08"Hi<  "Hi@9t t"Hi@@<@T 08"Hi<  "Hi@9t t"Hi@@<@TU "Hit`A"Hi"Hi"Hi$h "Hi"Hi"HiA"Hi"Hi"HiA."Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HimDi""Hi"Hi"Hi (08@HPX`hpx@$"Hi"Hi"Hi`hpxN$>"Hi"Hi"HiK$="Hi"Hi"Hi (08@M$X"Hi"Hi"HiHPX`hpxFA"Hi"Hi"HiC"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"Hi!"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi!"Hi"Hi"Hi4!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi B!"Hi"Hi"Hi B!"Hi"Hi"Hi!"Hi"Hi"Hi"!"Hi"Hi"Hi"!"Hi"Hi"Hi"a"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi?\!"Hi"Hi"Hi>\!"Hi"Hi"Hi=\!"Hi"Hi"Hi<\!"Hi"Hi"Hi;\!"Hi"Hi"Hi:\!"Hi"Hi"Hi9\!"Hi"Hi"Hi8\!"Hi"Hi"Hi?\!"Hi"Hi"Hi>\!"Hi"Hi"Hi=\!"Hi"Hi"Hi<\!"Hi"Hi"Hi;\!"Hi"Hi"Hi:\!"Hi"Hi"Hi9\!"Hi"Hi"Hi8\!"Hi"Hi"Hi:\!"Hi"Hi"Hi7\!"Hi"Hi"Hi6\!"Hi"Hi"Hi5\!"Hi"Hi"Hi4\!"Hi"Hi"Hi3\!"Hi"Hi"Hi2\!"Hi"Hi"Hi1\!"Hi"Hi"Hi0\!"Hi"Hi"Hi7\!"Hi"Hi"Hi6\!"Hi"Hi"Hi5\!"Hi"Hi"Hi4\!"Hi"Hi"Hi3\!"Hi"Hi"Hi2\!"Hi"Hi"Hi1\!"Hi"Hi"Hi0\!"Hi"Hi"Hi2\!"Hi"Hi"Hi/\!"Hi"Hi"Hi.\!"Hi"Hi"Hi-\!"Hi"Hi"Hi,\!"Hi"Hi"Hi+\!"Hi"Hi"Hi*\!"Hi"Hi"Hi)\!"Hi"Hi"Hi(\!"Hi"Hi"Hi/\!"Hi"Hi"Hi.\!"Hi"Hi"Hi-\!"Hi"Hi"Hi,\!"Hi"Hi"Hi+\!"Hi"Hi"Hi*\!"Hi"Hi"Hi)\!"Hi"Hi"Hi(\!"Hi"Hi"Hi*\!"Hi"Hi"Hi'\!"Hi"Hi"Hi&\!"Hi"Hi"Hi%\!"Hi"Hi"Hi$\!"Hi"Hi"Hi#\!"Hi"Hi"Hi"\!"Hi"Hi"Hi!\!"Hi"Hi"Hi \!"Hi"Hi"Hi'\!"Hi"Hi"Hi&\!"Hi"Hi"Hi%\!"Hi"Hi"Hi$\!"Hi"Hi"Hi#\!"Hi"Hi"Hi"\!"Hi"Hi"Hi!\!"Hi"Hi"Hi \!"Hi"Hi"Hi"\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi \!"Hi"Hi"Hi \!"Hi"Hi"Hi \!"Hi"Hi"Hi \!"Hi"Hi"Hi \!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi \!"Hi"Hi"Hi \!"Hi"Hi"Hi \!"Hi"Hi"Hi \!"Hi"Hi"Hi \!"Hi"Hi"Hi\!"Hi"Hi"Hi \!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi\!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi$!"Hi"Hi"Hi4!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi !"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi?\a"Hi"Hi"Hi>\a"Hi"Hi"Hi=\a"Hi"Hi"Hi<\a"Hi"Hi"Hi;\a"Hi"Hi"Hi:\a"Hi"Hi"Hi9\a"Hi"Hi"Hi8\a"Hi"Hi"Hi?\a"Hi"Hi"Hi>\a"Hi"Hi"Hi=\a"Hi"Hi"Hi<\a"Hi"Hi"Hi;\a"Hi"Hi"Hi:\a"Hi"Hi"Hi9\a"Hi"Hi"Hi8\a"Hi"Hi"Hi:\a"Hi"Hi"Hi7\a"Hi"Hi"Hi6\a"Hi"Hi"Hi5\a"Hi"Hi"Hi4\a"Hi"Hi"Hi3\a"Hi"Hi"Hi2\a"Hi"Hi"Hi1\a"Hi"Hi"Hi0\a"Hi"Hi"Hi7\a"Hi"Hi"Hi6\a"Hi"Hi"Hi5\a"Hi"Hi"Hi4\a"Hi"Hi"Hi3\a"Hi"Hi"Hi2\a"Hi"Hi"Hi1\a"Hi"Hi"Hi0\a"Hi"Hi"Hi2\a"Hi"Hi"Hi/\a"Hi"Hi"Hi.\a"Hi"Hi"Hi-\a"Hi"Hi"Hi,\a"Hi"Hi"Hi+\a"Hi"Hi"Hi*\a"Hi"Hi"Hi)\a"Hi"Hi"Hi(\a"Hi"Hi"Hi/\a"Hi"Hi"Hi.\a"Hi"Hi"Hi-\a"Hi"Hi"Hi,\a"Hi"Hi"Hi+\a"Hi"Hi"Hi*\a"Hi"Hi"Hi)\a"Hi"Hi"Hi(\a"Hi"Hi"Hi*\a"Hi"Hi"Hi'\a"Hi"Hi"Hi&\a"Hi"Hi"Hi%\a"Hi"Hi"Hi$\a"Hi"Hi"Hi#\a"Hi"Hi"Hi"\a"Hi"Hi"Hi!\a"Hi"Hi"Hi \a"Hi"Hi"Hi'\a"Hi"Hi"Hi&\a"Hi"Hi"Hi%\a"Hi"Hi"Hi$\a"Hi"Hi"Hi#\a"Hi"Hi"Hi"\a"Hi"Hi"Hi!\a"Hi"Hi"Hi \a"Hi"Hi"Hi"\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi \a"Hi"Hi"Hi \a"Hi"Hi"Hi \a"Hi"Hi"Hi \a"Hi"Hi"Hi \a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi \a"Hi"Hi"Hi \a"Hi"Hi"Hi \a"Hi"Hi"Hi \a"Hi"Hi"Hi \a"Hi"Hi"Hi\a"Hi"Hi"Hi \a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\a"Hi"Hi"Hi\ !"Hi"Hi"Hii!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hi B!"Hi"Hi"Hi B!"Hi"Hi"Hi!"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi!"Hi"Hi"Hi!"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hi a"Hi"Hi"Hia"Hi"Hi"Hia"Hi"Hi"Hi"Hi"Hi"Hibpf!"Hi"Hi"Hi $"Hi"Hi"Hi$"Hi"Hi"Hi$>"Hi"Hi"Hi$"Hi"Hi"Hi$s"Hi"Hi"Hi$"Hi"Hi"HiA"Hi"Hi"Him "Hi"Hi"Hi$"Hi"Hi"Hi $"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"HiA"Hi"Hi"Hiz1\&oF]syzxɂx>YJ9TYDDdJj  |m(js-z(E6Z lu4q]3shh{+4!Ia>IED?#-;L1V[SGcwdsQ; 4^X)KrMu bkkY.֗_YM>n+LU|b$۝B D DD+8+K*j}p YX6Exz6/}+~\X]ʻKm}9h<B#bQcQ1NGNFJ:ddHQAY3@]lT`K3%\nUohbv) yW$L"I$%Lw pDz.6~xOCj MI.Y{Aʥk7yz.'y7\J X+Zi+bJ|G$IFG)Qv {҅?LWHmhr8{ t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4f"4 (!!, #@-@-80M@0(@3/P $ 3,H08 : S( 0h 3/P   00 0Ѝ00 0 1/qp0S 00#m8@@-@QkPЍ@ (PЍp@-(`Vp80@  03/PP+8003/(Pp@-@P`P 080 (0(3/@ P #yPЍp'O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 Al 000+ xpt|   ЍO0 P % pHp 81/qp4 q+ ?P p 4 Z+ 0S4 tp0 0 0 0 "Y0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0004 8pX  FЍ'h '#*R/ R 0 0 /\\CC  B0R00!/0"SSS S S S S SSS SS SS SSAQA0/C-lBM0 0  P0 0  0 W? Ÿ$  ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!!!! d 4 !P`4~4 " BXX P!d44~4 " B   !d44~4 # B  d44~4 /0J~8p<@0! 7~` d @44f~4 gЍ訸'tlMbP' 'U@-@RG-A `00P4 2#&P8P0 (1/qp $ )㰀娐pUЍ0S0C080 $0(3/P 0 `V`PE@)0  Z  $j갸'#@'p%a@-XAM P04 00#!8 ( 01/qp$ )P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080 p0h( 3/pLp #U0* 0P/`RP `'#m@-@L M 0Q   0  j  Ѝ'(O-wIM0@S`M. 8S+ #='00S( 000 t" ! `!x0T0# #|0 4& (%IލЍ&n 0 V0 `S 0E0VS06  S  S $0S0 600000S60 060 00 l6Rh } 0Rr0C0C00Q0 0S. ,B<  (6!}0P X$  ( ( ,0S 0 $0P0,0(0000 0S $Y# 5%(0St%0 l%00   0 L5LL,0S <5<%0 04B,~[ʑ5$`VM / V 7* } 0 8{| 08 4p$(t| } 0  j|`,00 0t 00,0 0@$ (0D@04 @ ` % d}840$0z'(0吃# Y} 0吳e&p4`00S1 ,0S #$`V 0 !40S d\ /\ * -}0  | 0 "} !5# l 0$`[d5 0 !z0$ ( , q0  !j,00 0T 00,0@0 (0$ D4{1,0S 0`QP L0P0V40> Ё/ V '* | 0 <{ 0< 8p$({ | 0  {0040008 04 @< |880$0y'(0吃# | 2!p8`  0 @D  0p E' :kx%{'i( CtWA'V@F] Yn $ @-pPP`@@' |P Ѝ`3MU@p@-XP8@T`@D p |P<opQ<Pp'A-AP 0P$ 0 0 SQ ( $0hP Vh dJ`P, 0R1@a@qU`0``001Ph9 -00CS000    0,`0CS0000 (00|/U R 9 8 4D 0$00 0$ `'LUț&`'%+к'T0 S 0SP/P/S/@- g`'} p@-XAXT0040S+@! PPP P`04 0PV R@40P 0SU40 ^*00"  `0PEP P0P4  S U 4 P0CSR40PP 0 = p`'`'|%'к'p@- 2 0`001 pUpP@0 儱p W1pQpTP0PP00 PA{8 , 00CS010 y 0P0CS0000 S0 0 @ X 000 0 P0 `0U0 0T p 0 &h'ț&X'̽'`'LU%+к''Ľ'O-PpP0 SPEUP ЍE P 0C0 X1 Ub000Pz  00C0S 20  70 0CS0L200 y Z0 P CPE P 000S S  `V$ V000<P rzCx t7p 00C00 0CS0@100 0WyX 0PFP 0Z0 CPF V&P嬀VP0PP00P 1zt pl 00C0m0 P0CS0<00jl00`6X''`'LUț&%+к'h'O-P@`p P`T  0PS ėP 0@^S00\P0S @\[ \jP X0 @P+0P00%p& @-T @000 <P 0S( 0C00S 0C0 Ѝк'ht@%P0 R  QQP0R/@- к'} G-QpP@ `V 0S0S  @Ѝ0S V 0S@@T0S VT@T0S @NP 0S 0 0 P 0Sк'G-@P tp0S'`$PUP 0 @P @P} к'X0000@-@i 40aA R    0/ᔢ&к'40000 01h@-J 蔢&к'G-R肟@p0 0S0 "3( 0`?VJV$ V00 0 0S0 =D x \1@s4x0"S04 @pp FQvP S S SpRR SR S S SPRPpRR R R R R R R R R R R SR S S SR^V ^V-Vi @ 0000@^V-V00@R$ox0 0I1@s@dx0"SR 0.V@0 @R \ /Fo@P0 R00R  G@PR 00;V0 00 W@| T0Swк'&X'} 0@-@00 005P 0S  S   0 0 0 ,Q;Q S  S   Pp000;Sк' p@-PD0QS@@R0p`VP 0Cк'p@-P#@P w, ($( p 00LUț&%+Q 0Q\S@-Ao/`@-0S*  0@000S! P_pP 7qPP @P 0 S</R/     0 к'y( Q 0@30/@-к'00@- R 0C30tк'A-ppA1SPS a00S S P4!`0`00`0S00 S@P0.S0 S 0P00`P 00CS0#0 m W  U0100CS00 pPк'&G-AP 0pRpGWR0`0`0` 001S 0100CS0H89 hP00CS0' 0S  XP 0Sp`0 0`0R00 00C0p00  $`pк'G-P4Ap  QR`X0A EP0A0S6PC000P 00CS0'0  W  pP 0圑0CS00PU`*<0`к'G-A 0`0P0 P 00CS0-0 n& 0FSp 1S 0PEP0Cp00100CS0к'O-PB`0pSP UB!0SR0XPPP00PE 0Q0CS00LN tP[00`F`0"P/  K P) 0100CS0G'(P; 0堑0 S, S  VPu^ R00CS00  0堑0CS00  jt0Pzк'tlLUț&%+A-A`qW ڬQ1ECe R0 0 C0|00PP;u  00CS00 t 0q0CSQ00 \R `R `к'LUț&%+0O-D0!10Pp Ѝ0S/  $SPPPPPt\ XT:00CS00  ]0Q0CS00! P1̃أؓ 0 S)"Rʜc0U```00pP 0b0CS00 s 1Q !@o!S/ %S !`V U 00 0AP 0帱0CS000!000\Q00`PR# !RU``0``00Pc 0a0CS00jl0` 1 1S 0S11a0S S`l  P6 0a0CS00=?10`! S:`Fp00  1S pma0S `10 BRpE` S`l   P 0a0CS00   к'LUț&%+' ( Q 0@30/@-Eк'`01S @-0@!S @nP /cP /к'o7@-A00 S1 RUVʐ0\00MPBsU I00CS00- 000 @ R, R uP Ѝ00!S HP 0 Sڰ 0R0CS0000 0 Q  tP   к'&LUț&%+0?A-O0 R ,Sp WX ! GYQ_YR\|`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}$|`}`}`}`}`}`}`}4k`},mtn`}`}`}`}`}`}`}rTs`}`}`}`},my`}`}`}`}`}`}`}`}`}Ti`}itjktl,mmnlooxpqq`}XrTsstXxy,myz`}0{PP00 nR pR lR 00 S  PP1S 'PPPP0 nR pR lR 00 S1S /PP0PPPP0 nR pR lR 00 S1S  P0 S00P0PP!R "R  R$ 000@ `PP 0 nR* pR# lR$ 00 S{Py PPP~0S!S  6]0S 1SkT ^P0PPpP`T 010+0 +0X R000@ <PL 0!SP 8P00 nR pR lR 00 S(0S \ ^ ~.PPQUH  P G@ooG`GooPbVWP101 P00 nR pR lR 00 S PP0SPNʈ0 nR pR lR 00 SH)0S << 2P0PP0SP.ʈ0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PP~PP0 nR pR lR 00 Sw1Sw P zP0PP  PP` 0 nR pR lR 00 SR[P0PP;P P0nQ pQ lQ 00 S 3 PP=; 0  P/p PP*0S\ `Vl0ViV PPPVPU$p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SPʈ0 nR pR lR 00 S2S0|40S402P0PP0S 0l0C0S 030 S~1S 2SqW P000@ 0S0 0h`PPw 0 nR- pR& lR' 00 S[1S[!0R!S P[0S1S 0c `PPP 0S0L 1JP0PPP`r0 gRG  R7 0 B Ro `@p?o0"S; b#pR1 rR1 U0 R 0 S( 0U0b0 * `P'00CS00 P00 S2S 02P00PP2P02 P P 0$0b200CS00ULWP!2R002 0nSS pSH lSL PP0 nRL pRE lRF 00 S1S"ꔢ&к'BYl %%Խ'LUț&} 4-''pX'%`^ !2R000#2 0# 020 2 2020P0PPCPYp PPT0S) `V0V PpPӒʈ0 nR pR lR 00 S,1S,02P0PP0SPӄʈ0 nR pR lR 00 S P0PP QR000P0P00@h `P 00 00 P0 nR, pR% lR& 00 S!0R!S Y0S1Sm bWW 0 P0S0P0PP1S 2SqXP0S 0l0C0S 030 Sp P0010CS 0nQ( pQ! lQ" 00 S3 00SE n` `T@pn0"S8Y`r 0  PP00 nR pR lR 00 SK0S TPP0SPPH0 nR pR lR 00 S,P zB2S1HP0PP P   -@- 00? ЍЍ/'Խ'-0^S0]S0]S S]S[S .0L0S^30   Q  ]Q RoG-鐁`P@0 SS&tPD(!,RF`a`qU`0``00P,Lm( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a l L0 0@S G 0cX'Խ'`'LUț&%+к'l'p@- !0 P< P@01SE0p0S S u`Pp@0P 00S!P0P00 *P l0X 00f0Q P0l0 ,(X'Խ''''LUț&%+O-|b|B0 %Q + PXrX00 SM Y< U 000MP "$lT H00CS010  Q0R0 00CS0000 S0&0Q@0C0RapU`0``00P 0A0CS000 0P \S0P 0 S 0t00S|hhP 000S Sq 0`00 PkX''`'к'LUț&%+d'h'&0A-P0 0p@ W 0 `BP! 0 R00R000 1BQk@ @P@pk0"S,$@gR000X''O-@SMpcȳ00 0GS TcsT`0``00cPkk` \_X00C0+0&SK BR D R: Y J @p R7Pmk> 200C0S @Ѝh20    BR   0 \SH 1B\C00 BR?ˆr L\ DR-WppB@ \ p P kD @<h00C0 AQ 0 T0 Tpppp  Pu p BR   @W0 `0CS0(00oq 0 b'`'к'LUț&%+O-M0@ 0P 0k (40S 0  0 00 0(0pPP `C̳0 S pSP(0Y01 Y  $ GP$}jN` \BX  B R+@30 #   BR 200S 0 0 Pi0 0(PP0 ߍ00Y0 Y P $ P$  BR 200S 0 z i P004 Q' 0 p1pG Y<Z  PH1 i8 40H00C0StX 000 "2 0 0(0VP< 00CS000\^W 004 00 vT00S 0  h 8 hXb`''`'LUț&%+к'tlO-pᬡA0M0CQ` 01 00C S00`NlЍr  0P5 3P!` 00000`P00CS000  [  E0S00CS0x00` P  Pغ''`'ܺ''к'O-RB0M00bsp 0soЍؑ0ЁS 1   000P@ 0##⩟ɐ Y Fp10S 0p0000000CS0C01; & \" \ 0 0#0L\ 0C000@00000000 0C LN +'%''`'l'd'к'A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT }@ 0''%'G-@p0 PR` 0 PM(S%H0  d $P 0 ,('LUț&%+@- h0 ț&O-dGM0PS@pM$Q403/P  0: Sh00W +7S P9:g?0$P0: S 0S P0: S 0S 0S 0/S&P3P0SbP( ʩP 0p#n PN+RQ0P 0#P]]]P  /nZP/hZPppbP! 0S0S rYXG XJ00CS0kpl Pph pYWr TTE\H Z0Sh0S0c ?o2500[?G YU.0.0 OfG=0JfPT.0.0 =fG=0INTP8PP! PArpW  ЍOe?<0匑SB儱|?@P 6d@V?2d@0d0SL H 50CS괣x\" $ 00L0S \0.S0S @@0S40S @<0?oQ20S X 040 ЍP'qWG-`E`ſTXP0HFL0 8 P0S$&00D0H0P0pP0 XpO5T H0 `F0P 0 KP Wv5X0 s0X0d 0t000|00PP, S,Qx |0R4 S& S' S 5" L0S5 T0S50S4P$Q40V  00Ѝ10@GS꬧Ȩħ<\tĩةh(8PhЩ|L0L00P000H00P0L00T0OX0s0X000P0L0T0H0D000P0L0T0H00X0:0P00L00T00P0L000\00`0)0`00\0$0d0!PP0<0080 P0 D0h l00D0h000000 0;(00p$00p$0,p0$00,0000@00 00p00t00D00h00x00|000000000D0@P\bD @D<\0 SPW( ?R004(0\ SR PPP00`0S0\0S00S S S0|0`0Sp0\0Sd0d0(P'ht@%<Ȕ&O T T%ț&x'Ț 4`80p@-@PT @@\p' 80p@-@PT @@\p' -L MRM\0 + pa帾0 ލЍ 00 >04@pl0l 0 0  L00S   #`ț& m'''$0\ 0S ' #0L0S/0 0 0/@-00 SM    4 $;pphЍ\0\@ X0R@P0 B ?Z 0Ѝ@~X'`'t'(|'rx'P `00CS`0p S00 P0S X0X /X&: S@-  S  S/ I* S  S%|@=A-|1`@pTXPM !\5@T10S H10S. 00 00,10'{p \ @0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?AZ 0T00S \'`'t'(J'''Ŀ'|'x''s@- "P@@P `PU00S @GT CЍp0t  Q \0 \@-T (P@$Uп'ؿ'p@-P@Tp0 0C0  $A @G-@0Mj03,30S`V0Ѝ0 0C0v 0XPS !$]0S 20Sh  4 "; $p| A¾0 ( p8P20S 0<0 ,,(20S  $0 : SF0( " 08"$410SP :1!0 0O 10S10S : S0: S y`}P1q H1Rp@1 B?2Y 0'Q %p , l^ ,00S00S ؿ''\'`'t'(J'p'''''Ŀ'|'x'''1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ0P 0 B`0S#p#QPPU% Ѝ  B 10`    0S[  L0  $R,   V \'`'t''Ŀ'%%ؿ'410G-S$0@010S 10S,0000 0 0P=0`VG^ ##pP儠UG k0 0C0 W bp0S$,  `YpP R`\'`'t''Ŀ'%0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG +0 0C0 W ,"p0 00 S p0S$,  Dp` \'`'t''%@- M @ Ꮉp ЍT  P  T0NP 00 0S@SQ 0  N0p&0p@-0PS``W@P XP PuAo@P4m 04P.Ḹp輿'/#C-CM@W `\ \PȐ`T *F 0pPPCߍw ? P@\w0S ?@ӸP?lP@ &@-] ț& 000/'@-]0 w ț&@- M\0P!00A00P!0 0"ᓽ .p剽 Ѝ "$ 10P @000 h0h! .pX   DHo"$  (0h'mrg j#zO-L@PQM CPm F]0Sq  <`OP 0S HP , d00CS00pp/`Ѝ0S )P X2P `P`(⣻1 04 Rt$tpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPXh0) 0 p W 00CS0qp pYW 0 P 0S  tXP `0: S ;P8X P `0: SupP` o`P᣼}c0S x WP@ ޴Pb #[ ,{P t0˯S ,!00   1  0  ! 0 p!p|J$80H0 UP 88x tRP 4\0S +`0;`0`FP  AP \0-S  PT.`Ph0S  <O`'ț&&( m#Y@)=Js@-@ `PPB@0P. UvЍpU li\@0 P4XU@%A-A~M0pSM P0` 0`P[p! p~,IP [@!1P~܍Ѝ0 0`Pt[ ~,,PPk[ ~,#P `0 0PV[x W Q \#10 00P>[0$ i1%m2[00CS0 0 /O- U`DMp 000D$000 0000S$xV"4`0p Q 30Sa4PZ|1PZZ0`$1000 0K4$PZ0$1V 0030p Q  #P0 0Z0#0V0030d#lPZ0X#0L3000DЍp(0: S d0 S" P 000 S|2"00"00 0R  Rz2`2Vn `i S0% 00 0PqpWZ0S 0㐐唠0 0p) W W)2`V%  ?S 10 0R  S0R 0!CQ:++R:0'WW~Ta0@ 0 }ST04[@T ;0W ` W00l W~,0 ~l0`Z BP* BP*Q*S  Q T0`%''%%P 0(03/ a#P 0AS0@0 a3/P|4C003P H4 C(P(40S  P T 0 0  P 0R S = $ `0Sd003p0St00PP p@S`3`0Sd00/SXPJ, A7 S0 0  eP0SW 0S = $ `0Sd002p0St000S "SD 0 l 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P  x1 Hb X RP$PP ,1PB0 P E @ ;/0S0S P0S 000[\000*4S 0S 0m(@l(%xm('m('tm('hm(`m(P''@''Hm(Dm(l(l(,m(%l(G- R@}P T T 0 9&@H03/P0 03/P0SB0 Y Pq0 09paMP P: 0 P0(03/P@F P0 0 @0S 0' 00OP@' m?P0 0 p0 0S TQP \0 CY yPm(hm(l(Pm('l(l(b m($m('T0@-0S\PP 00H03/P@hm(m(0O-MMD嬀$0: PP0S5  Up 0)  BJ000SPER0  !: 0P! 0p 0P0U00pPF0P0 000/`F p  J00`00Q MQ P0 S  PF'%m(m(p@-0@0PpP EI0Pp@|'%A-`PlplU@0@DTj@P U@0 I00`PE'%G-P`ကpU0@0@DTG@PğU 0@0 SI0@UP0 `'%G-pM =@ P`IX10S PyJ:8$! U00 J(A 6 0 BR P#?U0 P0PU0o0PJGJ8h @D 0RP J(L J4J80 _ `ލTm( '%7X& Q/p@-JTUPPJ0P C Pp.P J4$ 7 婤0 40pk(0@-PM@ $Ph00S Ѝ0 $ R\ 04 0R\ tm(0@-MP @PЍ000S0: SxDP/PU I0D P 0;I0 tm(h l(0@-M@, 0000S# Q0S 10S P'0S% X0 ?A3c000S&!h0 ?A3c0 P fI0NS bI0X Ѝ0ZI0< 0S p%%Mbp@-@P`P p BP $00;3I0 ^pl(I@-!@1P 0;I0@ Il(gO-P0`/Sp/M/L9@P7 0P. jp /00 P&  P!00S  P  P0 Dx Ѝ8m(G-@P 00/S (QP 00Q  GpZPH0 0`0S Vy뤀夐p0 EPH0S@$<jP@D0x: 40 @Dk( @m(l(A-M`P@pP5(10S Ѝ 0RP  0RP !0: STCP P7H0 bNPW ,P #H P W0 @Dtm( h *;0@-:(4@: SM=0P - \ 00[ P0 !p 0: S ,Ѝ000  tU:P/  0 fA-pQ?ZdV`PG0H!@1@0S/0(DS7 (1!0 0 0 00! "4S pPGp0 50 40Ѝ@$<@0(DS PL(DPL(DP 00 08m(0@Pz=0 C`z Jލ Ѝ   Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40APz P#PF 0 `0 + D`\ QX00O0S0(4 008 00$m(!Xm(8m(@P0/S000000f PR @@@pk(h0 RX R  H R/< R/ $R/Q/ U!k(lm(Tm(|m(l0A-0S X0XP@0P`PpT R S> +0@l(k(LUț&BC-b@ 0,MS0S/,Ѝ0 0P50C S>##########x20S 0X0 00!P 0 000! " PPP  0!$:$!5 0!0 㓝 Iz X BB(4 : S>  S8  S%  S04 0L! /0 J $!/1>P6 S  S0  S04=! 0400S ̈́!!" # "040+04 cPC0P 00   0 Ok(l(o $m(i p@-8M@  D 0`P`⇣U`$ $ @ 0MP8ЍpA-t1hM0@S T/hЍA\5`Z(="(<,p@1WpP0 0000p084 40CSH$0"60"$0( 4 CR+x 5hЍB>'PS+<  㲅l(LU(  -&m@-@XM="p:(□0 XЍ57@-@Pp q7P Q Ѝ0 0 ` Ѝ0@`0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qqp@-@@+0CQP0"S : Q%R0W^$B0CBSB 3b 30BA@pQ0^AC S*p P@-*0S ^*00 S R( \000C R@30 ? SR@*:@ 00 C@ T \A C@T2  0a0C R"  p@-0C@0 PR"S :$B QN%R02W" 0C@Q `@ 0@PpANQ0 C S*80P @-  //dm(>A-@8q8`Q PC-PQPUPQ S A蟥AT1:UP0 ddj? 0:S@ 0S000 4- l(Ȕ&yț&/<s@- `80P PQ10*@PЍp0S @mR! bR kR% + 0*S xS SwR! /QP0@P0$+* &0!SP@P0PA- 0S[`PpP l0P# X p R 000R p0000S ,E1P0=0?1@Pᙛ(l(s@-@\`P0C30 0  R R00P+@P0@( 0ЍpPE ?00(l(@-  ^㌾ț&0 Rr @-/%@-4@4^(^ ^^pț&1O-px K@ &\Pp`@0, [/00 ` O-lM/PK3oPD}@P p`0p/小0/ `0@ ?/@|p??A0s S  R`?`/0X CRSE <zP񟗳75l2575555575777755557555555555555555555555555555@7L755X7d75p7|7555555555l26555566655557755l26575754755555554(5545@55|555555555$6,646L6,6T6\6d65t6`N>4=P $,PMP>@J >0 -R,Q0 00 0;= =, 4<= 2@ 9`3@ <2 3 T2 @ .83" * 2@@ % 2@  2L 2LP 20A00㬁堑 RK aR eB Q PATATATATATATATA8ATADALA !00000 00K1]PJ `1J  P1I  0I Hꈁ 0 010L0㕺1Pd H$m(!4m((l(m(%Ȕ&%ț&l(p&''tm(%8m(m( G 0.m((%Ȕ&(m(% Y#ؼL#ԼY'0   0G 5가z0P  , G# 01F  1@ 6P00F NP`1*PE 1E  1D s1 1C1WPC1PB $2B  42A  D2A  T2p `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C 00 0S3# C*SS8C0U Pg000Sv|30UӈePE3PhPN0000S 3 Y0P  /(l(l0P/`0p@-0 PL@LPP@0@6P6 ˻B(l(m(" Q ț&$m(!A-`  @PA?\+ \ *\.  Q R( [\SPQU !\@@]^.!Lo \0S8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ |m(p@-@@0/SN00N P\WpPQP`Q*C0CT030@"L00Q*pQc!@-1MP M AaqRP/`5P 30P0Sۍ Ѝ.S@T|`l @ @Y%$m(!("X"z" o" """"O-cM M33 "@p8%3]PW0`0 00S 0f0 0 0hP`` 00 ;RSVz @0 0;T* R`DV:  cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 0 0@&P\P   (0 0CP;T+ 0S( `0V"p0S 0 0S ?0S s  $0l 0 x.@T *0S0T00  R S 0 $l( &#c#ț&y#@#C-`PMM RP p\SP RT P0S #  0S\S R. gS PS$ SS GS ᬓ 0 0=pS sS0S00 R @@@(PPP ဓ%@P p 0P ; ӣ0 0g ۍЍ#$#l(##A-PP 0Sp`p@PL P<240  R p`@@ @9$N$l(X0A-@0LPL`LpT  SZ G0@l(LUț&{$`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0  04wP 0S/  00p0S/  0`01 @0/S000 0D  /l(lm(|m(l($$0A-j40@TPp 00S0o`0 00/S @Tx0T0o2P0 SD fP04l(lm(m(2A-0@SP' 0`.S0.S0S/S XtP 0 Q CR S.R  S.R0S/S  10S410S 4P:4 CSR ! Q`V 0/S0S.00 p1 00C0V0<0J `V#>_ VP:4 C/o"SQ  S 0 BP  0 p@-0@P` P :40CS  0 zppp@-@TLPLL @0P U0S *㱴l(%)%k(A-@` P10S"TUp& q0P# 0P00C0PES%Pe0@@ PY4YY4YY4YdY4YC 0C0 0A0 B!"00@ꔢ&A-Q@pW :@ :P墊000p 0@-_+ 500S  /m(0-h0^0 SQ0Q00Pm( Q#p@-0PSp  l*P`0 r   H @Tp /!%+A-`p娀s@PP*P@*P 0 \[H0@ LV00CS0 $ 0 + %++&,m(A-`PPЍ8".:0J840K0CS 2  `70 01 .  dd (l] <tX @ |qp}  H=/ 0$  4 =CL2Q ! 1Q) ($5Q/^)040)($84K ARKQ  $ q++  @ 04(4 :(40/S0004084(49)($ q++@k$m( m(C-j4@0CEMS* yDy\yyyly|yyy 30SPP EߍJ(J(J(J( J($S20d 000CS100 0=P  0 R ⨁0≎ᩑC  S@ 3. b 30,  J(T0Pu[[P081  1 Є0(p [P0<x TP0@ MP00  0 DPP u00 09Pl #PK=Ђ;PP P ?Ѝ@Ѝ/m(p@-@ATp@0 R PClP ` `nP`pm(-P@- 00|0 x0x 0 0 h@0S Xl00L0L <Ԫ ,$ l Ѝ@ Ѝ/m(Pm(l(l(ț&$m(.Cp@-x巳@Pl!hPP XP pḳ000S  p/m(mxm(/ -P7@- 000@ 0 0 0 P0S xZl00l0l h} X姽T}D 8q0 Dl Ѝ0@Ѝ/m(Pm(l(l(p&$m(.Cț&2@-s) [S/ț&@-M@P@ލ0/SRfPpMfP ᕴp P␴p 0RP 0RP |2/$h 000/m(@-1) /ț&A-q`@ MT tt lAPD700CS0?@@P hDP0P 0@00aT8@ppw(A-ppP`000 6@60 06000@0CS000SAn(n(p@-P`@T !PV 0@p@@-PG-Q=0@T: 0S W@0 Y =P P0 V VX00CS00 jV 0 0 0{@p`w(0%00%C-3sPc 0 ^p3@0! 0  0004 B @3 3 00`Dm5蒟 $0@ Ѝ/R@R R@ m&@ B&QꨝPPPPPPPPPPPPPPPPPPPPPdPPPDP4ԞĞP@0=S0  "?R 9R:BP\ԝ̞|R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R'0o  -R(0h )d%b#`0 ]ꔢ&n( n( 1n(n(Q10@- n(10s@-0P`0Z0`0@S P 0R@P@%  UP@%0S00S %0ST P000 R  Ѝpn(z(%1/ 1@-L ^ꄡpܡ0P$ȡ\T @@~, \- (1#P? L 0l0̠?0 c0àΌ SQŒQQP0R0R0P0QPQP !111O-`pu딠P @%R@W &R X(4! 0[00 @P@ P@ Ѝn(2@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F2P@$ P@ϣ Wn(p@-@P0)Spn(O-@`p04MTV TY T( T) #T! @$TU "T 0@#SP  +4Ѝ'0DSYG x@W'0I @S 0 0@SP'Y00p0p!a |W! sz! m0  @@P! `0  @PWWM'T@@p@P, @+ n(7222O-p`M8P谟蠟4!@ 00 R@ 0DS U# 0 \ 00S^^ :U 00SY` p PU @ 0DS Ѝn( C-`p 0BS00@SP! @ 00 TPP@@ Ѝn(G-`dP0@S! p0 00PP@n(@-@MP2`PL0P  IR NRpp  PpEp@@0PS@ $z2Ѝn(I2PG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P22Sp0@1PH0@P 0,S@2(%%u(z(@P/-0 /RRR00n(@-@PMލ0/S Xep `p 0RP 0RPh p@-`\1@P 1D0p@11"0"SP Vp"~n(e2p@-T` RpH0@Q 8 X PP `1pp@n(P%|2O-p6WR 0S)P |B000000000CS020S 3@T  U tU`WV+1828b0400@/Sp?EpPI0S0/p0CS0oppW002000pA0P00 /|000 hWU \SU00CS0810S 00CS0 0W00 pR0S/S0@D001@ qP  R*0000t/S0S _P 0/0CS0 pG0S 00CS0001@1@1@n(n(n(y2|2%u(%oh A-`p0@00P 00CS000S q0P0CS0d00S b%@ HW 406 R0S 0Qn(n(2%n(LUG-2BM8)r0@T%U@P' 0.S00.S000/SSJX20Pp  `PF } ePZ( `V+u]PP "3` 00` E0E~!@0-S0SH1@T@<~UP0⌫Pwe 0S a /pP0: S W /pPX[P PW ; 0S| 7 /pPsЍ%2w(y2D 2n(222@-$0Q @ S @n(|23p@-L@QD70P000S LTPP 0S}@@O 101hP00CS00 P 0 O0p|Tw(03n(D3%e3G-pPp@R` V101 Pp Pp `b\TQ @0T! \0DQS񟗀HDdlt|@0 0BP!0 BS@@00CS00 O 0@0 @T0S 00CS00 oO 0 0SY00CS00 ZO 0 60S >0S$0S 00D0$ 01C 0p>0S$0S ph@PnT@ xP H077S 7S) >0S*00S6 -0000,0(00 0p(0P =&0S(7S%00S 0 0Sp= 8  8=, Rp@ P 0 8= M8 $= <, R , ,( a%P000<<0S @A @X$ 0 $ ` 0bt<H<>1Gh@T: =pHP`P H00CS00 nG 0PppH@T4`@T @ [00CS00 SG 0 H@`@T0Tk PU#00CS00 7G 0 ;G00CS00 #G 0  .BP @P07:0P PP@HP\: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP0077S 0C8#8S0\\)SS B708#8SBP0 Q A!Q8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  p8 @  (00(00@070040 8<000L:P7 7H 00R}0( ?$0SP007pGQhJ 0'000 000 7 0|'0x'00$(0h7  10103/$0 7 G474' 6,' EL0S L8 6 6 @ R] 4 0  X $E&@00CS0 rl`60S C̜P x60S%,0#S5T6$5D h0 L5,,0( H0000*,0( C#0hE$0(0S,. $ \5 d50S $5,0S prt<%050S 0 @0 AP0ET>0 0<0$0 0C0 000|D000t4 8\XQ00CS0D40S FP) `40Sq*T0SXQSK8 3 3 3 \ 4 03*CW*00<p3 0 0S '|0R#C#0 0 3 BxhL00S0\P0"0C0000QK8 2C  |2  t2 \ 2 *00 0`2 T0S@"00CS0 2 R   01D0S$mߍ;10S %0,!SS{1 08 L0H@1Kq10@0@0S P1 @0S1 41$ @0S  1@0sH1 R#0S01   B  @0S @0S7S@<< 0 00S X;X@,0S0  =,0Sh@P3 bF 0,0 0H 08|(z(o({(z(% Xx(n(m5{(n(n(|(% Dt %w(w(,-Ȕ&%%%~5n(@o(!w(n( 5B 8 dG@T(0Sp0 t0,0 0s,p)DlHF0/o(0 /o(0 /o(0/o( 0  /o(P@-@'P@x<0 QP cR   5o(0 S0/o(0@-0M0/0@0P P L0: Sl  S` PЍ0֞P0 : SV# PP8|( 05p@-Px@x`M$P*00S O#0`00``00"`s#$Ѝpo(w(@-h@P$0]'0 RP  B R    o(//C-LM*8▛8 p@<(P@0` D, ` 0CLЍ(%5A-@P`,pWU ngN8" 00L(pw(8o(O-pWC R``%` P0S:S2 E@А @0S,W@  @0T/S/00q0 00S00P R:R0:SPPPq @DOB"S"%%0DSZ0 R"00ㄲ0  pPZ m P2 @ 08@00Q  0S/R10SZ #P %pP A0000S R  pJt#P R  R (P0 * R; R 6i 0@@D: P R  BD T@0000S R    BR =D R9 7 a8|(P6%00J 00CS0$00S Ѝ0@Ѝ0n(%n(@-gP 0SKO-@p`SM%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩00S"" 0R% PW>= >0 @ TW 8Lw> 8P 4p>>0 R @ T Ѝ_>~>A00CS00 = 0 00  x100/PXP!  SZZW YA>>>TᬘPW4>W~`F ]jWxWtWq ~W 0` @ p`=`'6w(6LU 6(767/7=7M7%8|(6S78xZ7p777O- MLBLRp 0@0`V' VV:V  VF /V   BR 7` F R|$! R  |a[  0000SHA@P  ~p[/R 0/S k09o^P Ѝ:^ @TW 0 BR  R  BR    BR  7 2 %o(u(%y A-(A0S 0PS0 0aqP0S00 P000?g00CS00S P 0SRh`hp0P RP000g000CS00S o(n(n(o(s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@@  `m@9 0S00S=STL00 <0 R0AD1U0 S 0S%w(w(A-dp`0PS@  R Rb00PH @o(O-rPԂ0M00B00 00$`0040CS ;4`PP00CS0E0S00CS020S & H|P+ 0S 000PP Qf P .10S 0EC0P0CS0X10S Ѝ000 @H[ [` V (QP PAP 0 SR BR  R  B ~  ` B `FAQV  RP Po(%n(u(n(o( 1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xQBP  `V' Q`:00pQ@  @% Y0S" S,P 'P@P P DoQP @@` o(L|(o( %PHA-XPX@X`P0p00We0p0CS00S o(n(n(p@-P=@h 0@ po(@-QP`p0G0S `*00E@P`P P `R@ Ѝ0P@@0`SP0S0O-@ Y X0 S@0 S@HY" \YX0 S@0 x00S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x^\| ]\Q000``S XSQ0 0 @ 0000xQvS^ P[Sd:Q" P-Qf]Qc  \QQ PP$` $0( P1 0$0 $`( P%H0RFPP0 QPQ P !$ P80QP*0$0dP d`0]S0 S 0p@X'\PP  8QP4\SSPP0 SP0S  @p37 O- P@M0?S*S3 [S;0^S!S00x \/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xPS@0/SR"@ R0A$x RP R  \$$ЍPX9$P| 0U0/Sd 00EhpP $0S/00E0S``0` xQP 0S V/00D0x RP0  Q: 0 R /00@>_0P .Z. B/o" R  P V0 kf$o(h  n(0  Q0@-0 @\C\0CC/x^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S P V$$$b0$000CS0H00S N 0S }0Po(n(n(p@-@ PTp 0@ @@o(G-p 00 S QA0P 耟`V o`R`F@ V pllllll@S`` S =QQ RU  F0P   P 0G-`@ M G0P £(q000e U00SV-00E@`PIPE@T Ѝ00CS0@u(O- R@@0`-SPM S! C R444444x44d?So @Sy 00C Sh+0 0 h`#0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P@7@p<(W@A0S 0g0CS00  P6FBЍ666*0000Q00S h6h pR\&TV(0S 0 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 R I 0  U  R~ȣ0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   8 ~ 2   0S  QAQ$AQ!   Q R V  BR + `w~  0 BR儡  BR  ~ ~  `K E~paQ 00S T 00 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00w(w( u(o(H L %u(,o(%L|( %O-$M000 Z0 0H'0=7,W0Jp00 0 7'0` 0`F#ZGF@Y0/ 0o@P`6 Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG (A39 6`0P`F 0 0S Z?0Y : @5% @AQ TK[Y0I Y@i ZD5  A0B F0  %T5  0 Z@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R&$$@&@&x%x%x%x%$&&&&&3  AQ AQ~00AQ u~o K R  BR ~0 0  BR S~0 0M @0RP[ 22 0AT[ @T 000S[@Zp  Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0 0000P  00B 0C 0000000T0 00`P 000l0 GR00#S00 B00S0p0 G0 B03[m$Ѝ|00S[0000p0SQ o({(%%7u(w( z(778O-0M P0 4ԄдД00C0~Q 0 `p0 @Q Q!:Q =Q Q QX   L  BR  V PR AA KA P񟗇+(+++()D*))W 0S@ЍQ Q@Q =Rp( `p(``# P  BR  wp  w     BR u   u   BR    ( R 0BQRQ B  W `   BR  v v 0AS Q AQ~@P   Q @~  @    }@P e i  ~Rf=Q0Sa 00 O   @L|( %o(%z(u(G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S!000`0`0CS0!0 0@ p  X 0  i 0  R 000/ 0p %o(%u(%z(o( @-0@%O-XAX`0$M`F;00V00CS000S 0S @pWZ00萠@ 0 Z)SꙂ! P00 R @0 000E000PS V 00CS0l00SG% E  P0(` 0`00n(%u(n(T 000@0A00CS0/00S/n(%n(p@-$@P0 0C0C0p%u(p@-(P(`@0@D00C0p%u(( A00C 00 0C0/%u(-A-@P(MHp@`DpPVP u T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@JM0 P p< T4O-` 0u== =====t(>)> BR00/0S0/@0S/ R /0@-00@00C S N RR R1\ * Ѝ>~>000C S0S//p@-PP @P  xP  dP TLGP 000C SPpppp &fQX0 0@- ^ @P U@R000/%p@-`@`P6N0Spv@Tpuuuu@u 0P p@%t(y;>G-pP@R^Q6 @a0S 0  pW@A00CS00  0 @aq刁 Q 0S  @TPL$aDqD0 R R @TP@00CS00 O 0 Q 4P @1@UT@Q@`Q !PGD`V0 8%>> >d%f>>?>>> 00\%P0@-f%>?0S/p@-@PPEPp@rEqEA-@1S`p@DPU 0@P00` Pw(O-@P0q儑0`0S -R  RF -R0SF P +R: `cP Z TPoP0S TP T``T |0|0T0rP0S \MT PT<0@@T0SOzw(w(>?(?5?%P0A-B00`0Q 0S 00S0S006X pWP P6p60S0S60N0S60N0F0 0C?oR20S  0-S0F01P0CSQC0SQ0 0SnP   000S 0 0^0 PA! R   R0 0w(%G?8o(P0 f@-\@000D00S 00CS000S n(w(n(000C S/ @-jJP 0 w(G-0p RP 0S5Q 0S @0?` 0CC10@ !,g``@ `_@j `` -R \ -Q0S 0`@T0:SF 0R@1T0:Y " @`-@ `0 T 0:S  @`@?:\00|@Y00  T@0 CB!0 4$@ Ѝ觭?p?U?\?%(P@-HdD0P  Q 000CH Ѝ?w(w( $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ HPP0@:T  ($w(??G-tR@ 0S PP -R`@@$0P 0S 0S@0-S =@T 0T T@1@DSq0`000@@CA!0S:0\:0l0@#1 T030V:0 000CS0 10S }3  0 #@0S`p0C 0 XZ0Oa0C R 0 0CS0H00S L@0S Bw(???n(n(@p@-H@HP080Sp0u`0CS0` 800C803%u( 0R @-@T [B0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @% 0S/xQS  00 S/00 0/0S/0/ 08 0/=P/P/0/ 0 0@-0%@p@-`R`@P:P t0 0Ppd0 Pp0-S0S0 0pV ($00080@pt(t(@%O-RM0 p0pᔒb"%Q  X @  [c { R00CS0`Q``@320`0@Ѝ X @ ,\[8R /x P0  BR (000kp 0 S B R   [000Xp X R  [R.@@  B@;0  / Q P Pp P  Q  R P000@00 w 0 C%%u(%d %0-0@ P RDM`0 Ph h "  U0L T<0< 1 0 01 0 %@A7Ad LA)A@-P@M0 G 0P0Sp`@T*vpPT @T?PLP @0 PЍ@%%x(\AjAl000S p@-XP@T T D0T@p8040@p 0 /%4p(~A({(%$|(@-0@C4p(p@-d@dPl\Ppi P 00008  P8 S Xp@T%%A-DR0@T @ B 0S 0 @ 0r8 0 00CS0!0`)V*V V v va A ` 0F SН$$$$$Xd V@0000 @\V. |V ;V&P @0 ;P @0 @0 Ppx&P@0 @0o|P@0 @0@0@0p P  00P000K 0 %%o(o( G-pc0@0 T T+P,0S)㰀" TPP @ @@`P  0RP `FFa@@T 0 % p@-`0$P P g 0R$, (@R   RP3Pf    Q U 00000S@p 0 BRp@ Q080@ p%A@-y0 000%@-@oPp@-. @fP P @0 000p` P 0`@`% O-С`P0 $ @CPp/0 CR00SY%3PB'V 0 H100SD (100S @ 0YP@0@Y PX @PW W! V! s000 @(pGWoVP0V      000%d O-PKM 0 5@00 04 P00400D$0j`P  0S _> 40  |4 jt$0000 `SH4 ` ,4$ ($00CS0c 0Sf@pW 0䃟RPp *p0PC0pC0 Sڈ#sV@0  o0 0C0Ps000>0 000CS0030S0@2 0 2 0 02 P B1 2R z0u`B0PUZKߍ20S d2h@d2d0p@00 0S V 0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PP@0000 F@!00CS0 0000DP38 1.1@@*pb0PC2P \00:0-, M00CS0`f R {00^%n(%n(%%u(n(A0O-鼯弿pM0ϟ  Q"/O/0 0202280 `00T/20S0S 2Y IȲ<е|ķت/Q00S; P.Q00S2 0P0C0p0000PbT.00CS0*@.0p210SxPpNTP"Pg KPEpE U0@#S?|T@8p0̭(LDp6p P00@ S0P@ A0@S7P@a0@SdWP@ W_ P H'P 0p@Wn00@S"cWf'PG\p0000Pg<0 0CS00C0~00P00C0l0P@E00@S0P@8 Y p0P0C0t0E4`0@?o? @2;R0S 6\P'\Pp ?PPpppWppUpW 6;E S< 5:0 S0 U0C *0?0%3?P00 Q~  B  PA0U!*00%60%3?00 Q~  B  ?PA00 QPA~P•3U5*00%90%6?00 Q~  B  A0%3?00 Q~A• ?P B 00  R P B ~ P  B u300%<0%9?00 Q~  B  A0%6?00 Q~A•  B 0%3?00  R~   B  U?p00%?0%p0PU 60 \0 e00CS0?H1P@0H21SZ0 0#<R00SQ 0SJ60PS܀V 0@P0 P>WUT@>P0 |P0 &PU000@$P 0Ѝ %% % o(o(AUB B"B:BqB~BBt(t(%& x(u(%U u(T   P!0 ,  0@ 0 0 S0Q >W @<P >P" &P0000000p0p0((0 P -P 0(0  pO0YP0  0{P BP 10 }0 01{W00E000C00Q#PpIM}PP 1 " )00 0: <}P,p @R<2 3 p BR *p) p|2  BR P=  ŤJ= P2 Y%W :W5 #Wh~v 0P 0 wk.0G P p BR pYpT3 0 @ R  B 0p3pP3@  BR 5p02!R1S $H<Q C4 DZ4an(@o(b/%% D :Dn(^DRp@-@P PP Up 4 |Ǹ ap`U 6ap0U +3 pDDpO-P `ppW@p  0Ù`ȐȠȰ0S UT  O   0@  U  }T 0S@@ `U %j(\ t Dtlp@-P  @`p R  `p d0 Rp  `p ~`p x`p,Hx(%Dp@-@PpD0 0RPPp03/f`PpHx(O-@$M0@000`p@A p2@ ̒V 0S"2 0S2" $Ѝ2@0Sڐ2 R@00CS 0SP P 3 8Ϸ`PzAsPP jT `0S_ ZPPZ_봡P000P000 S`|1 0R  _pP\H  B R% 2 ( C _PP  R  _PP UP _ R rP0 00CS0t00S 3T0 00`Q RPHx( %%%t(t(0Dn(%3Dn(O-`0Pd#dCM`s`` `00 J<p(V( PEWUCc 0 pW` u@p00S0SP20SU0SR0sS vS V`p0+S -S X @ @Q0 @R: VP     3PU 0 P0SA<0OЍVF p p0 %  " Q  %5S' ^p"1 Q  0^p0T 001 o X0 M IU00 DZ,-Ȕ&5E4-t(t(mE E:E\ _E%EEEA-PQU 00CSQHq10SL R@ 0`0CS00 `01L00<S0S  50qL0S 0CS>S0SSxh R 00CS00 - \ oEp@-@b0TP R R R& 1S# 0 MPpR!Q QT " "D0600S0T0S 00S0Xx(n(n(%@-@-P @(0P\Pa @-@P <]P0  S 觭dz('FQA-@ 00CS00 P `tpt ?U UH?U!P0P0CS00 `#tlG-@Pp000 T` 0000CS0H00SG0S 00S R.@n(Xx(n(P P0  /\ Q0 S//Xx(@-b@0pSM910S5 0SPPT,2C 02S ]p? 0Sl UX U` Pp2 W`RU\0@D>T000 0iV00 \10S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ Xx(u(%w(\PO-`@TP P@P ,P0FpS`@ PCPBPP34 PP`tDa0S! 000?-U 00CS0 PT40S 00CS0 40S P@U00P@`s䃟1 R 0PU TgO@`@VT @c儃Q0S 00S 3@@TP@P @LPP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X P̱̑@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR B,pVP 00CS0\00S 0U00 P꜏ JFK7'F%4FXx(n(n( 6FtlAFn ,F%FLUA-@P P0` pUTA0S 00S Do0@0@000CS0 00S PXx(\x(n(n(p@-H@P02`S@20CSpV02pXx(40T0P?o20S 0S//Xx(C-p@`1010r!Q0@S10C1 ЍqXPU X2_P{+P 0S Xx(,o(@ 0P/!!R /Xx(p@-8P\2Sp@?<9\BpXx(0-MM01`"R !R X"R   1 1d"1!d2S ,WPl1, ,WP L!0,00W@P$1, @T0d[`0P, U @T 0S P00CS0 ! Z00 0$0(00D>S _00 Z[ Z"!031Xx(,o(n(n( 0@-`"dyXx(p@-L@'P}0PPp0C/U00p p@-T@TP0 0P0 *0 0000CS0p00Spp@vn(%n(A-@R`P  Y0PPEU`pp WD0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S sDP`0000 0C0z(n(n(p@-@P@0SH00Spp@00CS00  %0%0%@-@P*ЍF-@-   Ѝ Ѝ/-@- 0  ЍЍ/% -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`nP$ 0S! l妴0S00CS0>0 "  u00CS0/0 " 0S ]pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' G %0Q%@-@@%@-0rS G@G0G-p0 P0R(0帐@0=00塾=`᝾`F@VPpPER000 S=S B`` R`ĥ`PG?@%u(%0@- 4@ 00C00 0 0MЍz(eG0P P PR00/0@-HP@^ ^ R0L00 A-鸀(  R c(p`@pW p0S 0QPU  0S 0S   3/P@P00z(0SfA-@DPXU p`pp0S'STP@DAM'PP(  EB>FmGGG#V A-P0`Sp@    3/@PP@X #W p0@=S0U0 0 00CS00  0 00CS00 x 0 T %O-@00Sp 00P㼀✠Z  0尻@PU* Ѝ`V Y   [ QʁxaP`0pz(z(40@ R P=R/=R/A-`P0S=SPERPU@'\0\p!0qV@pT 0S 噩PVpp@z(z(@-1`0@S @  PPV 0 `U' Z h3  `R Ѝ@G'Dq   R <0 2/0`2' 0R , R  00 0000@!L@0P U U0 d00CS0`00S Ѝ@ŭY0#L 00P P Ѝ%Gn(z(n(-x0GM00h0 001SP  <0  40 Gߍ 0  0  en(n(A-`p= P 奭@VPp PmP0D @S= O 0V  @*`ЍA50CG-GML000RP00$0 0  Gߍn(p@-)WX@P0`y&@0U<h 0U`00 0p@z(GGy;>!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ]$Ѝw(Gw(8o(%t(p@-@`TP000T 00CS0p,00Spp@Ь@n(n(s@-P@T@ aPP0 P00Ѝp@n` OP 0 @tg00000 00PЍpX z(GA-PpU`A0  %0%@TP@ {0@00`z( @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =@@ o(C-pP@0聟rS``PW! 100S T! 0  ЍC]nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000  h9@0 L 1@  !W P ʫ|Uw(GGs@- P`?@P 0 Q   00 00CS000S ЍpQ     R T0000   $ 0 $n(n(D A-`pĀ@TP0U0   $9$0S R   0 02/0 j$00 0000z(%%A-p`P@P 0`0PPEPvT` eTp` fTxTp`X @V R@Hw(PP@-   WHC-p000P0`-S㸁@TQ l@ 0@00`0CS0Vl10SR ЍC躪 Y@P=ᑹP ~0 @0 00  0 00 00000  0  RP 00 00=S Tt0T 10=S010C0 0P00 Ѝn(z(%%n(  {(p@-@PTpt@p@-۴P@`P \rNP@ xP@ IP@P(P0 P pUHH6Hw(00@/ 0S0@/s@-@0 0 P`0S 0"S U1r0!l%*0S`0T)000 @0C?o2R0SЍpH&H@-M@ SP ލSP@D 0RQH0PP0@-M@ SP ލSP@D0 SPH0PP0@-M@ fSP ލ^SP0RP 0RPA-@`tSPI0 0SC PSUA SPPPlpRPJ! 0RA"@- 0-RS# 0S0 00tF Ѝ0SX0 0P0S00 040,P$  H 0@-0P!S@M0SPЍ0P{ 0SxPUo U U 2Po U RP? RPPEUR ,<L\l P  P  P  P  P  P  P P p0St00@RT @)R0(S0)S0 0qop@-@`P(P} 0Sz00CSt 0@@@@Dp#oopPP0`@,TV%@`!VT`@V@`@ P`@P`@V@)Fch0S0!SPpp(S0)S0S pp@-@PPPEP.U)  ,@0op=Pp0\0!S0P p(S0)S0S ۧpcGHH@-(0Bާ%I%@-$0$0 00 Ч8o(%GI@- @n R1P\ * اЍIO-@`@M "T0pD P-R lRC 5R -R| `N@P{2 000E @PppGWP PW pGP〢倲PE0%S``PX嶧pW ;sR R`6pTP`2奧PU W@1 000 PPP@U aDP@ 1 Np NP lRh90X@P 4N@P0S0Sp@Np|0 0 ᷼ `X0 R P!q *S0e 0R dS 9 Opv   TTTsOo(& I JI%ILU/ 9+J 0@-DMi0   0@@DPU#N@0 D   dP0P x, pp LdDЍ0=GP o(J(?p;p@-酧00S 0| 0x 0p0p p@0   PU P@P0P H0H P pp Ppn(o(o( x(%Hx( %%%%%p@-@.0@倳 0 0@0PU@0002A d0 R 00CS0H00S p@^@C0PC,o(%Dt(%n(pz(n(P/p@-@PTp000@p@-@PXPX`Q P 0Ѝp@i>00 d> PM MMO-Mp:ヮPc0䁟䑟䡟00SЍM@P 0S =iPP oc00  qc[h)P 00 Ta4i[DP 00 ,P jq 0$0l[ P 0 0o[ P 00 P Kq 0(0 `Q 0 SP00CSH 5q0 0 0SM ,NN0N 6N=NCN0K00M00P0D0 0C0D080;800,0/(<0Q00<008 ,0,,8 /@0D 9K<@0(080$00= 0D00<00,0/+$@啸0@-0$ 0d8 Ѝ@-@4(000@-@4 000@-@(0(S00 0H0,0Ѝ`t p@-@GPPR롤뒥8吥<厥@匥GPD[`∥U\傥`, 8F` GV0,0p@-@48]0,0@-@48@0,0&*= } @-8y@"=7c( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8<@0<<@00,0@-$ 'HP 4b ЍtJN@-HP'bnt SN@-HPbot ]Np@-0MP`0@-S00(00P0 0  P:P 0( RT  0 0 S40(J03/Ѝp= fNLA-@`PpQP-U@QᒷP00  PჷP 0-U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp p@-$@P0S <00Pp|(Q+  0 BR@- ; M| 0- BS^0@Q ^ 40 ? 0 C  / /᧭|(|(Mp@-hP@`V P<p舵`HV4<,;;0|(q# C-MPp`M@8T H;V@P ; @$       @     T  | p d X@<  Hy <u@ 0q $m i  e a ] YU Q M@D@ <$A 7t@  < S S  SH  D6 C"VyP   W        @uą0ST  GlE;" :X@ t:@W `:t @ Dx8l ,` TL@4(@  T4 @QV \ T@Dt8 0d| \ x Lt  @p8l(h d`3[@V RNJ FD|B@l 0@:TY :Vl2<08 *(@@V  S W   2VxApr`VЍ00 d9 @V   Q  90넑0l  @t9 Tl@ pfOOOOOOOOOOOP PPP$P,P4P?PGPNPVP]PcPjPpPwPPPPPPPPPPP OVOPPPPPP^O QwOOOOOOOOOOOOOOPPP#P+P3P5OFPOPUP\PdPiPqPxPPPPP>OPPPPPGOOOPFONOO OOPPPPPP]OQQ@-* : 7Qț&@-,0, P 0 0 :6|(:Qț&Qs@-@`,000 #S@P!0S  0q^00S 0 a^Ѝp#R0S/#Sp@-@,P$p0P 00p|(: @-PRP@ p`p 0R" Ѝ0"S0SO 00SS  00@Oꔢ&@-TPL0 p@0"S ^ЍoR|(R@-TPL0 p@0"S]ЍR|(Rp@-h@P0S 0S 0SS <<< U   S(000P 0p|(w\Rp@-Px@Q d]zP L0   P    pp@ @ R|(0@-@PPM 0SLED00Ѝ000 0>P0 0 S}(SO-Pp`PM 0S<!;$ ,] P 0S ߍPꃯ0Q 0S @s?0P P@ P@0 ST WpU: 0S  H 09/PV` 0`|(0SFSUgSS@-÷0S S S8 4 ЍS$ ЍDT#SSlT7@-lP$ R\\;@ H$0S p (\ \ Ѝ0|(T(TUp@-@P 0Sp@0PS 0P000Sp8U@-EPD@D D`DpD0S 5008 ;UBUț&|C-P`PM 0SG00(p/p0 AP" @/Q `0p0@1P T0p 'PH$0@@ 00Ѝ S}(|(PUG-@0X T7 HRD2D1H#<7( 4 7, (70 78 74 7#4R! 7!4S 7!4S 7!4S h7!4S L7p!P0S t07T!T0S \~7p(HP8W IЍG蠨0S. a`` u 0b7 0 ]70US !S|  !3 \P70US:3 0U  $B7 0t=7pPmUp& ܖVUUUUUhUU(UUUUUUBBUV VV- (O-Q ,@QlQP0QT 4QP@DPQ,>80S,00 80<0S804 <0P<,PP<%P1 QB"9`㤱8X0apS pR   <0RXP 00< S4P0S9`(Q (Q @P0S0 BS `a 0h R  R* P*da (Z#V2VCVVVhVVV|( WWWWVVAWXO-;$M p*bP 0$S  ߍS P@T[D@P 늤40 婫X ZS' ("$0f0Qf/ ja,2!S!R !SS0䡟1,21S 1a(!"$a$"R R P@0 0꘡1Q#>00 Q,2,"b"!4b4# S 0 Hp)#> 0"448#8 R* 0S 0pjX P 0S 0 p1Sq j3  @51S jQ f/ j01T T %Hl (|(.XUXVEW}}%XWEV(}XXXY~(p&A-P@p%P` %R 0R000005Sw D $0f0Q $Y  |((1Y}(p@-0@kP  P$p@a$0@-0S ,P|(@-P  }(O-@:P,kCM M00 8uP( 8BP008⸿80p0SP :ᒤP  N@00 堿Y x NP 1(p Xi p@ @P$4 X p: 0 $0%P$0S  $02P P pGGqrP,圙圩$ pW 0S$00k P$00 P$00$0 P$00   @P pWa 0SY] 0 0$0P @2 8$ 1\ t$ gP( $0S  S;Ƒ8@0;RZ(( P  %堮P 嗮 P0 0$0P$0S ++RP0 0 p |{ P 0 0$0gP$0T0 <j P 0 0$0VP$0`0 Y P 0 0$0EP$0X0 H P 0 0$04P$0\0 |7P l2P 0 0$0P$0d0 ( P  50$0 P$07  P  l50$0P$07 { P  (50$0P$07r jd P  40$0P$07a Y$ۭ P 0 0$0P$0x0P Hʭ P 0 0$0P$0|0? 780aJ0S0S  |P0X: `X0 H0I070t 0 ST 7 . 2Z/ \Խ0S 1 #0Գ000S05 0  3000"0$0 0 0 $0]P T@$0!S DL@J0$0|2$ 2 ,@@pCލ Ѝ0S 0ū  QP0 P0!A"A寫0S 0崡0S 0C RS񟗚lTblTbTbXmTblTbTbmTbTbTbTbl HO0S0 0S Pz  0$S _o 0 S Pe ~ 0$S~ Jt 0STsl 0 Sk PI b 0$Sb .>W |(bY8US T fYiiiYYY}(YY }(i(}(YYZ!Z2ZZBZPZ]ZaZlZvZZZZZZ}( &Z-[Ss@-`0PU V  PEL@P hgЍp`PD!Z 00ҟ0@⣽V  \[P$00S <@-=00D%p@-@5S4 0PSP p@_Pp0S 5S 1S fV|Pp5S T \Pp< HPp.(( PpMV|(}(b[edArdA[s@- 1 AP(000(`;a5 S4 5S Pְ0S Ұ0S005S  Pt p0pP/"5S ЍpH DlP8 WEV|(fd[md[D%q}(gd[@-@P f/㛯@}( 0 ID%܂(md0S/!  -3@-PT P 0S S@@ <P@Ѝ0@ Ѝ/&p@-4@4PQ|?p@`l0 i0 @L%NbUb@-t@t0MQh  `P0cS CS SS 4勼sS00ۍ0(+Ztbb0@-MM@` PP 00YSP ,iۍЍ0nPbbb 0 괂(p&@-@M0 vP  ۍb{p@-@$P  0p@ op&~(( @-YMM@p p\YލЍ<0< S <fCPژ10YS<0<0/rdAb c6c@-PM`p]@(]^^j^`8]!_b^ N/ЍMc@-P0@ 0$S0SA 70`Sp7 TQ,BQQ,Yt10S+ 8@0 ٨ 000!C0ASvvvvTwvvvvv4wvvvvv vtwc0A Rb/`/ Ѝ8] 0\` 0V``(p] 0` X0G` L0 80?` ,0 07` 0(acpc@@-\@\0MQP  HP 0nS yS0 $T00ۍ(Xq&ccP `00CS`0p S00 P0S X0X /XI0&G-P 0p`0I@P %T.pG`T@Y @ 0@;HsPp E7p〠 0  a~ U <`V `` X6 Ѝc|tp&O-@M MhP`ںX%XTuTT0S0#!pD P ⅩP o P'p0 p( P   NTt`(p P  aP `R.ZP<608 Tt`( p P  aP ..0(0Ss`, p P  saP .0,0xSXs`0 tp P  \aP 4.000$Sr`8 ]p P  EaP -080Rr`4 Fp P  .aP l-040xRDr`< /p~ P  aP -0<0 Rq`$pg P  aP -04Qq`$pP P  `P -04xQ`$p: P  `P 8w-04(Qp`P p# P  `P `-0P0P|p`T P  `P J-0T0ۍ Ѝc~(p& dD dCdVd rd-ddddd e2eQeseeeeef>f^ffffffO-M@ M[p PS `V30S0`S<P`P8apEbWWnF`0E `F 8ġ됳0A"S0#1` pVp P( ATPD#" 88_ ʧP0S  3/ PA P ,ࠐRx%.A p P" 4SA4`S>;4`P92a0C" 20< S :A(,"YA,x5|%.A  p` P0 x5< A B0qpAm,A 0Q<0PAHx[0x5< 0RA | P 0 000S P0`p崀(V R s S 0 00 0`PX,ލ Ѝg+gL% 6gD Mgggigghg+h(p&(Ch - BR0 R F-A-P@, R1!, 0,0 ,X0 X0 pX0 \ M( Hs,, <o,0 0k,8 $g,4 c,< _,$[,$W,$S,$O,P K,T G,R0p 1R0S*0X`p\PQ 4,Vl=A]i| [niiiiiiiiiijj+j>jGjWjfjxjjjz  O-pᔀ 2MSR R@`aX 8QU ,[R 0N0 H  ᭥0@" * 8 9,  2 ᗥ`@04" * $ 0+ !R21` + 0S 0C RjSgx̉x̉̉̉x̉̉̉̉̉̉x  1 0 0p+8QI TT +<0P+8ߥQ* 8 0A0< @}+2<0P+8ťQ *ЍOw0 0 0 0pZ+ dU+8 T ЍO"Ѝjj| jjj(jOk\k|k"k5kGkA-@Pp(D4+<?`8SA[ 0`bkrk 0`( "4`#/A-P@ "440 "440 B >((,,004488<$<"444$D"444$D"444$P"444$"444$`"444PTTXlpXQl`pQ("448("448P`0@`V@  |0TP0A0T0A T"440A}(@-@l40Pm087f/ṨWEV@-@LP TP8#!00Q@WEV}(80@-0@S B08f/㏨~( 0\ P0//@-XL0 D?*<<J8@8P(` R.' 00*kț&k%oP7@-@ PTlP0 08P8 04p0 N Ѝ0(vdq0@?o2P0S@- p`PE@P @P ;P 6P@V@l-PH@T@T S4p0 4^N@@ ЍYmk(udq0@-PM xdP@` 34p D?N 0 4(00+ +(Ѝ0(zd@klls@-@ 4p N0  (0 (0`P   (0   (0  h(0  P(0  8(Ѝp(td@ElRlill@l(lllmAm( p@-@PM`P5 3p  ( )V V d(PЍp (⚓H( 3p 0M 0j((}d(@oma~d(mm0@-PM @ yP 8M4P 0z3p0 MЍ0m({dЀqC-`0@Pp!匁匑,M00 p0SP@TTA  O3p  0[MeP qP p` $0Q 00S*@P 9MQV'W %V 0Y R00'tP 0S,Ѝ00* *  '`@,-Ȕ&m(|dmmn̍(J-n>n@-P$M /@P 2p pL1P' 0P, 8>0P 0 kJ0P 0PC 0Pp@_zp@ 0x%Y@d%p@U@@HxPptcidyararrbmngnts_J #r0D S/ 3C5C$1 4! 8<0/(0@-4A QU0&Q  „?/.01 ^ L043c 0P0Q  „?/.3@01 24@5 ̎ @( 213/P/(A-PT0p(,`@ဟ,0T@@DA??@(?0@-0@0 (20,20㷝0P!P30(> 0R//G-`0(,Bp P᚝ EG@PP=$W ,20CS(20CS G.$0(ssp@-@`42SM%^ $ E 82<"@$ 0(2,"$Ѝp@ $$D<"82E@d#`7,"(20@#X"\4Ѝp@#(&st+tRt`tjttt uaus@-P`£  0SЍp00S@ᱣ0"S1Ds@-$M℣@>00  0 0b$Z!(uț&A-`P 0p @TʬH /,s 0d  ? șqp  RЍA+-L`(-0S`@D@,d Ѝ&,xBx(A-0ppP@`phG!14P S H d" R S R 0 <A2ό_xU(}xp@-4@P0S( ١0B1p(O-PTM0$ (00#,0x0@08030匠s0<080S: (2,3`Fg(0,4 0^40D$04 @?S$0 0L$0  00 C@ D00"bd"P H$0( 00,0 " 0 RL0 $R0 S t2000#1-R0" 8LL`P@4!x0P00S ᳈P  孈P  姈P% L`0L00 S? 0g2< t"jE%KUP1f?C$5\"0˛P@\2S@0x0@XRx0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (0 0,00 0h=" @$PTЍ P @~x(&xX(&=x8U&PH yyy0y-s@-@ "00CS0 YP` Pp pp?G0 P00CS0nY0 Y@oЍp@Ѝ/&Ty=O-a0 pGPp/B$0e@O 0 qp Ѝ  R ЍOL+t`g+0S 0 qp `BE, 3+0S &Zy(p@-@P2S 0p`n/(2僠1!41#41U &"U 80U p@@PC @$@Tp(h((G-r@,<<`P F` VPmYTLE J$,U 0V!U ! [E@s_Ps 2X2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@t000(cA-\P@PAds 2F՟ t B B$ 00C0(O-Q40 Ѝp0QSP LaXR XF0 pQ 0>80Ԣ #ZYPPUJ0U @DQ ČUȌ̌X L X0PZ 80S 0sPU*‘ ry(yyO-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q 32 $450 (, T02Sx Y< ЍP P倰[R21 RS$ [0 0 2S Y lPOEY 200p@`p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$00C0@@PAy`d1S  14P8 <   00P2S. Y  a14a8a<0#d1a#h#0)S Z0)S R0 Q !PB00 0s0<   0S8&(i{t r{({&{{{{{$}F}*|\{H{D|L|l|U||}|zC||A-4RUP@P@DЍp(0PPPB1P@TaTaTS <ЍAA0?!14!8!< 41 11p& 1!1!1<0  11 ?0 1!1<0d  1P 1@?0ЍA(_(N}^}m}~}}}}}}}}O-0P4MpE``d,0 q 0Sၤ0od\,("/op" R 4 0 0  ( [ 0[䒑 Yy @ `D pH L( @P 0d0h0l 0XS T0@Pt˟( ppPppW;0} @P8 21S /0.3p00102044p58<0 TTpQ4 R:HL"T /"R, 嗨4Ѝ0(2o0h(0}H 0 (v 0 (m wpUt  @D H L(@P0PXB(@ Xv  0 `d0h0l9@`V2SjW 0l !? 49 r,pi  R    0$  $  0 0@PPT0p V0S P8`@V 0PS$0 @0v 000 U 0S@8Xb\" 0SR ` 00 RV0P@0 0z P`@,p0S{ 0 00@7P2S W[: @P@~  -v 0@ pR,'0Q0Z08!2 @PSppaQ $ 0s ^A$ D 0 H L@   @P0|21S  "/0.0010T0 3p2044p5 8<0 T @P @P2Sp 0 00@P52S WC[ @P@ 0S7 2S H"%>0 $00 0S- 1S*  W000P$  00SW0!14!8!<!14!8!<W p$ $PLPD(P0 S( 21S$ / .0$40 81 <W S  PW 32 $45(, W\ 00$0`@P`3"Rq2S0 h?0 00@ P 40 00@ PWS (00D#$0 #(#< 0&4 0&80&< 0 0p `xR0 @2Sc BT0cp%P[ 0 1<Ap 04@@,2`0C 0 0@@(2 00p ? 0@@pp0`Fa ??`1`<A` 0@@,2`0C 0d0@@(2 00 <0@@? `Fa?`?``0S 2S@ @TJ041S0Sd 0s PX2 0 RS  0A04o(I(_ ~M~(@([~ a~.~#~~~~~~~O-HBp42MgS0٥P(r(b42S 0P*U42S 0S PqЁ 42RSfP:履42S]1!$1(1,ЍOd0Sd SZ^` d04兤Y2S HL` ` ؠ0)P8"PR S.0SЍOe+@ D0ЍOSP 0Ѝ(j(PV]6r@-0@M0@ pp`PLpߍ\ ؗ0  0uP \ ၗt02S 0S " `P D!SR ׽0PzA2(0@-Xa0 0LAP d2S8 #P(!p! 2SP0U0 $pt"u Rp\EU$pg0 00P d2SP #P@W Ѝ0P0!!1 &(md[(?vh(aA-@T2 @PQP LP GP@ `p@T 00S p`V@2PD00S @@%@P1kh(&A-Pp`'@''000 0@@@A-@pT` ᄑၑPP'0@ @'@tG-M0h4 P@ TPD ےP @ 0ՒP(4 00(0 4QT(0 ,0'4@ 0#_0@,0S @@((@`@,0s0000CP倃0P>PP0 !01P,30  ,3Q #  c0T0< @"p@8 PA ,0S ,< 00S< 00@ $hPI&0FSʆ`N'P0S -S@= zP00@@P(,0S ,^A0 \P +8800  %0 R00S' V"410XAXQXa400C0 C;0S0S0S0S C 0S C CC$0#4 ܍p PS Ph((^ 9y Xq! ~17& rI q0/\(0/\(0/\(-@-$@  * +Mț&G-P`p႖@0S  0S X| U :T|Y0S 30S8@ l\(.C2-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @;!PPݍ Ѝl!rp@P=0LLD@rO!!P,0: S0RP00 0+PP !P81: S  S U r+PPg6d6P%PPPU r#PP @P\( l(#<@-G0P  0 00T$Ѝ  KYl(h0@-4S 3/ \(@-酕0 @(  0$y@ \(@-s@ki@@-p PL`@@0 7/P0 S Ѝ k00(O- MM06@  @  @ 0p$000 (06P(LL9@ ܍Ѝp 03/0P0   #P @$0PS )(0SDUIM5`P 0 W U euX0YpY 0 `  W ;p[ 0S $P % 5 e@uUT \ 0@W0SU 000 !00S# 0S,aQoQ00CS0"J@ T 00CS0!J P @YT Y@DOoB 0Q  K @OoB\ 0 @0  0 0 SNT(&p&Xq&0@-M 03s0c00@S oPP* R!PP<] 00@   0PS PQ `Ѝ0S 0S 0S\0S\  0/@ \0Sp 0@0 @Dvp 0S0S @g0S  @"  @0StΞ @D HP@ @0 @ `!0xP|"%#   T`    P @@``a/ ] x Zp h 0 @`((( =SuȘ 7iG-0@  0PP 0S< 0  Q*a  jPPZ   0`P f pЍ!URQ PB l ┐0 p H0 0W40p VP , 0Q0   040 04!$0 !0  0( 1 0, X0`P`  PD 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0pχ00 QP   / 0P 2nP |y,npP1S1S1US1S 3S3S3US3S,  pP0p* p2 02 121300p0Ⴧ00 QP  7   0Pp00S1<01@040  0_40  QP   0PA0O A0  mP 4W ԡ 0R  N eYX`V P0E^ 06#++R`HX8 $0S,0,  RT0CAD0"P#10P  0QL \0   0P 00P00h00l0dd@DÙݙ!=_{x RRaArrAaUߚ7Zr@-p@`P P00 P0ᯆ 00QP  Ѝ 0P< !@ !0 P0ᑆ 00QP 4 0PD_@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  k ,zP000,=&`G-Xp` P@2P W Ѝ0!0 0#XY DF pX0 X0 PiO-@,M0p@l@$0`P PprP$P H@,Ѝ V0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 S 0 Q q 8( $ 0L $ P 20 2 p(p,"  @ "  p@! P0@ S  2"!"0  0@pꛜݜ.0P s s// /6:~O-`@PpMP0S Ѝ X  H r0A D00 s/ r qh  \*P0p@P q x0 ` P 0 00  P 0 00 ` P s0 `P pP0 0 P`8P Ax uʝ2FžR0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0`O- p`0P\PPX $P  qQ0 0\Q@T(2 R@0 P" R S C0BTX t0D s  3 0 TX  R 0 0 p pP YP  L BPTR2 Q PE+eٟO-X`0pM@PP`Ѝ $0Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/KP 5  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0!  0;0 QP \ }PiG-@P`p,P0S 00S <0s+@qa$0S  0S 0S,0 ( 0  `0S"P  S`pl S HDpP@ q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hPP0P Wp0RQ@0,agx zWx@-?`XP\@#@3P@T@TpW @@T`L (O-P@H@M18p p00TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ0 0 0D Q P P0 W:0 0 01 Q P PLR 0 rP<0T 0qB (ݠĠO-M@L0Sp<`@DH S!-P PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:O} ( A-@/pp0%B?[`0S 0ES PC pp@@0T?  C0 (0 PK %/ (O-p 1cMW, 01 SP0 S@0Pp(0@@D0 0$04@|D0' R$ X0`1#b#000<< 0,00s<00 QP cߍ0P@4p(0@pD0 0$00 C``02#  ,PV002800aL0`FL08 SD00S   80< 2800,0001<00 QP  (1 0H 0  RR R0(104D0L0 `0L0C < *9P.  (10(11  J  , 4 0B0 D0P 0D S140S  ZI@(1  0I0@;+ 4 P(10(10@4 40 0S_ 0@ H /o@0(0"s R$ 00P p, 00(00$0@0S@0! 0C@0 0@ 㓲"X 0X  PP  :X R: U$0p 00pP0 4n U/0 00pPd(@\Q UpW$     Pp PK/\Ј g0x!P0p00pq P$ b QQ#hQh  0 U P p$pp000 0000 ,p@Pp0S*0  Q .b A0 b @ @ bρ LG?@@0Cs PQ*W w 04L |1r 8 <|1 0W4 8 <1t0U`0  0\|xQ1PP|!R \  P PPL0sPP|!70I|1@|Qx1U0P U* SR   1S \ldP@ 0I 0000@14hkPP 1|!RJ PP 1@]300 0Q (0R| U$0p 00pPt, udt000U\`0) 0$ (\T P0000T 0 00P0 00 ,E@W 0$ Se1Sb I_1 S0(0YRhP0S 0Sl \d|RR P0S02S 0S0SV 0\2SJ\E|!2xQP >PPx 00I@ s 1 |1P 'P$P PPPPPPL0Is0PP@1@S!U @[Sh✃P=PU p|1WS P@ |qppL0Ispp@P !SP| t<PP 0 1|10|1#40L0s_?00010PP$ K/\CPP05P 5P0h00h0Fd 0ES:\P P|!d1HrH"HP :0 @0|12PPp818 ,80PI 02S0P0 S0 U$0 P 0c000 000 000 ,@ D00S< 0,00~<00 QP80,R0 ^PI Pd01S\+0!X&P %4QIP0%8%\0 P@i (Ġݠ ` (ۡ9.h oQe}͢8e G- p@r W pP\aPP Pp $PK/D08QP0Q:" 0PS00  Q pJxPh`P 80"8 R 00 05 !$x ('KoDp@-@5%SQ%  5%QPR 5UUQQp  0Q   0Q0  (A-lP`5p{@ @ 0% Ņk@ŕ\ (O-POMp0P* b5S 5唢@TE  ⶁP@ ET XT 5d 50 ! S$5"R$%P0SOߍdP  RR @`0d B2" 0| JQP d d0P Eh0K/0h0 0 @!,qr0d  01(C  j   ,10,1#40L0sK?000/1001001#40>000310 00 000T0 Ce|(%,5QP Hd d0P H (P(fRv @-@ P 0 5 (0/P(0/P(0/P(-@-$@   {ț&G-P`p҅@0S  0S X| ;U TY0S 0S@ gP(.C2-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  8C-@M Mq` @PPݍ Ѝl!rp@P=0LLD@rOqP,0: S0RP00 0VPP UP81: S  S U riPP%%P%PPPU rPP @PP( `(#<@-e60P  0 00$Ѝ  Y`(h0@-4S 3/ *P(@-Մ0 @(p 0$^Ʉ@ P(@-Ä@M[QN비@G-`MMP@p`PR0 `: SW/uw0P  rR 00A 0C @H#Gq"@ V& 0S UP0P帐`0PPJ0: S,^0"'P@PTP&P uP  {PP @u3M`@ S @ S @PPZ PPn UD e- @+S R UJPXp!t0#:PU00`P00D!  @P2  HP0S `X ) P4P 0 *PP W80% ܍ЍznxPUz fpUv TrU 긥 FΥF F@ 0`( "4`#/ p@-"440 @"440 P"440 "440d $(0 $(⊂ XXↂddhhllppttp p@-"440 P"440 @ dddDDd@@dHHdLLPPTTXX\|`\ `4p` p0 p@+p@-`@"QUpf@p@-@Pgdddad^dpA-P@M4Q->COd->CBX?X\<\99>>d9>:>C9d?n:>CF4d 0? AC>+d}C>G&dmF"dEnFdE~Gd 0X J~XpW  $$((,S>,c}S>GcmFcHHLLPPTTXX\\O-P ! "441!"441 $$((,@,0`Pp0Q࡟\5 S L5sp`PҀ0,$ $Q p W thvTrTpXnX\j\`g`dddhah`l]lpZptWtxTxZc0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P̈X <00!Ч8 %8 !(0 40(0,0 R0(<0 (0Ṣг { 0 $ R {  000  S:0 0P00 C c9à30S00  S8%0@%0L  (0Sw bI z$20Sg 0 0 0 000$? 0 6@ptP 0 uU` p 01S0 $400(!(( x(o? khn4k( h(g,0 R0(40O8L @  H nb! 0bM0P000 ʏR0T A'' 0'2 P/,P)8 $t2 t0 _1( @(  Ph@h`(L6(x(<(&N0(bn(O-M`@ ) P0I: 0 @0P40$? 0 ;62  BQ p{("(qsQ<042,0 S000#000 wD2pQ 04  0R  @PЍ( 0a  0 4 Y: |10S<000D0z`&2 `0 0a 020S 20S 0[` `$110010S ?p1p1000 . *d<(x((&((O-@PFM M X `yp: 0 5 R|"0hSD 0S00  000S Fލ Ѝ$*00 10000 0~4 H0pT00X0400!0S \`  " p$0 0[h~"`.P P4 p\t4y"0S$ L000 0s HP #0000S Ɔ0  0v.P0K 0 8 s@ o  0 0S r \  P1 "d.P Ѐᴢ L000O0 H I { 0-0X0|2 0J0  000r00S$c 2j0 0H 0Hh [ Z0# 030C  4 S 00403P!9p1 0>s 0:s0  k000C0 0 S <   0 0001    t0000 0 !0vs  0 00S gꊥCu0(((&$g¦(( `(8tlo`wG-P`M@HXpAZ 10S t10S 00 0N P<ЍG(@PEU> 1 RP1H W0  P!`0 HG0S$00S U  0S s0S G 0@ЍGfX7-P H0 ЍU8(0(D((&C˧ק( 0`( "4`#/p@-LP@088200@ 00 !/0@0 wp<(00S 4 /( 00S/( 00S/Z(P000R0SO-`02@ RPMgD R0R0`ď080S  C/ S ! R 0C00 0@ἰ? 0qp\5h!S 0 00Ϯ0 ?@U '  ϬR7 R  0w \5S0 0/070/0 0 bЍ  [ T R  P0P0 0<00I/h(<(4(T)IbP0O-@P:1 R0* 0똑嘡0 `P3Qx 0 T B:\500 \q00,"1p R 0 0 !Ž p 0>q`0 C c00p0S   0 .0x 0#q T0 0x 0q400,00S Ѝ`((<(T((O-0p#M PQ P* D'PW0k:, `\5 00 p00O,"2@ R 0 0 !Ž @x 0p`0 C c00 d0@Hb CC cA30B$ 0Q,040(0PÏP0 8@,10S 18P0XpC9 ȡPWEʸ0 8,80<01p!0<S0<0<0Ѝ U8  P\EYXEEVXkRX U00KX0 S0TP0S<0ذ(?0WTE4U  P 0R0SE ?Z0:P0EU 000Q(<(T((((((G-1P 0p` p   0<0@ 0S 0 0 80PS `P` 8UH0ZP000PS q`4qQ$,$ (,`(PP8<(ʨ((@-@8P 080(G-衟0PSN 1p00 B?o PCP` 0@`8@Px1 ?o`10A0I00 00 0 V0 (pp1 p#",`(p ( W Vp`0PQ'd0SP 1@0  XPP00Ϡ^P0d000 A(<((((((P0p@- P?@9o800P 0 c!SRp((5p@-X`0SpL0LP0@1CA0SYW000pQ((( 00 /(O-H0MSPp` M 003/ ލ Ѝ30 Pᴣ00 +0G00@0 tp0 ¯ S 0V  0n0W0H3p!0S& 83Q2Qe *"0  10 V 0[0 02M+ 2R2 t R:X;000TP  $$+P"1 Q    Qt Qʤ1 +!!0Q3 !03H0 0C?oR20SF <1B 8  +B$(P4 P R& P  P 0S 03/     0P  0`V bx8<((((D(Lm(0O-S0 00㨄RM`PV@#M( ( , : S \ \p$(5R<R ,P  RSV 0 0h0S  MsV ,Est0 PB?m0`p 00p0S 00W Z 8ő @5D0LT 0 a31 Q>P  10@(Pp 00 p4000?000S* A0 0000 0 @0S$p0Yl 0 `00P $ 0 00000 $~hQ(<(Ϊ@-&n  ț&s@-@P `0S 0S 0 |Ѝp}O-xEM` MP0S 0S Hp P 0Sލ Ѝ 000S  P `0S 0S 0S >0S} 0Sx 0Sdv0SP.0S 0S0 08Sd s/2#' 00 " " 0D@?!? 00? 0g 0 gd!! 0g0 lpP0SS "04 0 R0  0"? 0 , R*( ,4ï0A18 ?S%78P0<P0Q R0" |o0S ljhbPUt "@0S H_Db@PUn ,V0SP@PPDPpH0S  `8Cn* lmSxl%|0S ll@0p00S0P0/% 0,0UA:000S 0S P H1 H0S 0S,0S P  2P   000(^P 0St P PP nP0(Ϋ&ImѬ -wc8( >O-H0PSp`M W0R0: P p`0"E,"0 S n20SQ xЍ@ 0Աԡ 0 000CSY?00 1> R. P!\!0  S P  P (  . 80< 0 @80< `P0 W P 0 @$0 S@ `00 R 0SQ Q\ 0 (00(J|(t(#_X((yV@(00S 4 /(00S0`( "4`#/( 00S/1M(O-M,M1@"@ pW0,$ :00`SHW ` pHP( HXP 0 00 0؍,Ѝ:00 (gHP  pXaHXPh0S  0D k@ P c0S, j ; ; Z  W 054%00! ?0S S :00/0S 0 S :V00#03  R00S l:0S7  0X c2P: 0S R< kP0@S0z4`Ə5 K)Q9000 B?dpQP%90S  0 / 0 0 L 07P 090S, jTP09 SPp0 SYQ980S5  V0;R00*h0S- 8((d0 #0 (P fd80S (0 0x0` @ ((P70Sh0 0! 7'(5SW/V S:'<V  3 #\  RHSQ; 0 0B D U0$00(p aL7 UPP0vX ZwPe P'000z@ 0PP6CPy"#h0SPp%Q_'qQ PpQ^q U0 EpPQ Ppt A?7#Rp 10S0AL 0( E Z$0S 1000S 50S $0S 0#  't ?uc$0S 1000S 50S $0S  <  10S0ꊡ  0_000 04 0 S0 0 00 0 0h$0000 #600SH40S l4 PP @pt3000 00S1 LPX00 H00SS9 0S 30S2 \P&  0HJDP  2 prLtoPd62 0\00Q&&0: @000S828040/<0a0#PQ8`\@P 1P0H0800AcPa`ppPU0\(85  @5D0L 0T b32 R((((P(VEmp(t(((ְ1O-@,6,(Ɵ(|MP,0S%40A,HDLdP T0AX  0g5 $00P娥  0@, R<5@|Ѝ 1o\%v' R  `  0p`oQ0P  0_S /  p!.p{0pP?00 1> p'@ `글n|$\5Sc%Ϡ<# pD ?(0 gD40S<40W SW ,4,t`V0`@0x@S d0, {b 0 0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0X30qA101[S>  0(A 0 Ń># 0S  !0S\000 T@T`V T0?  @`@T` 1 0X20qA000PͿ0P0$W= !.f0 00 pS ;*00p0 VTX0 @ PX`` @W0`3V5 R 01<`7: R 0@ 0 00   0K0 TR 1VS0` 0P   W@*  A 0e 00(<(T|(DX(P((((((p(Wț&0(D(U ((ұO-` @ 0Mp̰̐ 0 0  BRЍ PP U QP |` @ pQ RP Q @p(t(# 0`( "4`#/O-dMX Ze0PpP0P1P 0L1L H1 0,0SdЍ0S @d0,` a0 `H00@ట 0D RpT0 :H`P 0RA0 ST TX 0S @PptS8<(@(p((ț&(( 0000@/00S 4 /(00S0`( "4`#/( 00S/pG(O-LM`PV`@@M,:0S 0P *S *`0080< 010S y0  aP0 X P ) P9`0S 0S T)D P00 ,9 #R0p0,0S01000P(0 0!"4410< 000800$k0P@ ` \_W0@0C0N !  R1\ 10SK0T!  0d!S@1`0 ? )Y00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0 ؠ<0 Pp?<((T(((U v((|(@(X(00S0`( "4`#/(O-plMX ^2嘒嘢00,0SlЍ0S @d0,PY0 DDP000P0(@1 0 0 0DRpT0;:`1AQ \`X00X00@SRL Ը p\t`d`V %P 10S  0@P=P 00S  0_Q SR  00k Q  000 P  H 08D<(p(ț&((4(p('O-oMM@P`00 I]0|2H?0SX0S $5S$0SXPYX0S $XmX S Rܞf>`0Vd2 P\20+! `" d" B]00!X d"B1h21$\Pl2LΟ\0C00p21`t2QB1l2>V 2l20CL0=SLq Q\20B  0S 0 $5$> *[D>=0S ,0 0PS0 $5B111`R B- 100 S  $|0S%  0帀- 00$%BR0Ө`S<B11@%L0ዷPP H VD PN 0S  <Pt| *堀C`<T<0S 0 00\0 bA?L04<5A?X0 =<0T0.H0H\t; 0VHRQX0h0@ @04\8 84<ϠQ b{ S Q,0 S[?^ @,:P= ;0S @0 # "@0A!" !@0 ! @ @0| ! A_P: @ @@\0009|J*vCp: d:0S G0 0؍ߍ0<00<`/  `!.0i0S pd,W 0 PP 000^00/\<$5St2 ` 0h pp WS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D06P3 !D0 R  "0 0000 0 08P1  "X@b2*R@ 2,20S #0 0T20S _H 6P 2p"S\?"0STT< 6P VbP2 H @0"bST 2"TS\?<  @u0 0<30S 2@#S?d?0`#S\L w6P  -P 0#S\ 2#Sd2/?L c?E0 0$ppS $S00 S0`@$Sd2?/0?`$0S0\0000p`X 2R`嵟\ 0V $S`0?0$ 2Sh2/0^>00p`Y7 0%S0\000S7囡!"TpW`l嵏X7 0%S 0\000S7囡!pWO-P`@DDT('p " W @ɸθA-Q0 % C@*r`! 10" q0SU 10a&0  a*"?1t10S 0 0T 0@# 03A0S4 e@ 5*< 5>000S 0 0@TP`UA[t0Tp Pd0 0S L P<0 0S <(0((&(((Ӹ(80/(0/(0/(-@-$@  [ "ț&G-P`pWX@0S e 0S X|\ U TQY0S 0S X@ A(.C2-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @PPݍ Ѝl!rp@P=0LLD@rOP,0: S0RP00 0PP P81: S  S U rPP<9P%PPPU rPP @P( (#<@-0P  0 00)$Ѝ  Y(h0@-4S 3/ (@-ZW0 @( 0$VNW@ (@-HW@-VV>W@P/00@-0@S H@ 0(.C_0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPP  hP R 8 4 Q  0/TTT8 (((((T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/((T8 T 8(p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0<H3H3L3u/L3P3P3T3T3< <h p@H3p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0<H3H3L3u/L3P3P3T3T3< <EEP  <4K44K44h 4|< 5 5d0d00000P5P5H5H5 @ A S>S>h p@20 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//(O-|4M X hDhhdhP@quP:0 0p 0<&0&0P7p0p(60pw>0 P0p(2S# *NP *NP *.qVXZ hY 4[ 0SZ?관X V. 0wR  M <0\:P$V, Q3C ?L|PPe 2S|3%8 S20#"20$#20PC 2SB4$040404E`02P&V20A2\02@2 0M0C`*N `FbM 0| lLH  ?`0P4tT#0`P\`Q=S/0P 5` ( 2RV0 S0Skc 5*< 5 93 30S 0 0`20S 0#0 0R V 10S `2R\\0SD{2= C ,0"000 0t00Cpb&? p0("l `0S10S!0 R=S0S lD $000E p 0L%000P%X30,Pq *8, 10S 'S0 0(((,((x(((08)((U ٻ,STƼ1߼NgT4(ܺ7y3¾(tlֿ0(#Lq( h(|(`(`((((((((X=m d(((((<(((8(((((HV=SZ0SR  0\p<<00P%X30*70 |00S 0 00S5 0 >0S tPq 5*N> 0:#: 57(1u 10S p0 000S(PP0q0*71U 10S P|0 00<cQ0,zP 0r<0*7(25 20S 0\0 0倂0 RL%r0L%r0H00q" T 000cH00SPFPr*Y72 20S *0$# 0 00L40q"  400cL00SPs*17330S 0# 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*6d4\40S 0$ 0 04t R,5S0%45S R! t004e0SP*6$5v50S q0X% 0 00刅(0S xQ$ V0S< x 0(%0S8Pȅ*65I50S Dp0 & 0 08%<5HSR$ ( H00850<S_^P*q6660S B0& 0 0܆@%D5LSR$  L00@50DS6/P<*B6L7D70S 0' 0 0 7 70S ,帇 0R" 0Rz7 0SQ `@+PLX p N@ Tʰ8 @/  @!. A@O@@ P 5  aN,@$)P0 ( 8  Q DI ϠR 5l)p) x))pPW)pp \ 9 1 P, P'Qڨ0Q, D 0 0S }Pz*5:: :0S 5a0H* 0 00S [0S0QQ 0 0S KPz*^5::0S /0+ 0 0P ][0Sh W[0S Q[0S^Q  "Q  ?[0S&! 9[0SQL<Qk 1[0Svq +[0S0 %[0SH0085L0<0@5h<D ,5S0SP ,000<0,5<0(5H04e0/85L0l0<%/@5D%0*4<<0S 0 - 0 08=0S 4=L=0SHm*4T=jL=0S e0Mh 4=w P%L5s0SB B-000=0L50P5?T5V>X50$E- 0 0B0T ӣ1`R.B!!@tN00 00L 00*n4>>0S ?0. 0 0@P0 @DT@8 HLd Lc B 0b03"4@ `P Z( \?0S  8 H4L0d @ B b"30P?0S  0p00P6@ |6PpE h0d& 5000T60S 1S <HP ,6 $6 @Q V @ 0`P@@  04 8 <%c#!$c4"%S 50S TP 0 0 . ``0  0 04 8 Y0S 00 0 0 00   $)Y0S 0 0 000  0Y0S 0  0w000 0  0pX0S 0``&d``000  0`pX0S 0@000  0 1 1Q1Q,+ 0S A 5< 0!00!0!0)pCS #0p R0 !0B<8#80WP `P0Sᰥ0@᪥TP0 Qd \  E/ !0!X4 H!M((D((((((LBAL0(Mk1td4(x(((H(("N(ֿtl00S!4!: S *C   S D00S @-4 * R  S//(4(u|1A-0`S hdF@ TL! 0S<10S,$11 00 00Sp@=00CS0&P U 00CS0 P PYU `0 P0  0 0 SNU L0(V((8((&p&p@-PD0@0`S 5 07Pp0(VO-01 (1$100 ᝨP `p1 ` 叨P 0P  ` PPuP(r @ yPT00 [T ṥX ᵥ  ZP @@` 00((<(((`(O-P1$M0HϠ,"ˉ  p1P `0 @v I,@$T  0`P$Ѝ? 00 ?   P 0 0 0?QR0 0# Ϡ?D0  <`0@p 0((O-pM0P8 0PȀ`0Ϡ," 忥Z 0 Ѝ 0|x@Z ЍO9 ?  夥P  ? k0@`(x(s+C-P`U@ (1 U P0 PP0 0T2`p܀*0 L@D0T@S   8 H4Lđ0Ϭd @ B t b"31 }0S   0P00`0@T Ѝ(W(b(<((( 0S/A-@p dQ A0\ a2Pa00 SR P00@00 0` PЍ<(<(((@-0P@T@THd pL `l0p `̠V W @ 0 0 0P0@0@00 Ѝ`(<(p@-`P@XMX  # $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT4(((0 \P/Q/ Lœ0|   ,PŒPŃ ,*.TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S>  S*-3`30S 0P 0T`dSTS;Ps5PUU00Q AP 0S ??@@P`"hR0"00S8 lr003Pb0S* xB0S* 0R0E>0*X4- 2p610S 1]0 00SSXP10S |S 1TQ `1*`-X1` H10S 00 0H10S <ZS (1P 0*>-0`00S 0t 000S d0P`(  0 0G(((((((0(S<(((((((`(q((i (((4(<(O-PPMp8 R B@0S 02 ?Q00@aV`` 0[̑ YP  t \P  ?H < ? }0 iE2r0S0c Sc 0!S 3S 00? 0!0! !0!S`0 0 0` Ul!Ϡ0008 L3R 24  B # R#  B ` 0Q" P*V,0`0S `& ` `Ѝ0hS  j$  B$ $ R$  B  <(h(|(T((((U vX(((A-Pph0``ATR @P<[0S @ wD1p0A(80 0 1S/ 0S/(`0 5 /H0P 3S P 3S P///<(^FPO-0(P,0@4p8`h P P0P` 0S 0 S   000 00 00S 0 S P0 v0       H(<((Q 0`( "4`#/O-`@8 0P1 008Q ЍS@pd8Q Q 00$ 0pሀቐp 0` Rh L (  P/! 0 P  C1  1 @-` 80` R!   o/ 10#/C!000P/@-l 80` R!x!\!P!  /  /C! C!/! !/@-| 80` R,""!!  /  /C! C!/! !/@-e 8O-$5 SW@ lPphU00 `1X 0000$ p  @R ![ 10 <T+EP 1C0 2 @ @Dό R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RM@Xr PP X0P`H `tP P7   p C0S ģߍ<08 H(00,0 000040!04 04$0D0(0P WZ  pT hp* \X咎` 8 MB 4\t (t t t t 0,0|t0 xt *B p 0`?`a8SPb 0  0**0P0 . 0* Td@edAkzd@?qA-PMPp`;@ p@P  P06PU00 ## ݍG-`MMP@p`;PR0 `: SW/50P  rR B00A 0C @H#@ V& 0S UP0P帐`0PPJ0: S,^0"7@PTP&P =P  PP X@u3M`@ S @ Sj@PPZ sPPn 8UD e-Q@+S R UfPXp!t0#PU00`P00D!# -@P2  PaB0S5`X PP$0 PP W80% ܍ЍۜnٜPUz fќUv HTrU A긥 FΥF F@00S 4 /(00S0`( "4`#/(O-pX1`P10P0ʟ 0 Y; X 3#ˠ121@ R` 0K;P萟A00!R00S! *N% 0%#s(0!ZXl000Z T00 pp8P,0(<(P(20(d(H( 00S/"(O-,Mp0`P@ᄡ0V000,Ѝ00 ?U0$p$00 0000P$00S X00 ?:$000 0 P 8700ğ,^ 0P Q P )Q 1 $( 000KYq tYPl 3 4ЍLOPlJPX30S, t? v8^`$3P3Q,`Q0C,0(@,0h `PX,*0p ,0R0( 000V0A+J T2 Q,``!(@,0)P,`S00@ 0 `0B"30 ,0V(! 1 1S2? @10S J, 0R00 $00?000P. <k4P1,00 0(0$0$ ئ0,00 00(0 R  000 0`@0` 0$00S A :<(YT((0(Kk(^FF^((P(+d(O-1APQ P1a`3$MS0_ 1P11r00`00 0p.000P0@T <ԻPXpXT 000/ 0[P'0Ġ[@  0S 6J  FP PD0$Ѝ:<(A YT(H((@/C0(x(p@-P0 % .  @Q 0S pPi# #3 l0# #:>0 @w0SpP p<(^F0(VR/G-P `$ 0p6@V` 06@`` V`@&!D( `G-P 4`pC<0ȠX㉑ ,Ƞ ,4 ă Ƞt,Ƞd0 "% ?Ѝ0 :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-P5>UM 1 !  Z:0@`Spp `J 0 U 0 0n7Π ^ÌVQ 0V>  0P" G`p P b72 R0V1Q0V"0   P 0 P$ ` U P ``Ѝ J 0A-1àQ`P |0| ||:0@Sp࠱ P$` p@QL ࠁ PQ  } p@-@PaSl0l ll90C800S   0˖0080P4 PR*Sp0 1' , G2 ,0S/`0@-0@  L]H,婖0,0080S 0  90@虖T(^G; ,0@-S ,0, ,,9@TP @肖wN  O-dMPpU`@@ U0!@3 @#81S41@D2s2@Ds1@DS@D5@D0  0 00P˻ U0#03?b[[U^ `#0P00T5Q L尻O000 8DD 0XR @"!$"!L0<p(08p$0 0H(0 0 `,0`4  0 4$9HP 00 4Ph40  (00l"P  0m,05S00SUSP3S` 040$0`UQᐓV  09 00`FD040 CH004`380EPpT`D0H RS@0 8 ,P0Xp\`^@P,Px3Q 0Q- 0CQ%" 0PS THpPL`P@ T@"P$" P0HT`@V !9ᖕP` T@!900P0 p0403 0?L00T X oPT X\0RP P%Gw`04 S2<0%"<0S@p L0$4 0 P  X Z 1!8"! P 9`"!400 0Q 80080p0? 00T` 0RZ@p 03 0 P 80Sʼ0 0C800S   0`nO@  > _0@0dЍ000T(LBAW` 4q NBAW{H 1  ZG-0,0S0 7P@o`00qW40S*ẔЍ!  0K@P   k@Ppx F A-`0@c,0Sh0h h7Pp8Q H0< D 0P@DT@x a C-`0(Pc,0S0 l7p@ Q |0l x@PEU  0P !  0 P P Ѝx q s X0sC-Ђ0@ P@` 0 00 0᡹P 0ЍpT((X0sC-Ђ0@ P@` 0 00 0ᆹP 0mЍpT((A-0PQ B@`p0P R   T0! b@P 84iP'(X(T(gGV@-,@P,0S 700X(@-,P ,\  D ЍX(p@-@Pp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp((<(27@-0S S+,Ü2 R0 ELi `Q |xPC㗶aQ* Q( PDP <4B 5*< 50d30a3 220S ᡵ0 00@ @7.Bp#x3 Ŝ ' 0P n`vXA 5*< 50d381q,10S l @0 d3S, CQ,aQ$ 0AS#AP F0@a3d3*0Ct00S >j D0@ S Ѝ044(T(<(V(((X(  @- o!O-0` M"##0@p $@ 0$07 ṞpPc0S@P@# 00"' qp=$囒LtUhUaU$ bU |P?i0E ST8T8TT8T8T8T8T8T8TTT09p$S @: P80 ( 0 @+0S ,00(# `!$F P P0V xoЍVp FpnP` ,[ p_P `P0V:P0V PP p;0[0T$$0 0!Q Pl  @b60 00$ 0S Z(0,  $ 8v)p Op @E60 00$ 0S Z(0,  $ 8Yp  @0P  l P0 Pq 0 ! P0!9Ȕ& FeG-p@P` 0P V  00 000G 00`000O-0` mM$0P@t004080 0 {p40S+ mߍbP AP LP `8_4]cP iP0p8- 4@0 0H4: S@ @0(0D04,0008`0#P  P 0 0! xGTd p 0Q= $ 0! $∑匱@P 0V$0 0/S<<`V $垎pPp<0"<BP0<0`P< \v Hnp< 0 0 n?C0 n?< n/׿0P < <屐!$ 5᫐ 0#$0@0P!Sd `V|s 0S `0S  R$ R Z m0$H 8 H0Pp`G0$pR 0$ pK opBZ (,PQ(,PQ S R `T|Ȕ& zd@N 6eO-P@p`,M,$P 0p)$0S0$020S($p P V 00 0P0P 0 0 "fP AP PP XbpP$p,Ѝ`P 0`P ,3 ?o  00 00  0 `< p| 0PCqp p Up`Ȕ& )U;G-@pP` ᗛp`:D10S:E A p= o09 6X $$ 3pp+ P%W00S $$ w3`p YPPU `fV rV GTP$$ [3 Dp$`ꅷȔ&c$  @- Uo!A-@P`pPa4 hhI XsU  AD<>4N4  6 Aw.Cț& @- R0Ѝp` P@BvP 0 R SR  R $$20BR R ,P0 4- (P/00#01"$#8 O-@  @T \  `?p蠟 T00 Ѝ@P 6 [ PP P7 U  Q*"ƌʠ? ,͆  RQ*  R*Q*"É?   C- 0P @8a8q@^ \ ^0᳀ 0S@ 0S@ 0S0@@0\ ?\CT:^ *$@A0607;00@R0@Q 0BR 3C !82O-0P$`@P 0㘹z'0 0)Q P  @ Ѝ PC-`$4 p咓P`品(@ 0)Q P Ѝ P404-@-0  Ѝ Ѝ/-@-00@(3 0 Ѝ@ Ѝ/-@-P 4(, 君 Ѝ Ѝ/.CO-MPp`@PЍ P P 4S  0lᇍT0P$ -Q$VP 0S 4S $ X 4P S $]SG30 0 !0!|p`0 0 0  @ 0P 000 00 0 0 P 3 0T0哇+ P#(` ,`$`V$R ڀ 0 `  tB @  "tPY 00pP0Sp&Jqm#O-$M@ХpPP? 2R 4S  0nj$Ѝ0 mQ Q0   RSRQ"  "S 0$000 00 P 0Pᕌ4S 0S,  00 000 P0 0P0 <00SS PẐX   0 0`V4S 0$R V P0 RS 0  000P\ H0H 0000 0   H;pFU )G-`p@MP؊@P `@TC^t# E@0$4$ 0840 ;p+p ߋzpx H4$$: S! R B.T npD $4S8 (4,$0.B.  ^p 0 0"dR04<,$$4(4$t0K>Ѐ 0 g*   000E`d$t؀E0  S*P0`P 084S   0p 0gp 0p pp{ p 0pps P P 0" RPp5:Ѝ Z0pY"YnTzd@d@+@-@P 4B BRP Żp 8L4  VЍ@IЍd@a@-@Pp P P 4PS 4 A- @P0TP p` X`p0 p2H$$ QEAS$0Ŷ 8#8"(Ѹ0 / 0T 00 /$4 0T0 / $4 0T0 /O-`P@p M6/`)*P̀PP `00000ᚰ따 V:Ѝ 1 00 0P0ተ`P1 0 0P UP `(jț&5C$$0A@- )P@- x`R@dbЍpP P 4U R 0 4-O-P_o!R0`@tMR(0S00S "R0oU tЍP PU 0SEpWB (0WS>!RSR6"RSR.pG/0[ P# 9/p " 9/p 40 P m0 $8  *P P  P A-@pP`P 5/p 4 5/p 4 C-(00pS4P Ѝ$d@ 0 ,(  0d` 0(0  0 `WP 8O-0 0P.p@ጀ儠T Ѝ` )P `V DDp 0  @4-8 lA-P@$`$p0 @zT8 O-Pp$M `@Ȁ뼰0     Q I Ex0 p `p X0 X p`00P0 . *$Ѝ(8 d O-PQ@04p 00` ЍP P0S* E g`P0       04 p p#p p04pp  0s@-SX`@ Pn0 ?o2R0S  Ѝp4-@- iR sR aR p` 4ep@-P@P (`Pp Fp4-0p@-@T 40`PP>pp4-KiR@-- 0 aR bR LR( *sR% tR@P 0FP0S`00p`(j0 o4-] p@-M`@P`ᎼP0 0͵0,-0S ' Ѝp(2G-Q@PM Q  ЍA~␀ p$``P phB~00 0 `PP wA2zO-$M@`H&P ,`$ЍPP 0 0 "0 $ Y># P0*'Q P0 0?Y S0STP pY0 P pE00 PU 0pop $ P 000 00 pP 4  \+\$  0V,S( 0 `$4 80p| Ĕ$%!#,[PP T P R*L0Sh 0p_ L004 0 000 00PM 4$$  + 4  !4 "4 $@xp7 0Nh00S 0@-@C^M E$E$$0D% 0)81P"8Ѝ0 @x("(!ګ"`#XT 80 Z @̫P8ɫȔ& .L`s0$ 8O-`DMPp4 L*2<0 5p 0S8 ! R4!DЍLRd a0BS)S&꜇pD10S  0n&P 4@P   [@ 㐃Pట  ޅ T t0 n0@  T b@0  @bP@pȔ&h4-4Fm  &KA-p`(P@jP0 p!`P @00 0$0@-@P$0S 劅@臅O-20SK@0SD00J@ DP 0SD0SA \^<40$ 400#qpp, 804<0SP$ 0I,0 , |P tbU@ qU PH04 8pPTЍ0$$ $(`VtJ0Y `0 XW0 0 0S$ (0 [ P*0W0 000$0 0(000qpp 0 QP Р 0Zp , 8p p  $ NȔ&!!XyO-@PDMCnp F#p ῊpX50S HDЍqP sP 80Up#  0qp PPp0#F0$$M`P P  0@x40P0  0 H0 0$0#P  P 4  0 (0$0,0  4 PSf 4,  (WUXpVP 0T 1 T00 S :0 U 00[ 0  40>P40 (, [0V [(Q,UX? U0U0Xp.P p (V,#X<! 01p8 0  U  0 0CP_ Q QXX 0 0  P4\ p 4 "$P0 0S 004  4  !4 "$0 S40H0L p $01S 0S P0`8#8&h$ r/0$0s?`mph4 4$$  !Ȕ&! !]q!-kOC-P0 @p`$M!!ᜑ P Bp*0S00 P 0SP0SM \^H 0T' 10S#!Q` O.NP. a@ P P ꐪتTdpT T  w,$ЍP`Ȕ& !p@-M(@,`P6# ,X0⑱P0 0͵0,00S * Ѝp(2@-WM M`pn@T 4G0S @^< P 0$$ 0$$0 x0 |xP x  xx 0jlܡm0 $8PԡLҡ#< .Wލ Ѝ0H_#+@-0@ n00 0  0 9Ѝ觭@-MP@a qPwHt| Ѝ@蔡` 吡 p刡Ѝ儡|倡 p!80pp\XT0 0 (k8iP  @08 0@TS Q2P  Ѝ@LJ $m0 8 00  ` ppx11S1SDPЍ@$ove( $P `00CS`0p S00 P0S X0X /XN&G-PMM`" " )-:2r@p嘂嘒TݍЍ  נ Ӡ `Vj @ɠ   `0"F0 BABP  ⪠0S8 1B-B⟠Bᜠ嚠$! @|<#P%$ !P<# pm0 $8D(z$x# b,@Bk 0Bb _   E0S 0CS 0 80H ꒄ ?k!#'(R(+G-0p P`@M!ဂ P ᯆpd20S$^PDO,@6 lP`Pa@ P꠴ȴشuP xP @ЍPP p*PPP0S00" P 0S0S \^ 0 Q  嵟 屟+0p帠W ᠟ ᜟ Q ᓟ  }   up ჟ,Ȕ&6 ! Ak`@-LM@P`4  U1qD0 p T   P 00S 0 iR TR a0BLR :lR s0BST pLtLЍT }p!}Ȕ&ܷ4! 0@-$M` 0 0@P!!dq ᜅp$0S00S P 0SC0S@ \^; 0T 00S!  0*a@ P 0H`TtpT T   4$ЍȔ&H!-0,M$00 0 00 00 00 00 0 00000000 6,Ѝ#7@-@ P00x0 0r0 0l000 P  S  Ѝ0C-@pM P`V R0 0L0 00 0 00B0sS 0lSp@ P$0㓄( b p l@ P 0㓔) L p Ѝ@T@Tp\!C-`P؀C$T2P WT Ѝ%P P WP9P+g0P0 eP000$$rZP]oe`P |eP (0ZPXIoD0 ZKP $0  pQ4 pLP 4Pa0P 4 &Pu  P00000[000000S 000(0>eP d:e0P$0 KnPP HHHp`P p$sPP04 LP 4`P `P @ JPn H JPh @0 SD00H0 RL0( 0l` 0GqpH  R$4,, 06qp 0`} z$4P `$$o$4P` Vd`P dP hh&tdP mP+8,0 7p`P 7p<&? ` 0qptnp wJPZ3po  JP   zJP  sJP   lJP  $ eJP  X ^JP q@ WJP  ( PJP q/   NJP r GJP 01S 0r/S㲰, s? Ѱ  1JP s/ *JPz$$Ǣ$4P$0mP裟z o`P o$$`0 bqpS, p0x< KPj <pP < <(< rKPZ <P  IPO  IPI L IPC 8< UKP $ <8 IP3 8 Y* 0c$ Bp $ VPp$4`  0qpt$ @W$4 $0Q 88\008$00(0 0 00(0 40P0,` 0$00P00T0$0E XA`0$$qp|$$$4P0 00H00L0`#$4+` 0qpc$$$4P `4FȔ& !4-$-|GP3 ! m Vq=UDaS]*Hg0@-@M P   } bp< <C 4.p$;0Ѝ08!'i@-SM@P, 0 T  \ $ d l 4 @pt H0P0X0`0h0p0x0x00p0`0h00`0 0X0D0P0L`0|`p^ ZD Sߍi@i!i@-@  H  0`( "4`#Ѝ10S/p@-!MPM@P% PA. (01` P A!A|P8 0`0?oS c`2 06P. 0I0e0 0A. 00P01 P A rAM0 000BލЍp`;0 0A. 00PH0 P A4 4HA@#v`o(((1ss@-6PP J%P C )`@T&ЍpP  00SQV  㤖@F!;0 R !O-M@ Pxp*p" `P"    aP- HeaP:apP P 0@p&@-p0 ( 0`P/ R/&0 O-4M@@!2T0.  DP岛pďů  0$ (`pVD@PT P p1cehT6l PP@ Ap 00JP`p R  P Q R/6 0TS $ P\(P  1/P +@0S  Vp "SR(0S`墵\ 2/P W0 [ Y   ((ɚ;6O-MMPp  X p`%z pP$ 100$0 -' ␟ Lpo ⃟t ?p Q X  Ǐ8 p$0Q $_ X@T \X00@0 0P@R 0 0D ,0@4@p 0h0Pl0q 0X 40,@pDg 4<廏Ej0H0S $P31嬏H0S=I0S:Z`@T 0 3/@: " _렒M0S:00 % p"RpM0S  {@ s@03/@r JўI0J/pNI 1R㓴a`"%J` 1 0 d1 T|p 1 d\!1 H.`@#%Js!1 @ t1 x!|1  ˎP@Tf 03/@ 03/ݍЍ!LZi~i &ii ((!3i@J "+d5@XcO-@PpP  p T X@XPT!YK`P \PPU D1O0S eccLW  P.Z  P' AP! K0S 0 L0S 0M0S 0 N0SO0`S PPV   ,a!m (Xgp&@-,MP@wpP -YP`(  p'0S hx H>P00< <l0 $^,Ѝ?(8i( !@-P@0 PJG-@XPP0  `@ Y㔀\p~\PP  jpp H H@@@oh@u 3!2(~s@-@{X@P 00ЍpX\PJ\ᱩ@P <` jPBhu 3( Ns@-@QX@P|0| |0 /\P!\ሩ@P T` APhu( iЍpIu @!( NA-@"XXPP0  `@[[WPPp p< >FJN@7 u L!(>@-@ \=PP0P PP L 0 S@@00 >00ЍFm U!(*ț&P0@-M@WPWP WPpWP d0P P P P  4PDp 4Ѝ07 I3(7is@-@h P L݌HPH` P! ,ҌЍp͌@# G-M`@PK `ppP"(  P    ԗp% (B ( px" <@T t8P哌l2P\匌 UR TЍ0 PhNe@P㰱 $@噗p Edt 0R [k) ` `pNtQp R%P\D mKP;ЍGfQ\ 0Q    1 0P%P0 RS  # ̋0` R P U 0pD` P\\\?8!8i(id!] H!(d !Pp@-P`@ VP V  W`P a`a  00pUTpaA-@T 00`Pp[0 p @-MPP 00Ѝ`0 00p0@ 0 P Y0Pp  0 p 0 `P0G-@(P\ 00`(  P1r0Pp*0X!U0"R0 ? "0< 0"SЍ$H0P0  0 , \p 0 @0@-@P w`@  O-`@pP,(0V0S 8RcP$P$P 40S 04S 0S(0p(`8P0S$0(PeO-M00 X$0 00Ѝ 0Q`?  0Q> 00 ;PP; Xp pP ,,pJ,4@[T /x@P00 DW 0800X5Tl (:k( R R[`P "00dUx 000 ⲽPo0"0CSi 0BSe 00Sa2^ 5!445XpubPPT  Ჰ% $pP `XdXB 0  Ap; 0STw /PPZ0!U8!10#R0 0i8XdP Z@ 0YPH@T 0CS00x C00 X ^0:T 0CS wQ0x L @0aD\W@DAD\ 7@D@SB0@ 0#0  0@D@ TW@GdTl p TP^< D^0 0 0`0qa/ !*DA-X Pp@`Ps 00B0Pj  0 p 0 `P0O-P`$M@ HpX8 P W0  tPp` 0p0  0^#feO-`MM@ <60< l gK7KP忥7['S(0`0 @$0 0 @`F( 0R|P~$0S0'V$0$:$ 0:0: 0:0 :0:0:](@!!0 X v0 /C BRZ  0  00=C$0Cɟ"! 0P PE ^p PE0`y\900IppcppCppPpp Spp@BppA`8$ 0PX0` !0X@"0,0,0S> 0( 0B'S(0؍Ѝ 0$0d(S   BS>C0CD(S Q:ȟ"!! CR   ##9C0C"!% 'S>Cǟ>C"" N=C0C Q 0*S ;S. RU 0C'S0<<<D<L<<<<<<<<<<T<<<<<<<<<<<<<<<<\<d<l<t<|<<<<<<S66`5h7`5`5`572S# Spt 0S R Sm &S|h 0R  |T |0Lc0, 0 B, @W0S 0S `pOpW> 0R 0=`0S 40S `p000 '00C!xx娀XP0  @ p` 0S W  04 8 <$S Wf0S  +~0S 0~~ ` 0d|Y1 4  `pG0p00D(4@Y400 03c10S1և!u ~p 00 ~3I $( P  #P# ß P# ~p|P3Ip#S0S l~0S#  P~S8}~0S $w~ s 夢 ` V0V"    0``~V4Z~0S 0XR~gDM~` 0 d(Y1  0G p00Z100 `&"R 1 !o 0B0 '~1I $( !P  $P|! x Pt! T ~pLJ|  lhd`\XTPLHD@<P0iH c(h( $49#=( P!( PPD 49R!` $+?p@-P M@` 0QP0 aPp@@f] Ѝpi@-< @-P$0$ $ Ѝm !@-< @-P$0$ $ Ѝm !0@-MP "MG@PۍЍ0@&] P+ ݆P@]ۍЍ0@0S0S1iS0@-M TPfp@@\Ѝ01 Fk@i@-T @-P@0@ @@I \p /Ѝ'm !A@-T @-PM<0< <l  >pЍ m !+ 0 / &/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0u-@-  sYoY ЍЍ/@-@\Yɇ 0S/@-D(-@-  SYOY ЍЍ/-@-  EYAY ЍЍ/@-\00S 0  0000 0 dXpЍD(@-@+Hp0yp!p@-pMPP2 P0S 0@P 0 0 00 0X#Xp DlP@@ ((@,P0P4P8PSF00!031 0@-Mt 0WW@P \ㆠ zSLPP @ (@@ 0DWP 020Ѝ0 &{pL(]@-@0P ,{  {xț&<P@-d0 !X !T@0 60\ (0000/!!!Ph0h@-`  !TD0 60\ ,00 00/!!!P-P040#^4<\$0000/!!!PD0 40#\00Q 00/00!!!PL- 0:# ^4 0Q$0000/!!!PL- 09# ^4 0Q$0000/!!!P 4 <# \,4Q00/00!!!P@- 0:# ^ 0Q0P@d0 :0# TDD#^<0\ ,00$00!!!@- 0 00 xP ЍG &A-P͗p`@WЍ P 3MP@ p7@-P@U0  (iT Ѝ0vrA-0@nS0oSp@ phP``DXPLT0nS0oSUPPUPP'ꟓ@-q0 WzOwxț&O-MM`<(0pP 0Y 0  W$p  46P$W $p$0S dePX P` <000S "0Pp0 0Xa  _  Z  U  P5TpN@$0Sn  |Php4$W 04 X@ @@`@489pP^`0 e! 01P01 0S} Zqxp@0 pxT x0Sm ꨐ  P 0000Z  0P0 P44 0S܍Ѝ40 0 x3}pi P0##4Ox0ISʉ ᛈ`P0 0!-PB0p p=0 P0 0 00@v0S,p hX0SZpp P X RRZM$0Sh poHXEXX RR0S Z ,0؂p<,X8B8b8r4000 w0S  X0S0S40 X <8@80@D0ہ  ,幁P(0T0(00 ZLꃎ0`"P0"儒 P0x"]p/\2 00CS20%|000& 0|0`P0 +0000 0p00*0ZVjlpg 四rPdPMP* UP? GP e@ PT[[d[[[[[[[[[[[[ 00 0 00 0< 0x`|P 00  0⎃PX 00 0< 0ntyp [,0t0Z00x0V0;;0|0ЍZ00x0,-Ȕ&4- X! -BMMI^@0 P@:00 \ 0?p0 @0 0/ 0 ℉ss !7@-@P V0Lo SϜ 0  Ѝ00 @-@OE0P@:@-@F0P@A @-@ WV0S 00S0?  廚ЍB p@-@P/P (嵚0/Sp_7p@[7X m  @-. vs ț&O-`@ Pp(,000 唐唰00 [p0@DTq oP0 P婂P<s뚂9 O4,-Ȕ&4-m<! @-M@A>0 0D@00 l0wp0S SH Q 00,00 4r`z    p@-@PᤰP (*0/Sp6p@6X m  @- ur ț&O-`@ Pp(,j000 唐唰00 N[p0@DTq oP0 PP<9 O4,-Ȕ&4-m! @-M@A>0 0D@00 l0~pn0S SH g8Q 00,00 婙r듅    p@-@PP (埙0/SpI6p@E6X m  @-  qț&1 O-`0@P(,p娐娠娰0 Zp00@DT oP0 坁PPg뎁  qA+=Om4-!Ȕ& @-MM0An H 0P0 $@e~p ;qe p@-@P᧯P (-0/Sp5p@5X m  @- tqr ț&O-P@M P0k`r"SZp)20 R. +x   &  x `!p 0 *00)0`Vp~pz ՘uPfPMP9 9P$ GP g@Pf$f$f$f$fff$f g$f$f$ff0PC@P@(0L AH`q匁( `L0zpS0KSh0  R < (Lh0 F2(n0 叕( h0N/@  0PP 00 0,P.0T0P P T0-p0\ $00X 00@00\0|00x00t0 0p00l00d0pRݍЍu~d( %!p@-@PḫP (>0/Sp1p@1X m   R R @-!/0@-@MP`p 0y000 zPPЍ0P0 0 0z0 |y0P s@-`/P0@00 SyP0 '[Ѝp 0`( "4`#/s@-@P`}0 0Pd00SPPP @`@^ 0qoЍp(%!(002P0/0@-@CMP( P41010 0000000 0P -K< 8?o&H00Cߍ0Cߍ0@o꠆%!qG-0@`p8Pp6 Ƞ,̠Č Ƞ,Ƞ D4$03 00n4<40 8h0e,b<0(000pE040p<0< Dp PH00ЍpHPD PG n(tu%!O-$M@0 N`Pp0 @T V0<00$Ѝ 03/ Z0p @' 0P0:@ 0 `  p00P LH0@3/pPN 0P 0T@Pp 0  ݊tNP P @0 ` 0  vn꠆%!C-MM`p/   P@1L#Pd8$#4d4# N41FD0@@ 0@00 0|@p1ߍPHڀ@Td8$#Td%4(G-P[ 0M@F@N0P` :0P`P0]  00x 0 P _ X/0L 0pp000S0 W0S00S0 p |p`  hP 00P0S`!0!D0D00W 0 000  P0b"!4b4#P0P0Ѝ 000<0(0u~](0@-M 00@08 P  ֒cᔜƗЍ@-S ;n3kț&O-`@M$  00p 0@"@0"@0 "Sp20Q0CS g@⨢P(~~~~~@X~~~~0p00@0p t! 0 zPgzP PP0S R  H ᴗP  t? o[!! DPP0S R   ᐗP   剗P ⹔p b+wp p 0[4S08pS @p @Ѝ,-Ȕ& 4-%! */ZB@-MMCN@800 0@(00 0vp ˑ 0 l"l!l(=0P( lyl,D<0P , Trl0LolލЍ4hl(dl'3@Paq7@-@P M0Lo SϜ 0 } Ѝ00 @-@;0P@:@-@g=0P@A @-@ L0S 00S0?  QЍB p@-@PŧP (K0/Sp-p@-X m   0`( "4`#/ p@-"440 @"440 P"440 "440 $(0 $( XXddhhllppttp p@-"440 P"440 @ DD@@HHLLPPTTXX\|`\ `bp` p^ p@Yp@-`@"QUpf@p@-@PpA-P@M4Q->C}->CBX?X\<\99>l9>:>Cg?n:>CFb 0? AC>Y}C>GTmFPEnFLE~GH 0X J~XpW  $$((,S>,%}S>G mFHHLLPPTTXX\\O-P ! "441!"441 $$((,@,0`Pp0Q࡟\5 S L5sp`PҀ0,$ $Q p W vTrTpXnX\j\`g`dddhah`l]lpZptWtxTx0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P@-M@ PU xx1ipp<0h`SPP\@Lp0SfD0D,i  i@x(qț&KU0'! 0`( "4`#/00S/@-ex(p@-Pp`0@S     +D00Sp "4400S "440p &(s@-@00S 00S Ѝp@0001!Ѝp@?Pl0`0 ,P08CV D 0$g"eЍp|(((((!R/'s@-P00S"0@00S |000 Ѝp@ ?,4P0`CV D 0$g$reЍp((|(((GC-Pot10MSP#` 2R  0  ?<#΋ 0`x 0`0報 C c00d0 `c C ca0b0 0 0P!\Qpx 0&0sS $$TGQT`P@Ul  00 ЍO u0tS hhȀ XȐPUP,U((U nTTt0p@-0`S[\@ L00S000000B0E0p( &P갛xl00/000/B10B1/101/ fț&O-eM  dϠ 0@ `Ì0 1P50S  100 R(0S\P4pЍ P` ` b5BL RW@QWR5p0ܜPP/ RꌝT| P D " PD1  2D1" " P 1 21[f0 8 P U Pp000 0$5S ? 00l1>0@D@ @00C03`0S30 0C0 0#0030 3#00020SQd 0@ `?50 ST0T00  B 0P SX0000Y0,ڨ0d0? 0 0@ `5? 0댠 ,1# 0q ! ?i0 00C000 \S T10S  2 dϠ 0@ `Ì0 10! 20XeT40A8 0 B0 080$ 0C $ @$  $ 40040 08 R R` /  `1> ``& ((U nț& &:O-MM␵`,@ l51^OR0\u@DSia@51o[o ?E 0S/nE? 0?E4[P`؍ߍ 2@ŒD 0L 04;2 0d04 0l0  0 SF0LSia,41~oo `&!""#0_ED@HL0? 0 040hl 0@DU0 L 0/4d;0 0 0@$ P` 04 <0#p R0C0p00s3o`Px'x20S6t 2ܢ 0 000`0z  `  Z ~X ZPPQ ,_ 0"\0Q>? ,0##90 P?( 0P@/  0@őD L 00 /4;0ndn 0d0@ 0_ 001r 0PV Ln`P 0"Ϡ #$$%90\X`d?(,0I P 0@Dő L0 0/4;$0 nn 0l dh 0@ `Ì0 1 &|((A &&((TO-)MM,0=0?0(8$0n <pW:t< 0 ; ` 0P@P`P  <0 P@ 0  ;$pn 0  ;Ep@ ;T@  #@[Pp *| @P xK(r0S0,5 Sx0<0(500,; 0,%S00\:X:Q04D b\ 0Q( bT* 0 04 0A bF 040A b= 0 4Q b4 00 Q* b+ 00Q(| yb" 004 Q\ pbP9 p00W 0G\3SrD9\s另XX9X0SQb X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R0081#b p4PP 0P8 a 2! Q S,QdS18$Q<4R:b @<8*\50? A00p#!3x00084$0<04D0t p@p0|00pXsL5P5 P4H   ?*8@`D ?# p?`}tF01o&" A00&"n0  4%8$05<4R0aH 66 p84<00x 0 08SoPN @P@0 ? @P0PP* ?@PP(5#R0:P@$0[`- 0000%" a`0 ?001>0[`0 c2# S,Z Q Z3?001> !00 ^  BB0oP`0/2"0$ 0  ?[V`1V`#T0`10F 0VI ?PB@TP 0ἐ;똀  00B1  B[1 ` Y"B !!0 R0C!I0B ?&0 `똀 0  B![0Ӡ!`S1B 110S `]r @P`x1 F084<ĔCP`0S84<Ą-0$5BPS,`QɑRB@L0 0 0000 20S|0` ?HL404P@0 @1pr'Fjkqp00"R6  Q偅T1(\50? A00!#4t x0Y0(0#T a2!, A3 31 0  ~@P0( & &X(( 5 `  (  =!q!(!!( &((((^F!>!|(/"((J"((!(b"&ht@p&"(" &((TT(U 04 `  0H$4  E$ ( B, @%LV.  R*h b <  X ! \ ! ?.@Xd@+@B@A.@B,-8 He `߰ @40K `0 ,p B8d i A YZQ 0 ǣ0 XZ R A  pW?΄$t<4Qï80P@D04 0H4(0Āp 2 R 5#< 523pr0S8ᗈ L I 3I 00 d AQ\ a6Pa`(PX3_ `41뼐@ -*Ս 3*0@0P 8Q 0,_ 0  R0:1P000\P2#00@P`@` 0 0#p00 R00L/&X0 0S:pD R^ TP0 뤤@t j0JF 0{K 0`0S 40Sa 0 # $1 $0+V. 050S  O 0=S,:0Sڤ0S0$0! ,00C."\ ^  00 0?d B2 b<10 4& ^$@6@H p iPP04SP0 0R0 S00C0 S 0,00P0F 0,0S' p开8嘥ȿ+" < Q \%0R.  @(0 0 @DU`40 @4AO`70 @R40 `0```0T0H(w 0 ` p7$X0`0 I9pQ80< 帐 P0x0 0 Sx0x0t B\0X1`01tQ0C00h0`0lR#00B1 d0R*%pĈU0   (0 0C0(0( 0 R R` ` e 0$5S  l01` p0000S3d0)ST0T00! !0)SP5X0`0`P5S00d0 0u r   l0000080@ y`Q ㄡ+H0!H (AP+H tH000-ᴰR㰱 ,  BU 00fy0000T0 10X0岑0= 8R\ ?0 P 0  B  R\ ?0   00C 0  080 C  C 4400CS T00C@ 0|`4  80QT:  $5SXL $`$`(0t|V0S ,4 ` d,04  0,4 $_ 00`  Vj0S   0帀0 X#` x0@} X\h># P 0?d @ `0 < =\%R m0SP,m\`/ `ƌ$  $ l(0`S`  0$5S  l01` 0000S1d0.ST0T00! !0.SP5X  ``S 0d0먐 ,   & 000080@%0C 400400T$*Q`?0@$00$0l0`0@hppT:S $S0ppS $S00S0`@Pl倐H(P00@8p`0x1(ሤpY70IX!@@լl00@0T: 5@$\,Q 0@08(0  (0d0O@ 0NN nC 01p0Sڔ30S0 000S.+[08CLC P3 RH0ł."\5 S 00 0 d 0/ @ `.3,00 $ E[0000S0S 0,00C0S0 20S /[0S ZT20S 0S Z00l:h*,8iP 20S#A C 10S303040404 0#pCVW*+V.PaV.GV0S  d10 PST1\5=S,w41?^ E?#0 0S 04 W dLĒH 0@ `Ì014 ,$0S0S 04 ? d ,04 0e 04e)ݍЍSoh(T(( "o|(# &#((8 (G-`RM@Xr PP XP`H ` P P7   ep K0S B:ߍ<08 H(00,0 000040!04 04$0D0(0P /WZ  kepT heep* \qX%` 8  4  (        0,0 0   ep 0`?`a8SUoPb 0  0**0P0j  0* Td@edAkzd@?qA-PMPp`;@ np@P  P06P{cU00 ## ݍp@-@P]P (~0/Spp@X m  R/˺G-P `$ 0p@V` 0@`` V`@&!D( `G-P 4`pC0ȠX㉑ ,Ƞ ,4 ă Ƞt,Ƞd0 "% ?Ѝ0 :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@O-4MX0p0\00``P0 0,, 0S% P 0 }mS;aSMSASB0C0b0C Sd\\\\8\\\\\TSSU0@0 0DT dS$ 09R "P T 0U8$UQUDT P 0 sS @ @ @U00@@@ X 00 l P}0S00 0 000 00P4Ѝ>@-,@ (Y  Uț&4#(!0@- @   $ O-@0p Pp`G0 00000ZI00SB_: W `B?F ᴐ@()P0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p@(0P  C @- } co`/|+!#s@-@PH` 0082V @ |Ѝp(@(+!#s@-PX00S@H0`ă5#040<2V @ |Ѝp((@(+!$h10 PS/C-TQ@@MPM`6`@f$a 1p P09 0 T:@6S0O@ _ DD6ۍЍC+ 0P \ 010 S a8!#4a4# 0^ P;0T 0+ۍЍ(@((0((+!G-HB` pQ/PP$"$N| 0F0( 40 X06# R 0 !8|0 60C 0 !&|0006&0=06 0  B 00C0( 6V0:`! `Vp 0$&0? 0(0 6 C c0 0 &$&?0`L0V&S %0: S ħ0d  &ЍG 1< ((|@(+!$$H$q$$&A-Ta00S FT:p.PP  0 0A1S0S0 P @D A01 S  {0S @2106&0006   B ! ! 00C 00@(+!$O-@PGM@Xa?P>U㰐Y  0@00D @/60d& 6F H  Td> R`$0z h2 XSQ 0@H0} 0 R (cR 5-0$0 0ᓩ (00UC (0 , P(0,   @R 0 0 $0F 崼0 0 60 6< 0(0,200UX,0000@| PD   D $`0P 0H\ d0(@4LPn`` 0T0;0Lh5R0L0So h^/;PU Pc  ;0L VR0400$ & \`#  @ \ 110B0GF0Df0$APpepeC0CP!P`\` :0p0-P`0"  py 0(0d0040\0@080< <0(02(,0 0C0)0C000 SJY 0Hj00 pS D!*&A 7 @ T|) 0 ( "*T 6 !"0H& 0 09寺PpD |IH&0SK9 R070Dy$0S 40S `PD@ 80S<000 Sg0C Zp,  00 001(0@`@ QHR'0 Xx0S7 0S0h0S00 0  C02#(0S7P p >_PPXP 0R SHS SQm`@pb Spm0 0Y 0:Y:tV3006X  0+(01 0m0 JgT  060 6&W(6Y:$0TSL0S d0 P V50SapW~@0S wD5L R d0 P# 0PDT%_oRU+Eg&0#aH6 C 0 ᓔ)6 40 눔p 6`U0CT 00C0CSX: B 5Y1 21[0!!!0 Sq# 0 ᓢ" V 0d0$&S: 060& 0vg0.RxGz 0W4#0003  SpXk0SMf`F`VI l30SA RW RD3PUBL0S \0:`0l  PP1 P# zz37 ^6|0X0000]096 30;Pp`Rw` pRp` zKX27]X0000p]f &1 #?1#  0RP *d "x P0 |0%PPP!f v*`Pw!\ *P  6p!dS!PU:< U*!:0U:,0 ,0 xp$L0S\^UB: 5@(($ ($(%K%u%%&&%0(&((&QNSD&(8(\&(t&(&&/"( '+!!'&ht@p& ("oA(#P''''4(+!r((,&&A4& ,!()@((0Q:BS! 0 B 6Psd  0P0 S %%* 呐  0p1Pl 1 !7P 8 `U&`D1l6\0U/0 x xCL0S `0  1#'$/%17\\X0|000Y\090& 2|0P((  /0 `px2& 0x90Df?o2U+u?&0#96` c2H H0 HDI\GߍW@G-`RM@Xr vPP X_vP`H `EP P7   D\p 0S 0ߍ<08 H(00,0 000040!04 04$0D0(0P 8&WZ  \pT h\p* \"vX` 8 | 4 (    0,00  Y [p 0`?`a8SfPb 0  0**0P0Ka ⹻ 0* Td@edAkzd@?qA-PMPp`;@ dp@P  P06P,ZU00 ## ݍ@-`pC  -@P;00S0?0\$ 0S 0 zuS\F\GL \ 4444444gL0 SDKT ЍE%KUJ%FZO%A_0 )()@-P LPDDP<@ /k0P00, @R  T_\0Sj 1Sg 1Sd 0 @D$1C0$S [  [ *0SR3#:\00<0S @!0S 喽P@ T <0 0P U8 PDJp8QP@@ 1 $11(1d000E\0`S`Sx0S4\0L 0H->0 $0Ip+ p`PxC0S)0p2 p1S?V?`#)$p& a1S)p Q$1S$Ae$1S X$Xp@ k 2"OKK@0DP?`|KL0OK\0K@L0 0Z0T0Q0S<I[# [ [ ? [l0S -80S l0Sd0h 000@0D0 0#h0S  d0S   T*,800S0 [0S0S"  0C0T {0#Su0S1`0S S Te,0S , 0C4,00`01l0S1|0 0S010S(1h0S01d0S4140S /l40P(0&:K:Rh0P(0 (Upp(SW0P!* RbR pV 00S(dR0(1S01[X$1a 00PV`5U1000Ac0pY ,g'HX뜵U pO 0 pSf:Yf(D0p>p`(uU ?4 0`SM:0!\R&0S 41 S$40(00p000 [ !0R5 R4*P 0!RP5P"S4U (R41SPP4Q41!SR U |`SRQ SP" 11S<1 P3P%Q5 1CP0Y [  0D1Q000pP$1+!`GT0b#02b! b&X 0S [() Y': [00ŸS#."T0 S :0㈀ 0[00DŸS#}00S#<0 01Y`T01 !000 30$q W5d:0+a! `  +!  G0  + [dQ [XQRU10A+!2"@Y0 0@b"0`(t0(0 +!  0@G0*0S1!YV*/+%,8,\,,!p,#,Ȕ,&,,YZ), --n-- -F---#.O..{..../?"/:/~/T////%0U0J(0000001 1#1,1=1 D1K1S1ț&*w1gfff@-/!U1RRaArrAa [0 [00S 0, S00R 0, t  [0 [00 / [U* 0!A(1(Q R0XL(J 101S0S0010 [0\S 03 ,! q5$15J000 T0 JP0S J 1S,0 I1\0IE?0Y0 IF?0!0G?00@0I$1SL0 \IY,!(pItIPr0bRQII4QI IH0S zލЍS03$150 q5 [(1 $1S|0-^ = C0 H02ME`!PP nHT =CDY(0 T02#H0 [00H <080$40`0P0#40d0,0#40h0@0$0Q l $   Xt  0|0(4Q0X080 S @40S d880 0x 0|I0$040S' [#4q4 0W0W03 W00S pZ@ D0pph0S  pRp T  ($ p Z [41T C/oS" R `0 [ 0 0 @ 000000P00d00,00h00\0001010100L0 0 (1$00(0,1,0>03M?03)001x 01100 0T2 ?@1c4 04 v. 08#$0 #(#<l 0 0&:RHt :>Q X0Q40S00|00o0 00 R  ST @XH'?  $RpE TS x0!R R S 0 S7071011H0T RZ* JoQ\0 [0 0+ S  R   0S* 0H0< 0J?oR20S C(0 00 25 010 0P B24 0180Sz 0`( "4`#/A-0 0P@\v @0y0 `Tpq 0xeA@00@- 44@4P\P 0B"" *-@=B'*@- HE1ț&G-@P ` !>0zP V0 0  PP GpP`02 0Pl0S 4l0 V *8-r22s@-pP@ 0  ?X 0TT7GLЍp P `?0 &G*#*2@- 04#$$04GQ   mG Ѝ2"@-$MPp  M @1 00@ 0! 0SG))MG1 pHG?`CG?P>G`PDpATV@D:$Ѝ0G2233,3fep@-0A0MP`   0 0 010R  2   $0Ѝp@GR  #   $R 0S1#$$ 0("( 18#! 0Ѝp@F0Ѝp*33T3u33 @-`Pp l*3L@-0 L@ R0* 0 #  *P `00CS`0p S00 P0S X0X /XG&p@-`@P8!R#<10 <10 .810CS81V <1S 0 <1l0 h\dZ`0YPp <10C <1$0 810S81*P&p&ț&*O-@ ^"44”P dQ\4$M2=p2 04ț&@-9@TP PD DD 8D ,D DAț&?q??@z@p@-0@ R R 0 RS000p\RP 0SP0PP'R"R `0S SCP0ț&BB@-@ P l00S\ 0@ !0R3 @00SP P990+++p@-P0@000`?0@@ Q-00B 0$10S !0 0C!0R3^0 P 0 0 0*00 R))))))))))))))) R  C=00pPP`C 0#0%0&P/0@0ꔢ&+++Bț&僠A-@P`pp P0 SR 0S0B0Q3 00@ 0  ❨+++@+P 00CS0 S00 P0S 0 /C&A-P@pMP  p;PdG Ż`»`V :<<?0/S 0 R0S /Q C0p R@ `/RR FR .R @` FRP @D T0t/S`0 /R/\h $(ț&Co0O-cMM00@00<+0< 0<0<00} HP 0S0,3,00,30S3S0PdlhO \|\ gBT 喳 00 3 S (@@ 0T S S00 0K#=PC@P0S+K K_30S3/S:+K &K @0 vY@PT[K>P 0 Bt8  t,  t   0S 0 8xS`S*?S DS . y000Yy*P0C @K+ C 00CK+ S00CS00Ya0CS0/0(11//1///2///7D8/8//89x8 ⍺  PK 0@P( 0@0 9 90S|9 00K  K W g < ѻPK 0 Y PK. AK  J  ⴻPoK P 0K. 80  0 t ⚻@PU T80S 7    ₻P= 8 (<08808407007,07(07$07 0707070707 07070707A   RP K  PP 070Sx'0 0C!0R3x X70S0Sq K 4 @P PRKh <⻹PK ⷹt0@Pp[ K> 0 p嫹t`@@hP0V"0T  HT\HX0Qx0pW pdR000QSL00D0QnDD0@-0 `X\ X0S 0PV)PP PP K 0P@0 K. @K>x%x 0 i? `@씟D@pP @ VG| DE 0S$0 0C!0R3 0S0S 0`0场P `0ᖺP c=0,C 0  R+ .t 9@ n0  d0|d0`@ 4ڭKR p 1  1 S 01 \Q \HHA/p@!bJ L0 S1P00P0P D0S( X3 R  h?  X   `H0 S   \0T0 S `,@0SG @DUYC  ╸  P0S|& x 0 ⃸ ` PcݍЍ v4  p  ڹPPA0S, P \  ƹP O  ⹹Pt C x ⭹PPh@d0SXTr000+ ɩM\) \\'P+@++$C+ț&*CGC XC3CF  +t&t<ahC}C=!+`CCDC,DHDhDDDDDEAEaEIEEEEC++gfffEc Eh o F))FF/FLU 2FDFUF^FcFiF}F@-<00iS03S !IE[P;+@+Fl0@-h@C   L @0 0 X+FFFFFY+@-`0@Px0 B0PU1 S2P T0p0S @0R<< 0,$p> Ѝp&++Foap&GC-PD1`0B8! Y!R!tM@p  10S > tЍ000iS00S 00S d `P d=W @ 0  P ( ᳸P000 p 0pf W@000p&++ Gp&++t&G`0@-@X0 B0@T1 S2@ 0P   0S p&+O-tQ0S hh6T @P 0S <@+  /000PU2 +p&II+0A-0S sP`||p U0(@TP`0  RF000S C@+p&J+JA-p`P@P 5:_p0S 0X0 0C?oR20S ,DoS 0/Jț&]JIJp@-/0@Pᡲ 0Pp SRp|+@-8-/0S$0$ 0 096rJJ+JJț&A-@0`0/0000 SPڤ/0>+b T0 P<uP0? 4 ;00?|+t:+~&0@-@0 080@0Ѝs@-@P`P @TZ TT9?0 00?+"+R  + BЍpKț&$0L<S/ @-)Pt:+~&O- 2@`VCM b@0DXCߍpTW B/ T0 S'44x'xp) j@t1P0S8Q 0SD{'{{g W:0000[9*0S >0 0S 50 000R*Q 90S `X0 c#.$cc4"0,4 4Q0 P 00000S  ` +@4+p&+K?KYKA++@-<Ap @,bPA0@0~& O-X3p0]MS DD@c@C 800#0700RS #07Op"& nRPP "2]8W 0"700RS[ 0"y7x(ph"lLmPP"L  PpDDB@@r0PSY : SVH`P؀/0 10L<aS$ < 8H @ ( D `  P  `\  T  ؂X  8P ,9 L88!88"hG/0>+b  P<˧P P k0?0H @P nP)PD D 8L P xnPBP|]ߍ+p&K+++K~&Kt:+KL~&LK +#L|+CLqP(Q$*+bLț&~&sL@-$@0 00: S+G-@ q `0S+@P 00S P0 S00P R HRڄ00S t7 Y `P 0 Y00:$00S $7++ț&LL LO-AMM`P@gpP8 0 840 AލЍO/0 009/P7 0p!p I6 ,`Q D D @P <⚱PD z@P@ D7 ?7 :7₱PD b@D t`Ġ崰TAލЍ0A. 4B   R ; 0 0 7D E@D W`0 H 0 D Wc t:+h Mț&LoBMA-MME00 /R @`㨀p?PP 0S P@ۍЍ0 D &᢯`D @P 0V P` t:+p@-0@ @P P @p@-@?@O-3tM0 S ttp00RS`3 T3T#0P|5LC4#S@<<tЍO0 6(PL   x6+t6p0@`00?ܢܲL<` 5L\0@ iWI < h`VV#W & @Pp YL<0@'pl0PxSiScP 0'0@$ 000 5L<0@ S,)dGd XL ltЍ0 0C0`10S 0`S%0` S\U?XU?h0SS   l<8i<0S d00X0\ 0`0G0P!bc0 <5d*?+p&_M+++L~&~&Mț&Mmt:+MM++MN&N8NINfN+l yNNNA-MpM`@PP 0pp*d!d>@P TT5L弦뿴< 05ۍЍ aD D< >pPU>}> U`k Y>p0P ]5둴b xV5N20S ">p T0TP 8 D5xI8 [EN.Cț&\t:+++NOGT@-P@-L@4#S 0  r?0#S 0 @h?~&0A-@P` 0 P0: 0tpp ?ᕭ0@$aH00S$`\!qp;#;S <%?=+XH@4+++p&X&+Xț&X+Y+FY+)YBYPYiY=+p@-87@0MS WPP P P ۍpV0S60S }00P 60Si  ""4h42ˋhȋ004488<<HHLL᳋ᰋᭋxx|]|ᔋ9^EᐋEፋ:^EቋE""442""442T0AS ` Pk PI lPdT0S40S xx00[XU R O!"441 40F""44"2"44"2"44"2"44(23(,0,T-TX*X\'\`$`+ᅨ0 # #1 0002#22 02 0 (0#(0/,0, H0T0/X0X0\ `0/`0d 0,d⡨20i0005/(0, |2-02R0L "S " 0x30=00 2R 00# |# #X0/80\ /`0d 0 %0L0<040h00S!*#3 |*t h1S 0SP! Da! AQdHX )9-0CS )  R0 R R 0N\ \0|Tt0=0- 9!m+lT@4++p&Yk+Y Yț&Y& Z(Z?ZZTZvZC- 2 B P000000 MQaM0S q쑟=聟0=P  RP 0AS^tl4P`=0p、0W\hq P  RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ8)0=ۍЍt0 h0P0`0\0S H,@-T++T@4+h+++#[ț&+ZZZZ [O-AM0A(0 "S $U+p0 (У0AC5/0(0#R00 #0Q0h2P00 (0S $0(C#5/0(0,0S3,0P0?0!#0,0@ .P Aۍ<ЍP(0S  +p0(У͡0AC5/0(0+p0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  B?(0S 8#R00SQ 00S \0l 9P tl&(x3  P8P0S+T\[@4++&G[+[+x[p&[ 0 +q@-@0SS+0O-wM0""<080000@ 040P0 00  0H0@0@L P0D`M1PP:P S  S  S;  S 0 ``'p SK  S"  S<60S  ,,'(60S 26v0S -0Pզ 050S  'Ѝ50S P 0 L50S  <<w' 0,000%p,,Y0S40S  ]'40S 1 P 0 0 8-- ~0~0V0 00 `40S 0 H j030S  '30S30S g1 ?0P? 0> _0_0V 0 0 8z-w-P30S` P [L 0 0#p0 0020S  &20S620S 1/P 0 00V 0 0 8--*-20S 0 $m"p0 00c /10S 403/ //!PbV00 0?X10S00S 0 0 8//00S 0 X/4\  03/`V 4   003&` /+[ț&+'\p&++@4+\[t& \TrLss8\\4++NUa\z\ q\\\+`8+tui \A-1( 0  S !@ 1 1R 4S8 !4|q04m@0t\a00S/ P0S  R+* RS-CP- !0 010000 QP 0PT 0$M +P ЍPB 0P;C0P|80S050 000 0 @ 00 0++T\[@4+\+']G[ ]@-|cM0S llhChS0S Y^Pt0#0,,g%_" R0W. 2r 0 0500K Pr5"0C590C990C9000Ph|n xA0S \2d"`2Q090 9  0  xh0 dP0 P80 < 0@ (| A+F__(_1_6_<_A+p@-P@P @0 4 0D !0R3 #p+E_ț&A-Pp` #˔00CS0SZ@ T 00CS0IZ P yTnTyDo0 @00  0 0 Sț&+-@- T 6L00S @P@0PIO Ѝ@Ѝ/ț&+\_R7@-P@00S#f,P uF0 8# Ѝ0R00Si,P`10 l`X00SD 0@P<#$00S $ +t_ț&__+f__p&o_@-@ " " "P  " P  "P  h"$P l H"\0QX X (" H"@0Rț&`)``!`3`H`\`XJu```0@-@MPPPP8  P$0$ $!Ѝ0P```E+@-0@ M \0 00B XK5 ۍ`p@-0@S g&t0P0Sd,P 0@00ᑡb p@044T"000Sp p@K"`+`ț&+ap&A-/`ḑ@Pp/@DЍ/SpPP 30 002P0000S@-0@S  0S 0 000h0@0S +P8  @044!000S @!a-a+`ț&+Map&@-0@S 0 000d0@0S +,P  @000!,00S @!]a+`ț&+tap&@-0@S 0 000ld0@0S *P۠ @000!,00S @!a+aț&+ap&C-0M.S`p4P4A0/SS 劾0  0r!U ! z  t  `!  Z!  T!  N!p  xH!X  dB! 00@ <EЍ+$a(ab bbb%b,b3b U@-EPE0;PP p@PP 001G0S8 0 00T1T00npAW4a 010Q05 S:; S0,PP!0z*0P  0 0r* P 0 k*Ѝ  _S-S xm)p0 00N*P0;CI+f |9 bb& cJ++b0@-CM@P0,  0  >Cߍ0cI+@- @ R200I+c@-$M0h `  P @PPDp$ЍPU D(0P VD!cTI+T0 0 d DopJ+ dcp@-P@U U  0< $p@v 7ddp&)dP 7P P =/ //Rd_dEd-M M? *2.ۍ Ѝp&4`00CS`0 XX0 X /&O-pQDMDЍO4@xM`lP !W200 u00020PS00C00@@ Rp@T3 W+X( U U P   Ṝ  \0.    ᩜ  .0X ^  p8M p Wp&vd<0!J+ #J+3<0S/@-@QPM PЍ@ p31Q``X00CSPPPPPPPPPPPP"1PЍ@L !0S SL   d0AS&<hpxH 0S0PЍ@踩$ r l h d0L1hS fS501 0400030020Pj0CS PЍ@=01 (0<00$0;0d 0:0090080070060 050040030020-1jS$ $%!Q Q  ( xVPЍJ+d<0!.Cdd(dP1!dq0!0!de;ed ee'efZ,e4ekHekeee+je1! fr2!fO-@`pR dp@-P(@P ᬕPp@&0S $  R RI0@- /khM+@- (0 0 0 0 0Ѝ+kh kkP P PnJk7k@k1k@-(M0@ #\S@3@#:@ X(Ѝ 2!`k7@-P|  S@P .jPP @7PQ|,O Ѝ0>hN+hM+0@-@QPM 41a! 4aDaS@$0d@Oo@@1e% 4eeT# ! "Q  R P Q T%<  @,Ѝ0%(T h \%T @ 0{P" $ @ rqkhM+>nkkkhk Q@-.@h0 \!@@QR  0hM+2!hO+0s@- @R`  6P.ĉP ,峄0S ,嬄|Ѝp l0!PU U 0< 4Ѝp@!Ѝp@X!&hN+>hM+wk@-@T T 0( ( ЍЍ@,Ѝ@khM+"!Q p@-@P T p@<?  p@60 p@0#O-0TM@0"00 p` @@0@$(@!P PLTЍ@PPE> @@0 Pt@6lT:TЍO|0 EW y R@x   ;y0P `yK  ,\100 0 S00C00  Q,4P `0 l0 0`f L` `X`00CS`0 X0@X0 X fkkX!&4Fk&@-00B Ѝ@-0  : ЍO-@p P4 aTAD -QP  P PPP@D`FRPP00SP Ѝk@-0@ 00 Ѝ@?@-  kț&@-'k@-QAM`@0Vp M0d4aXQX!0TL%0P 00 ,Aލ ЍP0001!! ?t0YI !R  0GP@Pls@ &o@c<T0 <\<@D@ \0D0X @ DDXP+l'l-ll(FlvltU+PJlll@-tU+0@-6S "_XP+l@-"&# xm/l`I!@P" X !TH ! <!4, !@F!ldmhQ+ tQ+@-C +#oț&0@-h@  0@ 0\0CS @Cꔢ&00S/p@-8P@U``p840#U:0X 00rX0X40P80 0X0p`P -7@- 0@P00P R*0 B Ѝ0@Ѝ/O-PdMP ⳕ@ T0D 0 S DdЍ`p | J ]  ^`!0 0  ѕ0  .0`  V0BP ufe&{ovoC-@`Pp㬀嬐@"!0# U 0 pp p; ݢ:P@T0S02P    ЍZo 4!o(o-,M[ H0 $0@0080000 0(0( $$04,oopppoț&o-7@-;`P @XT@  R 0@  B*000 Ѝ0@Ѝ/h!&.C$W+@P)> 0QA` p"> 0JA> 0DA 0q$W+.CksO-bp0MSP@M 1T S +P4"44J@ 5 X:0@8 0 p2o%ٍЍ` Pp W "R x4 X R TX PR*1 21 0T 1S1!T0 0*sT 1!0 0*g]pᮈ0 < W M@ឈ 0 < F$W+6!#{ssO-{JM M`@Pႈ3 <|0@0 0C?oZ20 `4  Sc/b8 ThK$1W0 0 04@pWp,,,4S 0U0- ; +8<: 4 @*:@#TRT 1S  HR @ 0p债p3 pX ,Ly,\ytTpp0pS  ,< {y,4, wy pp , oy, kyp  , cy, _y|  , Wy, Sy됹|  ,| Ky,l Gy`{  ,L ?y,X< ;y0{  , 3y,, /yz  ,'y,#yиz  ,y,y렸y  ,y,| ypy ,\y,|Lx@xW 0 \( , x, x ', HQ  (  X7$R Z 0XS XQ;X PD04EH0 1HpL00 1`00pD0 pIpL0X 10@sPXp&4 0#Q0KX00CsGX`0]oXP` pWI-`X )L L6T&8<f86/ 641 X00 h4` 갠Z 0 R(0 R pP \1Sti X0@sX 4 0 0 0 0P3A7/,%00D0 Jލ ЍX@  RH 1 H0GpH0S# 0 0 @3S* H  t8pW%$RZ 0 00@0P0@3A4/HpX񟗶H  t   0 0 @3SP1 04S) 403001!P  0p 0040 [*b_Y 0 S P40So0 00   $ $  0`p`08ᛣ#0S P   B ( P R0X0,( 0P$0 ,( p$0H0pp p0p<  H0pp vp0p+;㨀H0 H0fpp?0 Sp HpP  H0SpW 0 0H0lpH0pp H8p0pH[@P0P  p ppH0!p 0H F8W+!&h ( !& $W+.CsssZ+ssst tttP"t,t S3tDtNthts 4!ssWthZ+tth!&tO-`ؿqM=P `|@Pp Up#*p0T?SpDp00wP.0`0p/809` R  0P1S@?b @`  Q00 14@J0 ,&@@<@%@{0pP@ @0WX!3W0 SC0JSI $ x ={P@8PwP p080,l P8@ T@pbP3Y =y-  0S qߍ,}{0P00T - 880S ` 0S0Sp )PY@P,T P P040  P040 P P040 |P  h `PT Ҋ 8804S  0S0S ЅP T  880pS  d0S0S!1R0 0:q~d媅P9T] 0`080 Ro aBQ# p p p p p p @ H p p p p p P X p | p p ` p h ikklgj   p  l 975M 8 78 W $ R; R0!P  : <0<00140kS00   0H0x9Xh)   8 8 W \ R R0S*  %00140kS% 0404@T0q4ꄃT:k ݉ 8 8 W p R̉ R `001  k40S0 S01X40S~   0H0 4@Tt@0s;p00k4@ThXeX01S|^4@Tj0@sq iu0P.&90004 081@AI|P8 Bt804@U08080S@00 @ c/4 4 6@ @t6p8 80 @ Y@0-1 `0400<0,0@ap';  X0H?oT20S 0H?oT20S0H?oT20X0S0pp0r1!05 1"" 04 @1@SX` 0 ⶇ 0tH0c?D`D0`5p`H spH0SX Z⛇H-0A1 ^d! `0 D00P0`qp͈ t1!0`100CS<$H$1"@ =x@P qߍOdoob4S g043((0 0,0c?00400003, pTsp;WO,^H RT=00D@ d剃`P0=S "8 R0  0{P 0=Sd h"8 R @`  mP 0=S 0"8 R  qߍO( TV0@40,00@pQVD@0S 1SL X* 5PP `V-,  0 0(0 0,003Ap06/00`8T"X᥁(@,PX\0,S(` T'& Xqp 0"S  ~0 SX0T R: $W+$h!&tu1 ttu$u (aa1,EutJuhu uuuvv3vQvvvvJwwew1w 4!wwww!&wwx'xhZ+Px>xat8W+00S, S S0&P00CsL "\ `B0P T0LP0PT0ppW65h0l PJ000&00' T00.T0hPc0S @@T T T0P 00,0@L D @' 0`@0 J000.00}0h 00}PP \0pGp WqߍO0S \0,`[0 0 0LT0( 00,00p @-ن@P   x l ` T H < ,ț&||}}4}O}b}}}t0p@-@PT`ց P   p@0p@㍆ [+Y}}@-M @ P  + PWۍ#p@-IMM @`P~IލЍp P0 y0 lshP 0S 0S0 $0S  P#}~[+@-M @ BPD@ۍ00 R   P#[+H-p`3M|Mk&PPWZ@P3P <.P@ P 04PV 7 P00S , P  v PPi P tP ,!v[ ", P U(+"P0S hV! J1!0 pJ >P RB PQ  0 UxtJ|!|1h@ N R$BP< n @4S J P pRPh 0R :CoP᫲ 偀 > {P00 S5VP90 xx p10 `Xp[+A~g{ #D~N~VDX~i~b ~y~ ~~7~~ț&O-pMM`;p.p P@@ p dp p0Wp㼱0Z:0S ލЍ0 0W@P\ @@PLqLL?HP  1pZV㟉 1Z SP Z.pZP Z.20Sa00 0Zz0V9 Z-P \Z.@)0T:Z^P Z. |d edAȔu[+I~@-0`0 0cPP 0@PT cP Ѝp@&0(PP DЍp7! O-tM< 8@40PPp庐tЍB0PP(0  (0P$0,)$0U  PT T T;P07W 0}T6P07W 01P07W 00S\PT"7TP 004 0S0R0S00 00 (0$@` 00@TH*H7H'0D7 0<7<087P0T0@(0@P,@$00Cs$0640S 0TS0[dDt   0`Qp~  ;XIpv xX `(tj0P0L6PV 0a}0BnS010<0S 08 SJ ?@0?D000S5 0S>P ?} T0 HPpo 0}? 0H|0L 01`p1 0!5 054H L ,0 0,0 0@000D0@ B^op `4 0p0`Xp $?4 $;`p H\$?4 ;$hp X0 08T0U0 01`p1 04 3J4h `Pɏ 0|` 0|  0.B0SP0剤T400[S%  p8c0p`$Xop $;`gp 0@[ 04$;h[p h0` XP 0G| `0A| 0@[00P  05| 000 X,0S0T4 00[S>  paX0 p`$pH 4`P$;p> 0[ 04$;hp2  /,`p *, 0$4 <13h00H!T0@P ,`p , 0 4 030[P ȯ 0{ 0{ 0 {T0| |Ꚁ]WA(f!Y@,EOx@- 1ț&A-@`4Sp  P T0DPEE$UX }P00 }P 0-80 P $?'3MDPE@D \+ #p@-P@Q0  0 p|P @0S \r$Pp Hl0@ 0< 0p R$`$"&+7,/,/,/,@-4800S ,0 0$p 8  먋++tl0`+O-\M0 MS1 HpW-Q`@`((Q(0 Dss+ 0=P 0 0 3ۍ Ѝ0 000nS ?S aS ppS qS x0  0 d00L00 8̋+++&Ħ+ɂ&قA-X`0S L00S 08P8@p0Pp00Ħ++̋++@-@L0@x3@00So',0, 0S00g'븋+++7,4a+C-RP`tM  ,,E P RQ ğE R`S fz0t`FQ ğR   TDR 7 4* CR ` 0S $ L^ ,4\ P20@04ßQ [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+Ak`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0嚝00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊ&&7,7,3,/,+؃PA-@@P@T =.@ P`p0SlV d0 B@ P ,0< 88(0@A"& + ;7,/,A-@P@pP0`S00|0 R d$ R 0L 0S @!P@`T !/,+@+"&/,P@-- 0 C7,2P@-- 0 77, P@-- 0 +7,9P@- - 0 0 7,+$/,?P@- - 0 0 7,+H/,`P@- - 0 0 7,+l/,P0p@-AM 00@0 0@Sw- P1 PS" 0S00!C{;P 0S0>PP 0T00aS0` 00S0``0 C[;PaS` 0` 0R`0 0@0S0@T@ @0 Q000S0'Aލp7,Ä7,7,7,G-1MMP- 84 1ݍЍP0$C;P @4@0 3PZ30S Scs 6@PQ 0 3@cs0S0S PU~\30S5 0P/ P30 043 0 $3$ 3Q0RQ300?o2 'Q20S  2 0[P0002@0 0R R00 R ?P 02D"000 H 2 2QT100?o2& Qy10Su 1@P0001@h, W| 0PQ0S0T畿,PU Q 0S 0S0 0P+ 0! 0 00} 00QQ000?o2r&Q|00S  d0 0P000<0P7,τĦ+P- 0`+++7,ȋ+7,7,̋++7,ۄPC-p0JM M 00@0 0@S+ 1 @Jލ ЍS2 0S! 9P 0S0=PP T0  x1x t1 R0 0S0QY`# 81 0S ,1,Ě ! 9PY$P|0S @'00 R   R 0 (|0p00Q5qp P0ST00@M7,7,7,7,.,+Ä8,' 0 0 0 0Z8,,p 0 0 0 0O8,,C-KM MP2+ |2 Kލ ЍP0`"C79P @@2@<2000,xwP 2 0S@ 2 0. @P0 aQq0S 0S 00 !4@P .d1@0S t*6PL1 `0P <1P&P0 0S 0@T 0&`Y@P m d@ hZ0@ X_0 @ 0@3/H0T 00S00~&7,lj+1FY4a+/ +r+8U7,0@- 0肊7,7,0@- 0菊`+7,PA-PPPPU㈀ "00P@lph0hP宑00`0 @00_T,0P A^7,7,+7,7,7@-PA 0P00冑00 Ѝ0PZ"0P%0S0P 00c0@0S 0 S  @c@00+T^0 S +<^ 0 >0P7,7,+++3,/,P@- !0S000 005 0P "0 0@\P  0 0 00l00hIPL0H0D0H=P0 0 00 ԋ+؋++7,fȊr{ 000 0@-S$00 00 ++7,+000 0@-S$00 00 ++ 7, +p@-@Pp@0@- 07,7,0@- z 0)7,7,PG-R@Pp Pʅ!ЍP`P? P< P`TP5 -PT. -@PP*%&%`. U(1$1@W 10SV U00@  %  %``PK0 0  S  =V Up0l0@W T00S H0H 0 @@ S8  4#e ?l+++ ++f+8t @-j07,P@- x0 pP \00}ST00S H0H@P 00 0( 0$ 07,++.,&,&,P00P0Ss@- 0 Ѝp0` 0S P@P 0Q R   L 0Ѝp@轏$Ѝp@7,.,+8,p@-4@PP 0 p00xPp+7,NA-Ps 0$"0Ѝr0S 2 勏P80S10S 1}@a0 ` \0崁S Cb"c! !    c#A P0U0CtQ00CS0< ) P?00CS0@) P7 (!8.PS0(p00 P 0b" R  c&0P UR PE 00P0 0 Sp(0L0 0 S7,x++S̋++++&ɌP00P00@-SM  0 0Ѝ0Pl  -P 0)qpP@ 0 $0$U@007,Ä+P00P00@-SM 0 0Ѝ0P | -P 0)qp L0@0PEJ* 0,0S 00007,Ä+ P@-k 0 P]Z7,&+@- (0@jP0 @f+3P00P0A-S쀟 @00ЍP  H-P 00`P P!PPP 0RP j@j@@|.p [ Df[ b[007,=& P00P0O-SM   0 ЍP  ,P !@P@ 0R@i`;.|0P 0[[0hph`h@Ѐ0000 0<0 8j7,Ä=&7,8,+,'Pp@- 0 0p`@PP P P@*p0 ` S P@@ @000 (07,d k+sT+X+A-p`P @Pd0 A\}P R00-4 0 RU Ahꈋ++Ѝ A-PP   R ЍAAP   R  K@0S00Ѝ@`p7,h"&+(0A-p`P0 AP7 @PLp @A&P 00 007,+p@-X@PP D0 p<00Sp@,0,0 0Pp+7,.,+.p@-0@p@SP \0 pT00Sp@D0D0P0,Pp+7,.,+3`ep@- @x@RP d0 p\ Rp@L0LɌ P0 ,Pp +7,.,+mO-MMPQ  3 ٍЍP0 #C+P S@p3`X 3 | iPP@)LY0`t' P00S 0P @B0S000p@I2\2@0SP$S \S0P0" 0   0  P#"00B   BR 0 D )bY0 g@0SPiR0PS 0 D)b|Y0g@P1 d1 0S x10SL1h`10S ,000CS0.  LY0 03/00S 0S 000CS0 S0  )t+Y"00000i0 NX 0`S8 7,+x+++&+1F+r+++@-@P i00P c00P]00 -h0lM X00S mH 0d[ P000p ;븋+++8c+-lM T00S imD 0d; P,00p  l먋+/+8c+A-@ gP` p0 0C0SQ3  ~SPP 0 B RQP  00 0C0SP3 p@-`P@:~]P b- 0S1PS !xX-p@lT-S+`)P %a]P00 0D-S!0RIcYRp@-@P 00PU f kPp00p@-`Pp@0P<W0 .O0Sp 0h R00ٮ Ѝ0 0S0C B RQ"  H+]P/0S/0@-@Q0%Q#0S P   R   07W0C2007W  Bꔢ&G-`P(P @ RP  RPU0 00P0 10S / \Pe *P@\P 0pS 02P p}*:P\P pu*P :\PQ p000 SP%0S 00S1 @RđU0 p& `;RP0 0 U @*=*:* 0 011 0Ѝ @p* P*W 0S000*0S 0PS S St0 0S 0`S@*H0pW ),pv~8+Đ+ +( - BR0 R  P R O-0@!M M P<@8@4@@0D@@@QPm4` 0p 0S 0S 40S 0S H偭@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /-^TpKX`V V5PUp@ @l0S ;^@P dJP TEP D@P87 (2000@0O)@P4`[P 4@P@D)4:4U[P 00;)<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU VPPP @ @ PpW VpPp3 Q  `3 j +U =0 080( S, $#(0 00 0$*0"0 0R S"  c`pPR  0(P0 Z , \0%T00S9 llX% 0S1  + U=0 00 (00$@0S0S20}S,# @/ZP00Y@VN 0SK U +HkU+ H3U+H/UH` +@]U=0 00P$` Q(0 A `00+SIU=0  0`0@@DcT@@0P/\P0,00(S  R[@pꥐ ȋ+ 78+W+Ћ+D ^a.,7,ț&?+̋+<Y+O-iM Mh8dLlOpt͍40,xHD@|0 0PH0.600K/p% ,A'@0'4QD'8aO?ⰐV=HLa少'TU01p 0S `PP wd0sh0sl0sp0s0St0s t5U 0S V|V=0S w'=0S0 /\Ph'e'`=0S 00SV8  0 _ 0 . =0S ~9P' Vi<, )0S  ~O)DP$.t>tN0 0 )00 @_QX /=0S-p= 8pR* p $p0p+0 RcP;0 00|S Kh80S;0y I`M \= 8= Mdt\[,SL;P0S004  V( m:+ 0S 00S `0Py 0Sv &pb̪ ⛨PPP 0S :E[PR bX :HNPPW xPx0SV x0SZ +0 0( P$P %XP  0`!U/1\1X1T100p `10T1S 0S \AT! 0S ;cP p 'UR0 0 0S 00S P P6&\K8KύU000,! 0!c4 8!0R PP000f84010c/10h`P Vg04 TީPtPt0S4 4թ\>gU`P@xTv u 0k_0P0/\P80S PPk/@ꔗ R R00S \k?/\D80S00?o 2$PZP0 P60S P 0S%P 0S%6Fp圆VqbP@3|)xRp60h6qP 00@T ` eP 00@T ` eP 00PO fM`ElP<t'N)P<}460S(`x@T*4!D.'K0('$%' 5 uPU<PV0 0( ,F„ ' @5 h5@T O?00$0@4!&t40ShPO PT4T$T& &Px ,4R(&&p0STP/X3Uc `40SI 4 Y &TXPt&('p8xXP 30S <4PFXU8cb30S 3 ' &U@b |&UT  s&`R0<0`0M$ @0<BP= rVP? 0 R ,2000@/ I$`pP8p p$p0p! <0P,ȠZS @P t2Q00S P PHT 4 LTr p8c+Œ++7,QmX4Fp&n]s~t+++} H+,Ҕ4+ D+:)c~|dNH)&&y̕2!T\@Ж1.[+p @ } ϗ7!ߗX+1Ch7,+@B8c+ucY+++Ę8,+8,+PA PZ 0*S0 7Q0O0-SK +0Q $0B 00 S$0 0<0 0/R7 *R0 0Qp80*000S% !0 05P 0, sL0cLsP 010SszXP "#PxyP tP lPT~V zUnZa Z000SP NP P a "<APY Y V` p尦T IGU#/K/IR032 U 0S|0#0 0ux#2S 劦T$V ! $4Y0SK?00 T| V  4 (}SKM|D4 PT0SJp40C $ 00 00Q$00S00{s0Q 0 00& x50S0|0 580sw858p00 RQ 60S50=upq 6d R060&00a 6R P T60F! $6@6`l0Əs lL0l0Y@T? V  _%P¥Ic0 0  2 @R c0"0C?o2? c"0 "0A@,000 R ;R H^P |000 R RT 0S>0S(0?'"( ,0".0S ?0.T0@.͡!͡!..R0n0"R0.͡0 K$PP#PP0S0S80S#PP ?BH(H000.R0@D0$. 0 pwx'xT PpPT \ XcXP\ #P U l S R90S x90S|9tyP $T0S @DT90S pYF1!0S   PZ0S= S EG#<: <:` T00R0SC rPqJ  _$P-  ]P Ub d:0Sd: P _** ϠP 0; R#(T @;R.sr ZO.!0Q3/Pp;@ >; R0 ;Q;F_+0 0 S dh lp(#0S,p< 0R.Kn l-+0S Ӽ000S ̼000S ż000S 徼00|iލ Ѝ0S 03/0S 嬼00s@- P@ HP  HP0P !Ѝp`P  HP 0 F/UpP Ѝp@/ 0S S0S  G0PPv0@-Mh 00P P10S 0S00 0 Ѝ  qQa @T0 S 00S 0s 0 :QP 0 S000Bp@ T d\P 0|S  00 0S00 0000t++ ` 8c+8++4F@-`$MpP L0000000r@Z0P/S:S y@P@tQVֻP һ$ЍUZPȻ5@ VL  L ML0/0SPP":SpP @P//000 09@P00`0@@DcT@@0~0@0CcS1S@k7, lPP00/@-` (0@ 4 000`@踋+He+@-` t0@ #d00S X0 0Pp E<0000S `@踋+++tlHe+@-`@`00S T0 0Lp !8 10 10S kv`@訋++tlHe+ h0@- X00S L0 0Dp 00 101000G븋+++tlHe+Ħ+ -X0lM@ d @zK80 0p  '븋++\f+@-0lM@0 0 00 0rS sS lid dNKd XKP0 0p ,d $긋+Ħ+He+7,B3d+\f+<@-`PP@ @0@s8#80U 0s8#8000@? P VU 0A0T0Ѝp00CS0 S0 S 0 /&O-pTM|0x0?X0 "? 0p 0_0P`0V0X B@0 @040SD H 8PZ0S= S DV0  8@P*w_0S s_0#S o_|0pS l1 R XaR 0# TQW_tp uTЍ  ?$0000  PP:_0S 6_0#S@DT|0S ph@"\Q$0 V `|#L"0 0 "@B++O-@BMMV@ Al~?0a>0 @@0P`46 pP,6P<[6  BR m P5(50S5V % 0U P0WU S00G00S(+ I 0S+ 0 S( Z000[9  BR 7$5PP00CS0+0 dP @P00CS0 0㠴0 0 {P8$ ap0,TS (400  00BލЍ@3@30S VW@@c3!BP3 0p330S' U U# cT$30 CRKH3000+ [)[00E@ 0A>V0 `W4$2 22 =U[2000 p"00KT1#0V CR@U-[ 0S ,2  00 020 CRUT<10S@d@60 @S405  [ [P [ 10Sʶ50F?oU20S d10SX1p10S} U T U00T0SyT} dT([@ 0S10S 3/1V 0    0ZR\@\ 0YS P 9/ 10 XS P 8/0FHe+ 7,H+++L+++|+\+$7!7,&.,ܖ$+-A-` @T O 0 ЍAЍ/0p0$ P -x {+O h0h ?Xo0@S LP 5/|+7,He+ cY\+#O-@sFM M`  @[ [ 0[0$0`30(0$ 0,@!]0P S\役0  3 Fލ ЍO\0 @,Q( H2@@Ȳ@aGT  Ξ 2 @\ 0 PD0P|2d QP `"`dG LG0S 00S , 0(d j PP dⒼ@0S00?o2 P^ [0@6[6 D01@np  dj 01 AD0(66S0d00 0d0KA0`PS PP P 00S t0 |0'P@ 0 @00,`@0?Xk+(+ՙ7,.,+zD +4Fhk+m+|+"60O- WJMMsn0pFXv600S00p  9PX 6  60 9PXӻJލЍD60 0 0,097S 60Sa 6 y0050S# 䵟0S5 Q S 5R "P 0S 500CS\5|jy00l;0S P97S, 5D 58%8G0S 500CSX0$000(00000 PN 460000S40܀C XSX @4000C 0h00d0$ 0`0 P@ CP 38w!>\ 0h0d<` ((0#$0#c# $c4"$( <7$("", &R h3U0 R0S R3""44008'P 2X0097S0000 0 0S  | 0pԺ8'P820 00 0 0 wY pP 087P0嫺 97R` S㸁 0S [10S/ 0S+,0 00 0<0 1, zOP8!81 R  t 0 ) 1Z&P 0S 0097S;7(0:70?70>7='<0S P0s00UX0 0Su [X  THe+ԋ++d+hk+H<+؋+++++@++p7,u+LUt`g+ T`k+֛$4@-2Bp`WLM LЍ@C pPk  pe 00011 0S<0 ?!tq((00 Q 00SZ=9Q ='/?@#b!"/p8Y0S Y0#S 0(60 8pp Y0S Y0#S 廹 pp 90S0 00 0 0LЍP4妛v00ԋ++H+MbHe+nK0A-H`D0 82Vp  R`RBR RB`2b  Q  ,D00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 !, 0@(00@ U>,00@ Q0 SG1(00@8 ~ (T!000t, 00CS0,a p@ TD0@++.,7,+>+FJ+@-,@02 OP<,بA-`P_`p[ L:@P  84@P $.@G :@-@P*, 0A- 0@0PS0p`0P㬀" q6P 0S 0"S0x R S  p`"R"^ 0 00&,@++7,|2&,+0@-M M P 31 @ APۍ Ѝ0Ph4/Sz? @ @P;0@TP/Ph PO-@P`pW 1@@Pp3:A@pF<@`ܰ0X1 0C?T@1`0 10S 0 SY B0fc Q0"?0S*00 0-0 Ѝ8,+@-vEP0@0 @p pP0 0SP0 0cE@Ѝ舋+ht@8,P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C ++v++@-0 000% 0S# R 0S0000S b0C("( R S            Ѝ ꔢ&&@-(A`0S0 0 0 0!0p 0S:S50P0S0 0 000 p 0S:S5000h `0PpT岤00, 0 p(妤ЍpX+T+C-@\ᄐpA`\P ^T1:00"\ \ L 9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR%0R0PMU20S2 2"0S0 C0GQ .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10N[00N B B ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0SP ^*0SPZ*@P0LG RX QP 0TJ*/0SE*<0 RS=*9 0S  7*+0S2*> @ S,*0 0 0GS$0P(0&ꬋ+4F.,&,(&,&,/A-p`P @ህP0  T  `00T  <0@ R   `FVp`00CS0 X PpTD000`000 T00(&:C-pP`<@0尐Ta  00@)ax0@P`0 \BL00D P 0 Ѝ+?+Qm&s}++G-M@ ` 04P0 43`PT 7P #T. .30S+ ` Q `V` pB0@00E.002 7P El"l-BE@X客ލ zp`0(T $埢 mp T┢0q10@S   0$ 0/ 0$ WpO~B0$S*F>C0S  {X4 `$Q(00SZ=9Q =(/?@#b!"/0 0p4XB0S TB0#S ZMB0AS  T0 0000 0/p 0S 4B01B 0 pw0LT P!B<00D h+ΪH+Mbzp@-@Pp@p@-@PP`=P 8=Pp0Spp/ @-@6P :'@-ʀP2N@-@p (wP@-P똫0@-PlMQ@00 00 T  40S P L00 P C0 0r 0 PACcpW' 30S ";@;@@` , L}, y,P `PJ P m0 S8 )0P 00P02  2 PP 00 @T : ? P ݛ0 0@T : ?P ΛlЍP 0S @P@E : ?  P@: ?T T0S @P@&: ?0S @P@: ?Tw 11@T  0P 0p`V;PP)+000p0 0 0PhQ X^P@8+p+++ &m}7,ˆʈԈ&,+++x+>t+++&,&,7@-P; 1 Ѝ0Q0S 1 1CP !70 CRhA R S0T!L1P 0S0,!S BP 0S 10S 0 0@ @w+0 @0@o+0 @i+0 @c+0 @]+ 0 00S 0U7,+.,++ċ+0+;++X /,/,/,H/,D/,$/, /,i l/,h/,/,.,Ћ+00S#@-@0M, > 0P0S8N@0Ѝ0@Dȋ+ۄ-A-0S2 >0#S. >0(0>0S0T =0 @0pXp00 PQ0,0>0#S 4ЍrP @0  00S   0( Q00SZ=9Q =*/?@#b##/ > yp >0S |>0#S x>0 PD0@P>0 47k><00(0`F@|H+Mb+0@-S`p@  㣖P;0P> 000(0/(0S,,0S)  P 0PPEUPG :=00 00 0 Ѝ0 00 0P (0S,0S 0S`n0 0PUPPϗP !0 S@-p`P @P,0S T000(0 ЍT0070@ R   `FV 0P 0 ST(000(0T00(/@-S=<,<0!R/P(0<18C8S/Ž10/<,,&@-3CM000030S3@TCߍC%="=lP ==HI<#1S4!(R< 03/3CPQ2{8`P0R0A@SB-R9@P; Rbp aP7@00S 00,S 00S0 `10 3/P00000S0S 11 03/0S1000/}p0 P0 0 SFn000 8PTq0 P00 S*$R0000S 00,S 00 S00S 0 xp 103/P (000Z6t0 h 000`HH,H,H,< <,6,&H,)&ϬH,LH,mPHr5.C8UF,0.<I,@-)< 0 A I,@-/ 0I,=,P `00CS`0p S00 P0S X0X /X۽&C-Pp@  l18C8S `l 0S  0e`V   ЍF,,&I,*>,@-H;; p( P@ zP ~H;;Ѝ;;X0/LA.P 00Y,`YAG,&ț&cYLX0s@-@ 1`8C8S P0S 5  H@0 0nS ЍpH,,&H,tlH,c@-PMP Tt P H00S@0\A PЍ @cPλ Hu@D,,&{I@-@80rT 幻GE aH,D0@-|AT 0S *5 0 *,&F,@07@-LAP/P.0P00  Ѝ0,& @-@0S S S 0\ \ \R@ R0 RG-P@ ?4  圀?4 p ?4x` @L QT@D0 DЍG}Gs0 ;@T*Qs00!)&#GG-AMMP`P4B  l2l h2 \2 X 0 0,ț&T=,@-MwP Pppp pl@PL\܍@, HP ܍,0 < H,ҮI,,&0@-MP MwP%@S0@SۍЍ0@CP551d dxPPTۍЍ0@Ķ@ 5] , ۍЍ0H,=,'p@-P hh=@PpTTlPp@8@坶 q8D,3n DE, pE,0@-M0Q00@ 011 U 6P 0 @P00CS0p 0 1 1h00S0@oЍ00 0 P 0S*0008D,Dj #&0Aq P/P//0@-^@\P0 R NQ | 0\ P0\R@ @ 0$R ^ ?E,PP 80 dÅe"Å^ P?d" @ef"/8D,F,A-|űx@xPx`xp 0TS 0T `0h2SlᲱ T 0T * 0娱 @ )&,&8D,0@-P@4Ml$&⥎ⵎ 0<, p"lR < 0 2  8-   C8S" 0!8( 0B(0R><r> 04Ѝ08D,,&@-`0S@ PF10S 0000q20\ @38D,# 7@-0Pl000@h R R  l R  P4,03/ Ѝ0Q P,&)&8D,#p@-$A`1QS 0SP *A,P00p00+0P +P0 +P0 t+P  dd喱\"0H@H  "  \ p,&8D,YP1Y 4 1ț&T+&F,00@-18C8S 0P f,&I,@-(0(@ 80@ PH,H,H,p@-`BM PE@0 S0`018C8ST01y0 T0Pn00x0 BߍpB/ BR 000P y0001H,,&pI,H, 0?o2 0/,&@-AM// R //0b0000@000  Pڶ0 q ܹP 0SS WS BSr0 +ɹP  Ts00S  1@0S0 pW ⊹18C8S ؀0S R  J    |P W 0@^S00CS00  S00 P0SH,4q F,H,#?@d &00 S @. @ C< /0ЍCw0.&?rp&n p@-M⑴P* 0: S0 0 S P@` 000uЍp p P @TPH0 0000T/J,O-0]M-SP M0S @p܄)P8 00S0W0S' (0S""디` ?pPxh4P ]ލ ЍOv/O]ލ Ѝ ' '@paW ]ލ ЍOp0: S  SQ PPDu ዲP ᄲt60v: S+7"$ 0P@`#P婆  HP p  0 0!0 00 0S0S`--P``;vH 0S 0` #P V P z{ RU^R\pPS hPx!1Z[ d 03?0[ұp`4 0S!P0!0v0ᴧ P: v?b & 0S -vⱱpPvu#P-Kᶱ 0Sᱱp<bJ,.&]A.^ <Qg}Ǽ &0 R R /0@-@P0R0  APCU 0APLU aC\ACP 0^0\0R0 0 0@-@P@@ I!P X!IP00S D00S  40 /I #P@[0J,H,|X,D&@-J/g@-̀Pp@-P @mp 000/PK,p@-@P0-S@@p IP0Tpp0p@-0@S`@MP0@ ܦ 6"P@ЍpPU P  e0P0.&PK,, @-@P @900S@PK,p@-@PPp00Spp@dPK,A- `pP@P000 PP0 0A` (@-@P P0P00S@vPK,@-`dMqPU> 0S; ucP2 @@?T/  % `00@ C @ H00 *S 0 000?0`?ZP10HG>P rdЍ< 0@- Ѝ80098<@ q|/ 00\ /X,G-pP`!@P"i9  `0  P09   q!09 rPGDK,X,@@A-p`VY@  @ @ 0 4xP0 0r0 \T 0 0x0@A;!X,DK,0P /X,\ -P0S0@  P2:1S0BS /O-@DQM@@@`@|0S(!U  BЍObS9 .S8 00C S 0  ?QP t@cS@U:i@0@0CS000 000C/  0? QP @@X,ۿY,p@-@P 0S`PpPQ P@dPQVL,@EP0S  p P.&D0&A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0S P@u0C?o2X,@-dMpxX@P{PLyPHwPDuPT 8S8c(s0S3(3(!4!!!8!! 0 -R  UR +R  >Q @c?|0:S [?t0cS .S bS S@ @0,S@pS wS ,IP ( AP 3wPt@Pp@Pl@P0 0  SxXPXP XPXP hP ^(=Y,Y,Y,Y,$LX,l@1&Y,Y,x& 0/X,@-  01SP R t0 T!WP R HHy@08 ,@"P0 X,Y,  0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aR R S R0/0 R /!0 R0S //@- @PH ` 0#-?00&3?=0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0P@\@P, PP@@(Z,A-P` @P lpP ` L@P  A< $@sT yK[cpZp@-Pl@P T0PpD+Ppp@U p@Pp~4F!q O-MM`p 0@P P0: SXΙsX  ZP  @P> ލЍ R R R00 P P@ P @P PP 0"SU T 0S0C0 6/ ZP 0mS PmPA&@rH80S 48PS8P Jo088~<80X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 0VP0J``` P Q`*ZXP@$ 0PY,(Z,Pb,kUć,,x,#,4,D, hA&4FK,.;J`([n,zDK,y;K,tA&^  PrPY U UV "0 PbPI U UF :"BP40S %dPNP5 U U.P!0P.$% (P0 !R04 0S40գ?0/0 $0 S00C0 $5 !R085 0SH50գ?0/0 `%00 x5 50iS 0 |050S080200S/Y,p@-@P/! pO-S`PpM`z`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0i80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 60P R* 0;P0   80 eP Ff [0J0CY,0   /G-pȀWY+p S@05PPP @ ZPPE0S`0S P B0 0R R@0`p@-`R P@ c0P @@@ 0ppG-@P `pM@?00C  RT0Ѝ ` ?i>P ?0 ?>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#8  0 |,pK,p@, 0@-M + srp@  ) PP  000Ѝ0DK,c,400S/@-$@P P@8,DK,@-@P  DK,P/ @-p@''0@-M@'яP00S@)PaP DP OP AP )dP oPit|0t00SЍ0 ᦏ0LP 00+qp寏00@&)8K,R.&O-(M0S 0S H0@S R u P 4X ЍL G@j Pp 00n pPPP`TP DP  PPpP0S P``30STPQPN ((@(!P3`00uP0`0 pmP0`0 4P T ( _0 bPf& 20SP `JP   @( YP Y |2 pd T2 +D2p@20WF0b,2P 0S P ( P# " 1P C/}&0S )/ 1X P DP Pd1 c_L10S Q\_ 010 (0 qp 000Sp 0 rAP 3 0 R  [ R 0 0P: l X DK,@K,4Fȇ,-c,# K,HK,$,<, K,4K,LK,xd,hA&`,,\D&RP@- 0@DK,00@-P '@c,W4FA-P`XpVVPU@JTWlP0꼕, 0 DK,@-yP@ @0 DK, 0 DK, 0 DK,p@-P@@P Pp@7pp@-@`P*PpVU p@] Pp PpA-@Q`Pp gu^q^U:G-@@` PР @PUЍp pPF^7BP ;^8p0SkЍGDK,@-W0@0S @yDK,0 R/%R %R0 sR0/@-(@0SP00$c,G-`dd@p00CS0 Ѻp PP 000 P U 0D IS  Ga]p@P@- 0PA-@0 0pR`@0S00 R0S@00`P0S U  P@00pA&qA&O-M@`zDPp!Q Zo`@pW*p%pP` P` X P UpV`LPL`00@0H0L 0`YЍ8P `@00pA&qA&@-@+pFPPP Ѝ@B@@@`H0H 0P0$] +@ ] Ѝ/?mb A-PPЍ0S `p@@@[PP D00< 0`W P\ C@-@@ yA-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0`@@K,DK,C-EMPPEߍ@ 0@!qp `,ᇋPڬ嬐P ` P:T0S EP @  S0pSI`P  P@Y,̇,A-kX1@0SGk @1RpP? ,%@ 1P````P0p000 0`00 \밀P@pW bp[W P0S[Ѝ b[@K,4FqA&pA& WM0A-0S@`@P0L ڀ@p3`P[@[[K,@-@@"P ,P o4F@-M@P ἼPۍ@ ۍ1O-0S# 10SPpuP 0 `|R@0 -R` hP JP D$@ ЍPP MPP L 0^ J[ ` E[V @T P uX%XSP HT@@P@T 000d0(@t`<P#@.0S[꜇,K,%4F0A-`V8@PVpP0 PЍA#mPj`@@@@0 `ZZ@ZT ЍAЍK,EO-M FP  @oЍ0@-@P0MSP @$^^ $P+!@Ѝ0@T@0: S *@^ȇ,pD&D&@-M@"P͡0 00'Ѝ0@-Mp0P@u Ph0 R\P0 R\ tu p0St00Ѝ0DK,c,c,/@-@?P P0@/R@-@ &(0@0T>$@X,@- 40 R\00S@@(c,,h00S /pp@-qp $qpP@ QPppX,@-P$P3#0 R/  (c,O-q$M0S|10S%@AP`\\100CS0S#P`vu @@(P`0S00S($Ѝ|P`@n 0 R  0吠00刐 00 000 0 000000  0P0000`0E X,T,K,pK,S,xd,O-M ЍO *O-P@4M(0X0 ,0ut@ P4Ѝ40SX400 ?Q)(@PPpLd00$0Jp P:P  ` V0/ C@p` P P@00Pἳ弃0v V `V@P,0S4 x3X4 @ P6L)X30pW0 0 `P20S Y Y` P P `V@Y*)P `@T_@ P0S x20S  P0 (0 S =  :&PI 20S 0  @ 1 0R00S8 P Pd p 4ЍO V000 P0m 0PA R TA 0 Pp``@P,1` !X$0r$0@P_ V Vj@Px P P Pr P^@Put$0U$0@P_{, 0S V V0$0$0S B@P O`0 (,c,X,,,xd,,,,,7@-P@vP ,0 R  000 Ѝ0xd,O-`wpPF!0 0$0\P0  UP  NP ,00 N8PvAލ Ѝ :Pg t.P \0`=V* !V' <V 0F^S0`͕0͕0$uL>V =R+` =R-`8 n Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =PV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` HP `` e0S} 0Ps {LD&Dc,U&4F&mo(1@$0 RP  /`c,0 14/`c,0 Q/P/G&@-04 ,    00T,T,T,S,G-P㌐剀,N@(NPT`ppP UOT QO  !  DO BO @`匀`c,A-8p@0PS` 0P0aP `c,@-@$ 0 @z`c,P 0 R   /d,p00S/p@-`@mPPPpP 0S8@pPp  ̇,`c,پ+@-@P00Pl0 0  ;D0)(<'(8%(4#(0!(003`c,HDUc,d,d, d,,d,P/0/`c,0p@-@00P0 0R 0.PPPPPPPPPQQPQ'H'D'@'<'Pp P0 Q00`c,c,d,d, d,,d,C-阁P0@SpM`Ip`ll!0 0!0S~0@ 0  K@Pa00CS7 `PU7 0 Ѝ P -0!0S @P 0R 0rq0 U h Q H S  {PwP؇,,\,p,`c,l,.&.&,0P$0 00S000/᠇,l,؇,p,p@-L@P`0S0000p01S 0p'P`c,Pp@-`0 p@X10S P@@p(1@0PSP5P/u`P0@@S  1CP0 1C%@4P 0S-000|  0p  0d  0@@PO 1C[P Y,`c, T,T,T,S,O-|C0M0dwvP1Sy0\P1 0S Z 0 S1C10q&QF 000 00PP20SI 1SF P2!0sr R0l2ap01UPL20SDXO 1R.sr0nS`J j`0F[J 1RKЍ1S ऎ 0C# R Y1S1S  ` 0kP  00KU1 0[0 `0S1& U F& 0R 0èQ0pP 0C001萄 S rI  0`c,\,pd,̇,K,c,,A-pP`|p00S HP `P 80@0@D@ 0@0TЍ̇,`c,K,p@-P@8 02PpA-`p@@PGE$1S 0P $@@|d,7@-Y 0 0R  x00S U d00SX00S D00SX   `c,K,,,\,S,S,̇,<-0 R!  ^ !0`c,04/`c,0 R 00S P@0~0/0P 0/\!4 0 / B  0/`c,, 0 /`c,qp/G-p`@PpP 儐u U 0 0W 00V@00CS7P P 0P@P`c,,PG-P0P`PpЀ@ 0@D~ P tV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB`c,,G-p`P@0@@0W  S #R0C00C0Ѝ 3,P  j 'H 0 CpGA-0PP@q1k`EP q 0P 10`c,G-1@`p`P0LL0 rS00TD`0PT@K,pK,`c,p@-@PPp P0S0FKp PG&@-0P G&80P/ R/0 0S 0 /f,00 0S/$0$ R Of,؇,nT6k.sq 00P6 C06PU p)`CP0PPЁ  G.P ,DK,,@-P ,0 0R = DK,l0@-0`  ^ @^TSa04S '005S #DK,,0@- @P0QA 6R 00,G-[pP@P P`PDC`ACp6W @,00S/G- M`pWi@吠吐qpp6W @ Ѝ 0 z PU!P P P 0 4it,LU,4F @-000mS Ѝ 0 Q0 >@P 0 S#  PPP0`0 S } Q0 R pV`PPp Bp00pK,17@-PU0P( P@ P0 Ѝ000SB@PP B^PB Ѝ0@H00S< Ѝ0@: 0 0$04 K,4K,<.&Pkw 0 8K,<07@- R P(0(@?@ 0 Ѝ0@U&pK,@B,@-P M# @0.S Z00S Ѝ ,0S 00 00S000 l 9gP0@  0R 000@0,0@U&,<07@- R P(0(@?@0 Ѝ0A@z Ѝ0@5A0 00 xU&|U&P/L0@-0@S !00 $0$ @$,LK, , P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P@ Ѝ04@P,0  0 10 hU&dU&X,lU&,#0/0Ї,P/RP @P/;@-@| p l @0TxSPLHD@<8@kU&"\&[@-V0dSK@S!1 CRJT" R&0CO  R갞 X X X X X X 0 X @P3 @.A C#R8 X Н X X X X X X h X X P  X X X 8 X X X X X X X X X X X X k C \ ,0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~d,O-@<M`00PP*0 S 000C S 0  ? 0p00C/  0?ApU:X U :TЍ D0!R1@0P S 0,ST(0 @0D@D1!0C 0d,H&H&C-PMP M 0-@ݍ ЍC` @B0Sڐp吀吐o -F0PUe`B`P0P F @@ݍ Ѝ 4CH&d,H&#P@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000qA&pA&2@-PM 0  0 x0  @l|d P 0S>000D ;0Ѝ,0P 4F,,<P @P/ 0 /TK,P/00S|,0/@-@0Sx,0/@-,@0S0 0p00Ѝp,e0/@-,@0S0 0^00Ѝl,0/400S/(00S/@-4qp@`,DK,P@- 00@ ^S00S00 Ѝ0X .8U&p@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0SX 0Ѝp40@0000$ Vc @X,T,4E P@-P A7 ЍRS+DSSS 0e C RĦ ̦ ` ` ` ` Ԧ ` ` ܦ ` ` ` E C CS -S 1 CR 0CrS dSWS ^S0Sh0wS     0  E000 0 FK N R WR Q S-00 0  *D,E800S ,00S 0P//ἇ,T,X,$0P/0 0 0C/ć,pK,X,@-PU  @A Ѝp`@PppQ 00S0\Q0S 0S@V P 00$Q00X,@-0 S 0*( (kb Ѝ * cbsІ,x@-#@ C,tP/0S/P 0  //D oP@-/< 0LP/І, 0@-L   ЍІ,X@-`MP@ᬺ0-S0p00Cp S T 00ЍU TP PTU $PT00W`O-P$M cLP 00S S03/0L0$ЍeL0 @PpXX 0 R @@-PD &$PP 0@093@!+P0P0U0 P @0+S3P <␺<9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P!  aK[  0 p0 @ =RP   R R tq000SPP000p00CS ,     ` 0U?o 200@S 3/TWU 0 [ 0S00S0000SL@40 S 0_P&00S І,$,LK,@-@PM @PU@`p0@ mTPU   c,A R  | 000CSc D T D D D 0  RzV)00SS# P}U  U Ud0?o20RP 2/ 0RP0 VX 0 |Ѝ 0?o2RP0U U U7W0 0S00S00W 0 0S00S000ES\ RU U U , 0 S0R 0  b R U2/U}00SS 00S000 S000:S U000 0 ~JYu Ѝ@-P;`e@b@@ap0 `r^ Ѝq@-@;P  @<(,G- @$p`P 0(S%0  P@@@0^3#@- d 0 Ѝ,7@-P@2"@? Ѝ0@B@-<0?B3c/ ( 0 0 *hЍMb@B40@-0@@T gP  0 HU&<,04S S S ˦0S  0 [Q0幦0S 0  C  Q? 0   ^R000 Q\ S$R 0C 0N0P0000\\   0C R 0 CpU&m,O-pQpPpMW My@xcPJTpd3dC  \\Ls +PZ PUA (3T \ۍ ЍpPS@DT2P@  @@ 0 D/X (| [@ (T@"0S000kP ;04P ST@ >8 Pp 0Q 1T n\P 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P? T0p0000,,pU&&,&u!m0@-@QPJP |EP l@P \;P VPVpU&!4F@-@P @P P P(@R'4MO-|1M0S" @`0 ЍObPp400 0 Ppxy@`00S 000S  0P Ѝ D0 000 { ;' 9' 0S @`,,^؇,̇,0@- LLPR^0S @T 0 B,pU&0@- LLPR^0S @T 0L B,pU&0/,0/,00S /,@-qTP UPUP/@-0̕,//@-L@ p0 P㌤S0PЍ̕,\ QR0* /QS QQ*/0000/@-@P &000000/0S0C 0//@- 0#3P Ѝ@- 0@SPR? P KO`Q  L&` PЍpA-`pP@T@  A-P`"F$@p QP ,0 0(000dPЍFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0P00`a0C@S                         PЍp  000@@0 0 0 0 0 0\/\\A-1!0 5p \[Pa@1!0 *p[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CQV 0p@]^S @p^404 0 4op\00,,lop@-0Pt @R RP D D <[ @D@ p@菰 @ꔢ&,,C-1`pMQp@P0᠁ `0Y 0 0PR l1@d1`0 Lno\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . C R 8" [T \[R@]S  000TT[T@  \T  \R(0 R Ѝ,,,`,00@-00M/SP M $S+ +S00+ 0 0 9S#\S @P0 0 n0IS@P R00ۍ Ѝ00@00 S00z @,,R)O-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S 0QU t0t Pp0 `nb`0V UP0 0#PЕ,,,,tO-`M@@_.0 0\0.> 0Nn S \|.t>0 x?n QX  t   H       0S 00@0000 0S 00@`0`S 0S @p#S ;S 0 p00@\ P  P 0S| @,Sv p0S 00@P 0S  00@[VXS @ x/ x/ x/ x/ x/ x/ d3 x/ x/ 3 4 x/ x/ x/ x/ x/ 7 x/ D8 x/ x/ x/ x/ x/ x/ x/ x/ x/ x/ x/ x/ x/ x/ x/ x/ l2 @= 2 3 x/ x/ 3 3 $4 x/ x/ 84 x/ d7 x/ 8 8 $9 l9 ,= x/ x/ H= = ,> x/ @= SS4 0 PS0@o0P0  Q Q* S  H S 0Q sh0 R 0R0 0R0S0H0[0S 4 0 j0 P^S0@oPL0 R: L `0p00)0800400S<;8 00 [04 0声<0S H0SSP80S4PU 0`  E:P0800A E4 P0T P 0  004 0 0  0:00z040 0H:HR <00s, 70P 0S 0S 0( KP2S 0 H|` 0S0`V: $V S00@ t9@嫿0S w 0Hd H0$P x0 0H$0H$0 S8`0V:\$! `000 00C 00pP0 `8 0R:P=`8 0ί `S p 喯7 P0   R:  ` 7B7` @'1 01S: ` 007 |?0 S0`(78 00 tg04 0副<0S _P<0800 OP80Sf04 0c<0S  80S0p4  H`P <000F400<0`04 D<0S nV 0400<058 00 V04 0,<0S V`L0 R: L ! `0pP00pY R  Q $5 0c4000  ~P 04`Z Z 0Z 000 G 00 00 Vt4Z  0Q\ 04 0 t  PQ8 p0V `XDcH0p0<Hp<(0000S s04 0吮<0S p PB"000Q0 0  0p V0`0  `0P  ~ P\   p V0S` 0  PX80S0s "Gp0 c04 0\G40P0 |TGP 0S 00Pn80S0sp!pdGp 4 07G40P 0GPo P R00`pL<0p<R80SO4XL  0`Rl0&004 0V@*000,L,|,З,,tl,p&V&Oht@ 8,qu!,d, #( &,L,4,<0pW(p0 1(W0 P0H !  R 0P 0 pW* 0$ (1 0X`pH0`0h<Hh`<x0h041 8=<0 0R0((vQ 0{Q  З,(,p@-@P`Tp0wS {S sS 0p FP 0 Db0`@p FP `#G-`XPPU00ap01@ R  puPVCG-Xpp0!S < CQR2 B \B HB B \B 0  a0 0 00 00 00:S 0S0S W00 000 0V 0S`: ᇬP 000BS ]̰,p@-P0@T P ?P1 0S-C C C C D D C 0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@̰,j- 0@-MMPE@P  P;a Ep43a+ E PEۍЍ0#3H0  BR R R+= /&ț&@00CS0 S0 / =&@-,AC0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@lԱ,1@-01\ @T P#OoB\@T P P P QQ R P\ \ P P Q R  耮-Ա,0@-  `Ğ\ @ T\    %R    Ա,-A-pA0 5S$\! R  (P 8!ߣ0  ,P !֣0  4PP6 庬AH<0S 00 <弣P`p夀0U00S 000\P ᆭP D 墣000 圣PeSꀮ-,,D ț&0,>kp@-@0` <8T  <;tkd l}P`PT p ᥪP000ST/ @&ț&C԰,Xs@-@P 壢PvB@P @0?SP@P` p Ѝp/P@TUP 0S S "@0S00a_ h@- :7ț&@-0@<TQ T00 :0001S R0Slp@TX` T@0$ @H4:T(8  @,:Ա,ț&-  *@-陹 :y7ț&7@-@P᮹  0S 0@T 00 Ѝ0蚹0"S p`@-@J P  p ^Ѝ <0p@-XPP%0ATp0 "R   DS " @D⧟ApW& 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,y0P01p- -01//00/00/00/00/00/ 0  /h, 0  /h, 00/"6 00/00/00/&00/00/@-@⾳-00/@-@ⰳ- 0  /-"6 0  /- 0  /-/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/Y00/G 00/r00/ 00/ᓅ 00/#sO/g b @-0  0Ѝ@-@ +@-  (-r 5@-0S04c  +@-  (-k @- 0-- @- -( 5@-0S04c-  @-, @- 0-- M@-- @-  - ( 5@-0S04cy- < @-  pt-< @-  gq- < C@-^-< @-  Vs,  @-  Ms,  q@-D- e@-< - e@-4 - e@-, - @-  $t,  @-  -  @-  r- @- 05-8 - @-  t- @-  q-  C@-- @-  6- $0Qa @-8 - @-@DP d 0  kg ( 0@-0 |1g- p@-P' dP% <P  SuP 5P 0CP  @@PV 400C`F V$P P P0S t400C`` l1SS !0C B/!?1F^xP00 S11W?zP`PxP@a@1S4020/C(PZ( @@P0} T 0@ST p| p| ` p| | p| 0} p| p| p| p| p| p| p| p| p| P3P$0CP?P* <P >P P10!1 NSPNQ0^ B 88C8 P P?@ "0C S񟗉| 0} ` l p} \ZvPq P1asF P x}1S'ʰ1 dF P xz}P 00P1 RE40S 3/Pi PP i P,ЍPR0h _ 0Sp0W 0[ 3/pU P `"F P }x h `5}h00x00A<0 b02P 00P000c}h8,ڥț&Fv-RS& -& 001/8,P0 R0//8,O-p`*@PP [ ! 0P @ Ѝ0凪00 1\$<0/P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @8,P/D0 R/0@-A1 P 1h@< =8,O-Bp0  +W j0p 000圅 Ѝ`440S 0S qP Z000 @  S" S0 050S lqP Z Z 0 0 0! R @ S0 0 MqP Z0S Z00000 00` S P0PS PH0SPP*q0 005q0S 0qt ?C S `ZPU  m0X!0C0S;3PP0 PEMZL,& @VUUUO-$MHZS  R0P 0L`Dp@B :0Y0 0S 0g jFPppp@`0p@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C 0DS0  0`jpX 2 "j0  B啄,X P0{ P>  PN P P!VUA`E D@DP`4i i i@`"PD P AP;  JR !   ` D0k0@0!P`1 V0p00@  ``]{`F`FV0p00@  DPE@@DU`E¨` Y @ 'ᇣ@T`— R    B=Y00000S 000 0 0$ЍOl0Y S L, cG&ț&A-pP`Pp `o@o@0T `P@ P CP0000L,@-P@p 040T0* J3p@Ѝp0 00˟ 0l` 0@ 㰏F3@t 0}P  m&L,h0p@-P@XP0Ps H` R :P 0S@@Q@pum&L,@-@!C0000L,0UmL,0imL,-@-@00t  Ѝ@ Ѝ/-@-00 e Ѝ Ѝ/-@-  } ЍЍ/@-@@#@-@#@-pP@`M,0 0(4 0 00`Ѝ@- Ѝ(O- M P`@pn@nUkT0 0`P 0Y(D0PSZ 0SW L00SSDBPPL00PTP^y@DO@W :p ֘PRWpV`KЦo`0 S`K0 s@PD@0 @>PT0 0P00L0D 0H0T OBZ  t ecyedЍ00D R00S 0S L0X#3p#z)tP 0 {t똰HHff BM0 EGs`P`H{H`ffL,-@-,, ($ *Ѝ(@-P@`$0 0 C 0 00`Ѝp@- Ѝ(@-pP@`M,0 0x(& 0 00`Ѝ@- Ѝ(-@-00a  2Ѝ Ѝ/(p@-Pm@mpL,@-g%7@- @C2IB}$a [PU {% Y(则^00h@PU k%T I(x^00000S$$J Ѝ0l,yj -j p,ț&j O-DAM@C(PP4q@ &@ (% ᭲@南Pࠟ   TP|^Aߍ`V Ѡ `PX Y  ᅲ =R@}@0坌 `Mm8ULUț&bYu!j 1@-p0O-MM 0p@ņ`P2 PP* P ṃP 0S0 0  c ` HPPP 0 Q0 0P)ۍЍ0P 0 B0  0B j  ,00S/ 0P "Q@-h$ -\-@-TP C1P <?1EA^(Z"Pq@y A-@M @70S0{Q%P,  *q0S#|P  X0Sl Y0] )PeoB@PaD'D*hB^&(ЍP@R@몀P( P'20S gAP'.Ap 0$!P?뀀 X  $P 0)AT JPP AP p`ePP 0q+Q Sp 06&V`T(p`AT-@p0T-:W@vQ  R@4Q p0Q  R@SAPV`003/P 00  h0S  R l 10!84@/AP -- -#@-MM+@(⺐+(ₐB+(ⱐB+x(u@PލЍBl@P 0 T @@@@@ @@@@.$'B(I?o  C-MM+ }+L E+ u+0= :@P  +?ۍЍo  0@-@M ޣ1@@"#P @! P A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*AP3>P/[P+W@P'AP# 0P p>~  0S 0_ Z(P @P4o0m'&)z*00 --bo o - -@-@M \0@@N?u#P* <@}  P 00*!R00$Q 0*@P  q0S 0` 'P%(3*Ѝ --O-`M  0 0X#*0S ` 0 SS 0p0 S00C `@ٝ0 S:APP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 罎ꔢ&7@-@ PU b! oZ00 Ѝ0llJ$P X J!L  WY*( 0$[( -j +o ;o Fo _o Qp@-P @<00S   0 p@8 0@ -ql,7@-@ 2PU ! #[Z00 Ѝ0#PP | #d00S L 0H[0 ,# l,j pko |o -n o ț&s@-8Q`@<lSZF} qbfx5bft fbf|8f'b-9*}h 0 A$n@Pxxt 48ւP ]CChaka 9|Ѝp -# ț&o O-}MpP`, 0!p ԕE -0S  -P R , -0S  `-\P LLP G뭆p@T Pd,, ,,U,0B? 0S.P ""]Y@P ""TY00l'P\"P; P  8; `;0S \;",P X; D-00Y|3"0}ߍ3Tf3 4咠0"!03140`0  400 ,T40    T(0j+P,00P>"!!0 # `+ PL  YP U $ t■P2P tW"tF0S TPU ~O8 C"P0 +T0  SR @+>+1P \ 1 {W0I2g>0YC*0P0SP @ 0V0 R0SQ #0S8 P `B{u  PS 2 -w&ptbtp f@l, -!q p LUap r-p o o 'p \-TLp 1p 8p cY00@-,M 0000P00 000 0 00\PPP@P DD妾@0Q ,堾,Ѝ0@%̦ w&ț&pp l, -O-piMs?!0T W+P 00iߍOЍ/lx~!@PX1P L!L0^!0Q.@P jZ` PPW0FSV030#Z0S 00W"W!` ,P P p0W0WU80P , 00!.P.ml,x!p p -O-p0MT@X   p$p\ `V X @M'U` hPPẙP@P jEH E0PPU 0'SP0U*S/ ΒP  [ ጙ0@ 0 0H0 P11Z A}0>p`PUQU ( +2S022SP0220C2   S`` Yy$00 00( 0p| W  @0   (PU ee(c0U : ,_W 0X0C?o20S ^c$^c fy@0Uk^^y00CS0000VU0U  \$0S  rG9Vgiyi 0%S @SJ B* BD0 0 /00L 0.RP 0 0BPH00Zp@P 0A0 0Xf3 4Q9(iVy00X ('S8e@~0U emyz  0UX ~bX^cZy{u U PPW  WK0ЍO Ѝ/p p L1p ht@ -&tlp 0@-CMlO;PP 0S .Q@P 4Cߍ0 P t,s,G-p@ 堀堐PB`AT:00Z W ,/Z 000 ΎP EQ 0 4@p &A-`Pp )p@ $ ,p埉 )P8(@r,A-P@opl ⇉0S DQ0Q.SNP @$ $@ <t,h s,@-M 00PDP  Z 0PDP y L &)p@ (  = E)P'Ux@*  ,```p @A*PPЍ  `!ir,%i,r,8i(,O-8MXd0 @⤈T4000 ,iP40,   -8 4d0 w=C$ CTrP, 0.̟ Q(<P 00 ( 0 0uPPPPP<@<,`0tD0D,Dq,z `< J /  0p>0a Xv6  PP\  PP;U 1sS 1lS;"000 bP p@ v ፛! H≛hH Qp0TKT[T{1D+0~, ӗP ΗP ɗP ėP 志P 店P 嵗P0:4: @p A*I0p 0HA{p H0St:t*10ll WOP 0H0 H0A{p 0 AP<PH , $U [ =bPPP@;jP@- ,ⅇ)0xa)0w\TP\8 0\8UXLy0 yJT. 0)0zC ;;@PEPS,PN X0 -\6SE p0 A@P: d5 %"|t h[7S'  PH @S07@ P 0(AAP\XP@Ps:4S 0 zP 0'APPxyP 6P'`0b@Pal\80<'8\8P,W 8Ȇ81 ΋P0&08P 8嶆8 弋P0060&S\880\8P 8 垆80S d&8P 8叆8 啋P000S\80\87P0S\80\8P@sT %0}N\8%0|F5T$A Q0:$R$ Q9ğP \8şWt^ H4   >ᵭ4SP  0@?S @P #4{ 0Q0:$R##\ğR#$R#W%HR($ 3 ( Ts0S1 `P 2@T YዸUHH#00S "0S <#|㋌Q3S3 TE 8"DC?00N?C0C ,>$P0  0@F0@Ph~P$A?p@Px080Ca@,0,}P p^0S , 'X >0S@0 <#X+4AS< ". 0 0S DʓD&W5S !,o0 0S $媓&XXzt, q l,+q ț&Nq fq xq &w& up,d-p p  i,q >r r Y q x!r, -q zu u~s,r,,q и,pr q q q q r r %r @r Nr Qr Vr kr As 0r r r "Ns Zs ķ,s -Ut t ˷,,CYu du ou ,Cu u u u u v Ժ,v 9v Qv av v v v v P 01/x!(C-鿏P@,MpᯔP3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ ߍkg v v w @-p`CM|@ZPlP#d0RXPP @ W<0080 `0(PCߍkg (w p-t-w  -@-@ @8 -@-0  0 P @0@ f28 0/P $  Ѝp-p r- - 0@-0@XMP0  0@ P x x0 t0Ep@;2P0/Q   LL /2 0/R@, ,@|Ѝ0t, p-8 -r-p- --MM^PƓP   ߃0 00SލЍ\0\ \TP L0 (0< ?0, :-u~p-q- -t,-*w -]w @-RCMX6S AP \8lP XT20S HO2\6S 8J2020" (2`Pr\8. x^10 eb:4S ![X\@10 O:4!SO *00 0 BDpAttJ2@P) v1d 7T4L1<.0S ,!,'$!$#0S   .OoP\6S  V OԉCߍ 0 Bt,D fw -u r r,sw p,x *x w ,w Qr ,w pw w q q s,w r,w LUw ˷, x Ax Ux w @-@T^ S C @TR00S\0\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-p@PhM 0S'hЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/ 0\ P0//!01000/ 00#0//O-ap$MPA@T  P00 ` D0S 0S0S$ЍP P00 S S, R ,0S R : 8 80R:P#3///@-@MP M p! *0 `p  Wd5\\ SS=S 8 d3R 0 ,c0 ^ڍ ЍTTy %y @-`QM p@ ТP !PP 'PЍ咑PTP0 p1P@$U@@ T @ @0 @3P3y Ay O-Pp 0@0M'"pPP [`ĐĠ0 R PЍ 0L03/P 0 ᐏ놁0 ኏  @w$0S P @ @` -My p@-P`o0@0S 0p@+q@-0MQ!p0`L0 3/P< 0t@T 4/@0p0 E 0@ 0@$0S @̀$0 @ȀT `@€ @⾀@R0S0C@ ,$@ r+Ѝ -by o#0S/p@-P@H 0000p@O-p@P|M Y0P,0+`&,$P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U00 0P1 00 0<00000PpP ,0<<0@D&@0S P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0 ` @-Y P 0P 0Pp PQ` QTPQH "P <080P/,/(//$x!WxGp@-8@Q0@P@DPp `7Ppw&p@-P@P   00ppp@-  w&@- y w&G-@PMP N/5 0 0 0S1 0S XP a5-P ލZ0S V0S1S P ^P @l0 1h0$1d0(1`0,1% 1S nP >4%0`>@`pԠ( `p^$  e f$0f^Y 4 P 3SG Oht ᧒ ⣒00? 0Ԁp䐍0FP 0S0)#0C?o27 #3RR  0R6p7P 'SH0pA(\ C~ QJ NhP XP H P ,0! 4@ <##p*2P  @000@0"40N?P0'SpH0AR 0 B Q  > 00B,0! 4@吀<#"0!pJ  KR 00K?(0811~$10 100 d@0Eo`YG_FPEEP 0000!X9PP 00S 3/pO003/No-P4$P (S("#+"} b+b}`ᓋP@``VB!aV>+"|+b|3\QQ0QUh $P 00S 3/p $QUY ` p0 `` pxb.;8/ 0 ``px`;".6/0S3   | |0 0噄`PxqxxU" b ,`P  PbdP"+"|b+ "`P ᆌP# ၌P |P wP rP mP VxT T|  P|` (BPp{  x!`--9 Ȕy k1#A~g{ y 00A-p$0p@` PAP0 @ p> C 01/@P00pЍpP@00003/003/$Amy O-PUMM.`h(@4P娏.z⤏Q_ xWHJkW`V`$Z^  UݍЍT  n? 0.07 00P00@P#Ppύz`40,Z^4S =,7h400C27\4=1 V =V?h400C26\4=1 0 000000000 00pp`d ( B0440\40s -1yv0 00 00000 0zcp` 0440:40s -1ଔV4 `v00/ nlE "g{\5@[^ =2,XL=1pP0Nόfph \  lv00$?00,Z000Ӧ?%N?@/&"`H`T( Z4@0S N?/$"@44pW(4 0}10  A  { "{ {4!0p  1$,01(L!!,H48> C6$ 1^(1)04 $,10 (q,1 48qHL$!R  p} \ z^x #@p#0"$1H00 4;$ x2P p> C  T/$100$10H00: 0 0G80 ,! ]6$H(@GS  GPn<PK <ISG 0$10! A04!8C0(1}1S0}1$1S `4@@ - -& Z#x&-`-- -(l,z _PP$030/0@o//BO-@P MMA E0*!Rp0)Q`U0 $0 ]  P y Pp ,Y* (0$0 C|$(pP d4\,N ܍Ѝp 84|0Spp0 @0 4p0SW00_ , R\  000x;8,9/PI 0  x8;,;/ 0 x8;,9/T08SS0CS񟗕T ( $ l Sn "Se S P0~  R{ <pWv  &P d0S P"8 H8 98Rd0S $"8 \0S  " 8_`0S ! 8UX0S! S! 80L0@ \Q\0S ` R !8p x8 lQlh`Q`\TQTPHQHX @1R<ޙ0Q0}5P00P0)0YP0 U @ ' 'pPv 0Q  c-z fz  mz D  z z gz z z z !.2K z vz { { z *{ z <{ z H{ P{ z \{ Tz V  L `p80  P 0 0 ,0ST0 S00 P0p800SS0 4 0  0x; 8:/P00400ST0(ll S S         t  Sc  SV 0 <0UP<0PL!@  PP ,0$  40x( P3 ~ ,1PP P 0005S0+4^/w 14  t0 S r0 io%а 0İ 0-{ nl,{ { { { (H|  -} -} G} `} } y;} } } } } } Qr _| a{ G j{ o{ w{ ~{ { { { { | f{ }| | | | H{ O-@AMT MXp P`L @P`T $P```PP@Aލ Ѝԃ'̓C̳ @'3 (4@$80'DP@<@T@X P \'430$3 00 z'2 $02(408@Y P `'딢娂  t20R'8@d2@DDAT P2P"PP巈$P <2 8&PI,2 $ *20)ATp !0  UP'!U%0 Z@0S #P 0St H0@4 000@0x;8 8/P6  %P !%@P 0  v @%$0 3@?pW:84p@x!} H{ Ȕ} , }~ ~ ~ ,~ @~ $ m۶T~ x!z~ H,{ -# (mbn0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  PBԻ,Խ, $0@-@"!P(@Ի,@-$@2S ~02Ի,O- s@P@Bi`P@   fPP@ ᫃@p0Ec#రPU* ЍI fP  fP @BI    R0S 2pꔢ&Ȕ@-@00 ]P Q P 0JxЍ( C-PJMM pbu 8q@4PTbH*PhP8b Yo`GFWI 嵄P 0 000!00P < 8<1P <08 <@XNo<0S0 0< 8`PX 40,0"1@ 0101@00 0A00000@ @@v,S@0S8 0S(8JݍЍATP0 8`$!QQ@0RT<0P 0 003/@<08 S0 S(0S 0S8(0S003/@<08 S@`- y&d 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> ^o~ 0@o/b0 !!/,10/喃p@-@4P0 `s1111p,O-P@p`ԐԠ԰0/ C !  !0  P00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ,% @  | 0@-P@M/.݆1, 00 0d0@00 0T0@@@@1 0 000@P,iߍ0x ,O-P`@p4M 0Sp_P pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+   Q 0S  r0 0P  P  $04@H0080pS,000TT0 0X0$0\0(0`0,0d0A- 0R 0  DQHa@1QRpB   !LAPAP'0 \AC0Q     TTAU @@,~ O-`BpX1MSL2X\1S,2\X1S \QUЍ0C`1`1Sg`ـ1PS \1 XX1! 0`1V$ 1x C H0C 0lP 0 S 0.S  Or5p `Z!XP fd0X`0 0~uX"అ\P \!অ000: SX1x 2 \1` 0# 0 X1 ` SX10 2 $ eq,y& , <.   p@-MMPoPoۍЍp"P@`+q P*+pq P*+q P*P6P-2kU p@-&Mvr@m(ucL`P8 k<0 0y P (d8(d j|` <@P ލp a~ b -x!  @-X@01SP@0S01S0  ,  O-@MNP! c0  d 0`p`嬢Y pP 0 06P0SߍP W%]P0P0 a0CS0S p `Vp08Sڠ0S' R$ S\0  0 a00 up 0h1U0ſ0 0s0Z+ 8p s`p [b0P![h!R( 00@P(O  00O0 0S* ?0!C O 0 00t00 00S 0xVa0 4q d@edA@,* ,~ 2C-L1 @1 R0   A h9&Q   R 0<1LPDTPapH~LP ~U `1DP1 ~U `1TP1 ~UP1 `1~Up!00, p@ ЍC- x!x!, y!(~ @-M@  P @oЍ@-| 0S lP \0 T0T 0PP0L004 80<y( Ѝ Ѝ -0 -- p-c q- -@-p@Mp9t)0 0 0T00.00 0p $0t !Ѝ,0y!p@-L!A@0P ?$p@ U -?@-P @ 嘐 R ,)0$@"Ѝ0@ Ѝ/i  @-0  0H P L0L L@ 0< <@0 $@Ѝp-X0 r- p- --3M M TJP0  4;P 5o3ݍ Ѝ X -3M M IP3ݍ Ѝ 00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PD@00( (0P, -- -s,- c p-q- -@-0  0 P <08 0440z000 0 sЍ- p-s,q- -0$ 0!S/ /,0$ 0 S/ /, 0( 0S0 10 1/,,11<0@ Q !@-0 " !/,0 10 1/,@-Mm/., 0l0d 060 P000@ 0b@,>ߍy&x ,0D D /Q/QQ Q/,y&@-@0@ 0 0DbPЍ @- @0S00- 0@-pAMhPN @0  0M('  0S q0Sv 0Sr 0So QN@P  0L0 @PYF? Q. QO FHnށ q (-o <  --` ̸,y&m kg w (G -t,t _ -MM P  P  jۍЍ䨂 -MM P  P  UۍЍ䵂 s@-aP' P]P K%Px0S l: : : : Pu @D`CP Tv@TT%Ѝph ͂ x0|+R/ @-d|+\0XT0PL0HD0@<08|40, - ,- -(- -0-P@-@ -@0QX -p@-@M L(@H@|0 #,0H ,0@@018h- Pp0: S H yP 4i 0i܍p,| 8|Q @P@PڨaO <PT81!}{|8 <sDQi T1 08808PP oQ P00S ny < R t00 00000 00l0p@ m(yt(0Q!-Kp-q- -X,  Fy!'  --h, O- 0CMSP0q `@j0!` 90`SPW!000 @ @3/@P CߍW! 000Z 0SX 0 @T W  00 0  0S l00S \  P0W0 ! !  000p-r-"w - = #f X- ,7@-PQ@0 SS 8`0 000] Ѝ02S  ꐃ  O-0UMp(0 4Q 博 i{#ß0/SCP3c0ԃC0P/UE_# 0SPSWC1 hGd  PPP$ 0RP iP +a^ 0 10S 0S7 0 1S30S kP`F %p2pMF3hVT 00a 40 0 0R RP 10 1000`yRP 1R QA  1S Q00R /RSR UߍP 1 0000$0000 P1 PKP 1 6T1 ,P c - -y&,ǃ  Ƅ  - -p-  P | ͂ p@-Ph`@TU_pUP`gP  Vp`&#O-`MMp\` `P ⲇPP0P  7-@ڍЍ ◇P ⏇P GP"PP GPw2tf1@PIn2@ < ⅆ0t &vP0=S`  7  PH2F2V PP  Phx@  D$P@ #3 1 ,28U0p@-4 P@y0 Pp@@-G-`P4 ry@T$ `V! p0F&04 p0RSP pPp Pp40Su p yPp@T/0 R/@-`p0LMS@`aP 0S0L0 3/P (0 ! "!P 3/P 0S00LЍ 0  1/p@-@ PyP  p@D@-@ (@A-P@p`p0S 0pp RA05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-8pЍP-@+` Fp 788p ./ () 0)`!V1 t@ ltP\P LP o@T rrss)s}DHs(W UsI p@-PMM`; p  @p yPZyPۍЍpRA-@P )xpP` P  0Q&P|d zd@@-PM Mp;P ` p  @0P,RPU9yPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPx00/00/40@-\80S0 S0010\80S  0\\@!SR0(SS QU S!0$0S\  0Xy!1Sp@- l@$\ 0P!QS:pQQ   P \ Q0\" 0 ,04S008 0803/P,000403/,, H0 , 4 T 8 X Xy!40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4  B(B(Rt01 408 00803/P,000403/,, H0 , 4 T 8 X Xy!000/O-0@p 4MPPp`314ЍO%0 L03/P% Ѐ0 \ p* D@ Z["H* 0*P T P , [p v8``pp 0S0P 004Ѝ0d-O-P@4`崁崑崡 Q 1SQ " 010 r 2 R  R V V $R RR 0S 1R",0S 0S0 0 0S 0`0 K3/P p  0!"0 0  `0RPH P00P0 < Q Q  Q R a f tO Lc O O O-0c(0M<00PSp@p`00 $ 80s!3r 0ph0@l0 S@3` 0X@  H3R0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0D002 p0 0`pHL048  Wp0(0,(, 00 0JpP23V 4x0p0P<0SQP0 N T00SJ0Sjd000q p0 0 Z0 000000  \0 O0 00000PX 00808/2p0 PpQXQ Q(00,0p 04 80F [`\p a X0S l^ 0$0p0 0(00,0  04 800p# 80, -2 ,\ (t C-F`0pSPlM^xo0S o0 S<o0S$o0Sko0SGo0SHo0SIo0SJo0So0Sao0SLo0S000$ R(000 "0A W(40S  0$S $SS $S)400 0$4 00o0E( cXo0SP4 PQQ008Q00S (4Q (4 $lЍCh W3W0] ] ^ \ 48P Q Q20 L3003 0n0 ? lЍX300P3 0n0 0HS(0p`@ 0  SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@0 8", P0   R>0  H0L0  H0L0  H0L0  H0L0  H0L0 h H0L0  P H0L0@ 8 H0L0U lЍC !SH000050PpG0  d 9/ 000(0P0,a f - -(  O tO O Dr `r td   Æ ʆ ӆ چ Lc C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``J0 0pp07/@-M0@ 03/P 0 004000 +003/ލ@-`,MHP Y_@0 0 0PP@00 RS THP pW oP00P00P0,Ѝ @T@0/W/0  0_H P00P0ꔢ&4F0@-$M@D0X  0P 00 00,0PRH0Dd$Ѝ0蹆 G-%p(M)@PW \\a `TW`HSP0< ,`SS0 Q "S `P  P !X$U0+$U ` 0 %q0 00% 00 0 0000M0PPZ(ЍP Xy! y! P C-40PS,M80S,ЍS S S !S S @P `p䐟`A`X 0 e000 00t 000 0 00 0 0M`Pcy!R d R O-P@0p (AMP U  ! `<#H0!(p<#=UP <lP ]00 P bP ]0Z0P0UX@!O 0 0 p `@ABBA0  0!KC8 @0  X!A-. P0  0!7D$` !plP@!@3Q@ lT -`"qT@D@`0@@< 0 0K-q0 0@`0P  .㨠嬰l 00@p `HAߍ!0P0RPN( -2,C ~  O-t5AM0DpP$_PQ 7@04`PF X, @0D ,`0S40  ,0 ñXT,  0$ p0pC 0$<0@0 0R80D <0 80 0S d42@@00,4 0$4@00 0A000 00@@@&b0S8H&P 0P40 0H03/0S,0@ p p0C @@0D @000`pH0SOUP p1x'x0(1F@P ! B B2@"A$,0W ,0R BW"p, p  P8p@p 0 Rp#p0x1Gx10q000AߍD0` ⇁0L03/ 00`0:x  Q * Bq Bq BQ B` B  0Xo 0@ X@@p0 0,(0 @@@@@ p@@0`PxUߍ pv'0+ pD`∀0O Z00*8b0A-0<0@SH04 `pPjV09j?V090VP:0A!r0S/A-@P0\03/0 0    `0V R!  B B" ZV10C+Rp 0!"P! 0 `PPp !@` B"7V00080000$0 01P0100A;z qO-P@OM H(na1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,(pP5Oߍş[@P XşT0@0C0p0NC2 VH0 0$ 0 Rд V 80L0TX 3/P1 0 00H03/0 T00!!  003/P#%#& 00t80x 3/0lPp 6n̍X 0 030x300 07000F00, +@ t01 SH0 V p .4t4` PP00P00X00 3/088q0X 0L03/%$& l00,0t0T0x0X0h0H0 0T`X 006/P `0d Q 10  0!s"D  V p0 BTD!2 B"T1ᴡ0C100C0 m `V`s`V T00 03/P0 0D 2#4`0Z5 IP0a 0` 0d0  p D00CTD!2 B"T10C10 0?o2100C0. !V d-z!`z!a z!Z T A-Pp`@a!0P  p0Q poTp l`P !@ B"YT lT0 01`0(`10q0000\pt 0S/ LP0 05/0P0 8p<  @  L 0P4 P p $ Q:  BS:Aߍ L`0 (06/P(0f 8< b @_0`4 V  V  R U  U  RE ,A0  ( g( P0 gp $, ( ( ,0P 0 pP`8p0  f 0P@fp`LPP\ p `P@0` O-0@AM - - O-@`4M0P\03/0 X ĀX p ppP(W 0 Y2 2 Z "00 " 0  C" 1 " X "0  !" " 0 " 0 "  C" 0CCW 2"j0E0 0l20d2 0\2\ 0J00000P<1,pp@12((4Ѝ嗓)08q P ,0gP,0ZH D00d0` 0P P`%0,00埽0P8 @ 0S[00S[ ZP tP00S`(+0,(00V,00 0 0i3/`pt |,qz b 4k uLS {!l V $h r, @-@P0igP/!_P0S0 O-pMCO TUtd4{ 00 rs= 8b0  * 0o P  0@0 B )R RHPQ0R r Q0CFS0TR000US00Ѝ@0  ||HPT00U00X@0 \%D1R4 !8R0 !R, R-RH T00U0(je@ PHP 0R 0R [X T00U00} [XxT00U 000/SS<({!,O, ,(T8 TH,, 8T, O-0MS@pأЍ`  ;W0 @00PS8 cSG MS  0 mS  sS. gSR  0d 0S cS !MS @MSCS GS +0C?oW20S 000 00SSSR mS @ R O-OM M<00(00 P08 @0 (0PP0@D00P,0 P 0H03/800<0 00!6 0R 0  0,3/ 0P`` S04 D&408&XU\a`0$04000000$0%vp`0,`LpH0WX0h05R0lp0fh ( `pV S]h `U TUh PUOh VU 00 0$PTv<:씟750P`080dPS<00O>0=C0H0 08<c$x0U 0S  T0Pv0 000H0P0 F0]PT0S xreP 0S40Q00`Q0S 0L0 aA3/P 0P P  2/``dF  X!ZpBP0?cUP(0 Z [ Q PD @0    SD0 R8X'' a`0"$0$000,000$0%$0t HP 0Zcx 0 \F0  0Lc 0(9 0CcȐ 0 /0l010h Lt0hp1+HT+ T _ Z`*pV 0 TuU 00 0\Tu0 4TuT0P0($00 Q030#Q0S $0A,0"PH?|p 0 &(PA00`P3/ A0``PQ1VP(0 [ J Z C8 C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a-H$0pQ@-sqa #"T R0//s@-(@T@ЍpH0P0 w{003/@PE5/@-tM`P @P0 p@@#P  30@Tp@tЍT0 @T|0t dl0l p M`P L @p-   # ,9  E H,R ` /@-P @ ꇉ x ///@-0@Q sϺ@o?0 \ 0P000@-P4M0 jbX0@T 0^ 0    @ 0&4Ѝ0"^@0,//G-pP@`ㄐVT0S0S ^P$1H0PU]0 X ]0 `p@ ,0SR00/p@-@P\<0P4`" 6D0# A@$!p - -A-<`P@]^Pp( yN A,@-S@-p@-@M @a0 hK0S Y`L0LP0 V 44 0 ܍pc- ։ 1G-1`PM@1P1!!  xxaxaut@Pl7TnPb嶿P0 [㴹ߍ B5nB?l\ ]pP0=SB`\?q@ B?`r@P ; B⿤Pt@t P 0 ThTD bT:9 t;@ m8U l,# 1A-1P@-dp1P1X X T`T`  P  @:iT 00cl,:9 $ < O g @-0M02000`00Pp0:@P k@T 1\ 1TO/11 PO/11 ЍD z R; 0@- MP ̸,C-`CM P@ ``;P pܐ܀0 `0`0SO/11 Cߍ5S  xNl lPX \\qT0S  <41, 1- -3 - ъ  " M;̸Jp@-P@1 1  p$-1p@-P`[@PW0 p@sC p@-P@ᨸtP `PN/1 1 pO Vp@-P@1₲1(1 HP1 1 p^ V@-}@8O C-@aM.p'`T[BP`ᤂrU U.S20P$0 _PZ d"0(@80UPW D",PU , Z 0 ,P@ZPKۻ1PL0P P110PU)!,`pApP0S7 S1  @_ 0` 0P@Pd1`宷 PXP aߍ@\0 !p  QBp\T.@T&RQ0000(Q $W Q 0S T vH 0@1 00 0TRT0R"1$6#Sp 0 ySP` ;#S0nSp0 d00\ `0h0x00X) P$`P`t0 (04Ht000 00 00p;H|! @-`X0Sg0 wW\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP S &0W Ѝ 0}! ' @ X s O-0TM00 0$ 400 ,00(0 0800P! 0` @@xP$0SUppФ Q 0U U H0!<01PRPpRPUp<0L @P PUDp p0S H0L HLPp00D S400@00P4p S 0  S PS p0SW ;S S 21+1:$0S LƯ$0,  QB\X<X4RQ2ȠP,$0($0(Q $S(0 S ! 0S H (v(D80ƀ1 0$ 0 0 0S0 0S 0$ TЍXRX0B"1P0000 0 0Sh0 0,P0 Q0 , 4F - - O-Pp 0MS 1cߍ0L00 3/P @0 8 D00S4A 0Sj)0 0 0 0000P@T 4/@<10 O` 0O 0`&`A0 R .0 00T `0:/P `00S0V0S O>V F 3 T &>0!C> f`fA0 010@0`(, -k #O-PM徬0@庬0` P(" `b0  500 0iOp!0@0 0\O!0g0p@勬 M@.ჰttluO@d| 0 L!Hs @p0 $!|$i!p 0s`쀟P0 R @ P@Ѝ 0p!H0i `S `@OT 0-00@p NR S3#:@`0( - - ~ ,  !,  A-@0`\03/ pPW@@P@ӮP< 0쀟DW  \-W0 U  0  !   0 00$ 1     t   Ch  0SJCT T0T TTR0B@@ r,q  ux `}!y s@-P,`@峯01Ѝp,p@-0(M0P,03/`h0@ S:000 00 0 0 0 p` ӥ0A0@|(Ѝp0@ O-PM4,@PЍ ხpP 0p @r @< gS PZ0H03/0S@`H@`A0 0`P p" 0 Q"d2d" 2I0C 0 0 000 0A 0 0 0厨j٨0Se'"0 L0P 3/P X0P@T`@\0`0 S8P 80S ,3 0, S001|40P ∡0L0 3/00 P0 % 0 F   0  0d 0qȤp`Q@N0,J0GpD` 㐤80$4@`!0 `40 000 f0,0 p冧0$100\$10\0d00h00`@ pl0O00S< p0 PÁt ,l3 000000 000 0 080pOp` ?3d,0%ᔤl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV 0P2Q mЍ.P00SZ 3/@@OoBS i@0&00|10@!Rx!@!x@|@pPpt@岠t0S|0X*@GP PQ 0!@x 0T:x0S@ 4t@OoB@|0xT:(@-0 z}!  -,P t R(08  @!- ut l,H >O-S[?UM< 00@48@`D ĨP ῨpP Uߍᴨ0P40 P,Q3, 080S 0R@ <0S6(1SL 0L ,HLAP4#0C 4 8#H@; $嵥㲥 0@PdP9 @T "2B 40P 0S 3/P,00,02, 0SU@`PD`D@t w T2R}  Y0N v s,H! L@H@<#0`P`T@_P !` OH@ LH,IH,00 0000 @Ῥ =H   , 崬 2H, ⫬2'H00P1:1!,L' @0 000000 0000 00㇢p` DaD0U4 Q[T Y 4v Ḣ`@!-D!-({ no }! O-/0@JM M`0PP+h9P) 0S% 0l"`!`\r\/@0P T  0CT *0C/Q 00PN@m+59 P:M?0  !P+0: S `VM>00ꨰ  PJ>0@0/S8 0+ 9 S pP+ 8 P*V P 0/S`0oo`bS JGpGG0&000 SV+t8 P*+8 P*kPM@iM@]dJލ Ѝh   @-MA*@-M @P(0  2@P ' P >Ѝ:0S:$c(#"c  8#8S O-M` -PPp X`p㴠崰:2P*Ѝ0S @ J.0㐬6+J8/J.0TぬT'X zPP~D4 qPPu$3+J70J.aPPe#+J7 J?` JPPN +J7tpll40 0J>)P 0 .+P UT 1ލ~P@Y+J7J}PPp0J.@+w7 P h lJ>PR ꨐ  ̐ ؐ   . { - > = & + = /00/00/00/00/0@-0@4M#|0$P 0cEP\ P0T0670 P叢 Q@P 7ᄦ4Ѝ0 - -,O-AMAd2 (000PB(0 0000= 80s#0(0`p[05 0E%500%``0$0 0$0S000`5_` @@`厜@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0 SW`vp 0 h T$`0$00  0 0 0#4P00 0`0000 0^$0Sr D 3D0Sa @Z%S[eP*%0C?o2 00;0, 0H03/$0`Sp, H0LC +0V   0^D X00;000P0 pX00  00 (00P 0 00 0S r(0 8DQ0v1;0 H0$0L010,!<1H0$00, `EP,  0Q00000S p, EP0, ,0 [wR0,4  EP4  Yp00p,0Y08pB,  YP P 0,00000;0(\cQ  k,00Z -( - &-  C-pQ|MW0PSSp`0 00 P  "  C" 0@T0 S>T2x@&T"@(@@,0S:0垠(0$"P@P  00+0@080s=0 0( T W|Ѝ#x!@&(00\1 0.C`!00 XTʹ@!0(Pj R P@@ O0! 0 h0 @E0 400t0S00XT头00P0 -P@0(l 7@h# @8q 3/P -$ g   2  0@-)M@`0p \*3 +@,P0 ?*P 8- 0 F  .ڟ0 0Ѝ0!0P8q0 S+P ,㿟P O4 tl -2}!. ,A-@  "(0MG( 0PlQ2d2 5  L! D!@`  p0.  0@ d-}!- -! O-`M,p@0 40PVY pݝpPT Pp0Z:`PU`Jp?ERUA `?`/``B00#h R 0  80s0`F`pHU p GCh0S 00  80spHY pPp 4Ch0l0 0L03/, 00Y:pPp彞p0僝0P80D>ЍO p0H03/,0$$ (08RPP0$P(<00WS:< R4*p,0, 0$` 0S `0S< $`Sp $ PR( P`$ (0==PU` P0 Sc@D S \0S 0 `p8P0VU:00S40000040,0(pWs08`<00< R:pp8`]p< p 00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0<`V`P p0k  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P}0H03/0@08P0D00Z|*p 0 `<080sb00_ <0 0SY04 @0SD0  0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0  -< V00 400P0 00 Q40 pp<0Pp80s00  h0S l Y* 0L03/Pt !0 儐X09/Pj 0$!000400$00(0 00 0S(0  0 H3/P- X$ 0 03/p<  0L03/0p Pp$0P( 0S pP$ (0; W00 40! 0$!000400$00(0 0$0 c(0## < 0  00 H3/P<00`0<0l0 S04$( $ 0S(0  0 H3/P* $ %P 0 0X 0T80,3/00T00X S \ $ ` ( d , w ,0St P0 P  R0P0l 0$!000400$00(0 0$0 c(0## < 0  00 H3/PP80s_ 00\ Q W 0 ST 0 SL0  3/P@D0 RP RP0{ $ , 80X T3/00T00X0 0\0 $0`0(0d0,00Sb 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQBPp`,0 0UA:8כ  0 0S$ p0p0$  S[p᎚`P p0Pj"0RZp YZ Yk:PpW00 U0#S p`Ѝ茀 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0P00  8 rp08Hp0!8p 40X 00 0S 0P*p ` ?80s0 L0 3/P 08400H0, 00,0+$0T00X0pPrm۶C !]s d- 00 80sh p v?Pcp@-@P(MS(0SΙ(`,`M0 00P0F0 P P`0(P^P,((P(Ѝp0000,埔(ۚ0,`(P -$ dR,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1\!S<1@100> C @t70Sp(0 ,L,0#0D@ 0'8= 0' 70 W &%, b0^80000, 0 ߿0P0L80000  0'ٿX妖0<0H8H0P00T00LP (X0A>W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000epp U85P,0;᪓XpW( 0GSC(> $P A$ 00S H @3/Wv@DpH L0] YZX03/ 0 05@0L0 3/P 00S 0SpW+ WP-0pH03/ 0! P7/P%$%$)@0 Q1XYK @1003/Q  01/ 0S 2"]<$Є  0:P  0 Hp0  @D@0 ᄀX80X> 7Pn㊕Bl,0S 9pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P~ 000- -(p408 @!-ut  !s | 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-Yp@P` 0< # 80s#   002[<  0 S R( 0S%  吁( R Q0 2=<T 0 < {+800 r"000S   y$ 1 SR08C81/,!0 /,$1p@-S@ x1SP $003/p@x1P$1 0SO-@0`PKMM0((0DpH0S >I @;0 0<0o- %"{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,ppK܍Ѝ(a(0S*< o !8 ;c&@@ u-O-`0@PMM,0d1d0p 0S (0 S> 9 H; 00 0 <0.%"@~40kP`0V,p0U 0000000 0 0000000 00Ðp`ލЍ,♍,0S*< !, 00B"X R00C0C0000S0 0,0A$P, u@-@-9;0  !<$10(10,1P001.@-@%;0 0! 0O-,MTTpPP`0 R",Ѝ "P9 @@5/᱕P`K :` V`G2 : 0" 00 0(0 0 02`}Ṗ0,ЍO/@[;p@-@Q-CD DDD\DtDP壒 0 P㜒40 Pl喒 <0`p@PP卒80 P<凒,0 Pげ00 p'Ò )͒ *+p@-PBMH`@p ' VE8EdEEEE\FF4FtFFFFPY 0vPP lBߍp`EP00S?0`:40Pl`480PS<80  0X0S,!4@   0P\0 `0S  @`d0Ph0S @l0S @|p0SD @P`t0P^9ג : ;=>? ABCE@-PAMH`@ȑ  X&V(GH,HTH|H0D`qK0 @0S  &  &8`V@契 0 #P坑 0Aߍ(0S l 堺@d,0S D 喺@@00S ( 区@ ^ /ג 12 30@-AMP@0Q*IIJ@JXJpJJJJ[  % %q0`N 0S (0S  %  %,`V D]Aߍ47  % %q0`N 0S (0S  %  ~%,`VP $04P 0 P0 Pp0 P\0 PH0 P 0 #    60S O-@MV M<Pn 00x R# R0`^嬵嬅adDp80  @Q D0 P͙  șPD  H%  $`V8p00(0S%⣹$B$00,0S$▹$B$0000S$≹$B$0+ 0 p0B/↙Ppὠ@Y 0 TGGߍ   4 4 ;$ 0b ̓ (ړ <0G-0@`80P0CpMS񟗤RR$TDTULU|VW1S,|1S  0" ߍG 0xX)W0L0 3/x1S 1S 0S~ώ8@4900`S $@Fҷ00" F/'0 00 000/8/P P # # "  > C"U0S1 `F` >딣0p⇞ 0S " "`,pYV o$ @%8`i +0`0"  Zߍ@V 0  0S   `pV A 0  1 PS d2 0  0N 0S @0S@ ߍG;<0040!00!@0Fo$ 0DL03/00 Eppqr0S !0PD` 0S K" G"p8` V0(a x Q0W 8 < RFO   ׶ 0@ /,@弍 0  d R0Vx 0⾶   4F   &#  w .V @-x @5+0 @0p0倚d- @6( @-D @5000(0,0000kd @!ꐯ1 p@-XQ`0@sJM@!   01S:pYYY Z,Z8Z咇Jߍp0 00@ @@0刎P(@0 (=0 0(0000 0u(2IP(.I4P,@,P0@00&u5670p@-QPM,0$0`s@|!   0(`$1 SI[([4[P[`[[[[[[ 1$ *PЍp 0 ,!,0S$0P@0 0ӵ0 000000 0 0HP0H!^@HP@@P@8P @00&u, O-P`0D00H0$20L00PP00 000T0D0 10S D0 0D0 P 2J1!b"`!0  ?1}/,1 0d!S0C 1ġWߍ  0*1 0" 00$! 0 0D080l0L0X 3/Pp 0Slht0S 0_Saʚ  00 2@ 0` 00 p80`-,8 (-81-- 8 y-؀!!<1--!XkPu L0G-pP@㴠崐(M0T 0^ ^ 0S 0 @ⴱ`-P aV@(Ѝ@ꀺ `-C-@4MT2P`p!PP 0 L0T3/P  Q000T0SX0`pS@, XT $0Sb S H H0S004Ѝ0CS@D&7#"1-30S/O-@SMP 000d#G\o`P HH R@3P ( K ⟮  000 單哮,pP0S* XZ'0 yPP Tq 0 x0.0()>I1P/S X(◎0(0 00l0SvU () )0S `Pp 㺏00!15:% p ⮏P q Q 0, ($!p p $ ⚏P^ 00 8a4Q101T/,-t1-`- (m  , n 0S@0@-S@00 0S/x1-a0O-P̲EM 02@T PP0 2P |1S$ $P| 003/P `2P X J@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 pPP2@0S- $P* 0 x0D 0S-a1- ,-8bt1-y -1- A-$A0MT@ QP` 0p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T  @TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 -1--1-(-81-\0p@-T00P PDPPp0AS@  1SAA--`-0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^@ ^T 0S"H!-l0\ Q0/\P ^U Q0000@-H!-0O-`GMM40X2@TL2V 00 0 0000000@@@@ 0h4p@c<  * G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  Kz*,0h 0 x0@W 47 `4|4 VL0 <0G, ,"B`-u ,0@-PDM@S P08 @\ 0@  Dd  0 0DЍ00S,0@-@DMP. P0, P\ 0P  0T   R X  0S0000000 0DЍ000S,p@-@Q`P@M<㉃@P   T0 0SP@Ѝp@ȅ0 @00 D0UU@Ѝp,17@-@SWȇ\Ј Ѝ0!{P4P&P<<0 &P0<0&P0<0%P0<04P%P<0 S, 0<0%P<0 S@  0"{080#{0,0${00000@-@PD e)x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍpG @-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P )0 $儯< ) <Up 0$QP 0|! |Ѝ0-a@-80@SP`4Mc00 0P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0̉  ؖ ~ 0p@-PQ0M0@$ 0x`0 6/8 ⭉`Px1狄x1a1S0C€10Ѝp p@-@P 0$P  咉Pp0S@}p $P Pp0S 4! B! $P  jPp0S h$P R 0L V 4QPppa 8b  9q" 7 O-uM Mp0 Z-1(H0cS_ C0SSzB0S ӂPBؒ0SzȲB0Sy2 P     P x2@    PP2 HD     P'00002x @@K @P@ PHPP< ,'h@ ,D@01 01P01P010R0 0K000 0 }p@  PWyM} 0S10$1S 10 0Suݍ Ѝ@P`H9Pj2Pi1S |!R ㆧP &,-1-,-t1--1-(-81-1-X1-x1-<1-1-p>LR@>-`-@-@900S @PO0-N @-@PЍp$QU0 `P PP> C  01/P ,00 H$L Q>-80S @-0 &/_J(!m b G-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  &T P $Q$00S U 0 |1 08ЍpP sP P Q " ឺ P _ ᨭ &P ,A-M|P8 &U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `pg&XDD2 08 8/PD> 0!! 7#`  0 3/P"#"#00 03/p p0` L03/Q⣬ .` 0SWp`?`B414!44 %0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv  0 |1 0@관!_J6! b ,G-`RM@Xr PP XSP`H `9WP P7   8p &0S ߍ<08 H(00,0 000040!04 04$0D0(0P ,|WZ  pT h p* \Xq` 8 p% 4W (W W W W 0,0W0 W M% ⳱p 0`?`a8SPb 0  0**0P0?  0* Td@edAkzd@?qA-PMPp`;@ ᩺p@P  P06P U00 ## ݍ /O- D J R X _ dd!0@-M  ⌀Pڔ HP p@tPP{{Ѝ0Ia0S 0 (fk tlO!8UO-@M M@P;B/$@d`P!$ Op ު00@QD0S.8 R( (Q0( ⰀP0D0 ܍ Ѝ y P P    0xP 4@bT4@0@T0@آbrT{0  !00#rpR{@0T  00# `#`0000D (`M(00#?P X\ 040RP`d 8<0RP,~0( S 0`0#2PDplP `p#t$Pu@ph W #WH`Ph@$pP_ pp#hPV0%# D0S(0 D (⒁#\  ( @0 0#C@#000@V( d@ @ ^ 6  @. 0@-M 0z 0@S|( , zPXvx0L @8⛟8 P 0  Ѝ4Fs2Rb! @-{0SЍ@-@M zT0  CR$00S ЍwA-pP@0ST 0S` @P ڇ!՚ @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p<,1-08S^,/A-J- p@-@ 0(  P0R0PS 00Si 9ppC-@`PNMM< Ѐu0 ` P `P噒000 ;0@PD pNލЍ覜  ydG-xM` @pᜐ堠KP! |!0@P 0S PU 0 R<D1D!DDL00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZL   YZ( (   ! ՚ / z O-`p@BMMP/0;@ ␦0P0p X@;$  um P) z BލЍjjP (0  h   Zm0/SX l0H, l!14"So[ 1 SR 1S  RS1S1Sr`2pB@?↯0Q 0 STS "0SO[@1kpPI P 04 8 < QR@ Q  A R !Q Q Q "r " 0Jĭ500 " "ko@ 8U01U01VMKURXA- 0MHL`Pp t1t!ttPj@PP0ЍT00卭 0R`0 !?020 20 02p004 pk 0PS" $0Q00 L03/P Q P0Q    R D0QR003/ !՚ >1-P/A-uo\vwR2UR@C0B0Eҁ@0$H#8@ 0A- @P^U PP0 8^ @T vgP ` ` `b` ` p Sp`" 2 `q`!~``Pa Jk00`U08pRP08}/ ^Q 0S`P82S011111111108 m2~/P/<`0Xh40S0Sp  P p2S222=040WP 2SX/1 O-bM M 00 QP $00/;㋤0P0`bލ Ѝ$ pp y?`x00@ ,(Z 2S 1S,2,",, 0@0 Ḁἰ        0S@!? U㪋p ኤ< (3kP^bV彙T&PRQ 0 p   W p!p'q ?p? @ p   W p!p'q??p0g@P%  0 eJ  pj?WU E ,( pj2j?W U `d@_J!՚ Us@-RU0 ! @ `d0T `Š"; P0H0`04 oЍpx !! ՚ @-@ ^ @ T@@@ Pp` TPPVPU Sx   D L"4 0"8 0.4 0@.800 0",<< . 01-d-O-P@dM0p4005Q 0 }Q Xg QP08B^  RW* ,50'D0Q   R0RS 0}υ^ @^TX 0SQQY WpdЍb004@F@  0!@TT0@ 0@4P SI 0`P P\ X 0`VBT`@00T04^21 SR8080<0 0Q"80 0<0$0 0,0q?Ⲡr?0(2 02S01 (0 , PO W2m`!R   R" 2S SP 2qrⰠs?0 Ȍ \ 00 0 0\ 0W<2?h "QR 0S2" 02#38^0WN dJ,0 (S$ 0 802o0 <04pP6 @0 Ē2Z02H[ 1P[ 0h 0L0S 1P0S`10T 80<q?r0 8Z o 0L^Q  Rp0 ~/O ` 0( R 0C0#801- ڛ _J3!T՚ C!lO-@|MHX0(S S|ЍS S7 ( [8( D S0@ }(00$0,,QT@0S4000(S$0000Q 00S 0[SX770QP"~, 4š $(( (00) 0P00U00( 000$00 00 U00040 080408 0,000, S 0 08B4X6wu? v?( $R BT@2r/00q?`0sh00`0 ( R   T R,0S0u0<04fpP<0=X50~;\0o_P0"H```V PV Pgި0( 8 t@0o/O @0S U SQ0-  T 000 0/ !o/ S㴲< $ 0 ,0S00@P0PT000S@ P0 P0\b0@SP0 0HL R   ?  ?/Z[d0P `@10d ἐ 09/0P@\Ѝ-G-p0@P8HL041` \ S ^ ?Y R  0\ VX0?Pࠡ࠱000^ 0 G/->0@-@0M 410810!`0 P0u0 0H`0 H0PU ! 5/Ѝ0- @- 4 I@ d@-w @1 0  ZR(, ț&@-@@0s,00p 3f0Coh&v--$M ?0 0 Г$Ѝ0-4M 00 000@ P4ЍO-pQMEU$T "0pK%0 0`000 `V0(08 0R(0`V0(0"R 0*`Pş$0(` 0P꿬 @-P@`pP0S -S :S S  000`  0 f0P0 ЍU0S T  5hPꔢ&p@-@Pp  `@U@700@pp@-P 4`p@  ϐP@p@-M@ Ep$ ЍG-`p@T2 P  3P0IPE *PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝ p@-P R`@0 @ 㷑0 00S  UP3PE Ѝpp@-P@@őpPppA-@Pp p` j F0W0 |0WxX Uh0X`0 P  0h0H )ЍU0 P 0 O(ݢ h @-`0tM0F?oP2p @pm 9pc@lp h2S p L0V#4 - dtЍth"Mpp@-@0  0 S " 0PUPUp@`0S   0 0S ``0S   0 0S ``A-p@PMU `0S@PE7  0P00TۍX700S @ Q@BPE@C0 00 pL)0S 0#S @UX ꌊ! О @-M@ H Pp8lۍP  !p@-\1@0S`M @@>  <P  0 !   p\0 S X09S 0Ѝp0 S   000 00P0 PS @ d0  pDL  Ѝp@ pܞ !Ŋ!  p@-@$`Pe]Pp0 @ `P0 002 0pp@-SP@`xM  j0 0юp@) 㿎p'  Ṏp! ᳎p  ᭎p  P  L0 6 p,4CxЍp? <ᚎڊ!ܞ  0 0 s@->@P`Mp @ p0 p`` P0:p @ 40 pЍp!! !p@-@PqP 0 Q01pP`qpJ >0#1pp@-pM0 p @ #p"@pЍG-QM@700ۍ   Y 5 @`V ɍ@pP`@-`R00 Ѝ@PTp ]@P  Q*@ 0S0S0 S   0 0S0 S*]P ` ^^0ST   00000`0 @@P0  5 @-@L@ !L1p@-S@T1S#d1S.RU9lRUppbV:lQ^lbp1CL^L10CL1L1PSD^0P11C>^T10CT1T1XS6^0X11C0^d10Cd1d1hS(^0h12,P0C2bV^bp2,P0Cp27@-@0 PP" H1 0D18<80@ 8@   (   )     C A Ѝ0@_ Ѝ0Q@-@    bP p -00` Ѝ@ Q @ 00 pЍ@ Ѝܞ !' Q@-@    P p 00r Ѝ@ 1S70|]7[P| 01@ 40F pЍ@Q Ѝܞ !* @-t0M0@Q0$%+p= Ѝ  1! 081/@-@d'P0S  P 0800L0S S@ 'B 8 @-p!@RM Qt0 p Ѝap1SJ 0@-800@@lA P@-@p t10cSt14 Ѝ@M @d 0 ЍR 0*Q7@-@  ,, _ Bp  P. Ѝ0@( P 11P,|1@ R  |'!AQP |`00CS`0 X⁃@ T0wp 0< Ѝ0@ X0 X Ѝ0ܞ C!p&&' p@-PD庋p44p@S @ᒌpK p@辋!q 8h p@-P@ `3 08 l, >U\& 0 0 008 , 81pp@ x aNp p@-`<1P:<1x1S0p0@Tp 0S    0@-@T 0S @C-`P#.H0$:0@0   10 &000 0sH00,PQ 0a(!"4a4# 0b0 >Q & Pp LW  g080`P040 Ѝ 0b"!4b4#@- @T0800* HP  : HP%p@-8A R>  **X K 0S 3@0 S   000x1  @  0SP P0 0 ,0 S   0 ,!  0C-MM000@"0p@00FP؁+ zP`pQ v07S 0 S W h0 0\!`1 1 `Px1 (ލЍ PpP  R쀟쐟PU "Wxx x  0 S   x0 pP 0 Px1p  P  0S 0v0 PC!1 @ 9l8Q@-@  ll|+p907S@Y20 S .0VS*0S@ܞ W!A-`R@p@M PP U70l0h @ЍA"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *P 0S( <0 *3 2 <0) |) 0S 0d !r 0S>0 P 0SV>P  *@ЍAi!qǢ O-p@`,$MPP   P 00A4 $ЍOpPy P000 pp XSP      0pG 0pG0 ZppIU3#pp pp =_p#3s 8118100x1Z* ؄Px1C 81181kP NP  6Pp4PpUPpP xP nP p 0S 00 P  YY p 000 0SZ81181$Ѝ P  YY p 00`` 00T0 :0G [W 000x1 Z R& ` @P `[` @H0` 0 00  WB W W 0S 0`0 7 0S [ xx0P 0S [{0 xr  " 2 ; Ȕ&!P aN@->@T( "44p P`0J"@"44 0AW AZL L0 b"!4b4# 02@> *->0@D Ѝ耼p@-p1PSM"`! M%@P T 0p1!V T 0S X\{MRP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   {0 @ cP 0  @  B.(0$p ,*l1S ު #Ќ! / q [ 0 R/ 1/Dv-/A-@P 1 !  8SXpR0 qP 0`0S}000S \ \QP0 S   00S000@00P10 paU0蘫 ٌ!G ԫ 0P@-p0p ppq =00P R20 U  蘫 ! p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@P p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLqY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@P@P0S 0S0 @@ꘫ ! ʚ; @-@^i00 Ѝ ^   ʚ;@-0 Ѝ@-@P`pg,p0 000"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ ꘫ ! P)@-0 0PT0/ᘫ '! P@-0 0T0/ᘫ 2! //P@-(0( ((@008< D0蘫 >! @-,MP` 1U0@0$00 p0p@000 0<0S bp,Ѝ8010C>S00@( ( 03(00@000 0<0S80 zp @\M R!Y @-XP@P yp!R@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0QPU `0 P  S   p0 00C0HQ0HPLPU0 P(P0P0V00 S   0Q0 S ,  0Q0 S 4  0Q@-@@QC-@PM pbĂT0SY 00C01@0S D3/2"(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0SH- L0 S* ᆩP% HLH R 0|S0       @@U 0 HQ0SPp0S} |`Ѝ\ P RUk Yh T0e0S 0S   PE  \P 03/Dv- d! @-8 0;(@ 8p@ t@Ѝț&A-`M4PspM t0 up@ @ۍЍ4F P ڣ# "P  RP@@#C 0 ,$@4   Rp&ț&-@-   Ѝ Ѝ/@-MMP`@p0  uR 0pۍЍq-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/p& 0p/QRp&p@-MM p p P@;00 dSV T00@ۍЍp P0 4Odp&#0/p&@-$@@!R4 @Rp&p@-dP@kp; P嬨4 P P   RT V00ppp&ț&Q@-@P:a@%@O@-q@ ~01p ~01@!2p@-PM@`   0 T p 1@ R! 0 p`Ѝpii$0 /L0s P/0 #:60#//A->PXMUV0P0XЍU700p@ `R0 PU B0>000 <0  ,> z!PP> *| @-@T?@Q/@-@T?@0P/ R R /0G-`P MJ0(0S @ yP P rP:x`P 0!00 0   d08S0 00 Ѝ080 N00S # `pP `P=0P 0iS.S  `P-04S 040:Sꔢ&0@-@PDM QP@T 00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S Q 0  pM>@P @-000Q/Px1P/$0/@-@M  2  0 ~pЍ~iO-YM `F/@H9X0KpP pYߍ0pM 0S 0S PP@ Y LP @T0SL0@P 0@S0@S@@T1S X1 ŕPAT1S@\1S`1 ⷕP5\1 S S R@L1SP1 ⦕P&L1PC_oSRPU@g P0HS 0s0P 0*\81 T48#88 S R p S 0 S T X @@?@0?H0p 0P0H0}>H0 @k000L0PPPp!A m iĬ A-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ S @|@-@sp !p !p`|Ȁ %0R% -@  % A  !@   + "*  ) Q%£ £    + "*  ) Q%£ £ /A-`Pᫍ@P─@Ѝ :P\LLP0 qy1P pP d|!A-PRp@ M 0S0T00 Ѝ/~P P&`0 00 0  ^0S TT E8PP/00T S8Ь O-P@0"S0Z"SJP Y pgpP w70p0 ЍT WUYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8qDrDrDrqDrrDrDrDrrT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: Q U*`XJ:0\S 0}   0P0N[ SP0Sl  PPTPp@]pꔢ&P /0 S S /S/P0/S 0 S S/0/O-P@P ЍO^='`P hha ЍO}Jp U qWpJ@P  ╢P 1 A Ѝ=0@S- P'[ ݋`PFJ `9`5[IP 0 0  0 0ꃍ! p@-@P !J` 0SPJ$` PP(0S $J0(0$0p,` P,` PO-4M10C`p@XPS0 $8t0D̄|y|yp8|y|y|y\ԌlyyXzhz|y|yz{<{x{{||yP|}|y}}~~l |y܁xl|y(Px<0yX  0\Dp<dԗȏ܏}pИ~H\pؙ,XXpHU- `Pp $uP@ ⍡P7 7  '$ !P`0@T\0S @U0 @7 0H050U- H0?0P 2I0 @PA t01x4ЍFP 0 pp 0S 0P I01#@%U  ChUH070 0 JpP! .R 0R77@0U h 0/pPL H RU H0@1SU@H000{U *P0H0q ,0 00 0 QP,0S ` {U ,0!00 0 -,0 S< K Uz <1E80w40b儒000 0 PPP00 0 P  p@0  @P  UL <180w40b儒0p00 0 PP00 0 P  0@H0:0H >P 0<0UH& 0S# /Pp؀  &P00<0/`P 00 /0P0 000H060U ,0 00 0 O,0HS  >h 0A  a/ph  P 4@AK0  U 0 U ,`P 0S U 0 p H0 50d h050,0 % 00 0 ,,00,pYT 7$ UPPeU700 5 0 $ 5(@p 0 (  0 p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 N,0HS 9U H0P SPH0;00H090U ` di`,pP D`P 0$' l C_FH0Q7;0UlQ XP0l1 QP0l1 JP0l1 P pE0P p1tH000|U10H 2v'P0H 2n P 0H 2f P PH X H000RH020MU  0pPl] H0 S;70:H0205H0600H0;0+H080&UV <1!8b0w4儒00 0 P000 0 P0P0P@U2 <18∂04gr000 0 P00 0 PP00 0 Pp@0  @U =P dp iPWH0p000 SP0<00 NP WH p P  >PWHp   1P  +P  x%P  dP=WH#  BjP S  ($p 00t ,p 00qpPh $ ( H,8   P< B7 \PWH B& $rp= BpP9 ((u (r H$8n  P  B l&!!q @ M j ?xx ƭ  |* ^ ) z  W&Y  خ     : C M R a n  ӯ 0 M ` q   Ӱ I ̹ 1,  @- H c ع D  *  N ! n ȱ ͱ ױ ޱ   $:P  84PW ,0 00 0D gL,0HSu  P /o"Be ($P|/>P0H (0œPl 7$ ! (0'0G ($P^/ P0H  (0PN 7$ ! (0 '0)UY H0#X U@XH020H0 0002,H000 H000H0 00H0 00(07600R 2 G *B350S00T01=5 =50H0U <10@0P@(470'P g0S@bU H$DᎅP$U 81 800 (0 00 0 K(0`S, 4`( "4`4# ,,05H0800 "PP0 0 P 0 0XH010vH010qH000lH050gH050bH000]H,';,WUUH090OAK3O0\ U0` 0w ZPhbX@ D3&7 D000 0000 0P70P7}0 G000 0:00 30000% Op o +8 0 D 0p0 D+ O0 P#Z 1H0E,w>P0047{(87P,:|؍<Ѝ80Ԕ$080,CP(/p,078247024<7囗 SJp,8|?@D7囗 SD@u?0H'87l"L'<7@7D7p"H7L7808 p,20!3 ($(P ((pW 400000(0 00N:@(0S 0 S S0P\S @ p p8000SS ,38 P,,00  CP 0?o20804P0P$0pB($(P f((0S0' & r PN(PI Z$d h!PP78=00@(0S 0 S S0P\S 00@ :0P  ܆pPpP80,C P(0)S YL 900(hQdqFPpdq P DP0S (P  P 0S (P pPP| 0)R00S P W400000(0 0  0}0S D:$ D000X|!P!`v-@ !!H 8Uq8s [<d 0Q//Q *///G-p0@0P `3P Y 0 0 `R:S@C@3@D"X HG;U( HGA-TpW0 T`@V0 L0LS @sP X X| |00 S HH0P 0RS  ! ? p@-P @Pp =@-p@-@Pp PPpT0 p@1@-0@T 0@0T0S@-0 i  ! A-@QX2X"XX[T0p  Q081800` PPW Spb0S^ U @@&P "P @T T0Rt0t 0SP t0+ t0( 88P) W(( tt0 . pY0S  pN0S@&hPT0$0x x0R lD@ t0 p%0S () !; = D k \ 5 M A-`P Pc_@T T0pS@p@-Q Mz0 T0S0 PU|0h xPc_`@P 0 @ `  Ѝp* !!  z  G-Pp0M    DP &@81A0 81(P  0Ѝ |B Q@T{   JT0 R0 0800+ P T8p0SS90SS_PT0c W`P| 7 |0   P @T T0R88tPY0Sx x0R   T 600XXSP  P T T0R88BP\;p0VS tc_ @TG 0`SS-90SS)PT00S8 00 H*: S R   p 0S 0S G@ T 00,6 s@P,!!000ڶ ԕ! n p@-@PQp8^!{ C-`TM@ P `kp) 0 (k ````7k1pWp0`V& #k 0 0 0h@ jT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0̌!!Č!Ȍ!-3@- P qp@Ѝ0@ Ѝ/@N pA-@RP0p`@0S p胷 A-0Pp`@S:0SS 0  RS* R0 #`V1S* >P a 0@DpR: Q ̷ ! O-ATP` M zyE@PAD@ 081 Z  wp 00GPȀ AP <P 7P 2P -P (P #pPpZ l Dp \61@ R H:p 081#?Q0800 00 & &(p L0S% S% p H p P p $  p E pw P0S t0$0Q0p P pe x0SA 81110x1[:e]p M PP> ,p@ hPH 00 \d\$kP|$| p* gd p-"p]@x p 0S P Q  [ T  ]p  # ]pNPO IPJ DPE ?P@ :P 5P9 X00S 2"Q`` Mp  Gp %P %P0 x1`$@ 2p X00S!XppW" a a!4p%P `V%R  p0S0S"0h 1SPq27p@0-j   pb 0!`pZp  < pP 08!pGpPA 1 RZ  P4 ЍZ p pk8! B 8  p $ !1 = _Jɠ N [ g u ,! 2  # ø Ӹ p@-P@pp p@RRA-P`@@pL0s  S  U@ p@@@dW0S R H R U p8  Q p@-P0U@Sd` 00p P@K@T:p/ p&@-P`1pSMAT  p@lLЍ TPЍ@!R 0$ 0 0 p@ *@aV 0 !p@`P p0S lt00#40  LLD SP [7 0 (A! R!q4 z]! ) p@-PP 0S @0`0S @@pY00p SU   \@ .S0.SA0_S-S.00  @R-"0T0 0D0p蔢& @- @0P PT00Q  DP `00CS`0p S00 P0S X0X /XL[&p@-h1@SP`vPPE @p 0.SSPP XP HP 4P 0  .PPꊆ p@-@P'Uc 0 Y0 tY0 dY0  TY0H/@,8)0& (#@        tY0  oY0  jY0 eY0 `Y Np@t? IPꎹ ) H ˹ D׹  0,   p& 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pP^`p000 XQލЍA. !. d0h Xp`0SPE@E p 0S:0@0D  $ O-,MTPpP+ t`  @P_30S  P@ P@,P$ X P$0X4B300,Ѝ P,P, R P,PE0S X R0 6#3~0 0 0 :$ R, R ~P 0 0 :$ R R ,PX!@P !!!d3 : P/ P/Q0@-0@0Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-P@`MpUQ:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  P70 0 .0 I@0 0IU:D X0 0 `TT  DSPO-`@P0p 00900W*0S T [700 Ѝ!0 *00@KP  t00T [ 00 P     @ \Jo"  & Z/Z#=T [\*00 0000K@P&\ZT [T [ KP|ꔢ&k!C-RM MPLp`Hp; @>ApE Wp V=p @4 WpTG    0 tIp P; IeP 8I/    VRލ Ѝ   20V002 0@I p  @pP0P@T*8p0S4 .p`@T*T 0 GWp @ p   l0#$$("( *Wpm @  Y0d#$$(B(   L04!c#!$c$"  WpM @@  9 0b"!4b$#  ,N   .0I/$P* I/Vp$ 0S @00SP%@Vp00#s   A- PpU@M %ЍR` R 00P0S 0 -0 0t0#0Q0 .V 0 00 0~UP0S 0 X > O-4MX@p 0S\`d` (0S:0 p20"4ЍO 0  ,   xp0,0 ,0SPCD ,<Yp 0"00,04ЍP V0 000!0  p 0,pBp000P!d `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  09,P|!s } ۺ p@-P@`P 0S P$`(0Sp,` P,` P  0_0@-MMP+ pp P0@ۍЍ0;0 C,@P ,P $@- PΠ R00\L  ^@-Q00P`PV0 V=`V xЍp@@T   t0x@ `DPЍp`Vx1@P _0>0S *P PU@P PPC`@/0P@-000 00Q$0  @1 ! ' @-` ,M 00<0@SP  '0x Bfp 0pt0 0 01 0 0S0S|0@0|0 0  X00Qx0 xIPT ,Ѝ0 8 0@0S 0xPTy A-`@VPPFP|P2Xpx`Es-P x倂|"x20 V0  S|20|2@-`@MpP! B (> (⺾X( 8p^PU@ Tt700@Ѝ ni///0@-M @ _+PPЍ0 3"Qtp 000)006^p0000@ 0(^plp 00 " 0^p< Gp h "!3 A T p@-QUp@p \-0x1p@-p@->`FMV 0P0Fߍp@PF/ 9  0$t01 0 `0 HF? ^P 0> *0 F?^ ii@-@MtP4@ $P P@Ѝ4!Q@-<0< <<T0SSP`///r T! $0 /Lp/@-Q @ p000t0@0Q00@-P@,M(  4  ᰽ P]p 0 00S p,Ѝ08i(p@-@MP  `   ⇽  (P]PЍp:iC-PQSM M3#T0S3"`V2"@p@"0B01801T0t0 H00C@L0@T3H @0H0L00L0 P T0X00L00L0PL0 0L0TH00H0XH0 < 0| H0 x ;H0R `0p 0`00t0H0 L00$L0T@120@ 2T@@D@@0@L0 X:   @L0  XH@L0   @L0  XP UPPEPP@ D$("(,[p`Sލ Ѝ C XH@* _!  z  C-`p"0M` 0$`  0{-pP @T+Ѝ`+PPA   0c-p=0 S +@ ``T*x0V*-00+T00V:0 (P|P@ ( UY 0@Ph!@-`@DM pP@    -!> U 134  R2$ $@0 DЍUi@i@-|@QM  00 p |2 0"x2[Ѝp@-]MP#vZp PP -R 000S0S S SS wR0S HipVPS CQRS@ 0`  x@P -$0 Bp 0S$ H H⚻hH [p 5 $ L 80St S S00,0S  R000@0S  R00@ H @ 0 Hi!>50H \0m[p[%0S !01S dd0Sc0 0 000 0 0`TRY>S SM  ]ލpRIxZ@P= p@9 i3P0 0- H)([P[%0S" HM P N000Sii@r! @-40 000 0+Ѝ|!2S/2S00/@-@@V002@-S0@0 @@V0002S N/ᄠ!G-PM`p (P1P(@P0 0TT`00Yp<00 O #YpPZ0S p Zp PU0S p Y)@! (t( |Zp | PuZp 7/PP jZp m'P Ѝ@ qB@ƻ lBpBfB@G-@p`0M00P U X0S1P    P崡 00S V 1!X0P00 0P0 PPP0PU:000000x Ѝ@-   Z ЍgBp@-0M2S`P@x (VP@0 \(Y00ލp@ ꌠ!B@-P`2@Sp0$M  0*00v%440 0 0p`X$Ѝ@-@8X )@(@-@pp Yp`~B 0`( "4`#/p@-^@P T400p``0@D^$"000œ\p@Tp0,R0-0 \ 0 # R0 0QRO-M@@00`1Q V00ЍP0p Q :8Q@SI 딂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 f'P 0 B0  0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S eЍ@-@ 000YP  R Q Ѝ@-@\0S \0\0@-@`q0`W0`0@-@08$@L0p@-800@P% >Q" &T0x1 RpR 0S TT0Q  >0S , p@|0800/T A-p`KPU&P@00<000S@ (0? @0K0cScO-@IM`ḠȐDp0 7Iߍ0RS*R? ,0000K C&PP d0S  FRV ( Q  R L)Qh 0 0000200> 0BS0 *0 360s RpS00n T) $0K0p C80$0Q  DPV VdP h  Q 4($/ K 8pHQ@`$Q DQV R <0S @HT60 0 <* @V20HS80 0 t@(1S p0 H0S=00(  (100@ S V F P81#<141816%#810p0F07spVg 5Sp 0 HS+00 %A C 5V0@B WeV M 5S8Vp0p 50ST 0HSt300r  0HSe 7000  0 @ ", 02 S3 07 ,04' Rl Ip0  0HSA20 0 W@(1SgVp 000DKP*0W(1SW(, 030 PV:0BST  ,,S P R:(, "  PV: ART  ,0 00D0C0W00HS90 00 0C!41@ 4S Y 0 HSM00 $A  40@(1SWEVuW08 2Sk  8 "R0 PHt  [:Q0 2 0000 00 @V5 VpWH h 6SD 0HSr^00 &A  60@4W08 2S'V0081 0 Z00 HRO P0@W00  ^00HS>t000@0D0D0 HS3<0 0 " x 2V0@ WV}[Q0000 00@0 0P0"9 0H R 0   N @~0, $ # cSc25K f 7@-P\ R&@P\-0S x0x08  Ѝ0PP @ 40yp |& T!qH A-PR1!@ `P0 pC R0 0R0 06 30 0 0}P0 0:0 00sP00;0 00iP0060 00JP00ЍP 0000000 00.p0 00"p0 00ꌼ a! C-P@UM"P, 0P`00P 01iH00P0 0v븀x0`  ($0(10< cV `!P (@B  ) 0ta!P( ``(1 ( =0(t!p70+"70 (P 0y c>```h!P( `"(1* (> >Qߍ 0*Y  B k!Ǽ ݼ 0@-p0i0 MSP`$M1 1 !p Rp@0S i Up ۍ$Ѝi@ 0 Pp I8QQ050 004pP!P()  &$q u! @- 0080PP `V@Ѝp0S  @P  00O-IM PpPHLL `PR  @P0IߍO #0,0#600 0400` 0 p00,0 PS2 V30a2@0 0 ,0T@`0 9P @]d@PIߍO@@0 Px !VT` 0X`0Tn@0 4`e@P6 !~E@; K 8 ^ O-@pP`QP,b尠,`2S$P㘀U`,@ ,G-PG, Q 0S ,9 G P,`0ꌡ!k s RO-00!`p@PT:L p T  X ⢱00U *"0 7 p Ѝ0R0   @?0 LHp  ?  @Hp@ܵ A-RMMi00@` PRp0F R㼀 W00 ApۍЍt p p @ =? Gp 00CS #@- 81S Q S0 00 0PЍ R 0# DPD3O-04MS@ h@@ `0P0_0 o0 00 0 pP 3 00 y0 pP3 0 0S0@0`00T0 @P0i 00 0 `P` 0 $ ( ZXXppP  ,$h(e,8b P`@ [0!P*"0 0HP 0 S$)( ,p $8(5,82  P@0Sh0` 0h0  0304Ѝ$ X0 k p( ,Kwtp 00 !0 ApPp @ kZj $3 ,/,0pS P@,0$S  S St0P !R "R hp( $(,8 'P@{ ( O-P0M040@p0` `2##pRp#ppW9 pW6l0S~,0Sp,0儂0噇 2Sp,0800噇 847Sp,0l0噇 p"R000, 20wS4~47S = 0h pߍ00 `2$p $  0 p 00 `2(p$ = 0 p $= 0 p(= 0t p#0}0,L04l0 440}po#0n@0"04,0 40kp`8p`5pg2pn,0 !P ,@ 0,00lS  R, `" pP 00H1,0,0H0 p 0 7Y00, }R0S 000P 0I p p  0,,0 !P !, `"P ,0 0H0p0  0,pꣽ ؽ ƽ  @ p@-PUp@bn0L0pp@- P# Mp 0` 0 ` 0@OpfN@ Ѝp ` 0uOp )X` 0mOp  .00; U100YOp@-p@`P8!(0-080000&0S  0R  dp`H Ѝ@@ ,0p Ѝ@ Ѝ褡! K O-`@p 0帀SP$H` 000 0 0 `00`0 0 Р0 `  $f<" 0T0003H081y H ЍO<0 $H< :000x3@0Sl3H000s$80405< D'S ,6000800S#5r 3t{840S'0+r 2tq40S,d0S) $0P%h0"< 00S:r p2tU 8d8 S0r 82tF 4,$; 00H0S0SU h R 0R<0S 0S11H000s8040 P14 P18 Pl10 804 T0@ 0R0i $|0.0 0^p ̀h`0 [ P0 x.0S00H.7 p P 0dh0 ЍO Ѝ& E L i p x ??3 P T//:d W ^ A-@PT` 0S0A hp` |  S 0i0P 0S <0S $";   .p0 s pP ppL0H00p 00p0   =00 0$0 F#5 FAd0h0껿 O-0R\M@pȀP 0#P X0 #3P 0 RT0` pp hPP/ eL`V` `@V@`#?L`} oF`P X0 R2 R 0PUkpqp T0pd0S  $ P $[ <Y y' l2 0d208#<410,00000<00@0,0D00 <$P(P Q48pLPPPTPH0Kpa mpZ 00YPPP  0x 0'x1 08#<48#8 10 E00@劓@0p08#<4 0P10 0\01pXw (04S#1S0810 ` \ЍO<t  7 0S @  06\Ѝ7S տ !ۿ zD CDC) Q ^ :  .@-`@pP`K0 +h0X $7S R @`00 < ` 9 0 Ѝ@$0  Hc տ  p@-P@ $ 0 00L0p@  D/p@-PUp00CSp@0@ $x9  (T000L0p@T/  {/p@-P `@pi800  B\7000D 0<0L00p@8 %  D/ Q0A-P`@ v0h 0R0(P3 081HAp` P08!(0 A-P     Ph0h hh; 0d 0 Pd0 $|A Q Z ! h00h0 C-p@ PR0  R $ RP508Ȁ `8  i@0S PP  P0  lHP81 R*⿚P 0S 07S Ǜ ǛY  S@6  !!  Q 0 S:500 0Dp00 0 0 ЍO Y 0 0Cs0&o0S0 S0L0  p    0P 0 0 `0SY0A060@ 600 0p0 0  `P  0 S 081di@6P P0S0 0<S<0P0Ѝ 0    05P 06SY700S00YV0S9 0Ul00 0P0 RS0KSK?3050`%<0 pY 4i%0 5 @0S0 Q 2 P   ? rZ0S Y Y 0  Br.  Br*0 @- $P0 0 0 Y & 0 Y 3@ $ 0P 0  S 0S0@00 $0D|Y<0<0818 ?  ; 0 P0kP4 000а 00 0 0P00 S*P *   pH @ 0ЍO600 0<P0 0S * oP  p`81 000H 0 000 `0`0\0S   0L!YP 0 8 R @ 1ЍO3Y Y' Rr   0 P0Pd0 Yk 0 44 t ЍO#   6 ) % .9  c v n ! ./ A-h0PR@3 0 DA0BS`pbp ;0 Ad$4 O-` /Pp 0䐠x1@T ЍT 0S R T0S> R *P  0 4@c O-,M@`P Q0 ,ЍO`F uVWP0@SS 0SP0#ttx'xVI:PQUE0VB:  ""448#8S50V2:1 S/ 0 0P!' 0S 0`00a0<10  &  !P >3  0\,Ѝ G 0  B4(! @-` MQP\@M  C0p000 p 0S TH # ۍЍ 0W`V \@Tܞ 4!$qA- p`@PpAPU2 0 HA0S 0A\0S 0AA! A-0 ;M0M`pp@P @ p00<000C$00(00$0C,00@pV004p8  XXU0`$0 0Cp ݍ0ЍN!ܞ   p@-@PzT  (@x1S0pSq C02p C02022p R Rp07@-PX0D @P 0S6 >0P 7P7;00@0S02700000 0#0 Ѝ0@}}Pg@>ih 00 @ 0[ Ѝ0zD `5p@-@P0( cUph0Spp@`5O-P`@T Q Pd0S  0 0pd0 ЍP0AQ 0S 0P 1  08p|0#  帐81- 8 0 $ 0R0hd`h08 R0, 00C0 b0800<0  P`00 0 0.0S $0 pWp:#<0 2 0 0 R0H0@S 00ppW\0H0/Ht   p00  * E ,0`( "4`4#S /0 @Rp@-˸00p0`PQPE@ `u @d@$,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ oSQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScG-`x1 @PMT. 0S pW$ P ̢ ᗣPP@0Sh0S d0S4$qⲢd0 0S }PPPЍ|0d 0|00 00od0 00i090 [P] S PU9$0 00 HPP 00C@d800ЍUpP P30 X@ XP R R R0 00Cs z@ЍOP 0S3Y0000000Cs ЍO^4? @PЍOe p    @@0 0>-0 4 Sꓢ!ܵ 0S/G-P@M T 0p `x@00 0@0 0 @_@ЍP/@-@TP@A0S   0:p@-@PPP 1000p" P 00p0000 S0 @00:S 0S @\S000@:S @pv-&0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/ဈ& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO4E`VK `0P0E@ 9 PP 00pCލ Ѝ@@;04pW p40(0= yP  0 `R0 :R`00Fd4@0  0(880P4 PF0 {0S =O p PP ;000P>p 0S#0 0 0ߩp8`@[ +  A=0P R 0T=0SJ w@s@ 2=0P 0S00 `0 SWG p@DW :Sp:SY @\Sp S Spp p00T:C P@D 0SJ =G0P0@ 0 Y@S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 P0@DJ`F  0S < ܲ 00,  @ ` P D,0  ,0@PEg P0S <$ D0A00T*y PPR 0Ppv-&{ @-0  0 Ѝ@-(@ P i0 0pv-0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ ܁0Pv Ps @ i Q0=3P ލЍ 0P P 0@Pi0 PP U L3P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  pv-&g p@-@PDp@NA-`= @P@ d# PPd fѱ 00@^S0S:S_ p0 R0S@Ad PJ] \Sp0S:SH 0C^ 0@0LT1 0L\0TSpASBC\ m nlnnlllllllnlllnl(n0bC ^ 0 0 00:0 0Pd @0:SS0AR0@A $ P A-p= `P@ d PPd0`FK 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00A ^a0ASW0AA0AS70A\2" 0@-4@0P 1Pv-m G-Q0S `pʯ PV00Ѝ  P00CS0Qh Pp0  W00S(@ ƫP   , P P00SW  X  R00S 047σ,P R   S@T PR   R v-sy-v-@0@-0S yP `Pv-}-@-@WP08Gv-p@-P@PPpgPpv-@-@AP M 0@87ST v-}-p@-@ PS P@p p@-@P & 0@87ST v-}-O-pWP`@P @ ЍZ K P PT  RT@ Z //////O-D@00S P`$  4PU00 Ѝ  P00CS02g Pp0 0 R  V00Sp ᣪP    P tP00SVppZppW  P ]P00S  P yP xsP \mP DgP ,aP$} :~Px}-skU0@-4@0P 0P}-m X0@-0S ;@@0@00DFP0DЍP}-~-@-@`0P0`Sp 0+P PP Ѝ}-@-@P08D}-p@-P@PPpfPp}-A- P@`pPЍ0 (0P84SUP @}-@-$ 000B;P Ѝ~-A- P@`pkPЍ0 (0P84SUP @}-@-$ 000B;P Ѝ~-@    /0A-P<<`0@ J0p0D0& SQS 0@/0PA/A/O-@PDШpDpG``b0Y:0z  Z# 0@@Dⶨ 0DA\0:Z: [=0 S: p `$ Ѝ `p-A-@`Ppᤧ 7ឧ 7ᘧ 7ᒧA 700@-A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @Pp TT0 8p@ 劓<0@儭404 4/,00S Y0TЍ&tl -A-`@ 0s P0I80p0pGWp0P@8P @P @pT 0@@PP @-p@-@P?@0 ?@0R:@@pP p-p@-QM$0Sp A1` 6/`1!6/&%!Q10P! \`6/*)x!(Qp'l10Pdd! \\\^`P 6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/Ѝp-&( tlw yp p# ը no Ea < C R a r | O-Q<08@0(00IpPV @⒗x`,@480T:(x(P80< (0T:(x((< 80(0@ 0T : o030H*@`(4 a008  D!0 `@4 P< 8000c4 0300 `@80@0000 4/0SD0p -!!&( p@-@0`,0DPSp1S{@-0D0P/-O-EAMHP MU>!0`0000, 0P0P6p0,00@00`o`L+5pp A>0t@lTllH0SpW W DGP 7P 00PpXA C9R񟗈tą8`th|؅ Th|0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0- 0  ;/QH$0`S {*0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 0 0045`| e,`PPDAލ Ѝ, !ᢩ/P 0H0- &u ~]Ȣ!p--0H0S/-0Pd /-A-HAP|0`S@M*0S'z50S S fr50P 0P@ @Ѝ 5pW*P 0 000ݕ0p5p@ i`0pcX0 T7/0S 90SP 0 P0@ЍA踕--&tl G-\qPL @0P12C001b5R 0 0&0S  15h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R 00n0S0PS &0S,P N,@GH--!\  0L0#0-@-p0M  L0@31 ^AP 0C! 0ЍlД- @-L 0 0@11D ^Q       -A-Db@0Mu L0 @2# p PW%cP_  Bc p\  ZQ$0 HD@,X#10000 2R01   0 0S0" V00 S Q ЍA X 1(4/00~X1威0 SV Q`ЍQ0S ⑔ЍA苔`\c  Z l'@l%0S Z  a0@0-!C-Q`0MS 00S` L@P: 0s%@Ѝ pᄐW   @巔 ֔0p0|0S0S %@Pp3p00FV@@3P 00T p@ۓp\`W 0S:S* ~ ᝔0p0pp--O-`LqL1P0SU$,@T,P@P6 h0d 0B1 `P 1ؓh L0C R P!050%Pd @T: Y 忓0 p[L0CY1T*Q@@-G-QT0Sj:\0`S& 2 c@Oop @d(0d$00@X1 0S. L0 P B I %Q * RB  0=408@S 1:X 0p@D7C 0p03 c0?o< @@D@  ʓP  NP ` @!ⵦ0 a`2!! 0 00p10P-&A-p0@@ `P PP0`0P P@l%Q *0S  y-$00S:@-@@W-@-PP` U(0SP@P )@T \0@{T0T 4/T떧 00'0S 0 (( @o1Ѝp-&( ]O-$M@PpD00T0SdS )@TPY P3@IH3H 4/"Y(0S p0dpY`WT0W @p pp0Yk0 # 30f*[`C`fQl: L@P7W KL ) D2 10Z 0F30 %0S6*0S  ϥ0@P1'0S 0 0@0$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@屦0 f`[x [`K``fpP @P0p0 KF K0`F@  L @%Q *0S  @-&(K ] p-@-M@pP,aD(0SWTP )@T: 0@Y0 4/20#880 P0U6@P  '0S 0 |( @;0Ѝm@P %Q|0S0S PA 00-&( ]O-@QpL$M(0S@ P u`(W +0PT\\0T**P* 0`0  `?oo 0c `S, `P T 1q*J'0S l p@`/$Ѝ4 T$P030#P0S X 200301S%T#2QZ E*0T00S  D`P 00P`P0 0#  0|0S0S @ @p堐,刑`0<0 0 /p`  `P% 0   Ր%T#2QZ J*0T00S  D3Vvv 00FP )0S 00@I,0, 4/"`P-]&p-( @-L0@'0S 0 00 02/T Ѝ@Ѝ-]G////ᔈ&/ᔈ&000/ᔢ&000/ᔢ&000 /ᔢ&000/ᔢ&000/ᔢ&000/ᔢ&000/ᔢ&000 /ᔢ&000 /ᔢ&000@/ᔢ&000/ᔢ&000 /ᔢ&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/ & 00 0CS0 S P%0 /p@-P@,`狟Pp@ TpL!0A S010//L!0P/!R/P/P/Qa/P/0000 /ᔢ&P/ 0S S//@-@!6000/ᐢ&000/ጢ&7@-@PD@P 40R0PP0 $ Ѝ0( 9 ț&PQ 0S///̈& 03P/(0 ACP 0AB0P CoSPS//O-MX@ @ЍO/SQ`p rT} 04S`\xP0@`,S@T~L_Uᚔ!` 㰢@T`0`PErCT 04SX:`\V0㨱0 LT  Q X ( Q  ⻎P@PZ P  yT0`0S0?oT20S@W-Ѝ @&0R @T`0-@S@`00P  0S S @0V @ X 1?@0@V X*0 00`!00S00/|y"& 00S00/W"p& ///@-@H7@P ( # @ț&G2-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P @p@-0P `| @P  \*. Q  Rp R  (  p 0 B ꔢ&-qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00 Ѝ0S/1>3 !/0S 000/ᜂ-0S*p@- @PT P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!ʇ0`0sA-0p0@P`M̂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ00 |R 0S |0 3/000Q R R0SQ|P.00 R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍ蜂-A-PRp `@P 0!ᷟ000A-@Pp`0 SW' WV00S񟗋4<<<̳ȲlV VjpGPX`ч1 X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0PS Hp  B0s  B`NpGP`Fe`AA-`@0PS0<R"*1 21<0S 0R0PP0S*! !x000S(!!!,p (R0PA , (0 ,P &&&A-Pp0 R*S\ ]\ t`@BX T ᪚P7P`& R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00蜂-< 08 C800/`Q'Q!//ᔢ&p@-P@0`WP@@p Tp@!Q 010//@!$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0P` &&&O-P 0R@M ܙ P&  ՙ P 000Ѝ 0@  QPP ЍO 0 PS@ c 0 00<00S*^Q000800R ]R00-R Ԗv0S* ]R -RQ\U0]Si-Rk0 Sz:0S00T6000S8\ 00000 68^C8e SeR ,0Sl40Si$0Sf<0Sc(0x_ j 0(` pc0@`F p@ Uh 00C0c-R [RQ :R =R 0`S:  0Q00pS0p000-S]S0pS0p04 R*000`BV R:0pS0p00 S>*R; :R8 ]R500A  ˜0` `BxP⠳ 0(S0<B(R$ PP    rP  `$0  0$ 峠0S00pp0Q00pS0p000-S]S0pS0p0= m R:0pS0p00 S*R =R ]R 0S0 -RB Q?]Q< -Z00  V1 0S. V0pS 0p00S ,Z00V0S Z4 0OP   `hFh400!0`Რ40 P0S 00000 P  P (B( [i 0]S S `Q\  (B( 0  EB#ЍO &-&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@ꔢ&&&C-@PPp\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  mHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB It i @ 0D OX &(  RPSxPA4#X  z 0   000`020$U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP  B   B0   B0V0\S0{SPP0PS<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S Y^0<0S 00$000*Xe .X< 0e꜂-)>{^ ]&@-0@``P?Q $0A  R S@hhhllhht^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )p V 1L  0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   000p030 0V:0S003000 <Q >Q x`P  &  R  #+S  *Sg 0S9* *B?RP {R2 Q/ 2000( =$,Pu 0S 00h2Q 0   0R  0 `S|* ,Ry  2000< V0 R  !   `0 S*}Q00 0RX}QR  Q +S ( 0  BF  B   B0:  B~?S {Sz   B0(  B 0  B  B  B " A 0000S 00000꜂-&^ ]0S C- `M pQpG (pL@P 6W:( ЍPPP P $PPxP @#P0 uPP 6   00|0  $ ( , 0P4 8 < @ D t_000G R:0S005000 S3:  H 0A0KP  00Q p0 P>3S! 1St Sq S <0RpQ00< 0o )  sSW S<0RuQp< 000p000Q S S SS8 S S4 +Sg >SQP>3S S' "S 0SU\ S: ? <0Sg 2H 0@0 @010 0  H0S MPR, 0E10S*P 08 BB0SE0 1AS*, ^ R0C*@ Q U B!U \1LX0R#3S#^S!7l80SD 0>Q Q QS 00 0R 10C/TUUl-Ee$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0XP` &&&0p@-0PS0<Q@*@80P p<0S P pH0@0@P(00Ppp@ &&&O-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T +P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  rP:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00Cꔢ&^ O-Pp`0,@Q V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. P`F`FV00@>N>0> \0C~>!0>#0 R@u @O-4M0\0( 0(0 000p 002   0 X = Q  0 R)  R # `Z X !,    R  $  S  R  V  PP$ X$@1`v X PP@(@ xPPP @(r P  @@ $ X1  RvX PYtt vb  (B( _V R  !    _X RG v@(@X 0x  v% YPt P I_Vytu xLt  _`V `R`V t@@ v(  P Px Ptv  O_XO 8@Y (@X bY0txPt- xt v  t v  (B(   _X_V Q ( X ,0 _X @itg v xx ,    R (ZS $X  $ 0` (ZS  P 00004Ѝ0S0 0x| @P ꔢ&O-P`M80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R >sp0 `800@ 0 WZR  D>sp 0 I800@ 0 @ZH  D>3 1> Q p0p-800@ 0 p$ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T rP0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  mP:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00Cꔢ&^ O-pP,@ W`> ^* +^` ^i ^O ^a pP ^o ^Y  !P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>00 E 0000S0R0SpG pGPt0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-3S SY S$ SVSc 0 F>s2 R >sp0 G800@ 0 >ZR  D>sp 0 0800@ 0 'ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R >sp0 G800@ 0 >ZR  D>sp 0 0800@ 0 'ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  fP:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00Cꔢ&^ O-lM`-PQ0r @-Qm   i        Q 0$R`S, 0pp WK,[ 4\ 8Y| <HZ01S0s x[RPR 0C1!S 0ǂ0p[Z 0000 ,@4H80 0 S I0 0CR 0%2 L j0 HY0S100u 0 S 0}!  0 @S P0CX 0SY 0 0$Ѝ 0 Q 3R0D]T00S SD @ PTP?: = @   40z0 R03S? $|? > Q0@-M@(,4`0  P#USA\ 0 `U-00ĵЍ~ r0\pFW`&SA0@-(M B (@tЍ0gQ0@-M `@(,0  P#USA\ 0 `UU-00ĵЍ~ r0\pFW`&SAg0G-M@0p`W PV P%Y P.X PmZ PNx P4 P nWf  n nV+  n {nY  tnt onX5Z! L dn< _nЍYXZ-  Nn In  @n ;nhЍ 2n -nZVY  PЍGJ(< < < ; ; ; ; t; ; ; ,; : ; : : G-PQ00R0p`ᤔ00M 0 @P @0S nS a0CSsNU2  0oSm }PN Ѝ}PZ V000U000}P[Z V070U070P}PZ V000U000}PZV000U000}PZU000V000z}PZO V080U080i0@q@p}PZ: g}P a}P [}P`ZL V080U080?J}Po D}P >}PJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000l|P T|P d: 89 9 8 8 8 8 7 7 7 P7 d7 47 6 7 5 5 0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  J p, 0 ၁p@ np@  7 p@@@d≁0 Pj낁P倁0 P# yP`Ѝt00@O-1MM @PDP  8 "(  p C. ` pX) @D;@8 (0Sl pp  ` ᰑ 00㨱$ %0!` p@ t0!0l  Q PO P  0S R001ݍЍ0S 0K0S R  P p 0 8D<4! @ P0 00Z  0Z20h,R <! 1ݍЍ p|4 H4 FtH4 |3 |3 l3 gt0@-P@M 0  PNp ep@ P  Ѝ00 0 Ѝ0@Ѝ0A-@@0s/ PP0P  0,7p` ` `e 0`0膀0ppY X`p {``M 0`0n 00ZxRpC-@PCM2 /pP4 $ pPC `  @S000' t3 0C.@ F P4D@ @Fzu0S VS00 SCލpt@@0S @\0\ 0P@0  P@1:?00@00@Px/ / p@-QMP4@SMY TE /EpPB QP0s+  {P = QaP 0`6pG @ 0@0vqp> D up7 ۍЍp+0si/ 1p0 +j@0 P@0 i P@1:?00 p 040#S @@@-p@ 004PXOWO %@DWO- - @-qP`O-$(X,P0p-S`@/U'W1 ? xZ0 0xP : [#P?5# yq 42x2 zPWi@rUZ0[% 0@-DM@ P, P 0`0?d0t00P0?T0l0@0?D0p080?<0h0H0?L0d0/X00\ 0 00#(0`@S  R $ R &R  :6$4&60!$ 0/!!> 5 Ã111Nş P ą?(ᴕ咉 ?( /( R  " R,咜  )/,< 0( 08# L.:6,$4&60($ 0(΃ 5#111L4 ^ 9) 0()0"!/#0 0 ,僂 ͌0, 0 0^P0(0 0T 0T$0s/`@ #)0`@00%$0S`@P# R"  " R,"2!x"$0St"x`@ `@x3p0P a:($^0\<P0W 0=R( Q( %0h00c @D0 0]s"):60 0($0Ϡ! "(>0!!!0C 0 \ ( "Yx? ,`Ÿ 0/  "1? A  , , 0Y (Q0040 `@10P :P0 0<R$0h00c 0 0rX!):60 0($0Ϡ! 4!(>0!!!0C 0 \ ( Y? , 0/  "1? A  , , 0Y(  R0#/`@ #)yyqxdx0!!!0C  0  " R Ό "!( #Y?#"0/  `@ D#`@ D `@000 P 0Ss D%`@Q0i 000 \0S_q< 8 D`%d`@D000 P 0SL!D% & PA#RLP; R8  \Q,%8< &0dP(00 00% :60 0!$Ϡ0! !>%0!!!0C % P5!" ?.Q!Q( 00 #0BL00 h00%Hw 0C000 00S ^0 0  s 0L0^ }  C00 00S ^ 0 0@P \' R" !O-Mp`$Qw0lL0Mw0W@0 V3 0 2c1  ?80PP/ 0v> 0`0?d000P0?T0 080?4 <0 00$$%"˟$` 0000  000V @;0d0P] 0TPP dPN$`P0Sʼ Rʨ R ʰ R  0 0f 0S0`@dp?O$@T'pET0}Np0`@dp00v v^D@D 0H080HXP0 00 PESQSp PQJ| 40 dhltxP^@S[R R00d@px0Ut0Zp0 Rl0Xh0 Rd0Ywt [,[8P0>C 0C 0p00@t0p` VP x0S Xv0pt0 00@p d00Pg xT( "ό R t0"! R RYv 1 ?)/!! #.ǟ/ B Y? ?.P  Pʉ 00#1?Pv.C BAQSx  \tp Ppu 0 qp 0qpu0S@T`p VPy0 ?oR20Su00ߍ 0 ud@qp@p 0Q   Q+10!pR@"NSp \TPd0 P0,Pd000 0  ZR 0S 00@ u0d@ [`yu0S0 !0X0ZS 0#0dd`` `?0dP0? T060d80? <0-0d@0? D0$0dH0? L0X$\BZP ;@p(u0S= C-ßԓ"bY2&:##c2S Pm8PP 0 hß0dT09L30@p4t 00P ` d0@pP ?/( R ß&0Q| 0Z/0 #10">/ 0C!a 0C0 0"#0R"P#. X#0,lX10( #ΌQà3\!=30S 0@! B^ A 00 0`qp: @p(p=t#00t0S@@㴰p 0d0@p괰[0"c01 2c1@T 0 ct Q 0  s!P UtT00Rt0S10(` #ΌQ@t00@po:tT00V6tT0004lH)\P(\ ףvɻ %I$@-@{ LbpTat X00 R 0 R 0Q/  /  X( t  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/'  H  Q j.0 0#  Q/8'00Ɠ\ 0@-pPo> 0@" \ 0 /&A-@P `p@P@0% P PPA-\@`@P pjNP@0& gP PP%A-\@`@DP pH@P@0& LP PPt%O-P M epP9 谟P n`P P @@ % "P P0S  Ѝz T W l  PM 0 A PЍ00@-@?PM 0 A PЍ00-,M 0 OPЍH --N0$ S   0/ 000"$"p@-P[U@pqp?( ( 0P 5/p! p@-Pc[U@pXp?( ( 0P 5/ph!| @-z @P 0003/!h @-> @P 0003/ ( p@-Pr?oU20S@ 0 0 03/p  p@-P`|UV00P00S@p$ P05/p  p@-P?oU20S@ 0 0 03/p` p@-P` @Ppo(@0 p@/l p@-P@P p 0 0 03/p -@- M  {p@(0(003/ Ѝ@ Ѝ/ @-{p@0003/tt O-`$M ؄P @d0Sp $Ѝvo0,P@@  4/ $Ѝ O-`$M ؄P @0Sp $ЍKo0,P@@  4/ $Ѝ( !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////,  | ` P < $  0 p \ H 4 $  T K $0(- C^ 0CQ$ :$0S3 57 $05, 0$0(00 # 0 $0 0@-@$ MP#055050%A0!0% P$00$0Ѝ0 $0R  S,3 5,07$050$0/S<3 57 $050 0$0/0S/, p@-R@pP$(ASp0$ R>3057$ 5 $ !PpO-`@VPpDM@P؆, lp0@ U p 0@P UK UK m,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R#00C R00CT,@DЍF, 0R3057, 5 05 R, S# 0C 0S 0C 0S 0C5$0P$p 0@V@B 0S1 `@@0 SS( S R 0C#@ =0 00 P, Q0Ç0,  0, 0 P<@0S80S ,0 S>3 57,050,0@q`V  FV")VX*0FSTRQPONMLKJIHGFEDBA?>=<;:98bV1 ?R20S/ 032 b0 B12 00@s 0 00Q,  P0Ç0,  0, 0Q @YfV ?R0@SQ  b9@S B88 C c3<21FV 0, 00 R Q05 705,5 0,0 5RQ= 305 7,5 0,Sf @ 2$01$0@@@0TS`VI2=0F?ofR20S00:FoFRQP Q P=V, Q05`7,505,Q,0 P,00,0Q  1@ Rf 0Sc @[ @ 0PW  @ ?RM0@SJ b9 B88R00F @00R%#jo%#jx%ju00@-MB0@ Ѝ0p@-P`M0@ 0 4/ЍpG-PRM[  `Tp~PC/a@I\P @1000< pp. Ѝ80S&  1 000< ppk0S0000< @ ppk0Sx k0S X 0 < @k00k00 @  @ 0 @-$$@M Ѝ|lO-EM M`X@P+p `EV ^0P@'T 0 w^0P@T| 0 &0EAP nV jVUEލ Ѝ^k00Yk00, @-@` pMPSfP& /^ 0RP$  rR$   P @0C rR  Ph 0 @Ѝ0 Ѝ@}0rS k 0   A-`@ p 0P/S /]P @0 Sp 0 S 0Q ip@-IMM@`PP p 0: S X0 0up IލЍpjO00@IލЍpj004 p@-IMM@`PP p 0: S X0 0Jp IލЍpjO00@IލЍpj00l; 0@-@PM 0 A PЍ00P 8 Q  8 //p@-@P PP` ' YPP u V\P  p@X*PPp--00 M (0  ЍЍ/fHP --M  Ѝ Ѝ// -- MN<P 00  0 ЍЍ/pfH0-@- M@NP  Ѝ@Ѝ/O- q`Pp,M< PR% Ppp0 0CS%+. P[ P@ 0 @[P iN ,Ѝ000:Q!0P00,ЍeXp@-(M `@P;& (Ѝp0 00 |dHp@-`@P7Npp p@p@-(M @P,0, 0 `& (ЍpdHp@-@@ @  `  @PNpp p@icHp@-(M@PNp `%8 X(Ѝp@-@PT T  ,M` @Mp p% =,Ѝ(cHC-PP,M/ p@``FV`R V @`0 @T M,Ѝ00 0:2 0,ЍbXp@-(M `@P% (Ѝp0 00 aHp@-`@P~Mpp p@p@-(M @P,0, 0 `Z% (Ѝp4aHp@-@@ @  `  @PUMpp p@v`Hp@-(M@PGMp `/%8 e(Ѝp@-@PT T  ,M` @,Mp p% J,ЍD`H P $ Q80 @-880@M08 Ѝ880/LL0000 0<jQ 80880Ѝ/_pP/0@-@0@0 M0S 0000 X0 x0PP d00_Bn/P00 Ѝ0@PP, _4,0H O-3M0PP 0 @0 `D0p@ P P00U pp0 0CY 2ATT00  RF LD@D T\:[ 2 0000~`K nL0 V0 W7 X2ATT 0`Fs 0Ry UL 0  0 B 0SH AL0Ѝ V0  0  0L 0 0pHX<0S3 0 Lw 0 B@ 0 B  BL`FtZ  0 B  BK 0 z K 0 0S 0 B 0 b000^ 00 ZHp@-@PKppp@ 0RS00 /p@-@<0<00P  @Kppp@ ZH808 00 Q0R00 /YHp@-@`PKpT T   p@pp@-@P\ \  ` @bKpTT  p@pYHO-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDA Œ Č Ȍ A`| Ap2  W R ? \ QQ Wt ,0 000IC11T00Q0 0, Ѝ000X0 00wVH@-@0@ 000 @T @P80@080V@-@P @P80@0800-M  Ѝ0-M  ЍO-ϟiM P̑Ёqa QP@ PP? `K͌U P ? K͌T nP> F͌(1S [P|> F͌(Y IPx4> C͌ X 7Pk= JB͌8W %P^= ̌V PQ\= ^B͌`,=@ 0S078 H0P `P P  P P` P< P P PP( QP PP (Px PDX PxP'( 8Q780H0x100C40S000C,0h0LP 0P( n(0Q0Pd , P `P X hU1q @a0T0 @=T, 0X  p @dQYh`@0`@ мP`'  V U `0P1A1S  ,000@!1S 0D 0| 0?piߍ00P,,0`L0!!\\, @  B  $8 P<`@ Y& 00A00@S= 00 1 `V P`庾V ,PY 000 `,0匰 0[p$0p1`㐀0@@p`GPp  W 0@0@S  P8<`@P(04 0R(0LPP1@0剿0S@@X!(@L 倿0S00!$0P x[Tr0S0 0 j, 8P 0BX00P0 P< BY 00 O0 T ,q` 0q @PV f`Xp0@  P  U  P)U,0V00@ Pܰ封[ P@0㽻PP  U `X0pP @Y 0@X RzY0,0P0  0, H V 少[0D|Ad>`Fp1 ( `1bY( ,be( 'br( "b (  b( Jb( b( ^b,  `,  B 08P< T$,  p , 0 H T0封1D|a>p@8P 0<04 ! , B BP   $@ 0[X T[0,p`p0q0 0q08@<X\PV f`Xp1@  P  U  P<U,0 V00@ P封Y P@0ϺPP&  U `X0p8@ 0<X\P@U)[P,0 CT", 40p! ,0 H0X 0q1D|ap=p@P 00 0R6 (0SJ ,00p W! 0g1(0pS8 1@ a! @0T0P0 @崼T,00 ` @UX4!(0R1@pPBB0P@ T  0Pp 0,0 SR,0, 0B ` p0 W" 0 0B00`S9 0P 0Q!1 @TQ @[T,000 @,0,0Q@@ఱ>P`p PPA U  p ` $0S; ,04 1Y 0i1$0 S- L 1Q!qD0 @00T00 @T,0 0P @Ta$0V1@V T  0 㞹0P@,0 SX,0 00C @,p0 [# 0 0 B0!0@SC 0T 0a!H 1 P U a PƻU,000 P,0|!0RP 0P1` @V0P` T  0 @  040 0R80000S O-pYM|C0cS@` Q 00L3?K͌ 0 00S?H`3K͌ 0H00S?pp2F͌( 0p00S|?Pl2F͌( 000Sp? 2C͌  000 Sd萍 1?B͌8 000 SX 1?̌ 0110SLN 1?41@BM@0810 POYߍ 000Sk H`0Sv pp0S P0S 0 S 萍 0 S  10S N tAX0@-P@L0MH( 00 ,0 40Ѝ0=H0@-P@L0MH( 00 ,0 40Ѝ0d=H\0\ 0 R/D@Q 0Q(00?H/=H$P0P0/ D <  R ,  R$ 00?H/<$0P07 A- D   R'P?UH@0aaS,p10 0D C  (  \@UV@U(  R 00/0<$0 00(;Hl P  `0H?30\ -@@  D\,00D//;$O-PP 4M 0pS4Ѝ˺PH D0 0 0L|!08:|@帺P` `0D0ZP`@0PZ0 T>P V@``@|P:L ?3Q 4Q<  H0 00DpL |"(099`P0S R@,PR @0P : R0`S4ЍT `@004  0`Pu @|`x:$0 00]8Hp@-\0\ 00PU 0@S 'PH]pp7Hp@-@P 0PS P1Fpp0P0% H -? \0| DR0  0R0 S000 0\$( /(7$0 00h6H 00 /pO-tRt2P0M`@V0u T":L"@"4"("2 2 $ 2 T 0 01X 0 01\ 1 ` 0 01l  1pmp0p0npp@z20吲0唢園 $TX\0` 0lm0n =1Q0'0 0 0 0 nЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000(6 l@40,HG-阂pP@M |Ŷ`P @@d2Z0 @#0 ͆BBB"`@C @@ࣅCC倵PV C) pQ pL 0p R] @B0 @@@(P: 0 @@@(P/ 8p+ #p' p0 @@po(P  'd 000S :3S ЍP [By2T @Tmk`Ѝh0S EpP_`34P A-Z`pPp [BO2S @T2?=000 R A5 A 00@-dQ+ P@E0`PM_  S- 41#0!!!!v : !' !_ !| !o ><^p!* p!:! f0p Q R 81 R 0SЍQ @0 0 0Dl0T0Ѝ4/H@0l 0̃ S/O-D@p`ᄤM[ +L(p($W 0CS0S43 P 4 0/$ % 0:̓xsăH pß|x8tdX`(PrHhÃP@弁8x0,($  @2101: R 0S 18p10S pWЍQ `2 0 0DHr'>ppGl`( JZ(@ T (0Ѝ>vrp<q^nvk8#h:e0'b#_z #[H#Xp-U-R`_O|LoIpFrCy@z={:@|7h}4`a8.  !+!,%!-!.%#0#%of&i`"%{j%k %l%m<%nq%t$%u4%v,%w%x~#p#rd"ye"z|@Lp@-,@'^@k( @YT(PpO-`ܶ6 6M000ƟJҭp6 0000SVF 0 p :p PP[ V p?P4S S S|V0S$pPn 0@l   $ `00 4S 0 0 40 s 00bR$ 4S4 0P%00Ѝp PP 0 04P40 s 00bR4 440P ?21 R R0 ;0C $Q B q 0 ;0 4pP.4 S S040S$ 004 0r0  cR$`S 404#` pse0  ;0 p PP4P0u0PPcRT T4S{0z$0P s 00bRS40 00V0ShpP 0@  ^ $@ `00 4S  20 zS 202#`9 pd p 0$ $P0 s 00bR40 ; 0⠴p@ P< pg 40 s 00bR4 4$R2P00$0C?o$ r  aR$2&100 ?c p p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100 ?c0`00$P r  aR$ $ Q 0000 4 00 40 s 00bR 440`00\0\0! 0dIP|(|xLQA\0 p@-P@,0 0 PW TT TpO-T4P@P0DM+ 8 `$Qi w :Q|#R3Z 300S 8 pK0@ W0S0:3S `00X00?! 0*`00 <00! @A40 00Hp@-@PO<ppp@p@-@80800P  @;<ppp@|H@- MP,QܯpP 0@T $T` @@TP  Ѝ<V>0GP0@P@P@X@-@~RP @xRP PP-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o" Ԟ O-00fS`PpMvpJP U0 pr(ʍ"(0I"Rp 3S(0$00 0D?PK ķT:?P ỷ 0XSX%$ LT 0@50 85 2P4S0300SL p0SI 4SC 4S 0d$V、匑Tp"2 =PN 4p2Z LQU P P lP 85oL4Ytx2 PY $4x2$4X|2 Pm 3|2gЍH5S4S 4S0?o20 D p$l h $ <%$(lX kQP Y dQP Z ]QPp2?;~0p220P_0 r("(0.I"Rp7XD  qQp* c0 M0 `0000w5 0000o508003 Ѝ 0< _503 ЍL L0 0`0` Vj#cP` @4 0 000:P/@-0 000傶X0X 00:3S 0@-p  AP`/\0\ 00 :3S 0-p @- P`/<$0$ 000:#Rs/$0$ 000:#Ru/000 000:#R s30/h(0( 000:#Ru30/(0 000:/p@-P0P`@0M0 0s -p 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝpht@4A-$R$BP0@SMz RP 0S `d 1 P00p pQ 10Q61 1`p0V0S  100V0S  034p @ 03, p /,%ЍP  QÁP 0: 0 `x   000 00%K0 0@J00|lPht@4H4@-,@@0SJ00@-$@@0SJ00Ԗ@-X@M@ 0S Ѝ< 000 00J0 0Ѝ蜖@-h@M@ 0SЍ J 0R  (00 Ѝ J 0@-LBL2@P$MQ :cVW0r3p p\?0Scqp 0SQ1p0SB 0  B0Z*1`00|PN 1@ 300 R 8 D 30 0X30}<0  :3,p 4 P`$Ѝ0`00|P @ BJ 0R` 00 `I00T @8 P300 %JhPpГA- M0 P`p   `R`hp `L@<0@00:3S O  Ѝ @ 0 000:3S/<X0X 00:3S 03@-p >P`/@-@0@ 00 03, p HP`X@-<0< 00034p `>P`0@-PPP M* 0Q0@00xP 00 02000*C; Ѝ0|P H00 020000*; Ѝ0p/0@- 0 @P0:R M P% P P Ѝ0P 000 f20T; Ѝ0PtP 4000 Pp0 000:!-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0\@Tp'#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@TЍA-PPM Q@`Q00?`FV`V` ,p(L 0@nTЍP/\ 0,  B0/\//A-`MVP@,p(L 0@BTЍA-`MVP@,p(L 0@(TЍ@-PP M Q@7`pV00Ӣ?0`FV`V` W,(  L0p@T Ѝ(1@ RR( RR T 0 p@-`V,@@Da QP(0 ^0C0 S0Vp(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0P-Pp4S-`w@PP3@ 0 00p) ,4, [ 0  @ 0  lЍB0  :lЍO0O-:$M$pdZ0  r$ @@T^ P 0p p 岢 VH&:0PSF  0 @Pp$Ѝ @ P0S S7 SpUV'0004S$ЍODp @0S F0V  B2Rp  `Fp}EU 0`F EVp  plE@p FPPQO-PM 4 3`S,[*Y= @00! 0@ @00@ "@TP/ { @p ` zPPE @0S  0 ᖡ`PЍ` D o P 4A " 29Ѝ @0 |@ P0  0 /Hy404 000S :P /<0<0 0 0S :P /404 000S :P /P<0<0 0 0S :P / 404 000S :P /-DD 0\ ʌP 0 qx@-|0| 00@T 0J#4R B0pQ 8@.P b @ 808 000S :P N/D0D 000SP:P4@//L000 000S :P /L0L 000S :P @-qp @P/A-0 00pW* Z3$SP! #R`@4Sp`3@Tv AfB0tQ 8A .X-0    pp000 000S :P /DO-00 0 MX% p `P 0 Pp @=P  0 PDp@ 0 5@ ႟ Ѝ@P  P /p@-JP p3S P`4`c30PV]  0s3 S 0P 2 $R 0X0S 0D3 20X #$04p03ppsp@-jP ,3S @P4P30@Sp@A-`PY JSU#X p @R 3S$ S(XڒL0AQ0, X0p ,01B0010χL10|10\ b0 0XP 3PSSpP4Spp3PUpp@-@P PX0:"C0T0XppG- ؀\/P@p  `ᮟP LTL VW PT WV  P000S;0 ᙟ0 0 O-($Z Ap`PVP@8P ( hBT2ZP* T PP 0 QB @00 IB0WXT P  RX8 @(  !B@0d @-?C0 @   @ (( aB  XA- Q@PP% pW# 0 0S0,000 R   R   R  P nҝН4̝`T `TX *P Q Sp  QW024p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S bP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0phpH0H 000S P@ ?# Q@ 080//hH(0( 00Q0/ H(0( 00Q0t/Hp@-P0P0 0@R` 0(00P 0P 0 00@000480H000\1 P``P ` @ ×P@  T  @`` P0CZ``(``@ P 00 0(0 0帡K?3$0 2[00Z2K 0STP- 0C (\00C>000T ,S  !(0   00C0<Ѝ1Su[` `Ph  0 Z  (0000 0P0Q00 ZUZ00T0[(80 @ #*0 0000 ፚP 0   0T S00 , 1 @01A 0 0X0 X`@0 0T0`F[ V@pV p@<Ѝ  1 AB ?[0@p`` @`HLP,D |帠p@D 0Q H0T0Q (00^00Sq H0@0 L0 0DἰD 0R`D0|0tpP  S,01@ 1A`pD00|`\p0 H @ L Q Dm1S J0 (00P0 080 f h10 0S0J0 80 W B0/0 p@``(00P01  (C\00C00 T0,R001 @0#80 00 0 S 0C`C 00080   K 0O-P,0M 1H`  0Z<U1 0p @T% PE$ `p0(@ U 0墘P0 0@  0@)<0 Ѝ-,0 (0 M0 ЍpH- M0 ЍC-@P M(p, P00S 0G`SLhPJ0 O@0H"Hb ``8 ܘ 0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ000 Ѝ0`00SZ00%0   0T S00% , W10X0pXP T0`ER VڜpPpV 0  pP Ѝ80  080 000 S0C`C4Sp@-`@P5!pp 0p@- M Ѝp@-@T T  M` @P!p 0 ЍpHl l0 00S X  8Q Q @ ,@ /&R//ᄯHH H0 00S 4  !R@ ,@ //H`0P0 T 0008!R !R @0<@0/6S//ᨮ<0P0 0 0001S@0<@0//8l0l 000S X *" (Q Q @ ,@ /&R//H$0$ 000S @ /pHP X0:20(!R !R @0<@0/6S//0P @ /A-p@Pp" 80  P` PF  ? D000T $000S0H0H 0 ?o20QQP T//H000 00 0RPT00/ḫHA-`@P` 80  QP p PeU @00PU _000S0t0 00꼪H?o20SRPT //0PPT00/,0, 0000P/P/<,0, 0000P/P/O-h3@P0Y Q T# PU D#00SPH00SPQpP0GP0HS``HpHW, 0 ^  1  !!9pGPI@Yep0S a[0q SV,0 0D |000 P0pP`a`0IS`IX`a,1 \  0  !!}9pW`YHp0Sa>0 S;,0 0D | 0 00P0qpI PX 00C V0HSP 1!TX[00CS``[TY0IS`YPY0 0CP,Y0 00@Hp@-@PpP`0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0S 1H`?c`` AD Ap0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CZ0 00갣HT0 ?o2R0S P (1  //PP P-(^,0R0^Q!R@O-A1@ 0QM4 P`p, @p 0S" Ï#SÏH000C  ```P  (0R0 (00000C00T0 03/p 0PS@  ЍOĢLO4N(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P- (0@SpP0@-0^ @ 0 Q@R0XMO-`P M@ VU``D0S  00C(00P00 T0P 0 S `&, 0 SPp0SᴀJ`Dpᝓ0 `| 0pP Ѝ 0 S RR Ѝ, P e,00P 00X p  ``F , B,(`aaA0  U p0E`4ّP  Fp`,004@ 0U` p0EtPT   PB  0SQ 0 0PC 0$ 0\R <PT 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000U1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP H4PQ8 0 /$ $\/ P/XPQA-a@`ؠ1Pp0$ TZ 10 0 QT$ D 0R U ESpM D10 0 QT$ D 0R U EAp; 0D00  Q P@$ R U E*p$ 0$@ P0*@0B0TP @T 80@Tp` 0QH4PQA-`0`p0*Â@$ PP q@D00T 0QP- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P  0 BS0@( p`0,,0A0C1!0 0i0`S@( X0@-8  PE? J0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M4~ڌ`ʍ@Pw 0㈰(Pp,o ܎PP0b Y4& 80!S0` ``pX08 0 T``0a$ <@0H0|0L P08 0!\08 `0d0h0l0p0 Ѝ૎P4/ ㄍP) 0*Q! Q80 SpG V P  PʪP Ѝ ᭏᫏ᩏ᧏@ᣏ A-0QM@PP(C p`QAR   B P1 \.X) P$,PBPP H0 DH00R00D p0$`P!b@0SЍPЍđ@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI 㠏L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @$40@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0 H@-44@M00 MЍhQP-D00M  ( @05ЍP8 /00@-MN 0N00 P@ 0 0E DЍ0QPO-r( P0@|0, 0!0 8C8PT( H00F  @HDHT,0Q0 00SH00S]   R ,  H D S400,01$00Q$0 0P 00AQ 0%, S00,0,1$0000 S 40p0L|@0H00D00kp 0SL01H@400 0,0000,00 0Yl0Y 00S 0` S0F 0R_4000,00 1 1 01IY0CRڸ/o<"L\ Rn Y@L0l00P6P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Yp% 0 AS 0 V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s D  RD   00SB 80 T8( 0`V 00P0 0CS 80 @%@ NN Œ Č Ȍ N LL\80ɟ`Vpl48( 00S>0X *1h"0( 080 0 @ `40 , 0W Pp$t00Sz000 @0$pd 1`11qWH7H'HH0 )<00 00S 0X *1h"0d40V @ 60S K6( 0p|Q:0A0 0C0/| 10 0 S' PP 1 11RY@ RRQ 0   V %( R R !%`FPA p0p`P@ !?3 pGWaFfP `/0 < p  L  `P 0P0P00 PP0P0D0T H00S y080  400 h H($40 p`\Ѝ8 L0h `T<00D RW 0 R PP! [R  j[ $R_  0E0 p0W  0E  <000$R ( 3 H000S2( 0<000h0S0F  0 0Q@t 4000Vk0 0C B 040H00 R d1S\Ѝ4080 @0 801P00C\H00^>0SC R\1( 0, QA@`3`4! ,\@XP ppX@P HP0@, Q J   4p@,@ APWp@PT ``,v 4( xK r|  h p`TPp P @0`, AVXDP q@DH P! X @   \`Q  ABQ`P P4 BQO p @ p   ,@ 0$8 R p P p , [!, !`w @@[`o P p0 WPn $ Q  $P p,@08 P LPA\H0000`, Iy$ @A`0,  \0 `@00400   0|8 0#00@ 0C40b0 pWPx p p  P  , BQ 0` R G 4 DP @P | 40@ PL0Y0I D|  p~0TpP:W W@ P r@DT GpGGD@d0 0: 40Rpp0,@0C 0B0W,0P 0p p000E,0 PU U R0a R  W R R"R10 S0@a 0 RAA LD8$ `P@@ ,@D@y'T \E$ P0B `0 B8 B!!g' 00Ch 0U40P0 P,0a0 0R0h400,@P d1S ( 87 G <0@00!R 4Q R dP  ,@ ``B 0E0p0~ 0E  <000P$ D8(  <0@ <0,0 0000Sp 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  \9( @` 0 `b( <@0 0L0 00 /<000[( x>@ v0 `C0`  <000tW B `0 U<`? 0 0LPP6Pj <00 pAU YʕbH5Sp@TL 0$`P@@U= 8P8P `$=`0 00 08QD0S0l%R h%R /!R!RtP/P//0= 0 000 0P/<O- MpuPp( d5` 80s+  S̠@D Pr ,R!1S5@50  50 `\Pᴖ 40 0z0P 40 0o40 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0 $,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SJ\Q*gnSt@ Q _SP9 Q ZmSV2 Q iSPV+ Q `jS`" Q _SP Q kS` Q[PS 0Y[=20  0S0*Spt !-=000 0R$"R 2U8Ÿ= @0A004 1aA`PU+ 0S 100S H0 0YH0,N  Z000 0 0 00RYmPU Ѝ0  00!R 0ʀl2 00 !R 0ʀl2 %R t5S 0ʀl2Sw Su Ss Sq So Sm S[j\<0lphd1P0TX POP# @ QH\F( 00ʃlœ\ 1:t“ @-'@T! tƒ'> 'tƒ /A\  B\  ^tƒ    /601P0A 00` P;ʀ :l“3\0 /@P%0000CS 00000000000000000/(5@-@P@M&\\ Y #3t P P 00 O000 0jЍ3p`P -P\P Y͌# /43@-00  |00S d d0 8=0!D00 R 20@-4!41 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ !A\   2,08 0 000:h/0p@-@0@`P0M*l"R R`   P H00 040@ 0 @ &Ѝp0p|02C-00$RSP@ M "2` @  "0S 1#{0 Q  l"R. R !`@ '( v@ Ѝ1=00QM0SJ\1`20+L10 0F0剑Q:20t1=00Q!0S0`20l 00 0&0剑Q:20h00 00`0`Y0!Q 00`M0!Q X/p0 000/-p@-x0x 000@00CS0 S 0 S P00 p/P0\-0p@-0CS@0 S 0 S P00 pP0p@-,0, 000Pw@ p`,p@-Pv@ p0 000S  @-@J Q P\,Q    @/,H0P JP\@-\,AP / P/0S/p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0pPP`@ V vP 00CS/*+*00+T0 S80  ,3 0@/0 @D BT p`$ЍIɟ,0 1A!R 1A0 CPg(pW01H1qH1P[W:PP  pGTPE  P0 00?3[0pPPp`rPP+  U   PQ(0@ SCIP@C00 (0C\00C e8b$Ѝ*{q X@ @ D0|0lp H0@D002 T `V `tV ``  @x,*0 00`&Hp@-@Pppp@p@-@80800P  @ppp@&HO-,6dM0@P$0 Z Qx 0pu`PuQ P1r0P0K W 040P0[000P0@SE:I.A@`0XP0P00PEPUK000 00PS0404 00 0`P0p @R@+40T R80 % 4000C?00 P 0 0@0 0x00 P  0H8#8 S R0 0?P4/[WЍZ  0H8#8 S R@0刀0pP4/pW|Q" @-@ RM !R "R pPĜ\  00@[Ѝ/0Q " @-  MS S PpP$R (@2Ѝ/X-4M0 Ѝ0@-@000M, @ЍDp@- 0B\\@S ^\1  @ % e ,\'\ { d"LB!!A0 4"!! L}0 p%   @ '  pPU< 0 ER3\!@`P    ^0 B! { c\ "0  {  \ @ o% d  + {o\\:\ { cQO-M  Sn0PP 0  &  0 S  s `\@u,\    @ \ .  QS%\+ L GRSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8   R"p} 00PЍ%@ i\@ @ `f` 00#1.Q0*Q 0S k@  RP %p0@ %dd\  @ @   RP% p0 @%@c  RP p% 0 C@ @%+@c     R} 0   @  Rj 0   @TY @ꄑ 0 0   0 00< 0   0D @@ @  T0 S\R [$ J00 S $0<  r0>/ 0 0S0\S 0 S0 000dp@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0A-@0MS0D0@!0@p0S? `  0%1Ã!1P!1"b2cP@AL0L  00210BP0 pW$P@WP 0fSPЍЍP 0ЍNgA-@0MS0D0@!0@p0S> `b  0z%1à ‚P P@0!0A1 0120BP0 pW$P@TP 0nSPЍЍP"0Ѝ( kL>C-@0MS00! 0p0S2 P  0%`1H $@0   0 #1$  0H $$N04!b1cD$!b1c  H0N 0 00ࣀ((!h!b∀C P㈁ 0tS0cS0S㸠 0 @00 h@PT0< X 00k @l`NgݜkL$>-?LL*S8z A-@`p0\ %\0PpS sS lS@ 0\TTW l000P1CP0@CV` 1D![00O-餮pQ qM PP- 00S0406 `$  0l@H 00S1  RS G@T l P p 4 @@T %T@%T400 R,:PjP 400P,%0p,08=0,P0(-(͟00:T T) `DV%?#"< / XT c`D`Vfz t``` 0`DHlQ 0>T-0p0  Tg@W -@@@C?T@^ >Tp A0D =R=S3t 1CYbewV.`^`0^@ C @00! D 2d* R:0\'TOP ͍R'R ͍T0   R'R'Rp@@pI@[ehP 00040\hP, 000p^ Q1`!RZ 0BS11`W PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#{1S 0C-11@ Q 34 00`Q,]*P 0 7p 40P040`OU< 01 1`0@1O1S  0C-11@ST 400 Q,%*P  4 @@8AT @D=AA0@a DQA DR3@D1@ؕ% R ?R ;RM  pR 0%R 0@a0D RA0DS 13 DOS ͍!!010@Sl00l0 0St00t0QU PE@=1QP OU6 =1 =10@1@10D R-1!TORP=1=1 @T!p1S 0C110 S@Rb  ?R ;R QeR  pRT 0%R 0 00000 0 B10 OQj }RR0  R}R}R@@pr!R =1X@ BT! 4 Q`!`10` Q,0*S 0 #p 40040@L, 40,qߍ! 1IY00@QU PE=1@Q@1OU =0@01P@ Q#-1 1OS600PgP 400P,V 2gP 4 0,`V e``&``VP``P``Ê`@oobP``V} =`y`@vs`pQ AQ AQU PE=1!T@QOo1BV 2g0PO 4 0,0R@p 00@  0 m 00 @ 008 ' V8` 00 0&@DQ0VT$"! y p]K5#A 0@0B!@D: Oo0B003 0@00-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/PA-pQ@PM 0S! XB afP `V! 0v0* V U~ ``Ѝ2pP0U0f ``U 8 0 0 R U  Ul8P0S U8  p 0S R 8(C8B((0 000SU00P ^m0 8C8(0P Qm0 8C80T෱U@౱4ୱlt $v ,v u u ht@tu Xu ,t 8t t 0R @-ME0@S  ЍA-pPOP U) @`TV 0PS |i@P0DV  P oO-PR M `Q 00 Ѝ@ pPb %  Pb  Pc d% 0 ES  eP   P  0PP P 0 S    P` 0 S  `  0Sn  0`S  0PS  `V$ `P 9f$`%dP !dPdP ~ 봰 0$[PP "(  [ `$@ i  (B8BBXnS0 sS fSU/o0"S R00000P`h&h V 0@:  B 0S  C("(  ` P0ጲ / P 0 U W PpU 00d  P`Vl Q`Fh&hVPb     0 SPW  P`U= o᫲ 0p @  0 ` PEX%XU !   X * `0 @ p0 00  PR0W00Pc0X0  0P/W  R000Q?e  dP$% P0(C-Pa@!`pM0 2 P y 00v 0S@ PЍ\`P  P0 p  R 0S 0IPP   PP004PЍ @  0 dP  @``+e P*`Pꘟxm DO-M M:S&0:SSP 0`S:Spp@F T R!*   @ 0  tDiP 0P:S ۍ ЍPۍ ЍC-pP,Ÿ,M M@`t-P) 0/SI P5{ P 0 ۍЍC0P p! hP20 ۍЍCl0P 0S/S ѥpP ;dX y02dX IP 70 ۍЍC0 PۍЍ p 0^ dYW L0L 0 $ۍЍ404 0 $j j j j j ,j i Ԛh G-p`@P  X0@cT  NP @\PP<P P @T  @0G0-@-@ M 00 Ѝ@ Ѝ/K Ѝ@ Ѝ/@-@ccc@cc c0c@cp@- 0@SM 0  ЍpP0`0 0 0 0` 0 Ѝp 0p@-PS@:pS tbP!p`C- `@V M pPᤐ0fU@@`V   0W nU sU  `V  0@00 Ѝ R@@@G- PMU# `pfSPU @ ds P0 0nS sS SPUH 0 Ѝ 0S00("(ЍPA-P# P /00`pp0,SS00 0\,\@Cf`P   p`p@d  C-p M@`PP(>pWX*nUO sUF fUH0D Y)RA @aPK H0D@ pH0@0 H0H0nUp@0 H P4 sUG fU? L00L0 Ѝ@P%  @AP80W D08 400 _ 0S0008  @H0R# ,0 0H00H0H0@ HH0@ 40 0yH0@04 H00qH04 0H040, R0 0dH00H0=<;:yl76ce3210/S-Q+*)_d` pPU@ U\%00P  @ P00@ %00    P`P pP`,N]8 <04 $nP@0f  P +P p P`       04 $9 ?U  #u 0 S00P{p0pP@`80 L0@\0 00 $04 W80S0P@ `UPPpP`O 0$0 000000 0s0P ,p:@hFhvnXEXu= @0n  8P% 0S00 #PhmqPQTP eP0 $Z0$ ,pP00E vPXEXu0k 0@s 0 P0P'0 $zP+] LЍ0$ m $g0`n0 $\p$< V p `K R R Q O $P O LO N N N P/N$P00//@-M@0 0!1l!1"b2cNL 0@@0$@B!A@C0.PЍ赁N\g P0`0K?//@-M@0 0 ClB N0"0L 2<@0$AB@C1dKPЍkL|>$0P00?//@-M@`0 x0C@N $@L0B!b!bN?AA4 1c1cL0P0@$$C!d!b8A@C1PЍ-?Lp*Sp@-0P0M`2&@P 0Ѝp^, 0 0S Q20ЍpG-1!0  aP P@4 04 S0p0p2,0PP0  |Qp`  wWPeȄpEQ  lW| 0 ȇ0H004~@-@P [[[ [$[,[[,00!R  !} 001/}001P//x} @- M`p P0P0@0Ps P 0sP Ѝ 0@P ЍtC-@P,MA!n`Hp@\ yf"RDK8d$7$rQ>*:eRZ>t [~|iUD1Pot{Yo"SRQPOLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!   X" ;T<"!00,ЍPM P :0 00X0BP P. ~P d* 0X 0 0"P 0cP0z:0 003X P 0cP090X 0 0"P(:<:"}Pi 0cP0Zh90X 0 0H"kP^ 0cP0K$ 0X"  YP@ cPc  (:_X`pF"(9" 0ϧPf9P* e0cP0d 0X" v DV0cP0080X 0"8"P D0cP070X 0"`8"P 20cP0 ʨ70X 0"8"P  cPpdX  0"P% 0cP0 70 00f P88<8X"h P 0cP060 00QX@ P 0cP03p60 00<XW P 0cP0 60X 0"|6"P. 0cP050X 0"6"{P{ 0cP0ʘ50X 0"5"iP| 0cP0yT50X 0j"5"WP\ 0cP050 00X" EP q0cP040 00X" 3P _0cP0Sʈ40X 0A"4"!P M0cP0DD40xXB 0 P <0cP040X 0"(4"P *0cP030X 0"3"P' 0cP0|30X 0"3"P 0cP0830X 0t"P3"P 0cP0$20 00X"_ P 0cP0ʰ20 00X"H P] 0cP0Pl20U 0 01X"= P 0cP020X 0"<2"}P 0cP010X 0"1"kPD 0cP0Dʔ10X 05"1"YP 0cP0P10X 0"L1"GP` s0cP0 10 00X" 5P a0cP0R00 00X" #P OtlE E D HD C C HC B ?|B 4B A A A |A A D@ ? ? ? > X> l? h> > = D= < = P= < ; ; L; ; ; |: \9 h8 G7 8 d7 (7 6 Ǩ6 <6 @6 5 5 5 85 $6 X5 (5 5 x5 4 44 H5 D4 5 4 4 4 3 P4 3 3 $4 2 3 (3 2 2 2 p2 d2 1 `1 41 1 0 0 h1 0 \0 h0 ! @-DTH0 ,0 ?0cP010 0 0IX P] 0cP0T10X 0"h1"P cP!AʜX  PW 0cP010X 0"1"tP 0cP0$ 0X"  bPq 0cP0h20 00X" PPk |0cP0ʬ20X 0"2">P j0cP020 00X" ,PW X d2X"!00NH30P30 2X"$ !00>30 2X")"00130 3X"i"00$30[ H3X""0040 0wX!00L40T40d P33X"I"004044040 4X"8"0040*40]40 d4X"5!0050'50 4X"!00H50P50J 4X"9{"0050+50 05X"h!005050) x5X"_X!0050Q 5X"K"00~(60z0608 0جX"5!00ht60 06X"'("00[6060ẬX!00J60 0᧬XJ!007ᜬXS!00, 7" 0㈣PX"00 0}X!00 7070 7X"["0080M 7X"(!00080880a@80HIP" @8X"k!0080]"00!00"00῁PԘԈ1!( !00z"0090r"00m!00d!00_"00Z"00U"00P"00K"00~F"00yA!00t٫8!00k@(Z BaP  L:B@P 0P p:"0S:!00J0SX !00B0Sz !00:0S{ !0020S| !00*0S} !00"0SD !000S !000S= "00 0S !000S "000S !000SN !000S !00PS 0S !000S "000S !000Sb !000Sl !000S y"000S q!000S# i!000S a!000S Y!000SW Q!000S I!00|0S A!00t0S 9"00l0SW 1"00d0S  )!00\0S !!00T0Sk !00LH& c@60N"00A "00<"007"002"00-"00("00#"00"00"00"00x 0ᲓP <5"m 0᧓P"5" 5 0 0+4 @@0 140 040 0 l4 @@mh0 84L0 0{4,0 0z3 0 0y30 0x30 03 @@30 P3|00 J!00}3L0 02 @@0 g20 020 0|20 0X20 0~42|0 0u22\0 0lg1<0 0c!00#10 0U210 0Lgl1 @@0 ?81 @@0 2%1h0 0)\0H0 0 0(0 000 0t00 0PP00 0',00 0^* * 0H* t+ + P+ * H* * h) x* ( * ) ( ) ) ( ( ,' ' ( P' ' x& ' ' @& ' % % & x% (% A-t ANL\0@Po>\DQ; 00P \QHTL a`0 9 0C46 0b0#6(7(0a`  0( A03\ \ ANN1 0QU^\/|2G-0@P Q0>A L `@/ƌ@0pG/p0PϠ B`@T 0 P\^\4 0C@PU 0. ^\!B\A ! QK%RL:     b3Ό2@XX 0唧 05P t` 0z 0P tP`P@P056Q 0} 0` 0i 0Yn?P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BT@! "V @D 8,0400G0, 0 40@( (8/P840,0S00 40Q 0 @-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0000CS 0S H=006c@ Q,=00 C0 0,0pS P<`@@e0S 0,SV [ 0PC0000 00 0 0 0 0#1^@0Q 38R0 4 RR  4,00 PUSY,, < 0 40 30O <Ѝ(0 S0(0@I; 03C`;0U 0PEd@T0S` ;0  R S R PQ0 P 0BS  0 0C R 10Uk 0PEd@T00  BR00S  7P 0 S0f8&#4<f4#R  \:00P:0 00 80B4 R,5@0 000 000 DQ1  P !ADL B \000D0S909 UR000 0pP <`@@n0*pS0 ʈ  P<`@@ ;TUS 0PEd@00 S  SL S5 8a@D00@T6c0PEd@T ULQl80 R H0A S00 CR*ʈ+R~ D800$80LQcD0ʈ;80\0T U 0PEd@00SQʈ@6c@D 700 $ R40,0000 700gUw  PEd@T  [ !RX 70Uf 0PEd@T:ʈH ;0 H @D;6aUR 0PEd@T:0ʈD+1 0D0@D6a+D`60[{ U1 0[![4 0 0C 00  00D0 PE 0CD0 p0Dld0h \ X 0!PU 0PEd@0S^6c@D0l0\ 04 R! / Rf<500 Q 0SU 0PEd@T6 0V3 400400 C`l P[T U 0PEd@00Rl @Da0C T R=0 U 0PEd@T40F?o20$0S0h $3$&$B0#22cR]0S 30T0PEd@TU|Tj0PEd@TdUp  0t$ R R& D U1![ $Q P LQ0Q 0 ! B00  0D PE B pD R=0 D l" 0$ R D D" C$ R$," 0+0;6cD@D10 R   B0 D  010$0S  &$   0K` `@U 0PEd@T$0D`S` 0-0`@+U G$ 0R $P (D R2D507S U     0d 0S PE p000X =?>?N?P?5?P M? Q?H?A?L?H J?|  C?  B$ 9?:?;?0@\,( @Dʈ+6nM2a@D0 D0B$0S`0  0`(3@0W43&8#[ D30L3HL0  h300@S|3D0z `o0aS 0X00\03@D0P0;T0300 C3a@D06c0D@C c P8l01r0ರ^l[PEd@[UsR!B"0$ 8 S0l00X0S>0p0P0?0X00 p0toP 40s0 (CL @n 850c@ 0`0P50G 00`_t50R|5l 0Y[qPEd@[kU 0C00Sq 0 000 (1 T*U $((U_ PEd1岐@^ $( 6cQ0D6kD @C6c0D@CaC6L0$ R&400  0s@ 7`0> 0cV`0@+KP6c@D\ 0ಷ@D&a@`7l000p 0 0P0<`@@0 $(C 0X0S>0p0P0 Xtp0(0$P$(0/ @80( &b0R0S(0l8@D0ڊSR: @3 0@l0$8@0@80t 0c \ p T d \ h WP ,90B0 `C40SP90*p@-@LPP80S ($03/$0(3/00pPA-@`4PP@p0 QR 408 B|4 08@vV000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000P@P`P-@ R2Q <001 0 0S!B<@0 RD R  0cPࠓ^ S R5 0 1 Ra @ <00 R1@ 0 <l0P\p\ G R R0c BP  R S R 00S  0S  pl0Sp0p0Cpp0+x0 00 0DP,040p0 x0 0 0 30 Ѝ0l0S  pl0@@@ eXvS???tP 0S $0S 0S P?,A4 BR/ Q /@o/A?A-PXPZP 0|!(`3/@PW 8pW8  ( 0(3/pPH 8 '$!#P S>0R:oRS B P T  B T p W0Bp$  (08#8p@p  BS>00p08 ` P S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰX 0C0 0$SQ $Cp0`0 sRpW-0 p  p0 Ѝ0` R`V40sDJB 0|=J^S30 b6 08#8^0X 0 C∀0S 0SCXP! P( 0 ! 1T2 0! T 0SЍ0W0T0S Ѝ0D?o 240%R00S020,0@0000,004@0D?o280(000 0 0 0C$0PU?PU@PUAP0UAPR@oPP 0CX2p0;(8ӗ1Ӆ1&=tPxl0fPPENAxtP N0NPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPP`l h\0S8 B0l0\000S mMP`-0S P(p00F S$0`0!h0S:l R1#P0 6SM \0P8 Bl0\00PЍl08  : RƃPƃPƃ !hP\0P8 BWl0\000SЍ\O-pj P,MXt \l@80H00XT 1#D04 @  QH0@ ,0 DA?C0CR`Pƙ Yp0&0D8#( ƙ#<0ƙ@30 B0(1I>RP30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80X`TptP` l H 06#0H0Xl \0P8 B l0\000S,Ѝ80&6&6 &!9096tl L Qtl \e 8t0 S` R S9 Sl@sX 2`o 0D 0 4 @0 0A$H0   @`@ Pl @!0P PH0P `   @P$ll R1#\ Q \P80 B0 Gl0\0w0P,Ѝ\P80 B0 4l0\0d00S,ЍlWO- ,0PK[ M@!0 ДP0pUp/oX" Xp zpHor 030 #4 B %B B  0BVU2W0>&* Q!M:l`\A `Fp W P!P1UP! U:XUppU`10\ 8  \ 0PE0 000C00U00\   W 0 B0 0 PpU` ,8^v0 6A,0 l0&\0PpU`l0&R65V`    R\S#` Ѝ R R0 PR \:0S@\!v!w|U!1^  RX  `\h$X  `\h, Rl R O- M`0P 0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPH/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S>00000 S *S0SWq00Q 0SD0@S>P0 W0Ss S00W0 00#400 03 0  0#400  0 \0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000* R0f9S /0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E000S ! P B R  PE[ 0 X0 * PH n0 ,0 SR0 B00 0 0 0 0 0 S0 S00ӈ R01q 00 @ R}0ES IS= [S8 gS8 00S0CkWi D8 RC0SS@ S   00#  #800#"0    ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S,  Rg00 0 B000,0g  S  0Q0q0S 000#40m0q00Y0SZt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SWc :W㴖K 6SV \0l S 8 B0 l0\000SDI\ R8 C0 l0\000S7 xZt0(l 8`R B  ^C 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l S+t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [ KoP᫲[@ `P``0P0@&ƅ&0(!ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0800S=p#  #800#"0 00]E1B 00c*W6F &R< \ R80l0 C;0,0|h 0 00 0000 B 0L0DC0C t0S*l0\06\0l S 8 B0 l0\000SD10,\ R80l0 C97531/-A-`pPTq@PG Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0 `\p# 0S%t l00\ R6S S L D0 BC 060@! Rpp  p@-@/PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ ‚2)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOzv `fp00$0`(0 } Ѝ8 80  000&1-M 0 0 AЍA-P?PUPb8 `7 0t!(3/@PU \!@, 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/bO-Q M R x 0 R 0#01,#0Pp4` 0  0 + P%*0 @)0 @$0 q0B0PQ1;`,:(9p'463041 R P%BQ` 01 0 0# Q#4,!!01\!#00#0#\#4!  01Q #0P%0%| 0S,!R4T0S@S QS,T%@$@N%, AS,D$ S$, AS,D$ S$, AS,D$ ^$,00B00 R  0 0#01Y,# ЍP0#20CS!B1Ppubf8a a```X`_ C-PRp ` P  0!\0 0#@B .P@18R0  C @$'^ C-PRp ` P  0!\0 0#@B .P@18R0  C @$'] @-@Plp`hPp@` 0!đQ0 0#B   ] @-@Plp`hPp@` 0!đQ0 0#B  \ p@-P04`^00# @L P%!p G-Rx 'xh Q RO SRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#7&c2pG0N 1pW|GpG1^NNPV=F10C>@@P  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0@0C 00 pQ80'7b"c2pGNq&R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/D U/0S0`0//x 1d36@-S k>@@0 #400k.06S0k. ς 1O- p:PTU0!`Q`+ṐY* V@ : U @0ς!\KU V*  p0Q=0^QQ [ 0O-0 0@ 00 0pq0 S[Q 0嵟  !  W X SA  ׾ᨦ [㑢* & "& R\+ ೞLY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0P 00Q00S@\ R 802^02N00 R0@\<ЍW@  yP 01LX 1R 6 G2#6pP^p N  p=A-`@PT1R`QPE0+~PT S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O-` MV00R@ʀkf W !.⼠ᾐ5 i8R#8% P000P#406IP0cZ38#8V嫞⼠50aS)0P⸐0P%TPVAPeZ5) B("(Q1P8#8000P#406cR!0C 6V V0T@R p` PF_oRRPU RV0W RB+pᰐgZ5P8#8000P#406pGp0cY38#8 WvAP78p#8k.00P0p#406VPcQ 0C6C0T@ Ѝ+}ⶐpi58Z#8PPI0 00#4 06P0cWs8#8 UVZ AU0pX%Xk.PPP0p#406VPcQ 0C6 0g0bQ^`徠἖0`j9Y8`J#8 0 00#4 0编0iQ8#8  R0἖`2006.01 P V+ B("(5VPk.0V0o B("(7k V0&0`8p#8;O-ʀ6knS㼖0M $P  #  # #  #  "A @b98 T#8@p000@p#406 B0c^8#80἖&R @ P$ pḀn98 Z#8 0N 00#4 060cX8#8qX tq@DH$Hph>W8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಐpi>8X#8000#406I0cWs8#8 0@弖^| `D B("(9@n8 T#8@@p000@p#406N0cR#8R0἖\ b98 ^#8 @Pk`0`00@#4PP0 B0`Q8#8 k0&Ѝ0἖10἖-\\\x\l\00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&A-Pk΁@`&8#8 R   pp "$ &bS0  Bk>& 0  8#̠  4##<V0 0 000*60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-k6 S#("(00@P P 0 #4@@06 c\  ("( 0Ck΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@PP@ @"$PP Ɓ0O-0 QR@ M, R 0p&]P+(+0N  q/ ! RH@P j   Q&Q3 "[r&k R0D 2 8#8000 #40&0bP8#8 Bk0&N.V }0G. 0S0 0xS0   0LSI>X&&&&0 Ѝ(  \ P+R +R ,RE R  Q ,^ R3 "&][Pj 0q ЍO R \3 "[kΆ 0("(1 Q8#8000#400aR#8#8 A+ QB Ƞ(,Ƞ!k>0#400a\38#8 A Ƞ,Ƞ18 Q#8k000#40缦0j\38#8 J Z㼦Y@ Ƞ,Ƞ!k>0#40缦0j\3! J`M⼦k> / ! Z! ! 缦jR!! J^ἦ    s Q3 "[6@!:!18#8x!28#8 SRlO:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  xM0S A-P p@0 C`0@Z\TUT @<'P &/@- MP`p*@P @ P V\p + @P  Ѝ 0@0 Ѝ@ Ѝ0@+T  Ѝp@-P*@P @@p 00p@-@t*0P 0q000 00p@-MP``*@P @ @\00 0[p Z+@Ѝp0@Q+T @Ѝp0p@-S P@0 C`X0@[T 0 p&0P@p%yara0p@-S P@0 C`30@[Tm 0 pw&0P@p%tcid0S p@-`@0 CP0@p[T @Gpp/0S p@-P@0 C`0@U[Tp;&(0P@%p/z%yara0S p@-P@0 C`0@1[Tp&(0P@p/V%tcid0@- M P@ 8[p  @P Ѝ0@ Ѝ0@ Ѝ00@- M P@ [p < @P Ѝ0@ Ѝ0@ Ѝ0yara0@- M P@ [p < n@P Ѝ0@ Ѝ0@ Ѝ0tcid- M} Ѝ- Mv Ѝtcidp@-@P%0PPptcidp@-@P%$0P p00ploobp@-P`w@P  0@$p@-@_@ @-@Y@& @-@S@> @-@M@Z @-@G@v @-@A@ @-@;@ @-@5@ @-@/@ @-@)@ @-@#@ @-@@ @-@@@-@@.@-@ @C@-@@S@-@@h@-@@v@-@@@-@@p@-P` @P  =0@<$pp@-P` @P  +0@*$pp@-P` @P  0@$pp@-P` @P  0@$pp@-P0`P @P  0@#pp@-P` @P  0@#pp@-P`n @P  0@#pp@-P`\ @P  0@#pp@-P`J @P  0@#pp@-P0`P6 @P  0@#pp@-P`< @P  0@#pp@-P`* @P  s0@r#pp@-P` @P  a0@`#pp@-P` @P  O0@N#pp@-P0`P @P  ;0@:#pp@-P` @P  )0@(#pp@-P` @P  0@#pp@-P` @P  0@#pp@-P` @P  0@"pp@-P0`P @P  0@"pp@-Pw@#(0P p<0P 0pgntsp@-P`@P  0@"pp@-P`@P  0@"pp@-`PB@X#<P pP U patadp@-P`v@P  0@"pp@-P`@P  o0@n"pA-P@#X0P pO%`P  P `'gntsp@-P@"(0P p0P 0pgntsp@-P`9@P  .0@-"pp@-P`-@P  0@"p@-@R 0@"p@-@ P"$0P p00ploobp@-P`@P   0@!pp@-P@P 1!0@!p@-@ @) @-@ @A @-@ @Y @-@ @u @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@} @ @-@w @ @-@q @% @-@k @4 @-@e @I @-@_ @^ @-@Y @n @-@S @ @-@M @ @-@G @ @-@A @ p@-P`@P  \ 0@W!pp@-P@P  0@G!pp@-P`@P  : 0@5!pp@-P@P u 0@%!pp@-P`@P   0@!pp@-P@P S 0@!pp@-P`@P  0@ pp@-P@P 1 0@ pp@-P0`Pm@P  0@ pp@-P0PZ@P  0@ pp@-P`I@P  0@ pp@-P8@P 0@ pp@-P`'@P  0@ pp@-P@P 0@w pp@-P`@P  j0@e pp@-P@P 0@U pp@-P`@P  H0@C pp@-P@P 0@3 pp@-P0`P@P  $0@ pp@-P0P@P ]0@ pp@-P`@P  0@p p@-P@P :0@pp@-P`@P  0@p p@-P~@P 0@pp@-P`m@P  0@p p@-P[@P 0@pp@-P`J@P  0@p p@-P8@P 0@pp@-P0`P%@P  r0@mpp@-P0P@P 0@[pp@-P`@P  N0@Ip p@-P@P 0@8pp@-P`@P  +0@&p p@-P@P e0@pp@-P`@P  0@p p@-P@P B0@pp@-P`@P  0@p p@-P@P 0@pp@-P0`Ps@P  0@pp@-P0P`@P 0@pp@-P{@X(0P p0P 0pgntsp@-P`@P  0@pp@-P@P 0@wpp@-P`w@P  k0@fpp@-Pg@P 0@Wpp@-`P(@<P pP U patadp@-P`#@P  20@-pp@-P`3@P   0@pp@-P@P [0@ pp@-P@P K0@pA-P@X0P Np `P  eP `'#gntsp@-P@(0P p;0P 0pgntsp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@p@-@Q 0@@-@R |0@wp@-@0 P ""p@PPs#0S n#pܳg#0괚@-$@@N#۲`lP 0R @-P Q o//8 , P 0 t@-0 hj L1j @-P Q @@ @0@ f0 S( (0( g0 J1j Pj 0j ,j 0S p@-\@`@@ PPpP p@ = A-P`p# @P  `P `pp"⦲P` " !" `!!~dp@-P @`sPpP p@@- w@P $ k0 0 0 HA-pP d@P"  X0 0 0 PS`P  ` P0 000 ,0< M@,.g xg /@-@P @ e 0 0X -g g }-A-M `V $P0 PmF@PpP  0PaF ;ЍAЍ/ЍAЍ/ 0 0t O,f @f U _ @-@P 4@  0 0X 4,Tf e }p@-@P x0 0 0R0 P0P Q $ p@pp p@-@P `0 0 0R P0P Q j$ p@p  P/0 0 0R /P/<0 0 0R0/P///| 0P @-od  QP  QQ %$/ P/ 0 0 0R/@-@P \0 0 0R  50P Q #00hP P/00 0 0RP/// A-PPM /o00 0"P R Ѝ R0 p 0 p`P 0 S  R H  ME pP` 5   00}  A-@PM 0 0 0R ЍQP 0   0p`P 0S d P E pP` 000( (0( $0 } D 'a ` ; P -/o<0"0 0^ R  R/P/D0 0 0R /@-P 5oTT P/D0 0 0R /@-P o P /ol00 0"\ R RP Q  Q /ᘿ x fP 40 0 0RP / $ fA-(0`SM.P@U Ѝ P0P pP 00  0rP* S'P0S0"Q00 @P X 0 0 0 @Ѝ( ZP |P P 00#0 0 P 0S S R/P/ R0/@- @ hqЋ@-0,MS-a @ S  P `C` `cP |P ,ЍX  ,ЍD P ` C(0( (0 4] \ (] \ #\ $@-@ٯ谊@-(@@K׮耊@- M`p@P0 P0P!s*0 00 Ѝ0"S@- M@pP`0 `t%qp 0 00 Ѝ0"S 00 S 0 P :\03#/S 0 P \0///A-Pa`c@P (pP  J@P ᔮW@, ,0, (0 뜈 @ntY Y M 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ xЍ00@- @PM  @ jЍ00@- @PM  @ \Ѝ0@-@P ,0 0 0R@ /P/0 0 0R / 00 !S R!* R0:/-  ^0 : 0P0*  R*/@@/ / P $0 0 0R // P $0 0 0R //ԵP $0 0 0R //᜵P $0 0 0R //dP/d0 0 0R / 0   \*S  0/S[ p,p0 S S0` ` S S/S >S S 0 S S0FU0 RtP0/S^ 0(00>Sa S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p0 0  S =S`B`0"S0S   0"R R  "RC$ >R0 W0(00>S` 0  $ 0B B G-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R"@ tR Ѝ mR8 pR oR sR ;R'@ ;R<@ tR ;R>@P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮qvhg"R /R@S00S@Ѝ!1 0 "   0NPp 0 +("( RB*0 Re \Rb  uR^ 7PY +  PS6I %"". 0)" " <,  0   ,0     SPY$ Y  ͕)  )# < 0,!  Y*-"-  }  )&  u4? ? G-@`pp W W00 GR0SWL 06<0W0PPF <W0@@j\r\\p 00 S S   CQ R<S+  ѶP)   ˶P#  ŶP-0@S@S -S 0@@-S0>S @ 0B@0S>S 0 @>SSS @@ @bP (0SP  R @W' W0S@@k@ +PV` 8P @P D -P0S= = = ; t : BO-PMᓜp@PZ ,DpPQ mFpQ 0G g``S`IP0!  W0P0Du4  Y  p `P%FЍ 40P0Du  600 @0!pF}`DwAo/A-PP 3P`p @ @P_@@@P p40,p0P4080<0 pe@-@  JDe@-(@@ u$eXᗵ┵@-@f@cO-4@T p`, ⁵P @@D¤@`T P礀Qㅑ@0@ @@0 PZ PZ P87 L7  @-R 0P< P 4Q ,  D D0D )0 ͷ, ,0, (0 ķ, 6 6 6 h6 p@-@M4 00R0SP,0SER 1`V- P` 0 0P 40, 0C40P% I`ЍpS' RЍp 0 Z0D {p p0p l0D r\ \0\ c0D iD D0D @0D ` 5 D5 T6 5 yp D6 4 L 5 4 iA-@`,pPP W 0 !ី,P0`:,P0`C-`0@SPpMF  ]P 00Ѝ!0 @P ,0SV !0 5P ,0S(0S00  0 P 0S?0S0"S 0:S 0 }R00 "R  0"S P  P @` 0 @P , ,0, (0\ ⰶ3 r q  t3 2 0p@-S `  Q P@0@p 0  0 ⊶ 1 1 0S 40 00$ $0$ @-0 t댏 2 (1 4 @-R 0, B4 P @@ @0@ <0 Y, ,0, (0 P0 @2 0  1 0 O-80M@ Ѝ@p`| PP @ ` @mЍȒ  ePP0 004QY  4 R] ,剱1Qw  o P 0YIW  B B!፞,0 P 04 `<0 04 <0 ֱP,UN<U8U+Y& 嘡 @p @P  PP) f 0,S<SS> bPc @ ,0P`<04 0<0x<H !8,0P 8YP V{,4x x0x t0F/ⅵd d0d W0,|L L0L 0 s\dB[ T- l- 2 / H- . $- p@-@PP0S L  Q <0 0 p@ 0  0K/F , p, p@-@P 0`0VPP p p0 0  0@S0<  0pPp( (0( $0K/x ,( + + O-0@SP MR z`G40SM x `P@9 ЍnP pP 00S 0q 2 00PX 0S. @0R* P# [` 4P 0P 0S 9P' X D` ЍORP 0  03/P  40R 1#PP 0 0U/⃴d 00C 0P `O@zh h0h d0U/jT T0T 0]/a넉a  D ' d) ht * ) P * ( d@-@0,S<SS; 0  0 5tU ) ,( PG-U p`0VRV@P7 404 S ` ^ \S` D000,0 100,0$ 100, ,0P ?o  @ 2\0S0S P`P : ) '404 SS`  `D D0D @0c/̳0 000 ,0c/ót ( & ! ( d& 7G-PS @- Y`' T 1p 0R  X V 004 00R% NP E 0S 0 GRd d0d `0i/~0,S0 000 ,0F/m< ' P% 1 % % G-PP' 0 0R"p4`P 4 R @,0儡ᄑ1  ,04 儑@ 0T:804 80{`0P 4  Q@-P80080/@p@-@P^80080p@Wp@-@P 80 0R@ pPI4@Fpāp@-@P \0 0R@ pP`400S@#:.p@tp@-@P!@pA-PP 0 0R4p` 40S @40S ,0 P@h `ЀA-@P 0`0VpP0S {P @T @ @0@ 0]/⎲@@0 # ! A-PP /o0`0"Q@@T @0R p H@P @T @ 0  0]/Tt " 0P \@- ^ 400\@/ 0  0F/5~ , 0P o@-x@ T\ @\400\@/ 0  0F/ 0~ ,  @-PP M @1 0R Ѝ`@;80  Ѝ@4 P 4 0Rp@ S*,P$0 B!q400C40<00<0  h h0h d0s/ñT T0T P0s/⺱@ @0@ <0s/ⱱ}  d u @ v  w P/?o0 2 R0S/0@ S/|0P -?o82 ^0S 0 S\ /{P/0 0@0R/h{P/0 0@0R/<{ P -/o<0"0@0^ R  R/ /{ A-`P @PpP (0Sp 0P  pA`Dz  `<(zO-0S@9 0@S7  ` P. X8qPp v P p P @j P HXP0UU@U !#10< ,$W P?@O 0 s0 װX% XP0@#r 1|P7 0 03/P0  40R 1#P' `P 00C 0_P  @ꀐ ) pG \ \0\ 0 ת8 808 0 ˪c(ba ,  h  40S 0C40/ 0  @-0 ⱪX  x 0p@-S `  Q P@0@p 0  0 ␪a   ip@-@P 0`0VP0S R <0 0 p@D D0D @0 h0 000 ,0 _x`0  T   0 wG-S *X@` V 0P 0R `00p |T` vV 0S  Gp@ @0@ <0F/80,S_ P , A-PP 0 0RF4pP 40S @,0a, 40a@T:8 408 /p^@-P80080p@-@P 80 0R@ pP0@p]p@-@P 80 0R@ pP4@p]p@-@P \0 0R@ pP`00S@#:p@0]p@-@P$@pp@-@P80080p@p@-@P8@@@pp@-@P 0 0RP`40S ,0AT p@p@ 0  0O/Q,\  aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@h@<@D D0D @0S/0 000 ,0S/ [ 8  ( p@-@P H0 0R@ pP`5 @/pXZA-@P1 0RP` 4P%80,0!qW&  P  1P ,0P < 0@ 40< AiAD D0D 0W/⫨, ,0, (0W/⢨Y< ` <0P -?o82 ^0S 0 Sd/Xp@-`P pP@bP (0S p@ X > yW0 //@-NUP0 p0 PX4 \O-IMP ; @T p `0 R 2/0BU\ P Y  9/0  p\PV @T!1 0 003/Y@ 9/T  UT T @T@" 000Q 1/0U' P70S+ 03/P. Y 9/T@T 0 0( ٧ 0 0 ЧIߍ 0 0( ŧ 0 0( ⼧Y 9/Z 0 03/X X0X 0( ⩧l d @ ` h4 P P0/O-@MM(p ~T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0=P 0 $ \00 Mߍ0 000 ,0H + R00ꬽ # 0/0/@-@@A-PPp`M2 0S/ @0U  UP 0/P B 0CU/PU  U0 0 B/Q T!0C@T@!  <;@04D.0 0ɢ 0 S* *up@  2V 0P244@Pۍ?00@ۍS02p M3`K3H3p 2p 0P@2 p@-R 0@S PR :   Pp0P  , 0`0` `90 lL0L L:0 d808 8;0 \pX h| H|̺ (p@-@Q PPpQp@-0 MSP@`PA Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPU pp 0 'QQ Px, ,0, 0 ⛥`Է <( 0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@ ) t`#0p@-S+@PPU Q PpQp<{Pp/tP PQ lP Qp@>c 0 Q0`  l0p@-SG@`PU Q Q DP<?Pp PU Q 3P QPU Q &P QpPQ P Q/P p@>  0 0| ┤븳  cA-PP4 Qpp0` XpW*%@P&  !P <V`p p0 8/PgPd`<``Q# PSP P 0S #P P PP@ @ P P 0 G tGp@-P@PP  Pp0@k@p {z011/A-\@`pP \1S 0 €  P 1P1 `p P 0808 8A0 ڣ$0$ $B0 ң ر @-@^ P ^%QRS  T00NQRS"  TŒ 00 0 Z0 ⒣ (G-@R00QP(M P 0 ` p Pt p ` 0T?o20S00(Ѝp`0 p@- @PM`00媤0 0ᤤ0 0ឤ0   Q Ѝp 0@-@P M0ሤ ⃤ ~0     P  Ѝ0p@-@ P0Ml,`.4l4#0a "44 0Y "44 0Q0   \ Ѝp 0@-P M0@:0 |b" b! / "440 (0 ,   S Ѝ0p@-@PP`(M/ 0S, R00$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0TX P0V00(Ѝp@ R 0S V00d@-@ 〣T00@-@.p00T0.0.0.0/@-@T @-@T000 000S/@-phPx000 000S/@-`(Px000 000S/@-POx000 000S/@-@Ox000 000S/@-0hOx000 000S/@- (Ox000 000S/@-Nx000 000S/@-Nx000 000S/@-hNx000 000S/@-(Nx @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#,    0 01/L 001/, 0 01/ 0S@-@1/00/p@-P0P0 0@0PS` A-PppjtLx/-000 000S-/@-X-Lx@-=!000 000S/@-EKxAo//0@-p@P M 4 P. Ѝ0 0 ;0 %vtD H@-p@M L .P pЍ(0( (;0 wt@$ 0@-pP@ M T T T  0 Ѝ04 @V. Ѝ0 0 :0 ߠt, p@-@ @ $>. 0 80 ɠ^t @ Lp@-@PP (P$Pp0 70 ഠ p@-@PP (Pp0 70 ࡠ p@-@PP $Pp0 70 \| @-@P  Y.<+ < 00 ;0 p @-@P ( 0 70 _(ܣ h@-@P $ 0 70 M$X HR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@᩠ P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@P80 0 @  0""048# /UUUU3333  `p@-PQ@ : Sx R Sd0 X Sb0?0 r-w - 0!= S ] 9SL @Sx00 r-w-0  R> R9 Rx 0 r-w-@!@ T0 T* T2 T x  00pRs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- A0a0-0$0$ $90 ଞs< 0 O-8AP@:  ߉pPA PA  6pP% 00` 0@T' ᲛP0=S AP` AT BX ! MὉD0D D>0 ^ ꁠ00A G-XX"X2XBM 0 P@DH L0TPi X`P ㌠吠唠嘠圠刀@pm pp 9pb $P )p[ X0p 0S0R0400408<@-4[-]-0D-^8180 00D000]*@l-T  #0S ]qp@   ) Ѝ +oЍ @0@ 0 П ʟ Ɵ?|O-PMp 0GW"S00`0v@ኘP-TPg +T@`0@ ?  00   P p ! @00D \a0DSW0DA0DS"70DURX : QP   S  R ~ "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`P00 R0  Ѝ p p᠀堐 XR A B0A PR W @ 0`H0H H?0 OW p pmꙙx 00 0M0Ѝ2$:/O-PMp 0GW"S00`0v@ẗP-TPg +T@`0@ ?  0D0 = P p ! @00D \a0DSW0DA0DS"70DURX : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`ꀞ00 R0  Ѝ p p᠀堐 XR A B0A PR W @ 0`H0H H?0 )OW p pmꙙDH L00 0M0Ѝ26/O-M8@| @-@P @ (0( (/0 +@Ի|| @-@-Q Q Q  Q010! 0 0 0 0 ՕS r0! S L^ 0r0!# ^00404 40 કT00ꤻ{ p@{ ĺG-P @p0#03w0q0W`@DT@!   0 0R ! 0 P   G0@ pQPC-pp M P@%P `P$ 0 @p0 PP  Ѝ蚗00Pꕗ0`53P南`ꊗ0P*`儗Ptl0 0 Xo+0-0   X{+0p@-@PP` /o"0p@ J0 40 (@x D@-@P 0@ J 0  A0 @x p@-@PP /o"p@; J0 60 ꈷw @-@PM 0 0cPЍ0 00 ߔpw x0 p@-@PP U J00QUPQKp =00QUP600Q0 /0 ఔ`v 1R ! /A-pR P@a@T T 1 !03/pWG /p@-@PTT 0p@/pA-`Qp@P RP 0开D00p 00$`,@(P0R00A-P`p@PB 0U0" V W- p`Pp`PqP, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`P@00|dXp@-@PPM& U 0`1S ,0S  $0S  pЍp@0@ @<0 ۓ(0( (;0 ғسs ds @-@P 0S$ =0 P @0P 0 0001 1 000404 4<0 ࡓǕ 0 $r p@-@PP% U 0`1S ,0S Ⲕ$0S ⫔Ipp@0@ @90 n(0( (80 e$q L4q (p@-@P Ӊ00CS00 PщpLP0 70 >꘰,q --M  HЍ Ѝ/ -- M0 0~Pd 1 S S   #@ # S\  000 S SP S0 R R R R @ B RQS 0S1 @+S7 -S[QUp @Us0S 0S 0 0_o0p`R0+S4 -SF 巈PPUpw[ WPW*D Pp S 0QUp @U40Sa QT 0 0_o00p+SR0S @S#0 PP _opR0S @S&0 PP` _opR _op`RU7 ! 1 0 2 30:ߍCPPpPp py S!@A. * _ 0 d 0x x0x td 0ۊ[\ \0\ 1d 0Њ(l$XO XO 0O O- ß MM`PȍP@yr T{ W 2U0&N 0AM.0; PY 0SV P +wl+w 0  0  0$ PP @PP3H0: ST 10P! 6 C  !1 0 8 30_ލЍX P 0 @HPP * CT100SP<104!414 t 01T!1 t 0&Wz 0 t 0pC "~P \0S  S 0000H0000  @P(l|0`$dM |L \L 0ܓA-@P`p0M- V6 W? 0 ᮊ0 0 0P @T@T 0 pPP X0Ѝ @RP0Ѝ| |0|  0V\ \0\ X 0W@ @0@ < 0̔J @J ]xJ h^- $M!Π00  0 (0 0 0 30$Ѝ|'h - $M!Π00  >0 (0 0 0 30$ЍV'tO- PP`w p B0@00 00B PpaBQWpBABQ7pB R0 S1 0A0CS: 0 $S'""  0DSRQ0 / S ,*@D T0T@0 T:0 00 0 ̈D[00T0S  [?0*00 0} ഈ00D\0\ \ C0ਈ }@0@ @`0 ԏH XPG xG Ȏ̎HG  G-t1@0P?  @RP>T !6* ȡ0/L0@- 0 0MPP000@' T ⸒0P ""  0S0 0p d0 0 0 30Ѝ0!@P000 040 $$p= T= @-!1 0FM M@P0d40p/ `  PPd@"+ P 0@ @Rh \0 0 d4 30Fލ Ѝ4 404 N0 ೅#\$< pH@-0 0dM@P0\00p` Pố ՑTX P0 0 \0 30 dЍ0 000 h0( # T; xw9v9@-<@<M@ r0 Ѝd,0`( "4`3Z1S //0@- 0 0M@P000P( U!  @0@  "" 0S0(0p d0 0 0 30Ѝ0)PP000 0F0 8#l: 8Ё9 $G- M砐 p@ U$e3P'0G W09pPUo0 ;u0+ @P   8U0 U #0PTP 0@@  nx p0 0 4 30܍ 0)}Qp xP|`" 0- M Ѝ@-0 0dM@P0\00p` P .X P0 0 \0 30 dЍ0 000 0 n"D7 lO-/? 0M@Q000} 0S @ TTa!p@ P+?@a+)\H@@M!DP@lX,%T\lT%8pgpX b"  b f!) ` " nH.$DLnD$ fa,` ga&-`a,dpmvmzNS <@ @&`(aKi @$@dIcKL%fc .al0$e;a 0#0c=f;h.d f,``l̠j`荠fpeˌa{'D #n e 8` m3df` piHpp,c{d p' p8@}n{ @n+)Pl .nc+g fi`k@$X Pm$&-3 `+k[%P@ +.B #Bj'Bc+00@m46K=lKY30i[i;d 0h!+@k@0@lˀ. `PD *`ˌ ꭠg )n @ mČƌ͌3kˌf+" d,mČƌh+͌03hˌe;# 0͠T0fˌ+>C3C7Cg;p隠3gPa"j{ a(f `H hkekb,b(e P]@a[l&al( h4bf%bf! lLe+( e+"+I 啓I 嫗Ib< l`` +LLd pL dˌp' p g|nˇ\pb)f+ *h! pf{h,Ld8p`K`nkpꩠgi `lɠleˌa{" pea{'p0P @g}h{ $bK,@Ph[bK$@f `dID`aKl['P`akl[%P`e]b[gk$`bgk&`8 klkd% l+d!ad ge&  g+e)雠` di+( X%p Tg+pf+! gzk{df+" gh@+NDCD4GDkK,+J͠ᕣJ`ˌ᫧J` . n`b*Le+aK)@e aK$ @P(MXfKi "fi h`0a a;Xld@P`kb$b!ai4(0ad )l0ibb+D0l[i;(06P0n`! +뽠daK) @$@L dJ`Ki+d+(, < R0 00//$@-M Pp @v`P`W0D>S 0!3100 0vЍ>SD 0!3100v00v00И/-p@-MfvP@U@0 ` ` 0Px0x 08 R;0Ѝp@Ѝ/0 a0( ( bD@b@bA-@PP`pU =UB 8X ERR14/.-,+*)('&%$#" Vp&2!0` 0`00+XPp -X% =X00+0E0VpPpp-0V0\0+00+0`0p@00,0, ,]0 s00 (> ,>p@-PP@`  0RuSpWSRX0CSG5 +p à 0R ^ PSPQP^  0    T0 0+S -Sp0$ $0$ b0 QsI@ |<T<O-0xSpLM 08@ (`(0,00040  0 0Wu @ 3Pu@T8 P0p000003  0a0GS] SJ$00+W@ 0-SR=W000 0` @X B R j b\S  "=W  R"   P:0$Pt @ t R $ "@P0 偡   n Y# @ T:$Ptp@ t0S$0 @"@DP@ @T X 00X  0  0pW ,Wsp`TS `! Z0$Pt ` $gt R$ `"`FP`0 `偡   ` =W +0G?oY20S# Z$Pbt` $=Zt0S$0 `""`FP` `傡V X 00 00X00` `Z$P>t` 6t0Sk$0 `""`FP` `傡 0T0 00  HR;I?I00 HR0 unQ0P R@) )O-P4M@P\pz WnX0S1 `00 S 5/000 00!S5+0 0 00!WfW0b Y` X00Ux5St50 0 0 0 0@0` P(0`0t5`0$0Xi 0S80`lW ,A0` iW00V0S@P ,(05#[0P` X $ 2P0 <%*&  # #. BPU 4ğ2#0!/#1##ʂ0#  0`V4Ѝ3+00 00!k3/0 00!dl30$0H\.d0La#0L0|2pST0, P `@!iP 0`V ^ @P,x ^~[d"$:600%$0H"%>!!!0C0"0T(P%"A0$AO#QX00 0 0$00?S%4P!( `1T101! T$?01>! R01"_0`A(0|10X00`d(00@t`dP(0 h  R2 AP5Q4 0A`X0 0A$0PE `0P 0  `3`3 0 9@ 0l 0 8@ 0lz` GzGRQ(\)\' h P%SQ N#` #h#8 #@#O-PP@`Mq Ty V 0 @@T:R P* $Ÿ P0 P R# 0Qz SQЍR P P PP\@Q @ P @0 @0 X^ @ 4^ p0^p 1^ @0T^Pp# W @ 00 0 =lT0 0 3lV}0 0 )lt(@^*?[!]- !! ! p@-@PP U p@/LX X0X 0 kU8 808 40 kp@L lP   Ep@-`P@P T U PpPUpH H0H D0 k0 000 G0 k< Dq @-1 0M M`P040p@' T P+P( 0@ $03/ 0 0 4 30ۍ Ѝ` `0` \0 kH H0H D0 vk Lut (E PCG-P@K TT P` ``a V00"5SP0 >pPO 0SR 0p R 0C à PP0 TP8 0 Q 0  ! 0`V#*_oRepP U !kx x0x t0 kT\ \0\ X0 k(m00PT (\( 0O-Ɵ MMMčƟP pTDe0= WF 0SO UX V* 㰰lU08U@@ R R 60B?o2$00⃰0S U0 S0E0@0Sy00 000SgV ̠+ W 0 @s 03/0Sr 0@ <50000,00H(003/P   0S00 *  0.S  Z0S0 X: 0S $0S  ,P80: S P (0JQ/03 10J10 00@#P00$ 00S  0zP80: S5 0# $2 MލЍ L0S0S + -P @4l0 4/P 0 000z0   `0NVD 00SS ̠+ PR  v 0.Ss0S^ 0.SmZ0Ss  @p 03/0  00.SG V P 0 @JP6 @o  2/0!1 4 0i!1 , 0i!1 , 0iW!1 0, i0Sp!p1p l, 0yiUT!T1T P, 0niV Pk00PS P$P-H 0@ 03/k0S* 0Hxk0/ 0 @0 03/0sHH0na$ 0r r*XT o / ` h4 <   hO-\\ß KMMPčP`pؔܤ9 UB WK YT \[ /\@ @ 0\/\0   T:"2 0 4 30KލЍR_/\8VP/00p/\V@"@2@ @ 0hU " 2  @ 0hW"2 @ 0hY!1 @ 0h@Pp PP 0   R  H 0T/S 0: S* S 0 0 0 0 pX P+P 0@ (03/0S0: ST/03 301 1:h0 0 H 0Lhnqj/0 0ᲰSj4j@ H m |n oP XSO-XşX5M$M 0PQ000` 2 @~\< 0  pH 0S/S;R/ 0B0 4ZS 0H*0; NP4S 0 0CPR IR*0S0;R X @H p0\  0  *\2 @\ ?\" [\!PI 0^N \@000XS 0H 0< S :@ 0< 0@Ⲑ 0R  R QR Რ@  P+g@PU "2 0 0 30ۍ$Ѝ0@S D0\P ]\!PLm @Ÿ]P 0 -P]^ 0]P @ 0< 010t  0BW 0R S0BW 0R S@c 0Q 0{  00P1A0 WY0 [0!P0@ E0 0 p3Q0Pj0H*0 ;zP 0Sꀀ@p@p0P hf0\X f@S@Q g?**d[-]D|!  A-`QPM+ 0  0 S -0{S @ p0Q @{Q0 #P Ѝ0}S0S ЍAc8 808 0d fh 0 < D O-@PM`pM R T  D g^ @P}\ @\ [\ {\PU PE0]\\ \8(PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S00 8(G 0}^S0CV  F B   #g  @ ]RR ]RR zpPpp0PpP  \0eWgL0 D0e`8 808 $p 0eTꔾ ,D LA-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ \R@ @R@ )\ L 0 RKލЍ$ $0$ | 0le\@м dp@-`P Pp@0T1@D 0CP@DP t000p 0  0 Ce, 80 S. *S8 ?0C\#S 0 P/0S /Q 0S 0 0/p@-@PPV 0S] "S "$ R6  CQ   0S- @ 00 CR S 00p\S 000#  00p0"S0@000 00 d\0pp2 0 p@-((1$a0QM`M0500 S h 0 0 5 30/QލЍp, P00 @ 0 p x PE_0 3\ZPDS04 P 0fX+lXL H*5C-0$eP`M 500S E@ p#S"Hf0 婷P$ 0S %P @ 0S-f0SЍt `p  0@S0 0 40  0Sx t刄刔p 0fS0fS 000#3R0 <$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 `P 000#3R0 x# 000 `P 000#3R0 (# 000 `P( 000#3R05 " 000 0#S 20@ R@@UP00Ѝ0 S Sd `P 000#3R0 (" 0@00q l`P  e`P4 000#3R0+ ! 0 00T 000#3R0 ! 000EtP `. 0@S0 @  )`P =Q\U 0P0 0 `P=Q 0 @00 =U 0P0 0L*PW(* *d),)(<(''@''&\&  &%8ȳ $%$ L$p@-PP x_P c@PLPPP 00p( (0( I0 b#б @-,@@P00`#O-ȟ MȟP P`@ pUpVpWT 4 Yp00: [Y &cU 8(,8 0 0 30Ѝ `s?0l0` Ⱘp X ] UV 000 2c110 0 0p0S( A0  $0p Ppd<000S[ d000@d@Z 0@ d00p PZpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #Sy R BQ #R I BQ #S H BQ #S G BQ #S1 L BQ #SL M BQ #SB N BQ #S8 O BQ #S1 D BQ #S E BQ #S F BQ #S 0S:U 00S! R B  <P `0000  00 F  RS0,Z *p0S Vc00 0McW 0 Z[ Dc000@=c@p, 0a @v  D# 00 ( #   20000"   2000000sp00,(@ ((@(@00,0o\  1Pk0Sk[y+ayh2"_0 `Db00[ ba  ][ TR0`00{0`0 0SpCt X  pG>w0080 b0SpY005[ r0S0 R  p`00C0C   pp p _[S IkF4PPOXX$@A\  0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpFCpP sP Ѝp|A-P`? A@0S( A@Q0+pPpPP @NP  p0 @BAQA3M@ p0 p0 ,0, ,<0 _`L,(dx lp@-p`pP`P-@T T0T0 R@@!p4P00(A-P@P`@p0S |@@0[ R"@``@P00a0@pT@- 00 C-`4MPI@P 0S|0V ! UpЍ +0P;  =R6 0Q*G B&R&>$#"M = -Rp㴀Y WꘀqvK SБp0X{FH 0d p$Hp@-P@\ Pp0Sp0O-# BMM $ #S  #P 000 0000+ 0噢Pm 40 4{LP# ` @FP 0#S 0000P Z20 $yb@`P 0#S 00P 0xS0xS0S 20 0sS(0wS%0S"10qap`0kP r00cP r!h1 0 4 30QBލЍt10000IP r00AP r 0`F +@K 1 0 0`p -@P YP`[[ [P000xS0xS0S: t00P^ dZPY.@  |< 4>@Dp@-d@@0S P Hp@P@P 4P ࠿p(p@-@P$ 0PP 4P TPPZP Pph`h`_PLtp4 404 0 C]| 4p@-@P$ 0PP 4P PPgZP Pph`h`%PL:p4 404 0 ]  L0p@-\PP 4P p<`<`P@ p 04T@-@@P@00X O-v,M@Pp0S 0SG 0SL L60` 0P U 0C   6000?SN Sl *S 00 *Q @R50*QLU 00  *QA[SU \S0  0 @ 8Q8 ,Ѝ?[ [2 *[ @[[, \[0S @@0S /Sx .Sxv 0X q 0X/Sn.Z] Q /Q NP  /P P,ЍQ /QT 300 000  ^[![00 $0 00 @   /S \S> S -RE S0 U@ ∀Ḱ0]S^$0 S w ti - 0Xm  0X/Sge @_U/200 0 /ZU0@  0U ∀Ḱ]^^ \^  @S ^U@  ᲀ^% @@  "0\ @ x!  [Q  @D1D!D|0 z[,1,!,{0 q[ P0 @0`pC p 0U0   Z  0 uP/ZY  /MQ /Q[ 000 0 9X |ȕ @0PP@-@ P H] 0 Q 4Qk?o2cL8p@-@lP@XP X:XP T00pT 00p] 0 pO-0p M @p` P ᚷᘷ10230Y ߍ4PT 0 vpI  (P: [ ; 0` 0P ᐶP) @@ 0  `p@ 0 EP0P S P [ ">0 "C 0 @p@\ -R 21O-0p M @ p` P 10230Y ߍ说PT 0 pI  㣴P: [ ; 0` 0P  P) @@ 0  p@ 0 P0P S P *[ ">0 "C 0 p@\ -R//O-0p M @p` P ᐶᎶ10230Y ߍ*PT 0 fpI  P: [ ; 0` 0P ᆵP) @@ 0  Pp@ 0 5P0P S P Z ">0 "C 0 0p@[ -R--p@-T@0`P@ e0P0S SP pP p@-T@0`P@ 0P0S SP p p@-T@0`P@ =0P0S S|P p舌 0 00 *-H- M 0 S 0  00\100M 0 R0    R s8 00 0 0 30KH Ѝ/|*)-H- M 0 S 0  00\100M 0 R0    R  78 00 0 0 30KH Ѝ/)( -- M0 0+--M  --M  A-pPPp` Q @Q "PD@L0 0000A9m$0$ $0 QX\(h` H0P R   0//O-0'07 0 0S0 Q0@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!T0h0p\@@PT !W08@@0/S(@@ @@tĝ4A-M@PQPq0PpC D!0C `0 00   ! 0b0C S0;.-,+0)('0%,`W0 ę0pS@ 0S 0SW0"S $7# Ѝ T1r0:W00ЍX w@-@P1 0S* ;Q@T. 0T)  /Q0C T !@# *0P@/S x0 B@T@!h0 0V  T <@0@0@/S0 00@-@PDM  @000p 800S DЍ0p@-`P;p' P@ p V U phUX p` V@ȋ$00 Q?o?o 0C-@c^?c ^' ^ `pCc&Pc2680E270G2&1H01./ "(0C0 /0: Q?o?o 0@ c5RA-?c"6R2 7R Pcp0E7`G 0E1C f<68<70< 01>?0#ό Ό C+ C+0c̠0: /07 Ϡ? 0S! Q/o/o @bPG-?b P) P @pBb&`b4')3V4( X4G1Y 010.? "1?1>( B24 5 /00@ Ϡ P! 0Soo C-@@a5T?a"6T3 7T `a2V7pX F3Q g>>> 36 / "A11 A>+@A4+a21/4 6:  / 0Q!*?B0CS?S3S4 cC0 0c11/C.B0B#B# b0///0Q0@-#/A BR?R0463R64b0A3QBA b3B ,00/A BR?RCA A2" #@A4#a01,000P-; S J?R$R b02!0 SJ?R  C" C0c0,PP `H@-|U00p@-@PP  p@$3 0 10 ?S0u p@-P@` <Ppp@-P@ <Ppp@-P@`D <Ppkp@-@PP p)P $PppC-PMP`V ⏮@T |00TЍp :  J;p@`$ Pts 00 R ,@-(U00 0S@v0#/"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PBPX `N@ :PPY  @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍPP @@ @V0(@$0O-`ϟC 0C,0   /"b!!A0,0 W0 0000 0YWP 0  Q0( SP 0 00HWz 0@P(0PW%S(Pk6 ,0 6,/,0 v>C 0CWP0(Z 000"0W0QD6 0 0P( 0, ,04!/A!b!b0C P0( 4 0 B0 S8P(P1W*p 50 ,P(W0 00W =0 P( WTWp ;0 P 0 0p S0 (0W(Ph 0 P(]c0 , 0PS( 0$0?2c1, 11,0 020 0000 0 ,, ,0 0CP0(J 00000 3 ,, o,0 0CWP0(000c c0 ,^P([(P000yW0T 00. 0 FP(1 u  RO 0s! `p0@@v0 @`   ` @aKal B  0 B0 V PKUS ZSP  @ 0,"P ( 0$0 R0Y R0P ,P\  /#b!!0"A `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0,40 00N(00 S!0 @pA_Q"pG@D  W@ 0 40N Q @(0P 0(P00L)\P(\ ףm l 4l Ql'$IHnܰ<a Q(PP @ ACLC  \^JS S 00#3P0z z H/o"(PzXn|TQ(P7 pp@*CP(!B0pu10 B0,Pp> ( ' Pp!/"b!C;R, a2ba126MP P(P @ @0C2c2c2P$00( (0 00 @ 0 @Q ,0@0S} 00@y0S 0@r r,p0 0P P(00, 0C$0(^3000c^\0M0cP$`jP$`   0P  P(00 , 0Cq$00(06  p  0P( ,  #P ( (0 b$ 00 0M0ЍtA-x1@0QHPP P MM Q%L10 P1$8,p P@@ . R! v Pp `U  Ѝ0 P0  P La@p ` UNT 0 ЍH MN00T\ @\ *gfffP@-0M@ 0P 00Ѝ@-0M@+0P x00Ѝ@-P@lHp@-LL1 00Mp0,00`@P= U2    P00Q Q Q cN 0 0 0 ,0 30"0Ѝp  t d\0\ \;0 LD0D D:0 L.Xt,t,t,xlY HY `p@-@PP U 0DPp P @pD0D D70 KU(0( (80 KX X ԥG-pP`' X/ Y GV @P0PES  R  D%40PEV R  SS0@0D@ D0D DH0 KX(0( (I0 KW $(W R@- 0BAs @Q 0CR ]L@O-阡PP p MU WC 6@PI 7PI  7p`M G4101S Y7 Ѝ060P@6P- 0 0P 60 0 ]L=00 VLl0l lD0 !K_6EM00808 8C0 K7TU dl|U RQ@-M @PЍTT M@ߦЍM 00O- 眡]MMpō @pG p1PR pJ @PCP`0 80xQ|QG8O⃨80`TQ>C9 sA$`040P@P>P x0 0 5 30]ލЍ\0\ \D0 JL00@L00$@؈hS 40   M Ѝ~L--M  Ѝ Ѝ/ -- M0 0h ЍЍ/O-鐒@P p`M X X00?@+>00P @ P 00 P! !  F1XPH  >VP WU V[XPVppPpW` D 0`f`0`ypPI PLLL1 0 0IW`!00!1 00k@ Ѝ学0XP C0PP00 V@ Ѝ0 I`8pP V 1pP `@0@ @?0 Ic\,Q 0XP @-@ M@(0S2 =0 `0( `1/qpPp0)  0 0 PUR <0PU? ЍPPTp 0S  0CP?K00Pp?@-P M?(0S: ==0 "p0( p1/qp@`0/  0 0 @ToR <0@To?1`V ЍP@T` 0S  0C@oBKT00?:K00?p@-PPE 4A0S5 @Tp1 Rp00P0 ¥ P 0S P0帥 0c0(峥 0P0 宥0 S,P 4P 8P p@蚥T0T T0M H0Sp000 0K0 HeEĚlL \ h> ܌@> 0  0|0z  xA-R@P0`Sp ""#b! DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@'200@1003/P(!p0 $@ 0V0 p00 R (P000P3/P" Up  R  SVp  0STP000U ,/>3л}h}}T|t|=A-R@P 0`So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@100@10 03/P(!p0 $@ 0V0 p00 R (㆞P00 0P3/P" Up   R  SVp 0SゟP00 0U عL{L{zTz$zG-@P P?`P (rp^u  0F0\c<!"#b!0CaqV; Y @PpY` $00100S p 0`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(ޝP`0003/P 0 p 0000SXP00}00x/>3жxl8x8 ww=G-@P P>`P $rp ^t  0F0\c<!#b!b0CaqV; Y O@PpY` $00100S p ^0`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(@P`0003/P 0 p 000$0SGP0 $0~00Xvutu0u,SR: G-P0`00Sp 3/0Y @IOP O T 00 00 Y @IOP < T P00 D0D 0 p`P/ltl8(رsSR; G-P0`00Sp 3/00 Y @IP  T 00 00  Y @IP T P00 D0D 0 p` P$/PsP̰rO-PPM M Q@ \ /\C Py=P8p/\ @ @. D\m `P /RR.\' B Rm/0  F0C P 0E P$pE 0: S 9S0/\0Sy@/\` FQ .PQX 0t/S0W0OʨP !P uO \= \B  B+/\p@` @Oލ Ѝ.00X0/ލ Ѝ @C X 0/ ?   ԛP@XC00 @|C>00 @wC?00 @rC00 @mC00iC00p@-@P Q Pp`\P0@P P`V KC0"S pCC00p@p@-La P`M=  <00QP0|P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P 800  B 0 @p@-@P`P3 V( 0Pp:P @P0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 @(0( (0 y@꼀. |r. p00/lp@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 =@U8 808 0 2@p- q|- mTO-ȟ M MDčpĝP 0o 0Sx 0S t4!S S,XPP `P  upP 00S `D R!' 0 00 I Pi 00P0s` @ `PV 0 S( [T :SZ \S S S 0U:HᨛPPE VpP+ P @0` S[1ZP#QQ ,Ph600`SP0@VE0AX0 0p$&6 0 D4 30dݍ Ѝ:SZ PPEV  00 0S m-00@ ЙpP< 嚟l5@00PS0 00@5p0040$0(`,= Pv :SL 0@S t40@0 0$<P 0S"2 0 >0S}p"p2p l 0>s `@B0S= 0R@0@M@@w`V C@ 00l;03/(` pۚV 0֚1@ 0 0 } 0~hg{(' ,yy& yx & 8gx d% e0S00S\S00 RAP| 0S7\S5 00S1 :S000 0 S4So A 00S :S|S@0@ A@0S'!1 0 8 30Y ލ Ѝ  w@P 00 C \10 Y P +@P 1 @@$QP P ( @ 10   0྿P 5 0 04 < 0 04 <0 0qP\ @YؼtlL(\i48`LgP \q(q( Tqqp@-PP@ T `` P 0 0 t00p@   T T0T P0@ Q<T8 808 0@ F< ao ooA-`P@P T U = tpP d㠖@P 0:SS  `d \S p+ Q0 @ 0:SS ^S0S:S 0Q0p @Ld@P 0`:SSd@0QLpA0]`0S:S 0C^7B Cp2RIFB?5/A)&"!0p 0 B^1 0 BR0 0 0 0~0|:0z0x@ဗ`PZ( 0n 0 0L ;M 0 0L x;T@t t0t p0L m;6p ps0po= 00 Ql x^llh hl@lA-PP@`I TR V; = PPf d㷕@Ph 0:SSpppdQ0:SS   \0@@AdPJ pd@ A\@ATp)Pp@ۗ4 0 0X ; 0 0X :T 0 0X : 0 F0X :pЖP@@ᥗ@< 00 Oj$ \xj"t tjLj#L j(jp@-`PP@4 U= T& # P? 00S 00XS@<,00A  RaPAUA0AW0AS70A^p| |0| x0d :d d0d `0d :UH H0H D0d v:p 0ihs Zhq hdhrO- AM Mß3 0@P0(0 0`p 0SH 60/44 ,PPN PX0D 8T  0>j<00CS3%10/.-x+*)(&%$#"!   0:S 84Sr7<0S3<00\"H2 0 (0 30 K0|$P* 0B.KS:S00 B0$ 8T S%졟 440<4 0 S BKJ ; M /0$ I 4$4I: <4$0C 0$CPtB>K0C 04 8 0S:S XE H R0 0  Q!000M P@04@@0: 0:S ; 00UOPIK0 E0 910 S:S008$ 0S:S00< ggTAC3 0 $@6 t0 0 1 30sߍX0X XG0 7V<0< <H0 7,@\A <^@^ ^0   M Ѝ갤O-ϟ MpPÍP0^ Yf 00!R !Z P   O2P0%%Z * 0S0 R 8/0? 0 3 30[ ߍ-P0 -2P 0C PS !000C 0 `0zS|NQ~|{pyxwvus1jhc_^\ `ZEU000 `0CP0PE 0SF0 0C0000 000S0  IY r<hP0 h1P 0P0CS0000 @ 0D SU*Rr? (0R0 (0 , 0C$00 40A@Qnt#zx 0 S0 00 1YK @@0  1P 0C0@0@ @T  0SP 00 0@0 @0 0CP2 0S0 000$0 $0S0D =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SP P000, 0@C0 H9T@!r?(0@0@ + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0r000@T@0TS XRm    0 (.0     7 5  0 00 0@0( 0CP000&     ( S@ @& YʱY  P6P&P0 5Y464&40 5Pp _P @0cP /P  0 S0 0C0 S 0P @00CS0K 0 S0  @$ 00S /P40SZu 40AQ0Q 0 Sk $ @00ESZ /P 0@0CS0W 0Y0 O @0ES$ PSZ R0 0@0CS0  0 S000S @+ D  @AQ X2 @ .P 0@0CS0Z000 0XW $+D @@P 0 R0 @NTA 0Ti@@P[ 0 R0 $ @XQ[@@P  R @0 00K? 0r?(00Y D  .?o 2R0SY 00 00C@0@00<000WS0,` `01D00(0H@V< e P 0  B0=>J(  r40  p P p p =>3PSx $0S0000PS`FP Z,`X@ $0S0 00 0000V0|ģ   7l T TD S JJt o 0 \.P 0 0C P0 SIP 0^Z``,4004Z`Iy @0&0,(0( =>0#C0,`-Ql ]QP @0c Q: ,`0;00<0000000900000 000:0090 00|0:0000s09000l 0  H  0 PB P>  +P6  P1000;000;0A00=jIT  , BR@ 0Z0 @$P 0 R0l @X<0#  R @#  R2XX  P BR@ $~P$M 0 SJ 0iT nT  , BR@ 0Z0K @ R񏐷D" AR>  @ BR  0X0@ NR-  @ BR  0X0] $@(T  @ BR  0 R0 @)T  @ BR  0 R0 $J$0Y$@Y,Y0$ 0(0@T 0<050 (@* p00500S @0SI 00 0!Z] <,P 0@0CS0| 0 S0  @]0SHP 0Z 0aP 0Z 0 p00 00= 0#P 0X 0@^@ =. #RRc @R  B   @ 00. @0=>03SS' 0@T0C0000@000 0SzP @X A 00 000kP@ 0 S= 0@@Q#]P2 0 S/ 0@ QPG 0 SD 0 0 (  +?o_T20S 00CS@0 0 S000@00CS0400 0S0  @0 ῎ PW 0 40H0 B=>  @JG2r0 mp= P p ᴎP 0Y0C P 00S"0,p `0#  , BR@ t 0 R0l00 (@o00P Z 0@003,  ]R$ Z Pp80$0 0P80,  4`, rO<`T P$0 0P(0080<$VPR 0 SO 0MvP 0X 0$@3jP= 0X: 0@_PD 0 S@$P P; 9QP 0 S1$1I/FP 0 S 0$ @08P. 0S+ 0 @0$P P $P 0Y 0@/X,` @ t,T P 0 ST @tZ( S C@ S  &P 0 S 0 @0002P $P @-  , BR@  0 R0"  ,$P&, WP 0 S 0$@ P 0 S |b 0S@!0@3ZS 0P P 00 0Z  ` `d0$0H00 $ PK A=>0 $ C0 0r֌p5 P&ZP@DD 0S#T `Z 0 @+ @D00HP0T0SJ0000rp0S3P Y ` 0@00X_<0< <08 6/00CZP@D`< <A-@P`p%0 0@%@-@`P MDp%@0p0 000@% Ѝ踂A-0R@QP`s v 200S5 f%0P1S010o C000P`! pW@0P@ ὊPP[ 0 /00  C `C000A%0  Q  Q*RQ1 <00@8 B`0"%"P%00P0 P + B ?#A 0#@ #T0T T`0 y. B0 $$`dD :p@-@P$ 0@$p@-0P$L`T M 0S pW  07/@P  Ѝ808 808 7.0p[0@ ЍH9 p90 00M 0Ѝ,A-0P$L`TpM 0S $X 0 8/@P Ѝ< <0< 0p -0$!0@ Ѝ 8800 0M0ЍD~A-0P$L`TpM 0S (X 0 8/@P Ѝ< <0< 0y, -0(/@ Ѝ 8700 0M0Ѝ`}A-0P$L`TpM 0S 4X 0 8/@P Ѝ< <0< 0D -04/@ Ѝ8 d7600 0M0Ѝ||O-MD@`Zp@P] U? 0ST$ZE 0SB [? 0 ;/0S) $\U 0S H[ 0 ;/@PЍ 0 0 1-0HU/@Ѝ0$\ 0 0[ -0h h0h 0Jh -0D D0D }\ 0- 6X5x <65L 54 x55@-$$@M vЍPz@-0P$L`T M 0S 8pW  07/@P Ѝ< <0< 0 ,08p.@ Ѝ, L530 00M 0Ѝpy@-@`pP.tt0l尀 ᕯT  @0 /Ꮛ$ ₯z,y0!?Ll0QO-şM `@0  0P0 pP0ʿ00! B b09<Bp  UQPE @ 04BL3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b P  00D0S0S0 S  \000!#300@ 00@00 @0`PUb*Ѝ@\ M00 ˈP-  R^^? @ 0 `0  ȈP 0J ZS0 0 0J ZS,1 0000 Ѝ0S0 P1 00000\  s  `\00 00 00C0S ``0\  a  `0\  b  `0\  t  `0\  n  `0\  v  `}0\  f  `v0\  r  `o0\  @`ixqA- Q@Pp`! hP=0D?o! D2]R0S =h0$"0@ !1 0 V V 0( P0 ATQ P A-P@`Pp .T Tp!0D1(0D,TS0 pAd_T %(0$"0@ !1 I6P O-ǟ UMLǟ@P `|  ?o2V0S Z Y y PM0P0 rpE0P0 [00 x190 H@ ~+U1 p00PU`p! X U0 1 #ևP00? PP P@6@&@0 E*PU`p0pGGq WP1 P! D)&`pPI Ƞ  <+0S V D0 G0CSax1  * 50 0  Rx1  ' X50 0  Rx1 00x1 00x1 00x1 "00x1@\00x100kx1 eД U $`xPUk 0p 9/P0,00`φ͆ˆɆ\$84 0 L1 30Uߍ 0S IP/4$0 )tP 13#z0 )3#0 )3#0 )Z3#0 )ꈓ ꀓ 0 DpO laV$00e 0S 0S 0 t*Y `0$0C0@4@0S 3P ,0 p( 505}J#@@!F#0(@A#@># 0%$08# 0%$0 0  @ $ , UDPp@-@P T UUp# 0 pH H0H "0p , ,0, (0p в $ A-PP`F L'p"@,0 $5 S9 S@T @}T V,0`<,0L0`S00/S , @ f"00 pp@ S00卭P, ,0, (0|  ~t8  1p@-P@PP 0P0S 0`00S/}p@a(}(}(}(#}$0$ $B0 N THx A- 1 0 0PS`@(M @Ppp 00 @0O P& 00CS(  p0 0 0 4 5;1(Ѝ 0<080-"" 0 (Ѝ0G @ 0 00M 0ЍXF@-@P P PP 0 *0 0@ p@-@PP U p@P0P PB0 U404 4C0 p@\ ` p@-@PP U p@P0P PB0 U404 4C0 p@T 0( O-PMp 0GW"S00`0v@`P-TPg +T@`0@ ?  00  P p ! @00D \a0DSW0DA0DS"70DURX : QP   S  R T! "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`&!00 R0  Ѝ p p᠀堐 XR A B0A PR W @ 0`H0H H?0 OW p pmꙙ8 00 0M0Ѝ2|A/@-@0LM`Pp@0 P LЍ`0 |LЍC-1 0MM`00<0pPyx@P V h1 0S xP(1 {  tP( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nSp P0S  { {g @Pc Pa P({(zUX P@@xnfs@uniop@-`HPp  @PpA 0@< @p`@-@P @(0( (F0 @( @-M @_p 0: S  p  IЍ 00ЍO-3$M0`@0 ;#;$SP00T00S00 e00 P@Pp U * y@P 0G Pp@ 0 ᢪp P PE U@*0Sk PU0 T Y*P 0    U1 T 0Ḱ @[UtwPP Y#: 10 001[!  @000 0 S [  P @0 0 S0S 0 [ z @W: 0p@D@@0 `$0@$Ѝ0 y00 000S0Y0wP 0!p`o $ D0D D0  | @=ܣ p@-P y @T @yT0 0pp@-@PP U   p@D0D D:0 U(0( (;0 @$ DH /O-pP M@`0& X. @T Pf[ P@ P  P  8/P  00[W@D:P PU ЍD0D DD0 vX,0, ,,0 lX \r` 4sO-PLM`@< Z TV- <000$0@ v0P 0 Zc <0Sj V0P@000p000F

 wLЍ 0 <q00<0 0 <UU `0F0W 0 Z 0   S`V0Y 0I 0CY0003  0 W R0B0C00000 U  !0 pPS PPp @pp`P @P Y@?p :/ P` @PT00p0 p5p1 *`Pp :/ PpT:P p 0S$0+S 0B  BY0Y030I p0@R0 0* 0P @pCY p 0:/ P0000Y`pIQ'p :/ PP`Y0p0Y0I0CY0003 p0R 0 0\_$Q\ 0L0CN 0A\ 0L0 00F8Dp@ 0 S 0 `Z p 00P HW8PdP `D  RPU @ P 0  0 0  0 0 x 0Zk` `0` y 0a00꬗ & '\ x 0 t-0 M0= Ѝp@- P@U 00S  RQ QpsP ! 0P 0ppH0H 000S@-@(w0(@v`,xp@-PP`M% @T@T T0 Q 0SR ``0`P 0 RЍp0 i0 0< pC-M@PO`0S$0090 0 P( p$ PQ# 0 00CR 0 U S R 0S$0Ѝp00 `$0P0P 000S@-@(ev0(@^v)xA-`P@p 䀟0 00S (HvP   ( `1#P #Qns PFR'000  0 0!܀,UPP@P@ 0&&```00A @Dsl00A0A100H H0H 0 ṗ 8L @-(@@ @s0@sp@-@P PP P @p@p0 A0 `X ,A-PPp` @P# P# tP  P@3*h"00@c004 404 V0 /U00@ꠅ hQ:// BQ://G-88!0000S03 0p0Q= `AQ@PP 0 `Q ̀@P   0PR@ qTl@0@S q000  B BG!` \ 8p@-@P P8cPpU0 =Sp=Sppp@-@P PPP@Ppp@eq 0 0 0 $p@-Pn@P 0 P0@pTp@-@PP LPp P3#p$ $0$ 0 c$ dlO-10  MZp @To p `P {P0=S] @PT[^ A@ZP1Z04 S@@@S*Z3 p 81 0  L `(E0S:a A D!0 0 @ Ѝ0Z   RS@ `0S a1S  Ѝ PPpp@- @t,PpP 000ppA-l`PP` p\g@P 0=S SP(00@0$,@-q@P0@谹,@-q@P0@x,@-q@P0@@!00-!0!Q00 000000 0#0, 0# 00!R0Q0  0R000p@-P@1`%S 0p 1# R  " R     Qp@PP@1`%S 1 S  \  1  p@ Q Q      p000 0/A- Up `QU @ @E 7/P@G-Tp `AT P PD 7/PX PPHPG-Tp `AT P PD 7/PX PPHPG-P@U`pV1S P@@E  8/P/@P@@ @@ģYC 1Qp0000/ @0q  0000W @0S0@0 pPT1S1 S Do 00000q@ @@@@0@@p p00qQ0 -"P 0 PC R00 SAP 0@/ p@-`P@T0^ \ > R>  "   T0"] \haa0 00000 0#0 0#0000``0000T ^pp@gR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@8Q `T ` R\ ! O-p`kP& 0Q@@PppW@Q0Jh `X  g0PX@aan(On(0pG.wZ_TaB v G000 D.@-,@@0@P0S@G-`@P@_}P(p 0@aasn0On00ZO.TTaXPB(0( $0 0 \ T0p@-05S PnP0SZ sX@ 0CR\np@T P UP@n$H/p@-@P $PemP am$_mP [mp@Xm0 0 |s Mp@-PP@ T $0p@! 0/L L0L 0 hT, ,0, 0 ]s r p@-@PM$ P$`0.uP  P pp(jT00S 3/Ѝp003/( (0( Z0( $\r 4r A-$P0@MSp p0(`0 0@0p$p3^Pp0(0V,00S 3/@Ѝ $00,0(p03/?pP A-PP@M) T2 0S Ѝ $`0P l00 @5pP fЍ00'pL L0L H0< T0 000 ,0< p o O-d`yM(p`k,PP } k@Po 2 m20 RF m0!$@ !  00⏜0 4L  00 0. $(p,`x PP 80 03/``jP"  e !0 0 1 302yߍ         P8qkP kkP||P(qk``PqA$x T `Pm |m Xm `P00/h@- 0UM 0H`0L10ねp! 0H1A@ٛpPٛ0P`p  S 0$< ,0 0 L1 30UߍѬA`p@-`PP`@M& T. )dPЍp +hP dcP  _cP |0 0  PL0L LG0 qT000 0H0 g\k L(lk $O-@P(p,jcP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV iP``Gp@P V@0SZ V@j00lj G-`R p@P8/PP @VG-!1 0M@Q000`PQ UI U .00P!1 0 0 30ZЍ0) p00P 00 S00 0ޚPP  0ӚPP ʚ0PSUp!0T  ǚPp0 pPp P嶚p 0 @P0 00✚PꢫX/ B/0  Q B  /0 R % B   %3 %//Q0 / 0R ,` , `! B  // R 0  B-  ` .$`$"  /0S :p@-@P0C0 00 0p/0p@-S@ :P0C0 ~ 00 0pp0S Pb"! b, @-@M0C0 & 00 0Ѝ/0S/ p@- PM0C@`0  0b"!4Pb4#0 PЍp0 $000  / 00$04p@-PP@ T" dP 0S S pp@dbP p@bD0D D0 T(0( (0 괸hd (,@d p@-PP@ T |dPp >p@eH H0H X0 s , ,0, W0 i c |c Tp@-PP@, T Pp JdP 0S SPbP p@Jbp0p@/H H0H x0( 2 , ,0, w0( ( b xb ܶPp@-@PP U p@ PdL L0L g0< U, ,0, h0<  0b pb 0@-PP@ M T# aP Ѝ0cP 0Sl00 eP P0P 0L T0 000 0L Da a ̵p@-PP@! T* 0 Q paP cP aP  aP p@aL L0L 0\ T, ,0, 0\ <` |` (ĴG-PP@; TD  R R `V V  0L0 00 0 `V000 0`V 0| M 0FS84/+' 0 0 0 I0l 5 Tp堀 pl 0(  R R 0h `  00 00 0000 0L^ ^ `%  @-/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`0 V% T ^ 0S^  S 0RR00Ap@@Tpp@0@ @;0 (0( (:0 ] бD\ C- MpPÍ`@PZ TO A< [PE ?Y`S 0S d!\1 0 3 30Nߍ(#@? R R  R 4P8  R   $ p0S j % 0p 0 0 0 . p0p p0 % P   0;<\H[ 0$[ HO-ddğIM,M IM$J͍$@@Pp P0`S S  $3 I0$ 0 30Iݍ,Ѝ RJ- 岰RW# " "  J=00hc +4p# 4I8#8  ឋ J- 0S 0S> S" UV J=00 v J=00Xe O<  9ZP Y0Sx 0SG0S  0S0s S0S UVJ= 0  2b"!4b4#"R #< v<0I8 0B J=00 0 P J- 0S.J=  0S) S LJ͍0 @:01 00000G0 ,0UP @(& 00SaLP P P J=00X0  YPjJ͍\Pa 8Y خ|4W O-ğ M@pQ4@0P0C`S,H6)('&%$#"! D QWX00 R04 0S SYk#3 0 0 30Ѝh#\3 0 0 300 HD@pЍO{QWX00RTcWX/ "44 8 " #8KpPNTL0S R "44!$$("( |"8#8 D2PTVT008" 0 X: P00Sj!0 T@@O 00!0 piT 1i #upYp \1\\ P0 pY 0@D    ׉T00? YLp0쐟젟PP0 ppW 0@D`    ᷉T00? D ଉP|Typ`X  hܨH0xpO-p 0 IM8 P@`p/ P PW  PWD F0@S000h &h0a00  0 P 0 0 1 30!Iߍ [: 0VX 0S 8P 0 B0_0A-@P`p 0 { 0P Sp@-MP`P@@P@T 0S  R0S dP@' @PЍpP8 PЍpp@-@P hPuX%Xkp0 @0 DN T0. AAS0C .S .R Q P-S.S S /Q P_S /0@-S GRC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ R 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0S00@-d!$M""0 0 AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S0S'  R  R R R/S /0S S/@-/ 0  00S S/ /0S//0@-@P M 0S PP0 PH@0S0S 0S  Ѝ0$0$ $n0 ĶI @@-PP@p`M- T Q Q Ѝ0SS ЍS PP8#<48#8W R# R!  p0 0  0J00S SH0 P 0  HH X0p@-PP`@ V T! 0pwPpx x0x t0 V\ \0\ X0 T@ @0@ <0 G t<F <F vO-Ÿ2M @ ,? yO-ddʟM0pC P,0 0k^P0 $03/P 0P&< 00SS   &< 00< S R^  0S Dp0pՔ&V!F 0SC:(008@@0H 40(0 C 0,^`P0  $03/P P^^p^W `pt<0Se [" &< 00 Sf&< 00S D:PP0K?o2W  RXKoᩒSp40S /0DY@0 pC(,0D\8 [^4 @0 C80P1 0P8040040"S? @&6 04 0 30ݍ<ЍX^00H0Sn&< 00 Sp 0K'[SPT 0@DUd:08@S4N Yw uP0px`0X0pP$0(4p^Y; `p$``p0, 055U0(  `  fP 0;0@#$$(4"(@0S S000 0S^Y[J ,0LE0S. ]00z[J [[[, ![ [ DcPP!KoᩒW00 S0K?o2'40$00 R]^]00ND 00R  Z,0cRC`\.@%D0_/`X0@@T@]@@/D d3~0 0\PPI0 $03/PA Y 00 S9 PD +,0RC.\@m&< 0{P x"00%P s`x"x2x 0pP $00SX"X2X 0PP  0S8"828 4P 0 X"2 P 0 (,(5$%0 5s 40S ]` ]]P1~0 0L^\PP0   PP LE[P + L0R4 d 4S Y 4S 00e\P00S 0R $RY $R 0}꾞~3D p8 7 Tx7 H7 h7 l86 n O-Pğ SMD`0ZpP ZP $0  0A8Y0p00SX Z 00y00y\ @T 0 .T0@T RuS d! S*0 u DD@Q00 00000000 P*I0=S H\0S Ss St 0S 0 P0s0S 0\00\\%  P 000 P @@PY 0  P\\@8"02 0 D1 30Sߍ @S @Rd! S1*.T 0 Pʵ< D L0P9dM   DD@Q000y0000  Qr000S~000.@DOoB0  _Pʱ[0T0 0 )0sx [00t Poz 0 *k/0i0Sa [00]0 3Pcʅ[000 DD@Q%\x[00Jmd0 jO-@X`PM @#  R[ tpP 08X0\0`0d0h0l0p08000 00000XS< S5 S mD[00A[P( P& PЍ 0& 0$8<`\` 0 0x Px000 0000 d1Sb>Ѝ 0<`$ 0<`$.#ppP X8 x  x!x T00(000 n 00R @# 0  P  0 `$ P!$08<080 0P $^[[0 Rl딀Xid1 @StX@Y 0@0S h- xP001\//سLp@-@P P@P [[Tp 0  0-B+ <rO-`P,",2M 0D000 0 p@P0S A@\ \T P-  _MP @!x1 0 0 30UЍ0 SRB P> 0 h@P30* 00S  Pe X0 SR ]P 0 B@P 0 00S @P _@@ @P Л\ԲdO-ϟ MSp 0D 08 x0嘀q  m i0 0` W 0S0S  ` 0 $/ "2 9ߍ0S0SP;0S`V>36 `.> .0J ` mQ P 0P. V 0S 0A?o2\0 P00S0S  p Y @`P 0S   0?SU CC" 0c6#PY$@ A0 RS S0 00e`P  `<00@(0PP`$pY i792 I120Y0 0 S   S  R  R Q ^  ^ \QRSR PSV  0 PsQp +0 0Si QRe 0S %0P,0 ӚP , 0 B  ` 0+P0Y ,00 X,8` 00  P 0P0 P㜐  00SS㜐RpmRo \;R P @ 0XP 00[0 0[*0e/0 5%0 @Y Xa0@S 56p$`(PX0000XP X@T0 H5p0$`(PpP` 000 WP@T 0S S00S0000 0  `P `@5 TB _?l$l4l 0d. 00?oR20S u 4@,8` D孆P1x00x0 VU`PPP@ `0V 00`UT0`UO-PLM` Zi  @㰱q p  rPP0 0 0PF ``0S S S T@P `0S `(0 ( (`5P00 U `V Y 00  Y``VU$@LЍTT T0T P0/Z8 808 40/VV ljh h jji G-XM`@tP pP @f00  A0 tP 40S0- XЍ PP 3U' 0 tP "U8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 0D DD@  00,0, ,0 ꉫ#EgܺvT2p=\ ZA-PPp`6 W* 0!ᣁ000?0"@@h>V0: ?0hS@H"#p ` *50S@@:p`F AH H0H 0 , ,0, 0 {\ YY4 <<Yp@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@ ` `0` 0 6T@ @0@ 0 +MH   8;X :XXG-X"X2 0M000@2@"00P005  `p0\ @ 0 XS@@ ,B,R0C# T/ .0N ,B,R0.\'^V*00D!41 0 0 30DЍT  Aa  B8 LR\P 0FS0 S S X0n(."4n4#0RP0@^*0^0 8< 4^*0 8<ꪐԒБ- M\P Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp ((0!@$R0@0T$0B0S \@0S ( !0$ R0DGTԏ l A- rM`PpP: UB @X0^00pAtAO0OO01 000TAΌ LmLP5  0 Q{pP& 0@MP 0 0 1 30 rߍ0 <0 Uh0h h=0 P N00 0P0ڏB4* SF R0   M Ѝ$ -- M0 0x ЍЍ/--0 M0( 0 hЍ Ѝ/Ḍp@- M@@ Pt00h` 0`0 `P@@X@10@T  Ѝp蜄H0@-TT1 0M` !000~p @P $  ~p 8}@ 0 0 0 30*Ѝ*}PpW @@T PU 0SRP@OT400@F-00%܋iT 0p@-P@0 0p0M(0PM(P,PM 0\0PP 0P 00,,sP 00pO7O 0@-@ 0 0 0 0 0  0 00@- 0 MP @0vM 00P 0 0D?o20c Ѝ05 00 0p@-@P 0U0 0pp@-@PMM0PPIM(0PFM(P,PpG-P0Pm `yPf 0@00 S S0 S S thPU 0068#<p48#8W 08 (pS@P 0q0p0S S S@ 0A S  A;@P0 ! 0Sp q0000 LP  p KPp20@~-@4M3`3O-@ 0Pp M,0(S{: (T_  0 T0V 00SR 0 RL@D@T0`G 00SC000@D@D0`0S, T0X  0!0J@0`I 00S$0AS000  ᪌0S000   ♌0S& 0p@OL0ppKL(0pHL(p,p@ ЍaKP  (,@(|0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ0;p 0$  $ 0 . Ѝ0O-PLMS `E$P@ @0 ``fMPR$IpPN 0 ``YMPC$PPU 0`@Q QD QR Q1 0U00Sz ]IPb  `000 @p R  R/ RY R 0 @Up K 0J[0H 0 LЍ   @QA@ 0U`   (⼐{p 0  ,  p0p 4`0W G`@ @U 0=K008K `^ \LQ  QA@ \Y ^ Q\ @  p, 0S QAR`  R  P@T( Q  A X # X/ X5 p X@ P  @U)<X X X 0` `p  `   Q@` ``  `p`<0< <]0 J < pC tC@-@P @J( (0( 0$ @yJ 0CC/zO-'Q Mqp PPh< H @00`0    $$Z0 X(0,3(``-P p`Z # 3X(00, "(`` -0P p`QK`a!Q0#03U0S` Q:PQ Y7X ЍX030#1!a 0 J@ ЍW000X; S`3 `#61S41`F2s2`Fs1`FPS0`Fh 0`F`4:0;`0Y S`3 `#61S41`F2s2`Fs1`FPS0`Fi 0`F`0809```\ pC-`Mxp' @Gzp* P0u00 @50@xt \0 0P Ѝpzx00x\ / p@-\ ,@\ \ Q :\ :Ap00p00C-P$0@SMJ 0( U4pȃ :`H;$963>0H G8ƌ<Π GpB71B- 0R  R  0000890L>1 0 00LЍ 00 !00V 0 0@-S@ 3/@HO-M@Y Qs` 0  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \ᧇ" 00\3 L0 1 00p0`0`Ff& G B$"HHࢆ(0F0C(6# B B("HA!0C0C1# B B%"AA!0 Ѝ ZTr `   P 0 p 0 J0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧇# 0Z Z Z 0 0 0 0 0  p 0`Z$Z7 Z3 Z5 0  p 0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[Pp`@p`D0|0x0t0l0h0dy7 <  @-@P @ N0 /0 <D 8p@-1!00 P@0 00D@1011.T 0@\0 S@ P p0  00C1000L   00LDLr ʚ;$ A-`M !PpM&laapGQQNHH0   @ N 03"Ѝ Q7@-T4T$00 0`P@P @0C0APP@@ 0P@PP PpP p0C0qPPp@ 0P@PP  0PC0.S P000@000@ 0@E0C2S20/.-,+*)|'&%$n"! je \NJ2S2\0/.-,+*)Q'&%$L"! J< 1,*000 @ @  @0Bdn`QeEBdnnQph0000P R 0NQ00 H 0NP0000N00 P 9pO-``!80@@R@@ ǟ MM|čǟT ਴L<,406C0P80 0 06,P0H0p000R&6 0 @ P< 0hD0 0 ,P?o4 2R0S <0`1  ~D0PU 0P 0U V H lV/h0S ̥ 00U?pa5P00P 0UH W00刅?pP|50= 0X& WP0 k@V00? )R 08p UpP  , P* 8  -4 p0] 4@ p0U 4 p0xK p4 p0PB 0SoEP C0P80[ 0 -#3 0 |4 30ݍЍ_3P `0 _0S 40ST<0`1   :fG`  YkP#2 0 |4 308ݍЍO$Ep$P00!?0"( =kU]" P "\` `T X@` *k@F`DV?xT 04  S)D#$$ D(H"($H1 Y Pk pI  Ik T 0 T2L p 0I00  .I, T@F 0 `DVX@P꘡ 0   Yx 0 z 0 tL1d`0`0 ppG  pGjT  0 d`[0L p 0J00  .J}, TʳF  jA˅@ll`$2raP:,`0_0\0//o/.h.d.hD..T.d.D.Y,,,p,(,O-tM@@ `VPPh0 P p 0s 0  0h$`14 %S, %ἴ0 徤   (6< 0 V 1P806< 0B>PU  0R40008 'j`1S   ;`1S0 0  0"PJ0  0P7P  P P$0  0P0  0P0  0P0  0P0 0P`1SxYz < P 0ppW  0R 0ipW 0pW  0Rx 0ipWf 0pWa  0R0 ,0wipWGpWD 0 PS00 ei`1S   50 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0001p 0001p 0001p 0xt1p 0[3EL htЍ tЍ 0 10 0  0 {0 t 0m0 fx0 _`dH*Y*p*V(|(0('U%%x%L%(%%%%%%h%H%(%%@-@`00AMM0 400p00 APP0S D 80 0 4 30AލЍ.Jꡃ]\0,@-@ M pp P@`P+P 0S@  Ѝ00S.S 0S Ѝp@-|0|AMPt 0 ` $ 0 @P <8 00 0 4 30AލpR[h[p@-P@Q`  @Q dPV 00pV00p@-@ M`p\PU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝ p@-@MP`30S 0 @S 0S@V00ЍpO00@0 P]V00Ѝp 0@- MP 0@0@0@T  0U Ѝ0p0 0P:U:L@@ Ѝ0<00@,0 0P) Ѝ0N0) P_4p@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@NM0@- MP0@0@=@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@00 0P Ѝ0dM,]0@-@ My T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@vT" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP(,TL|hx0@- MP@O@ P Ѝ0 0( 0P Ѝ0t0@- MPh0h@0@B>@T  0U Ѝ0O,0@ 0P Ѝ0tIMp@-@ML 0 Q0P0<00P@ ` 0. 0T @D B000T H0 0 <0 30 @Ѝp@Ѝ/.0 T3/lSRO-PM@PP pd``0 裟Q  ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0`a 0 T @ P  S#3@ P 0RQ  S # 3!# 0T4 0 T @  P  S#3@  P 0R \  S # 3 # 0T0 0N 0L0 000J 00  0;DRO-Q0 dM R Č  $Ȍ (̌ 0Z >Y >dЍ00 N\0ꄀR(N t bdЍXZ HY  8 igMbQQ, @-@P 0D .R\0@*S0T .S@@T QA.@S@@$ $0$ 0( й 8L@-$MP6`@P`^0pv> 00pp< pp_p  bPc$ЍC-@P@ `p MPOP @U f`P@W  Ѝ @Pt0 0000 0 P#@0S0Toᨂ#>xpIPC-@P@ `p MPx@P @U  `P@W  Ѝ @Pt0 0000 s0 Pb#@k0S0Toᨂ#=XH@p@-@P00CS0 S  P `0 Ppc`0 0CS0S P 0 /c@-M@0  00k00 !R !0@hЍ@-#0 S 0@Q0 R  004S 0@ l@Q0R Q    R Q ELp@-DPD0P`@0pp 00p@,X0 DL0p@-@ @ `@0Ppp0p@,DLA-DD p@0P`p0 ALDLC-P0 `0pMpp@ H 0D @ <8 K@Ѝk;CLC-tPp0 `0p MFp@ ( 0  @ ЍI;HCL0 00/BL0 00/BL 0 00M0ЍBLA-TT p@P`Mp 0 ЍTBL0 00M0Ѝ+ALC-tPp0 `0p Mp@ ( 0  @ Ѝ:ALC-|Px0 `0pMp@ 4 00  @Ѝ:4AL0@-P@000 00M 0 0UЍ0@Lp@-D0D 0@0pP p@:pT@L((  M  0 Ѝ?LF R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` ?0T  0C0 ЍH0H0 p<0<07/0 0 >O-Mp`@PP*W3*00V.:Y `8 @1@0 p pZ, `0P 0 P0 P 0`000000Ѝ0 P`Ѝ ` ph0 qP0V0`FV0S000 000 $<(T O-M 08>͍0,0= 0080=͍000\ @p@8<LH$0 PJ 0@S P =4 0H P0 Md 0P000 0Hk=P0= <<0@PU *0,.  0< 0;/ 0`Hk=0PE(P0P D0e=<;:9876543210/.-,+*)('&%$#"! APx R 0S .S 0S 0S00S.S=0@70- R' 7d 0 @t0 PJ 0D$0 SbD0C`7.800440PJ0000$0@ 0CS(00 w0p` :>Y@`p @D0  P(0S0 }P0 0`P 6000#80p6, 000.0   .00Q 0 ATP0$0Z 0D: 0@H+B 0?R0S %5 0  0 30  ݍЍ5Y =00S[=0@h50Z=0@T50T=00P040H0000 P@00 0;0P00$ =4000#80P =4 0H 0 PG6PD6@A6 0PD;`4@@2 00 Pf00004 0<8 BnPZ 0H@ 0R0JZ0Sw#3 0T m=00S>6 @0D;3d 0 XP`0 P,4 0<8P` B6P"H40P`<8p@C 0P`$P0 sP 0 P`P$=00SB5000Xd 0 0DT2 0 0 LP=00P@C <2> `Pv V qVp$ @P0 -P0T00 E$P00d0V0@DVt0 PT1d 0  0 PAp`$P0 0@P 0D 0PYX' 0 $P{=00@C0088    (@\, 0`XԮ@ $%@Hx ||*PhhX L ======VUUU d  0d$X<0\LPX@0@d 0 0=`0 |P0 P0d 0D *0 kP40d  0 \PpWD @QP0d 0 00  FP 0DK0S3Yy 0 7P D{PUD " $bp`0W1 0E@GS E^=00Su4@`x40 P@D[ n2d 0 ` @ 0  PP:Y4 @DK *Sd P0  p 0 PvC4@DK 0d  0 Pd)40D; 3d 0 |0 PR4 0<8p B\PH$0D P@C  4 P`P848$0 $@ 0ZD: T 0 P&$0 @C40+YW =00S D0@d 0 03`P0 rP 0 d #0 dP$0@T 0DK*HU$` pPTDK 0d 0 00  FP =+L0W 10"3% 00;L0==0;L020 200;L000300;L0<=0;L0L10 0;L 0 P 0D$0SDvp@`T2 P‐0d U`(  R @ Y$ P0d  0 Pw@T0 +A0W 10"3`' 00;A0==0;A020 0;A7; =+L0W 10"3' 00;L0==0;L020 200;L0L00 0 (;L>L C +A0WD(1 000X(;A>A Cd8;u  4 0<8 B*P 0DK$0SPxp\A `(P倐P 0V4  R @0 Y$ 0d   0 RP@T0- t9!?C0 S 0 ;PuP`2 0@DK1p)0Y# 0 "P\=00S= 0@$:0J 0  < 4 8 BP 0Dk$0PCUQ=x@p@U31 W2 T0d  0 Pz=00S= 0@ ;040P`<8p@C 0P`sP_T 0 PW 0 P`bPN 0 PF 0DK$00CS6 @;0p4 0<8p BDP0 0 P( $lDK`1PD[ 0d  < 0 }P1PD[ 0d  * 0 kP1` 1P 1<@d `0DK P  0 QPH=@ 0i )0 ?Py=00S 0d 0=0 0 *P`V D 4 $ 1RP@p` PPPP_=H 0 0% Y@ *, P>P0PP\> `05/=0I 0VHD* $0S&@P0 Pv@P(0d 0>0 0 P c=00S#1@ 1 0  $$\_ L8_ A-Pp@LU`. T @0 x0W``W0 .pPE^p P0070 2000 S037#Q00 ^00 0  g 0^ /To/<///@-` @0 0DM0<000p2 0*0 RP) 0 0C 0< 00 0 <0 30DЍg @ O-H2HrP0੒ 0 M 'r $rgqC8(0B刀B$ C@$AQ i!dP`3 @@CB*TJXRW/Y  @0 SP7[0S  `  0T0000000S @B0?R0S2  Ѝ @0 MgP Y W 0 \P@D 0 RPX  @0 HFPWY @0@ @e0  Ѝ: %I$ XtZ A-`pP0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@( 0 p@-M P@ ȍP k`\ P4Ho4 (0 0 8 30ލpf X 0-@- M0@R0  *JPP * Ѝ@Ѝ/ + Ѝ@Ѝ/vfPRp@- `@P PP0 ?p@_UW00pPRp@- `@PPP0 ?p@@U500pp@-@Q `xPPP0 ?p@U00pp@-P@ UP p@ p@ p@-@P 0PS <0S pP 00p00pQP@- 0R R  00p@-PP Q@ @Q Q QT0 D3200p4P IT0DS@p%P :p@-PP @P - T 40,D0S 00p T@pp@-@P T 0 4. kl\ ʠ5 6z 0p0O-Mh0@ $$4 ,?p0S @P000d0`-Q-+*)('&%$ 7>000Q00o 00A S: P @1T00PCT Љ0A d @00A S0P  ER  00A d0d00+S -S ( 0(00d000C \0Sd 0 d 00S 1CP' $ ZB 2^iS7 IS4 NSd@qP2 d00(Si <010[nS  0S Ѝ00XS `d`0Q Q00 Rd000S 1ЍT @Z v 0'$0 Z0C0;01$Cy 0 "v 0nyZ0ST 0SL %0jS 0JR0S 0R0000 @+1 0 dy0 00qPU 0 $S B ? @ $0(SY0SX[ }@P hk}P 0  0N}0S P $q X:`ppP)9pP0S t :0jSk&Bp 0 y[ 0 tPpqf xhX{V{T{ R{(`zPPV   ! 0| }PhI {@P; |0S $ B $R 0C 00CSp`6 bAQ`ppx BpGaw0 [ 0 0S0SIHK 0Se|@P h{0P00 h{00Yh0W hz|PhQp(@0S   88Y'\ hzzz z zQ 0JR0S8 0R000X h0 P'1 0 xH X+j0vp8p Xx0㨀pSY  t6!:k cR R4R p 76K0ct0tj 0aP 0 'Q0p0"00yQt \ QNdT0# 0 C Rࠃ R0d;0d000 C Rࠃ d$ 000d0Q0 `000SZ  d 00S `1 CRd` 00C QPsW0 S 1$ 0^0C$d 10 Hx0Cd00C [ d00L0C [@PxT$$ ( R$  b$ d@oP|{PPYp(@$zPPNPt9  o 1oPk [t` 3# 3#s\3X 00S0jX0S c0#3nP P3t[1HL0$#40k60C40pc> 0Nw'2w`2 0SRF؃ vwt 0 -wpdf p`D"@2nP/ h(@yyy y ~y4w  1w[_1@D0$t`#0\t 0`p`P0[00Mt`p0 P @0(0$0 @00 0h0 dl 1l0@ S 0S  p0S46S  0=nPO 0 v0 #1X\0%#4#$T dQ AK 5?E ||N?55̥P9?? ?MXkX(-0@  p㨀 |v0XpSt剑5At nv0 0SI&BS5t 0'́5fFp't`%E 0Vv':v(1pW{56Qp 1'G  .00C?o200!\ $ 10 S' 0^dv[ p  2mP "2mP SV 0p'(h@t pfh |PR 5$nhQx0l p0jS'0 ` A V@du 0#$v5ft`Q  N$ZPZ Љ Z$\  Z ㉐Цd00Cd0mPd00d00p(000C?o200)0pS `(@0S0SL Vhwww w wXK 4 uul40S> 4% 4# iP0 46'4t0[p(@ k R \p0 p 0"uVp0@SxULt 46SG50jS  X Rk&PBp  0up0p0(@t 46S60kS0S0S xPa yPvt0T&Xh A kR?7RcNwLwJw Hw Fwn@VX t 60jSR4p R \,O p1 0t 0@P^Ph7Gh>p02p0Xp@q3 \ q.6B#: :p t0(g$!\p0p(@ 7h' txP xP@Xէ 0' 8h'((S   0&ht p0X( jRqlS@" k`Q0 00M 0Ѝ  Q":?C0CS S $4c&&0C0c2///A-PU@`ὼ0pS  "P 0S UDp@-P@}PyP0 S :pSSp 0R:pp808 8e0 $0$ $f0 D: `p: @A-P`H@ET*AP/ =P4 pPW 0P P B $$P W 0 P l l0l C0 GT T0T D0 >< <0< E0 59 8l9 H9 0 0@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-r-w0-x0 00000S wS -S rS  0S /xS  /  p@-^ PB2 p 0 pP P//0S/ S S/0S/0S/@-@60@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 /,4 D ??SQ $0$ $p@-0 /ܙ4 P P P`/AQ/Q/Q Q/?0 H0H Hp@-0 ܾQ/?S0?/0?/D4 \QP0 ?0/@- 0  A-_P 0`0H@p  P[0S0@@pp@-@P`M P0ES  aЍp  0P[0S 0 0 Z0 ؗ\2 ܗp@-@PpP Q 0S PW0PSQp@NA-PPp X P@PEX `᯻P@`( (0( 0 ``t1 O-` MV " p@IV PᆻP @0SV F!ࣦ0 `F`1 Ѝ Ѝ ` \    t 010/C. *     A-RP`p(M @x 0 @0@0 P0 P0] P@ 0 (Ѝ/ T  ^Q A갳 0 \p@-@P᫱00CS0 S  P `0 P㢱p>`@-@P ㉱ 0`00@舱0 60 O,$ - M ? Ѝ0@- 0 0 MPP000@ T$  P  ṻ0 0 0 | t0 0 0 30 Ѝ0T0T TT0 ྺT<0< <<0 ഺX4  c@# <Mc# NA-pP@`% V. 0S 0S 0P Q 00 00 R` FQ`00L L0L 60 sV, ,0, (0 h " <! bO-ß OM4`儳@P `pPdh V V 00m/00 Z.` 妬P 30 00 [ !!.PQP\.Q Q :0 倬P 0H [ 00:[.[<##=[0Q.S7 Y_0IS00X00 I Z  0O 5 P00 0J ` `垵0 0C S:: 0  `   :[ 000(0,$P0 1 !01 `0 $ P00 0 0 41 30)Oߍ Z[0000<4 'P@Sx x0x t( 05 T.R  :P uW ԯ D p H ` 0SPBO-ʟ@ M MDtz`PppxU$ 0 0S 0  R0 R R 0$ 0l*`: 0 D5 30|ݍ Ѝ@:0(0(0P,0 0@ T S#XP ,|5 00pP0 (03/P  T: 0CoTSQv ôP0XPHP0(t, txᤐX 'x00 T<0|5`00 0 `L0=@ D8040PXP0 C0PP0 (03/P Y   `ZV `W TpG,000@0,0<Q 0 d0D P0ST Q  RM p Ph < `BZO[P0 0 0Pj ! RȠ LȠoQ \ V\pp0XP 70(02W <0S B@Gq 0P^!P" SPSP@Qp`0S 0 0X@@ @PC0@P0CSX@ :@p` @ZD0 C0 0CSX: L04 R  R Q9 0B'RS] P K `G0%H `,J 0 SRP`5 080t`PC0  `Z=8嫳X00 S5 8 >X P(07P0 R R < R00P决0P `VX *P D Q* ۸<0X`0 `D<0 0S S $4 0@ 0SG#3 @ 0= 0H030 0`P0 9 `ZL @0,1Q:*,P1P PXP*0 CR00 SY@0,008tPhHp0XP@ CR00S$@তPX@(03/P X,0@(C 0L00P , @00,0,M 0 0% LEc  0:0!40 =8!r:R,b0 PXJ 6P 0 s`PB0 , 0Z0;<0S0,P@0,0ᡲ`V D`,&0%H L0#L @0,1Q *,@0P,0nP T,0@(`C 0L00P  , @0@0,0@0,0}  |  h f| fx|  A-@PPMD 0 S`05 S Ѝ0p 0PP> P9 80 0PP  0 0P.᳸U 00S S 0pᡸ8 808 40| C  0 ` wPwG-30BMPP040@ 0 00S0. S @ᬒA~ ` p0v #0G7P @T *X` \"4T2P 0 <"$2 0 4 30Bލ 0    ! 7[@PI "`PD 8 0 0@?PK` 0 00 00000 0b0@TA 0 p pIP  00S 0  0pW0   0 0 0 f 0 0 0 _V۷ 0 Է 00S Sy wʷSX (wv| `߭PT* P`: 0  0d!P1 0 <0 30HDЍ( PI `  AP@/ P1 0 0 080 J P`00 0 0 00000 `O`Pꠑ $=d<4< p@-M`P@ ),0,0   0cЍp贝̝@-M@ $$ 9 Ѝdt@-M`P @ᾳpP0P0 ɠ@0@ 0   @0 PέЍ0@-P MP@T 0t  P00 000 P 9 @ Ѝ0@Tm 00ꨜxC-a@P`PMD UL 1 0` "  p0\# 00 0 L R_0100 L.\3W 00 @Ѝ R0 XS 00 9\0 @ 0 m0 U0 n0 ް\ @ pG W QU ( ,$0P c#!$c4" 00h ; b; xbO-ß3 0,MPQ0$00@`P R Pm P[0@:T000 0p Tr 0@ßP P` ` @0  P a Z\ @`V pW` @$pTN(",400S T0DD S0 s\b ၱLLrL p 0I4 HVC T T^ i/ 0 "1 0 $0 30n,Ѝ!1 0 $0 30c,ЍO@:TP pᅢP :V@Z) 0S  $0R8#<40Pq1pJ04 T TU 0 0@ I0S h 0@ ޯ>00@ ׯ@$ph@.T`@$pTP[ʥMTg< h X9h 0`p D ( ^8 7^7@-1 0,M@P0$00`P& V.  0 0 0 p t1P*  0 0 $0 30,Ѝ諱 0 X0X Xh0 vV<0< <i0 lM@ ] 6\ \54 \O-ğ lMQd@p0 R P P% r/ 0 p$h4 0 d0 30lЍHHTHdP`0H 0W T~ T0 % 040 $(,00h1T@ RT@P  0 q0S P q u \P 0SP qI u00 \0S PZAU00@P40@ 0b0T0` VN*:0TU0O "K 0 0YP?@T$ 0U00S 0S "2 0 d0 30x lЍOu0P040@` 0bu PU 0 S *  0CR00:80 S8: 0 /Z Z9 Z@P(1( R0  KP $PP`0P`I0 TT T0S 0 0 D: 0 0900@SPl :0U0@tNL  4T [PZ0 X1 D14X1O-إM@P pP+ 500SL ᄤ([R U U U ' 0 ~Ѝ0` R 8 @(0[' + ϡP'P 0;/qp 00P @ P 00 0 00 GЍ輜p   ;P0  * R + L UZ p  0 ;P 00 0 SM  00 0;/qp 00`PßQ <`V;h0 P0 ;/qp`0 z 00 0`VßR <0`VßpX0PY Rf0T0aX0`YKS  00Qe <`800C`V0Z & "  RY`L0i?  `;/qp> 00 `P  @ P 00 0 `Z 00 fP'0S$: I y Z1!0 00C0y0P`T 0S  0C`ß$1$!$G0 ݬA`V0 Z 0CJ `J`P @0P 0000 00=9ڮ 0 1H0H H0 ࣬0~ DS @S RR4 Qp@-PP@` R 0AU0D qV p<0< <H0 zVp0Pp5 QO-P$M`@ T\0000 0 00#ppӢ0 0`' 0`B0S0 Q; `V00S  F 0S` 0 0(PP0  0^0  T? X0 00P6 0SW @@RY00S@ 0`V00S`V[* P`Q @ PR  _PV 0Q @`lH04 QY0 JP, 0 S# H @ P00S T0S S/ S4 T: P@000S 0 0sV $Ѝ  P `BV@` 0r ^` D0@@ yW TT SSD D0D h 0{@$ ? Mp@-@PP` U 00F Gp 00p0 60 SUd0d d70 I0 0@ph0TSd00 M$M L -M0 3/Ѝ/0@-@PP M U( 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0D0D D0 U(0( (0 $2 KL K0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 ສU, ,0, 0 ௪ $1J KJp@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0 , ,0, 0 x dJJ 0Ip@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0$ K, ,0, 0$ A I4I @/ I0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H00 U0 000 ,00 h.4H tHH0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0@ ȩU0 000 ,0@ ཀྵ \-(G% xGF&0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0P U0 000 ,0P z P,FE )EF0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L Y0\ BU, ,0, (0\ 7 D+E tEDe0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L a0l U, ,0, (0l <*D xDC0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0| ྨU0 000 i0| ೨ 4)C CB0@-PP@ M T 00vP00 Ѝ0L L0L H0 T0 000 q0 |(HB B0@-PP@ M T 00P00 Ѝ0L L0L H0 bT0 000 ,0 Wh 'A< dA0@-@PP M$ U- 0S S S Ѝ0003/P 00S00 Ѝ00 0S0 02/ Ѝ0L L0L H0 U0 000 ,0 L &t@ H@0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 اU, ,0, (0 ͧ@ %h? =* =A-PPp@`M3 W< T% rP RP P P ЍPX 00R X# ЍAt 0 & 01 0  0'W 0  0 P@ J0SP@@' =<| "<^P 4=x<_ "p@-@PP U  ;p@|L L0L H0 ߦU0 000 ,0 Ԧ\ !;0 4<X;A-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0 0  0Xl l0l h 0WP P0P  0v8 `;`: h 8: : : :90A-@PMP` 0A UJ 0pS SW   dP R`V V V Ѝ 00p0SP Ѝ W`# `0SPV 0 /0 Uh h0h d0  Pp 00, T8 8(8 \p@-@PP U p@T }P P0P L0 ۥU4 404 0 Х(#L t7? 8H70@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0C/U0 000 0C/} \(6W 750@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0G/6U0 000 0G/+ 4{ 54p@-@PP U p@QX X0X 0K/U8 808 40K/p@9 |H4 ,5$4p@-@PP U p@zX X0X T0N/U< <0< 80N/ܤp@b| 3P 43p@-@PP U p@X X0X 0R/ཤU8 808 40R/Ⲥp@ 02 32p@-@PP U p@'X X0X T0V/U< <0< 80V/≤p@0 X2 H342@-M@DP0.S00Ѝg@-M@p  B0?R0S Ѝ$0$ $0 T0C2 2 R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 /U L0 00/U P0 4# /0 48 P @Qa ٔP @Q`P ΔP @`VT*` P`Vy [\Vr .V DAv Xt0S Q.Sm @]ᥔPj `0PCU`PxQM  D P XS  ``/Qj ]QOP R02   0 ]R) PR  "  XSnP   R0 F b" R` V` `A ` @R^ .R @@  0D0C  X1(00$Ѝ00P  ` < V   \  PS X R0Q  S0 T 4*@DT[@ XS(@ X000… Q ` T`4*@DT[@S X00`P @ 0 0G-XAQ@L*p0S% RC @R`P000 0X: 000ܠ   \ 0 Sp00 @NT00Y0Sx x0x t0G/$AS 0SPQP!00P0X=(0@0L X &4&RO-P3P#RP3 M0U 0p`\ @X @RI R R5 (00 ЍQ*@ Ġ[? A @ GRPR@\ 40S4  0@0[0Q0A[0S 0 0K/ⶠ  Y*@T*0Pԡ 0A\ R!ɑ" 40S 04 04 $|$- M{ ЍO-S@4M p0S0h 0S 0S0^P @^Z \S 0( X S B `$ ,PU P0S @Sf   [@oU `PU00 S 0W*0 B>^A ZP `00  K Z0T?\P0` RP SAS^01"0!0\VP`#(00X0S $0 Q*0F S(0S 0 `(  0AU0S"  !  [)@Z0 p w(  ABQ APAU QpF  p   0B>SE0A S0AP`0S 00С(00@4Ѝ R p0S   P\`B0[,? 0,$ @C /Q R!1 0R/xpꛡ00 0 0R5 P`Ꮱ00j,@J0? Q0S 0 |0R/S sX \Q\ @ @0@ <-0?D< J PjX p@- M P0 `00p @ !vp < 40 0 1 30ލp@-=@C B A-P 0 0M `0 10@0 (q]p 0 ph0 (0 0 1 30ލ=B ,B Q:/R/0S/S:00/@-\@3#* 0^ @R R R (000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R00C訠(00/C/A-@P`TP% UVT ᭆP @TP 0?Sp {00v(00QSp@-`P@ 偆PP@`V  0R p/pA-PAUQ?UU@A`pP W ځ1AP3(00.00*?00Q @-A?SSRB 0@S A00 (00/-- M/ ЍЍ/@-M@ *p TЍR/0S0 \ S 0S0000/O-P M@P 0DT"S ` ᅘP-Ya +Y Q0Yc T@ @Q ;pc`Ppg;pc`P" [-SQ& K0I P0aIQW0IAIQ70IS| V[SQ;+ kf0S \0J0 Ѝ`Q0YXP A@0L ^P @?0 0R0   ЍQz T@@z0 ?0 Y 00 0M0ЍGX: DA-00 rMPPp`, V4 @X0^00pAtAX0O `p00TA΀`L PP#&0 @t0 0 1 30rߍX0X XF0 ੜV<0< <G0 :(: l9 \ P4 0   M Ѝ8  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/T8 O-@SM ] YXc 0pS000!R !01 ᗐPP E`#3`7P*Q30A 0#1#2#4#8  P 9   T U 0C  pSVP0 0@pQ 0S  Ѝ3T 0 @00Ѝ808 8@0 ! 0 0 (A-@`Ppc0 z0@c$0$ 0 M Ѝ5 Tp@-0 000St@@@pdPddP.@P)@P  0000 05 x`@ p@-P@ǝ p@A-@`P᜝ppp0php ~T  1<0 x  Aj4 0,x'(%@-@4P0S  3/000S@譝 A-pP@`  @ ൃ000/@P p@-@PuPpp@@-@!1BMM 0`PF040@@@ @@z9xqPpU h10S \!p0@  P8A0@ P< 1 0ो!0 0 4 300BލЍ@P >@P  4/P Q Q 0 0}p0 00P "0 0  @V803 2 (h2 \ O-qQpMP@ 'Ap@f a@0` RD 00]1PI 0SP p Z [ @@P K0[FpP A0PU :Y 8P``S@PP TP 0@U:W "0@@00SQx00p@@WЍPЍ<0 0܊ 4  1 0 0@-@PP$M U" 0 P' 00 0 GP $Ѝ0`0` ``0 UH0H HH0 | Ȥ ~ t G-@PS  RL `10\0SA HaHHqP`p #)/0PS-00兑 000S 0 000 00 0 00 0 00 h GP00H H0H D0 ℙ\( & `   t h  A-pP8 0S@P$0S!0`PP @0S PU @@P 0U00 ᲁ\@ 0@ P 0 000 ,0 0$}l| `hO-XğdMR  0 S X (4`000SYD@0S00 0#003 0  0 070P YP3s003@0p0VQ QN  QI P0S_ 3/0 0P U@@ SP00SJ" 00C0T@dЍPB,@@@E20\ 0,0Sq  R20$   @$(0,0 L00LP 0S 0 <00@00<00P 0 S@ $0S(  ( @0PN 1S@iPQ 00C0 d!d1d 0&( P0S X @0!010 ,0( @X!1 0( 500$   @$(0sP @$0S(  ( @0@J$  $(0+ x{@ Hh{{< dz zy  ܝ 8a |b(x C-@@Ÿ 8MpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W?!1 0 0 30[ЍU00ì?dPER ?\00S T=*0!0 V5 @0S00L0  0T*0 V @0S00U0Pep 0PjT*0@0S00 V@@W <0Pe 0PP54& Q% PO-ϟ |Mtϟp `0S㠐夀m  Yt 00 0S` %SP %0BUSV8)" @kK/(1 |yZF?^-= 0 t0 30|Ѝ T !O#d"@(,0 P$;\-\#"0T-cR:L-c2S@=  PP 0 0C@aa0C0C Cr  \\|-N2?#c!!"N ,  ! bQ-5:bQ , !-#c!!2N 0  T\0 S 0!Y%0`0S00 Y `0  p`0 S00CL  B1;Q/0A!b0\P  !Y0`0S00 S 0  B10;Q/0A!b0\P  Y0`0S00 Y0 p`0Q0: 00\P Y0`0S00 YD0 p` 0Q09 00\P Y0`0S00 Sa /0 b !Q 9Q00\P  Yi0`0S00b SB0Q0(9 00\P }YQ0`0S00J S*0 p`7`p0 v`,p8 Q0 0\P  IY0`0S00 SQ / b !Q  '0 \P0  )Y0`0S00 S Q '0 \P0  Y0`0S00 Y Q $'(0 \P0  Y0`0S00 YU&P#U"P Q &0 \P0  Y0`0S00 Y 0Q0D6 00\P Y0`0S00 Yj0 400080 0<00\P@00D0000 0P0% Yl0 `0S00d YD 0E0 S0ڜ YT0`0S00M S-YG0$ `0S00> Y00 %2?2c 1 R11Aãd0Sâd0CS0c0`4\P 0CY0`0S00 Y 00  0  p00 S0R`050\P03 0Y0`0S00 Yp0 p`0\PS0003 0Y0`0S00 SY0" `0S00 S0 p` 0S 0 @ 2qp  cqp  @Q 0! S! -Rk Si! 1Q0R'Z0S()@n \Z R SH*ȟX`` ԨԸ  v@@PPȟ$ȟ夘 ,J(q[.|xtȟ5 :lX\@`X$ ^, PΌ3# `_ 0RS@ xWEXPP  @E`E`ǟ)ǟG $ttH|t(ao[.`gl 11 :Hg8@ Їß0D0pϠ'l ‚ b l C /B/`0`01>aG` 120S"&.2db`3ch@G@. c 0㠇4#+:60 0($0(>! 0#‚!!!0C0"+a[oÏ(" ?00 #2>[?@G'PE@GPD2#"*" H2H0@r,W#10 ?015: 2 0 #"".2Q  3 #101`0T!2? B4sppp0/SX0 p c 08!+:60 0($0(>! 0+Qd!_P!!!0C0@![Ï(" ?00 #2>PVXi`v c 0 &: 600*$0 *>!!!0C0V& )!"2 >n:E.€Q_uk9"mnDl Sc$IųQ\(\ףp= ףdg g Q(\)\0f sc 0 ņ8 +:60 0($0T (>!!!0Cl 0[+Q_("Y0%R^PP0 0 cQ @R0!V BqgqgXpC)1? c 00㉆0,!):60 0($0!(>X! 0‚!!!0C0x!YÏ1(" ?00 #2>r/D B 1?A1c 1c0R0B0$2@ 502c8"2c2A" "b1C S/  P008T2T!:#0 όR! UZ: 0"#2>"Q0030#0000T  @D0 S0  @ @$ 0ЍDv)1?c 0 00x#):60 0($0#(>!!!0C Y38#,"0.s<0P0@<00000@<0P0@XT 0 @-M0@P T 00t0(0Ѝ 00p0e e O-`@PM 0S9  V 04? [P␅$PQ%  .   !0 P  0% R0 R !P  j00Ѝ0 S, 01P0% V 0? VPKR5. P P !.Q P V0% R0R!Y0h&P l6m&NS`@@0FSHkpP [ 0S10ƒ!0 hh "0"Y001 OX10\1 001Y" <Y50 S0S >S@p3S*S0S -S0 C R0`@0F0H0N<)`h0hlpt ߆|Ѝ*YY -Y00I S@0IS0   S ,S;SQHAL d ;S,Sc SiH^&- Q 019mPhj`019mo\` @KO@h6Pc^`L 9k bhp&tulg>@0 0N\hPp00 @i @  P 1 0 0@1 00\P00P 0,Sd0,0P 0S   HILu& ah& `p&g.tl60 4`0 @ `ᴄğ@$(00p$cR0#030 1`002c2c# b?0ppcWZ  X  R `H 4$cR* $L%P 0 S 2J @`p 30@0 @0 `cQ0#031`002c2c3?0cQcs P`Q   Q0(38#AcQ*3301c00 `X00@00"0` 8p @@p`@D 40g 0Bl Sh0Ű1p` @ 괸\@Q  ף)\(\{(P 3P,O A-PQ@F 0S00 01ɀN  phh6l6ф`r`P 0:S jP `VpFPW N hK0PPT`V_pHPNLg@P`uPpVA`P L ̱A-A`P@pP %PPPW☀PqpATX  P>UI QQ |1|!`0 t0 V00 m``@ v P =D0C0CS\@0d/@D  n@D0P0T0S00#  1PWPࣶ LN  h/U,qhmP@P0P P0p0 000%$$PJ #@|#SI T 4#0@-@ 0 0!R ! " @-\FlQt00QU d 0#P@Hp00 P@|{ $ht,{ p@-@PP 0 p@00 p@hp@-@Q0 0PP 4 0p@0 p@P0 0p@-@P0P 00p@ 0@-`4M00 00@ 0 0$`00 00P0$0(0gT0 0pS`4ЍD0@-PJh@\ 0H 2P̌ 2P0p@-@P#000S 00Q ʁ0h T 0S"ZH p<02@T_lkx Xx ܧC-`P @h0 Rd0SZ0hrP P0SŽZ0\":h0p  W\ Z^ TRpW̌ • W R0hpP 0 W0\ 2Z0 RT R   ̌ 2W?<02P?<0p@-Pp@yd000S T00P  0tP@0gpjv u hp@-`@P`P U 0 D0Pp000\ LpL0L LA0 %U000 0B0  Xv`> ̤v8> D0@-00@S $000S 3/{ p@-0 TP@Tp+   03/P ׂ @TpA-h0`0pPN@P UP ὂ  $0p `@ @G-Pp@  ?o2W0S Z +`v% :/@DP@ @pTP0 F0 t`tPt0`P G0ZP0 H0808 8H0 D< (< ТĢ; |A-PP`@! ppT P `L2 @0L€00#S €^"R808 80 E T: p@-@R`P  p@ 0  0 &: xp@-@RP`  p@ 0  0 (: HO-pA M@`tP2p0l P2 ?LB0T- P R; S P@T" V0S !Q L/`3/L2 S1P2S?T030# T03S0 p0p@T@@P20CP2SP2SW pW ЍS @  L3/L2 S @L &A-`0P0Q0\\ MS@P1 V9 T@p`0 80xq|q8O<T@D @@`@p8P1TA`NPP0@ 0 0 1 30ލp0p pP0 N~VT0T TQ0 D~jT 0 `  P@7 `x7 8-(0( 00M 00Ѝ8  --8M$ 00  0 0 0wЍЍ/ 0--M0 iЍЍ/p@-0 0@PXst`00CS`0p S  P `X0 X PXjtpXs`| 0\0\ 0 `00CS`0pS P X0X /XT 0--00 M (0 X ЍЍ/h 0--4 M0( 0 XЍ Ѝ/ 0G-@SP`m 0S:X' (S" UX t0p W W2* ~0J0P0Z7PQpT 0 @00` p0pWP PPpB7P Iz` C000 s q~0 0S Z0 0 :}0 0C 0 00sl0l lQ0 '}T0T T=0 }s Iy``3 44e2 X2 ę--M  &Ѝ Ѝ/ -- M0 06 ЍЍ/@-aPP`@M8  5pP/ l@P,  0P$ S 0p@ 0$  0, 0 (0 0Ѝ 0tЍ~0000@Ѝ808 8>0 |P  @LL0 T@-@P s0#3@s0 ;0 |U\0 p@-P`@Fx R T0U:T0T:p@}Rd@-p@-@QP> 00!R ! 00! \ P 0B RQ`0 Q0AP R 0 U00SppP#XpP `RpP0 \0\ \<0 !|D0D D0 W| 00B;~ 00$T. dl. @A- R` P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ 110L00^ 0A pW \00W00S PA0ASP0@# 80p@#1! L0  A 0A葮p@-PP@ P ln0000p0 0 {Q, xC-p@0T@1WP` M } }0S D!S|00@ Ѝ00} m}0S   |}0 @!|}@O-P4M@p `&|0  00ShSf  %R0 0BZSZXWUTSQPM&J?>=<;:97310/.+,+)('%#" uqpo  #8qnR V@6VJ 0V & 0 aQ S  T k4ЍPPPP010 00C0B Q$RPMP00F x3 0S 0V`1!(  x 0SM 0V`1!  x 0S6 0V`1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p V`1 0! xO 0S  0V`1!xX 0S 0V`1!0 *RS 0B Q@ 00B S@@@ x: 0S 0V`1! x  0S 0V`1!    x 0S  pD 0V`1!ex$ 0S 0V`1!X V  x 0S] 0V`1!G +  x 0S p (  xz 0S px) 0S 0V`1!x+ 0S 0V`1! x 0S 0V`1!xn 0S px 0S p  0V`1! py p p xp& qp jp cp"s R 0Vp0y  V@ `1 | x 0S 0V`1! | xm 0S 0pT  0V`1!u ; x 0S4 0V`1!f ; xX 0S  p/ T- b* p# p$ p7 p#l x 0S 0V`1!(P x 0S p[ x 0S 0V`1!  xi 0S p 0V`1!$R 0@C p7 x 0S p  0V`1!x 0S 0V`1!x 0S ppx! 0S dp@ x 0S Vpz  0V`1!  x  0S Ape  0V`1! PZ X PU S PP N $pG PD zB P? u= P: p8 0B Q@ 0 B  0B Q$Rh x R 0p0 V`1@b P H p  P < p pO p P " P  P  P  P  P  P  P  P  P 0s 0 S p  0V`1@! P $Ry@00 P  P  P  P  P  P ~ P{ y Pv t Pq o Pl j Pg e Pb ` P] [x 0S ,pP  0V`1!q PE {C P@ v> P; q9 P6 l4 P1 g/O-@Ο oMM0Pƍ0L@ H@ @0Su 0L00!R !0s0g0 ` 0S   R  @, 0 ܰD G/@$匰\ 00000d0X00PU @%U PU `DV0pJ00S00`00pU 0r010P( 0 0EZSjG?a C07wArFG801P*jP    R\00sX @0S p=*X1rr@XO|X.>TqCvˠn@qPF0D,@ TDLl(80<@P@iP@@0@ 0@00h@00E `PA@00E S$U[ (@D T V4 $:, 04   S! !0S0q-0r0 0S^  0@TS@@ 0R00S@r0m4 , dp @_TP<4P$0000S 00倀0@0S0000XX )9 0 6 301 oލЍU_ QP0}r0@T0P0<040!(R PQ  R8  儠`AVS 0000S0r001S \000010000S0Z @DT0 ,00Sp0I0 (0PCU80P0 0P$U0U0Sz v040 0S@@0S ,!0,040S  x|0t00 6| `R1|0P x 0BD00?R0S 00S D0P00 t0S-0r0|0s<0 P 0P@$V&l9 0 h@lPp@$P`FVQpP`FV p h@lP:0Q`0r0FP$LP$Ud0Wr0> XPPT @P < 4 U0ڸjp$`@PEU 0S` 0UPPEU00S08;0P05@P.0000S0;0000 00 `000000S0K|`V 0D 0 000X00Rp0 1P}$0 (S,   H0H0 0 S  ࠡr40,000 S R@D @@?VH ,<  , 0o/000NSP `Ur0r}pP @@  T@P@<@-VH}p$p@`FV 0Rp0 P `FV 0  0R`0   @( S ,   D@ @ S , P@ 0P0p N @ Ss ,   ncP$0 vZP$0 xP TQR PshP4P $`Y @ @LTT0ጐ @HX \ PsHX@ P0\@PYPQ/? 0, vnx00CD03jP7P7$r0sV0X@ 4P$P`@K[0S`0P0 1<0 S+0S cB-0C R!1/΍L1BcR0 0a0  AC LQO*^`L0 Jo00S0<>00`0O.> , 0n.> , 0mrMPH0, 00 , H0OS , P  3SH , 01H S-0`r0͵ 0SF 2SH0,   H0! `4P0S0<00`06P$.X 0p@T P 4 _fPo$G0s<,08 08m,Xd ~40p,0H   S6 ,!0SH , 01H 0  g  s S, H10  H + S ,P *  d S, H10  H     S ,wP$Tz,@p`U0ʤzp0r0X R <A R R R <PXT@0p_4@zpTP$vs0^80< ,0 ^0my_X<倉,P,T`P`#" . AP S H$\ ,\0ZpEE \ S 00 \00S+0 0T`<40d,P @H,00S@H0, 00 , @ H040,0 0 S |0D@s01yPF$400 0ES00^^"100  Cd  /S R d Tr0 @@0p_T@P@<@ P   SH0,   H0SH0, @@H00^SH,01H,  < S , P1qvSH,  HsS , P1 +  a SH0,   H0_SH,  HRup@p DşS 2"N 7m00?cP @0 =0d0nSd 1(0Pmp4%x0 4P$TH000H0 < T @0p@T P _ktpev0`f24PP$@`FV%0SP0 PW0F40,00 80 0E0S00 0pE4P0S0300`0|`#3 P 0Zk0 @0]OH0P00H0H000 0H H0 00H0H0PH0 KH0 00H0XThP4 W p!H0H]SH0,H000, D <@BOd? `p1lL 0 pP 0@00S ,FS ,P!49S ,!1 , 0jx @B0?V0D@#P$|`l 0 0 0@ 0kpl 0 0 !1 D 0jH PH OH0 H0 H0 H0 H0P H0i d``x$. - d8D^<^3+ [Z`Z VLT,# T" TS\QQ>*P0@ 0p 0SH0 ( H0;@F SH0,H00, 0H P0H H0PH0X0>P00E SR@A@00A S$Q0'S3 1 0P T P 0SY P,@ 0@00ɳ` 0@|  0PL0ST 0S000p0t  P )Jpo  46OD5@DT 6 4>0.0>,.,>`p.> 0`p 0P  0XPJ@H0DZ0K=1 PgTD@80( 000D00@COo0B SP@ES0C00@0CS% =010x<, 0  0|ЍOtt@@C>0 SA. @0c 0c6"ў0@DT06A0@00DS0d0800800Z80( 0C800jD0=0P 0P|Ѝ00C?o200P0J@00 40X <0$ H0t0S( Rʘ;$04 S00Ӣ?(01 ?` @Р $0X  \;`p 0jHP 0 0 0`pTP  0`pPE0 0P P @Y0<040( 0X00S$00P 0 $0S00R  \ Q  RH  Skt0S(0Sʌ0<040SX0$00<00<0 ,00 |ЍO< R T RpPC^0P6Pe0080Ph@PD 8 RQR00 BPE0A8 0DQ <0Sl @P- V`P) F`P" Z  <0R0P   0`S80`0800P00<0( R$8 01"B`C 80@"T 7 `p@ 0 0 @0S d 7yP1$t7 $0`S uAo $0`0(0h0<0S7`01C 0 ` 0؄ 7p  0  @0p`pp 0DPhlHؠ`P X%  t6 h6p` P 00P 0P`pP  0 0P H PT8SY\0H0v$ 5g` uA 5n 0P  1P! \0H0V 5(0@c01 ^ 0$B  0$` P0@`S 0 = 008 P 8  00UL0SS@0S$0S<0SZP p$ PP  f00S0SU0S S P  P W 0W9SpG 0P0 @}X$48 DFP P! `P @P X0S|$080SSZPa 0$ 0C0$00040  pP0 0S 0PQP 40S0 RIWQQH R  R R S p ]PS P9X 1U TU  p@ P p  0U (0000C0-$0S ` lP P 00 0(00(0100T `P <0R0P 001 `Xi ?aCoc?`(?yPD?'G ?>?@$@@0 ` 0<CP`00i> 0 0`p0P@ ( < 0 0jP  0]PC! t0( 0R?0S\0H008P@<0_X  L1P`p!$$0S 1 LP   P0 0  0 , Q0|Ѝ<0`d \ 0t0S h0 P(0 +Wp$0Z5 7P\ U  /@PT  )PPMR@PGl0W0SpG P @pPP8   ! Ce7PP, P 0@DTk t9Y h0(0 0 040 P0(00d80@ TP(0 0C (0P <0SPX0S$0000+0Q$0S X0S`0(00C h044  > 0 `4 0` uAVW0S0Sz 9Xw p90 @0` P@h010(0H0S 0S SL  0 `pJPA P 9 P @X jPP @W>0S 0007 Qڶ0Sd46S01::S0P000ZbQlHP#h0 PH(0 @$ P !(0 Ph0/&$zT P p0SB0T(0 0(010P0 @&$`00C0X07X0$0h0 P(0 @ p@B00C0 X0|9X[ W1 ЍP/D -2")2b3c1@2`M1 BЍC@-@PPM ` p  0a P剿p`Ѝ0 ;0 0a$$, p@-0@Q r P p0 S P1 pZPP   ! -b@0O-PM p0D` A Q@ 65V @0S SXr  01@ i P Z 0 0 0"<0S YQL Z 0 <0SO ЍQ_ 0 S0BV PP0P0  8 000 S+ P 0QF<0S 婐 +YPCU  Z R=<  210PU9 0U07Z PPP 0 0 b"0P0 P  YnZ 0 ah@P"! 0#0 0 0`P@  0Q/ R  B / 0Rp@-@P*`0B @!S@ *@B@DQ@@@ `0  `f2& pS@ * A BP   `pb3PPO-`DM$@ (0徼p[ 0, 0-Q-M+*)('&%$ 0 00Q000  00A S0P0D0 @ 1T00CTQЅ0PA @00A S0PL p@8 ER00 00; `000+S -S0000C \h0S  00S 1CP H  R 000H 080 BS@ t Sn ?o2T0`T@ Vpp 0 V#$ <01$Ch 0# 0E05[S@0S @0S @%0bSVPBP00P0PA U%b_$ ;p0X@@"ث\`##Z 0 -_EpGPEPW@ 0#X@`D;!:?C0CP465640V 0+$p 0`pSP 0P PBU~ 吰  0 A0SX0QP0PLU  0S 0s0000D0P S  X00SP0X00$0,0 0 0x @08 HS B ?`0 00 hl0,hP@Px  l ! _0PPm    !_`圠0P F p0] W00`0, P `pC0F0`p`Q0C `F`p`V00S0S`FpGH00SJ FQ8:@0SWWOXD0P0. P) 0S0S\ `  `oT0SPY 0 S #w Z(X0P S00 ,` V0V `FQ $0[00S\00 x07#$$0吠, 0#Z00S0d00 `P QCE[p  !8P $0 S B\[X0P S $ B MKYd0 p000C?o\ 2R0S @&@61 pt0`@6p'JP  0FP$0S 0S`Ѝ00XS ─0Q Q000 Q00 0S000R Ѝ0 WiS IS NS@P 0 00(0000(S 000nS 0 `0QM p\QNT04 0 C Rp@8Rp0000 C Rp0PC@0PU0P0U4 uPP { `H 0 000Ql K0 00S>  00S `1 CR0pC08000 1バ0C00C Zx 00L0C Z@Pl"H ^H  bH `@Px 0t0C0P0( 0000000 0-P 000s0PC@0P0P0Pe0 $!1 0 9P U%bk$ 1p0X@@"ᐡ\`#P#Z 0 _EpGPEPW@ 0#X@`0!:?C0CP465640V| 0 $p x0`pl P $#iP \ 1`pP` Z 0 x0@0 #$\*E V瞯< (A??N7P  B\,$0SI ,0 0R0 $060P0 "P z P@P`m@PP X0 0C BX0 ^\0$05 @1Z `pd!d1dxdP D\ 0# 0T$\R \ 1gPRaT`P  0>P  0($5P `p0x ,00$0S&0KS$0! $Pj $ 00C 0$ ( 0h0 R# 00S S SP 000 (0000 "AQ!*\000  0c230$0 S D0S 0P 0 :]"0 00Q0000 @00)]"0 0 `BpP 0p0C0I0$00 00 ]"000( 0000 @a!00 0 x04#$\`m 00T0 00cT0  [0( 0 000KPF0 S0``IX00X0k  97Y `p,($#\0$0T0 000000 0(0~P0P00PCU0Ez,`Vq 7`FPz`p, X0吰0C0 DPi !| x| | r|Qʛ p8  &\ H 0[ 0P \0x0\00cx0 #H7R @ 0a0P04060P`$#@Y 5\ 0T#0 0 (0P [t 000(0 0Q00 N@S 0⊐SQЅP S@80\0800SQЅP8$ H 80 0C10 T 0#0 0 (0P= S`p,H$0#`Pa @00C1 P0 CnPe5P`y Ad90P00(0PoS!00`p,0Z` p P,b $0Sy 0 |{Q0r !P0 00C  0Z `p,V!0Y0$0X PR0oPZ P000  0C吰0$PI 0SK@ 0( 00 0S; 0`p, $000P00P00Y!08 0$00# [00S 0 UY 00P0`p, 3S 000 P  @1 @d@P000!00rX0P Sጐ !000Sg0SD00D0a0吰 0C0f@-00УO-@ 0Q@P MPP`PV  0Lp@P  "(%(!( Z"8J@ Z3pIq WG N@ "8!8P0LL#8S 0Y 0  0 Ѝ @P   ! Y ``O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WI:Q0 [ \ 5 0QR T0#03\0SuWa*0 GV*0F@S3 F\   X0WN 06S  ЍW*@DPD@ Q0: Q0Q l  l>P:00XS Q0pBO)AoR^" 0[0 k12000 QS0T0l1 c, 0# Q:|00Q )Q  0' O-M<0 CXHX8@`p00S 0 0Pu0@0P0  DB0SG^P0D= PPb P0 Q DS ZH P 0S S SD `Pb@00@0 0c 0Vp@ !WT 0 PeS5q0 0@00S Z 0 P\Pc R  BPPb SP0E0CSڣ0S& PX 0Sa R0 0UX 0p 0 Q U P  U UE^ PLU 0CC10B P0DSy`0 S0 S C U 0S S S 0 XP@"00ЍRq  BPP+\~ -\  L^ ?L NZ @\ #L@NT @Pl '@Ѝ \ 0P@0Q 0S00 LS S80S 000 0 b@0SX"00@C `P `D21 2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf 0 S_ | X@"00Ѝ@P0M@E  PL `K"V`pKW  J` 21p 7 ` PE~@QP!80Sj80S 000i U U E%P 80S800c8080S `XT0)  RP!@L#80ST80S P 0 0  B P\ \vj 0`e  BR "@` P3 `2 c 1P5 # ` 0 A-P@p`* P  0 P  0 PA-P@p`@ P  0 P  0 P0 00/ HA-@< RP`pn3 ^@ P 0 W@0 p0U0`PEPU 0 B P @` pV  0 B Pp0U`98C- M` p @P 0  B 0C2S P 0l Ѝ6cz@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ PU0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/l`l4lA-^0000PbA1 !0T2, l!p(  T2,0N10C#10R! T TNNN1^0R @-P@M: Q @ 0 R Q @ЍQ0@-@ @^3#1^HP1.P2 L+@L+l0n0O-1!0 M000000 !1 0 0 30WЍ`pD00@0P(@0  `a  U0< @( R  00     U| QT@P0TD00D0 0D00D00D0 ѱ0  000  k`  k  |i`1A-0@`T@p Tp P1 Tpp8#8S$Q-* q2 q: R 0X00SP ^T@X@@@  000COPX@ TppPZ@W@00?2  0a10^020B 0A-ˠ a LRCS0\8 \TO:|10@o\0 ^# QR=0b035PPA@DT3!#1^ !1. !2 A"LA^U /B R s၃p AT\ A Nr4̠ @@QPUP@E 0  @T@?e$G-@  \PP`p!! \Q 0S6C 0*4>70 0S6C * Q 3 "\  \Q4>7 0$>' 0G- PXl X` PC Xa`  P)2Q>8 qD ?qV   0@)pY00 S X Y  0  $Šˌ '5  ?@pY 0 X``@pWuVVA Ϡ? pAAG pa2GA n2.! N3! 3>a`baO-T M0! # Htd{Ġk[ @R) X# ZHM R?[` k? 2 B0 `b>6> 2 0k 0K55[@Œ P 0S 0 ЍOE = Ѝ Z* XJB0  ?{D? ; K2 k404(; 0h# 0H<#@<Ƞ@ X X+0P QP 0`Ġb ЍOP  Œ  0ŒJ Q0 002 0O-r M0!J# DŠUe [Š"kX LTW T@ ^ 0$:[ 0x:820Ao ЍTL Y= ?Xb h? 2 B1 b>0>2 0h 0H<<Ƞ[ 0S   RP3P#(1R$1 ",!P2PP E!E2D5 ЍOY 0A ЍT PŠQ. ЍO% T! @I?x'?8 H2 h;1;$8 0d# 0D:#: @  @ ^ " 0 0@  t]TP/P / /BR30!#11S041 #<120A#ac/ P/R30!#11SP41#<120A#aK$00 0A#aA4P Ϡ`P03 !0##1RH$1",!020 C  0c0C>b0//~P P03 !0##1RD$1",!020 C cA.c00 //8~p@-K@T0TUoJP& V @DOoUB@T p~T03@d0 D  000V`p@  000ppXX@-@;0SM S^ #  0$", !0 C0c. =Ѝ^ h <$;S 4#6>Ѝ(R03:045S |?S/ | ?S/  s;p@-!0@S. ) T SP\M M P03K:00a `00Cà0cT'R: QP3:PR 0* p\0D?oR20S p@P!PPE%Peà$!P0  Ap@CBCR @pp 0\{z;!0A-ˠ_S  _% \ \ RP0V _R^\RF AGA!@L,lS^ Q03:00!00C0c @C0$aqW` }@~@I? 7\S00 AQ3:,xyy;0S ;0S P /45S 0 ;S l0l !;S /45SP/P @-Q ;0S ;0S ?S/P 3# /R /45S @-45S /;0S ;0S ?S/P 3# /R /45S @-45S /p@- !!:S$&O3S%C>c0&0T @c PC22 Q pQ{pa1^ Qp|  000pPS X  000p0C?oP20SVTPP0@-0!*P M!: %+ %U  C!A Ѝ0@ O Ѝ09P :#:S % Ѝ04>70 -Ϡ M\Ϡ Z Ѝ Ѝ-Ϡ M\Ϡ ЍJ ЍC-M! P D$&F#z o \ @po& W \" Ѝ@U  Go R \B  ЍC0 W 0 0 p@ E%J +ህA!p p0#0 0P# 0S 0AAAЍCPOP 0ЍO-D!j,MF#_Vp `@$_% Y Y  0pOp \83  ,Ѝ@Yt ,ЍO1  0 #V 0 0 `@E%(K$ @0刅ᤊ E `F 0R0O:p0?/000嫰 0 \G` 0 *) r\ Qc0S0QY0 P^ 3#P0 Y`F PP0 #0#* 0+G 0Q0`,ЍO(1,Ѝ R0 #000!*R0p#!`!*iÎ!)`#Z Q p#pQpQ[ ` R0 \3#`   ! # QP!   00 / ɠ@- ʠ,ʠ\ l!Q  QP/> X4>70@-! # Ϡ\Q^ ^0030# P  00  + @-! # Ϡ\QP P03# ^   00   A-$a$1`pP0MS3 U10AT !0S 000' @T 0 0S00 0Ѝ@0!0D1S<000S 0000 xFlĞ 0p@-@P0p R pPQ`00App@D `ا80 0QApp@̧ xElLE0  0#10/ P30 R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P:pP   ! K`}P03#01S412s2sS/1J //@-@P0@0O-0Z  @ SMpPA PaU* F B  zJ  ^'* 0H0C X000300 ZP@T   `d` X`Z P` @T@T 06S @ЍG-0@pR$A0 QPiV'10SP`P\ 00001010i0S l1̦ zPP4 @p PU `@00SaPP# 000S 0⢦0❦PU 0C  pPph0⋦iV0S <0… ,0R0i AxqLAlh?G-P0R@T`塢ڃ0TP$ Zp  !pI0   a!  \2)0L0C\0003R @@GpG \ -0P!1^$23\ *G-0@P@DTpD !1PD*32\ ::P @ P@a0 0S 0S Q 0@A@DpQ$A3 ! V @ 00S 3 #V0`F`F` 02NS @0@PpP 0 0Q@3A! p@-@ AP`DC0 P `R C*\0 `l3DR<* 26p S0pR4 c5 # 502,13p0 p?C-@ MP`p7P Đ%T@ 0Y0   CII5` Ѝ P `!300S   Y0 C@@1`0S0/0 R /@-dap`@PMB L1P5PP3 pP-0S  Q6 p 0: S/6P  8#800@ 0$  0,  0( 0 0ЍI00Ѝ<0T0T TE0 RGxI00tIO00 @L{Dcp@-@P =00CS00 P=pP0 =0 G|b@@-@P 00CS00 @ 0  I0 GbA-@PpS 0rSL wS aS_` I 0 \`0S! e C+S ^R)# `0S``0[S0\S0TS0USP`0 >0 Fd`lp@-@P7 0S=  = P00P! !& 0S 3/PP೼000P @ P C00 `=00aa<d0`` 0p/N:P404 480 VF|H 0P0|_p@-@P 00!R !+P 0C 0 ;0 2Fh|^@-@P 0 0 S @:0 ;0 F|^p@-Q@PPP 100S3 0 VT 4000S8 0"$0 3/0P:06p00P @ P 00< R 800p40P)L9P00:l l0l J0 E  0@000 pG 0 @00 D ]|z8-Ѝ/p@-@P@TS S S G 0 pH0p@j,0p@g0p@m6@000 0 0000/<P 0p/@-G/41S{ O- @fQM  Q 5/p <`?`  +dl+kh+&dlk&@kh+&dlk&D kh+&dlk&H$kh+&dlk&L(kh+&dlk&P,kh+&dlk&jh*T&li)j&+dXi*h(\g'+d)lh*gt&`dp0ex%j*(n.jd+)h`l'n&lx,p eT('lP`X d%xl( `+ẗ|x|FGEPKJ`DIpŐlĀH`ĐŀPt l [`0 `pA/`4嬡pf APpM_ĀmZQ 0pmPUQ 0plPJQ 0plP@ Q 0plP6Q 0plP,Q 0plP"Q 0plPPQ 0plP YQߍ/FOEp,qꬽaQ@-P @41S  P bP0EA-4!@ pPP/1S 0L1l @P!e<PPPUQPMoPP TQp KW Ep_oREpEpp@-@P 0@2@A-@`P] VapPPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V "E0@BE@SSO-P M. Sw$AT`p$a(q ap A`TS XX`D( [ʋ Q `0(qS 0 P@  Ѝ0Co$!?P" (Lr ^z \ `VH$8 S ypVpGp@(VB ( $ AT$$( [ `( A^ \ :0  : @PD@@,A \$!G(1s V(0 WBT0 MB䰟 0 DB (R 0Q0(0$ 1@($AN 0 rPf Qp`$a]@OO\OO-,M0 0 S ! rp2/0, (Q0 Pu @`P@P\%$P 0  CZB 0@PUpWW 0 `PM 0@SP㲀1UJ[K ,Ѝ 0 GqPPu/  $`qPB 0 $ n`P# 0@SP㲀@1  P\ \4 \  ᰠZ"[ 0L `PP  iP 0 /lPp@@,Ѝ$`  0[qP   hP(q@GT 1S(Q0 @-@ ! \ @,bC 0 ,1[C0S@-@0@ LC00,1R@-@1  @09C ,!2C0 0O-`Й0S ]MH pPw᎜@P Uq  @| CP 0  p <* 4ɟ4 00 84  DA@ APXP :V P0 S40R !Q!3^ thȟ ^ ^@4O= P3p D H 0$p jP8ɠ3 LJ<,0( pQPVNP P  0p pt 0} Vp 0Sm A/ 1= *4+ )4p+́* (4) (<' 0<' .4 .<0 4< <0 4< 0#<  <$ 0 4< $( 4< (, 4< 00,#<0 <400 44< <840 4< 8<0#<< < <08 8 8Ġ  4   4| pp $ <  x0$0 (p , ( 4$,0p ,(048 < 4x0080 < |@ <4, 8p | < , <00@)Ġ| )  p' pJ0  | S!tpH (( x 岠*LL,| , S[,CC r A[X3pWTA^P  8/@ PH( PD 1DpN8ɠ0  !NV QU0 aPP$4Q$凙Py 2ŸrR@B  ` `]ߍOPὛAP| 0Ap 0 ppAPAQi@pW/ <*  8004 D?@ ?@ -pX @00@@P@P@P]0a{@@@@ XapH4hO-(P`P10p5fS@(Pp6 R ؑP. ( ,0[ D`D` S`1 005,`5O6jꂡ P ر & J#? ؑ@-@ 13/, (Q0@-@Q Z000 2D@ 0 O-ĶMS `p & 0 Z0 P U E QX X R Y HHYYY  @00 Ѝ P 6&0 蕟 0 m@P 0 10$!12@P- 0@S0 2005V00t500l50 0d50 0\500T500L5000 S S ?00P ip c 20 2 80p 0 0cUP U\3UX# 2Z 00 20120QSE  000 1S 0:pE:`@V*("(R!3w0 .P0 "  .P 1S0S1S q/0 29 20 29 20S 28 2@R/S # *  P{P s R < "4 " 8(P0<S 0%4,<%<00.4$`<.,,4<&,| 4& 80<$0480 < (0480<,0 4480 <*$,00 4*,80 < 40P$0SM(P00>0S >p0P p.P  -PP `V010!! 0`ppp= . .J>O00000 0000-0(P0P 0 xP`0` ``0 e<Qо  (<0b1`7t)@-@`pQPM y.00U( `P% 0S r?(p0 # 2p 00Ѝ W.Ѝp O.Ѝ=>00p 2/A-Q@M .$4,.,80!<004.T"48<08#80CSP!4< Ġ!l 4 ̌8 0<04 80<"04"80< 0*0(S"( SR~  B("(p`p0#$ 0F0VP   < 0   '  P       P  0    V/ 000   0 0   0 0   00   00 0ЍR 0B8#8` `0#0BR0PP      VЍ<0< <0 b; 0(0S"( S8P2\ 2/QA-@6 10CSP* 8 R#8 RZ ,$ 4,,,80 `|0| |0 Y81aP00@ @0@  0F8? p갊''`l 0A1Q=11/C-A MT' }TP# `P  8 0 AT R0 X 0V@T Ѝ0`P 0 00 0 1 01 0/p@-Pp U@ Cp p90@9@@C-!1 0CMM0,40@PP; P10L!,` @咹 PC*0p Ay5p@ p#  p U p _ 0 0 ,4 30CލЍl"0P90 PEs9P@9?00먥 d` |O-h@dƟ` TMQLpP )00 2mU}  n900%5 0 L0 30rTЍ0w 0Sq1S6 (P䁄/  0少0 0!00 BR{?Ⱐ0张:1S ZY0 0eP 0弰ᰐo(0S !,)( L0P0 (崰0U P0尡 1 0C S^*0 00 P U 20 2(0 0~w R0%6*0R0$: pn 0 0008004p@000S$0<0<040 pW 0 00000$0D0HD0,070 0S,`UV 0(P< 0㸱0EJZ㪠* 8#8[* C00C 1! 0C8 !#(!!#Ȉ00 00(0  0RE 1S RK  R[@  q(g 2 O 0 wpH b(PA [( 0 eKIY㩐G* )I Z0 0kP0 +1 S0"1! ! {0!10CS`*8#80C S010{/ⰰ10 b0 5c800\0\ \b0 5D0D Db0 5  Td0@O-(0pM J @a0iP^0P P FP  1X*%8J1Za @%X0 R 0 1S@10CS㣰P* 0K8#8S0C8#80 V!S10C1(0 . Ѝ@ Q! R b0 `(0p. 0  8PM |p P up 0 0R1 S0C1ȁ2"b0 (5Tc Y 0I 1pzP(00(0O QPEUP*0EY#:YQVQPEUPk*X%XPEY Vp崑 (00(0G1!X%Xb0 PE4Y*0 p1BPQ Y Q &PP @ PA.PA(00 (0&0!0!0```@0 `p崑P h ]&PPc 1P0CS㣠 *0J 1P(00  &|0| |b0 4(00(0 &@0@ @b0 4}0}|H|T{d{ {{p@-@PQQp &P 0 0&Q &P 0 0&ppO-P,a V0Fm  1%@P `Vp0ഀ0 0 jpt 10CS0*S0SY P&!P 1!b0 4  H u1 Fp(8V㴠(1 p 0 R 0 1Qp10CS㣰7*0K8#8S C("(  0Z08#80R10C1  & R ]P  0! 0  P% %(0( (b0 3XyhywHwO-Pp@Q$M %00 2T T 500@$Ѝ(  @l @$Ѝ007طا0 0 `Pl  R j8#8Y* P 0Pd1 "0C @cT㴐: 0 bP38#8Y:@I0Y 0*0S0C0y  Ps 0zps 0B8R#80010CS0O*SUP@0 $pP 10CS0*SR 1 M1@0CS0*S#P 0%i +%cT*TPZ@ 20 2$Ѝp5p%pb0 2T  %@5@%@b0 2 $Y 0)Ioᩒ $)`0 @0$ P 0 RF @刔`S< 0S 0 $q,Z@  @@DVC $q Ww 0G 1)$P A`W@DT@:#b0 m23#b0 d2 $s $ $pPHPd P3P#P0b G20@W1@ H$H @01` 1 0@1@`01d$ #P@ Hx 0  R$ #P 0sl2l"lb0 2@Tt 7$T v%400i `  *$ JP\ ,p 0R X $aV@F $a0W# @0F 1{#P; VR  B1 * 崠T0@D1 &!0I*0t`崠1 加1 0` # R#P@D 10CS㣐:0 b0 1  # 9#PwvtttDtTtsDrr r0r 0X0 0UXS 00; Iw0. T:+[) P0K/S  0>0P00: S 3000S0I S 3?00(1(!(C0 0QP PV# 4- 㶼p!20S X  \0 RK [ #P200W p xP 2@om̋ G$  L' m R Q0P:Q0Q:1@-@-@@ $ @7 p@-@P#-`P$ p@誽|6 0@-@T M 000 @呎P 0S  Ѝ0΍5 O-@0lMdP X0Z1 d8T1dp 0( 0 $d060DP 0(d0.0, ,0 d0&00 00 d004 04 d00H 08 d00L 00< d0 0lЍ2-bynd 3expate k@-00\M R0T00P`p @  / 4/@  X P0 0 T0 30 \Ѝ0 000 ,0 .Ё H |dd|d7O- `@<1<M00p '8P@    0巌p' R$X h { / s < 40 0 0 30Ѝf&a  A-dQdP`MD⨌f0S 哌@P PUЍp{ppePU3 ᭋ @@P {Ѝf0S p#*0p 00  \0]p@  Bp ET$ .@- - O-PAPPEY0!44Ÿ\M `T B000 0"3*S*s@? U: Rc:Y"Y)W6 @s w@T0@P00W@PZ&YYt!l1 0 T0 30R\ЍL!L1L H$ 0-@ P00 0.WZ @ ?0 0S0000.@  0 $ 0`- T:YY p p0p l$ 0P-YYW@j} } <`<`__@_@_0O-44MpD`$ $0(0D0H0,000L0P0T0X0\0`0!0 <  S P _@# ㌱CP ^荐     @PF | .Z3 Z0  D 0F  P  iP 00e @@݊P0 f0`00d X (0 0 0 30ЍP{ H`^p$( ( ' Dy 0@- 04M 0P0,00O @T d 0T T H0 0 ,0 304Ѝ0$  x $' x A-$!$1 0HM Q0D00@P ` @~T( 0T  p` mV 0V  \ Z h X0 0 D0 30 HЍ$ K $ F 괉B x X& & Tw C- 0 04MP`0,00Q)`@ *pW:T p 0T :)T H0 0 ,0 304Ѝ$  wv $ Pv 0@-,M P 0 00$00 @6T ` 0T P D0 0 $0 30,Ѝ0$  Iu 4$ u @- 0 0,MPQ0$00` pb@ T 0T x l0 0 $0 30,ЍP P0P 0 +$  4u p# t XXA-@P` A!811!X 0 P 0p0SM   L Ƞ,Ƞ P00  000 0xЍS)!1 0C8##Ȅ00P ` 0  M, P 0 0 0J]O-a`FVPp* @ @`< A@DT@V*H$H@0`@0 @h&@ⲡᶡ  A@DT@N*H$H&H00 0 00 0谁H⨀X(@*X 00("(R@:갡J⪠Z * *Z 0 0@8#8 S: 0 b 0* 0 b 0* 0 b 0*h h0h b 0*L0L LL0 }*rtSSHtSSLS`S$S8STTO-1,M0CPSPᰐ0>*A0@D8@8 08#8T0<*0SM H$H0Dp@`0$5 0005 00 P$ W PP0ES63210/-,+*)('01P0P0P Wy*0V 0@  `PvhU&ht*P 0H$HS0SZ 000pxV'x: P$@0SH$H*1@A(0  0R 1 S0"8!#8!1!V 00C01ő YP0P 0Ӂ p0C00 p@V@u* ⋰ppS V@ HB$HQ񏐹~si501 W00: 0(0"(Si*0Vf W|PU:X0 )01 P0P P P a01P0 P0P WTP   Ƞ,Ƞ` @ h&h@HV$H0SHp$HF*0 S108#808#81,Ѝ   Ƞ,Ƞ   Ƞ,ȠpGx P$'x6 0  0!)2 0  0) 0 b 0 )l l0l  0)`@p[QP`LM O8$MN@MTMLNC-Mp`@P&  PP!  00 000 0` Ƞ,Ƞ0@@!! 0 040000 00R@PЍЍO-M@ p8PPd 01 0 0 0ءR 0ⲡ 0 1`0CS㣠C* 8#8V5 ء &`PG  00 00 00Q㲡!0 )P/ 0 0<0 00! p)1Vp@PЍ 0p!0@PD D0D b 0K(p x8JLJO-dM`0匀pSBH0D @ሐ(804 0 oPUn Xc*1 $0C8 #  #ȅ 0 x0s(0D0HPS a,ZM 0ll)l   $ 0000F 1pP& `V 0`h0&h0CdS:V76543 10/.-,+DHp   P  CdЍ0 0封10CSL*0S00004 080b `V 0(p,0 000CS@1!0 0 0R0 0  00"0VS00 HX㨀*(ሀ1 0 0 \XP0TXP2/0  S  000 !0 00 0 겄DX 010<0qpGWp\*< x'xp0qሀpGx0'x0qqᰁpHX㨀>*0(0,0HpSa (0S  2 0 pP=  : 6aZJ P 겄DX 010<0qpGpWx'x*W 0 08#8S:1 <0C8 #8ሀ 11qpGWp*x'xW 0 08#8W00,0HpS P   dЍ0!S0 B("8 110 p Z"      0D0i  L'L +P 0 0 0X 4@ 00 D G#(UHX㨀A*8#8V *("( B``F 0,01`01(p2O`"      qpGWp*x'xp10<01qpGWpi*x'xp10<01b 0&"P 2 0(7p00S >00=l!l1l b 0%P!P1P b 0x%'x,!,1, b 0%!1 b 0%p00b 0$ % 0!V 0 q$ 0% 0 b 0% 0 b 0%uXHPAdA@@p@@@p@@H@\@,@AtA??d??O- P`@Pd 0S: 2 Bp0* 봐pY) Q0? S   PPJ 1P0CS㣀#*8#80C 0 P!0 0RY 00p10CSP8*8#8W 0 b0 '%0 R p崐 POU Gp崐 0R P 00<0< <b0 $ '==<<O-PpQ`,M 00 VV 06J  (0`FV񏐒fb0FS&00@,Ѝ(0VQ ,0`1V 0 `1 0`1 Iⴐ0 1 C@P a`FV`:'  0b  $ 0  a`FV`:h&h 0b`  s$1ᰑ0I`1Y婐: 0 b c$1,0`1S  1`  @P 10CS0:5%b0 9$ @崢 @P 0 00`(0r00@(0帡= ` 2@ ^ 00,Ѝ0SQ 0SN 0@TI @崢 0tp@: 0S "0!0 " @P) VL !VI V(0&YaVn ` V% y@P 10CS`*0F*V @崢  긡0(0 @崢 x @  @ ⴢh @`F*ᴢ a(010C S*ᣐ=* 8#8ZV? ` V '@PI *a @`FV`: 0 bi# @괒 @,  1 @P 0VSTa V0F  2 " b0 E#괢 @,` 1r @Py Y10C S㣐*"* 8#8Z弑Y0I ```1崠አ!0 @ 1H @PM 1 ! b0 #0C 0* ; 0F*50!1 `0崠C 1 @P# 10CS`:p0p pb0 "X0X Xb0 "0;D;9:$6465(5\4Ll484(H4p@-@`PP {0 00(0`00Q(0pO-@`M, 弡 CpPN 1p0C0XS%X:*U2 P*U! @H$H @ 0E8P X 0&0!01@0 @ Z @JH$H o0@$ 0b J"0p 0Ѝ 2 @ TQ^10CSP*8#8TQ0 0@p P P ἐw P I0㼑 Z08 #80CR 6뼑 Z 0I 1pP Q0YPEU0P:@3@#@b0 ! " @QP@ Pt 10CS@v*0D@ 0% PPb 0㼑 Z0[ 뼑0 Z, P0I 1WpP @YT @D1 H$H @U0PE1;1!b0 !1@DH$HU @PE!' @10  %pPM 10CS@:d1d!db0 h!3 5 @# . 1 ! b0 O!0PK{0 1 0p1pP01o P0  bp0Y!08#80 !x34H200L/H\/..L.H\.R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P , !@ (! 0"TO-@2,M0\00$0(P 00$` 0p@ @` pP 0 0!$1` !0`!%g#"," !00 &Z0e!e!   0 t10\0 0` pP 0 1 cIC$A$ 00#l! !00 %b !b  A@YIH$*E$00@0000000 00 0 0 00 000 000 00,ЍC-@PP M' $q`?pW($7 ) 0(0 `,!6`p` b8"#4b4# 0! V@h   Ѝ 08R(@R )p@ b 8  )p8 b 0A-1?`@Pp @f(X( P 0刁0 0$0@pG0($0p ?W6@`G?`@`` 0$ <@P U 0$ ?pW ( 0$ q0 0$ ?W@`G?`@`(`@   0$ <@P U 0$ `R @-/ L@-@P 0  @ (; 0"R @-/ /@-@P 4@ m P 0$$ O-B@6\M0^~?@0P0D00H 0 0p00$00000000(0 0,0000(040,0800<040P0H`8L 0 @(00 @,0 0P$0 `0Pp`p000 D00 h$7$)'90#%ɠ%'nj) "ˠČ 0#ˠČ<0 "(0   (&Ϡ' .,80  * $ )'& )80冼0姳 . 0<0 0 0 $0 ,  04 +  !@0 S(00,0403`0~?00L`Hp@P@`       @0 !1P"0?0#`%o#,.0#.,',YW) " g Y i WP&8P[T "PP< !Q` PPqQP0yQ@^vp'Q禉0Q4PQႆ^P%"#-&S%a` " P08{t`p' 0 0 <0#0.0` `!4`0( PP0, !NP/*! B@$*n /!!bp`&,#@$`& '@.p p " @.$@0`@`0P$ PY0p(,[ P@`@@0@ 0 00 0 0 0000 000 0000 00 00 0$0(0$ 0(0,000,0008 400 40<0 08 <0\ЍLp@-@@DQPUP`  0pRPQp bgo Qb0P0H @ p@<R Q bM2p F@0A-1`@Pp fPX; @0D 0 #@0D  H00H0L00L0pGPpP3WR`G```@0D ;  SP@0D *H0L 0 H0L UpW PF@0D q0 #@0D H0L 0 H0L W`G``P` )@0D ;  SP@0D *H0L 0 H0L U`R @-|/G-@PM 6 PH8I `p `@ U Ѝ@-@P 4@  P 0$$R @-D/mG-@PM  PH( `p `@ U kЍ0 ` a!, a c,/0@-<PM0AP@;P񏐽mdm<840PLHD@<84|xtplh|xtp<84JIzP;DPnE@5Py|{xsrqponmlkjih{xizQPedMl]\[ZYXWVUTSRQPONMLKJIHGFEm[6Pv  6Py 0P9@0Ġ 0P%0H "zp Hߍ?CP 0P 0!@ 0\ߍ0= @2S, DP( 00  j 0Ϡ@P000H Ayp h0@ P000H Ayp D; ? 0 0!@0H yp HP ߍ 0d 0 F0y@0Ġ 0.P`@0ĠSH@0Ġ 0d 0a 0^ 0[ 0 0 0 0O 0L 0I 0F 0C E0 D0 C0H^P* EHXP$ ? 0+ G04@0Ġ 0 0y 0v 0s 0p 0m +0j *0g )0d (0a &0 %0[`Rp a@ U 0O 0P@0Ġ8@0Ġb @0Ġ@0Ġ B0- 00P@ P0H Ax0pH0 <0 ,0p@0ĠX@0Ġ Դip hT,8,O-P 1` ȁ1!004 4PU 08  R88P@PX`0 A@ r0 801248 Q!:0 S 808PrP84pP 8 ` 0s`P 80008PrrP8l00`g P 80 O-ɟ M@pD,\($ 0 PU 0H"4S3S1`90U 4000Hh00w P.00e d0R 0h@00S d0P01 0CX 0 ?01Ho000 pf0 pS000S0!Q0:X Y 0c/d0P0c/K0  00S 0 Yp 0 SRPU 00$ R 00)"00'p7 0 2 30ߍH2SL708 R4003 4P0P\ R400P4`400刀Ko@ 0  sp 0`U:` 86(0j_Vࠓࠃ6048 X00Sr  0\ Y``VP `PP$XY0”2  \8Q(( Q &P`00S 0 SRPU @00$0S00t8Qr 4Zx ` Z``q XPF 0SU 0 RP ZaY0MX  R+c/w0 0( Y2 0 SRd@T 00$0S ,0S  ![$0(0S (0@TP $  P 0 SR@T 00$0S5?00 ZY0 0c/d0,0 p 8Q 0 SRPU 00$0S 00c/dp x@ 7X P2 `0 R(SYPR`WY`P2 08@04ptRP?|pP0 S (0( PC_oXRPU``  0S0Scp\40 40 8 \R8 \P0` @ v` 0 SR@T` h300[@ @ hM`m(0P`2 ` 8@P@,@ bY$0Sm00B 0X0 0 SRPU 00$0S/@ @ D  t l ` A-`PpX@M@`@p000,0 0(000i0@pЍ @- A0@ @ €1p@-P@Q 0P ! "0 2pp@gp@-@P` VP(p0-P@  P 0S RP0/P*0    PP0/0/R00[ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/@-4!41 0MQ020' 0S0. /!PR*/ "RR /@ 1@D0Q R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ ǯD p D /O-?o2P00#R00,MSPP '[ 0#!    c 0pT UW `0E"U`@ (UP )  ;/P ;/PeW0 0P``V0d   F BR R  L B@ER !R9 0T0TH S[:P 0C 0 0 0Pp0pSpU0@ᕨ(T **p@Pc`Z* p  Wp ;/P T T  0 X0 W p0p0W:,Ѝ  `;/ 0P 0D  P@V. ;/PW W  00R0 0 R0T 0e:W  000@D`V 0WW   S W 0 0 00   R0 0 S*T . PW  RW 0 P  WF  P  B B@ER !R AJ;/P  ;/PO `0QP0  0;/P  ;/P0F $0;/P ;/Pڅ00DP 0;/P d;/P ;/PPWAD S  ;/P`  R0 PP 0 C 0?YP 0 4 "! R  B B@ER !R~ A"! Rt 00SQ;/P<P ;/P5;/P~ $;/P$`v ;/Pa ;/P Y ;/P0 0P $;/P`X 0 R0^P@0@ @m0 f(0( (l0 ]H \t-0 M0 ЍR Q0P:Q0Q:n@-fC- 4PS@ M  $3/`t  0  QP` l4P4S  $3/000 Ѝ700A- 4dpV:@T@T 0P0S  00 S  0|j@P0`0dp@ B ! A-`M p5@P0: StXjPP ˅P@ P 0 E tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0RA 0 0SL@-  00AS 0 kO-4MS{@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0    Ѝ P@ $ 0  QP 1uk$R P0)00@000dS0  pq0Vp 0  $6/Ѝ 0000O000Q 0A00/0@-S@  R   0 j0S{jp@-@PT @T 0 `pp@T匙P`p  0S S/P/$(0#   @// / ////@-P0S`@M:Q !S@Ѝ0 0p P G @ЍbT 0 @00O-PP X 0S & % 0S" p@p" a,0T T 1 ! 3/PS00CS@D0 T,0@pVP ?0T` BB \|  i V`!  0 0C00`@000CS0 0T` @pQQ    D R ! ,03/`PIʼ0@00 "R( Y `1`! 00PVQgRJ ,03/`PY M 00CS@D0 T@0Tp   P @0S*V*  000P@DS*`A 0`V:Th0P 00``F0 ``i  0Y0C00 00oP  p 00C000Z` f 000YP sd0d dG0 * XH0H HH0 F00_B 00[H$}|p@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 V0 |0p@-@P0 O0 PPp 0P0, @i Pip R0  R/ S/p@-Q@PP7 100S 0  R 0   p0 0c0&   0R0|0 P @P Ah0 0 $0 ,0, ,<0 c p D, z,@-8aPP`p@M+ W3 T; p   ᲘP0:*C/o" R  S L 0( 0R Ѝ ; 0 Ѝ;0t0t t0  WX0X X0  T<0< <0 y@Dx,xC-d#d3 `S0lM@PP0d00B 0 C 00  # 3 0 d0 30lЍ }0p0S, `De0P " V000`S0p eP0 @"@2@ |0 0S"$`@ zPm 1 0FB0/Q/U-,+*)K'&%$#"! :5 +`00  00 0SP pt 0U 00 ` `` `h h0h 0 + eLPGt `  Dw8\Xupp@-@0MPg00TahV( h0T1S Og0T1Sh0`h 00UTX!\!R Ѝp@|g\!h00Ѝp@sg00UX\! X\!0 000S/ xp@-0 00PUp@0Qg00TQShU0` TQUP EgpX1P0X1Bh0T0`X1 xh0h 000S/@-@0*g0X10CSX1 @!gT1O~g0@g x0 000S/g x0 000S/p@-P@0gU0 \AQ\ X10CSX1 p@f` h0T1OJg0p@fd x-X X0 04M 0,008 00 0 ,0 304Ѝ[  p@-@QP  p@$嘖 0 90 # t,@DqO-M8@: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !0#00  9P0ЍL00<0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ)00@-@w@w0 00/\ 8-$0$0 0M 0lЍ8 -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ؽ x@-@p@-0@ ,phpPY0Ppp\//////Xn //1O-0pPW`,M ~ n1 0 0(05/,Ѝ9w@PK 0S PPP S0S3*0! 00S S( #S1 0 0S  0S S * Rp C 0QW001 00 S0000t0t t0 00X0X X0 &v@<8t\KЭ4K//O-TT͟ M00P0Q0S, X  Z9 = 0 00< 00$0 0%SS  PS 0p  0GZSZXWUTSRQPMJ5~}|?>=<;:9876k43210/.-,+I)('&%&#"s ZU  {KrW  ` P0,p` ,@     P  *  Q [: R R0 Z ˄S0CV Z0Ԅ0˄PU*a 0 `CV`F[ 0 [04`V*U 00Gp! 00G S[    0 00S- r0 0 R0 bp<p*WQ 00G S4p00G S-p)p&P @T  `v  D0P 0CV  P b0` PBvp xp0 $   00sk 0SP00`bP`@ ``0S  0 S 00CN  P ( ) [R* RP  BR BJ0 [4 R*DR s 0 0 000plWp p`  P0`,@, p倐p@ 0 00 0p 0SP00}`P0@ 00 ,  q QP`v  000 0  +0p0VpS0pS 00M5 00< 0 0@ 0> 0pS+ @00"".!0d00T0`@V0 S B PF0@$5$ 0' x< 0 p0z R0@ % % :T50%1L` R0T%|:P dV00/d* 0  D@D0 \ 000  0qY@.10d0Q00 S0 000D0@L0 [  04   BR B  [4 R* R [*  [* 0Zp˅ 00W c x 000 0?0 [0K0"2 0 0 30Ѝ0 0 /  F 0 ,-  0P C2 000  @ 0 0 0 0<@: (0B( +0 @("(  0F @0(0"( A@ P0 @("(0 00 0l0 0  0 0  00p0T0 0 [ݗ뼺 JpJXCxL x?(>Hg=xA-@P@ `t0pP@PU J0PES 8/`uX@pW$0$ $:0 |П<ܟ 0SS S 0R / 0R0@o/ @-OoO-,,@ CM Mp4čP`u0@ n 0 @0 44 30,Cލ Ѝ 00 00p0 `0pFP $Xt 0h p|L+  X  0X/2  0pUG-0pS+ S'QU$ X!`@0`S  0P 0#S@0S 0S0S0S%  P V Q@0 R!R  "R0 R R \O- BMM!dQčHd2 hԀ&h Pp 0`V' 0  TP@P UTT0 ZP/PH <0 0 4 30BލЍꓖP | O-LL AM @ MTč4 0Y/:0`x0(SP05 R%S3 #ttx0'x 0@T {TxT0  P pW t   0SPP D0 0 4 30Aލ Ѝ x (R9$  O-M Mϟt p / 0  @T 1S 6 S`1  0 ?t@X@0 ~0 p t\ @0H0 ^0S3 S90PpP@u` R HP' p 0 ] 0MP R!R㇓ 2P PpU`@P0ST `u岀0S`V@ 9 S 0S< d - L - @ T p P  Tc0 <0040v?D0\@4 0` S1S < 300S S00X01< 021帑Y[0H0tSp080400SAT <0CP D0PpPPw 0;O8@  ἕP R@P0P KP w 4 <0 @4 D 0 T<0D \@0S a H0SQ +<002p0^ S00H00SS *pt`P|@600P @9/P"8`0 0诂PF 0  Ps % |+: 0 6 30hݍ ЍpW 4@P{D0Ppw} !D0Pp0 e  0 : X0T 6D0pd4000S70X08<0PS\0S  P@U  0`F0P?$P 0,0 蘰 P(00E0, 7P [0.(  QO `1  0 T90 X0L@0 Y  @00@01$0 0 0 SO@0b0!0\p?A9c!P <0S 8@60P U0T(0@' x  ,@0P@01 Q!  (8 0 {P0`1  0 70TX0 @00 00x  1 01 0@0`1  0 (70X0 @0r0 M 00 X6PW0&0< p XxLP 00 @q @1W㲐@D0 `TPv? 0WP G  0‹2 0U 000W    ‹0v@1粐0 0 p5H@X0 0@0! =P0D p^@\0P )T0$0@$ x v (0d00@0T0$0@L$L x0 AQR Y `1S9 0   0@ H0I @@`Tiʋ |@ A`!!! Q=   30 @| X0Q O 0H RC A " aV *Pv|@0p t@p6/P񏐦0+S .0CS@0PPPU a0 2@X0 20`!02 @HXwi S0\01S< 3`0`00S S8P1< `0 妁P00 `[P101@PD  PhP p ` 0P\`0P 0D TP B("(R D0DI PO0d0LPJ0@E@ qd06SF[D jꬦ  X\ tC,L48̏XLtx  \|܇d0hxT̄Ԅ0ă 0P6pSZ06H`("( DP TP B("(R D0D P0d0@0P R0 0@$!$ vVW0 0R 0`1 d 0 L1t0XP0 /&0R  RR0!0@! uv 0 P 0 1 X@ 0 &0 R  d H0S]=00^YR0T"0t"t Gv4& G("( 0R00 P T B("(R D  R,#!Pʌ_ 0 ]0@ 0往P`P y1011S1?00 h0 30 X0,<0d0+d000 3@X@0" &0 R  l $0 4 X0  00g0d0@0P Q0X$0@$ u0d0  `0 ^0+S .0CSB@0P Q0$0@% uW| 0|p0 (0d0qP0 @ @r05 @XquvQ0%0% duP0 @ `Q0&0& Nu}/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@P$Ѝ0 #P 0"c110$Ѝ000$Ѝ00@-$MP@~P$Ѝ0 ~P 0"c110$Ѝ000$Ѝ0M0- 2a@@0Ѝ/M0-  0/@A#b@0 Ѝ/MbO-@ßBM M 1Pd$č$p000 S00- 0p  P@QP0| T0T PN0P0A !< S 0 sT40 ; P0 0000 ; PPd P0. ^M x`10$430OBލ ЍS  JM 0S0Q4 Q. Q( 5M  z  t  , "44 .$$p8(#8"(s MMMԌ $@ @M($  C-LLP AMM č@`p04" R3 r 0@` r P,8ĝ0  0 0 4 30!AލЍRO PP 0@ .R` @@H [rD D rLꔎ됉 43 \J~\~O-嬡 AMM  čR}pPLpPG `SsPPB t @+0c4P7 0S4 `  0S+ 00@ p'P00@S 0S0S 00@ @K @ O @o kD ,0 0 4 30AލЍ  }5 O-ß CMM`,č@pPX\@ L0S  .S@0SV:T d10S#0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $K000$0D DR @@ 0S+ .S& 0Pʟ0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@1( P/d!  0Sx0h 0@$0000\0@P@Tk0!0$  00$0s}0S 0S =KV0 gO0  ,K8 @ O-p0ß\M P@`'T V  0 #à  #4 : 44U@ 0X 0 P\ЍH20X (  0 pVX0 0 0 F3JP0x 'xJJ0SUPPZ   B RX00 0 BJP` JJJ `PFJ0?T0'0 `F 0S0   J J J0 J0S P x0,P0T0PEU0 S\0\ \0 9vP<0\ЍPH0?T08 HxwuuG-@0`P p1@D T@?)cJ0W [J0`  PJ  @`DKJ "440(",40U00S Le@a4 404 00 `tt\LtdtG-@P` p崒Ḃ. F0S@`@0WV!< J@`J ,@FT00W0S ?T0*G I0U0`FV0S `T T0T P 0< <0< 80 `s s s= rrA(0`( "4`43Z1S//O-0P䡐 M0S5 @@d@t@`p S S0  |P&  vP0 pPI  iP00^ 0  SR 0  SRS ЍPd1 00d1 HRoP0 Eo  1P  *P060 P0 &o P   P090\ o000<oi0:0  P  P090090| P010r  P020h  0P0Z^ d@5 ?R? # 9L 0 2M$ 0P0ZC @ ?R? # L 0 (32 P+ @ P010  }P010r s$sCrqq(rBq8Bq4qp8q,q\ADAp$Hp$$ooo@-@HMyxy% |Ô0`p 8   0  xa 0yxHЍЀ|p@-AMT 6y 0P0) ``#00 0by 0 0Ѝp@@@- 0 Q0|MU0t00& y 0p`0# @0 K @ 80 0 t0 30|ЍPPЉv lu <A-@Pw 1!01n0SPpuOPp wp0Sp@-Q@U x3s|p JH01P DH01000prwcxVxkwP //DLP //kA-`p@0.V0PVSQ@ PQP  c _0 0O-P*: 0MM050:@00QG0RT 0 E01)0`,4 05@ d!A  d!. 0`11110FPx  J0@ʏy p d10 d1~ UP  `@ J`0D@SH _H S`\  S S00 Q`@0S SP C0SQ0 0CQS000008mP PP@0 0+ 0.P 1#S;S 0x(S 0l(Sw 0`(S: 0T(S 0H(S <8R0sS2 S S(  8R2 S S0S0 S S SS@@ ` `0I_AOP`@Q"0A'A+S? d7R2 S S00 R00S @0 S S00 0S S 50  00H00@06w 0! 0KVPj< Rf0P 0< 0R@p0@PP0d!S 0 0 2d1 Au0 |351 |5wpA τ0`0S V `0`SH@DH` .S`0SV Pp.`FV00W0S 0 0P $ )0$00p4 0 5 30܍Ѝ4 RB T T Z|44P00$0l40p000Pp(`, T T@ TT  ;T RO@T $0 ` ;T 0000@@T P 0 0P  @0劁 $h1P @@T;T P3P0 0000@@T;T   P @ Zl@(`,0p4Pt 2R2 S S0Si0 S S SS@@_  ``H _ATP@`0D`SH  \R?* S S00 Q`0S00`069OqP.(P `H1=C` l(DQ XaD@`jQ<0 SQP@* nP  @0劁h1P0- qA`>`Pa 02 Dꒆ0s  s \J ji\" domasearnamesortoptionhinGer4g/le`el listchaata!1 p@-P@hlHM QP  T 000HЍpp Qx#r cuV p 0xP00uPT $000HЍp\|A-p RP@`0P  R P  @R0P\ R 0  0 O-0PQM 0 x4x0j0P0 p;B0P0  0@P($    4`Pz cgPY 0& SQ 0 - 0 !#Y㌰pG 0P ` `P @gP0`S Y 0@000; R# pGP @0Z* @ $0   Q A PT pG #Y [嵠 0 Dq00pQߍ @ $0P PEQ*$ 0 0P  P哠Y j 0p S : PC U 0 :` PE0IⴰR 80 ` VPE$` R PE`# T- (  0 PE a T ` Z 0 0  0  P/ 0 0 Cw 0 Cp 0 j( Z@-<0< 0@P @+ 0 0i,a l @-$0$ 0@P00` 00/ @-@P @h+00i T@-@Pӟ00p@-@PP  P  0 p 0  |0 R7Xp@-@PPM. 0 ` 000FiPP0 %P d3Pᑟ  0 Ѝp቟Ѝp  0 Ѝp( (0( $0$  l 6W@-A`P@ MK !1 |Q0 Pp 0 RpGST `Kp? Ѝ4A@eP! 0eP 0S@ R eP@  0 `D Ѝ  0 D Ѝ|0| |0 dd d 0 `D^ Dt ;0W9VVt9V(V$0VV 9lV0A-0PU" 0U"0PUP!q@@``FjAP $bAP 0!E`1$(`P 02~Pܾ'' O-Ff@0`S M, 0 4 & $0( VFP@RB 1ؖqY\0i(1<0 BRS %+38<  50(< 䅟 1 c0Aş0 p8'(p4 < P 0(0 P| t hup40Sf0S L 4 0SlX6S ,% 4 0Sup00S S504 RS 4 ,00,000S4ğ0 ( 0XA3*0210S P10q S^P40( D40 0Sp (4041%40(8(JiP0440^30( p ЍqR 0Q*# 04|3p040(P8p!@(%01Rw4#30<!^ ^ ćrp S:p 0("< !0(0% P^4)|20(  l20(<  X20(<  D20(< 020(< 20(0 208(  0聟0(0( 10( 긁(0(10(0 R 00! 0t1t00`10]Jp (4p Ѝ8p N3p 0o^4nqp2  Z 00K B[ ؽtp  LhD,lSĻdP@,`@L8 ظxdH$ D$ONP pG P>P 0`0,L@-@00 R \\  $0!0D0 0@ ($ Tꀴ,@-@PL  0S  T0S@{?y?@v?سP/0-` 00 0Q,000 P0($0 \p@-@P0`H P 0(S  1T  0 $000`pԲp@-`0P<@P P<P 00p.I A- 0@S  P t00  ( $ bPP$ 001P 0P$l 1$   @ P p0@ $ P  1  ],P$@@L `  10<0S1 0^O  }σ P +>  PH1H0?:Q@ Q$10 p?  960@`@0O-hN T<,D0Įx 80X\DC><>>@-@P00Q  P    $00<0 0@ ($ <ܤp@-l@@`VpPPp"0U1pPE1PSp ( 0$ 0p蘤QA-pA@PT`QV089@P  0 p"PP``p`@h<A-p`@9PP T  0 000P   jg <@<@-@J@0/ 00(/آ000/Ģ004/ᰢ00/ᜢ00/ 00(/t000/`008/L008/8A-``PU 0AP ppR0AP;404 0 ,(0  8::/-< <0  M00( $ A= Ѝ`` :@-@P 0`00@0 50 l8:@-@Q "00 2   0 O-ts`Pp@M 0pF T 0S000 0  0 0$ -0ᡟPP 0 2* "V &= " 2? 0  0 qp  Z Z 000@ϣ i@PЍ <R 2"00@ảX 2: 2 (jP0 0Z 2< 210 010010 010 0|100t100l100P 0 R00   0{T 0 2 13/pTb0-00PP 02 2tL00I@VE@B0S{Z} 2: 2d hPv 2 @0 28001,00= 8<,C-@`pQP M 000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH P (0$( p& 2P ;00 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p  ЍR @-@`pQP M 00U,0`V( 2S * 2 P13/PPF `P 0 p 2P 00 Ѝ _ ЍM00PO-1PSM0:00 X1*q`I`[ Ȕp@ p W 0 P tZ 2< 2ЍЍ7P O-MXr=*`00A̱P叔pP W [K D7@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 ) Pu 0SЍЍC-"1`S M2:rWB R"*T$* RU  R00U00SR Q0  PpX U"B Ѝ 2< 2 ЍC7P"! ЍG-pZ RbM'*Q* U@0U @ RD0  P X U 2< 2Ѝ@EЍЍG-`഑p 0@M PP IPm!X%( 0!|!0 0CS @a%XàD 8#8S0C! 0 R 0 1P@10CS㣐7* 8#8 0 BR ("(R B("(  0V08#80R!2 B0C!2pl0l l0 T0T T0 < <0< b 0@-TT--00-|0-p@- @UP ` qPP  pPp@-P`@Q 00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M m00 Vu 2+ RI 13/p)  0! 2$  00 3 p`0 9/P 0 9/P  e0P 4Ѝp$  0iqp 0 婒P 2: 24Ѝ?p`(0 0,9/P 0 8000S   "4<Ġ"< ̌Q0 Z "Q Ct۞pp@0@0O00t" " O- P `0@P H1嫲p0q1 Y JU08 10000N`ⴜAO-40@S`p M0S0040000 PD 0$B1;0C10 X0 M ^ Q @ Q 0 PX!B! 0SR|   R 0S  "  0!2#$ S C$ U @ UX SRRS5X%XfUa 0 ẜPY 000@@℠0ᄐ000ಀXX0HPIᲀ0@ ЍX D $ U D T RP1 PD D00CD0 0 10CRN Š B QP" 8#8 0X%XP!@ 0C 0$ 10C0S  0"fUPW Ѝ1 Ua00!1  0 \@0B YPUڸ1 0S 0PŠ!D PD 8#8\1 PU PHDŠAD(1 Ĺ<O-@PU`p 0M1^000Xg*0Q P @PU \000U00SP ^ϛ PЍ`0SP0@ 00S"@P 0S00 000Sb 0 P00080080ЍOQ 0008(8840PЍ0@0 00^00` 0500C8#800 0S<:00C8#8000 0PP 0 X0:0 H0ಀ0 0 ` `x x0x 0 70q X X0X 0 0f< <0< 0 0\ ꌵ`|8p 0A-% !@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!A4pP 0  < 0@pxV0O- `ƟtMV@ `P՚0P(0t 0 ͚ P0 l (h0&h 000 00p0 RFH@ P$P  0괐T ` @H$H F F 00D00@`P  Rڴ R  F@D 凕0@IHP$H A LH $ (`(00P`@@H$HP< 0,0040X0$0800CS@H$H@0S,<0@0@8#88 @QpT0@:80@@@00, 0<0P,0 \j 40 S)i 48,0400<0 \  )PfP0@0Q0 00 R P ` 000@H$HPE08#80 ᳐Y;00S pB C TpP\X0S$0Q0 00 R 0P 0[ 0 $0I 00040少S,08400<0 P6PX40S 480,0`00 0 0 0P)d0S 0% `0[$0 h0`S,0 40i B("(0Y @!: 0I00( pഐ0000 000tЍ( 0\ \0\ 0TL 0@ @0@ X 0 P S$t\ O- @\T @0`S0P p@D%P B/  .P( [  8#8R40  ͺ 0(10S0 1$10$10 0S0P 0 P0S 0P  00S 1$10$1[00O-MYP@ 0 00X00 ``FV(:S 1 !* `p0 pGx'x0H0q0pF0F000 B 00p0@000 ``FVB*hY&hK V 1 !0p pGx'xIJ0`h&h08#8አG0Zp01`*0ಠ0`0p00_PP Y```0S0`0F2"0y 02"0 hY0&h0``FVs*hX&h\ ttt2 00 00000``FVQ*hX&hC X 1 !8#8X0C8#8 Hp pGx'xҹ`0`h&h8#8ቐG0Yp01` *0ಐ0X0p0`0 00PP @ 00S.0`0FBЍЍ0 200 0 (0 0 0 0e  00 0k 0`t0t tb0 D    d $Ĩ|Pl,$@G-p`P@0R"  0S00 0ᛗU@ {T; P0X BPR RQ00S0Ӳ00ô00A0 0!S CY01 *8#8  0000EUU800C80h0剐CY01*P00< <0<  00x 0 S ಐd O- @ T @P@D(0H$HS(-W D0PPI$ P! @T @(0@DH$HT `pV T`  0 P``p@-P@ 0^\ ^ P0QՖ Pp\ p pG-@` 0PS 0S  0Qᴖ@PS"  00S ᲀ\: 0 BS P> 0 \ᘖP   00(!S$! 10$1P0 ᄖP @p0弐ᲀ 0%p 0 S 10 B\x ἐc'xP  $1 0$1(!00O- @T @0`0CS0P@D p M!P ?, +P' 0 0  dP 8#8R0 ÷ Ѝ0 0S0P 0 0Pj000@- M@ P p10 Ѝ0O-@PM 0 0P`Hph  PT P0SZD0Z0 0 @ @ 0 pWU@0  Ƞ ,Ƞ pG W0L*0@p 0@000S p0C8p#8W㲀Ḱ0>*0p00ᴀcPP D0ZPPЍ0 P ၕP 0  0 0  00 pl l0l h 0T T0T 0L 0ܞ4f |}TdG-Ÿw?`0 (MR$@p~2S:0JS "P P崀2S :p 8  P ZP崀9 Zp1!pp BR>:0CS㣠X* 8#8X*:1!0C8 !# 刀#(ℶ 20  2E !1 0 $0 308(Ѝ( 8#80C 00C_0 p嬥P202 p 000   ` 0p,0, ,b0 kL  DA-@pPQ`M 00 2   Q `:1Q0" B1"000 VI VFEXBAF?0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " Ѝu00Ѝ0PU Q:(0 $P0PU`P'P    )P 21 s)@--M0  @ Xh hP 0PSP000S 3/ XkZZ 8 80 $0Q/ $0S/ᨫ , p<<<0 0R/$ 0S/X xA-@T 0SBp`/XP0P@Q0@ @@OP 0A/P Cț&O-@$M`0X*T ^5pܴ4$$0Rab    rXpVsBP b0@SFSC$8HXhx 4[/3 3$$ 3$ $ 3  3$$ 3$ 3($ 3$,$7 `3$/d `O$Ѝ $  ( ,  C # PU! HPp "P O@P . ` RYPxB `  p  BR 哅pPG Q]($R0 U tWS UX,$R$ ^Bp4 IBp0 W$RD $pR $R !N&@ $R $Bp P$R& U Q R  T$N&@ @ $-  ` &@ T `   p Up$R UMHBp -DBp P  ^:Bp U?@ PzA^(|&Ȕ&4-p&pț&&X&4Fm#O-@`MpPVR)뤳3#@ @B1p#x3B RP!GP P( Bf@(hPF  H@ P<`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X @Lr` `Z`r`T tWPP   5`Pd 0)ȱ0V!Xq``pWpP @ r% B R888888 0S ᅩU X V0S X  R 7/ P  R ,$ c)  $ Z)  P}0S PqX 7J(D%&4-Ȕ&7\lq$\#O-PyM`UP(0p I 00 00 2p8 PEU( 0Ra S 00 0 qvPePRP&GPʸCf0@S,44<44L444T4\444dH0@ S4444 44$aP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0Sp 0pSppV0!V PE4V&  P Q^6P/[  0001H0SV0Sppp C C0S S/R <Vp0SDUa(0S0S 0 0 Vp !p 0: S UH/[0%p V0: S0( 0 000JPU   ᭥0P0 $0P 0)0P @/P050CS"<$ `( 5  1 `00坦PP!0S Xrp0Sr 00 $  B R0\ L` V `,Q& /0 Խ P@0`0  P0` J/R  S/R/   C  R: x ` * 3 0S S/R$ 0 SR& U0sX/ HL!R\0X\!R\  X00: S 傧h C C `U0: S P1: S ,T : S!  Sn  Sf @ S_ S L0S !APL,0SK JF0(尥 0Z k Z80 S80p1p!ppQ xUP!P1: S G00Z0S 80 0CS!800 K?PR X0|VT , 0S !A0S !dA9G(&Ȕ&d%/l%8#AqWtom&1 6DY ?dO-@PbST%@&0p8464f@(F1BP60` V B0S0 o `SP 9C4P0805H`40BP0%.(0@BP7nP0X T5T%H`aSP8P H04 0, %43/00P08004 nB4a 0V0!BP (BP 0 00000 D@0D 0 DP0; S @,0(D 2#!H8 01/,dP0`$TT2`` `0vHs0 CS 01#S+BP0 0( ,S* B"!0 0 B8PH0U 03/p0SDfH0803/p(^P`؂G0 `0d P 0 S * X  0 $03/0  0-Q3  R H(tC0  0 -1/ (P0 0 0 0 `0d 0 `0d P0$ ,!:B 0,ؠܐPYZ0     00h0 l 0 h0l   000 RB0 0013/t S~A S>AXP\`0O ( !(0, PU`00 XP\`> ;F(IȔ& 'Xp%'a'#''! !d'@$O-M MpQ4%$B$$H$ .p 0 Q 0  s0(0G@-P񟗙4T`t(@0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S $lPU RnR oR0P<0,׷`P   P8l`P,÷PPPPYt pAH9ER8S;T5PNeP<a4 1S}H @0R. PV`@0S0H0S 0  EP P 4R㓥' FM DP3mY`, 0| ,0Sl 8 RS P0SPeP4PD0S $00$C`İPE@Dြ0p/SP/᮵Pp0 S: p  oePPU(e'Ȕ&jA-`P@M$L D 4 0+ MP  L MP  L MP  L MP  LPlڪh3P0`3P P$PD3( 0VP+( PP3( JP7( DP;( >P?P ( P6P( 0P NP8$@Ѝ(P ("P8T"d(0S (P(0S ( P(0S (P(0S (Pq0S KP!0S0S 3op XM`PPa D1R`ᅻPU 0E /R .P(崗PU  00,0/00!\00CS,<--D-oP0$0u00S p gBq0s00qq=>@|CGP \b@@L P P P 0@0 00 @L{L0@0 00 0 QPL|ED0S hx {HPT/:(̔&Ȕ&DQJQPQBt @ZQht@eQt@pQ&Q4-#{QfNgtQ@-FF:O-M pFt@0o0C?o`DT20<$<4@@@ p$4 4 00S ST [@ Y`> Z``: .bRPGPP! H@ P,A@@@@@@@8A@$A`hP dP fPvP$@``j1 00T 00; R4 : ܬP @A0S #S!Zd2 00 0 ֖`PXL 0pL#>. J P (qvp ivp W Gp a0S<0 0@0050C SRBDD0CDDCDDCDCC[ Თ@P60S? 0a$ p 0p0 R qX  Pp P    3/P00 S $ p tpZh000S J9(|(1R$%Ȕ&:R4-A \|(q#\O-M MP'KJ ^n K5 00 5/K5005J<:0 00P J pP pVǶPQ `A@6P񟗹`FGpFFXHFXHXHFXHXHdGTGHGGXHHXHXHXHXHLFXHXHXHXHXHXHXHXHXHXHXHXHXH4 $0QPClo2 0000U1dR0 U% PPL0_p LP  PPL0Rpd2SPIBPX0: S0d2232d2oPPS|0 t=_KP0SP FL bzPGRP 3P@/PA1@P>4Y00PU%>pP  >P@x%P FdU HPh Xx 3023,2 3(24T\2S(",2QX"\2 !14!8!P@0+ ^0 \ d ` v $!p  ZY0d2S*'0\ h f[tPPL00<08 4P 40 S8 *"<02#L SX U[#<00R,b(H"L2R0;\2QP 0(Ȕ&(,4-t (܀H( (z#+Bh(UYkԁ/+5@((rdAhedAz֨(>ɂ& 6b((لGJdz8Uك&X(=sl1 SR Q  RQ!R!RS !14!8!04P)`CQښ. .a0C 2 0Vh(4-Ȕ&edAȔ # ț&(x(%&(p(1kΔ(zd@8(DmO-`@pЁБQ ?p%W㰑 0S 0S p10`VA P d0S L D`V.Z ЍyPmPPP fP n0@ SrXrrqXrXrXrXrXrXrrr00000000000000pM*W 0+P 0PP :X갗4-(Ȕ&l җO-4$M` J;P! l:P90pD刔刴00PPPl$p3W00S 0S 0S 4Pp(4 a X' 0S00vP q0S khPY30S ЍzPOPBP4 FPo vAP@*P,wttttHwttwttttttttuu$vvtvttttttvwtw8wttttttXw`wxw00 ᠪP2 嚪P20{00b 0 8Ap/o0` 0僪P00e @|P00^ 0 c APV ]Q000M00J00G0 mA1 P :T000001000-00*000&000"p 00000000P0SWFKPVW00S 0kP `I%V@Z 8@Z4(X0(4-(Ȕ&X8(w\W~{~$&ʮ җO-@MP8@88룮`(שPUPE10ŴsvPlP,HP8 TP3@ ` 9p@-  H7qp@!0 S < <0@Zy Sm@ P{x{yy{{{yy{` 8"p,2 R Q!  R 1,0Q qP,00S  0( @ⒺP@700-SF 80@0$0 p0|@P?Ѝ$0pw1 4 ?$040P ?000R0Sp c```8KpW0S0S } 00 0@@`p @$@ @P Xm 03/p T]} 4- Ȕ&  ,֜&@-,@,ᤜ@⩜墜@赜(&hO-@P8M -`,@zF8 0uv`^ p p S6 R|,0 P8 /P0T 4P0\80DpHP88F U1 6V(pCE C`0IPHPU 0  p 5pO005S 0(0,00(00 0FYPPPx%xRPzZ`ZNZU 3AZF CZP0 yp 00aZ CZ LZf a J0RkL 4T\dWZ$00!0 0 P B$0DS -(K0L0J0~O0{05xN03Xt X`CpM0nH0l5$00!0 0 ᔃ $0@S* xRI0X00Pp 00J pD0kZ0{mJ Z =~~~~~8~~~XȂ/Ԃ-[mÛPH0SI0SO005S* L㳛PO0S U5S5 ( Ĥp0 (0S  0C!P ᄖ@P!@]p``ϥp! ᖖP|! ~Pd! 0S1H!3/ 0\@ PH0`Pᕗ)('P1! HR #%0 p PP 0  00 hpS& (&&p(&&Ȕ&!&X&4-&&;,@*\ f!igw!iui m@-ךP (Q埚@幚P!(p@-D@D᎚Pᓚ@(勚 劚᜚p@袚($&XDp@-D@DvP{@(s rᄚp@芚(&#`!A-|@|p `(P[,X^0`[8P@S@@4M,N`UAd( &*$*G-`M5Pg IPa u6P0 p) P5\5@P Ld6H2HP8"0 8288@o 6 H|p HQ 6 J6P - @ p1a 0u0 @ pk0 @e xa080<0@0D00 0000P0 0 080$@P 囯 84 HL@P@T@X@\@HPϪ H˪444 0400,0@@,0( 00PpϪPPUPh0PP 0/`ЍY W>x"6 C &BA(AR~p> 0 O p@7x>pt>a0SH>D$RX$r R  $t Ct00<4A @0<4x00<$ 00p N <4 L!H &3$`PEB@D4TG4ttt8xtDttttttt`ttttt(tttttttTĝTtttĞ4 ȟtLtؠ00<@@P p< $y7Pt   << l ,<$$r $dT4S`岞P T3 2"Fx2ŸS H$L4P*pH0 L4H/0#! 0 ZpL2 C  H0, GipĞtZ  0P 0T+  !L4HϠ0# 4S 0 X#?X 뼀04$$ST RQ  X  0,p0 XR00R104Qg ;R040 Q$ Qr*8nx(GFȔ& &4-w\ț&K2K aU= J &b &   A :(>(L\ q(3Ej}Ȕ((!aG(! ]a;Vj &`} G~HL4 Q} QQ040S[R0[ 4S$fP 44崐S04144 0S @4S 0 0@4,4S $4R#1ѣ1,40 0 0KUu A,t =,0S 뿆p@) P+ 0d!t">0]>*hP=.X R04ʃ1$4Q :$4"+ :T4S u-d0<"t!~,+++`,\4$H1H4L1x0<$0@ 0,p tP Z > PP  4Bsp   T4 v .0< H'O-0pIM M␹i4, upP_h9`4pGs04WZ ht  pYa) 4S<44S $$4R0(g+p  h,p  4 SP,0S x0$ $tZ0 0q 0$ P$H 1Sh  $$4Pa*` FZUCU&DPEU@\\\\\\\\\\\\8\\\̮vbPEUUl\\\\\̰\\\0\\\\`\\6 ('8#80( R&0C RI ("(eF044s04=0 00 d0 5p6/0(00 ,V0,P'0@ 80 00  00*00 +0 0*00 +00!00  00c 00 l0 050!00 < 0,00 1 1 40(40SE00; T$40P0<$Eh+p 4S 6*PP#`$N>`P#H  <(@lP04(0(00`V Z 005p"#8$p = 0RP0 r0 4VP QP#0E3}p$p4S80S4` 1S 1!0"@ 0S0/P 3"b|11   $Ĕ!<#VpT2   OE$ epܑ WP pe 4 $$s(4S 0@?W  u $tR $4&S 4%JX0; 4 44 W  0T)p0EpW.X0:S Q 4 $S  0  zg)0S Z _)I!X0⫱X+(#4-Ȕ& 0(&\#aU= J #3j}Ȕ(6+!`z aP+!;VjG-GMM@ph  p40@D@DTQ6@@5P 4DT44l444448444̸444444444444 ,4Ll4|44ܹ$44Ll4`304030033喱(x3 p0,0p0L3000<3080,434#  3@| 2Dt 2Hl2"d20L0`|2"X\2d"P<d2D"HL2 p0V0  2W6 2 p0X01!$ 1`p0x0p0\1 s)p`P%L  &qp`P@0 S <  & 0`YP ~C0S*0Sh`lP0 CA/\P 0$ 0 0 @xx>:@P\C AGލЍ,!Ȕ&4-$ ))Y))))r/F/))) *ZȔ*O-`PML d`cP(NP*C (P'p((px `Pp/'8` X.L`pAH 08 P U ZK > <;S'P $G $6G 0N =N N PX(  =0 2S1<+02L0WC.p=0S- C@4Plh      @   4              t     \htL ( 09 0zl hh0P 00R0S 4tBf 0;8;08;_ 00;ppGX䋟h;h00S 0EP  +;EP= 0DBd hh000S0? P< ) 0< 0: 0 )B@0 0:0@; 0@0 00 008;0ꨊ hh0P00S0? :Pڌ 00v 00s 09p8 hh0`0PS 4t hvh00S0@S ec 0; 000) 0 0 000) hh#0 ɟ Lh00S 0EP h:080X)X9 &PL zZ 8DP &P mW<09 ,md &P 0: 0 >0!.8u 828P80PS ̌p 80PSUpȌ 刀pp_Pt  4bAUp 0@ @ 8 0PUP 0C S0400000,00(00$00 0000000000 000000x0 0FO0p Ro PP@8Wo m$8; 00 d0&p8; 00 d0&p8; 00 d0&p8; 00 \d0&pL pDV  |0 x;0 E y;z+做0;0; ; '0cy;0z;(0x;P+@iP d0Q&P;"0#10@00 0`c`QH `    ` 0-&Pbc0S PP c0 &PU 0  00 4&PHd ~0 X/ Ut``0 T%P`l4l$4%`㖚!2P(10Hd 0`[[[[,Q0Q4QPPPPӚ}+4d<;SS%>؀C 0 5PuD`p&I 2mL 0K 0K 0%hrN% 05PUD@XPI @2ML 0K 0K`"2R 07CP ' "2@P,CP20S 0 ^' t@P 0CP@P 0CP2 $p0崗$p00 dT_@+9@0W0 00 DiP1 XppW $ P 810%P`dAQ D](%PE $1% 0%c*}5556 *?27eAN7t7Ȕ&4-55`RMb@A5 6(6F6b6{66 **6 *6{Gz?67*(t*7&7 8fe,8K8**4X8y8 *88d&L`*-C6?4*"97888~A*$@H*@@=9B9ț&*K9(**p99P&99*p&t* :θV:r:::::;;7;Q;g;~;;;;;; <<<(<6<[<}<<<<)=< =E=i=s======>=L*=*===A JN @1J@P 0 #B`PZA@ Pq 0J 0@PBPE 0 BP E1 JI  p!#@T9 Z0S5 $}0Pl0l00P0p+t#P E0S t;x80$t;L000!R@  X1 0  92d"RRW 0 T !`HL 1@S= 2R`" B8#<48#8Q\P3!TR?LT0 L0d0 d23X%XN  B  xx0|0?t 0I#I 0JIJ@ ZAP# !VAP#!p# 3PŠU h2X0Ph2dl P  ⢗T 0# 0X 3% أ0#$$L0(00"(0|4" BQ2 (Q: 4 Up3P0؄#tt5x!'x0G0C8C8S ! 0G 8(#8"(i 0  6q   DPT p5 0U؃0#$$L0(000"(uP6 V  ItPL0@0SLU k( 0RYU[أ0#$$L0(000"(?V'0 H0D 밇崗0ZP0  0CS0T Hl$Hl0 P Q>lx  0#!} 0Pp#x         $ 0 PG D 0 {P> Q n     a0 \P 0 #$$0(#"(!M0 HP  C0 >P4  0 5P Q Q l p pt n0 #P  r0 P  0 P  0 P  0 P  0 P4  0 P X 0 P | p; 02 l.0SG S Sx U؃0#$$L0(000"(P S@0IZC U I 0K@0 @0C@zp  JZ  @0I)0C9! @ @0C0YIZU& <;Z   &sPU p(  ḫ TUP bP JZ UU PO-M`P@0L-S@>P. @,4 t p+40SP a`F0pP[PVPijQNpGKL!PN  G; P@ \3pC d0@SL@20SVK@HGG 0R 0p0 -Y \:Z'3`PP`0b 2 R } 0 S q lU+ 0 !0!00X #p4 ,pL0SkXk` p:0S0.0P0pp@@ 0q: Vp$k`Ȕ& #[>/mm>z>>(n>>>>>?D> >O-PAM Mʝ@`P}xP lJ}Pd70`W00-S% @1P {+P0:@ p0K0\Z n`F0S0`@DDA@Dv ep .6p0StbLPt63 Q X ;P -00 `@Z-00  D0B5S񟗊tHTdttt(t4 )00S 9P}90 0w꤄4P 900i00f`400b `4 ^0S Hi9 V 04 R00OP H ܃ 300S P60$010(0.0,0+t0C?o 2R0S0$0tPo\lPg@)u00@DT3a00@`FrS; RS iS/ ~tS xS*똒弢+l0p 0@00@00S " 0@T 0S ~#R0B(0/S Qj (0S F 0@2\k0S (0S p0|1 0h0PS 4L!:(0S ( 0@!*9Pq P+- 0 Pc@T[FJ!+AȔ&A@4- A"A8+DAp&aApAAA:ț&tb|&t<@p&B2BDBh BN]BtB;O-PLM)@pPph/p\?,,#@DRQ0I 4@@0SR'8vP cP SP- TP0(3 LP d0@SDPht0D003030800H00 30$30,3C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0 qp,4y 0P 0PQT)2JZp3V s`(os`F vP% 0SU030#:U 5%P|娙 P le 2 T/P&T6K/r003PvTS0 0S0# G@cSPEX: Pc 0 0<6SR46SR 0&2RRPh2 01cc6S |^bP W0`W  0fP c!EK/r0T,6S m/`P 0PQ! V+*X\c#<6S:46S: d1Q0@6D&S|1 0 00Rl!  H&`R\! $&RP! 8&RD! 0&@R4! 0!Q   @ n뚌 @딌@|0PSTmXP+Ȕ&Am4-bmLtmmV+4FtQ+hQ+mm&mm&mmn`3!/m[>0P XP҇0Pl Shn0 jP4:Ty |P :h(q\P 9T(X(g8 c,匂P 9h(e40GDS4P`lX<HLP` 8(V)S h8X(T(N T8,J8 8P 00S= 8 V,8, ,, ,0 7,, 7H((E$8pE7, | 7L(w+r P:?@ 0 D7P(74wDpP78x7 7<( 6T( X(L7 6P 00S 70  6t(6 x6P 00S 6 6@p q68pDp0⤖80 P 0SL6t pW 8p(H5+  5,0 0l5L(5D` L5`(d( 85u A$5P հ@ y5?Q45GލЍx5| p,ꦅ0D\<8;8 0S0SA  Z$@288S2n@P R<S P 0S C CH2 uN @+p P: B?\] 081<Skf+p P*7L0:uP 0AP #@PP |7 p75TE @PH7@ 70@`,ruPP0@P`p@+tp0(@0@000,`40U0 (P<P8D,8U0C?o20SP ,R  \0,0S PC,8S= [,8S (+kg |g  J!0^cm &p&Ȕ& hr{ 84-H)&)+q4Fț&40-J^ty  ǎҎގ&=/@ |  ңʣt+ ` G-P`)0Eh勄P03vNp2S ll P)UQyPH t圄9PB/PE0@ *  'pd40pEWQU H4 000`~P L,oPE0S#3 4# 3P߃OP )vP303 C`pp hdlP\304 VP#S4S @SRP  (n)uF P 4SqRRPl l PnRx,p`bG1/΅<01 1> 110101$1Q4p#(2R$$7hp`g Pd Q18C8S TZG`q؁ؑp1F0[X18X1`咆0  F1|!1hQda帘0  I@Pw\1j >0[ >+00. [X18X1=0YSpVPMP 6PR ?PI 4Pp㤍N@P񟗯FDFDDDFFFfP j@PP񟗞XFFDDEDDtFDDDDDDF=0P1`<`F@pԌ}\1F3\1Kw0000q0\1lH 囇@fppcph`0 P P \1P 傇0#P\ {0[ >0  ⭕@P 0 P  b84'0 00X1 zvpxx t  ≆1S P ,2  ^ w:0P \A@ @0 Lp  pp D( \ X1 Q 0P819:\!p*X1 d [pDT '"P)(< $X11Z 9tPPY* 9Y) 9+ 0)C\1 ކPz P S z 0 09刂z☂pHx  W 0S L 廄 *PQ ]z0S(  vX!\10\1808"/0  uX!2sP8"/0 u2X!s"/ up= X1`~  uP%D`X!\1 0\1 00 8巁p 137 ] wzPtwht 00 7Wpy0S $_X0pGWy0ST]y0S y0 S X1\!8 0\!'zpy0S &|5py0S &H( P q  w&twX1 I S0ӇpT9 ]p5 P <\1A>\10L1] 00 6Lpwls0L1L 00 5Lp(p ]p P \10\1Q|Ѓ)bd咃\1 @0\1;pP  <ۥX1 X40  tp` X!\1 $  $$ 43 Jp   vKp參 00 4vp@僃|!RX14X11  ┅P+p0v!P0!  R!m00|!R00SR\1 wX1 0㌃匓 Q01Z:  LX1  w1PU3X1\!( ; W A? =奂 w ⶒ1R@T 0S 0 @/@ 0S   bx 0S uᰃPpP P ( RW  R   0010 S   0=PUQR垂\1@0@k2,`\7j\1$ 붣  }! l& P O !Ȕ&( * 4- " : ҧ ! @ Oݢh .C!: / Nf $ K & Ǩ ݨ   E \ = g mr C ũ ة B 7 Q x 81 p&  Q/0p@-x@0Ppp@ P T0C"`p@/ 0 0$010,d`cO-1!bM0 Mb  [ !1 b0 0 30Zbݍ Ѝ  0 "m !l\ $Cv`  $; 0 0 +Hp0Gp( 80G( Gp` x8_S0؀00 00 P00 @G0 vrP x8##[`@*krP0 l8 40GPlU P0 l8:}p|0J|,J0ƒ S"*0@- R P@ 0\ R^D00"@ 400 0^ 00"@0/x{`{L{ p@-`M PAP!@ `` */4T*/@-@t@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.0_BETAxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv5/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32gamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressnot ACK or OFFERdeclined duplicate addressignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d [HwdE Y   a !#d#j&m)!)F-|.q5x<7w<7R<qz ?{??G lDOrPV \klq ps x|>,8m H @Ho~hZz x0{ ض8 X/m 4?44PATH=  ti f=>dD>=>s cQ>=>mJ>=>lX>_>r  9pg>8no>=>v w>b    EOF reading here (<<) documentջBdChClCqCvCzC~CCCCA8 CCCCCCCCCCCCCCCXgICNCSC;XC^C6B >N=(=N>6O`>N>6NH? P@Oh= P@CNp?N@ش@ @N@>N=?7N?/P@ O OOOO#O3"O#!O3)O2(O3/O3.O#POOVOP P@@PPP^ONNPPP?OPGP VP@]POPdP.jPOqPxP NC$NCNC$NCYyNOONNOON POOO@N@P N OOPP@$P,P 4PNNNNPPPPP GO@___@^@_@_@_@_@_@_@_@_@_@_ @_@`@ `@`@__`!`'`.`6`<`h_B`I`O`V```h`o`v`|``@`@```````_````````_`a aaa^^#a!]2]B]s]]]]]]]^$^7^B^K7b^bb bqbbb$b*b1ba8baGaNa]adajaqavaՉ~aaaa[ aaaaaaaaaaaaa^^`^^^^^^^^^^^^^^^__ ____%_._7_@_I_T_]_h_m_t_y_______bb bqbbb$b*b1ba8baGaNa]adajaqavaՉ~aaaa[ aaaaaaaaaaaaabb bqbbb$b*b1ba8baGaNa]adajaqavaՉ~aaaa[ aaaaaaaaaaaaapIlmi{݅':a   , H jz'Ň؇7K`v ƈ!#$ֈ&12ވ345689 9:+;E<c={@ABډCD-ECFXGXHXJnLMNOPÊQՊRST UV-WG\QalcvdeӋfghipqstuvwx1M^Ɍ، +Gg΍1Ifvˎˎˎ a CVexЏÑ3C^ϑא!9Wrȑܑ2hǒ̒ ߒs <]Փ[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]\{  `z *a4a>aGaNa]adajaqavaՉ~aaaa[ aaaaaaaaaaaaareturning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock         @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read XS4&@`X<&]@&`D&@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-=FoyxL48H&i|L&@r 3EYg !  $ !!!! ! ! !4!H!!` *a4a>aGaNa]adajaqavaՉ~aaaa[ aaaaaaaaaaaaar T&@i{݅':a   , H jz'Ň؇7K`v ƈ!#$ֈ&12ވ345689 9:+;E<c={@ABډCD-ECFXGXHXJnLMNOPÊQՊRST UV-WG\QalcvdeӋfghipqstuvwx1M^Ɍ، +Gg΍1Ifvˎˎˎ a CVexЏÑ3C^ϑא!9Wrȑܑ2hǒ̒ ߒs <]ՓPX&@$\&@d&@`h&@@ Hl&dx& x|&@@&SFH0eCSFU0eCaHah!IdontNeedEFI (s*K>;5 |nQn- q+'3|nQn- q+BL|nQn- q+Yb|nQn- q+s~|nQn- q+a=rGy=iG};Mt?mWC 3KOOyD<#*=(3Dh&\ M}-@Mjy֬#4-чHaE-чHaZZIчH tIчH IчH2IчHL6 %?aS'@ )Ѹ*1@ )Ѹa1x )ѸW&x&@`&backupstore_gptstore_tbl &@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapssetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusɠ printallmaindo_setifpreferencedo_setifcapszi`&yiJJJ&QL&JJ&a (& &Ip&\ &&&|&(&0&0&<&<& @+7? H0Q@ZchƲ |m x~ @ɠ init_current_mediasetmediamodesetmediaoptsetmediasetmediainstRG]Rh ] R `ow@ow] hmedia_statusmedia_constructor6?7 F&K?7 F&7 ?7 ?&I?I6&H?37 &~?~&paddr_match| PhPsettunnely&P&print_link_addressessetvlansetvlanifm&r&"(setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanFILOsethidessidsetapbridgesetiffragsetifrtsup &t`0&|X &{|0&' &&'<@* &[ & & &/& ( & @* &s &l &?`>>P&invalid major numberinvalid minor numbertoo many fields for formatffs@    M  I {  { @{ { { G  $  6   > Q ^ t    ! @    @, \{  E J `z S  X H{ \ `   1kr{  m {   6  ?  @       &  bnorripbgensbextattbnojolietbnocasetransbrrcaseins  1kr{  m {   6  ? pz @qz  " @{ @    1kr{  m {   6  ?   pz @qz  "  { @) I @ M  1kr{  m {   6  ? @  1kr{  m {   6  ? pz @qz  @bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror  1kr{  m {   6  ?  @RJ|~s  @6  ݏ@$ IOXbl w@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv   1kr{  m {   6  ? @  /g2I_ @St:o%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@#*B4*CC*FO*Ih*Lr*N*O-,S*a*b*c*e*f*hD+iP+k\+mj+n{+o+r+s+u+@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:^@@1@h 1p1p 1p1p ` 11@ 1 $1м|^t0 Non-system disk Press any key to reboot ^qqq^qqq^qqqDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYchvhhhhh'iOioiiii j5j]j}jjjUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_printxxyyy y5yyByPybyoyuyy,y(yyyyyy zz)z1z)zEz)zUz)zgzszz\zszzzzzzzz{"{5{<{U{k{{{{{{{{{||.|@|E|S|Z|,k|||||bitmask_scan xxxxhw.disknamesfetch_url+Msendrequestrecvrequest(***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]aО О : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data(mJ\ m l ٦`-l l r-l (p-l ( -l l 8 -n m 7-m !m 6-Cm Nm -im xm q-m kg 5-m (S-m (R-m (-m m t,m -m m -m ( -m -m m s,m n H,n @t-n @p-/n l -8n m -Fn Nn -in tn -n kg -n (-n (-n l -n m -n (-n n -n kg -n (-o (-collectp x p x kg |g x *a4a>aGaNa]adajaqavaՉ~aaaa[ aaaaaaaaaaaaaNAME=`z X \{ mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds*a4a>aGaNa]adajaqavaՉ~aaaa[ aaaaaaaaaaaaa edit_fs_type_extf O tO O Lc td Dr `r 1LO eP uO edit_and_check_label *a4a>aGaNa]adajaqavaՉ~aaaa[ aaaaaaaaaaaaadisklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzȳ  ( 4  t 8 ( $ Ծ $ X ̲ \ L ( IJ h P 8 disklabel_change_geomH|!`!!outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_defaultx1-X1-1-1-pm_from_pepm_whole_diskgpt_freegpt_create_new!h,H40L؞Ԟ Ի 8XpĠȟ 5 5   aa ! =oxL ^R W \  _ e ՉE j J `z S A an X H{ \ ` as a| gpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eCSFU0eCaHah!IdontNeedEFI (s*K>;5 |nQn- q+'3|nQn- q+BL|nQn- q+Yb|nQn- q+s~|nQn- q+a=rGy=iG};Mt?mWC 3KOOyD<#*=(3Dh&\ M}-@Mjy֬#4-чHaE-чHaZZIчH tIчH IчH2IчHL6 %?aS'@ )Ѹ*1@ )Ѹa1x )Ѹ    aAɜ /Ӝ     mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newH|!x!l!|L`84$D|d X$t8 mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************(control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump22dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionܡ bƷc|de fk gD hj iÿjm kw la m n No p2qr s  t u  |v wa x z/myIJ Aʲ Bײ Cl D޲ E F G H IQJ K LM N O P- QhcSd T5 U? VI WS X] Z 1l 4u 6~ d |~ }  ó ѳ ϳ س ֳ ݳ     m { F    *  $ . ; E V T ] [ c p  [ v | ױ  m ʹ ڴ   default_configread_configrt_compare_proto@@rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtrt_buildrt_delete  sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init8ON U _ h bs [<s script_buftoenvNUV c] F make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcpC N Z 'i dhcp_boundu  ~  P %  i dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifazzzzzzVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B ^, L lg& H ̟,  ,Q L2 lBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~A &E !!N !İ! ^  g& H , @Q 2 }"{"y"cs_pathdXW  bc_base_max( bc_dim_max( bc_scale_max( bc_string_max( coll_weights_max( expr_nest_max ( line_max(  re_dup_max(  posix2_version (  posix2_c_bind(  posix2_c_dev(  posix2_char_term( posix2_fort_dev( posix2_fort_run( posix2_localedef( posix2_sw_dev( posix2_upe( stream_max( tzname_max( atexit_max( ^`  xg& H , 4 Q L2  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareg_Ctocg_lstatglobextendglob3g_opendirglob2g_statglob0globtildeglobexp1globexp2_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'@Bʚ;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internalgetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddr_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseekoisescaped_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf__sprint0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_getpagesizeqsort_r__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEXl|x|Є0dTUc te|eNe`'$e<eee e dd`ddd dd d @ d d d d d d d e  e e e  e (e 0e  8e  @e  He  Le  Xe  `e  he  pez <  x   ,z h@ 0 Dc ~ X`  p g u LHc q D ~ \  Lc Pc  ld 0 c Tc Xc \c `cdc < xhc lc pctc xc ,|c,c hchc cc cc cc XcXc Xc X c c c c cc cc cc c L\o .c c  c c \c  d  d d d  d  $d  (d ,d 4d mH@  ٦ J$ ~  <<x!9 B <W >Y tįX p߯(Z ||J $O C*0Q +*0Q cID .ZE ZE hU U sS ?,m #@U `C, KE.FOPƴcݏal7Ns̴h״C, !"$'(+-.03569:0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [< is a directory is not a regular file (use -f to see it)D&D& ($" >|g" 1;< j7D N W e#r28  (!9`&Wxf)'15:eC:MK%U_6h4]t +,-.*?9 E// 'F$ U зcq vWxf}ɠ   WmkRkRkYcWbkCkc kG ky wb YMYrWca0U& ,)Gb(U&@Ї,0 oB U&ԇ,cU&,))dU&,PkU&A,DU&(8 eU&,fT&ȇ, %FT&,AkgT&(,hT&, $iT&܇,H GgjT& JT&!,kT&H T&H4 KT&,LT&,;YmT&,q~nT&"؇,oT&t OT& pT&Hԙ PxT&@ aAqhT&,Jr`T&"̇,^sXT&!, SPT&!,*:tHT&p JT@T&, Pu8T&,\V0T&T w(T&", x T&(( BNXT&A,ZyT&,zT&ć,"T&@ ~S&!,6?S&Т #S& TgS&A,sS&,S&,S&,MS&( S&,S&|,  S&x,, 3TS&t,uS&$p,X S&$l, S&h,3S&!d,L\xS&!`, fpS&!\,hS&( `S&!P,XS&L,5RPS&H,wHS& @S&@,0S&,'8S&<,Ag(S&4  S&!,S&8,S&4,*[S&0,S&,,$Jfr{~4'1BQ\hnzGJ`N  2pT&8?HQ^jv` <, (press RETURN)t!'u!wu!pU&pU&|U&tags643{}abcdDgGhHilnNpPqrs tw xy !:#=,ا,-e^H-i^C-k^UK4m&l&^ dl&dq % $l&(l&O (k&s ( k&O (k&O }tk&

p ?p "6 Q Q Q T T T a 8` r r Q Sp U U |U LU a ` ,U [ TQ T|Q Q ,Q @Q "6 P P Q ,8p RHp xXp hp !xp `V @V V U ,p V V V \r |r r  p V q r 8r jp kp W q q o P P o o o P o o LW (W @s `s s hq o PX ,X X W W W Lb a pW X[ q o \ \ \ ] ] ] ] ] h] P] 8]  ] dP tP P HP uTP h^ @^ ^ ] |o o O O &^ '^ (^ )^  _ p_ x[ L_ <_ %^ _ _ _ $_ _ I lN pz N { N { N {  O { 4O { \O p{ O (8Gn K+Y PSWa i|1N;Un 9   J++ y3 6 9  l Q  $ A N [ z        E   _   _ m . 5 M ] i N { m  A c U  +   '    [    " C R    ,    4 w          1      = t c _" u" " B# # $ S$ $ V& =' ' ' S( p( ( ( #) N) * * * 6+ ;+ _+ + + + + + + + , , +, :, H, ^, g, |, , , , , , , , , - - - 1- H- Z- t- - - I. . . . 4/ / / 0 0 2 2 "3 3 4 4 4 4 4 4 4 :4 5 5 +5 K5 _5 {5 5 5 5 5 5 6 6 *6 76 I6 Z6 l6 |6 6 6 6 6 6 7 '7 \7 f7 p7 z7 7 7 7 7 7 7 7 7 7 7 8 %8 :8 N8 x<[8 j8 8 8 8 8 8 8 8 8 8 n? 8 9 9 9 )9 89 M9 Y9 e9 y9 9 9 9 9 9 9 9 9 9 : ; = = > L? x? ? ? ? ? m vj@ @ t;@ @ '@ 3@ <@ Q@ x@ @ @ @ A )A WA {A A A A A A B B C B C C D &D :D D D E t}E r{ "E KE jE E E E ?F PF F G G G (G G G bH ~H H H H H H H H I I I ?I SI gI ?J  J ^J lJ J J J J M~J K K .K 6K  :K KK VK lK L IL N N O &O _OO TO gO tO zO O P ~P P Z,Q Q Q |y*7Q Μ @Q [Q hQ tQ Q Q Q Q R R +R LR `R R tltlR S :S ~S S S /T 6T sT T T T U VU CV V a Fa Qa |` r_ ia a a a a a a D a a b b (b 3b @b Lb Qb ^b mb b d d d d e (e `f g ^g og g g g g g g h Dh h h |i i j %j 8 x x x x y y y HP y ~ ~ ~ ~ 9q/, u #, J {  Dž ͅ < Ӆ ۅ  0    10 &' ( ) *|+# ,+ .1/ftp @{ n] "6 h p  @ W} i~D 6>̬ # ?D 7@t Q A& B+ C0 D &ة E 8 F a G  H A I4 (Y$ ( (  1u$ 1e u$ L Z i v ʑ ב ]\>]\D@Ī { h (((((((((C     P v   w 8 B      ! 1 s4 8 < @ % D H L P T aX \ `  d !u " # $ % & ' ( ) * + , - - . ./ /10Y 1 2# 3) 4. 563 79 8? 9H :D ;N <] =i >{ ? @ [\ \ ] ^ ^ _ _ ` { {, |: }F }~Z   -dd-ddTdd:dd:dd p p@p@p`pppgggg#g#g#g#h#h$h$h$$h$(h$0h%8h%@h%k%Lh%Th&\h&hh&ph'|h'h'h(h(h(h)h)h)h*h*h*h+i+ i+i, i,,i,0i,8i-Di-Pi-Ti-\i.hi.ti.|i/i/i/i6i;i;i0i0i0i1i1i<j<j=j=(j>4j>@j?Hj2Pj2\j2dj3pj3|j3j9j7j8j:j4j4j4j5j5j k! k" k# (k$ 4k% @k& Lk' Xk( dk) pk* |k. k+ k, k- k/ k0 k1 k2 k3 k4 k5 l6 l7 l8 (l9 4l: @l; Ll< Xl= dl> pl? |l @l!@l"@l#@l$@l%@l&@l'@l)@l*@l+@m&` m'`m,@,m-@@pn?@n `n!`n+`n,`n"`n#`n-`n$`o.`o/` o%`0oC@oCLoDToD`oEhoEtoF|oFococododoegeo#o#o&o&o0opp pppp p(p0p8p@pHpPpXp`phppp|ppppppggpqqq qqqff f f@f@̶ffggg g (g 0g 8g@@g@Tg@Xg@hg@pg@|g`g`gggggg g@gP ,v33333333Xt3333 DuUTC330%0%Pxyrs$yr|xr33xT.DX|339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž&&&t& 8% 33UU33UU33UU& 8  H &p& 8  H H& ț& 8  H &,&&8-u4ppXχOr_"-gw>/;A>q8.ϳJw"_:[y㵌|kyV^}Tp)k*bL ׽3z;o.\4}iqa~ć| c(Sk\#Z??ۼfsmG"ȯEzډ|Z?ݮF>GiREQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf /B`Haa-P<% Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5768 5795 6361 6661 7302 7349 7462 7555 7589 7608 7626 7634 7643 7668 7672 7676 7679 7682 7804 7989 8217 8737 9088 9117 9130 9143 9148 9168 9187 9208 9267 9284 9298 9320 9365 9391 9432 9510 9628 9742 9796 9825 9857 9896 9902 9935 10058 10065 10069 10077 10101 10183 10189 10196 10208 10222 10231 10264 10283 10295 10405 10467 10486 10605 10656 10708 10720 10739 10791 10995 11203 11394 11454 11503 11771 12231 12898 13322 13644 14069 14201 14233 14245 14423 14620 14781 14915 14935 14968 14982 15051 15164 15336 15471 15491 15603 15695 15718 15741 15800 15815 15836 15851 15872 15892 15917 15931 15955 15967 15985 16195 16445 16466 16482 16535 16603 16676 16713 16739 16815 17310 17336 17358 17465 17572 17773 17846 17930 18030 18525 18763 18914 18948 19083 19127 19266 19307 19352 19399 19643 19776 19838 19932 19937 19971 20005 20020 20048 20081 20088 20113 20131 20157 20164 20179 20194 20214 20254 20271 20291 20312 20334 20349 20369 20391 20406 20419 20433 20445 20457 20471 20494 20517 20535 20578 20629 20666 20851 20914 20950 20999 21090 21220 21273 21533 21580 21941 22091 22260 22400 22520 22652 22692 22739 22749 22757 22767 22775 22786 22797 22811 22836 22879 22912 22945 22980 23034 23059 23078 23100 23105 23111 23142 23159 23186 23204 23225 23247 23266 23276 23306 23332 23359 23408 23436 23463 23516 23526 23536 23542 23552 23561 23581 23585 23590 23596 23600 23635 23644 23675 23692 23719 23740 23760 23779 23805 23818 23826 23842 23873 23904 23925 23951 23964 23972 23983 23989 24013 24023 24035 24053 24064 24084 24100 24126 24148 24164 24176 24196 24222 24228 24258 24272 24286 24309 24328 24347 24365 24383 24606 24912 25330 25531 25771 25955 26033 26088 26155 26195 26218 26252 26263 26271 26294 26297 26300 26306 26317 26329 26342 26372 26416 26429 26442 26479 26493 26504 26515 26526 26543 26554 26601 26624 26673 26914 26947 27202 27223 27256 27309 27335 27362 27518 27524 27567 27587 27606 27635 27642 27649 27656 27661 27710 27748 27782 27839 27867 27912 27929 28030 28035 28112 28126 28136 28160 28283 28364 28474 28502 28507 28523 28552 28560 28601 28608 28622 28635 28643 28662 28695 28715 28735 28951 28982 28987 28994 29001 29005 29019 29031 29046 29079 29092 29147 29205 29241 29259 29277 29295 29332 29338 29346 29350 29371 29388 29399 29421 29599 29643 30345 30369 30403 30422 30467 30474 30481 30485 30509 30520 30525 30588 30709 30832 30845 30979 30981 30983 30985 30995 31004 31017 31044 31048 31054 31059 31068 31073 31100 31102 31115 31127 31142 31170 31214 31261 31277 31299 31310 31343 31363 31412 31512 31514 31579 31628 31677 31781 31879 31920 32011 32018 32079 32143 32148 32154 32263 32322 32573 32714 32841 32909 32946 32953 32980 33026 33029 33050 33095 33146 33205 33274 33321 33426 33569 33594 33598 33632 33649 33673 33725 33776 33848 33914 34012 34029 34060 34096 34130 34154 34178 34211 34231 34241 34249 34257 34267 34278 34292 34318 34366 34389 34409 34450 34749 34752 34766 34778 34785 34804 34818 34825 34832 34841 34851 34868 34884 34932 34940 34948 34958 34969 34987 35004 35023 35043 35050 35067 35084 35091 35104 35139 35156 35175 35195 35205 35221 35234 35252 35272 35293 35303 35323 35343 35356 35375 35388 35412 35435 35448 35459 35464 35471 35489 35508 35527 35535 35554 35574 35599 35617 35624 35631 35644 35653 35674 35687 35695 35715 35743 35760 35766 35777 35808 35816 35829 35851 35873 35882 35903 35921 35928 35951 35970 35997 36015 36035 36048 36063 36084 36098 36105 36119 36134 36153 36698 36731 36759 36788 36796 36833 37145 37322 37399 37416 37434 37449 37471 37521 37531 37548 37570 37629 37787 37811 37941 37966 38092 38110 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_BETA. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_BETA ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_BETA ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_BETA completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_BETA. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_BETASalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_BETAEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.diterGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5656 5683 6259 6619 7304 7365 7443 7538 7578 7600 7618 7624 7633 7659 7663 7667 7670 7673 7795 7980 8208 8737 9155 9184 9197 9210 9217 9237 9256 9279 9322 9342 9361 9384 9428 9457 9498 9564 9676 9790 9844 9873 9905 9944 9950 9983 10061 10067 10071 10076 10117 10254 10264 10272 10291 10305 10314 10346 10387 10400 10525 10583 10602 10721 10777 10829 10840 10856 10895 11145 11317 11489 11544 11579 11830 12235 12535 12804 13165 13345 13664 13684 13697 13886 14030 14226 14360 14380 14413 14432 14533 14688 14876 15063 15083 15162 15260 15298 15321 15411 15432 15455 15474 15498 15528 15572 15605 15628 15640 15658 15926 16245 16276 16311 16375 16450 16520 16551 16581 16673 17164 17194 17211 17351 17492 17689 17808 17955 18122 18680 18976 19157 19202 19365 19419 19554 19590 19650 19700 19991 20100 20157 20254 20259 20294 20329 20344 20368 20401 20406 20431 20447 20470 20477 20494 20509 20528 20560 20564 20584 20602 20614 20627 20645 20669 20687 20706 20733 20760 20772 20793 20823 20853 20878 20911 20946 20984 21237 21306 21361 21422 21540 21699 21753 22014 22065 22441 22596 22740 22880 22988 23173 23203 23246 23256 23264 23274 23286 23307 23316 23322 23354 23396 23432 23470 23507 23555 23579 23591 23605 23613 23621 23650 23667 23696 23717 23740 23749 23768 23780 23824 23862 23889 23933 23961 23988 24041 24052 24063 24070 24080 24089 24123 24127 24132 24138 24142 24177 24187 24217 24240 24269 24291 24313 24335 24362 24374 24386 24405 24439 24472 24493 24517 24530 24542 24555 24561 24587 24597 24608 24632 24642 24662 24682 24699 24725 24749 24762 24782 24816 24823 24852 24875 24898 24914 24929 24944 24959 24973 25161 25466 25897 26088 26323 26511 26553 26603 26657 26705 26727 26768 26779 26787 26811 26815 26819 26828 26839 26850 26865 26896 26942 26955 26968 26998 27012 27024 27036 27048 27066 27089 27134 27157 27217 27469 27496 27758 27776 27803 27852 27882 27913 28045 28052 28101 28124 28148 28177 28185 28195 28203 28208 28261 28310 28350 28416 28449 28493 28516 28617 28622 28699 28713 28723 28747 28870 28951 29061 29089 29094 29110 29139 29147 29188 29196 29210 29223 29231 29250 29283 29303 29323 29539 29570 29590 29596 29603 29607 29622 29641 29667 29676 29688 29742 29800 29835 29854 29871 29883 29918 29924 29932 29936 29957 29974 29985 30010 30188 30242 30933 30952 30987 31017 31063 31069 31076 31080 31104 31120 31126 31201 31351 31470 31483 31551 31553 31555 31557 31567 31580 31597 31624 31628 31634 31639 31648 31653 31680 31682 31695 31707 31722 31750 31794 31841 31857 31879 31890 31923 31943 31992 32092 32094 32170 32225 32275 32374 32469 32517 32607 32614 32675 32739 32744 32750 32853 32905 33151 33312 33467 33538 33591 33598 33625 33675 33678 33699 33745 33800 33859 33928 33975 34080 34223 34248 34252 34286 34303 34341 34394 34434 34510 34575 34669 34690 34728 34768 34804 34828 34851 34890 34920 34927 34936 34944 34952 34966 34982 35010 35062 35079 35100 35144 35486 35490 35505 35516 35524 35543 35555 35562 35569 35578 35588 35605 35621 35675 35683 35691 35701 35712 35730 35747 35763 35781 35788 35806 35823 35830 35840 35871 35890 35909 35929 35939 35958 35971 35991 36011 36032 36042 36061 36080 36090 36107 36121 36144 36168 36181 36191 36196 36200 36218 36237 36256 36261 36280 36300 36325 36340 36344 36351 36361 36370 36391 36405 36413 36433 36459 36476 36484 36495 36526 36531 36544 36566 36581 36590 36611 36629 36638 36682 36706 36733 36748 36765 36779 36810 36834 36865 36872 36886 36901 36920 37465 37498 37526 37555 37563 37600 37912 38089 38166 38183 38201 38216 38238 38288 38298 38315 38337 38396 38554 38578 38708 38733 38859 38877 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_BETA. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_BETA est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_BETA est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_BETA Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_BETAExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5750 5782 6274 6563 7108 7154 7258 7344 7380 7395 7413 7421 7429 7456 7460 7464 7467 7470 7581 7766 7994 8470 8804 8833 8848 8863 8871 8885 8903 8924 8975 8991 9001 9021 9067 9097 9150 9207 9318 9439 9483 9516 9555 9589 9596 9629 9706 9712 9719 9726 9755 9867 9873 9884 9901 9918 9927 9956 9968 9978 10079 10141 10161 10281 10318 10374 10388 10409 10446 10656 10831 10980 11015 11067 11285 11600 12125 12488 12778 13171 13306 13319 13330 13476 13655 13786 13920 13940 13973 13992 14075 14190 14331 14456 14470 14578 14671 14700 14720 14796 14813 14831 14847 14866 14886 14903 14915 14941 14953 14971 15172 15411 15438 15455 15511 15573 15633 15664 15688 15747 16123 16153 16170 16278 16388 16528 16602 16678 16756 17248 17468 17579 17610 17737 17773 17901 17928 17968 18014 18230 18354 18422 18522 18527 18563 18599 18613 18636 18669 18673 18698 18717 18743 18748 18763 18778 18797 18822 18834 18856 18873 18886 18898 18916 18940 18955 18972 18985 18996 19007 19027 19056 19085 19109 19144 19179 19206 19393 19442 19474 19522 19619 19752 19798 19990 20020 20342 20471 20611 20751 20868 21003 21047 21090 21098 21108 21120 21132 21140 21151 21178 21212 21249 21280 21315 21351 21398 21418 21435 21453 21458 21465 21492 21508 21529 21546 21563 21581 21598 21611 21642 21667 21698 21729 21764 21791 21844 21854 21864 21870 21879 21887 21902 21906 21911 21917 21921 21956 21966 21995 22011 22037 22054 22073 22094 22110 22123 22128 22136 22151 22177 22196 22224 22242 22253 22259 22265 22286 22296 22307 22325 22347 22364 22377 22398 22418 22438 22449 22462 22484 22491 22516 22531 22551 22563 22580 22597 22617 22636 22813 23097 23407 23587 23798 23986 24052 24099 24154 24198 24218 24247 24259 24265 24281 24285 24289 24297 24307 24319 24334 24353 24389 24400 24411 24450 24462 24472 24482 24492 24508 24526 24575 24596 24641 24885 24911 25165 25180 25206 25263 25297 25332 25474 25491 25540 25561 25577 25606 25611 25616 25622 25627 25666 25701 25731 25786 25819 25865 25879 25958 25963 26017 26031 26041 26065 26151 26199 26305 26339 26346 26361 26388 26397 26436 26443 26465 26484 26500 26518 26550 26569 26586 26743 26774 26781 26790 26798 26805 26819 26837 26856 26866 26878 26919 26964 26993 27014 27037 27056 27094 27100 27108 27112 27133 27150 27159 27178 27324 27366 27876 27884 27908 27926 27970 27975 27980 27984 28015 28028 28037 28083 28209 28300 28312 28376 28378 28380 28382 28392 28406 28421 28448 28452 28458 28463 28472 28477 28504 28506 28521 28532 28547 28575 28619 28666 28682 28704 28715 28748 28768 28817 28917 28919 28987 29027 29072 29147 29213 29248 29329 29336 29397 29461 29468 29474 29573 29629 29905 30029 30140 30202 30240 30248 30270 30319 30322 30343 30388 30443 30502 30571 30618 30723 30866 30891 30895 30929 30945 30970 31018 31054 31115 31169 31250 31272 31311 31348 31380 31404 31431 31457 31471 31479 31489 31497 31511 31524 31536 31560 31601 31627 31644 31673 31997 32000 32014 32026 32032 32048 32060 32067 32074 32083 32093 32110 32126 32169 32177 32185 32195 32206 32224 32241 32254 32280 32287 32295 32312 32320 32337 32361 32380 32399 32418 32428 32439 32453 32471 32491 32511 32520 32543 32563 32574 32589 32601 32620 32639 32650 32660 32665 32671 32689 32708 32727 32734 32753 32773 32798 32815 32821 32829 32839 32851 32872 32888 32896 32916 32936 32958 32966 32977 33000 33007 33021 33043 33060 33069 33090 33108 33117 33148 33164 33191 33210 33230 33248 33269 33283 33303 33310 33329 33344 33363 33908 33941 33969 33998 34006 34043 34355 34532 34609 34626 34644 34659 34681 34731 34741 34758 34780 34839 34997 35021 35151 35176 35302 35320 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_BETA. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_BETA zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_BETA zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_BETA zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_BETA zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_BETAWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_BETAUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..