9$UWVS }uENH NHD$4$<|ƅu!yH L$UT$@$ tEG D$GD$ GD$D$4$u4$*nG [^_]É4$ n[^_]ËG [^_]ÍrD$ MD$D$d9$֎UWVS ð EC 88 ,-:)lj}싓( u2E  D$ $  [^_]Ít$E$lt$$ $lt{( t1= ;txED$D$[luًED$ˮD$ED$ GD$9D$$ [^_]Í9D$ED$ GD$9D$$h [^_]ÍD$ pND$D$9$EED$ܮSUWVS  ''w}  )ƉT$U$tn  UT$ $tG   D 1 [^_]ÿ'y qUWVS(K8 LJ LJ LJ     11ҍ VEE5 )Ћ  ڍAw ,ND>ЉD>]T>ӉT>lVMHL>@CD> C kTLTE֋ xzt =w ;NEt =w ;N tH~k LJ yM !؉ MeM썇v$  MLJ   M싗 1ɍN]MEUtwM<9ErMtu艷  Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>lV TLU;D> rU7UsD>HL>PD>HL> HU7Ë ; eLQH P H HLJ U MULJ D>UMD>ЉD>]T>lV T]ف9NLQLJ 롋 LJ$ LJ( D>ЉD>]T>lVoMU,-E 8E䍇 $UMD$1ۀ} ËE)؉D$ GD$9D$$mUMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@6UM^D>E싟 ]X] É %LJ LQ f gUUxz Mt   ; r tXLQ H P H HU Ћ]!LJ $$ffUWVS0 EЋH , u䋸P }9EZuԍLYLWu썰 Xu؍Yu̍YEE]]Efd t1P}艗T PP , 8 X 5R}苗d \ D$8 $d \ 돋D uЋ@ Eԋu؋< , À8 u }胇89u}UX P @-8 E苐4 @-X4 U苂\ }]苃4 D$ D$< D$, $rLP X >E苀, P[^_]ø]苃, $K $Er…MtO1EP-}L-E7LEDXtE7<$]~rƒ9r̉E8R1KU}X MԈ@ }ԋD EU}ԉ+, EX Ћd U\ }Uċ:O,T OŰU苂P , U9E2\9ËU)Ӊ]W(EUȉP H XND]荃D$$!_E艘T 8 G,+UU]ȋU̍<Q9uUċ:,^MO uquF_ u؉G D$ $]MGt/U艂P Uċ:MO u#O)ȉƋ_uGE荀:1uȉMȁ vE W18 M苹d \ MċKщˋMD9UUċ]苃8 $ WUuUȋ]苃8 $hUE苸d }\ M[^]荻 8|u 8 kd 4 ZS < IB , U5. U8]U U8 ]U U4 ] 0 Uܺ U0 ]UWVSʺǷ \ u"$d uމ4$)LJ\ LJ8LJd LJ` LJP LJL LJH LJ8 LJ4 1[^_]US E$[]US E D$E$%[]USǹü E$[[]øUS螹Ó , D$ED$8D$ GD$;D$$V[]UVSJ? ut,D$4$XQff D$4$lQ[^]Í0D$ d[D$D$5;$pfffUVS Ҹǿ EpFtD$D$$=F!u  [^] vUWVSi^ uM.D$ ED$E D$E$腉Te>EDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$aqDžH V€ʀ UTPtD$ D$D$T$WыU !ȃP{vltat0<$T$~Dt01[^_]À Vt t0<$L  PxD$T$OP^E E DžTED$D$ D$D$$oDžt HƁ ZLsAs0E/s0 6s Go G,@G g G Ge Gp GD$D$L$8PLPP LЃHtfD$PD$L$:H  D$ $PP D$돉Lq8PLen  P6D$T$NGP@ ƒ@ ui bBh fffUWVSֺ }EpFtD$D$$8F p[  D$4$u_  t$ur  T$U4$Džu=U9B0E pp[^_]1UD$D$4$Mt̀N(UV$ED$E D$ T$L$M4$ !@MukF[^_]ËX[^_]F(V$tߋ9F(F$PD$D$$+7[^_]UWVSָ EpFtD$D$$6FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$C !@MuFЃ[^_]úЃ[^_]ÉED$D$$6UЃ[^_]ÉLnUWVS$诰ä }9EUEEEE;E MmG$Eu݋M…tUL$D$<$?UUD$ ED$}|$4$8u7}UcE;E sQ $[^_]Ɉ뤸$[^_]ÉT$$t㉇1UWVS(od uE䋆EMM܉;E E苷EHMU$CƃUtY9Euȋ})lj}苊U|$$U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$6u@EE9E 1([^_]D$ ED$ED$4$6l([^_]UWVS(ڴ EU9}] E苊;M 9EE܋E9t<)t29ut&M\$U\$$] =MUD$ E܉D$L$M$U]5M9M Ut%E9s.E9hw1([^_]Á ([^_]É\$<$DžUt([^_]UWVS(rk EE] ;M sf]]9suE19r 9t[:u)ÈU]D$ E܉D$L$ME$]4uEFM9M Uu]1([^_]É)맋E ([^_]ø([^_]UWVS蒫 EU EpLB< D ?ZU )ىL$D$$]* f}U fz|rrE Xft)ۍLZu0f9sfuf09uut^JLB)wmft" F]Ff9sf9ufjE1[^_]ÉMU GD$E$] U M̉EU ]썋_L$ [L$D$; $+bEU UEU ]썋_L$ [L$D$; $aEU U E]썋̡L$ [L$D$b < $aU EUWVS莩à D$T$$tb@D$T$U4$DžUu D$T$$h.[^_]D$T$$H.[^_]ÿUWVS  }EpFtD$D$$-Ftt88f [^_]ËE t9sF [^_]F(t‹tF$Pun$ 1 [^_]Ãtރ [^_]UWVSD& }wFtD$D$$/-F}   8CuD$4$D$ D$D$$nH F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$l;EtD[^_]ËMN$tD$ D$D$$G!уtD$T$$7;u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ_EE$D$ ẺD$EȉD$<$W3EԉEE؉ED$EĉD$$k‹E؃9tD$<${mD[^_]UWVS軥ð u~GtD$D$$*GD$4$G uUEu@t*$:]uU|$ $tUx?UWVS \U EE,E}1EED$ED$$]%ƅ@ @=fU1 9M rTVÃf;EuUMUfY]][]]}tH}t8MNDF,D$t$$]'E!D$DFD$ljU]荃̡D$ [D$D$b <$ZU ]{_E}E9}twu})D$D$$]&9utAFD$FD$$]\$tVTP‹}u뙋u]^}8 [^_]ËEpE )}fG w [^_]fffffffUWVS$! uƉЉfMy} ~ϋX9U)ω\$D$M$]EfC 1U~U 93;DD"=. fLD$ E D$ƉD$$]`ËE XKMǍDUfTTQf[MfTftEff9؃0[^_]Ã9u}ԋGDC$GDM_=ƋC 9Ex}؍Oȅy¸} E PS$u}+D@=D$1]܍>fEEԉEf}eMfyvDTQ9.ED$E$E@EMU EHfEEf;E}f]fD M)lj}]U)؉EE|$L$E$]C9E U5]f{vDTS9szED$E$E@EMUEEHfEEf;9]tED$E$1MUEUԋMf9MsFfED$E D$uF D$t$ ED$ED$E$]ruOEEtE@EEEt5@EEESpEE@ =ufufČ[^_]fEEEE]D$ \D$D$8<$ AMt !EEfEE:M]D$ [D$D$S8<$@MgUWVS$zo Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$ƈED$$QEu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$PR…t EME$EPEwD$ |$UDBD$4$Q tʋ@f8 $dž mDUWVS,Նʍ uE xEFEEEE@ETGփ>VMM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$UU)UEftfDuf)tGfLGM yITGփVuJҋu9sM DG)fET$U܋UT$7$qU)UUPMf WfЍL)΁M wdftGuftGfWL$E$E*DEfEfDU܍_D$ @\D$D$y<$<M UaM _D$ @\D$D$<$<M VuM DGƃ=Fu!_u䍳@\uDG)fET$UUT$7$U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUt[u9s‰9E8Eu;p)E9pEfDN,[^_]1,[^_]fE D$E$E tˋxLUED$ E܉D$D$<$:UED$ E܉D$D$<$:_D$ @\D$D$<$:,D$ @\D$D$e<$Y:E@E_D$ @\D$D$k<$!:D$ @\D$D$b<$9FE)UWVSʁÈ EE @u E1Oft{DPND$ t$D$E$]fLƅt|$E$FfUH]uYfwfuf|Pu E]M IM1M AKEfE@ =\)ځɋ]fTKMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfAfAF^[^_]ÍD)wMfTAhU]썃_D$ 0\D$D$<$8E@ ] UfTK=UWVS؆ U EzMq uf+4GMM9U t$ED$DM$8u)uD$ U T$MDD$E$4J…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$袲Uu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS~ Eu} 'D$ D$DJD$4$]YItDPfzuft,ˍ< fD$ t$MDD$<$H aLJ(@f8u$LJ 1;D$ t$DHD$<$G…@ fEB@fE1fEE$#MAE9F ED$EFD$$OM1U)fUN fMD$ t$MDD$<$ G…ZM_LJ $LJ(14r9UWVS({̂ E։Mz@ =uW)ЉEN MMȉEGfEt$|ED$$wUE D$ED$ D$t$$E9F ED$GFD$}E$E([^_]D$ t$DGD$E$E…t#M L$M $MEEvE8UVSu]ED$E$1ɋU Ct1[^]øUWVS(7z, uD$E$1ɉE/D$ED$E$3EED$E$M fA fJE @EEE@E;EEHppfEHuj/V1ZYtp%t0MPVZYMu}] EEAe[^_]Vh "hU "h-;aUWVS]u 6+_h$"VS o tfulp7-ۋ=p-)u=-u h$"Zt- -$"hj5-5- @u5-h$"jch Xu4'h$"jAMUW6ZYMtUBk `%u6h$"jVKSWh%PUWVS] 3 h5!#jrh5!#Sum@t h("p-DP-Zu-w$1--`%5-`%jjP4- y 5---*=0 -v-u h("j-u#--("-`%-`%(-%H%hPR3- yT-P(-%H%hP5-ң- - y5-hUW$jl--<(-u--u-H-uj-D- -9ӡ$--se-tá-P-t-----  -t- -t(-%h=`u; - ----%-RP5--P (-t h("jh-`h۫j%hj%1=-=-= --hh0 -P0 -V5(-0-4- t H-L- @-D-9щss -- u15-5-5--P$ u15-5-Z- rPPhUW$WY[-u5j5-5-5--P  t5-hUW$XZ*-------K-]-](-] --9Uu/9Eu*--ڣ--@-D-6esEUӣ-- --H-L-(-t1----j31=-=-XsE--EUMth-l-EU-uRR --8-8-=u=u%=ۣu5*-t=- -9ȋ--s")1=-󪡸----- -t j9[Z -5$- tH -1=-󪡸---- - -)։ -5$- u-=-ujPY@u$8th("5--PZ@u h#j\|jxUWVSX ] 3zh5!#jkjh,"SuEg G-$%|-1l-H-x-t-1l-H-@p-z<-l-1=H-Yh-J15l-H-3d-$`-1ɉ l-H-\-X-T-P-L-=D-th?,"=lp7tu hd,"jz1nuou8-j,PtYZFt@jVaD-^Zu ht,"W8pj,W@ZYt x>1>:!Ph,"h-R j>p-T-=t-t t9h,"Buu/ h-t'h-"&=h-thG-"\-p-jWwX@-ZYu hn-"y;O|-=d-t11X=D-uمtՋ=X-jWWY[^t' 9=|-tЃ=d-t ]tljuti ȉ=X-\t 1Z01C PmjZP0Pt 1B"@-~h u)VI__Zu h-"jx15@-DRPЕZYyƅu(3%=`uƅu3i@- PVY_=@-i =`-t9PVYZt=P-Vh-"}=d-t%" r=P-ugh6$3h-" Qu =P-u7h6$V3h-" G=@-=P-u3hUW$|XZ=x-t4011Dž8hhR)%PO L-5x-8i@- 192t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t =t-u1&t-@-=x-t50A";@-si  C1e[^_]USEEE EE0 [1҃vU|r҉-UEh1"RPc_ tvpt.Et?SuF-Ƀstxu0 -볡lp7---Ph`%h- jEp-EE)ЉEEt9E8-u/-EH~p-)EEEHEj1ۉ$3ZuYhxjXZjjY[hjXZh@-Yt1h-h1"hXZh1"BYh?j[XH-Et^E8tTE0.YtEEj0YZyj}Z,E8!tYEh0h-S @Et9h-h1"ggYXE8tj(Zuh1"6BXx*-tPhUW$Y[h-Xy"=-th-h#h- uY=-=-h-h1"fZYh1"A1ۉ$Z&f%L-1-냋-| thr/"qAXf%L-^1-hx(/x-PRR tt 1j1ɉ -h-h1"f[Xh1"@1$d=-ujpjZuh-5-h2"h-h-h#h- h-h1"eY[jZZn=-ujh-5-h2"h-wUWVSXu} 7ghˢ"YZu2" fulp7h2"WV&[ utt p-)NvAQE8}WUZE1% tAB9EsEUPQMWk UuMt6QWh2"jRoփ빅u Wh2"AE@t1j URPxE ;F|E8tEph2"joE1~PS7YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmW- UWEffEERhm+fEEERhmW 1!EPhm8@W x E%6Sho"jnf9tfuPh2"EPsh3"KU1"OK U83"O MOuuuuuh<3"N$uuuuuh\3"2uhz3"% uh3"XZQURPW x%uSh3" ,URPW yShUW$j,mPh3"jj;UWVShu E1E1ۃ}~F8-tEh4";_th4"P[ZYu -h4"_th4"P1ZYu h4"tXjh4"h4"ϝ|EP8uh5"d0YE_t<1ɉMMMMMMJh 5"{lp7PuZYh+5"jkEhQ5"WE)P WE @}w}c}6to)}4E뷋Ed$H%}8tEKwn뎡lp7Eh'5"5lp7PEXZjlp7E]EQEEp-p-}uCp-EuMp-4>tj@uY[t8P}t Uxu)NjMMU9rxtEE xt}t1ۋtP3Z\tSMXIEt'U)RPSFwSÃ~t C}u"h'5"h$ EZYu ha5""}uEEuh-WuuEpEP腔uU yj=-y h|5"}tLjuVjhSCy h5"oXjVjh5-y h5"oXh'5"蟪juVjpSjVjw5-ڪ,uy1ɉM̉MЉMԉM_1%H>v  DGu΍EPEPj =-t}t.D1}tE܈jEP4%( GuEy ht"jhVh~f5-4Vh~fS(SMUEK}u j uXZjsUE 0~jZqgUVSEU  J .uc1E1ۋ4%Vh.G#uU,-H-Y^yh-j #XZ-P- Cu 1e[^]ÍL$qUWVSQxq14%.8%.@%.D%.L%.X%.0%.T%.H%.,%.DžDžDž1|h ]"V2R @I&/0$%S'$(%1!-!-!-s!-d,%.jP5lp7 :uy5lp7hw\"!-0%. %.D%.X%.@%.<%.P%.14%4%h\"QC uL%.wH%.l8%.lp7j/SZY_Džu ;C3@;tGt @:t%t@tj/[ZÅt8@tYt@t3t~@tij/bZYDžt+{tQt7@tUt/{t @t)tG|h\"O4%.Ph %.h$%.h(%.h\"5lp7Tulp7<t h\"jsc=(%.u(%.fPh`%.Phd%.h\"5lp7~!lp7<u`%.d%.9sh\"뉅 `%.lp7j/SY_t6PS_Zu#lp7%=@u !-lp7L.T%.!-!-lp7\%.}5lp7+!-[=~ PZPh]"j;bp-)ѡ@%.=D%.t X%. T%. L%. 8%.tWg=0%.t t$h@]"4t=L%.t=8%.uhr]"=8%.t=!-uh]"I%.u !-iDžtDžxjjVjjtSQ@t,DYtjjVPjSQ@t=!-!-=%.u/RP._Zu%=u %.0%. X%. T%.1 L%.t1=\%.!-=%.uRjhh@.PR4!-y', 8uh@.h]"tFh@).h_"/[^h_"h_"h@-jdh@).6hR"ۋuw1ۉT%. 0%.u!-=X%.=,%.!-u菿Ã=@%.uMh#`"YtpjhO`"pXZؙjjjjjщڸ{`"h_"Itt Sh`".^_1^'.@u ^'.0%. L%. T%.1=0%.D.Džt~ Džh`"2'.Y=tk jhjjjщ¸`"ƒti¶ f2'.j).DP8XZh`""Fjh$a"4'. 11b'.tJ?tEWh2"f'.1ҋΉT 9u9u @u1'.1;=). ).؀tet\Ph2"6D ).1Ӌ Ɖ\ 9u9uGtDžDž19~JCWShDa"މD 9u9uG뮋y1RPjjjʉٸUa"TƉV#;f=\'.?1'.%t%u ù19rGD80'.G0'.%.11ۀt,4'.t#u;u u@ $ut0'.u돋5).).19}{.tK;tFȉ9C219u9t0'.A뢡L%. X%. T%. 0%.=@%.uYhia"^=L%.t$. l$.t ha"[h b"YtM$.|`$.r2$.f~ hEb"Z`$.M~ hdb"qXj񋅀Ɖ1ƃu h^"ϡ'.11;'.ÍPP ZYx+=w;)uvx%.=t%.5p%.jStPY 1eY[^_]aUWVS}] 1ɉ1Dž1hr"SW|7 rfq1stws1҉j P5lp7Slp7 8t :tPh|r"&08"[N5lp7hr"joKDž-Džp-)OtjhP6P2Ãy2 h).hedAP y hr"=j*.#9 #@fj*.1ɋWXu uXhr"jh).h-  tȸor"u5!#Phr"ZYDžfh*.h).fh*.h).-k~PSyhs"~9j@u"PhwdS h$s"XS1e[^_]US] 3SuUS] 3SuUS] 3SugUWVS}1ɉ@j/E 0G[^+.t@E +.P ~ Ph"O*XZ1 $11<8,(Dž4h_"u W34à A6$%Dž,jhjjhlp7y")8jhjjjlp7Ձ")/.jhjjjlp7")/.0.Ajhjjjlp7h%}) $jhjjjlp7"O)/.`jhjjjlp7>#$()ƃt @5lp7h"(Y[lp7/.jhjjhlp7#$(0.jhjjhlp7$(0.jhjjhlp7"z(0.jjjcjjlp7$$V(!-jjjjjjlp7"5(/.I@Phjjjlp7$ (0. jjjjjlp7("'4lp71҉j PS&P< 8u 8t Sh<"h~"< )Sh<"hF"jFDž8Dž(p-)Ov(< t5<@t<t#JC rh5lp7 VHSh"DRP@Shޗ"޼$hd`\XTSh"謼H 119t T@ܸ5!#t#PVShM"_=@.~yh'"IX1 =TRPhh"#G u"j 1Xt-h'"_ 9rj YShm"ܻXZh"~Ph&r@ ~~z"uXl"~";" ,;..| E#5. .9Ȼ&} VG9ƉS}M)Mt1jjs sM9ȃM} u XS t,;C|"s^C t"=.u!!>"=.t"=Ѕ.t"h.5.Sh"jj}h"=.th"j!=.t3hhh"ƃ xjh"PkVSh"jQh.P.h&";j.h.j hH"[=.u=."" ""EE=ą.t Eh"E=̅.t k"=ȅ.t n"=؅.t w"=܅.t #=Ѕ.t #6$ .PtPH1ɉ h{"3jEPSg0Shq"jk0Sh""$ jjXZjc UWVS@u} E@h"WV` tTHth wT$`&ЁȀπÀ5lp7+-X뫡lp7|+-1ɉM똋p-)Ht 4jVhق"腵 tVhق"hH %j h . .jVXZy VhUW$ju ]1uȉuԉufE5+-]S8SjWHyh"^jhyt Wئ y8th"95|+-hCt W详 yh"}tjjB'Y[t h"j1҉UUUUčEPXUWVS8]u 1E6ٰXhC"VS x`At$M4.ăa$,&@.<.8.+-2 #덡lp7.!0.v,.k(.`$.U .Jp-)Ӄ= .t=(.t5!@. <.t&=,.utu@=.u7<.+=4.u =8.t#u=.u<. +--U1..hMXUu hQ"j/=<.tEPWjj11ҍE:1.tjh*"P茨[Xu5.hUW$j1ɉ .jjh.jVÃt;tMFS1ZVtX"4~FMFK1= .e[^_]UWVSE p.EX1=|.h"PZYu |. h "P蚲ZYu t.j֛.(Gb}}U#Fg5.Oh "P;u .qZ"=.tU #P _tP>X~5+u!zt~Kh%WٱZYt W=u=t =襾h"h._t8u%h"h.PZYt h.>#h"hd.PY_t d."1=x.tjh"4_Z~Pv"jvK =.u&jJ.Yu4j j=ȋ.t. t.ujh"GPXZ辅jy\jXz^_=0.uh#5S-蕰Y[uZ~jh"OjW50. ZtjW..Bu@td..6]u΃=.t$H~ 1.=X.u `.=,.~jh'"M.Oj I jI*fjWUWVS]u 6[$.nG.$..h'#Pu ut.VS[^~身j蘘Y1uhf(#j9~!vu0.h(#VS u%/~k |Љ=x.vhz(#>XZšp-)KutmP-DPu^S_=vhh(#hSh@. ;tC.@.5x.h(#j ]S2h@jvh@jjh@j^h@jR S^u h&#jg@uh&#jh-h(#) u W-.'h" [=l.t"5\W-iYt5\W-h(#j躅t Ph(#j=l.u5\W-+Zu€=@.t8jj5. y h(#*Pj5.m xh .j `. . `.%l.%`.%d.f.. f~.x.h.&h.x&h.n&h1j˷Y(#=t.tM(#PhUW$襝jV.^_C6f=\X-t j;[E8W-utEڃ=t.u*t{8,X-u1f=X-X-< t< uG< t< uMjEP5.) f=Y-{5!#} u"P޾_8W-uwEE5W-PZYf=X-tCۡP-t H-fEjEP5.蟫 f=Y-uEPvX趮he#jUWVS E 0Ŧ.W1.t.h+-#&Y[t *-#}3-#MhI-#&ZtT3MBuglp78tpjRPh :uS1ҋ .buV.. .ht.#u uà uC$J&5lp7ha-#..먃 .륃 .뜃 .듺{-#lp7莻낃 .vlp7u#h~-#h$K&h0W .h-#S^_À;1h-#SZYƿ@K&t&VRSy- u <2t&h%S^_SPh-#苓 . G.O3u8=eRh-# 8=tRh-#KY[\3h%S^ZƋtt ug(S详YS@ZhǾ"4jPSW‹ 3 9r(<,tuxG .QRh-#SV7h.#艒u5lp7uh<.#hK&hKh,#衯1k$@.t!VPZYu@..yGhK.#VhN.#jUlp7 .I=p-u). uʸ~=.u,P՚Y@u h.#j .#..Z!Ãt~@K&t%Ft!á.0Rh.#V  s.0h.#7XZ s.0h.#_Xt Sh/# [^j uh-/#tthQ/#֐jE uC.3hR6ǃ u R3ho"xPhP3 tlj=..t $#1 :%.hPW脽. uR5.h/#j1 h.PcZY@u5.h/#.t&h.P_u_.05.h/#j @.=.t8.8th.PY.u$߃8u5.h/#jq =.uh 0#h4K&h0hjs蔼t. u sh%0#hx.P_Z@u shD0#.%=tE.Bt,=@t she0#\5t.t.Y sh0#7Cp..5.h0#V._Ztpp 0h0#9 .uB.%5!#=@u,#-#up.u-#RPh0# .t Ph1#ՔY[..th.P Z-#8th.P_$-##Nu@u h.1#jh.P^o"u RhX1#(.%=u5.<[@u5.hv1#@5.蛻Y@u 5.h1#t.tPzZ@u5p.h1#jWjsUWVS}u 1ۃ~^;-tp-11ɉ<8Dž4h=#VW+ it1҉4Y-t+:t!;B uBulp7B뵃Pr5σitot8DuFDž<늅u lp7{Sh8$h=#X cDž8Tu謿dx1jSVxCtjjj9ǃuh%VhiP豒 @u h7=#jWYY-7tvFtjNt^HuTItBQB蠿Z.0QHXɋ0u hF=#jP돃넃8t4tL<tjVUWVS$u] 3Xh5!#j hA#SV, Btb$DM&jj5lp7x.......s.d.U..vBeR0G.f"$M&H $N&a...G.1..a.1. .?.1.1."..1..1=.....p-)Ӄ>.=.t*thB#. . .tbh C#jt3=.||=.t=||)=.||| Dž|4Y .j .P Cx<hSh]-d=v ShMC#<h]-Y]-]-X/tK]-]-1h jXZ=.t.Ph]-,x/uP]-@]-= ]-wPh]-Y_@uU8Uxt)o%=@xtbK=.u=.t. .t P6kP6_Z@u6hUW$ja%=@t /t 1ɉt4h]-h_C#j. .tDžt Džtt$P苒ZPvЀ8/uj|V7x 1lpupCpQh]-^Zh]-CHfuFs Psho"@~pDžlpxfXu$wfushuC#}Y[ftf tt)]-C,-]-=~TSh]-hC#} o{DsC(huTttCpj/Vo:YZpt)xph">P YZphp>h)8/t z/t/Bс]-vPh]-hC#} VPRpp]- ]-= ]-vx/uP]-@ߋp=.xt Ph]-" Ph]-^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh]-hC#E|CP@% =@B%=@t,M1@ush]-hC#1Jp΁@tpw `~||t {DPSZY/sH . .u&fNush/D#?{Y^jSx*f5.V..lhOD#hDN&h6tCPph]-胬^X=.h]-shI"v E%=@t'%fuL=.u%.H..yhwD#hj/W6YZtxh%W@_Zu^h5!#VS @uip-)Ãu]p0oZY@u jjtje;LtEPtIFu'ZY@u*ShUW$^XtxtkujpvPp7ZY@u>7hUW$zߋ^Xt!DžtpSVZY_yɾߋuڋtV&rUWVS}] 3%h5!#j hI#SW tUit)ft5huP/σvu?/1//15//뗡p-)ǃ4j7s/h# j =/tuϋV)PFTtP2l pY[uNj|%=@luh2lQà =lv2hI#jltx/tlƄ/CGh>WZD>8/u 9tH@j/W%0ZYtPRdΆY dvWhI#sXZ"@PRl: t DžphfpoUWVS@] 30-Su I]Sj9uEUEUSjK^_Sj9ZYuEUEUSj'^_Sj}9ZYuEUEUSj_XSjY9Y^uEUEUSjXZhCi#s001=0=0=00P]1E؍}ȹEZ uVSj6xVSj& x"}ujVj y}tVSj xjVjߓ y}tVSjē xjVj豓 y{}tVSj虓 xjVj膓 yP}tEVSj g y1jVjT yVSjB xՐy y)hKi#0j9 ^=e-tUjhH%轝e-[^y hki#0j0 #=e-u=xe-t 2@hЦ"Yt8u`."V賃ZÅt @|/tCP0_uhi#j艏0ZYtlj؍P0/h/#h{: jbe- t! ttBGuBG@3 9=/t hi#jyD=e-ue-Wt 00e[^_]UWVS]u 6\h5!#j 1hJT$VS. tLtPt9p-thMv#'_8/u|hs#P,XY^ukhh#SX_ZuZPSxY^@tHxPhH%b_Z@t2|9u;xuM9 u;EtjjaDY^uj S̖h-'cXZ-@t h("jjkUWVS}] 3h5!#j| 1hJt#SW ft]/WPtwR)d0벃vtbit6rtxu{0010p100Z0K0<0-p-9=04zu8QuthTt#lXt0؋Ht ʉA?jj0[0 0u t1=0t =0t@jPWǃ uhtt#C =0t.u)WXCHHf $T&PDs Psho"j=0tC ?ƒuts WPsho"j0k=0^KPSCMHjSWTC 1ɉK +C  Cu>S=0tCHSftYwifu`KPCus$Z=0u&shUW$y0Y[R蘍8XC=0us螾ZuH1ьtm=0tZ8VL8?H>8r50 0$10sKX8t hB#jWS[hxVSZYu8=0tCjPSho"+i0_u=0EE%=@uB=0uSht#h0Y[묃=0t'E%=u,S虗B=0u=tىډuh=@uSV=0u SZtXFt1=0uShUW$^迋8 豋8?裋8u=0SX50*e1e[^_]UVS@jj蒈^X1EĉEȉEEjEPjؓ `iP¸9u 9E 0j j6Y[(0H (0j;$0$5!#jZYh#Vg-1ۉ]$h@0m^Z0tt3Hu:0.|0x010E H000t.U=f-v=x0i`w=0tEP9@X100tA:g-HyP躤Xg-H J hg-PXEHm0@0|0x0SEP?Xu uQXZu u(Y[}um=g-t,Eh#;^E= 0u PEuE=f-u}rEj:^=f-'7= 0uAh"蕲[uY&jh #Pj@ÃPn;$>Y|=Vg-uL= 0uCEP>$#X8tEP蠄$;XE01ۀ=ng-t$=0uEP=X0ng-u'j4HY&K^XC̈́RP蚳ZY=ng-=04f-050:h"譣$g-0XUWVSpE 0Juh5!#j1ۉ]t- 1p-] ;E9h#WψZYEWTw_9Euph#Su tZftatDeuI렃gu=j5lp7觐EZYz5lp7hUW$j[^p-E ]SubZYy h#yEPhBt @ui y h#9X}Whht@ui y hʔ#XEPht@ui y hՔ#Xt$FvE 8uVEPuWSS^1ɉMME 8URu VYZURVRYZuURV^ZuoE 0P-DPt"V辥PStVSϜE9jh#Vv uVSEZYVhב#aE E}tSjuj y h"j}t WhgtuCh y h#Xj^UWVSu 6rh5!#j^0 xo011ɉhdt`p11ۉljhh-h#Vu覽lRtf(LtntMH1һ뮃PthtPdtXfuyDž`뇃vuhDžds=lp7hDžpYMDžt@Džh1 p-E)t 4Hubupt uY00t00pt$t*tt h#j t)00>=0tzj:WYKYZt@0j.W%YZlt!h0W*_Z@lu B>t0<#uj$0h0WA*ZY@u ۉT8xPWZY@u WhB#j=0tE0E0jSVǃ 1uhB#>pu jSW W觸X CHHf wg$8p&s Psho"(^Džl=s kPsho"]ttDžl  Džl0ht)KPt;Qu0t;Au A<50RslЃ t"`ushUW$Y[dsZҀ8t hB#jSVpZUWVSu fT0h0腙 P0 ʈP0d0IP0 ʈP0`0՘Q0%$0fV0\0h+-#[th#Y r&t7GtPSrYZu QShA#WhR#j41h#Vuy A6$p&0%(0|0 00x0=lp7h"WVqYZuh`#W>qYZ;s=lp7.j j5lp7Uǃ u~8"u 5lp7hc#D=d0j j5lp7Uǃ t =h0~8"u5lp7h|#jj j5lp7eUǃ u^~8"t=$05lp7h#뺸Y5lp7Z@u^PAt0I`0=1`040(p0 9tt؉ $0v jhΟ#uh# \0tt h #j 0P0ǃ;=`0u/;d0u"T0;h0uQ09rt1= h-00  h-p-=t0tP U)4uE=|0t=x0?x04=x0tt  1Ljhh@0PQ蔧PLy h@0t=0uJLxPPWZYLu&%=u00w($q&J|0PJPhЦ"y^u`."h2#Pha)%hSI]S蝬ǃuShUW$ Y[hr"PPXZthW裈h@0h0V 5(0h0V ViTX1\`dDžXhVXPje Džy0z8#tjVjCht"]j肛_jVjP,Pqh"Gƃu5#SVhT%TP;Tu h 5"jjPh"h$h$ÃuVYSxTP^Z9ujVjpTH h*"V`LY_uVhUW$UXZ0e׋H󫋅LLRXtP3Džu Vb[eh?#f\h-JD-HD-ZYyh@-SX@-P@-0 t+@t( D-y h@-S_@-P@-Ѓ߃NPͩ^ JP=,0u ,0 =00u 00 Ph0Y[J}0l0P0=l0X=0t 0W,h@0h0h-5(0h0h- h0Zxdh*"v^[_uvhUW$j('1JPhmdP$ h#jm^~WYu WhМ#P0eȺ0t jSR@ h0ZIPWPUWVSjj]Sjjh z&y@u h#j3u3YtjjSPjh z&F@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQdMQhUW$VYU1G맅u) -yh-j _XZ-P- 1e[^_]UWVS ƅ]-ƅ_1ۉH0L0H015P0T0P01=@0D0@01h,#u u5 ycPtJTtgxPl$@z& 00뫃 00q 00 e 00Y 00M5lp780Ye5lp7>Vj:VV=[Zuh#SHP0t)XV3fZYXu C[ӉP0=H0t h?,"jlp7tuhd,"1Ҁnuxouh-h%P\G^_t5!#H0s ֋=lp7u 00i5!#lp7@0E Omrhz&Ph #h-ZjlM^]40R 00t0000t 80p-M Tu)tP1ۉXhn h6m 580RXRrRhu#RL/eZYTLSjjLRPV 9X}XTPT0VhP衅à uj/S ZYuShق"hH %hSRTVڳXu"VXu9S^ty2LhV!à LVhUW$juhyG"LRdZYh#LRcZYSh=#jjhVjSǃu Vh^#jh`0hzd@PT uW |X0`PhedAWT @uVho#W{VVaH__9~Vh#(NE XS!YXuVZZ@u h&h#S*Yuh&h#jV葷Zuh&h$j衺@ uh$h&h*WSй%1󫍅Ph$Suh#S!_Xuzkh$S ZYuh%h&hqP/ƍH_v󤍅PhiST @uh$9YSjCZYt Ph$>Y_Ct Ph$>XZj =XF 뚅\\8rqv`\jP׉\@Y_xuhSuUS] 3>SuzUS] 3|>Su8 UVSu] 3a>X] ue[^]TUVSu] 3=>X] ue[^]"UWVSX] 1p0NhH$P<_Zu.CthG$P4BZYt$=0tM0$1Dž1VSup @ B4s$ع&Dž=lp7h"WAZYu 40h`#WpAZYt'h-hL$՛|0_Xhx0=p0Qp0B=lp7h $WAZYut0Gjjjjjlp7#'Lx-qjjhjhlp7>#$&d0P5lp7h$"lp700jjjjjlp7"&p0jjhjjlp7#$k&H0jjhjhlp7#$D&\0jjhjjlp7#$ &X0jjhjjlp7$$%D0bjjhjjlp7$%`0;=lp7=0tFWlYuP-DPuWh$j赤@W^m@jjhjjc$$]%Dx-jjhjjlp7$6%@x-jjhjjlp7$$%P0ujjjcjjlp7$$$Hx-Qjjhjjlp7$$L0*=lp7=0t.jh@0h`x-Wh]u hv"X P]Gh$WJ>YZuT0Xhն%W*>_Zu 1ɉ T0:h$h$hT%Q=lp7hj$W=YZu 0h"W=YZu 0Wh)$Djj5lp7Ŭ 5lp7h?$Phjhjlp7$#h0l0=lp7WnZuP-DPuWhM$@=Wk_+=lp7=(0j:WTZYuj/WFZYth]$ ?u h$j $0p-=Lx-=p0u=0p0p1󫍅l@0AuVE)Ћ0$DžMDž>= 0qh$5r@@0jxlP5@0phH$D@uph$B0@th$, jr HM1󫍝`4󫋅 =d0u d0tJl0 h0Pu[^@=d0h0l0s=x0u;h0l0}hR\R @uh $P>$ZY@uh$=x0h0V$[à uVho"j蛟Ph0Pw ujhh 0jP(syh 0h4$!P{#^_@tڋ%=`uh 0hF$1=x0jjh 0*Q yh 0hk$jP}Y[uh 0h~$jh 0hق"t8 %0t# 0VRW9^ZtN xRjVhق"$8 u ƃrVW8YZuSh 0h$j=00u@00`PP500h 0Z@uh 0h&1=00,0=d0ud0 h$Ytc uh 0h$h#S7ZYu&$0uh#S7^_t t Dž 0?=$0thk"h]%S7Y[thps"h 0h&Džt'd0RP5l05h0Gh0l05h0=l019|Y<@ t d0SQRPG  5h0=l019| h$t5 h0l09sSQRPh$jޛtdd0 h0ˋl0%h0RPF @u+5l05h0h< $j蜛'0P_Z@uhW $茡[^ #$]X0P5lp7h$jjjjjjlp7"X0jjhjhlp7#$W0jjhjhlp7$W0jjhjjlp7$$W0ujjjcjjlp7$$W}-Tjjhjjlp7$^W00Phjhjlp7$2W00lp708h+$DžDž}p-)Ӄ=0u 0KtCX14`E =0u 01=0u;00}hPdE @uh $SL[_@uh$=0.#jhh0jfyh0h4$SZY@t=0jjh0Dƃ yh0hk$djP/q[_uh0h~$;Dž0jh0hق"+ u Dž0xxjWhق"+ u ƃrWT,ZYtWR?,Y_uSh0h$ 뀍`PPjh0p@uh0hԿ& =0u0u h$jt] uh0h$u7h>%P|+_ZDž0t hs"h0h &j螐Dž0t(01RP5050;000019؋|i<@ t" 01SQRP|; 0019| h$t5 009sSQRPh$j葏tM00 0mRPV @u'5050h< $jf1$0PVmY[@uhW $_XZ 5$j踊j|P5lp7x |:uy 5lp7h[5$릣\2 <3 <3<3t hy5$@<3lp703j<3@u <3 <3A 835j|P5lp7输à |8uy5lp7h5$h5$j讉 <3 <3 <3@j|P5lp7 d |8ud5lp7h5$`j|P5lp7 |:u Pv5lp7h5$#w. <3jj3lp7b# <3 jj3lp75$lYX|P5lp72XZ|8u5lp7h5$<3Džh<3H2z&u$u H2MH2{GL2z?tҗt h86$GH2v貗t hT6$'=\2~薗t h6$ ٽrfr fpH2٭p߽X٭rX\82<2߭X%٭p۝X٭rX @2 ݝ(uu h6${<3%=u h6$ X`2t\2У`2`Hu 9p-t j9}hh335!#j3%Y^=u <3 <3 u33f33u388ht,3hu ~ <3 1~ <353=@3W6iD3Zu Wh6$j<3@03P-t DKt@9t)Ѓ ~h-503h7$j虅EMQMQMQMQMQMQMQMQMQMQMQMQMQMQMQPh@7$R Ƌ33H19}L2@91B<3uQhq7$_9~32Ph1"CZYj XtLh9} 2F sT283xt&jSjh5,3N@u h}7$X83t&jSjh5,3@u h7$賊X83t&jSjh5(3@u h}7$脊X83t&jSjh5(3@u h7$UX<3 t-f2232d22t'd2ƀ2')ˆ2ƀ2d2( d22)ȣ22jSjj5,3y hD4$g2d2@dB<3f@fJwuJB  3J 3J s*EjEPj j5,3y h7$wt)jwPj j5,3Yy h7$=3tTjh3j j5,3)y7h7$q s'jh3j j5,3y h8$D353SPh3h38$ jhd-hh5,3yd--d-hP8$jhd-hh5,3jhjw'1ɉ 3 3 3 3 3 3 33EnEĀ1ۉ]]]]jEPj((hnj 'Ch^_19\2~h 2j}lCXZh2j2^_ٞzt,-2݅(=2ݝ01ۉ@D%ݝ@1ɉ04h 2j$XZ݅0zt - 2݅(=2ܭ0ݝ@`29X2}y݅@؞vj 22hc%s=`-t#<3t{k 22/cvܕ@vq݅@g02%H2vݝh2 2b݅hܕ@v݅@r j jݝh,3EfEjh3j0 @݅hu hs8$S %ٽrfr fp٭p۝h٭rhPjEP91 f (0 '8" fh4"EEPURj5@35D35,3{0Ly3*'8 8fh8$Єh-_X h 2jD3HX[^~9LU8<3_ eu}PLh8$ 4 LX)dHhh@;T2 hfXX2Hff9u `-2 222 2u2P2<@P2<31ɉPT s)hPU@ EʉU1҉UiE'%Uthp U2_ݕP(2(2݅P 2 2h-ܝPv ݅Ph-݅P02v02؉ff`352v!`t:H3:$hR:$hj:$ h:$h:$h:$h:$h:$h:$h;$h;$Ph0;$jdhg_ hU;$dh]^1ɉPTDž`1ۉ<jdhIgZh@<t%w uhc;$<uh;$ht;$Xh;$Ph;$^_h[Ph;$.jdhf[0hfPfh@fRPh;$ jdh|fYh<$jdhVfZh(<$jdh0f_h@t <uhW<$hA<$^ Phu<$Y[dh"\]jdheZ.h@Ph<$dh[^_jdhe[h<$jdh\eYh<$jdh6eZh<$gjdhe_vh{%Djdhd^Sh<$!jdhd[0h<$3jdhdYhPh =$zXZ<3dhYHpX<wz<Xx^FLs3`ts)Xh=$XLX"LtkXD- 5[FLXxFv89~88X`;2uMSh2L$ u5`t h%=$X8N)XL22L󤃽`u!Zh4=$_Dž` h3=$^LW.8LtkXDX Y뵃`uvh9=$>[i`uPHxhfXfu蹾TPW=$ZYXOFLXLe`t HYh-X\P2;`2)=3UWVS}À8-uCh"S& ZYud31uuu'h"S Y[1ۅu`3πh=$u Wl\ t[dw<$&Eσ=d3t 뾁북뮁EbEE돡p-19tcM E1WtUPB ZU<RSXEtPV1h|(%V1ED>YtjcPhUW$j)p}tVS$h"j;p}"h=$cdjjh5!#h!>"h=$Ld }ujjjjjjjj jjjj jj!@u h=$jojje!ZY@u\8th=$=j@8X}u<j-8_j j&!ZY@u8t+h>$tY2 u h>$nZ W7XVS#hA>$t 0ajj ƒ 5!#Bu~=$SPhH %j nUWVSDu]  't3h$&SV2Y v~j cStITtbLu3뼃dw$&3333zp3k3\3M3>p-)ƍ3=3tjjh%T3 >Ejjj"踟3jURh@hP} @u hV%sY=3y h%jl;u=33 @ WmZ) (    mt /  =3t1ɉڸ\e1ɉMhjjSE؉EhjXSE܉EhjFSEȉEhj4SEĉE hjSEEhj SljEhjREMU ʃ} ʃ} у} хuu hA"E1҉38gtj53q_X1ɉME5!#E5!#FEȅ"CEċS:-0BRUlZH3U$H&3"0-30-30-30- 3uj|3[x3L3A91&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸduCEċSEP1ucCEċSEPM̸dECEu/CEċSEP1ɸdX3uCEċCUuZEuKMċs t^03hw$&]1R83F@3:H3 .P3@"X3`3 (3 3 |3 x3t#  3 $3 3$3t1|3jjVu1C R3u#EPM̉UcEXUUuEPM̉URB0^uCh%s+ZY=3uh_B$htB$h_<%W 3CHw)=3uhB$hB$h_<%% 13SEP1ɸbX]ċu3MuhB$5u>au uhB$"3Eġ3}tuȉuthC$jfMu}t }EEă=3uMEȉE10E1831atctguIE3E333@33333 333U9sHxt)Ј3t]E؊Hw uF:T80D019r)19r)1ELE؃9sIJ 33tMutHXSVh3 =3t =p3t3C$iX3tE}tHpVWS蹱 =3t =p3t(C$X3tE}tHpVWSk =3t =p3t6C$W3tE}tHpVWS =3t =p3tDC$W3tE}tHpVWSϰ =3t =p3tUC$1W3 tE}tHpVWS聰 =3t =p3tbC$V3f3=3t!=p3u=3tW3@Y=t3Sh353 u( 87t WPhA$XZ9~kPhA$Y[]] 83u =3tHH 8t3 3 3 3PSVm 11ɉډe[^_]ZW\e[^_]UWVS } [hI$PZY…Uh~"WuSL Ut.at"t=3lp73뽺붡p-])Åt>um3t&h#SV^_thH$SEZYCt/=3u&43wnujRKuEVhI$h-VhI$h-jm=$3u.$3hI$WuSK t@lA3w$&z=$3u$3먃=$3u$3듃=$3u$3{=$3u$3c=$3z$3 G 38 3)3 3 =$3"$3@ 33335lp7v'3X=$3$3=$3$3j=3lp73h~%P Y[>3/=$3F$3$3)p-E)tH:Eu5=3= 3t =3=3]= 3t =3=3txt4h#W+YZ!hH$WYZu/ h#WYZ7hH$WYZ"h~%W_Z,@JK EkÀ53jj535 353krt53jj535 353Br;E53Sjl 0ShUW$jO\3E/j =3mEijEPj-3fDž135lp7PXB1=3=,3/3,35lp7DYU35lp7hn$U3tp7?u-11uPhn$XZ-T5tp7h1n$PhGn$/jjj503谈Ep-)ЉEE E 1U33T33tq1x3DžDžhh3RjVt& u0\DP _PVhn$1ɉ C3 C3h"Mg^t8t P*OZC30ui`PLXu;PXt߃=C3uF t8t PN_C36NYC3C3=?3utuhC%NZC3ghPh?3+] =v&j?|C$5C3hn$ ?3hhn$h?3] =w=C3tj M$ hn$P\ j hQ$Vy] hn$fXX$hX$fX5!#X$hX$eX5!#X$hX$eX5!#X$h Y$eY5!# Y$hn$e_ "oR$nhn$weX3l$#Rhn$[eX5!#Y$6hn$?eX5!#Y$V[:jj@XZhj$Y^hj$_Xh j$XZh j$Y^hj$_XEt7U ESRPà ;3uShjj|$^_jXE j:0Y[t*E 0EZuU ERPT_X9jh3Y^uhj$XZh3j $Y[E 0j@V褾_ZÅt @hPWkZ E @1=3t1ɉ 3 3ER@PuOXZ=3=3uu 3ujSVK =3t 1ۉ371҉U3Phn$503 53?Y=3a뿃jh3^XZhj"Y[h3j "^_'e[^_]UWVS}u uhm!"PYZtWhh!"SYZthg!"SYZut3)~3ltXnuzh{$VW>7 dup3׃Vt1PσwB0-뾃cu3t3l3h&h#h-jh&h#h-ShK{$h-jp-9u,=p3t 1j`x1[ppt8-u ƀxu t1L=p3t 1`x1[pp8u;J5-ƍxPVh_Zti=p3tSuO8uCV' -Dhl$-Ylhuh 5" U1th{$vE@uVh{$xu P`n=p3tX=t3tO%= uu-jVXZy Vh{$T^W^ Vh{$TZYS75X5h3UWVSu 6h5!#j91ɉ <4 1hm$Vu4 ua`Gt+It2EtHa<$X& 4먁%4뜡lp7u5!#<4@4z4k45lp7O$5lp7Ph"W ?xlp71*x 4lp7u5!#<41҉@4jjjh--h$/4jjjh-~h$NX|PPh$h-jp-4 4ut Xwv>ttow1cwj53ߒh-H t h("jXG5D4pUWVSP}1ɉMM1hӃ$u WS2 t3gt!utGu.lp7Elp7;ulp7E85p-9Βt3SZt@E%U̒MM@uShڃ$j}F1}1ɉM}t EE1}t6h%EPYZt"8tu h$j0FGʒDʋE 46?ZZ@u6hUW$j0FhH%sY@ttEPWqW_Z@uh$}tu'Y@u h$jEtu[VZ@uh4$FtVRPvhUW$jEh#\Xu$jh$$SSCShUW$jEUWVSu] Po41t4u4@`4%1t4hG(£d4a1X&?t2Gt&W =(o4uRh(o4&YX RwPQ <|4k4t4t4t4hi<%[_1҉tu"h-h%9jEDuEl4hV%SV/ txmtW~փpt]rth-h%]9jmft$Cuht4ht4h %5lp7z뜡lp7됡lp7tTo4txPha%a[^uUu;EE|Chw%/6Y1t:SKZt@ <uNtS&*Xu 1pjh#hn$t Džp萴Åtl5-75-7sjjVP-m4uh-h%KtPL5t45t4V^_5m42h?hjdhjXhjL 5-725hh `4`E1ɉMj@y%ljxj@j%Ɖ|tu1 jP5t1>XZtu(xH%y}u)x%cxtP}tjUxY~jRt(XZlN t1tttWu)^P(R[yh9%Eyh9%t'WQRjpQjWhQjhI#h*9%h*9%;(t h 9%D1ɉ 4 44-t-4@ftPhht@ƒ PBt4Zu h/9%PP^y h9% y hE9%u@U jPKPpeS3X3hZ9%jB%SZYu#h`&hB%hB% 101jEDž`C%@-DžDž$Dž DžDž1((,Dž\EEEEEjjM @u1 jj7[^@u } jjZY @u` 1$1ƅh%>%t>% Ph&Ru u^V4M 6?4uƅ뛃Nw$&ft'j{$$&Dž<%`lp7`Pl$5lp7vjl^X-Àt ˀDži<%hDž$Dž$Dž$h%h?%[q ƅDž{<%{Dž<%gEH;p-t dSHlHE tEpp-U)‰u 0S謎jjjS蕄ƃu(h% ;p-!u uPjS躁t%huąn h?%w $h%C%YY;p-u;VSNjjp-u 4Sƃ u uPjS-t0t &h8C%D@Sx hIC%LHSghVC%TPS苷 g dh  t u, @ À翉  dhd%@Sd%uvtSZv8Sh " ~"t"t5!#hH%PShgC%j+0P<Eh5!#h5!#h5!#hgC%j+0PdE9p-u t1h%t0P/Y hC%sHZ@uh<&hC%D[X>uh<&hC% jj 0Sh|!jhD&=P=$@uh<&hC%v S@YvKRhC%CWRt#8t hO#S0P X'@RhC%CS dhӃdhu,PPp-] 4k dh u-CvPjp-] 4 dh 7Pjj @8th<&h:D%B[XdhuGw8hKD%8q8 dhh%hhaD%OZY@u!,8thaD%h<&hpD%B hh~D%O[_@u!8th~D%h<&hpD%A 0SYt&uSh<&hD%SPhD%AhD%ZA1'd%@Z0F(Pjh0jO@u h%Ku,\(Sh#j\5@uh<&h:%@Y_ A@uh<&hD%tt$u/9bPhD%J@ ht"@#hh E%Zh(\, Sh#j\S4@3h<&h:%;@XZh@SO_tPh<&hE%@ .軿d%h u =uduA%1Ƀu p-} RQ0PH @uh<&h,E%dhǃ >%u5!#>%u5!#?%u p-U QWPh%0WeM@uh<&h>E%#1҉h[PīZY@u hQE%>XWh)j2@uh<&h:%>_Xu*dhǁ@u dhQP0PF1҅uHh<&h]E%\4PCZY$u64hmE%3>_X$P$9x uً4hE%‹t x t]@h% hE%P<0PTd% uhE%=Y8t tjjM UXZލP0W_CPW.A1d%@tWY8t" tW?Ztڋdh@t) y tI߅uGÁt:Áu- hE%PE;0P +t'%@t0PhQj3V0PAw0[_~ tVhjj3vՋd%@u hC%l;Xu u0S [h D%;dh@_dhShh jj3@Shj  /@P6$ZYy)h<&hF%:[_ 1ɉ$ 1Dž$d%0uSZ@uh<&hF%:Y_PS>XZt;t HxtyzP P;XRv1ɉ_VSu _ZtP蠫^H=S݂,S;SN;@-tP[hƒ@tRt \tBh/F%u9h@Yu&j$RP @uh<&h:%9XZ5:lh-rh$tPRh<&hD%7h<&h&D%(%Ѝe[^_]ÍL$qUWVSQ@Y1ɉPT41L41,0<48ha~%S@" ,H01$ '@6%@65lp7fp41Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @fp4F누0fp4%1҉Lj LP5lp7qƉPl 8u!lp78tL8u ;Ph|%pj LP5lp7c0 ~lp7:t L:t5lp7h|%4z @6@n6th|%j,& @6jh-w1ɉ |- --^_lp7< @6j LP5lp7/-lp7 :t L9t Rh|%j%@=Rh|%lp74 @6 0LP5lp79lp7_Z8tL:t Pv)ݝ 4݅ tjvPh&}%!(%v5lp7hJ}%AٽFfF fD٭D߽ ٭F $|--߭ %٭D۝ ٭F -xy5lp7h }% uh`}%S-^ @6S3th}%j LP5lp7-8 xlp78tL85lp7h}%&,%@6 @6 @6 @6 lp75P-tDFu h}%1B卅(R$R RRRRR RRRRRRRRPh@7$QYƃH1Ʌ~ )1@6hq7$臮Y14@9u919~4Ph1"OGXZj d @6t1DžtDžxDž|Dž:h(6Vj5lp7ʜtP'Ph}%(66rJB6R @6@Yj LP5lp7+- xlp7:t L:t5lp7h~%=hh~%@6% - @6k@6%@6% @6CLP5lp74XZL8u5lp7h5$8LP5lp7謎x4_XL8u5lp7hC~%p-@)HtŹB6j.SY^u SZ)؉@?wPSPߑ@Ƅ t@ P-t L-fBۍ1Va@KjKPV@SVVdP$TVh~%jz Hd`hSVjqSQX@6t=- h~%LXt1DžtDžxDž|Dž:h(6VjS詙tPPhUW$j(6BtÉ4ru h~% 6Jr rrqQ6 y h%<A6@t"56h6PV t hXN%<1DžDžDž:PtPj<跘tPP ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizeoutput block sizeinput block sizeblock countfile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. Explicitly specify beg/end address?The bootselect code is not installed, do you want to install it now?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -An < LFS_MAXNUMSBnblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCAN%8u %4u entire track defective%10u SCIOCDEBUGSCIOCRESETSCBUSIORESETvpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x invalid console name, valid names are:Boot options: timeout %d, flags %x, speed %d, ioaddr %x, console %s console %d keymap %s Patch area in stage1 bootstrap is too small/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20260126122514Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-extproc-parmrk-onlret-cread-parenb-cdtrctsispeed %d baud; ospeed %d baud;lflags %d rows; %d columns; queue = %d; line = %s;-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfoiflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignparoflags-opost-onlcr-ocrnl-oxtabs-onocrcflags-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Read failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %juPri%s GPT at sector %juSecGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableCreating new secondary GPT headerMoving secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]GPT part %lsUnknown %#x %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AFpltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab MBytesGBytesKBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20251206NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandLPSVEPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVncan't stat: %s%s is a directoryopen: %s%s is not a regular file.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.0_BETAxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initnd_dhcp6_invalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completedelayingmulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: redirecting DHCP6 message to %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Alink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*12aargon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist