08i+|<  i+|"Jȩt ti+|@@<@T 08i+|<  i+|"Jȩt ti+|@@<@T Ui+|t`Ai+|i+|i+|$ hi+|i+|i+|Ai+|i+|i+|A.i+|i+|i+|xAi+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|mD9Li+|i+|i+| (08@HPX`hpx($i+|i+|i+|HPX`hpxN$>i+|i+|i+|K$=i+|i+|i+| (M$Xi+|i+|i+|08@HPX`hpFAi+|i+|i+|Ci+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|!i+|i+|i+| ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+|ai+|i+|i+| ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|!i+|i+|i+|4!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| B!i+|i+|i+| B!i+|i+|i+|!i+|i+|i+|"!i+|i+|i+|"!i+|i+|i+|"ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+|ai+|i+|i+| ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+|!i+|i+|i+| !i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+|!i+|i+|i+| !i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| !i+|i+|i+|!i+|i+|i+| !i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|\?!i+|i+|i+|\>!i+|i+|i+|\=!i+|i+|i+|\<!i+|i+|i+|\;!i+|i+|i+|\:!i+|i+|i+|\9!i+|i+|i+|\8!i+|i+|i+|\?!i+|i+|i+|\>!i+|i+|i+|\=!i+|i+|i+|\<!i+|i+|i+|\;!i+|i+|i+|\:!i+|i+|i+|\9!i+|i+|i+|\8!i+|i+|i+|\:!i+|i+|i+|\7!i+|i+|i+|\6!i+|i+|i+|\5!i+|i+|i+|\4!i+|i+|i+|\3!i+|i+|i+|\2!i+|i+|i+|\1!i+|i+|i+|\0!i+|i+|i+|\7!i+|i+|i+|\6!i+|i+|i+|\5!i+|i+|i+|\4!i+|i+|i+|\3!i+|i+|i+|\2!i+|i+|i+|\1!i+|i+|i+|\0!i+|i+|i+|\2!i+|i+|i+|\/!i+|i+|i+|\.!i+|i+|i+|\-!i+|i+|i+|\,!i+|i+|i+|\+!i+|i+|i+|\*!i+|i+|i+|\)!i+|i+|i+|\(!i+|i+|i+|\/!i+|i+|i+|\.!i+|i+|i+|\-!i+|i+|i+|\,!i+|i+|i+|\+!i+|i+|i+|\*!i+|i+|i+|\)!i+|i+|i+|\(!i+|i+|i+|\*!i+|i+|i+|\'!i+|i+|i+|\&!i+|i+|i+|\%!i+|i+|i+|\$!i+|i+|i+|\#!i+|i+|i+|\"!i+|i+|i+|\!!i+|i+|i+|\ !i+|i+|i+|\'!i+|i+|i+|\&!i+|i+|i+|\%!i+|i+|i+|\$!i+|i+|i+|\#!i+|i+|i+|\"!i+|i+|i+|\!!i+|i+|i+|\ !i+|i+|i+|\"!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\ !i+|i+|i+|\ !i+|i+|i+|\ !i+|i+|i+|\ !i+|i+|i+|\ !i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\ !i+|i+|i+|\ !i+|i+|i+|\ !i+|i+|i+|\ !i+|i+|i+|\ !i+|i+|i+|\!i+|i+|i+|\ !i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|\!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+|!i+|i+|i+| !i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| !i+|i+|i+|!i+|i+|i+| !i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!$i+|i+|i+|4!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+| !i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|ai+|i+|i+|ai+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+|ai+|i+|i+| ai+|i+|i+|ai+|i+|i+| ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|\?ai+|i+|i+|\>ai+|i+|i+|\=ai+|i+|i+|\<ai+|i+|i+|\;ai+|i+|i+|\:ai+|i+|i+|\9ai+|i+|i+|\8ai+|i+|i+|\?ai+|i+|i+|\>ai+|i+|i+|\=ai+|i+|i+|\<ai+|i+|i+|\;ai+|i+|i+|\:ai+|i+|i+|\9ai+|i+|i+|\8ai+|i+|i+|\:ai+|i+|i+|\7ai+|i+|i+|\6ai+|i+|i+|\5ai+|i+|i+|\4ai+|i+|i+|\3ai+|i+|i+|\2ai+|i+|i+|\1ai+|i+|i+|\0ai+|i+|i+|\7ai+|i+|i+|\6ai+|i+|i+|\5ai+|i+|i+|\4ai+|i+|i+|\3ai+|i+|i+|\2ai+|i+|i+|\1ai+|i+|i+|\0ai+|i+|i+|\2ai+|i+|i+|\/ai+|i+|i+|\.ai+|i+|i+|\-ai+|i+|i+|\,ai+|i+|i+|\+ai+|i+|i+|\*ai+|i+|i+|\)ai+|i+|i+|\(ai+|i+|i+|\/ai+|i+|i+|\.ai+|i+|i+|\-ai+|i+|i+|\,ai+|i+|i+|\+ai+|i+|i+|\*ai+|i+|i+|\)ai+|i+|i+|\(ai+|i+|i+|\*ai+|i+|i+|\'ai+|i+|i+|\&ai+|i+|i+|\%ai+|i+|i+|\$ai+|i+|i+|\#ai+|i+|i+|\"ai+|i+|i+|\!ai+|i+|i+|\ ai+|i+|i+|\'ai+|i+|i+|\&ai+|i+|i+|\%ai+|i+|i+|\$ai+|i+|i+|\#ai+|i+|i+|\"ai+|i+|i+|\!ai+|i+|i+|\ ai+|i+|i+|\"ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ ai+|i+|i+|\ ai+|i+|i+|\ ai+|i+|i+|\ ai+|i+|i+|\ ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ ai+|i+|i+|\ ai+|i+|i+|\ ai+|i+|i+|\ ai+|i+|i+|\ ai+|i+|i+|\ai+|i+|i+|\ ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\ai+|i+|i+|\! i+|i+|i+|i!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+| ai+|i+|i+|ai+|i+|i+| ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|!i+|i+|i+|!i+|i+|i+|ai+|i+|i+|ai+|i+|i+|!i+|i+|i+|!i+|i+|i+|!i+|i+|i+| B!i+|i+|i+| B!i+|i+|i+|!i+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|!i+|i+|i+|!i+|i+|i+|ai+|i+|i+| ai+|i+|i+|ai+|i+|i+| ai+|i+|i+|ai+|i+|i+|ai+|i+|i+|i+|i+|i+|bpf!i+|i+|i+| $i+|i+|i+|$i+|i+|i+|v$>i+|i+|i+|$i+|i+|i+|$si+|i+|i+|$i+|i+|i+|Ai+|i+|i+|m i+|i+|i+|$i+|i+|i+| $i+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|Ai+|i+|i+|ɃR_P[s@ QF2~IUe@*q#3 :a{g }|3S'a\1Z]YrrYwB;T} C$ '6;Z}fE=ݲh`y6hyblow9Y*CBqY]zd.;(f$f[$os!Z'pI;OJr#wLfi9ʫ,QGKIs|\}`hr}zE%Ya \[EKp=GUZ<:;#gu-4R 1A(Dq;wj/ls<"&س ]'*]<WXea։ ˌ^|@nIh !YDxYh< y8pf&#z8)bVUm'Լrd\'og^7}7ǧBr"Or(hwI'3 dB5 +5+t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(46|4 (SSb LLbNetBSDAPaX NetBSDearmv7hfeb3D0D 0p@-F+`fpywh+iK8F_X "oȿ+aoXFJ`P;HYFh#Oc+a8K` F_D M)hHF0ZЛB) F_f%jhR"!XF_4_0 F_T1hHF pCO F_F1hH>F3h+)FXF_ , I I#hZF8FD_( Dљ c c, Z Kn:f*oB² *I_'mQeppG Z [CIFFH' &F [XJh3`pG gH-pCF-FK"F)F0F` @IF@F( e K@1 I H! {z"h'p@Y gHD [X0p FFmF@)F0FT H1F pkh-ApG#sFF `.=0F_FXCNh+J$h#@c`.2Щh0F_(C+I+H~ O$)KEpC,9F.20F_0*C h-+.IH\$,H_F(ѩhH_(ѷ OH)F($ I$H> O FH_00+. g\xK-OhFH_\I _8F(~ЎIH $x!Fj"F^AF KXph+KJhhCЅK+@Kh+0yH _D0nvI|H0F^+nvKh+FuMmJ tI(F'0;0+ PF2xFđ(F (0OUУh!Hch&#H####&oH## #&o"hH&x#H##&n Ma!@ B=j 0 / '+ 0@0M0aܳгo$0+[ЃK0#0#+`O~KI~K0 #0 {K{H*FA|+h!F۰O6;+`B=)E(0+I+h9FlJlH2lJ2 2:FiK&,0;gKgJhH #F&fH 8)eK0 #cI:;+`B*`)]I *`B*`)аoаTH&c i  f  C 0+$ 2DK@A!DJDHB:AK@B!>Jh/Os_Ery9FXFA)FFFHF@zSFF F @rFFXF9FA F0F@fFF #Cq# @! #4!BF+F{H&Jz$U;ldp,2N8>U!xahl!xYF8FA0 X  YF8FA" wFFF=FH00+@,0+#H& $Ph "40+#wH&\Bu FA*F F0F@F FFFA 2" &&::F9FdH!&$hbMN1*hh *h2h *h2 #C# @! #FIH&jIKj+ 1cQjUr:H !2F+F=H&N{+h/NOsWE{-9FPFAbZF)FFF@F@2KFZFF @*FFPF9FAM ZFF0F@F1*F"H&QF8FA45 U QF8FA% 3FF=FI1"+F2F@!> H`!xdF!F I &`9FA 6DB pF Mk&(ۆB BNh IF H%\H(F.a} Hx6& [X!x4#J#p? `"J`]F H K(FF(F@*F + i#U>`!zT!z [X!zh!z!|-OFFFF(H%$&DB { x405BI%H & x ^+\(\  HYF=L( 5O500 x00 x00 [T8I"@ h#jF ` I\p( ۽0+;J`0+;JS`]!zh@th KZh B)iBHo !zh-GF&MFliPO +iBkic!Ho Fki+Ж+i+$4tki+.,<ki+,i FFMF(Ыi+ #"#AFF8F(kiBѾ!zh-CFF0HfoL0B̿H F FFB (F()i;F"F@ (-hLF!zhKJh30 H-oa9 Ki" 2 #Da b(!zhB Kh30a8Ki@[Ho b(!zh-CqMԁli p;xY2I +"(7p )(((iiiiiiiiii^.30-.^. LD"0x?.. .@ 300xA2@ (I@>#EI "`:CF;3@.h"+=Ho Fs۲20Z-.^.#O3DO3 1H@ #,I "`CF;3@h"+*..0/li*/YBYA0xB30z*К Xxpb;.0jikh`3k`,i`B,+iBڥO4!zh!z b(#Lc`ci3( ch+F"+b`h!Ѣ`!hch 3 c`x,) ;) +F"+b`F Ѡ` S0x;+`aBу!zh! L FF R .F3V˄E5F+/`:5F!!zh8F Fp@BhIFH$PH F8##+ia [XB <\+9@  N0 ~3h8"#3`3iSIH($HF?(F 0F9F,c I F,/*/"bU"Zp3iI" Fw !zh)0J1h8#@ C`!zhF H  %;"@hO1#@;!zh'8L`a1da, *1I @B"``3x S0x *ћ+2x.*rx *0300FF0;0S#h E" biF#`B#10;0+#hԛ8FF*F(o!zh Z-CFHL#hB07U%B0ЂB"(FF8FhFca1(hAF$#10;0+_ hKMѽ*F9F H0;0+6o#i1F B̿r"((FhBF,8FF0FF;hh+`B]`00Կ#hȿpȿ33D#h  0FtF8FpF !zh-GF3Lhc'eaBF"ܯB ݪSOO +J]00F30)F0;0+4#h N'* 0;0##hԛ=6h`i0;F'Fbi@FF)F(o !zh-C F*LF FF 030 0;0+:#h 2 L#i9B̿h FHF1Fh9F#i5p[9#10;0S hѽo !zh-OF^LF'#iB̿H F0FF]ETh {B۷=F0Ou5D30)Fe(Y0hP;0##hdԚgDJAF10FSe(w0>3fa0(Abi Fm(:#10;0+\ h68ѽ(FF(K+ih;DB:ݳ y IF2 @LhIFH$ZH0;0#h  q0h;0##hԘQF*i8D@ +i-hDVo !zh [XF-Ljp/1QXibB?+D",(Fw09F30F@hIFH$H50;0+#h  0jp;0+#hԛ2x\*rx6/*6!zh [X-G#Ll2CЬH!YF on B;@B0 F5D30)F0@rh,IFH$H0;0+#h C 0nP;0##hԙ1%@!"p x +8"B@B0.F6D301F(0b;0##hԚ*Fo@1Q"ZU8x!XBXAt!+@%+n nB"۵F0Oz  D30QF(?o0n;03#h?z?|0!xSU0Yx\)љ[xU5F~B.n BEE.F0FF6D301Fe(?30n`;03#h?>?@0nZ x1ZU1 [x 'H1n`+DBݳv 1F2 ,(?0n`;03#h??13Np DBvp{0++1H!zh5 [XM!|0HF'F>4aCB!ݳv 1F2 (?0n`;03#h??1>F+D++Q*>DJ1h8#@ C`'!zh KF1x!+ I> /! F

<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<Z<hHqX<Owb<}%E0 F+n*p*l*0 x + JHEE1 1h(o(FaiF(% F+n*p*l*0 x +1  %(`iE0EEaiF(% F+n*#p*l*0 x +1 (#B3caE0EE!)iah)Hv[x320[ Hn b(!zh*F(?r% F+n*=p*3l*60 x +L!i (Y(R(3x 1KN!0Fw(@jJ#1O3`J`5E0EE!+СH"1F:N3x+Hah)[x320_F(? x!+іH%E0F+n*p*l*0x +ݮ xH":HVVEEQ H!i (Ӯg/ G/(F(ɮV/ (  ( F+n*p*l*0 x + 1)F31zE0EEch+?% F+n*p*l*0 x +hQJx+?yPIPH#sE0EEch+?׮% F+n*p*l*0 x +=22+?JE0EEh 3H$%E0 F+n*p*l* 0 x + 1 Hh8EE`iA( % F+n*3p*l*0 x +1 !B?E0E!|0 M!}l [XEh _x(%`3F+n*p* l*03x +9FKE0EEaiF("Fn)p)l)0x +vB(%B0BBaiFf(mu7(fch HNh.$#iB? BuۮB% F+n*p*l*0 x +.1 i0F6H#E0EEaiF(%"Fn)p) l) 0x +BB0BBaiF("Fn)p) l) 0x +جB`B0BBch+?N% F+n*p*l*0 x +2^Kh ]Kh2E0EE#ch+?   F;l; ۲+  x +1+2q/iO5[x320]ch #i`3F(?{% F+n*:p*0l*30 x +U1 !3x2!+ ,H"1F:3x+1+?4&Nh0F(J?J#iB?F#1AE0EEO%.F0xg*M- *=0: *,? "9F`@80C?h"+>Hb 'q!|0!zp*"r*#-0x *-[x +*ѥHٻE0x +2H̻E30EE2E#2D#20b30 i`F0;0+#h  ZB (#b20;0##hԞ-ArIm(~!2C2 xn+Rp+Al+IaiF^(e% F+n*Lp*Bl*E0 x +?1 z!D#!2rCH2Ճ# #2C22 2C2CE0EEaiF(u(ch+?h.#iB?u% F+n*p*l*0 x +˪1 0FӺE0EEch+?:% F+n*p* l*0 x +E0EE&!}HQ)300 O5%x320Z:F(?!ich C73 F+n*=p*3l*60 x +W!3x2!+ ВH"1F:3x+1+?;NHI#W/F0Fb(K#iB# 9(?E0EE1+?12+,q(o$ch+?  F;l; ۲+  x +gHai `D(0x1;+"Fn)6p),l)/0x +ҩVKhh#iDBFV?R&QI "OM`L(`@80?@h"+IH.`B0BB%E0 F+n*p*l* 0 x +ch[h4H"EE!ich+?](% F+n*$p*l*0 x +` 002+fHyE0EEai `DF(Mh"F» H2oC!|0?!z¸RT@'HS+"b]pG!}lx^+0x]+0x]+ +[+Dx.۲+ JBF/F])ѢB F ) F o-GFP,F#xB +.eJ BS@B4O.F6D;h1F3;`(7?<h,IF,H"J+H;h;;`)Kh [+\+ 4F( Ht&0Fcx +HF H;hJ`;;`+Khԛ,a*F0F>K"rU@h+)F0F #G!z [X!zh!z!z!}l,Jphx (*H# ( (L01'H0 Y`[x +ЃBMF pL0Kh۹K&0)F`Kh(J@'00g0a U0(>h: IF H" H!z!}l!}T!}X [X-O_N`L3hZ2`Yx%)"h5\O%|3hxKEX EF۵F;hOxD3;`AFP>6hKIFKH"DKH;h;;`HKh xIE33`CHt h  N;h;;`+0ԙ3hZ2`x"h +SU*3hx*P;3`B@B'O.F6D;h1F3;`(;h;;`+!Khԛ#h"`ZU\+'3h5Z2`x"h + 0oKh+jXX(Н0D< +?Y 0#` 0]FO!z!~!z [X!zh&!{!| Z# MF `F`*hx /J`##` (+hx *кB3+`+hx1)>f$I "`(hd0`@80>Xh"+H4`og*3+`#!z!~-OMFNF/h*hh0B"ۜB@BO&F6D:h1F2:`(;h`;;`+xKhKԛN+i"U=:x&*^   Bܤ KFSE*iH۪ Eȿ#FD  {2hYF22`>h\IF\H"\H23h;3`+o FRKh  3h;3`+IKhԙD\3PT\*Xzx 1)R0:BN  E ܤ KFE*i5ܫ Eȿ#D.O q:h2:`2>rh-&IF&H"%H;h;;`;h;;`+KhԟՓD\3PTFB@B2h'F7D22`9F(?[3hp;3`;Kh?k?m +iU45!~!z!zh [X-O} FF#1(Kh#!i #"#i"# F(@2FMF`h7Bf  E?`IDq(i 2 >hIFH"H! : Kh ( : *xKhԙ0+ # " F@(i!F0D> JF F[hM>o HF }  E!IDq(i 2 ) ( : *TKhԛ0+# " F(i!F0DNF>P #D!x)7DAK? h  EO QFOq1 Di2 3KH>"h0IF0H"0/Hu0;0+?RC#" !F(? 0;0;Kh?4?6/ #CH J+i# K hKE &`S`9Ho h0 `V:FFb >!hFJ(+Ji +hO 3+`0FF+h;+`+"Kh C "hFB+h;+`+Khԛ&h  XFF$F(:F1F0F( !z|!z!zt!~!zh!zp-O[O[N;h3h3sh3VH`oSL#hRK"`T R $0(F30(<+ # # | FOl E ^AKh 03h0sh;`s`0;0+a7KhV  R2 ܾ' `FSXSP ;Dhh0 KhXhhh`X`KhhXh`X` hY` ; =?a [!zx !~!|!{!zh!z|!z-A &M2; Y J#+`Kh`JhZ`\ Y/ D+`hThhB F FDF#F!~!z| !zx-CF LFFh"hB#hO bh8F P#50Fh`0Z"`d1  "`(@(Н IF H! H4`h !~ [X>~IFFH! ! [X-O]NF FF3h˹IrhK* FG()FH =pCO>#`o `Ob)F9>oB>?# FY$(pCOгhS FY(pCO3hkh[+x/+2(FYH)F FY(@D3h+@!F(F<\(8рH"F)F `(#FzJtOa!otOb!F `8 `RF(OalJ `! `Y(gH)F/!(F^勉/! FXG9F@F<FX3i+@ـsi+YOX8F:WIX"F!0;0+@F,F<8F (0F'F o3i+@si+shoc)FF[ #FYR oEE*O8S=( ]`Y6F(ѼB'O8S=N ]`Y(((N BB R1BB; ]`ZF)F= ]c ]`JF!F=v ]c 3i+Ksi+s!F(FY(Mi+T ]WX2-dL"#kG#cchC3B+ ;hS#"#\0.+ѻi3k B8F +ˀmsEsBs 8iB8FB s h0B_j BF7H0ҲCBF# A #h+ii)Vi&J !! X i(j)P+j J !! d XF< BFPF <BFF8jpIF<BF3DEFF !~2^d\F(ѢxF(Ѩ 0YF(`QF 0(Dh`:jJ!F0(D`| FajXOrEp;J!! <(j(+?KBsD( !J!<j-+? KBsD-;B//3XUUUV-OFNNFNJF!Fk+"FF Z!`F 7h/(FOYk'(F:Fx=h(F=`=h+[1IP0;+R#llal lml l lm%H\!j`jAFXF#sal[\0.+ѳi+"!F(F3l+sk!jPF!9F(FF Fk+)њ!jHF!#sc!~g9nh2-GFhFRI L :((IjF X 0 J`#3X#ah'%O JFAF0F4CfюKbml C"mCЊH|K`m3 id#eBaoCC  Co C@M#hE+c)@c(@G#*j+[+Z oKc`l+@rcm+@ph+@n"miKiI* F*F#c.e0F`i#d1G+HO|WdotO #ã`#d#3`ce3m3Oe`#3ced&#`#3cedO3e#"2#Od>`O ## 0#cf%E#c#cE #"cdff#cdf###`#!~@th T`ezx#`#Oa' 1#'cbb#cb#b#a##d##b##g#cg#cd#f#g#g##a#0##0#cdE@=X+IF+H!  E$I8Fj+[b#hA*ѢEEK#n Km KK+++KK#n Km KKKKKI s [X!gKfYfeegffeuiyEu8FKh<jFHD\ D8!X8FKh<jFH D\ D8!Xl\m!J@A DOb!FXC=hIFH mBh@AiJ ##TH nKJhhC F Kh F!FH Z [X!P!T!,K\hjHXHFX!Xh0lKJhhCKAh˱ # 0bKBRK!j0I H 0KMhK*FKhXAOrDp;F F(F0@Xѽ!~!~!  !! Kn:f*oB (КmQeppGIX] Z [pC O س_гO I * @O г`O% /  | @ = 9K-AFhmF,#4H F3Kh۱3Kh+5 #"2/K!#0,I P+H9F rD)K)JhhC40F&KDhC%KhKhpCOѨhD FKJhK) FFKohX oOrApaF;< FF9F@F 8K0Fhv!~,!~!  4!P!T!L!\!$!!,hF"K(FF  BKh[5B I#IYBBAI[bBA5B 5B9!h!p8Fh8#;CЪi Fij h-GF J~K}Kh F`&h@@@ #;C0m+#ajoH z0mKh+| #'7BiKBRK!0dI 4ibH XhijPFi L\Kh#:h!k[H Dzh!jXH @XKh#hiVH 8h0C_Wj"RIز1C!k #NHak LKh+g  IKJJhhCf0F=GKhh;FKh3pCO=hpC O0FV he;K*Oh:K*F9Kh<Or@p; FFi8F I# h ! I!0?gjH "I"OHj8F KhK0FhZ!p!(,!  4!@[!bh!H!P!T!L!\!$!!D!,!~!~RHK-OFhEiCj3DDKh+DKhñj3DBK FBJBOhhC55;hE FOi9N!i3hB ݉C"i2`#h&˹)F@F.FF@F.9F0F'~F5OEE1: C@&06hi "2B  E KajR*h*jJDVEF FO !~!~! !L!\$!p.K-GFhEiCj3D*Kh+*Khj3D(K F(JhhC5y%K5hE FG꽣i)F0F.d'FF0F. %hFG #;CGE '0ajKj(FFE7hi 6!~!~! !L!\-CF#Kh Dj4!Kh+!Khj3DKh4.h'lp.C ci#;C/, 7W2k;D B 'L0ijSj0FDh >i!~!~! !L FFFhFCF L K!hF8 F(AkD kh Jh@F(m(R{hF;`+ W_hZ` "ppG-OFMhAW LO3J``#33#a`0+?bzFK`cahBСi"h+szKh(kyIhW(l-Kh+,I )<,()I"FH4$Kq"hBFB8 I O00(>0+I HOq$&H!FiGL#(  W) !FH J`_ h\!pt!q"--OO 8M$8H+hFFh9FYFE$кXO;XF -I (L)Kh+(I(I FO $@F+hAF#H[jGF0+hiRIJF$HF48 k!F@FG(HFKh+II f*hi!k HG("2""-!p&tLo!x!q/!MFHFF'p1FH鈹h/##p-K)FJ O0 MK0Fu")F9/#X;9FK JEx#p !|!phF;`+ VhZ` "ppG-OMO3F+h( (+hjG(+h kKhFF+7рL4 F+ FF( F((O3uKh F# F(.@΀nI" UkKh  (ڨ Fz(оbK4+`O"FV(:$8ZJh P ;+! FKHIH#y/+ 8KH9JIFH4/ F FEKh+ F(0K@J+hZFKF F(O +;hIB FlG(U!B F(2? F(: FN('! F(!#y/+ 8H9IFH4KBFHKFtKd0[:vJh (;hjGI" U U2@a("-!x!|!} [ Z",-O/( /\M+hlG(+hjG(( TKhF[RKhU:PJh NKhùNNT+hjGJI" U (ڷ ++hIB FlG(9KS@ F(1KS#@ F(+Kh+*HVj((O;h C#HV\谹:h0B`CXKhBAK#BA FM(! F(+H+K#B"-"+x"-!x",!8"- !|"-!!x!",#y/+ \8uH8duIFH4TrO0:hCmHU0+i;hKB`CXKhBAfK#BAYbO;hKbJ+hVZF`H43h \Kh [Kh+ (94+D +B;+;PHF+7@Y0CکP;h+?ծCO;h+?Ю(hK"`>J(F232;Kh+:~(90+?R̐0+?K.Kh#0B&HU (00;"K!0BAK!0BA%K!0H4+> +<;+ P( H4P",Fd"-!x",!|!!",",!p"-!x","-",",",x"FU( :8Jh P0FU逻Oy$# -w'.BCX)s0F-w6Kh /CY 9 2J#h @I#* .32C O0 /Bw0F*F(uJ0h 1cE D-gw*BCX)sۘT4B I",L!H-AFDL- 2*s&%' h 0B@DAq#hFi*F9zF+Da0B BA*I  (%K"O7`#Kh#hB+Da'8Fua(#6DBr##h2FF98F3DaKhYi)0F#<)(0"hBDa܈!H#",T"-8 Li#hB ٥i!*9nKah8@X8!HT-AFO FL- C,=iB1F,F&DF"F9-F#DaO0!HT-CFd FO-v C,8hOyBv 0O,FF"FF9 F#D,0f %FO0T!H-GBC̰FFQXUh 1F"hF9~(Kh59J#Fh vO0",y FT(hKh59#FJ@h Y",-GFxFF/+O80O/ (FO /!5F(EЀiF(FT&`@(Fd0/##piF(FT쐻p@@O0&Kh#:F1F(F!(FT(iF(FT` (FAqa#jF(F`O&O0",-GFh#x/+ 2Mhh(1I"j#k`O09 "G@ATy0UH9 #h#J3h N3h E'0`!h;FBF1,(90C@$8F<>( K$h54 JQF 4`D"+ ",+!",-AF FFFFTT(@.Kh ( 1BB 1BB#I2F O0pCOI F7h FT(9xJ#Fh * FT(/ !F0FT(9` F(/J3FAF "- <ZkS0F(4pCO)BCXPh(s U%BA## E `iF(FT0pCO  I*FXO0'0#"#iF(FNSF( P Q# 18pG-AFXUd>T(8>J3Fh 0N1F @F( J#p`&`FJF7F`!FKJO(F AѿKhKhZQJ)+@K`(P @? hz(;S ͵AuAͱAAAAAAͽAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA͍͓AA͙͟AͥͫAAAAAAAAAuAAAA%)cAAAAiAAu)AsAwA͇AAAAAAA˽AAA!%)A-SossA ^4K)` 2I 0I` 7-K,Khx-*+JYx#``#'K"&K'J`&K&K&KKh+$H(π!K"`" K` 0K"`J#`J`J`K F","-T\R T`t", [X!L!X'q!",!7"- ",=","+","-",Kh(A vKK KKJ030Kh0'Ku E  0FOF Ib 7~JhF; F Z`}KJYKKPKNtKh(?\tK{JG{K|JDzK{JAxK{J>wKzJ;uKzJ8tKyJ5yK/dKhgK/wK)wKwK_KhuK#0'rI`*+?nJ`nO#< h(RiK"ZakXL#h xCeH `x bK#`aKL"p7]K`(@|@ h(@%VK"`UI  ;6%hOI(F6(@߀ch+{a4;i3;aHI6v(}i4CIHF6h(AIHF(@JF=Itz EFO rF(Ѻ%(F -IHF6<&h+?bJF)IJ(F'q","-!}",N",",",!",|"-T"- [","+ \"-XI6@;i@FO 3;a~I"@F6訹;i3;a%(FO !F@F#c")F@F(#XkK#FRyi"(F4(#!(7F ;W[]%hYI(F6(c`h(?4!(ǭ>FSI6r(Oeh-?Ү47FQF(F6fLI(FFP*Fph(!{(ڣ?IHF6Pp>I"HF62 ! !HF8N 0Fc(?![(0FWF(QF(F6*0F%~0+*F7F4!(FĐF&Kgz0#J!FO KF(FAFM3I@J `K`K3@C‚ IHLMO.@I0;0+򡂰1  Zht [",Ǜn# [Xz*πFD@JM{Z`{)/5;~  &)W!FFK)`? I Q7K"F`K"F`KFhK`K"F `KJ`K"F@`K"F`K"Fv`KFvh(ӮJKHh<#/Ffa*Тe_  ) {J!`zJ`0`vJ`wJ`" sJ`sIFfdKh@(FVmK"FV`kK"FF`iK"FF`yF6vT"0aKL#`K`F6c  \I\I\H#[IXHhL#XIUHbTIVHuAKUJUUK"F&`?PK)p LIKIOrF&$HK"F`)KFH0h5&0O30F F(;I H.Kh ((F5K"F`3K"Fv`1I -ɻ/K"+KFfKh<(Ff!L!"-"-'q!"-!7"- "-"-",",","-",}"-0 [XFb}",!xf}",",",!hXTKh0(FVvPK"FV`pNK"FF`jLK"FF`dJK"C`_IK[HKtAKhGKeFKFJbFKkb# `DK3@bCJ2@?# `AKV#2d# `;K#)F@8F\&>N0Z "pM h+0K0J`0N7++?j,N3hBe"T#Fa(03h33`+U"KhB!I = KT%`(ͺT#!(3h33`3hBK"`0'q",",",",|",!N"-TG 0 ."- T`H",XKhh`pG"+8KhK ILhMh8 KHh5@#!F(F8"+"-o [X",F1F"2`FO[?-0*-5,B.[-+̼Ex"!- F4x]/4ѥ!EBEAB;xK"Jh*O0/+7` +,*1 F+Cx*++9F7 x+#2F F(?/А-ѐ о]мEEؿ"E""-FhDx/+5CF(@o I0O0`h1FBҘ;8aB8 D0(DB (py}9=J.KFh M,H,L,N-O(FA F0F8F@A(:$I5"H5@CBH03H M.+ѝ@$H F.FHV0Fb@BF0F1$(`O0",d<5El-O]xK0 EFFF @@BFh1 ;Osi#0 ")F({F[h LcB٘E" LcE𘀲hDF0hB҂FJSI:F C ]&)3\)+Bx0*,9*!0: B((R*B F)D LcD\* FPF&*BhD4+x+3Osi?s*Ѷih;'Ssi0x I:F H0x+?S@BYF8F1<`II[F:FH Ld LaB*F;+ La#B#p x*+?gI[F:F _",x— [X±-CFMx"KI ,EF+xGI2Fr\+55B F(C'"AF*p8FqFOcjF9F 8I3FjF_ FO9HF M2x(F+F038F F\+B%P `88F FIBF?ea3aKhR`\`g+P+S+G+8F F3xI2F0  p+ s+aiAaiAaiAZhaÌ> ",xg-AFFFx;I O0 _F IO`(F4 Kx`h`` `hTaêÿ",x K M N Oh#"i 9F "h)F0Fn#di",x [X0Kph[UD4-I"i h!B"a p(Jh)bhz$* УB5$Jci F`#4p0 ``I ach /"p#c`O0ch/"p#c`&h0F4`83\/+#3TO`#aDF[iB2I 4",x"-"-",3V#F4 Kh#i!hy/+di,Kh@ Kh Kh@ @B h9F5( h"9F3D((FS(# O04",x"-"-F_KFh[y.+Cy.+уy/+˱YI(F 頹*FF2x)Z*,.*,.* M.hv#y/+ cy.##q.9I #+`x.h  5C!F*F(S4+;+ CA@F(Э CA '8F4 aF8F/#h;#` I:F =I# +x##a ;x{!F8F(%2I:F =/&a*c* C*M* &iFm*&iF$I;F o F#iC#a#И0@F(IBF#iC"a!0BA I;FBF D Fg#ca Kh` ``hTaB~Z#Ƨ"- -CFK FFh@= F4W! Fѹ I  h(1BBѽ@F#dG%"-0Z Lch !@``( IO0"-0yCK-OF_h/YX4+J84+EB0CX@PF4W!F\F LF2BE 1BB( i, F(  `xU##:9G&@ ) FI mO0!h @@B04+ ## 4i;a+i h0 F "-0Ǥ"K-AF\hS8$*-4+);+&B0CP@Vh0F4 T!@U 52EBi qBB F+ѽ h0 FA"-0K-A\h&T4OV_]/Fi8hy8Fv-ѦBѽ"-0Lhs!LGP`0I O0JKh S BB L h)K`05j#h Jh  hQ "-0",", Lh !@ `( IO0"-0 L#h !@=u `( IjO0"-0SP" 07@ @B-O[NF3h+B C XOB0C XpCEBQFCO#CFGFF(Fh+;1@Q"F( @BBY"(TV O (JhaB C`E`B0CE0>!BEB<i BE""C("FBE/ BX##h a` I *I  ##"-0ȃȾ Li !@=a( IO0"-0-CNiñ%O F@Gi\Yd### hj5B"-0-OF-F'K0@=HF4X! FSFYEHEBBЛj+0 F `v(H%@ FI O"-0*-AFKFFFiԱ@=(F4T!@!jBEB!BB(FO0` hZ FW "-0 pGF!KMFFh{x/+ iF:8I*F  MF( (FI*F(F. `XI*F  F M@s`## ##07Kiab`"+^u"-0-AMNOilcha3h cjh hZ;h C #3### h Kh!j h h Fi"-0",@)s¿@9@@!F$%FB["B8F5D1F F4FpP%5 D-OFHM@,}ЀFLGRXk1F@FT @FL$O #hB-Фi, jF(q#"#2(_2FAFBLU&`##0S' aC'@;#22BB 5b Jh O0 M2FcB5NJ2FAF4@(B`CXQh BA 1 52 Jh  F5(JI iɦɾ"-0-CF*KFh7)I8FO @"W F5 F(70FF `p(F``0G(@h,!h0F3(fh(F1F3(0F(F``( I O0LF0F FI"-07dF KFFh h@"T @T!h(F30ah:F(F0P0`h"-0 F!F(O0BB5/3O.//O .MTMTB DFt039TQB+DO06 F"(D44CO0 TlT FF0OpB DB0[(DDK@,-A]\FO. * F7J#hBD",x/+61JkF@   (EO0 ]+]** .& CDl+F]3D,?*D+FV7`\&JkF@   (JkF@   q(ڹ JkF@   b b(ʦʮʹpFh FF*F3e-p@(e"P/F/HF hj#(F#`3`pF  FI Oa KhOq pGOa"-P0#L#`\3щhY`ah3!`!`h(̿  0O0 "-P8FxO08I"34Kȹh2"` Iw"FOqF(F O0"`D-ANOt`Fȱ%h1F(F3dh 9F F3xI#F*F @ K J I :O00;+I#F*FK"`3G=k˙"-Pt-AFFOq0F(O0BB! FU4(S #840K;+cK@A@A ` @\K "dFBHY"F (lM"F<tE" !@|??Dy`" !.B`BPH`BPBPBpBH`PRH` hB 8 &2)1)(4*1y/)BCC"(4#$84K+!ٖ(4/5)#4(4C C(43y/+1#3q `-"CC$"8$K) # #4{h'TPYBBqSCC(4BC!X${hYBBA "-\"-d-CXŰF4;+: 9("((Kh;%(FETI( TI(T~I(T|I( p"-x3S[K"`KJhhCL#h+I X##`KI Hh)F HI F0@pG",",",", [X",8!HO`I"M(`PI F"h` 8(h" FOt Kh+ JIO0"-x"- s FSkK"`KJhhCM+h+I #+`KIHh>H1Fl, FIF H0 I p@pG",",",", [", [X<3IFH  B [X̰HF$ FLx/+I(I F(iF FOb0H&O\0 &1BB *1BBTXMJh3`pG"-3bIFH x [X-AF>OFF|ẖ+ Jkxl<+=+/ Bkxl|+#F Kkxl&+#F Dkxl=+!#F = jx+*k' 5jx-*k( /) -% +# )$ '#F $#F !,FF  b(".lz".`".h".T FKHh".P<Ks[hM.h+`K.`0FH"xK*F3"` F1JF F3hx3h3IxJ\ HL3(F!Fp".P":|d^\zopFFF#- do[ls 8H)04 |DHSBHO)Ѳ??=H ,1DFF Fp1>FJC"D@`?  !,CC@?  !A\@C@BpO!!FBAO!!FBABpBBO !!FBBO!!@Y@C@ГПа-OFFt %*F F,U G9F, &*FFH## ;FG1FF,CMFDFF F(F!Fн".P"K𵍰#FF#e,F F;F2FF F(F!F (Р +N9FF F/. TF F F FJ!T" ".PX8 FMh)+8!F".P-OFFFFO O ,v,~,7,:]H,##LFF$,|",1FHF0#+F F PH,'+عtLH  PD T'F+T)8h +F F'6JOO6#3FFc8h" f## kK #%#|3F9FFHFbC $,F##k3F9FFHFQCC`.', JO6$4FdOFT"X".P-OFFFF*##F#+FF F @+ FF m;FBF0FF F  <E - T"5hX`<FMF+h3+`MT( +h;+`#Kh O0 +h;+`F#Kh .$ H F K6 0#KHYh .".".Fd".pvK-GO sL FqO ;hhtnH! ?F(AlHe(O S`dH!F0FXF aH2F!F0F0,FPF0(0D0jF2;h(Yh0DN F04F)0FO#x.+'cx.+cxIK%FO7O "!FFPF)FF@H#x-+cx+=Kh,\h#F/+9H! (0FMV({2h+2'0F00OFpCO /0F'0O 0<F !F0F1JF0F!(/2h+2'0F00F@F(dp"70tсэѷ".pѰ KYh)@"H 𹹽@Hg".pT8L$(M(FF0&Khh#%HܲL, g"MhhH /kh#H)L h "hhhS#S L hCh;C`+ "hhY` "p h #hX 2hF HhZ`8߼"7".p t--G FfN2hS#S5,FT_I@F1F(\I@F1F(@%F'O E\,@/Yx0)^С\ز({+yxxxxzjxlnxxxxxxxpxxxrxtxv F0hCh;C`+f a2hhY`pCFFK,+hk0hCh;C`+U L2hhY` "pU;+Ѻ 0hCh;C`+M 72hhY` "p0h 2h0A#$I S3AF$ xF10(B0јF$$ $ $ $ $ $F$hZ`hZ`%FO ^'F[hZ` t8<F)HF FhBhB< + #O;h+@"Kh"I"H G{h#zhIH @H2F)F &,IH 4 FIFH ,2F,L hCh;C`+ "hhY` " Hp@ qhZ`\".|".xpJFh>!`".|FK aXi0XaO0 F".|K\i"a"FiF aDDM$ Kh3 K60 F! 2 2".|"5ddKh "` ".RK` ".FS[20)Fh FF FF2"2F)Fh FFO0R FFO0 FSK2!Fh@pG8 FF2*F!F8@hO0R]pG FFO0 JF0 H ! J :HBѲBPh2 ".HKhpG".pFM^F h( ")FMBF hM&``h( "!MCF`hMf`(FpO57MH+hhK"6 N gK\h\-h Kh#F2F(F``hBB $h F0"7d".";sF$N Fh+' *\<#XC`h(F1F0^JF! Fg j` g++#x6+ cx0+I" F,hp F0"D=0+<.+(F"p@N".K"`"apG".F #h;+h "iF'[h#a iH "iF" FYh-dhhhh a0L%jH*F!U00* bB H!Uv0 J#jhy`q j0 jrK#b".vFh+уhch@Kh"hh3";Ѓh-GF!>O0FO5F;h3;`hFsh@F+gF4K\b;h;;`#2Kh h1`h#hhF( -(FMD10hF"Hrh@Fah:";h;;`#0 -!!(F }+M! s`h!- PM$h`h!(FM+[".".".-C FOF^0Pc!N!h)3_{lCP rJSb$qKh +πlKXj(ʀ,ǀ `hAF^0hh, `h!^0sjhC$&`h!^0+h+sj+SKh @)F Fje)F F@YEKh $)F Fp0 `h!Z^0+h+sj+h,Xtb4Kh AF F/Kh AF FN*Kh AF F%Kh "ioK"Zb`h!JSj[ Sb`h!KZj*"Kh Fv")F F H ? H s )d"."9"7\-GF!K!(Ft&hbl` @EF ~K^bױ ^0khD(F& 0+!F":|".Hd(-GH(Mh7%L $K & hh0*x  0;Jp0+k +0+xF;F=F +{#hF K(FjlKXjK"Zb`X"."5h-AF!LF&i3ahh!%^0hh+#i;#a+ #`+ "i:"a*#`ifb;a;+fj*hcj * +Ѩhhfj++".d-GF4GLF^`fj  oh/[ `i3a/h)i0+/7K7Nh0W 5H h 0hCh;C`+= ^2hhY`="pxh 0hCh;C`+0 M2hhY` "p0h +"yhh hAF^ fj"h;+#i;#a+`?h"QF8FhhhZ`hZ`+#i;#a+`ifb;al".";pd":|-AFFh`h"0eMh,4h #'hdh3i0F0YhN#dh9F0kj|hj^ R"h *9F0kjkbvh#F".d":|-GFhF2h J 0chSYKZMhZK0ht WH 9TH .SH (hCh;C`+3 q*hhY` "p(h OJM.+h+`%! F&RF!FF(=.HFANM#sb+h;+`+5нIF(h " hZ` r((+h;+`#.Kh h! `hGl+h;+`{. .'!Kh+нGKh+i+h;+`pb#Kh 0+Уh+Kh K0h U H RKGh Ƽ";p":|".".".dOKpȰhh##IK0۱hñGK &GMhGK0h DH h BH =Kh !FX5K `:Kh $,5K"ZbHp!F(h2F Tdh /H 'Kh V"K!h)L !#h3#`K`h #h;#` LXh#h 3#`K` #h;#`+ H Kh Kh+Kh+".d";p":|("."./".9".#O23##KF F^0+=(;N3h33`x(H!(F")FFK0`h L! t!(F L`#`3h;3`#Kh q" d".A".K-Ch$3 KM!hbKh,`iK`[`hh(@N%#i F*F3`dh,"N'`hm`h4#ih3`(m# `+m 00+h`qK60KlKi3 +¿S< hK0+T +'cN,@$hx0+x0+1YKh+@3[h+NUJ!h3`[h Z@# ( JHdhi F:F)Fxdh h2 Yhh`@Kh9K0h Rd='O eh9F(F-F`h iCh;C`+D hY`5Fp{(F T$h,N $,X#Nh0h-[Ch;C`+_ 2hhY` "pKh WCh;C`+ hY` "phZ`hZ`";":".";|":|d"7".A";pGM(hCh;C`+ `*hhY` "p`h $hhZ`"F)F &mh( $hZ`#x04K eh:F1F(F/d5$h -KB%C FF;VF˼-ѐ- рx8 Kp(%F (  m0 +YD#x0x0+?Ȯ;+ JB?JB? p$Ja*x03+ (x)9) KB@3hF3Qx-(Hx(-(ъx*Fh# C + фK"Z`h`@"` C O3~Kk }K!h+ (@jwK+`vKh3B@L h +Y\#x0xiL9!`` gJh#c3`eK"`#dJ`dJ` bbKhS#S G`b WK` [K\J`\K\J` # fYK`MK"Z`* cρ3@ BKB@5+ @KhQ`hR`"`+@[!\mCK&0++ѽx0C[hh;Kh"`"-KbLGF)(= )K` 0K`$Kj*Ob@F FB  o(~C&K`&Kh+fac0 Jh;h`3 FFH{Kh+KF+(6Kh++J bL$s".".";"7"7'q T`t\px";dd".".R".+ KKXjhKBh +` K  j^ C #F L#cb +@ `b}K"`|Kh+?,(tKj;Kh! rJ`rKh+h K!jN FA &5F"+h `#`# _L;3`3`#h3#`]Kh`\I h #h;#`#TKh +!(-SKh+&  IK!`KK`JK`EK` ?K`@L& F+h#` 6Kh +` cz X7J`7J`h2K`*LB i3az/H & !Ji ;ah L3` K F`K`K`K`+h #`K`Jh;`[ Kh*""HKXj  "."."."."."7l";d".".":";|dFKh+ # BJBBJBAK!h`#8 +#!J F-hS`I*FF F".2 -AF F*tL$>Kh3"1FhFFKah5H 8F A2H 2H )0H1F z.Lk hCh;C`+C "hhY`*"p hCh;C`+9 "hhY` "p4)MH c1FH +h`h3+` FhF+h;+`;H N KHKh+H1FhZ`hZ`"; t". &".*8FL h0*xxB%+`h8)F.(48FL h@x+xB)F.`h84 K "0%h I:0Q;+г(,۝rh".-CFL%dd#h3#`|-#h;#`Kh˱C0[ChB h;`Y8h(5+0F"."."."K-AFhO6Bt%3xF+BQ:*(l<:+5:)lM+h+r.` F.`F*%*q H9F(.F,F,Fs$";I-A&MX+h3+`|.+h;+`˹KhA~0+ #h`h;` FOs+O3`1,`Jh2BD!՘IND !0F7(kа **уzF"  0* j` jԂJh* }J@h*0FF({Ѻ2к * sJ0hO O8"1F\F蹺C gK!HFheI2FF F Os+wFO3:x/*[ 8FK.(_ pBO@ *j @8F.MKDh2H(tCE?p?-/:h*?e/4h*?_/.Y!F8FL#h3#`!0F6F *O   "h:"`*Jh*?~  O )  ";Hp`WI".R".".-O$&F'FFFFO HdF(1   !H ;C3CvK &O h7FFFFh+@oK|BUnL h ]#h[kH% (Fb=-R%HHGHHGGGGGGGGGGHHHGHH#O O O '&$OSк)Vл,!FPF5J/0KRFXFh3+4н 03C,? &Kh+/I h `?d!XF(а0+R#I#IIOI_,н 03!XF!P F%F,l"7".tv"/X";p FN!3h33`0F+ +@h +#kh`krhc`3h;3`3Khp@p".".0LFF#h3#`#0 K>00 S(F#h;#`;Kh#0@0".d".!@0+@h j -OOM FFFGF(FX!hM xc+7CWIЍHp(v(V('O&&/<ЅH+hh+97F+h*`h,l F WHc&H`H]!Fa.+h'*`haH' h~'"7բ)7Gt";հMT$Yoք֡h-OaLFaMF#hF(h#h` .؀.:.) .c/.*TI h: `*OkF *Q"NNNNNNNNMMBJ z>N(v3h33` hxs8H F"O &/*ј0/+ QF"pJbPF@FSj,/K :* Ҳ * 2h:2`**hQ)`2h:2`* *hQ)`ZFB*` B*``"/\"5hd0~-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`3h;3`+;h+"#caFh[aaNOcihHhBȿ`XhB"3h33`ci3h;3`+;h+U"/\"."."/`7Fx F!+$Kh0 0@+*+ Khh"E;S/ x* 0; +/# "` F F/h+x =+T Kh-+x+KhBۛhD9)A+. *FqBF*FO B1 5D;+J :* Ҳ * : "+ &: [@ "F"/\".".".~`"5hEK-OF[i FK G`kh`h`>KF&ZhVh0 0;DE #x+ D`F xɲ)K `(F~&)AO 0D`lh `h`aTF E#x+$Ё+@F  F+x0H+r頹 F@F+jp H+dLEF(TFF &F"/\";h"/` M L Nhhha#hh3#`#ho`;#`+3h+1"/\".".8F-0D)FF =KjD``b8"/\) FOF{;2F6h#9F`F0FFahhh-( 5`.F*h,`#FFF4`&F#h+%`F! ʿh1-OO FFF[غ*Tк?#xGк #x+4#xSE4T& غ\#x+4!xCx$ x۲+?b+ cx;@" 4#x+ #x+4Ax#xQЙB4+4;Cx+*+Ё+*xҲ*?+[+ѠFF8F?*И 4*4"xB)Ё*FbxBИ 4B{x+ѮAx!)^)5у[x.-?l]-!)^)&ц##x+ +cO x;xɲ)@+?J[+5FZ:)5F[;F>F#HI(F(ШBqx)ѱx)ШB)x?JQ\ BB # pcF qK .F;]+[E?,7F4`5BЕ  85qE8+\+ F)x-)&ix])#Ё)\)5 k"# ^( #6 R(ؿO 5BO 5F0+?ٮOFDF֮z-OFF F"#x*+6?+4[+=cx!+^+ѣxx./](@[($Xx:($Xx^](/(3x:+ѳc(ўx+/+3F:(ћx]+竱/+"(3x/( P3狱x(ف+4#x/+:4"TL+FfjxxҲ*ف(1 x+ 1B`j`j)J(EL $BICBx/+E#<`F($0B/#<#x+5&kCFF xɲ)ف(F08Ft./#<x F1xҲ*ف( F+F+AEӯHH& 3(F/+*/#!F<8FBF(Z{.*Ѻ. "@F(.(F&$3"/\".FpFx3ɲ )F &x<p,XpxQ-ً,p+F F,F+pFF$M$N`hF;C+j`h`#F$h+b*+?+[+3h/j33`kjK-oO`hbahhjhjV#kb3h;3`# Kh +jB"`8h8`Fh("/\".".8FM8+j`h`x,b$h"/\-CFxF0۲ +عB1"FO FxV*F !F.FU*ѽ>L .++*- F!xB`   =) ЁB MB*FF !.nF+D%++2F5!Fz-Gvtv F FO#00F ! 6F0и/ N F-#<=O3h;3`+K|"5h *-OF#xF-+ F +@򉀣! *|L[?+v@+0; +m.# "`0F |F.vh+^x =+Y.@!Khj-gNMLx+E\ ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xpqK&qMԡhBK yc0fO;0+;hZ:`"yp6bK_Lh!h& `^K^K^KC;`#yp@-VKhOJ!bh,KMW;+x+1+hGN;+`+3hZ2`"p+h;+`+3hZ2`"p;h++h;N;+`+d3hZ2`"pC3`#pC3`#p.N=x+0 ;+ +h;+`+3hZ2`"p+h;+`+S3hY1`xp\C3`#pUZB2`xp+h;+`+ S3hY1`xpx+ћ:ZB2`xp0C3`#pm"7~"5h"/\"5`"."7lTdKZhVhK3xKhW+*?  ̀-ʀ|x:h*?.@A)-x*ДIP h: `* Qp :* : * Q!p : *J P xpB "pQAxp1ɲ )9)Ko~H p9)DAK0xp x):h*?.?}x :*RIL h: `*, Q!p ,: *$ Qp;=A!p5KC0 xp谶'B "pB pB p4+KhB/hF>S&0C#`#pZB"`xpd3۲ +3h;3`++hZ*`p3h;3`+S+hY)`xpx+C+`#pZB*`xpN'M";"7l"5h"/\~-OF; (CxJ\ O O =!@F*HM 3G ОKJ.h[hh<Ѻ _$O &@F.hKFh@ @@ "" h@*"b@F \~K.hh}K@,'0@+!*+Ъ+rH9BFx+к#HHF R,P$FO h49`)-)hH(` p ;ܹ 3O̿F"DO  D @ЀMK)hhD)`LI hD `xDJHKA`pEKF?JDFRF@FLDkO ;Lt$[FА'[FF$O @*-Jh*@B@"(--{++++ K  9) 9))ho~H(` p9) )hH(`\A)`!pUA)`z"/\";h`dֲ"5h"7l~ * "h:"`**hQ)`"h:"`* *hQ)`j#B*`B*`\$#"~)hFU(`*["FiL8F!;x+@78F4*@",8FCB[x+@*B$7,tX0;0+70Z "pF ( uC_/0+  F) њ)ښ@)њ =*O(`hI h: `B Q!p'|B "p [I h: `* Q!pTI h2 ``B "pNI h: `* Q !pJB "p( QB): &/7I h: `* Q!pB "p,L+1ɲ ) !h9!`)H p h8 `(D@ )p *A!pD@Hh1`f  F)@"F *F@h h F";":|"5h"/\`Kh8`(C0kpᮚ ~*ܮ=)+?֮#)F FC0B pTF"5h-CF;KFf0 "8L)FhO6Oa05J(#`4Kh;`ih`3;hfCT;h3;` `p#hp;;`++#hZ"` h0  F$AF#j"`+ i)F#j"`i*qh `s`C#`ik #jG`` bd"/\"5h":|X`"/x"FsKhK@0`-OOq5L&h02O;h;;`+FP#hZ"`"pP0F5D(F0 h"K(FhF F #h2D"`:hD;`+ `!J hC!h F+F+*ѹ"3D0FYF#h@F=+D#`;h[;` |C#`#p"/\"5h":|X`-O*(NF(O !!FiFF7V;h3;`0`KahUDи*HF")F3h 5`;h;`3h"p#x+H*FI   Ja H KFJF9b"/\"5h`x4*-OFrO+,FFi9B 9! 0308``K,ah5DNDM ,|,!,FO B ;h"pRF)F0F(fфй44tO BӔRF)F0F|(K#FНB ,* *Fx)22B8FtBRF!F0FZ(AbЕB <+ +Fx)33B8FRF!F0F=(#x+44BӉ,Fuc:h=C3D;`>00B t;?;h<`0;0+ c;`##p;h;;`030%C;`#p"/\`"5h-CFLFx7h!p'ha0ga#`Kh00;0B#hZ"`p0 h"1FFK FC#`p"/\X`"5h-AF-LFA,Hb hCh;C`+&"hhY`&O"pB"HAFK hCh;C`+"hhY`&O"pB hZ`W&6+DhZ`W& hCh;C`+ "hhY`6hZ`tdXHFNH@NKhpGhB` Kh) Khj3c1 i@ pGh(h pG pG"/Kh2`Zh:Z`pG"/-AFMFlF+h3+`0j  0j`bKZhB`h`h$hB`g+h;+`KKh3A$"."/".K-AhN,j3h'i33`@F+ `D< + +KhiCah#`K$5bhZ`h`h`#hEob#``O02;i+j#h;#`+chZb`x-h+3h-h#+JF!HFHS"!HFH(@F3h"`Za2hchQiWa Dc`F)F+: * Тh:`* H`"`h!`:`*;#`+#+p#.x+p K03`h Kh.po"/\x׍dpp L#h;#`+chZb`xB#h;#`+ڽ@7"/8 L J#hh`hRhaabhZ`#h`O3 ``#3a"/FLFI#h3#`"!(FHN3hh(7hi`#O`Oa K"``#s`#h;#`3Kh@=".pM"/".F-N!F3h33`H)H)FKHrxpCO)#" F*C!" FHj(F I$( FHH)F#" F#*C FHH)F F6BH| H 9Fp3h;3`# Kh +".ר׶׼".FLF#h3#` . O(F}`+D K^`#h;#`8``3Kh@"."/".pNM4h+hh3+`(*i#j˹#h F3`3h Jh`i`i[hQ`s`+h;+`KKh3p@rp"."/".KhpGpFNM3hB ЫBѬBH|p"/ 8ML+hB8"/8FPM+hh(+h`8KhB`pG %Jh%LcC$LehB5F"E p B2eF b`) )$O30 bhU%b)Ldp/0"Fbhc` "3Or5 FSMhB%RKhRL(i hCUOH!H& `0 hKI `7 h(`GHfFK"N '8F*7/8FH `0HhB! ! ,! 5O'! #H9hB H0,h"F*H 9h hX0;,h"F$HH^hB 0FH0,h"Fh h60,h}"F h! O3#`! ! `"3"5d v%"d"5`PtF0+gH3K3Hh3KaYC1'1N% !Ow3h33`B 0B(&K)Hh&KaYC103[h? ѻB5!0,Ph(Ќ FH ;OpO5'Qh сBU`p;3h;3`3 Kh@"3؜Or5".".8FM+hB+`Ќ@! F[+h;+`3Kh8@p8".".-OFFF 0hI FO/ؐ3QHBݪ IFPhShBE_  ++ +E 90+ і0+k0FЀ FK0#00CEooKpHhpKr@hZCB_G_'B "-"fJ!+rFh aJ !0XFXF+bD  Q=XIXFO +P!FDYch;c`+ F #h7/"`!FCH( o# X+" "=J!O#7J!XF{5J!XFu(OsB "YFN0XF*D(H@?ch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#hFZ"` "p:FYF F7¸"3 Or5 ?"'60Fp@ճ DPh PU4mh-(FB! p$& F +; CC+OrB 0-OFFGKHH[h x%+c PFPFCAH+%@JQhB!h"D0ӱ Fkx+Ъx2-+%+++3K $i ,-HO)F'KZhSD(K!(Hh3000+ kxp?+YF8F"L4F69FPFW(((F&XKC;Ԕ Z) "R,B4HH$ <["3Kk-G/N0HH3ic.M/O+h!hP0F#+H+HH!1h OA%H2O yC10CE!Ch;C`+#N hY` "p F+hh"[h*`+ HF 1hZ`"3"7Or5يz٬6t';MF(F03;D+7Hj(p(g(&'$0Khh[h .H!F`+Kh+KAYC1*Hu$ FF.)9$H0#N#O0B# cC0F4XW8hCh;C`+9h0 hB̿ # #P`p;! KCX0hB̿ # #Q`4Fٴٸ"7"3Or5¸ ntKi !T(@B"3JiH#;pG2 pG pG"3KF60 Kh Khy Kh KZC200hIͼ FpGd"5dp"3Or5-GFJM+i+G?\#+a@F;DO;h3;`(WOhpFkh",`!O O0D"F93k`;h;;`#3Kh /O! F;h3;`.K0;#0#63h0q. pC;h;;`#Kh F0 F40On QFF+#F"EPF2B03 *4w"3".".dFJJFFhKF F'-)d` FCKCJ` FAK`/N-?K60+I!F !F !F `-5K60+2KN00˹GfF1F G뭹+K1Fh0,th/@RF$H0h!F !F K603-K"a-!F \!F XvFpGVH)FG(8 IH0+/,Т"5d"."4\"3d tר FF JN js0+ ""BO0G"Fd-OFFF #`iL AFHFFh ,h+#h+(F-$0PF300"B.00OKh+OK60+@DE@"P"sGK!Fh0;0+BKh+0ñ !0##FB C )I*#00?#ЬE?O|dE,O4T`$@8`F? OsE!2 O~EtEѐ@D@T`#*#!0DEѲP"y0C0z"9"5ddp"."3"."-GF F F " F(0KN0O &@0B(ڽ'JN *3$N0hFGB4hGF FN0 +h@j"FHwO0C0C0 F64Д0ոД0#0*F!F8Fd t"3$!M(F,` M,+hhё xH l(p(Z($$$ K6 "0 D@N0h+h!7hh "FF8Fu+h*`[h+!F?"7dt-O%NOF0FF`t-N0۱$en,p,H=hO Khh+-@0+M#KO &h>GջF'^F[Qhh+,O #1"9| *@@\F#"(FF(kH)F#!(FgH)F0++ F  8h8A2B̦!@FZSKF( [, З *!8F F% F(F1hGK60+8Fz ^B4 s O O z@$("0@#!0F0F5ѾB=Ж0+0F@\F;;i#("F3JAF(FS) 50b0+\FF'Ԁ 0+R0FԀ0+8F0"7"74Jd"3Ը0 ;!KCX!J  0+0F-??"AF(FB CF+Ж0+0FdpFFJ5N3h33`F 01K)Fh&0+hm@RF*HO!F 0+ %K&JhSC JRhB! F! F%0+ Fl3h;3`#Kh (Fp-OsB 0 5OsB-(F+%". t"3Or5".1Ki0H0F -H%+H&1+O0B#(M(hCh;C`+&*hhY` "p!Kh0+hOrFH8F51hhZ`M F+h3+`e F,+h;+`F# Kh h F"3zي6t t".".HfKhh@}"7 FHW h@p8L0C1"B ۓPUP-H(F#ca823 "3VOS-C!F Fo%0.@F+:F* ؀* =*|.آ"۲+N'#:*'S" Yo}kDK)">+w++ \*э \"zx#*ѭzxF5K /CFF@Fx0? /CCBЁ""Ȁ)K /CF&KOaO#}"{x +Ѹ!K$"""I JICF%:") }*Ix/ј K$"K""+FO.?L"#>;Fڌnچډڎڔ"3xڂ-AOFF,ni+k%h-*7]sEO(( &&XUM"hBJ!(F#h;+h+}HC`h!{HzHh.F`h!vHh%`h!rHrHqHdhhoO=޹ch˱mH hh!+h8F-hfH`h!udH dh5F`H`h!dSHx[Huh!YhSLHkVHhh!LGH`QHQH[`h!?@HSMHPh!4;HHHHHHHHAh>FH;`h!DHDH2chCNCOh,=H),h ?H!h0Fh!#h + @F8Fmhh 3H}h!vh!rYhr.M"-M"-M" ,M" ,M"+M" J!Yh!V%HR%HP"3ڜdڳڸڽlcڌ d ڢڦڪڬڰڞpF N F=! FnchKdh0F)F Fc0Fwdh,ppFN5KFa6 N0+ 2$$!aDi+ <."+*UZpp"pp$i"p"3d-AF)KFFFh+A*C%KN0+:P!F FF. Kd F0!F FF.FKd0 Y!KCPO3C`#r܀/9F܀ FAFF.Kd.Kd-O"5dd -AFFF$CFЀF:F1F(FA+ph*FHF:F(F1F F -OF-l@ #0NN>MKXO ZhKIKhh 3H30KE"QFhFFp[0+-#x+:"FF2x),/*7" FF!("#B"rڿ z%L F%L/ hCh;C`+5"hhY` "p"##  65S] :+хL#hBK*Fh F*#cU=FKh+FI FhZ`"4";(";<2pX`"5h@"3".-CF3L&0 6/O?U(FBA(K!hY %H##HF^0}B(1.ܔ^0+P60+Д.0+H6Q(( WB-ѽ(Д^p/ J>FhKBKA9F`HdHpxP"3"9px+P(L!#h3#`F(#h;#`+B"Kh+>нp@~KhSy!#h;#`+M@Ĺ&F z O t0;#0#0p@`&#0@,#$0p".".d8!LF#h3#`F( !#h;#`S 8@H)FIKh+".ר".8F F@-`h/ 8QH#ۚ3Hۚ8F)t0)FF F8L&M#hBڶ+h7FOw83+`bhFpC+`+h;+`#Kh +hh3+``#h#`+h;+`#Kh 8FX".".0I " E6.Jhh` D`ۧXKZh`hhB``Kh`ZhX`apGX"5hpFMN+h3+`ph#hBchh`h3` K`+h;+`[ KhCp@[hs`p".X"5h". Li#h3#`KZ`#h;#`3Kh@7"."5h".-G*L+Oj;h3;`3OIEk%3B-3h)0Fc`ch `#h```D00%`hB ;h;;`KhӱGhh"DRi(FJFQFF*h#h`+D#`X"."."5h J0 h3` KhD`h `h;`#Kh pG".X".8L%h}#hJh[;(D`8X"5hpMN,h3hh+hh3` DpX"5hJ hh`#D`J[`X"5h-A$&FU{+@>`oCBH), D4C hp$r5UFF-8F ApG, 4S l)F@FDh(F)F۲-OK"O&M` #8F3F0Kh+hH+?KEйIF&xxPHIF&rxB/LHh:`*F[FF;/?zDHh:`*[FFnF h?g72h_:2`* [FF OQ{F Ohh2h`:72`OiF 9!I(h)F:2`*XF0$J#5h2`Er@3h33`p"(h" " "/"7"7h"5hX`&(?@F&/? "1F-A%|L FF(@030EFE0;0#pKh oKhh,|-u^r#,F0;4kDw" ,x4kDx" , O <^r#0+F3jDw!<3jDx!3xkDOHF,\r# 05kDw",5kDx",@H #< ;L hX#h[8H&0F%d4H9F#x0; +#!FF x0:ղ--H!F%/_(#*ћ&H!F0 F30Fx0;0*`h!FFHCF(F*0;0# Kh CE:Kh+"."7t܍.4Ss".-O$܂f'%F@FF(2Ȣ0+<0B7ѝKh3-8%,‗OLFFW <+tѓL h#h[ՐH&0FS.a.H.EE$7F [hHl-IHF%)((HFF'F !+0ܲ ,ٚvHIFP?x sHIFB"Bx O1o@[F(,BpӫG w iFE80l*h;F_HiF E*W<,FW YHH) oCB?0MH !PF 7]oCB? BH !PFH) 7< FAF(F FXFFF7<" FAF(F FXFFFoGO4OFLF ЩHt t iFE(*hF!HM 0+ "K`ctoCB?HEHt 0"8F!F(pF FH3H9F"7$tJܯ &"4X?$fܟ :*# p;;+pG8?  pG+B pG7#Fx0; + "'FFzB xZAO5CBAH!FH!F 0x0; +?+ pG pG8F(XFFI(F︱I"F(F, I(FP+x0; +(F8 8 &, KqUy]"FFgy24Bl*Dqd8LM6N+xñv@EEEE>,pEKI"F(FH8@8d"4Pڄ0-C FMMF(l)>KH,FJNJIHH#h3y@F#y\$IF74/BL hCh;C`+"hhY`=N$=O " p)h9y@F* 2F:F45,ѽhZ`1H+N0O؀yyB*h\@F45,$L hCh;C`+ E"hhY` "p*y8FhZ`)I(vhF F4y4,Ѽ $&U6A8F(` !F0FC 6.K:F H]d<ޔt8,fަv~T4\ތ KF $yBѽ@0(KHY\dޔޘ8Fych=U h8@Ժ8-AF T 0F0+р'======e=====;=$9==========X=7V='F?'O MF0 +0  OEѫ (@H_'(#Р0/0+-Z_'(@P^0300h Q_,K] ;+#h;#`#;#hEF;#`Z0j0+0_ OF#hEF;#`#Q?;+`(H\('D\(!'{`X"5h|"/"/~HH?('U'V'TA+7Ya+WP/-٥XCo}H#h +F"ho2"` ?b? Eɲ )#h!;#`!hF9!`+?0"`* b Bɲ )#h!;#`!h9!`p?Eɲ )]!h1!`!Yp#h;#`H"` b 2Bɲ )#h!;#`!h9!`pA?Ҳ *Z"h 2"`Xp#h;#`Epɲ )U!h1!`!Qp"h:"`;5oK"`*b BBɲ )#h!;#`!h9!`1pAҲ *Z"h 2"`Xp#h;#`pA۲ +S#h 3#`Pp"h:"`pR-j"`b bBɲ )#h!;#`!h9!`pBBɲ )Y!h 1!`Xp#h;#`3 pCҲ *J"h 2"`Hp!h9!`p ' '''\(B? (0300h ' ' ?'3D[#h;#`#;#hEF;#`{dxE #hEF;#`\#;+V ( 0300k2cshZ:\(`(}(ۉ˱I²#h \; 9) #`#;#hEF;#`+%$("(ћ+#h";#`CF+"h:"`\" Fqh)EF#`#;#h;#` #M3DB*#h;#`#;0FChFF`"EFZ*ۉ+?t0FChFhqKB#hEF;#`#3D12#h;#`p[ #h0F;#`#0F0F]IChFF`"Z#h;#`# [0F#h;#`#F0@F((F@u((@fr#h;#`#F;sh[#h ";3DۉS0F'n#h;F#`(FpIFU#h;3D23Dc#hEF;#`{sh:<)(F.@F&rh;EFK0F5#h;#`#;pF #h;#`#AF0F3Dۉ+S?sh HhB0FH_F~|#HB#0FH݉M0F0 Hc#h;#`+DۜK[hsh+C'<+=+:#x X#xF+D Ff0BF`ڊKhBȿ`>/D,$>(H#+`00F`]b0 a)F Ff(R0@Fbbe00Fa0 0O2`+hKhB`>/O4<(>(3&(3#+`'|(#&(##+`#'+` `0 (j]`a0j-("`$t`##+` F#)F#h{(3=J\V{/#`OO ;3Kh#h3#`$i#(Fld}(F*K\ 'Hh00XM}(F/FO MK]hOh:`*E{5K*\Fh:`*O=eEF+@Ӏ%/Ā:/a#/mO0K`"4Tz b("5h"4XZHIF0pFCp[O LF0 (h:`* {sKFР0 *٧gF :`pgKFO R="cKF+F`H#]KO ]KZH9F#WK(h:`*@{h:`*4O {OshZ  I JJ)OhJI@ C ST0F ChFډځO;IZ`FFOVB  }/ h#':`* O {FO FC ST?'(rhhJB0F#`#pIChFF`"Z#`$#p7#h"";#`Bp0F J!ChF`"ف"7"5h`~|-G0h $i4&F0h *h4D`h3 0 khhZBZA F Fkh`Fh+0"F!i-G"QF0ij``GH(IK0h!gEK!<"0BKh'@Kh#FN(P8K:M$!F`6K`+`"F3Ie*hj; )3,I)Mi!   2#KFS$Kh K`K K`K`+Fa0K`K  K` K` Kh+!# &KK".d".|H`".W-GM"+ha# (%*hSi3Sa(v"dd|+h[j;` O F Fl`` < e`( +hi* Y  (+h F GFp`  ?`" Zi2Za +hi+ # #F` (`` !` F (+hjiDXHj #`F+hik`a+hi *j*NIi&(+ #`IK`#`C`+hkai``:*Zi2Za+hk0` (!1`c`+hiZ* GnF++h"a(( ! & `0F[& N*h #`Fkk` v+hk``;.h3i +Ii&IO0O +hi*" "ak #FJ;F+hi++hi * ! HoLk_+hFz( +hi*! vk 3a?+h"`ac(Р +! b ( #3`+hQ &F` #```! +ha8 (0*hSi3Sa#;`%#h+ #4F` K0F ( +*h8FSi3SaF F+h[j;`Qd-AF?MO$+h+h (k8`F+hi(Oi )\j4`& )G2B±Zi2ZaO 0#`F+h`k`a%O R+hh:h0FZcH0Fh/!#FH*h##`;hk#a+h``^c FYi1Ya*)O0H-A"%0ac(< Si3Sa~FW( "#F# F`F` &FFd``4`<(>F##` Si3SaM VF0FL!5(є0+HGdH8!M*hQaa` +h$`(*h Si3Sa+hh+hiHnH8 FH"FapGChBhKFhpGCh hhBpGh"7F FFFch```v`FhFBD(!H/!K7ih8FBȿ`%F F9F FB!"FF(Bx! '! '!F'~! 'z!F 'v1i*F FB:ATKXh8 pG"7F FF)OBFBѰB0FB:K FhB`)F0FBB, 'h*F1FFH FBH#F*F1FT-AFDh FOt`{h;{`-- FDFh(FBh+Fh("7pF N L5h#h(F3#`+h(F3`#h;#`3Khp@3p"7".".8F Kh\- F!$heh$h,8h(B-h"7KpFh FB`hB`BFB#"!F(FAB 'zh(FB0F0!FFH FpT8$Mkh +ܿ3k`kh@ , !bFBV(+hB(`B`K2Kb , $`8dTfffg"7pFNh +JhBh !(FB( KhB`B(FB. Fp'h+ h +"!(F,FB 'h+"7"4XT8F Fr(KEh``8"7 KFS 0hhB` F@BFF"7JFhpGhBh"7-CFOhFF;h -;`ܿ#KUh;+݀K@i!0FB&tK$`'!Fh1FFpH:0FBzmKhB`-iK0+𫀬B{"!Bx!  FBriOr@!0FBRYKV0+5i!0FBDCFOr@!iFB"0'Nh FB\'H`FK"`'B!hl1FFEHpCO FBB'.#`&iOr@aiOr@ !h.=0FE0F`@ *F1FF/H - .0s# 0;h;;`#(Kh t'O)F0F "F(h&h*F!FF(FBEFF2BO#)F F(&h)FF H)! FB".".Td[".2pF F FXO0p T!FFH7! FBAF-&h! FBBF -&zh4!FFHH@H@pp-OF"FFCFD#O"I2F8h J!K!N-FF3h8h[%I"F8hIOhB BFYFhC8hIF| EFQFv,h+$ 6-$t8 !MFhAC Ѫh* b ! FAE KhB`8 !R FAA " ! FAB" ! FACHr"7T8F KhhBVhFhBch)FGhA`8"7-O$DF 0F@ yKhF`D``ؑ 0tKtJ`0sKqJ`pKhhBnKhB`3h F;+hB FF8 !FFbH! FAV(&PhF@ FIB(` FAT Fjv+xh!FyF(x! FA.8(0300 +AK! Fh0BF2ACF]&h* * *0&h!FF2H ! FA &h*"! FA BP"!(FA &h* 2P*F!F8F"0;0#Kh 5$030BF0Fvh B("7tp"4X"4T".".T-O&JMFOFL#f`+`:F FA L}M+hB|L h#hX@òs+v+tH.`O oI0FXFX,СW@FF@FF000+x+@F%0(0B@0B+ѫh+Ъh FIm+H!FH!F#h*ch;c`+ F#hZ"`-"p I FL Fd8F&"K,hh hJh*31+/K"`&`8*Qh)Rhx*,h*hx*!" D" K60+,KhK`"7".".dF2 F@I F60 F(O0"FP0J#FH ! ZHHd"9(FYCh;C`++#hZ"` "pN%O(F1FF F -?- !FH@X!F8FT!%ch5;c`+ F#hZ"` "p-C$MFO+h3+` #;`+h;+` KhCX0;3hx#0h4"."7". Jhp2FX h x3  "7F`NF3h+_Kh% [h+x+%%,Eі,2 ,$,,32+l++E$+JKN0HK6 ʹGJh02BK60+32+K++%!2+>++7I%32+JjF! F&@0+,--%! F&0&DR-! F<#>,33)&P#`"iF A%%F%KN R,--ѵ*ٓ60+|+?zBvb #@R CB<"7"5dd"7ݭ(-OF F!ѤIh%ehI(F%0I(F% (@Àkxp4p+F(@ŀHO #(GehI(F$`HK!hpO PFI(F$F(lэNLkh #h3#`hh!i`g#h;#` 'Kh++8F#h;#`#~Kh 7@/#3`(uO$&FZh[hxm,@qH$0FF@F6@.jHjN$kh{khxc0Fhh FF@F4@,ц&W(3$%FPYOX -V-%^hf,OSH$y(FF8F5@-,HHj4'9I h$@F8/P% ''/6.?.԰<ԐO T(?:v?(Fp5K"h5IhYO .%/?a,F %(F4wF8FR ,HF4F0F4hF@FC ,]H,FW/Kh hn(%h+x-+kx+%.?ծ42T.(t"7".".?J5p'/O D0+?z)HsD'H0C%H0FF#H (()-h030% OZhXh8DP!0Fx0;0+9 Kh+?40030-(FFJ".-AFK"`d%N-,ѽA{Yhx3h33`cYBYA+3h;3`#Kh z5"7"."."7pF LF#2 ,D2;+!(F%#2p"7KXmh+(x+ pG pG"7-C' L N131#rQ3@+1;1qUh-hFX2(F'AFF(Fl+hF"7".K@ 8 !*pG"78F M\2B ! ! ! \B8"7Ͱ#IK`"b!*8X"*42d"AKAJd2`K !J *%#`" @A!F@+P "@S  CC "7"."."."K Y"78F I'!F F!" `]8 8BOrOA 8 M Lh#h3#` b#`k`#h;#`3Kh8@8\".".-AFF F*F1F@F@-D'7 /`%Rh+O0%FhFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+`hc`` `+h;+`+Kh+3 Mh+hq`F3+`hc``0D `":X".".8E F?C K[iB F8@ch;c`+ F#h*xY!`p8\Kiܿ\KYiֿ\FXHZ!FR]pGKRi]pG\ p FKFR& ;+Bp0Bd#<p@pG-G F'!F!8sx+[I0F3\ch;c`+ F#h!F0FZ"`""pWch;c`+ F#hZ"`""p3x[HI0F:7\0FyF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0FF(ch;c`+ Fz#hZ"`'"p'=F%\KYi4\L FE@?\Fxr+ HH#*Jh-Ah h2xh+xB,K=!0FhKh0!=!F(F!@B!'F=++x;/0;0 =*+O%p=F)F0FAAqF/F5F&Fp`X"5hChL!2hJh F  F ":hoFxB #` O^8\ 4F[=B|] *`z-A("l DF: 0('uFF?0F'`T;+Yhh)0X[-jh++iC(FG `4-hhD;":Fx#@HIF F#BNO#x3H!F@'+8Fe,F'! F!F H!F"F0FGx-AFiFhFFKBh՘GF,մhF HAFH9FOF40=+sh-H F8hCh;C`+:hhY` "p8hCh;C`+ :hhY`,phZ`hZ`t-OF+LFF0; #0x% E"K)F @=* Xk.qhղB PIA%`56h;FT ZFJ":h":C/ B=*Ѱ@ pG=* pG pG-AFFF F;;JU$ F=+@`'!O$7` KDi,hB Ѡh*FAF.7`'F$h":":hIKFy F!XDiF0FF(nChZ `0F#t!;Hg`j0F@ 5O:h2:`iRsq Ch!F00DGkh`Ѩh*ikh2R"*a L##k`D#k`khH$$TCKFBB0 ;h;;`ùKh@YE $ TQ5Fh``d".":h".Kǰh!Kh@ K` K`G]K`"K`@".".|-AFF=!F BFH/G(FcBF+$t="+*U"Zp&41F('`(FA 0F#lD;Kǰh!`@#K`G]K`".8@L0`F KH-F0 I"#`0 KBF8@H":hڄ0(O!0> h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp"( ] "7l"7".d"4PpF MF+h3+`T+h;+`sKh[p@`h(1F7$hp".".sM,hLH0h `#;0p@;h 0Fx0Fh"``Bkh#0Cc`h#a`5p":h%O-ѽ@ch"h2`Ԡhch F4h,5[ՠhch#@c``&F":"FF BhiC՘G(h3DhFKFh(F"F!FeFرCh2CiՐGph4D gh)F8F:0=!8F!`D F$hh".-C' h=F #xr+&&@F]p:Khh#*F1F FCn(p('% . F&'-*Khh,0 h(F! F c\=+   2FIF F(Ch7 3C߹F#C`Ch#C` H"F%ChH"Fx% F(H!F"7ys" FFFChX)> I h2 `#c`Jh;`#Kh pHh2`)! DRx I"0F|^ch#c`chCb`ћԠh"h F` ".".-ANO|@ #heh0m:h@Fh$h Fh+Ѩh!"i:@hh0DGkhԨhhk`h`#i+a":hDd-AOMGFFF(F6F`VK'h=U Fv, e, f,&x,O''OGFC/(hAF*C)"7(ܽ@(H" .-CFX FT030;x-+F!|xHM(h*hGI$>0t`3`0`;0+w?Kh+sC"8FF=!8F F8F%A"h##3a%8FBehBh`BB`"B0iC02aC`B*@*% #c`h\=+8Fd% rKB 1\=+ 1#30!8Fpch+Cc`Dd".";h".":h8F F8`h)FC$h8H8N(x(I($(F( M+h*`hH8DDM$!FN"7` hxxpG hFxxPxKxpGsF$X# "` FF F$Lh{$Hh"+ jfC2s3H!FBxr H!F Khx21 R3B0F)Fp b(̰ FiF@ L& F@(!60BB8BԿ  BA ̰ FiF@~ L& F@v(06!BB8B  BA ̰ FiF@X L& F@P( &1BB *1BB  F F@ I#\Ch @iBѤ5j?B!F?ؿ%hFF(F?8W 3jB8FUFxCx-*xKK"I#`x K " I#+K" I# I#f(H p`h0Fx F!+Cx+x8 '0(F(𕀰0+@𐀰P- - - FF! x@ @ x8 -iF F?(E ?(=-` _#)/5_M_AEI___V[!hF;!!p@O  p@Op@_p@Op@_p@@Op@ O  @ +s ?B? +x(+ #x)+kxbxCO0 TO0QpFFFF(𙀰0+@𔀰0;+{ "+:IWep)F F#r@ @ )F F#f8 )F F#^)F F#X(Կ  FF(FFBB  FF(F FBB FF(FFBA FF(FFBA FF(FFBA FF(FFBA)F F)F F)F F0cx#x!+ )F0F(  p(++x)+kx 0xkO08 FF#I h#X=!IT%#HYD%-011 chx@ 8b`h(0\xx!+ (  (+x)+Sx+H  FH!Kh #VpKhHI3Fh ".px7 "F"xFFJoAACoBAI"F 0-OF F I,khf/x-*@Zxl*`G*-*(FF(@vJ(F0h320[\F(@>7.mI8h#.>7̡=OU;x%+y8F%F(@)h`HO>@FOs*њx*LНZI(F"F((FDF(;hB(Fx.ќKJ#xh320Z F[(Fȿu F,h(?uBK9Fh-(F0(FF ;I*F j:H ;7HRhx+K$y F0p$d# "`8F! FFB xɹOBoAE?IH:F`nF$>h!I!FXF?(0 IO*hH?QF$,,N!XF?H b(V\t4e`0j"K#J"h!KhcMhh.13`# "`0FJ3xh320F ki2FhMhh,53`#x"+'+! F@#"` F!#x++FF-+J3h20[ ki"Fh H#+a8F1F F'>F"; b(-CFFF!jL@- H9F%s##a9F H2F&D,DL#Hu";"<-O#N(F F3aeKhS#S7`h%!عOO:F!F(FJC ќKh-  L(X4#FS+`sa,FkfKhBh+щE4\. " FMKFhCh;C`+ |KhhY`$ phZ`%.kx%+ѬrKhCh;C`+ nKhhY`%FphZ`kI F#\'*+7F;x.+{x|*+z7F^H)F8F\IO6DXI F'O4{xxOxp غW غ%:Aڲ*KKH)FX +R#////+R#/U///2LF\HF!0F\(ʁFO\ ps#;ppua F1F"F(F";t\L T`*2 P(()Q ,(.&*Sb FXp'(\("(4 Y>o p Ff n r t v O\ OM ( ^#? F ;HpaF-#(@@^#a e a!F(F=F{pKihL h"h0@)#I S"xP`,dO `#I"df PFd(x!"s#;ps `H#F2F)F0uL"yI#n`:hwHqCF2F)FqHaCF"FBF)FlHKFl"c!(FrcCF"F1FMsBF1Fn[Jhh(!3`FeBF!F]AFF1FTF(Fj"FF(FQFYse"F1F@JFCF1F:aJFCF!F 10h(6 x"+'+!FFX0+6L"QF(F"s)e!"F1F #~# `0h0  hXO OKFBF1FaKFBF!Fr c"F1F(FKFBF1F(FfKFBF!F(FN.ȭB,ŭ#Ki p H.";t<"nh"-Ckh0F 5#D|tL-OFF:!LI L0HHAFF(x+=!F =I"F #;IF(Fxc5I F!,(]`i0I F! ;`-I F!(I+I(FT{bl&I F!(8`o2QF F!{`I F!(I(F0b 61h) x[E F!(sh;+ I(Fsh;Dt3h+w Np nL`#K0#M0#P0Cl# CCCdk#cc#bpGj#ABrC##bpG"r#lBl`3CCdB3cK@CcCCd#c#bpG@$ hh>#dBj80]F@k##cfF@k##cdFjhK#I>#b#t`"pFFH>" Gp[Fcc d`dBe f 8,"=F(F>.#bpXeF@khF8#bF@kZF8V#bf dH>U 80@FH>Hdj >kBRBckBcBl"rBbBd"bpGjF@#80f#l#SC@s#d#b I>\(I ]tI >J(I  tnI >:(I  to$h"phF F+x-+5 ##bKI # ȱhԢj* H)F$3h2`[hccH)FCh FG pd-tFFFF)h9%x--41hF F!Hh9h!9`kh C ;` 5 F! 8:h--sh "C68 FhJh@(F b8J8(F$( JD(FT(J<(F<(l`8FL#h# ##`e`8"<`) F2Bh:*J!HH JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJHd"HLpHqHFLoHpH@LnHoH:d!mH5mH2lH/lHhkHo3F"4,? )HNHaHaH`HXHWHWHh.VHVHVH@THTHSHSHwp )1098@?GFNMTS[Zbakjsr{z'08/7L:H;H</39H7!L8H8H1cL7H7H+L6H6H%L5H5H5K?F.h0H/L0O&h>0F5,Hch F 4\3F:Fd!H.zh\:zBBF !6{h8FO 4\BF !FHD& ,$0. 7&FL"IFH  [XK IK( FIH "L [WEV;F FFN%"h*o`0o0 !F(F#5+ { JsjqDB I"F I(F!F "<"Bx*"<8F Iy(O2 F!8@ FE"/K[i+ O2Or8 @"<{F HF  "<-O$N4M%FOS-3 @1H(I 5x#pI \F+:!@F(H)F4F#I ;PF чI@F (?FI@F (u888;x+B0wI@F j(OFWFOsBFAFHF(+iHJF)FeI"8FZ (IF(ѧ j8FNAF8F CIF8FCQF8FCLH:F)F4~II@F XHOO:L ?20+?-E?*"F@F8P)FXFV4@F7e3I@F(iB.H)Fb)FODB?W(?.)FB?K)FD KB! b("<"<$."<Ks&S[}>"1F  F8H$(Fp6 I(F K"1F(FS$4B_ $]$9Kh@< p#`O08F&L5+5 I2F(Fs( h+ h+H6 #5sI(FX(H=KH]`(F5 p J I(F@( H2F"JOa F x (( ! F( @pG#pO0 Z8 L M!hA8@`H<ȹh(F 4mLKhFJ!h)FI(ݝ0c+ C+S+ H s+##` m#"bx0MIFhFF( ݝ0Y+ F(H M0!F(FA(HKFHhL"BL [mI#F"hFM("iF F m8FMFJ(F>K!F(Fh8@ [">L"BL hhDmIFFjF0H mkB If (ݝ1Y+cFHAdr";g*Fgj zF JOazzgzGz z .]~7 FFQFF+x$+kx+_(F>BUxT)GB))HPx;Kh+IФk"#FC##Y@8C++R#====>=====> ======9>cڲ*HHO0F0zg ` P0 zg    @"bxmLKhFJah)FI (ݝ0n+y+#c` m#Hz"bx Kn:f*oB (КmQeppGI; Z [-GFF"F )F# F-I 9F+H V HBBFE 4"K$")F8F(!FH NFhDFhO FQFS)`D0FVME0FFB6 &/F EL [Mxyb"Bg3<3J04M4N)FL AYp1F(,H$L0*M'NN )FB?p1F(!H N0MN"m)FC&h1F(H#eMNbm)F0( 1F( Hce MSys/-OMFHIAW(ЮM.h.Oѝ0+@G0`+@BhP`0B:0|VaB  `03Fh3SsEbF”FO0 `I"+(# nGBxI `ȹI""HO0F1FF@kh+ FG 5}JO R `:(=ѠDh  F  `QFC?hx4+\ѝ4`+Xى4`0BQSa;RX[hDkB]H a  " aWHy0x|X  FIF  `A?"(CХjkO F0ZF a??@H a a#" F(kB7H aO3B{ 0k[@B{-H a"1FJ0(K:F(H!Fh>&K[h+?ʮ"O%FO3& B Z B02F;h!F@F%#D65HX MM`k3`Q `"BL ["bxx#h F0:*F`ڍiBhQ`p0pG0; FNIFz F*KKLILIS" pKI" FhGI" Fb!FEHmCH!FmAH!F~m[>H!Fv!F j;I F@j9I F:*k8I F6k6I F0jk5I F,k3I F&H 1I F J /I FL -I FN +I F*m*I F jm(I F!F'H.p#Q-;FX!O\5V/9F FB!FH F@;l(=Sbu~P-OFOFX 0F+a)cбk)`,[FFYFFPFYFAdJ@! ` LjhkF|jFFFtPFF#UJ@!XF0SI:F FT*{ F!*NKOIOInH+{;ڲ*j+hLgLggagLggVggggLjhCI:FBKhk{1?I F$k)_hh;IF FhhkBA!F+ }kjhKX DD1IB FX 0hhDkB2!F+ d*H!F)O;뉪hk{1$Ih Fk{1 IhI FJIk!F* !F k)!F* !F )O;),4;9L]pF FF & I H!F0B F@; 2F;F)F F6pG@pG8Fh`Ȉ؀R[B@[(R[B@[шj FlFbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXeTXEXTBElRuBD3l#J1C 1 f# 1 `# Q XC Q Rh"C B8Q 2BC Q D( (1BrہBA O0 I LMNFF H" I HLT+ T <)F0F\( [X(7 F( I`h鈱# M I(h:0#h jhIZ#0J"bdv*(F F(OhI8FFI8F(I8FI8F($.Ih(D4LI h:j0 +h bh I$$6?;>"bdu*(0FUMI(h:>0jh F I( H0,#H#.#90"b@dzCTbs*L+I h:0bh (Iah9%H$N%Mah2F#H*FahH 2F*Fah?H 2F*Fah?H 2F*Fah/H 2F*FpHah H"b@dt; 3WpL("F F !4I hjF:0bhI @("! "..ahjFHVpih " X I h :r0bh IkhjFahH@"b@(d}Z(d~(0 FcIh"hF,( I" MjF I(h:@0#h jhI50"bd{*-C&@J@OF$ FF#`;`JF)F FnC;hB7O%,FE8hIF:0zh 0Ie(q( O&B#B)F~F(zh !IQyhH ꖹK" FMIKH* FyhB (#!F(F6#*##4'q T`"b#XM);rd|(FLI h:0bh(FI*I hOs:r0ahHg"9F0F:;F2FHah4 "b@d@d-O(-]SLhI Fx(DљMN2aOR (h1F:*0jhI=|i 0 hw! DZ`h+ ]#PFih(4? #TxKFBFXFzI F.XtLxI h:0bhuI FtIF(kM (h:0nI hpC_jJjIkH |2D;aOS4(hYF:0F {hSD{`h+Oq ~Fб"FKFOFNFRJFvQHihhHI(h:04jh( (~}F!( F 9ƼƜ@tFi3hI Qi hha@GFih2H*ؐؠ,?5#-H̰##ihv2BA$hz#BRs(h:F3F??ihH6GHFOrAF(h:HXF0PFۂ"bdw? dx0oE[ [X~  [\(-A FIh"(4I" l!i. "(/I""`h6xF Fh'Ih"+ jfC2s3!I B.I"`hxFFhIh"+Ѹ??I*eMI,(h:v0#h jh I HB6 1c{"bdy*-CFFM$OY!IBF @Fxh48Fh1FG hC:l LMDOch`hBF" `0bh I\"bJFRh I"b*(7 FMh I(F6툱 I(F0( K Ih:0 h 0"bdw(7 FMI(h:0 hihH0"b@dIFFH  [X-OFF# HF F 3!E "j  (I(FJF:0%I ,O }p(IJF(F:n0SE K ,F$B$~bIH  ,EHIF&OjG#2F(FQD4O DKp FF bH,KB7+KB@}SB F8&IF $KBc#3B F FJK( FFp@: Fp@F FH: FFFH Fp@~߸ FF H Fp)FdictaraynmbrK !*03(pG"f-AFKFF送FFAF@3BF++?B6BBH"v02!:BCܓ)LPqFRH2;H2u鐘02F#!*0Fc!B{ FFDDEy2c+0F7A*10DX2"8F)F~<@02HHHHH"f%QupFe}k3CK#;B2BBHO0 }pT"jF0F)F 0 # H;C I I\"! F "fi_J"h pG"f-O}FFO  YH(ܦH }O90  0F+F()@CK"I#(Ah H!#J9FH6T꦳KOYhFpA@H|K"*lXBdaeH- Eq`"<) O  !)KpHd dK23DkH!?@s! D9F^JJ!aH?@s! D9FUJ6 1˹TJK2+ }B\PIg"(F!FNH*/+-2+AFJ?K?H)ؿF1JAF>h}*F#F8HND1*+2+P2+b.J9F+H (F!F0#XCF'F3FZFQF H1F6*F#F.#Cs#2n"fZU;, -a_!@#;*"kESBT*V>K2+s #F;Pҝ>0)+7JAF7HHZ0)+_2JAF3H>XE#/I0K0H*ȿ F)JAF,-HQF($K2+?"ESB"KJAF#H"HIK2+%*KJAFH)! |FI KYF"#KJAFHPF|"f;IlJR3<-AFCMF bN B0R F9NE8N1m1F*F+5HA9x3H*F1FF/H*F1FGp)H|1*F1F&Hv1!1F#H@sD*Fh1*F1FHb1*F1F?HX1!1FH@sD*FL1*F1FHD1H*F?1FA9"f1;!3DUg-OF-XT( F3H2B@02FO A# { FI2cX FH RFIF 2+x1 p J'FW @Xr+@怼BIu,FT@K%"HH2FT0 SE2I2cBy(3H 1PFsFEBAACDC  x2E+?g'#*F9F6#FaK2(@!+-/@(4C+CC@"!XF01x"f;u!± BFu I Bu31+}K2+?'#FF" FFz鈇!JFKF& .B%Е1 FEFzkACd@CEzFOFBsFF4u  FBГ!±VJ?EFz 6EEz13)BpOF 3C7F Bu/F&F=K"PFIFX\2TUF7HLF *CEOHO ##REE:F#3Fi F+#*F9F6#F K2+B/@!?4CC,C?+ >F=FHC;FFe2"F8HC?FW`&?p?C`+? 2+?HBKC}F!O"OF F0H9F }\" F|I" F#\"! FK2+h+#9FeH#"i2BBh#iB_Mf"fo#3N3LB d2C0I8(.Hl+J! B0*Hb#B d2C"I8( HP2ù FH2B1o0"ACE"0H)F2ROu-iA"0 H025;D,"fdm"pFi,/iI FHI F I FNh4h<Khñohhv,F h9F( Kh+Fh0h9FF( F$ ,dh"HF FF`F8F `0F#`kh````4l`-AFhF FfF0Fb F5)FJ3F)FF@D6<`FFk-G]Ki L h)F@(dhI:K# Kiѹ Oph +`JOa `0F#h`+hc$h !F*h O@&4%h$` ;9FF(D%C$ ]`pKi QnKrJ hrHBF|pN0FS%tBE 7F`?,J  {{ Sh+ Sh` Bv(FF0+-+ =!HFE$ 4#4;E$4FGH  {N{K 8Li 8긹 ap88C 6Hi/k 8<'Ki[0L 0M*F@A 4@#h& 4@4h+T?+,h+!H 4AFd 3H 4AFZH 4ATH 4AN S FhL(%HB"Xt6p|Lx h O ?* ](?#OrB?|FH@K2KpG"KhpG"KhpG"LR F!F N [X-GFFF5ILch!hH.hS!hH" 9F0FB-PF|'FHch{ chS$h!FFH d".<< R]pG R]pGHR]pG R} -Gm(FiFAH$@7B>H5F(F mr@20F9F7%C! :`hF Nki(iG3h8+ 33`"-O$FFK'FBO`FB Oa F;@ bpI$HV F 'G2h@OaF8H@O \F F#F9FH\ +X-]F(/M NO@kiFh'FEF GE% `PFH@-kh+hrIrJsK( FrIrH~rNlhrOrM,0!h"i) )F1FiH9Fj$h/i+-#)FrhhGF(ՄBF+=\IJFWHO Dh! b(FshOcCFcQI 700F F7$HFJKhCFKDEF x;62`qՠ  0Kh.? FHF2F#` 0B ?3`#%Kir``Zia2Za 0 F(Fzv p2i 0FhRFIFF   0+6h)F H)F"""b [X44@dz b(F0F  8F0FHF0?􀮁EF6h7hJH{iB?h*hBH#!i%+COqB?+=h9I:Hh"i4#*.S`O `##`hK c```h#{a+h;+`*1ji:ja.?~CE{jiBwh6h.Fh+si+0F;a2{Z`bh` i{h{ F{:a.8FF(?HEF?LF5Z?xO vl [XfIFH  [XpF7Mðkhsh3$ FCp@pG(0HHGOqHhKh+5)N)M0F"(HXkh;k`+)#H jF ,kh;k`+'(F ` (y,&$ Y\B\AhJK)FHhd J+hZ*`x竉դ+hZ*`x +Y,n,N,"x Z [p~𵣰#OFKNh;`3hFH9h" FI I60:h:F F6~HV#;`(FF#(F6  3h% =`rH!FI&0F#3h+ 3h+ 3h3+eHfH(F"rC(F6+':F(FC;FC{r7B3hMHC~3hHHxTC&(F"C3h?Hd(FECD9I X@(FSC&(D! ppC *H,4" ԣ 'I %H$ D&&{(F60?AHx<HtHp#(FC&F&"""2Wc!-G FI#F7OsҟH zFH)FHF6BF ЗH"(F{'8F!U*Ѫ)ЎHl"!O3d 0o{[g`#`'8Fv(ЂH9F)|[`` }H01F* [R#a0a[jcbk}R"bcaib[*jabezFfH zFaH#iclCcdglkj( e(0*+* dRVH|wjHFjc+R!h[bc:F#cKC#k"hSCBBHH{Z1FHFR6CBI"0Fh@Ip"`Fع1ù11U+і1+ і3S3;3U+і3+=/H5/I 3F(],K'!h:FHF3`S 31ES13#kKC6#k"hSCBB H0Fz@Fz1FHFR6>C'#kC1c1#d@dHt`z"RRRaAE cckO !hRFHFKCck"hSCPEBNHAFHF60BѕA0  O"A0akO BH$  0BIFPF  e0Fz@Fz(Fzm4H1F%h ik)F@23D f+H)F(HAF}cjCbceBF#HrjAFclF e opBBdeH2F@sB KR#@r[OsBOr[ HA1"#!e#ef\|(PF F hzF%H#k%!h*F8FKC"h#kSCBBH0Fzd R1F8F6\#hCk8F!k!"lKC!*F"h#kSCBB HR1F8F6#hC0Fz4(FtEsFFlFh" B$c+`,h,n3f p o3g,mB  KJ Fl H@2F I 0O3 +`K -GFXFh FF (Fz8`8H)Fd h#@F UV2F+FfBB HM8hzm@F"h9hZC6m"hSCB >-O$D FFp7m?8Fz FXuH9F(Fz$ F :F!Fsi*xlBkxhѨx@(dOpBx)?)j $;op@B7x)y ,y, ly,Ѭy,,Z( (y(hy(Ѩy()yQHyiy)yxxLIKI $lOrB2opBB0O 3mKE+(Fz@FOzOpB op@BЩx5H2Ix2Hx-I}$/lOp:O BR   op@BW+QF@0F`JFCF0F7H JFQFC QF`0FJF3m[EDٺx0F73QFH ZFCD  yCQqFH KH FpGHpGHpG-OFF FFO 'P0BHF )jE!2K P@F 3F8 2 6H9FZF5I ع#I 745  F9FZFF)H)I #j+b#%I2F(+j#bF F!H9FI2F (I 3F9FsBFFHI (I2F(#H FBF9Ft I r(I2FR0`rLh}pF$+mBpkhBыYl`Q`-AFF IFF6F0*F1F8F  I* *F;mB4X*O30`-G"mFFBO %;mBHFHj j 3FO]hBZ`0V 0+ٜB؈b21QhB ёh,F" FX,$٣B b 2 F)FF-HCF*F1F8FI 5RhB)2F,$BH"F)F BF)FHH#F)FCF*F1F8FSIRFF  :mB!chSE =RF1F8FH"I e`tX, b-OFm hF FF_C8FyF@fH9F]&0F:F!R#lfVci!ipp+pOsBopCB m!O|opNB9&FFhCE|(Fz+p"poj`OsBopCB &&l!FPF"r((Fz{&2F(FIFHFznOlX `bEO)rEn2f2 px3lf"Cl1n2fFkFn2f1  Bp3 in2fI2 3,mPFh3"h;ZFXEBH&e:F)FPF5B-GF` FFF&'#mB #k+kY5!lJq0F$0B' 0# 3+!,0( 9FPFT;F*F!FHFCF+ 6IF0:F)F FF7nB"F-H1-I /!lFhK#mB1n+ X+$J)nHc!FHFC!lJ"mB(+ X+'"mB + X+'#mBn'JH I "m#B/w'iX #d3%+R/]hO? OBڼB`\&knx05"-OF7аFF_C1 ;D,3mBB  1Drh5nPFU3h#*FCFBAE:FPF5B#E#*FPFCFBAE H Hg ;:FPF5BB$Y"-OFFFVF+q/+/H)I 'pBlJB@FJAIF1bRF+F`( AB-#B  HH ; B"-A#NF/'e 3c~@F|+FB5FAFn|F$h,F ?",+F"K OpyBh %pG"-OhF F /Eл@ӄ m[E@τ$O3%F'F C D07 *3 X0`3v 3 # F  BBСHj cO3=FsBD00+ @ [#4 BByH(1Osp 63rx*E*gHF FlHlI (G(1" AF#(11 $(?sE1 "BDDD(1%DD#DspC(1D KK@!JJKH +II((1C(1 D 3{+@rxQN 2- =F FOr!PF{ ;+K; # !  ( ! ( ! #KB"HMe ;F/FF[+?@H?-@;F /FF3{ BB%/ ' :F/FF'Jqx)""Or! 2{ g3F^ϘBOp0# ()D {Qh)!h'-?ӮHF#"AFO32 +FC%<;Op3-=F qz ). D3sqzDs 3 \ D O D (9Op/@LZopCBR_ѳ}q}CCC_i`/ uOrQFO00\-@ހO3 ^R`C@ހcFHGI E(K5wDDvDL opC@FBuuu_#_^5-@2P B6hB`+Q`ñ(FH I ( DD#D 0wwsw`IF(@,_ 1BāHFFHI F([ 1_v_ 3wL opCB|1su|1u 1F۲CR/DBڲ B?2- ;F/FF*'(0\-?PZF2#AF  +FSC?/ E/1B?*HDD$O1 ;F 1B皹LI00h+?9yFEH]#*P0B[X3 3+ChB?[X[F7HU_F5H8^"2I 2F(#spDDDe 3 9_FX)FF%H,F$H$I  PDDwopCwDuw5wvL BOuuu`D+ڮ-,D+ѮD<V,BsIr(AP-;/h_ӱHFFHI DD_D7wvopCL Buwu%D !BmHFF{HyI F 0 1D/F{FqHOrP( y jH Ch55Sh03h0d BiF^HM^I K(?Z_%d`DBY@FO3DQ_`5'#FJK 5\B $DO RP0[E?DZ =FHF#!O31AF +FC!D00ӹ  BB̫ ]#K*F5B$D$@l ihd0]C`Bc`+FFHI (?DD`+ uwwD+ -w P><-[r"-C F#Fi?NOAEF@FxF08HAF| HFxF(8Fy1HIFH8Fy@Fy+H^Or!VclСk)#mB"H/ X( +!ShB khC`5 !縹HI k" P F H H "7T 8!L5% %" 5F%ѹ 5%UUyJyF@U8YhZ`F F!`FF Fh)Yh Z`Z`"h"-CFNFF5F$ FU-28FU%JFi`AFC"-OFϰ F oIFF(EmN55hEhIhH4 QFdh EO 5jnDB$$5Y0hnx (WHV 5 1+$5*mB MIOH7 O"x2*$ 4!;(hBC@F#"J>Z2BB?Hjn@F 4knB EnOr!3f;F4J !O J jnhSCLFF F  ! "YFK@FvK vlopCB,1#u,1cuL#wL cw01w01wLhC`#T#T2BBHdjn@F 4knB m"y#7G"`L y# 5"KpG"KhpG"KhpG"LR FL!F   [X-GFFF5ILch!hHhS!hH 9F0F-PFyFH|ch{ chS~$h!FFHj ".<< R]pG R]pGHR]pG R} -Gm(FiFAH$@5B>H5F(F mr@20F9F4&%CK! "$`;"h @! ! |`-G] F  .%FFFP5B0`pC_x/!0FCxr+R#`dJcOaT0!`FUEB+,F.#. Ft``4F(U0pCODTsh|JOa(F(F @u`F,%&. F4(.> F4(W(΀x-T`X.`4|(h5FO`_ph!4&phOr@!4F.2KERE a@(Xt5p2" F(ڧ-O ""`=J3F!"!4PIF4h( h+ F64^P+I F4Nhh F4&'I F4B(xA$## F ]`h4x,x&O4x! -Xhx-4,ۻ-4 F@FFpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h``lwhd z  lm(d p lcdf`p`lSd mO(e`mKhemGemCeQ BC p`"Z54S+BE+8#FBT#!A#38 FF 8F F#T#E#34+gfXX\\|q|pccWFgfWFcbaXXSBBczgfp j $d$(^(,X,ZcWRFLH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"|!KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3!FHX0F zqil, J0hC FKh+Іq "<"D"8FF'F pchK x+`hF2BB' pch x+ `hFh(2BBРh(-AFFFF)FFee0F9FCh`D`@FA-OFHM)nH_#ClK hZw>C ЎOrE1F(Fe S`O"j;h]kUC2Fh #O [br #PF MTKh*FQKhFBiYQF[ӈ[Ӏ# 0 2Rcs 2*sO 1DO F#cF 2爈oO`FFhF0;0#0[0ch F@ИGF8%J0hC0#0[0*F2FiFF k0NDT#9hOR 0iLKih 0iF"i# 0\ FF""""8"<""@"DMFFFFH(!F(FP 83F:F@AT n,uJ2BAH!F(FFv( r I Kp@OFH M"&7 FF0𵗰FFFX"!FhF(#H0K7## Khk`hhiF F o`oA"4)-OFp FFF𧀩J2Bp-x𚀕BxX"!F#0Kx68Kh-~`h!h"KOyCFJFC:O{-lJFCF K QFXFk FB@&;F @2F@Ag ~0F9F8pKFMF&FP0  @A C  )x ں0 F3U3 KhC0 v o3!`o/"OJFCF K )FXF^k@FWF 3U#0+22C8 O FFC 300 Oi" Oz2H m  $ K F%JK H    J YJ FBq B <D@l D 7""4""j bwb Jng DFb fj] Bq  JF@FBCi+@ i%  k-BiF*@ %i nIZ0D0 DBa# 0 P  @$C C]I h)REq <%D5L D@F CiF+AMI"iLH AIKKh{JH|# 0" 0kZ2!# (F "F\8J2IhFD4H (3K+K0hOxOj%i  `I`8 K"`5j 4F$ b `nW@Tf X"4."B"N""L-OFFFFBB@)Fu Fb#"#0 0 [kZ2#F vKhvK)h 'O@gp :F74p(F0)!FOs#Or"6 B0fK@ Fh *F0F (F\KhF0ZkBiF(F!F%,F(F!FjFFQF"iZFK(hi iIk DE" :Kh+Os#{+Cx!F p#"F8F"HFQF"*KhD@F1FZx+@F1FSx+*F#F8F!F(Fe1F@F?!FF(F:0!Fp(F3x+x!FvF(F(1FG@F#C3C@F1FF@b0^Pwb"D""8"4"X-OlMF F!X"F&)F FI@@F4pCKHOF` F)F0+U0[2C ##; lM2H|3C1FC3CO#C@! !H0#X0K0F PhhFo##K#CqыHH(щK"`oPoH0cL0"! zO#=F F!SH !ȱvJh3`0tHQ#"nH(ѮS ! F@s8oPXFQF`0 + POTp@OHSHvRHw(`"! L0#Q?f!H [C"#d#X0IFIBO` (VC Nv PFr,I Bw:0YFvBv O)Kh+ +F:F)H%J\5Bii(h2SC2HBr#JF#F vF ABq  Kh+ +F:F H0JF H0#F "" T   , E")p-OF FNJ2BALH2F#F88#pSx МBp BBpb\5"0F!F0"h"T"dK"h pG"t-OFH0$ FF+F ChGFXF $ K*jF(@40k{0tkKFOqFB"qJ0 B;FaF#EAK(FhKh+>CE"iR# B#33"pDi  E# 0qK!FhjhoKBoKhRoBEKELۣiO #aO cHih( Q;C!Oa(F[JYKUHihȱ ! Q+)  hIoYEJK!FhA+JI`GJFBJih*CS9QhQBѕH0+eV b=K" @@A`##7H A6H(FJq*JhF*5` *H0)J!`S)(fkFF [(FGFТi"aRF3F(FN` I  j 2O K""4"$1" /"L P t "H-Ot$] hF F`+# `v F( !pC0@_8 Op$(5BOpr ۿHh<)rۣF#C )n+)F" .)FOr ;k&]i@pFFF;E5S@πȀ<5@D%@5Cql@qCm " B ACH0"bQ@+1-/ہK"G@A`##|HG{H(<0F+0kqCKpHoK"`67 .Pk#b0+ 0.k #O sCO{`w *u4QxєH0+@-w}RK"G@A`##-MHGsLHt(h0F+wI`@H@K"`D6 kU j(?^SF 0kqC|FF0+ ch FGv $] FSyXm(FF +F:FQF F0  ZosC 3kDg XyI`t"`"L P t "H"4"lpFhRV#-B+r3OB#py1`l2 8Flhal0Fx(F(( I1Bs  8 "l$hV#BB+r3B#  `8FF F1H Ff,uZ.J2BAT!F(F*MF*HT*Kh+8+h+3`htxh$HB F!Hh&H&J;A1H0+   #]!F(FKh˱IOr(F0#p@H(;h+ I" K``" ""4" ""L0F FH#j !F(Fx) )HK+0#p#  K-OhQF F x+%,F(F!F %$܂&2Bu82BB"(F!F0[FFFJO hR Bq>V! .8 &^E(^F0FuFH(F!FyxF+4EYh*!S FBƀXhu}K(F!Fh C `SFwI0<\%Bii(QCL|hȡLṟPF908F dK h*+`KzhB#B]HAFZK 2ZHVK" zh(F!FBO5zm 00NABq" C 0;j;;b4$;4L3B2$ h:`OR8KhP1Kh#F[# 0pCOг O?гOޮ#3pi3aO  #32+?z!K9Fhq#3pKh8OO8Fa(F!F eKFXFwuC"ц#3p"l"P T"D U 9""@""4"" ":#e8Z@0  OpYm   +I I HFYF!O[!Oi AQ'J3Am#Kh+?<3sp6eFb(нOxd8 0[m   +H HYFO[+8a8ba@FKPf""8-O"\KFFPh0 F0\JBii&QC@ph@rPF0 F JqKh+0+mKbhB#BjH1F$X"!fK@F9F8IcKhF+@hThPmL(F ##X0%UKh+SIOr(F@F9F4#pX0+ #  ##r#hkhH1BHNKh+TMHJF3FN kBBS;B2FKh;pO#DH(0?OF+O+h^kOy1FHF"9hHH)F#W00XOrIp@(F F^'Kh3JF)H3FF#'HF#HpD(@epKh+\IOr~+h^kOy1FHF""X"" """L" """"D@"4 Oг_U5@0 - w(F @݀K G0O h)pX@ F(?tJ3A`TX(F t(@8K`HH(@5   O*CхKh+?qI3;)s8ңn+5KjIh $ hd0  xH wKhS #vHU#Z 2FF(00ó ?^Kh(%*:By5cKh<.y.*N0#CFIEGu -w: '%) 5G/fn+*IEu0+Bo9kC3WD ۱0C##K:Kh+? QFT#uF5HQ*0;#u FFQF+H~2  ko   ñ40C## Kh+?f  T*QFHXQ*0;# 4HF FH2  """LP"<"("D""`Em``Kh``O@V  F ##p#IJh3` Sp03KhOsBFBOrF g`gzK 0 00+C`hLhPmAFkM F ##H0g0+K+hdKh+EmXCC5[H#YHXK"`#p| ouL`opP`n4MK"hB#OpCeF @ +hCKhZk6UkC3 eDV*uѠn;FvmF5(4KF3N`p O h#H0$ kKDF=2hI9U +m<5@$D5@AplRm @p # C @ C7 0QѺEљk0@FGՌ"" "<" "0"l"L"D"FFBB0V#HKh;HNw0FH0+?#"####ػ H(<fI""2"K!-OhO LMKhjB3Qk0HHTDLD NO EpBu_X"!XK$ K K 0%jBapK`0>\Bii!pCNFViNvIhNrCEr1 F F*FFB@Np 3BN  -*F#FECBs 4EB 0(FcCFdJ\5B ~2"heMBr(F[Ki8Fh R]Kh]Kh*n+n[Kh+qнoO XN3hMKh,YFFd `C#FQIBFPH>#3`OKh+MKx+LN{hBT3BI5sjJ1BAr2DU )X ?>KhC4P%@CO EBRF6H+Fii$CC @w+ 9Fi FP&H!Fy{hBm;DOJ6#=OSJ:CsEBOb0ѲFF/=J:"lT""1""""" "D"4"Y [X"" U"P BRKhC4PU u#s`4s50IH pYFFs`^F){EXF'6H1K EB9KN%0#Bx9j qH EEРeE rPs0D"Z`XFp b PUBEB%@@BBs#F( F H~BxFDBe"P" -OFiOTF *@F"8F!FPJ(OݱBBtJ  t hB "O-hh B4GZ"8" pG-OX"!#P0$5KF'F3Kh3K`0jB00j1FFd xC;F(I*F`'HL#0MF  B7F-t$ F)FEFKEh0۱ڱFF F)FEx+0F5D""8 [X"D"""4h hPk[kpGKh @pG"DKhpG"DKh /apG"D-OF$l`.SѪKh hF`J2Bv0F&Cxq#CC#hO+ဝIF(@׀FEHEЕJPFIFH2(h& `;h˱y+JH( #q&&KK"`2*s}IOrFis0;#0#00;rKh#0[0( #C5y3#; BR۠!hS -F(F DD)F 5!B:BF FX0"h*׀IIF(@̀F y*?J"8Hqz(7J'h/@:F $HF,I;hOr;#0#0T;h;'Kh#0[0$Jpy7'3#7DB>#hH8H+(?BF F0 fH"<""8"L<"D9+"4H(?ᮠ[!FSPF0F "8FIBF F #4F3B#NC;C#Q xFFy3#DBE.#hkHH0 #Hc#3B#{KhzH"#0JF F &pHv(c#3B#jKhiH&c#h   !F8F JF F !h F H\&O""s|k"L! -O|](xK+4HHK"`  HH! E@"#FF9C ЦHK`Hg(УKh3! @#"MK(hX"!#`0K0.hBDӑKh*@/hB`O ,hOB8-hBB! |]HxH(~H (?{! vFr @@lsH0˱~,h4O F `CRKF:FhIhH:#0VKj++bOaJC9h8F,XHb(4IK"`A:h:B=#]@A#]RKx+;h"OIPHj#]0KH9hjOD8F0b+jF(@d!Or&8Kpjh+@#OCp0/@8F( ;Fj (F(O sEm (020304### #/  "L="P"8"d"Tm [X"" "D"T"""4:hIHj2]MH& dhh23L Xj# *F(O (6cE *$#P#&#R#(#T#v 013 8(9x.h"`BoV(0+Or!FNiK Y(h*,@@"OBp /8F %KFB### #89h3B 6KF B WKQ?j+? 2BB????#CF3Kh+1K#E/K#s;s*K#1'H&K`C3Cs;s###JoT{nx+UKQ?#;C?tCh`D` "4"< "L"DKhpG"D-O}pJ0hC;kKhB }0ñ4p<9FFd `C#F_I*Fp^H#0VI; Cx C*SKhRKxݹROQ%x+ ;hB25F*ѩ%EKx-*)pC3C;hB#HFAF#(6KC;3HAF2H(?w}X"!F#P0##&K&KhkhhAh=(FTHHF#AFd(?BKG<HFAFVC3C(oho"d$ [X""" ""FnE"4n"T"-OFܢKpXF!FhOrKF\2FIBii(ACBrhBrHF0(F KhKh*u+uЕKjhB#BВHAF_%_FX3jO #D+d܊O2!FF(FQCKThFѱphhm ##X0xC+] F NY0opo}pn`(F!FX*Kh#*H*F#F4E(F!F8"Kh+"H*F#F1F-N0hF+!BB   h3`rI"hh1#CI"#I"F*F H#F [X"4" " m3?G"""P-O=NO! 4h=h#!p 0Kh+Qݣm+$5+ Ȃ0+@𑀠H(@𓀣m+:$@CE2ݸ/+#H$5 2"n@H-B"kAB@򃀂HIF$Kh#.03OH$(qO?h;03# nAHhK.@𛁔)LHـ)^H ^Hv0+?g#$5"XK1h`OR TKhhRKh#Fs# 0GDT80GHIF@0-B Y0HO$%*% nAHD%8hDDDDlAFr Fx.H.H(?A0+н#"K"8`'O`OR1hi 0KihKhiFi# 0P0KC21FC:|""l"pk"4"` U"@"@"D""Ne5OsO sT#rOr!*>`K! 'h*H`9X@"OF&k<48dAv8F6@vBqyO j[E|u ")F (\CKh3c  b1HS#0I*K(*F*F2ήBB 3FB#00OR#K$Lhi F"Kih!KhiFi# 0 =#U#)FFABGr3AG  pg"<""""@"D"Kh=j9FFd [F2FIpHJ#`0H 2 "\Bii+ACB FhNBr0FO i(FK h*+𒀆Kh[KjhB#BЂHYFV0+zH# 0}Kh|K 0C{K`hCzKhCoyK>hhtK\ui0 < gJBii+zCL FhwnnLr  @# B@B 8d * <$AC B2FsUKhVh/@瀔 *~;j;E8 +?n:h)Fig8h5O0 2 "\Bii+yCB Fh7OnBr8F@{i2HYF1Kh{iK.Il(`K!h0in Kh#i0J\B J&\%KhK(KhB" [XT"""D"@ UB"p""h"l"$"4"b"@ 8"p"0" KhKiKh0\u < ̍JBii+zCL FhwnnLr  @# B@B k";$5+ݡk0Fj#B("jB("0*kB"/𒀪oB(F "!郚bK!B ~郚\K!B @rW0+L53QK5`' IF 0CEXػHKB CxBp;@KB CxBp;&Bz75K nWFOh;j";E餉F80Dt02#K;Fo1F8FxK+!3OJ;BKF"@X\CZT6Gx.wH:F3F"$""T U"/FFG BLr \B ԃIBF O   C 23GkBBpщ3+C`nJB S 2C JBFЂPF`np F9F"#JC9F F @803(0$5+#n &\CTkDJzP5XC@ +Ћ DnIB c[X\!AA#@ F#@$5+ݝn'O 1D2;F0oBK$%BFQ# 2A# $#(PBr##Br## Br## Br#O L3" 1F (98JhYF5HXhsh;Fh/I*(gЈ"0F,N +KORih )Kih'KhiFib# 0"Kh+G (FN 0F # 0  D 7+CFOL O Y+$BFQ#0A# U""""@"D"@"}K`)F 쐹yKB jhBTimI  qIVv(QЂ(FnN jKjhBThm@B  t0F# 0aKx+@[KB@𪀙DjhB5qmI (?mUI@7(?fMKjhB5pm@B AJCK`CE CkhCE5sm[]9"6B؀&:HkhBCEvs+n[CE c]9'6O 5r'IkhCE mF[];A  9DH7/ѻ\&HO 5r'IkhCE mF[];A  9D H7/Ѷ @UK`~"L U,""dD-O 8F8F$Bӽ!F@F@g  HF8_E 4RM+h %@񜀓C9rS6 KhC/HO;h+oGKHHS$ +hDN)hORDi H=KihH5F(F mr@20F9F,%CKh *2H8F0*GJ `GJ`e(@JDKh#hC0CY-I|2F(F h0;H)F0;8H)FAOs5IBP3I<(2H)F.X-H)Fh*H)F4&H)F#H)Fp/H!H)F","$"T"(P"t"*:"H"""""pSLר"D"H"dxt*Qx"X"ObQFXF#FFFϐ)O*VFɓK6X8SEA0OrACFEp2vH9(?sO%Bߛ #8SE%"ɚ@;`p(OлBNeKeJfIfKfHfKfK]IF" O3F)/SBYF0XD[ ZF@FL YF"KF)F}ߐ;FI@p[I 59hDHBMCJ+h\7FBѓ0+;,+h 5('18K"hh:76HO04H)h2NOR 5i#s 5 -Kih+KhiFi')# 00++h"Hd!J+hh0*LJ/CKh+!hJKH) FF^"H"d8V%s"T"H""@"D " < T"#hLH#+h@b^oRHJO|jEIBC  "kBC:Nr wwDAGwC w`DvG *@ܠ *l +h*@𣀓0+#h+N(H)h0F0"!Wp0L%P%Or0#X30\@FdQF)hOR  Kh#F5# 0N 7"" "D"@"4"p"0+#h+Ho)h"0P%ORc0#X30 Kh^Kh#Fi# 00+?W+h !1c#{H%H&(')hOR 5#c# 5 XKh!Kh#F,# 0+h0+(هHH( )h#(OR0 *yKhwKh#F# 0+hkc)'rHpH()h #́ORc cKhaKh#FS# 0 +hRL%2@A+hL%2@+hlkB0UH*hk[Bd#h+@QH( HOR)h BKh@Kh#FBJ# 0 0+hl[kB0=H_*hSk[Bd#h+@6HJ( ܀OR)h 'KhO%Kh#FZ'J# 0 0+h%KZ\JKFZ)P AF)@R  +F#h+@\H(=POR)h @Kh  X"@"D  ! !/!>!"!"`"Kh#FxJ# 0 0Ă+hĢ ,%*@60%45BB1НH+h0u4e#h+@H( OR)h KhKh#F1J# 0 0+h(0+ځx)5ЂHz0++h <"x"(%#h+@ʁxH`( OR)h rKhekKh#FpfJ# 0 0)h8%<5lCBB4bH8+hblCB#h+@WH( OR)h ZQKh$JKh#F/EJ# 0 0)h@%D5lCBB4BH*hlCD5#h@+@X7H( OR)h 1Kh*Kh#Fo%J# 0 0#00k+h *? +h*ǁK 0+@{.hOp@!FpSL(@#H!FK "`ܹH(ԹH}(̹"D""!"@"J"s"#G"L } "4"8""p)0BHV+h" #h[HC( OR)h ~KhHKh#FSJ# 0 00+?􂭆HZ#h+0B۱CvH+h #h;H(f OR)h 6|KhzKh#F uJ# 0 0CsH#h+oH#h+KDkH#h+yrZ! *NBK1R)\BR]H#h+YH#h+<)$TH#h+4-PH#h+mfLH#h+lC<%O|l8CD%O|@Ÿ,5+?#h+dK"`=Kh=K) OrOb`08H-h7L 5s6 #"''pY+ɲ.kp03B"!p",H@S)H#x%!@(Fo%K!`F(Fo#K`,  ϼ"H(J#p`J`JZ!)?VHJ+FHj BH"8#J( 02"`"%)"N"L%J""P%v!Kh IpCO س_гOг_ KhK PBOг@OH "D"%F5Kh5H4I0FNF b1Jlx0Kh+/H1F.K p -KxxC ,H1F (Kx+(O(M1F8F'H kh;k`+"H IJ ,kh;k`+(F (y, Y,+hZ*`x竉ջ+hZ*`x +Y,n,N,"%P"t"$%""u% Z [pF KFFh H2F+F!FfHg p"%P3KOp-A$-`0K`0Khk9Fo-H-KOaaOp @ao(%K9F%NaO @ @af( F( n89FFOpoF(,(Fo63h4Ean`+`5`]`O 0aѽ,+ѠF"x"t"%"""-OFCKFFhZC;"D2FB#F8HJFL2F!@Fx4H'=FB *JF#F1F@FF(8F AFKr# 0B-K(FhIsB#)!  DOqOrAaF f FF H`70DD#HT"H&&&G"D-OFFF8@3RFDKBEK"`HBF3F%HE O+ 9FDr# B(FvHrH0DD"&V&\"H-CFMi Fu3K i3OhT2I#B9F0H#i%0F Pea#i*KBE)O,F.F:kL3B 0F#*FIFHF8hkL4H$aCBrAn  @#B CH@IFhI0#*FIFHF;h4kD;hPB"H&&"""$"D 0}pG-AFIO hIn  .C#;hC3;`2BBK!Fh H{h2F3{`+FihXe`a"""$"(-A F MF I,hBdhBHd  #F >CrBB$hiF F2 F`Z`+he`#`\`i,`Ca""&pF FF!X"hFhFe0p FhF)#  H0+ : Kh[ H##`  HF H(##` H?"&&&pF N Mi3h)h Kh32hi(hp@p""l"DK"`pG"8FM FEBA H K"h Kh0 FT1BPhH8"'"P"-OFF dFFBB ѣ3C F@IO*HFAFx;+6I:F(FT"YF'pEEOHp7$)KdriFg8(F J)F;FF:/"G,B'd3C #0b9F(FO*K!F0FdK@iF5?#?;p<#4C0jEۉ<"\%[K-CB}F F@𩀐0+)U h#O`n(`(hOH+Ob!FLKhLHKJL5h*8IN3OOx3h)hFOHhF Wq:F3hIFHFiF"2 E[!;3h)hF}(h:FiFWp3h)hFp0#0#04#k$ \3#j $0$bj44OS<$j8D$ @L$"#0H 5L53 #P50"0#"# }T'&"'M" "DF F\#IB?ѓ); WpLE44b   WqPEPE@@@ @ Or]K*ϽOr]KpGT-A0Kh+@J`L h(ڡKhA*潟IKx+=ОKh+9НM+h+RМHKJhhKh*Pі *LFOPFMOR1FiKih0FjKh1F0FviI h# 0QM& hO)FiMn\ h)FinU}h B9iB!}H|H#(+h+У )F hi6n1(Fn.EFnJ#[M`mJ`+h+E`O;h0?[N3h+5gH+h+59hQM#OR0ci #X4"QKih8FOKh9F8FizAI h# 03hKOHNH((`LKh#KHKK4M"`OR7Kih7Kih0F5Kh1F0FiF'I h# 0;Kh#:H7K M"`OR#Kih#Kih0F!Kh1F0FiI h# 0w)Khk(Kd e1FhC2F)FF$HNKh* h"<"L"$"("","d"'""4"H"@"D"""''"x"t'"h'"0"l(""(0-O@*O>hkB$K Kax!aEs#@ @܀ B@Ȁ(FAFF\%1FHBii)PCAqzJhPFvNArI;h@F pKh+3h+mK B#BiHIF;h(FO vs\H h CTZJ0B   `O@D\E  " MHO~#Br#8hL3 kB]0;0#;B2#0n;0AO3AF59LOR9hix6Kih8FB3h9F8FOi&/H `)F `O  I0%D3BD 3h+?T:hAFL$0$$0 4 4 0b$ 0 F"""T"l"D" U"""@"KpFF @P%8 m8 HICiB iT%0FaD% a p"L(P KKi i@P"0B@"@FiBa"LKFh 5p KB0BB 2BB    "ԷF^)-OFp tFFFA(=XF1F(7KhNh[iSE"QFw`h[A0C03i[iKE K"IFh\0a3iRAA"""PpG-OFFkKMpF$S"0[\OC kBܽ#DJ4K'F[$ S$0kBB 'DX$@@HDH$[R7P,Fn*#\(   [@²\@BZ @² @²IH(lFn*%\@ Z\"B  [\"\ACIH(lFn*"TX"@ \# T[""IHZ(lFn*"TX" \C T[""IH0(l-GF F $(In IF&n*F +Ow\O ʿCCwTIF o$uQF E(FH! @TFDEB< `F N~8\"@aFqE:ܬIF2B:FU"D.E"U&E&, U$IF{xE$4IFF!B1Ri"-G}FFFFJFF(dI2F (bI@F&(F(D]I*F@F)R0xh+XHIFO0 }kkcj`j`+k#akkca#@0#bB0cbklb/{FI:F@F) 0t@I*F@F)0:@IJF >I&QF8"F F"F:I0F8I0F@ 6I0F:4I0F42I0F.h"F0I0FB,?&.I00F "!8FpHF)0' 0ByBOЪ# (15D*2*#0x "F a2( (@dAde(@dz).(()((() )-Am%OcFF)FFxxCF*FF@FF F)M:`1#(F mF-G] F  .%FFFP)B0`pC_x/!0FCxr+X#`dJcOaT6!`FUEB+,F.#. Ft``)F(U0pCODTsh|JOa(F (FFu`F,%&. F)(.> F)(W(΀m-T` X.`)(h5FO`_ph!)&phOr@!)F.2KERE aF(Xt5p2" F(ڧ-O ""`=J3F!"!)PIF)n( h+ F6)dP+I F)Thh F)&'I F)H(mG$## F ]`h)m2m,O4m' -Xhm-),ۻ-) F@FFKh @pG"DKhpG"D-OF9KFFF F9F6Kh0OySFJF WEt ܐ7$$ 48 FFO``p" 0ZY) F]CHKhCH# # #'@#U h*۰mK@FBHr0[Y]CU H^( K` "N")o"!"L)"L"Kh )#pG"D-OFF FUBv 0kBOst8 0 F)Fk  @Fi "FIF+FGB " -#FF#$BB*" [EF F "F+F0kB [i+H ^E " ^EBi"a Po^FF Fi#a)"-Om` F" FFF(<F>FF6EWE#ѐBB*#2FHjKhH HG(K` )"!"L-AOB F !+NFF3h+Os#FC (F"# M+hkBFSi3@F9F3hCKix)h" i"aORLi0 Kih3hiFi# 0"D""N""@-GFiFFFQ F;PKhsF8F FFHJHIK` GKhFKhk#+FiRF0F" i"aFFQ F9Hؠ0kBOsuC0(F!Fk NiD#8F#`" HFe K (F#!F#"CE i"a*F8F#F*0kB[i+ H( "4)"L"D"*"L*NKJ-OLFOKF#h I rOS5QhQfxS+0;O #h9FH#Kh+@̀~H(@ɀ#h9FzH#uKh+uH#hO#hrH# #hFpAO#heH##:F[Kh+\H#h="HF#k!h kBZi*?O %#hKD #hS5 KhCGH9FS?Kh+gDH h1F #h"#F0#hkBZi*}6H i4K5H4KFhByB Py0B҈-B)H9F# i#avH8?EvH(>K "` H(dH(f"tz*f" * **++0"DF^^F+"L"N}Kh+6^3F |&ltK`FtK B!rLO3 h 8F F(рE ?ā# BGi#a !h. (F k !O 0 lVK!"J&YE 6Z&`O 1 @ 0 8F(H 0 +O +F#kF4F:J2  B0Q" \AO2H2Khñ1HD kӱSC8F0kB;(H'H(%K` 3h)Jp i D  kZCQ@pBO  i"a`4J [i+PF!F"4"說cU+O"!+g"L"LK(-OKMFJLKKKNF#h#A@GJFJh"#Fm#hkB\iD;H)F^ 9Ji%p FE ؀ؐBi#aERF8F  (:S$4#1F@F### )0H\#8F### ?PPF( K` f"zt"N"+0"P+"Le+"+8M+h %4JLBH#h 8H( ##CH +h# #C H #h+( "ԷF^"+P++ (upG-GFFFF)F@FRF3F bFFj`#" ZLD&O` FVE`۽#D#  6YH-G%@F 4F FFF F! O 3_#H"K ##Or `KF!q F !F  vmH#: F^ :^Fp FFFr2Fk2Fd2F]2FVppFF F((*Fmep-A @EB ȗA nҍBAӃ Bt ҍBA E|   Akk@P!BBh-OFiFFF%󅰃@B;K@J1:J;H c BvFFbjF hbhB# ( XFG XCFCPF h]DD"i (XFCX CFPFB)F#bhs!FYGBv>FFe,t,Si!@BK@}1JH cBv F5FO1F t0FlIP`hT@ fh3DP0 0O/F OshBihPF 1BB*H8iO A B47CF@@PI IPF+BBK@ 1JAFPF^I ",WABL- -,,S-6-tWABN-- #k`4 `@0  R#`H`B#803800O/FOs hBiiO 0NFBB47CF @@PI JIPF80+K@1J|;80h BhZ`Bh`l_6I H*O$PFF]PFPFXFO ,q--GO CiFF j3K@FQJH O0$kFF+kS(p_kkCE0Fl F#1F(F#JFOF(#IF0F#RFF(?h,,S-AFCi&F@jF3KOVaJH R1F FY K@aQJ:FCF(F(, F$,+,S--CFCi& F@jFF3K@qQJH 1F(FQK@sQJ4DI JF#F8F(#AF8F#kF2F(F(F,A,S-K-sCFh F N3hBF HKF>KF0hBF!F p""$-K-sCFh F N3hBF HKFKF0hBF!F6 p""(.#KMxQHN$O+hmB(hPHH( P(hN2hR[m8FS4Rh4"t".S"..PL h@j ( hS##`"7FHh(j,)F0 F"8F FKhmJh Kh`# #BB  8@n "4"D"pKsh;+oKԿO@bO`b`lM+h Et`) gHggHh(W a)7)5aHV^HW(^H\)h]LOR 5i#s 5#d3#a3UKihPSKhiF\i# 0#$F! $t#|3.h e3# FF!BHPAH :H)h9LOR 5i#s 5#d3B3Kih 1KhiFi$*K" *hd3+7Y)7ؒayK+.HH(?j!HL)h#ORa3d3iKihKhiFi$_ K" + FpHF""".P/ .""@"D"/(/J/bI"6@ <pG-AFFFFR BC !F@FHa` ?88F$"A𕽽#-OF 3FKF F  h3SB/F=FјO:FIF0FCF ѕO;hB$@F(^# F#O3 #TF??FT k'kt-h- a-8b-%ЁI F]i +R#g~~S~~~~~~g] F0 FAF F F#AFF ;hBЪ F ## cFPm$BFSI2F F(F7N9 FIFWFJI2F F1F FIF06PBPB=I F7FNF HF8IF F04I +s$4" ># FF(I# F F"IBFIF8F F01F FBFIF F0?}JCF!L#I F%###rCf</| T`X/////03d0X-CF jF FF'm6BJF)F F*F!FCkCCc@FC:F)F F7Ck#Cc#-OOF FF 3:F1F FB јKhB4ЗI xmb(#A(%L(АI jk kO0c(i( (F-0(F (F#H4pCO O ,FF F  uh! FF#C,mI FhB"ѴkI8'^0 +`b \ $F( Fj WH@UI F'?8Fk2k/QI3x/+0F3FNJNI(#$k FHI0F!'  FDIs0F'<'0CS HV`m 8F(; FF64Hvh+!J;F!(FI{ FF!(F5(? a  mEӫO F3N3Z3c333333-OFFF!F0|I0FO0!ESB4+uIJFCF0F Fjg #pFA\)#32*X 6+)fI#"0FF#"C0F####"( Fj7 ԫ4+VIJFCF0FH4+QI#"0F=OIJFCF0F#"C0F##JFCF(@ 1[+)дFOJ--J F OK??K EJ  C /IJFCF0F 4Bf$* ݔ!0F'I1*+"0FOJ '(?)ha3`JCFF0F0 3N44444R4e44-GFF OaFjF8yԋH1F$#Tet@E#!$4###F840FOcu<F31FOb FsI F;C&b FnI1 Fj$a&0iIH4$$pCO(ВdI$B&0`I$4#_I FU#C=[Ib&0XIU#C.VIdF4Os$4U#$tCc";FIF@F C GI:F F #`EFdU"$tIF@F;F )FuFF F*F7I Fr4CQKF2IBF F*F3F F90?_#" F#'0?Q"# FBF?G! Fj|F FS гBr F0?, F3e#4454@d45@d5)5?5U55F4BB* I& 0 I F)4 I"F F7@&I@d55!Fa(I F ! FT  I! FK! FE4I4j6;6h6-AF jFjF& mF`mACFi&aehF F^AF a(Fy0 I(FO09F(Fk0I0F66$$ F<$*OܘF # pKpOsKNcȁOsˀOs OrF jjHm0 F F -O FyF(C $MF f"IF0F j2F I&(H FFEF;h#h+F\NEIO0 ZFW&06H#hSCFFW%02FAFPF5#h:ME$%66 [X6na"$4Q 9`#+N FrF7hIO08F(2h I(F2*2s2hI 'q7 7(78-OFF2 h*Fs FOUڋj k2*s @ BO0 0Fp(0FF (Fi+Wi/TУj BP0(s!BBD0(s!BB8?0F9F0F! XFfH"QF@FG0F09F0F"QFG0F0ck0Fi I@ 80$!m#jFiFXF J(-i"AFXF(7HFFFFO0"1FG Fa0 4"1FjG F\0 FzkI 7X-CF F WFCIO0F$d"HFAF3F CIJFCF F"3F(F9F FFCFFI*F;F/upFaF7b7v7-OKF Fx 'IhF8FO O !F[ `   I"F0FO7kD#C C#I F'q7FN$O3i4V+)F8F,7-O FF F"IFF!K    C!x*FH' & )FF F*F FKEVJ!v x K*FI(F F|*F Fv F 48-OF FF F)C B C /I FO60F(mBF&I*F F; FYFeF(I*F Fo o   F" ! B9C  0YF FF #@ FC@ F:C # F0I*F F88$8D8` hsF F N "0hF `x32h(FIjO0p'q7(Fi* s* a*s0O0 !FFIFO08pFF F[PN!F0h02h(FI O0p'q8pF h FLKh(`0I0FO0p F'q8i*F4 a*b*&L*1IFs*.t*  FxK!Fhh8 @B h+IO0 # `10O0 (1R01 1*8'q8pF ! IFF!2F!F( H#0+Fp0Hj p9<)-GF FFF ) FIyO0OI$ iFHI:F FsOi#"# F#RFCF@ F I:FY0FiL 99 9799V-O!FFFXI F,O9OFHF9F ! FF(#" F FQ FђI$sJ<#B 3u D0EFE {I[CsRBz^B: FTi |I5Bz5F6SFVuI=OC8!# F>0$0Fi3FlI#"# F#2 PFicIw4bJjh3`ShOrs`OC#4HF9F4iH{i Yc 8 F0?>v$$0 C@`FBF{F3eOCseO 0 0mmE +JF;F! F0? F4j##h IYF FE 0?  4$$j j 4 4j4 49q9999:3Z:90K0FhB.I !0@e*HU#$(H$4U" FF#H"H! F0HO0!0jHh v  FFH  FFHJ8!hFiFHX!mH T T`8;f;q;;;;;;d<< F$"8F-OFF!F4" PHKBF9F0FCF+4BJhB0AJ(FL*oТa+"+ hh h`hh4K{3IHF P蠱1IHFzFx/IJF(F.I iO0*LO`i`&I(FiTE F|#F@2!ZFIJF(FTE Ff$ ! @r(p~(F0x(F<5 T`m'qL Z8 >1>\iBpGipG Fi(FpG-AgpTE sErڀi FiW dE BEA!!b l𵋰F$! FF8(F IRO0 J !vL(  F=9 IFbK"F IH$^ I H M NU40F, JI??H [X???e*"* IO0**    ?@pGpG *8F FF +6&( *+!#% 8 : *"+J@!HK FI*F      JR#0 O0@"@-O3OBF$F@^I0F%F(FhYJBFBUI0Fh FiiO'F#FFFFjxECFoFE4+DIBF+F0Fg@F)F$4"O FFRE Fi1XHPCBzOEF  34+ݗ0"+H*J@!*H(K)IJF0F+IF 0FGC18H#)FO  Fj$XCFjJ FXF5EK9`E  7JR#0@OVEW@c@@"@-OPFFF#O BF9F0FBF}KhB(F !(FF#C&tI(F p, A,f,oI 4F F s,# (F0O #jO (Fi#??4jjFe11 4+ Jݗ1"LIQ2BAKK0IIJF(FL!*I<*>DI#@ BO7  7(F0(F0!@"v0F #0FvAF(F0N/I(Fu2*,J@!,H+K**7+'I(F_{%Kc"SF(F?F!K 81FH#6#FQF#F FQDA9C0F  $) T`@p@8XA@"4@5w@-AF)OHhFO NON FFHI2F FYO0 F!0I2F FI;F2Fk(F99 OOP-GF F0?-$4 d9H#OF$$1jj H0j(& .a(Fh (a F0I:F FO02F FOhF FIKF:F0F9 P:9PW)-OFkI OFF F!#@dI FO0! F! F!  F ! F4F# 4;QIto`OIt/@(#"!vj@EB \DIF Fs/[- 4;BF3F! F+0! FF(EO O #" FC1IO #" FF+I9FOrpESBF13F#" F#YF F0I F)_I F; [-#!h F0?L4+ 4+#"!(,PwPPP2f2{2Q&𵏰F FF!4"hFpOK :F1F(F$CF KhB J#iF F% iF F0I tQdQ\ T`@KSB@pG<#-O(F FF   BF9F0FCFJyKhBX+s F'`i+Ui+RBBL # F# #F??F1 F +F> I"J>H<J!>~>H2m#8$!H&H$ #SHh |]TTT;ldTTTVT Kn:f*oB (КmQeppGI$ Z [𵽰FFBV( :,468tPH=@$5CMH1kF  !FJEH=CH?HBH8?H?H?H#C8H;H!j| F1![R,"" GBB04(,H+K,J(F)H=@$G'Hdx $!8m#jFGiF!HJ!#FJHF1+є1+HeFH=@$T2bdUTUUU&U4UBULTUdUiUUs2vUw-GFmJF H~J |H|HF(FzJ{KyOFFF$ F m#@F # @F i.1FgH#!#"ji &j`J!"3F!B3F:FB" XI""WH"i+Nр!TKB:FRHBBHFOH$$O O@1!(1$#0?Hh gm#8$!J9HZ8HX #S5H$idB-HJB:F!#H>bOa#PF4#1F#"jiD )i+;+#j83":F!c"HF#jc d 1bblUUUUdUU"tUV39V[VT>V-GāF FF%BF9F FHC`KhB"!0FO\H ;)F0Fl( `(a8 (    %u(x( NI F FEE0FG00FEEE+s0F !xi+ 7BB )0Fi+J +HT*J (HN(H0F&J'KFFF/#@F 4 #@F, + (iPF" #)F#:ji, ?iHF T`VĐlUUUUV@V-AF FF!4".KnF 7Fh3ScE2FF(K(N2FAF(FLCFı!I"8F쐱!KhB J;F FE"i*T* L*I a+, F0l*ТsH O09F F0<WW T`Ĥ?Q+B@+pG#𵉰3OF FF :F1F(FC(+s F!`i+Ei+BgBB<ԱKhB# F##"u)a8 (!$I  F0, Fh, FH iWx T`ĸ?@pG{ {S{{zzSzzӈhJ ]WIpG FFhF @шzrF 2 B-CFF FP Fz Zz  ۉ0sxs+sxl+O&F"iF8FFp#*F FCjF)F FD'F"iF@F,h#*F FlB7/67.-C FFxk  FIFh  7"I"F 6 5  3 2 1  . ( ѝ0 00**+4'EF1Ff0#S˄7/O0WpFpL&"F@!hF6hF4G. pFL%O#51F8F-XpFL#FD F5`ir)Fp@p-A FF(?4;;J440rABOA64N  #38NC0 C8dCS00hF)F#@c0 HO#CFI FO0'F:FAF0F#zI F~0F#IBI;F FbD0F#0 CC0SXeX(XBX\Xr-C FFF(+IC4"!'O&K#:F1F(FxCF KhB#JkF FxJkF F U*L* F0a+( I  K  IFhr0LZZ T`ǭǁ'q  FFIhK8SB@"FFRKh JS BB KSB@Ih"@pGpG-OKFN FOF2F)F FF3 ѩKhB ШI ?O5o+;h"F($$*ڞK!JHI(XHFF8F$F(M8F I(恒IF(@߁HFIL(Fg?2i;+AF4jOsI"F츱OF1+F8yIZFP(FvIHF8F!(FqI(Д!(FnI(Д!(FkI(Д!(FhI(Д!(FeI(Д!(FbI(Д!(F_I(Д!(F\I(д!YIF(F(дTIF(F(д PIF(F(дKIF(F(иѡF()F@F>(?z  4e K!>J]>IZFb(II F8 IF^(?\ ("QF(YF0F(?G/I0F(??BsB r$I F{#"??FI Fj)F"$4B9I T`ǐ'q\qPw\b\[8[\\[\/[\\F\<]#\,] ]O]g\m<l6B$$&16??ѪI^FEE٨IF(?I(?OrF(FI0F|(?F(?OC XFhF@XFjES"1#??@ĀI FID$$)F"$4BV6I I F#HF~I6r*DB(zI*DHF8(rvI*DHF0(sI*DHF&(roI*DHF(lI*DHF(rhI*DHF (eI*DHF(raI*DHF( r]I*DHF(к1++O31Os1Mn iArEI*DHF(?krV?I*DHF(?[H $$)F"<$4B0 F(?HFtFHFv$42F_C[??@!Ig"!0I0Fx(? FI2]u2b1[]W[p[D[P[^[n[w[[[[[]\lI0F8(?ծ ~($YF0F>(?Ǯ$&$0FI0(?&(&0FI"(?((0FzI *$"wI0F(?ErISF F;$:"(D>$:F)D"fBFL$$16??[I$JF)D"DE$1F(FKZFRJ+FhQhOrOCAF#rFF0Fj  d8 ˌOr ##IFOCke(e \!e(F2F(a$4??+I;$$)F"$4B.a\!(F$$1(a??I $$)F"$4Bl[\,\0W]]3Z]^pF" FhF!Tah"hFp(hh3SB"FF B J IP IjF"CI FB $pǨ^Pi'^\!!ӰF F#,"!#2#c.# #@'# #!K""'K p( K) K* K+ K,:F!0F)F FS@i^li^xi!^FxhF  X]JKpFx +cGJhx Bxm5@C0@I @@B=H A i(DА *=#@;@B7УhW iF/Hh`i# Bx3@C0#I @@B#H Ai"Oa#JqH  pFH1Fh`i# Bx3@Cj0 I @@B|H An6ѧO6""H^^^^^^sF J I"0I "(FF$pah(Fph[x+ F+h`h $hǶ^nbCh/hB(F"W-OFFC BFxJxI (F9FsJtIFbh hQFhhoI(F$(9ПlI(FF(HiI(FFtFfI(F FlFbI (FF(1Ѣn# (F0%NJUISI (F(0+ѡn)|"l0F"0onJI2F#  ***ѻ YF[ kױ:I9IRF 0(AF4I &쯱09F=C"l0Fn"v阹"l0F!n"p0bnl)lckB(Fh1+#o˱!F(FG0mI, "l0F!n"F0k0Fm"<0m}^P^B_____c_'_G_y-AF(F$ F8FFȹ F>x1FF8FrF0 F(FAF F((FF((FI]-AFFIjFFF+ CFO0&8FF(А"!FN"9Fp"I0F"0н0"FI@F+_iF0 F@ FFF0#`O0BF?#8F"FF(F2(! FFF|F0#`O0BF~?#8F"FF(Fx2(! FjFI@f#`O0]ÖpF.IjFF(,K!,J,H,I F68FŔ)9XBaA;@!F8FI0FF(F`I F ĕ! IFF0FF F-O0pC____i#I0,M   0 7" Oa#J pM#x7# OaM #Jp#xc ,M0!F(Fd F0D!F(FZ F0Di_``,pIFF (KV!JH FlFFh3SB"FF IjF(Fj0I p_`<_i`^F"!hFIjF FHC&iIFjF0KOaJHI F-C0)PBaA:@ I F00O0 &C`_Ș`iisF FIjFCF0F$0K@QJHB FFI rx1xF JI h I(FJ I Fe p`_ȣ```_a7 F F0J I:I(FF0 K@A J H0 F I KFH80Ȳ_a&a0`__7 F F0J I0 I I(F^F0 K@1J HI F80_a:_a0`pIF<@LO5#`(F$p~E@-I (FeFIF I+F0F0 I IjF0FTFI FeaTaZaoaia𵉰IF8#`O0 8F0FeFI xFI3F8FX0 I ^ I8F%V0I Fe(FgaaiaFXCHHHj]Ba 𵅰  aIF!x0I "0ehFI`I(F!d0I2%OBȿB FeS  1F8F5 ixab b3sFFKF` 1F FO0I*F FC( V bLpFIFF$XFĕ pIjF(FmFĕ !hFIFF0FF(F`f ivp FIjFF0K@fAJHD!F(F0O0 p#*]BbB;B2 @@e !#hF(F I F|F(F\` CCb\_`f8FKICF(F$0 K@1 J H) FKI et 8Ba0``jF IF28#`O0" F0IH bbH^ bk IFjF0 K@A J H I F?0H &b_`ib IFjF0 K@A J Ht I F0H` &b_`ibI#jF3I %]ia FIF0K@1JH4I F8a&a0`_F08 (٣a*أWA*أ=#`O0F"!$I F#0I 0 iaرL ! ! J H` "F4IHBbb4,FF J Im!HONL!(>FHKI"F(;FH3FdKlƹm!HJKIDD(F"F HN(F Fsh(FG6hbpbbc [XcA`pGA`pGA`pGA`pGJF `l `dpGpJF `Qm `SepGpJF `m `epGpJF `Ql `SdpGpJF aQn `3SfpGp8FFHV0#`O080 +$ A;+#M(F>( #,T pCK \"JFnpG BЀip-OTOK @@ DP!Ox0GI #(DIHD@E FTF0g AF(FI0 mJuI*)tH*#S8X@,g"9F&okI&0F+@#*!8+fH !(F"9FoaI0F$O ! 0W d(>YI :!#pUJOao:xp#x۹:##pOadp#JJo&#x+!FPF F0D!FPF F0DchAF(FG$h7I0F !06I 6Hd4LH0s(F(0K1I0HAF(FH0I0{@ƀ`@,ǀh"AF(FGi"9FJoI0IJ0FD!0@єIJK) FFi^PeRe`eiei~f feififffg "ȘҊgieFe:pff9NV#9H`#Jd#S2I3HX#S/I.Hh#S+I)Hj#S'HZ#&Hqb#Jf#SIHa\#SIHW^#SIHM @F: 'YF8F鐻YFPFP IZF F K0hՙL0hԙM0hՙN0CO06[AF F F (-h. IhhbL0gznb" [𵋰FF8FI I(F,OF("hFIjF(F'0.h+I I"0FB J I;`;h I"F ^j"L(i8jҐjj FFm4I#FF lk-CF!I FF0KOqJH,N4h N$F(F F8FPFȱFHFnCFJ)FHF$p$(F$dD (OsQB?Y)?) A\ X^0 X fO " F Fxr(00FdXպ0Fx(AX0| X Y*##0FdlO;""#`O;$ 8FF !YPO;+?2kDҲ^ x X0:,;+?w*lDx ?FF#Ö\(lla- W<+۲C# FA-7<0< ,_!?Zx1F(Fc$JI i"F( FJI F sh04(`a-AFFFF@F(#`O0@FvF #ji!F8F0h Vc`-O%FFFF   GpW;F:F!FXF5g`9hYFhFKFG F5[ F00J+- FAt#`O0(  +-d#` -GF FFFL#`O0:DjB#!ia00sIFPFH8 0h($h0-+ PF4(( iIaiybh*=C$70h( 0h(H #FF)F0F0ck xk`i+aI LFh#FmFF$ !FFc8K`T7`4FF !FFc(KeDa7<-AFFF`i0FFB hcaach cXF0`ixO05i`ahcaacH-AFF (!FFcF K"1F`FC/:Fa0 Fc)$ F%wD-CF F ,!FFcFFK")F5FC$/2Fb  ;F0 FcO HFL-OF!FFFFFE8hO  B "`O0tO  :hO  EJTC<`(hY+ "Fh(FF[FeFG(eh!F  4*h[F(F"FG(eh!F4-G%FFFFE(Fh_h'ig1F h]1FFGFPF*k  4|*h"t[hG pGh00O0 BjF*#cbdiL Fj0O0`h$h0jF+##bdj| F h2#Ah*0O0`k$h08F Fc `ciE``a#`a#t F8@O08pư&IF%IF0FF`"I`""H#`O0Fp(F`F F\xxFBI zOr!hFj)F/*("!F/&*(" IjF0F0 H"m6m=pmDmJiJmIH [Xm1K!-AmxFOrB8< h1`W>v4CK5 b$ b(nn7n)F Fx0+Kh#FB"FH)F@JCxh320x+H&(OBb\20 V@# H]8F6 b(nH b$nPǶpF F"!- -7F#`%(Fp"#, P۴O,F!0F!A\"T`bF(2F K"#F FFCF I 8FFI"(Fm:*F1F F@u^T^pF FF!"hFJjF)F F$p-O<]FF ?J?I L }CF9J;IP05J8IOr!")F^ؠ4 <]ah(FF 0+ћ0YF +"OC 0IF8F P0IH$h 3CEњ0Mhx[c@C(ѝ41+ KM I HF^^Pn^nmnTHni"HpFHx FCF ,h++ &pI "!hF"1FhFm`"x!F*(" IjF(F0 h1+h/+H@ni nKx;@FHt"nF FF Fgh(F9F$hhKxB8F( IH [Xn FF!F(F"$ FF I $I"( J3yh320[ I*F F0O0 O0nn b(i:"F0J IIjF F 8p#`O0 I F0|0I no i9o"F0J II FN8:#`O0 "xKI F($0 I F70I ^Poo i9o"E0н0]#HJo,o%pGh JB ~BB I H JBFpG JB I H HpG HpG HpGPPoYjPPo_ofoTokhJB~BBrB I H JBFpG JB I H HpG HpG HpG HpGoTjo_otoYofok-O EDFFFF(FBBF)F8F$DF' 9^). I2F8F.#P=$/DYFOD LE  c  ءEK<h;Q8FO޹F$nPǶIF0I I  F0KOqJH`0 F ICF HJ F$io|o_oioF!"!V #I  F(C J IR I F0I T u>oioIFjFf0KOqJHI F0 I , I F0 I p_oio|io-ACI OsF0?J ?I?H # #$C c #c@0O3 1I(FI0Q.I -H "8"@*JxhY2 R'Bx:*$0$'0;D#DAFP(#`O0` 4 ,x+I $2F!(#F"3a+Ѧ uPpp08ipap8 b(pA#I FN0JI R:FIhjF I F00I H u=pqpipIHи [Xp-A°2F("!0FI2F F0(6'Ԛ'o %%"!8"!$!"!I F0𛀝l * ّI %%%Hl m-!щI F#`0L0нb0+vЃHI F#`0;0нb0+k{HxI F #`0*0нb@)B^sHnI FI#`00нb@)BSjH8"!$gI$ F0(+I 0bI F0@_I F0\I F0 YI" FV(@ʀOsBSHBQKx+PHNKx+NHKKx+LHvGKx+IHnHHj#6;I,2 F:.2>02$+*0>HT)-.,C0C**+7H xh300[Kx:+* 1H"" 0H)F0&$'i)@F$.?k75/?f, i!H;H [H(i8iqWqiqqqq8iiii q"qqqqqq b(p0qqq8   $FHOsBH *!rr0 I$jF%DED D D0I(Fh F08ipaF"!hF@IjF F0I N ip IF0 KOq J H I F0I , uD_oir-AFFFHF< FFEO< Ƕ-O=I#  D0. Os H07(ڍI H0'+ @.F##"F(2D !<(BF'-}K.|H|KF{K{K{K{K{K(!0!!"F ꩈkԣ2*O |3 SkJ$;2+Fo  O1 BnzqyOa F]IE#\KD pKDOIqDOc1DOCDOPDOSqDOB1DA&k&pDK)F@H|:!0D"0 +w + D '+?o =/ #QJL 33~@B4@B(JأgvA6B$رO &f13?,!!@C;2%2^A$1B٣zcTc2 2PS;I"JoB1FKirs<ssAsEsIsNps"sS"#x*+؀H+1ٛ *f;'+ejlnprtvxz|~+R#/gwwww2+(+gx0+𳁛 + ]PFW6"8JFI0+СxH 0+#y'FIOHxxcxN;6vFEݸyyy(yDBPF7FHF0+СxxH/0vJB /|؛0+rH!F~zpIeH0+?rkHIFFfH릉eIvF$8&`?_Iv_GF F! 3D ۲+]8&ITH|TPF  9FMHnMKF8hBKBsB\GJGK`EFBH7V 9@IBJBJBJBys@I)HD0+?"zyHB=H"!O04(" " 4Hp3N5`"O0Ch+!3h+" " 0hB+OsB H! FH4h,+OrB+ + O333:H"Bxh\4sA7%SKh#0@pG;>+T#`Y T! "D! 0"H!"a FI a MF(` IH!Da([ k`08up"lN M IFF(F )FHJI"F(F  [Xu~uvp hI(0TK! CC B K` 03ȲCBKK!`Xmۂ(0TKI 1CC B K` 03ȲCBKK!`Xmۂ(0@# A C%BF#CL`BK` 0K!`Xmۂ(@# C/F۲L`BK` K!`Xmۂ(@CS_FL`BK` K!`Xmۂ(@CCOFL`BK` K!`Xmۂ(@ CCcoF#CL`BK` K!`Xmۂ(0@CS_FL`BK` 0(шhTIòCS! C_FM` %B۲L`BKK!`Xmw}wۂK"#IR@h]!@-AF!D'FBO@F`)FF()FD(77 FhF]I*Fk8(FaF `0Fk 2-A F xn+Kxo+4'kL%FAF\80Fa$(F'x!Fn+ Cxo+0a(=F a(ч\IFFH6 28 [X-O]F S 4E3Fh S 3 S)FF3F HQF:#@.1FqI0F 8 ` h+@𩀟I(F(@𢀝Io(@G>՘IMՖIGyՔIAՒI;KB 8A(F,0 Nd!@ k` h+𽀇I" F(@𵀄I  `hO@ $4{I 4>F(@`uNB$hhU`"`sh+@lH4ȑ  '0HFS'7B rh+FWI `[IF.H `Q S3h+?`!pOER FI"HF #Z"(FFQF FF2"#@##" #>#("h_ IF HH#`O0C] o B2-OFFFFB2%O )FZF`DUZJ#D ;I8Fh3`D5#D :<D 3SK<3&C(H#`O0V<(D+V,"IHd"X?@N~8-O%& /FFUF F/u>.z<#`O0 G J {O O AF!M `IEp %/FFNF(FB%UF7FFNFWGCHh(FFF FheFIHW~H-AN} x FF!F@FOr(F)F(OpMF4F$N4D#I:F0F #Ch N}( 0F L!D ĕH "\-G["F FFCH@!(FD鸱F! "p,hHL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"d!KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3h^2F#F H" F"" "("l"t pG-A FFKFFh[KhKhCKhAfSDKeXhE h^:F#F H$ " "(""l"t =K-A]h F%u%+f(d5Nh3hhYk3i3`̀Pp9F-JBAJhBA۳hB@_U9F(F Fm9Fsi*FF ]Ap9F F+FORFKhh^hU!B@B 3# FE!0+FORFE ]" "t"X"(-OFMFFhhQn   @$LCi0C#h#ihF iZhKBПH" i jYh:bJBO5sAJqm"@X\CZT#h#ihFhhQn   @$Ci0Ch$:$A1ih:` jSCEzvHRFKF V "PFIF0b\EFF0FFO{ "gKBD@C. | cC 3B DCFx0"4`0  @ C0!C@pd0  F  @$C@Cki0 !F0FhAJPF\oBOIF80[AF8FQ$$TRBAT`7SBBX @lh0Fki!FkO "9F@F*(0AF8Fph h  E 7OE @POr9F@F"t" UH_TT(#TpGP#@ \C TpGR##FIH7 [X-OF hQn   @$C0(C0PKh3 Fq0KJE JH'=F8F)Fi+|DHJh REvq nn  %D\GCG*J7#](  (D*r6#efO Od   _`EbO  в Bb @O   в B  .IH*# kUGwJiBw Hv'O =F#" UH [X"t# U 0$5+.#FFnCFsD"\"T` @i;a#;B2O#030гi3a#3B#030Kh+an  L 0%L8shHBTsmO S :C shPBm A @anOs  L 0%LFF[FO| pDO| ,2D@ [FOqYC0@DI90;)0#k(B4EKh3 F hQn   @$C00Cdc @\"T/I0H!akHDkO  0D 0k 4 $[ 4sjBr$ Dsbsk3scCNGt  kBQhBv~n,!FFD3BAr DA  U" [X"t8 FyFF(F2"2tKhc h[Kh(`[8" Kp Fh!F+OfOv2Fy)F F3#3ps)D 10Fp"d-O=ǰFF!OrFkJkKƮ&tjOh$h>y)^#JJp>s!tYh_I F>v10hXk>b&0F =GD0pLJFNI #DU@[BL@r[ CSfd04 @#F#"kh # +u#}+ZJJOzr>vhSC   F*Isd3ddd#s910hXkQ #DUL[@UBr[ CSR #d`  @C!4 @@#FD0<zF ""tp΀kp2_B@Ѐ;۲#O &@;FKh3A@񳀏O"FDhk0c]RF`"  FXF@FRFXF!OpRF)FOr!BheJ\kBcZhOzq  hKCOA22$0ZK00()?h#DU@l[B @r[ CSh0~ph( [n@#FtOxfKFBF+hrC2  .z&F>;F! yOzr OAh SCD0@0H0L0#K00C?Gh#DU@l[B @r[ CSR #Nh1A"8FAF@,OQOp^MF`(OR!O1Op]a(zLO2!#h+@O3,5sKhsKh4)qH h)mH kOkJh9hhcZcK BhH hYkK BcH h2hYkB_H hk_ZHOR hk?UHO2 h BOH MK h;h0BSB@\3ؿFDK8F\sEXhm++#$5kAkWD `x.D&aADO 8NpAYC 79DA0E<41D4%8$BOpr{H$ xKhxK <48x08Pkz(@DAF8&)FTOsPFF9F+F&$9`BA+FPF9F`#O3sWHAF&F0$-BOCȿOؿ# @O 3KL@|*O3BCBs[B @@`p   XK"KBXC2G/2GOBGrG00 `Y @G"L)F3OqOsK I"Aq0DBrOl.B8F/('Bv8'F "XTL"H"ty";FK<+F @pMC5jBXSBOw"t T"Dh!%ZkRhaL4PkR3bisb@bbD5lc@_OSfKhcKheKheKh0cXTc#0HUP0h40PYF @ 0Dbij,"0"<"P "TF^"t"T "X%"(""  O`z`Kh+^I# h`)hOPeFObhObxi6QKhyih$h0+xiOr!Wp0+FH0+{hCMj0:4D\Bi"iBCDFhInDr  @#"C@!CF#.J -K-IfC(AѽJ0+P# 0*G+E;#H.hO`1F F)1FOPObF? "FF(lOb)hOPFY# P#"d"`"=T^ Z@th+hjPL#FhjB@KHV <8dO{0GF  "KQEA\%FI +B% a`D%4<`DSK B D p0C_CKBuےH( h!i x iK$I{`ȿ`  h{a`Ŀ@;g)#@Ӏ"#x0t[SEgx#  eH;fqI h;3  #f`0fAH {fBdH% 4ihj Db-O F\Dh[Ei@ˀJhnREvq nJFh$%* ݠi "@nG\:CBTi i2aAJh*Md D(F6 @F `i#kDBhhJ`f\B ii%QC FFkk  FvdFD   !C FFm+GKh+@72D?m. 3h=I=K*FF 6I2"\Bii%HCBFhqFBrxn  @B #:C@'H# DDB?(3h+hj;[KhsH+ JKhs B: :#|:x* ȹ Kh I v UT" "QLghcgNKh+303040 40JkhSC#oAIOb`i>Mfib!`$+hh1F8Kh6K\5h0+WpOr! 0Kh@CF:Fr+h+hiZkFVhQnLdH  Rk&@Ci8CSjcjB+h#hFZk4h !jjUn1Rk!b@=!k`ihiYkI D-++#"t ""$ 8"(-G}FFFFJF6F(dI2F (bI@F&(F(D]I*F@F0h+XHIFLO0 }kkcj`j`+k#akkca#@0#bB0cbklbx/{FI:F@F0t@I*F@F0:@IJF X>IQF8"F F6"F:I0Fp8I0F 6I0F4I0F2I0Fh"F0I0FB,?.I00F"!8FHF$0' 0BgBOЪ# (15D*2*#0f6 "F a2( (@dAde(@dz).(()((() )-Am%OcFF)FFgCF*FF@FF F:M:`1#(F mF8F F I"F #x/+ !FH)FH8@F8y2yHyb pG-GFFFF)F@FRF3FzFFj`#"rLD&O` FVE`۽#D#  6YH-G%@F 4F FFF F!O 3_#H"K ##Or `KF!q F !F  vmH#: F^ :^Fp FFFr2Fk2Fd2F]2FVppFF F((*Fmep-A @EB ȗA nҍBAӃ Bt ҍBA E|   -OFFFXF# " `0FH xFPx(PI3F*F `m,3a,M,%A,!JI+Fb< ,P$BRFG701F8FFF hFj$6F6  @  ! J +FJ IF&PF|$61F8F!JVlX 1F@F0pC O+FIF&pfPF|(FO[𨺀"$$`SEB"P -VtА-AF@N0 0FB FZlFб"Fo+FF 3j*FBF[ (F[[ x2(*] #!3+BDk\CJ I"@CkT06h+F*&F@F (F[068z0 hpi;` D"U-Oǰ F!FOK F0Fa7c&JFS`cB 6 8a F%FXF!IF Fo̿##{aFK$#Br {I   #XB@XCO0DAFI!F A  * " BB8 aJh F)!FF #9-HF x  Y D [B  D!FIF  Fp1F8D5L1F8F# 6 6:K:IhbSC2#bR `(u%"#! #& .I/Ocf aO1 c!dqP #ceKX0R~3I B*F+FH>Kh-=(F(3I""""1[ДА"""ИQSN*"@"BH")F8l" f $2"+8m5`iOv𽀲Kh+𲀱H/ Kh-@;l;m#n!H<O@h"! (( F zDx06kC 3"zN#06x%j(( &GFB&( KN6{2#Bw #"<"!VlK#nA#3'4/5Dx0!zkH 3"&#x0#@% F((@S]I^H%1FO@F 'N)F" zHx0 3"zf)F 1ZC"1 DO1BAOan@J@Ih!9(0"x0F%4655J7IRO v@F Z!F-J/IA@FZFx 6*FB.&0O  &DB&#ME@FZ 53F 0FZ#"%kl+ǮJIF% 5ME# JI"М"$Ӵ{l8ciO O 3+DFF%Eө !E":CFF h6"DDt`nPFELJLI j 0}#H+DD  F%05^AK"q!@?I?H8?I!F9I;H6Gk!HFRFIFXFNXvKFRF @3kV&+K0F@&"#ciD$HZ`[ !O)H&DV0(D :ei6HFHv@K hCF:FF0F)DHDG/ݶlZМ{"$""pG@pG8 FFFOb F(h `hh``h`h`(i ahi`aiaia(j bhj`bjbjb(k c( h`(l dhl`dldldPPRRhm`eXXZ~Zmwe(ns fhno`fjf^`^8p FFF FFX(R hN`(J hF`hh@``h<`h8`(i4 ahi0`ai,a(j( bhj$`bhn `fnfnfttvvx xzz|.|GеF.8ـ3+5+-+%+++ +p-G}FFFFJFF(dI2F (bI@F& (F(D]I*F@F^0h+XHIFO0 }kkcj`j`+k#akkca#@0#bB0cbklb/{FI:F@F,0t@I*F@F&0:@IJF >I2QF8"F F"F:I0F8I0FL 6I0FF4I0F@2I0F:h"F0I0FB,?2.I00F,"!8F|HF0' 0Be BOЪ# (15D*2*#0d "F a2( (@dAde(@dz).(()((() )-Am%OcFF)FFeCF*FF@FF FM:`1#(F mF-AFF"`0FFFzh3,x[x+(I;F2F S-"F-G= -S%'33g= +dDTOH( FAFDTO($D4OXDOxI;F2F% I L ONF H& I HPch5"x9F0F4- *m [XU-CFFFFO 1F(FZAEFtFۏByI3F*F L-G}FFFFJFF(dI2F 4(bI@F&B(F(D]I*F@F0h+XHIFO0 }kkcj`j`+k#akkca#@0#bB0cbklb/{FI:F@FN0t@I*F@FH0:@IJF >ITQF8"F F"F:I0F8I0Fn 6I0Fh4I0Fb2I0F\h"F0I0FB,?T.I00FN"!8FHF0' 0Be,BOЪ# (15D*2*#0d "F a2( (@dAde(@dz).(()((() )-Am%OcFF)FFeCF*FF@FF FM:`1#(F mF0# M xj,h214 F;*O"p $T3 +0 b K"`pG#$1FHO0?FH -OF-h"!F}Jl`0##hchh #icii+#j$0j#k&ck80 ck@0B0D0F0G0l*L0(#mT0 + gH@#)KF(`HC9 \H#COr@c))F3SH$;blOI"(LH$#"Zf!F(EHIF3d =Hef+fpC_HCD5H5I"FXpF_]yrUBUA "AFjPF蠹AEHFPH!%QF8F(<FѰ#C*##BBHO0-@dlxO4Z:@"!+tC B:E1#b1ڲ$*D*@B 2"+@/!Z(i0KFh x F13320[ՄB\cl:+iB+fC+c:"EY;E+@̀ 𽀻 ## OPqF$ B,F;5 -nHnL%OD'YF(4D:4Ŕ?EAFf?320_c#x`+`0B#+;CV,"01.v0ۜ:CIJ9F0?:B[?.DJ(?&1F0?BCC>J)F0?CE+bE_E+R02H*4+F@Cd DT%?&Ow+F@Bd DT# GR@*OF;x$!#B H@4 ,] #H<ػ#л 5HYF # H b(lw;;#OC:c КH!FHYF+ЗHYFO O ҒHOr!F$# ӱ;BЊHF~BوH"FF لHF!FS; C ;B~HFa ;(<;+yH"F=>$+sHFF@&FHI +F/! hJOa((?U!F3kdF(fpCOgF#F0F9FC ѧBvCBuLH= #=@EaOs>>a XT; !s !FOD O`OPD~F<:!O EI c@q"Oscf%F;- ; Hй?E|H!FO@(8 B,<EHIF4BDHC+F*E %>H$FOw:H:HH9N9MF B 0F(F 6HIB 0F(F z }?8?<#E OFE+!!!$튋FF FXFxF ##B,5F^M@F 2 3[I !FD # ###### @#$# !DJ) F& "3$?K)F CE?L:Khd g 6ICF5H1J#` { *IOsB%B"GE ظ#C<B)F"F>A?1B:FHݹ/4'78F# xMKF*FbBF  OEcqHqHpK" pOaX`2+F@"D3`2 ! +khCWI`f .ձ@ jh{:j`Aqh hmBEOrDHq;F*F1 @=N #whW (#䰦f#ADIQE#3YDB#*H1F Ԥ@ &! { F BPEV +k`pD:FcF&}#(# ##xbM+ [X##P2#H#8;e6#$I IkhQ + [B( +D Hk`B13k`KB+ D;%#X;e6-GFFFF ` w jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B  0  59FFH&0F L#(-CF#M -FF(F@h+HCF:F1FHHIFh?  ?H !!h R0;h< IC@@#(_} [X K Lh K*FlI#FFH $ @ [XVMIFF(F I"F(F I"F(F I"F(F I"F(F [XBKpF FF+ * *x *##pp\* Cx+IH(F;'*"*+;.F;B+I5FHL [X FKhhSHKh\B Kh ) l(OOCOC`O0$,$t$@FFFP;"F/O#O? F`,HF+Jh`)Kh[ch(I; h\B#(FÈ #*##ty*%!%!-#h)9h21 RX^# #=#ctIH ###%#1h (/#@# b($@$,$t [XhhFMNO FX+hh *3h[S9hO  A L#2y b2Z F$@$,$t$ K : *B ( QppGI| Z [X F:IFFB(8I" F$頹6I(Fd(F*F F&DB 0I1HZ (#x/+ (I)I!F(F+F)F xZ'O/)p,+Fxr1/*+FK/,FK\"FF/))2*Zx.*1FFFF2*9F F`Ih7>I_F*3;D3Q+FQ FAF8^F3#CCBQ#TY 5 F( FD hCVF(JI#H0S]F> [XiSu$,$x?Vu8 Z|p\$t$@fffg @(I BH^FJ C @@Av,FFaF.SѦI 2(FWUHu0[;hI; h\B՝Kh;h+ IHFl(ИIHFf( I# 0yBDoObJFIHTFHF"F9FHF26FK"1F(F"1Bw 8FQ 8gFB8F (  ( 7O  SE=3E6cKhr:FdI[H y D C 2 QIFCw 2 DKEFI r6e  +?Fr*Q"οСίEσՋHF۱`HFZFSF(FLFCJKh+0FbѴ0XCY F)F)F F"C&cy+ F8I*FF8H2 HZF(FSFÈFCÀ*Kh+0FDF FW*I+F2Fr!NHFHFHZF(FSFF0C3h+?W  B  B 2h*?B FHF+F"F2$t=W$,U [y [X0Z+I F&by*(Ocy+9F F F F*i,ZFSF(FzF/ F{K(FjbSFbbZFdFKh+?M I+FFHBI*FHp0F I+FF Hf$$, [ [X:7K-Gh6I6Hx6O&܀$2Bv1K2N2Oj0F!F4FCy++Ic h\Bjx-е00;(FIFFPF (F(Fi,j mjcy+Ѵ0I Fc3h; Ff9FFH F Fii$@ [r$h$$,$tK-AhIHM ,j&GF4.,jM#j$F F(F!Fl$@ [$Ҁ$h=D [X$x-C!M -MF+h,I,H8㈚ Fy#i,+h!I#H"'$2Bw M8F!FF4Gi-눛0FIFhF(F =JFFhF#i0"F$@ [$hK-AhIHd&O%2Bvӽ0F)FVF5F0#by*#F〴09F Fi$@ [$hFFFF0I:FHb F0F)FFF[ H2F+F=cy+XBXABi+I F [X:&8"OzsF FJR#82BBh$F HJh+KJIHKh O$ [XsFLyw3/#3Do?Oa8Fc?"K2( H#?o)F뫈o3D?$$ #F"#h$h`hDs FFFBФI"FH$s #"3D(hl`<(h ObR`p [XK2;"4(HW$ ! H@CF@ @U F^ #`C`LK-OFhðF.HMD4BC4lOr!hF*h v"!Fr$0 0hF(42Kh+@+h+Gѵ iEy3#3E80#I#H.髈0IH$y3#3BQIH0I NDBؐYRQ)+Ыyq#q+h(F^D $$$ [6%$@K-OFhݰIHNOaL#H#J#hj0R+#OaH#J#hZHEJIIMHzJI |IwH#OazH#yJ#h40R+#OaqH#rJ#h$nH^AkJgI0gJcIfHhgIbfLfK"ġeO#ch P +vpCOq!UTF[HOzs"IF@FW# G#`22`Sk "lk bl bh`!i "ibi"(4H;J;IM8F FFcF5I0鐹XF$0I2F0H/I2F-H,I2F*H*Ix(9FO F M yJDoObI:FHXFFF@B8F#h8F"e 1F$  [X< -AmFHx/*p$O&AFF8x+ 1F8$ F m3iFH(FFF(yB02F)F(&h$ 8aQ F8`"iFF,F F8$Fh F@UK-OhIH0R+ ьKOaH##KJhrL4#+ шHIHO񛿆I`HnhV(IF{H|~IbxHv烉'J3FI H0FD$@ [=$`$d [Xz'D$XWx$0$ $4$8-AFmFFFFF(@H:F#F5Or@a0F9I2F9H>8H "hU5IF3H0 m*i0NԀFq2hmiF-0F F o/F0FOg:F0KIHm#hUIFH 0:F Fp0KI Hm#hU~ IFe [X$ $Ҁ $4(   7L4#+ `#"R`#x#+ H#"F@HQF FFJ2BpH"F+FiO F)F{h:hER#qbB#` Khvj O2BB9F0Fvj$h$$,0BijB ћibpGiBтiapGF+I?QpF F J2Bp Nsh2hR#p2BB@j $h$QpF FJ2BpH*F#FN(F!Fsh1hQ#03*F#FHp@ھYjBB `p$ F$h`$}-A!mF 'FkF@FFkFk/..p h)F@i,$ F m.$j8/!FF$ F8#p(F/##pF(Cy+H)FwFL/'6*yB H!Ff F)h F^! 5B|(4 I(FHIHxhT2JIFIH`dhTJIFp3h33`,F!F HA $ $$ Zt$l$\𵅰=L##|:IF:H@##CbnF5I3H24M8#3K@3I*+F2H7"-M.I+H.h.A##F(IF0F#.h#C,6F!I0FN8#KI*3F7"(hI(h)hH +h[I FJJ$΀ [$Ѹ [X$8T-OF\ŰF FNF0# F~HIDLF\E#hEӫzKhCyJzKzIuHLEF0pI E#y+:pJOq8FyD0S#ykJjI#hhaHb.#..2Vy"h`y1A:KR#D@F:F!y\J0/SKhZIOH@#hDy"h`y1A:KR#D(F:F!yOJy"h`y1A:KR#D(F:F!yvFJ#y+ EI8F pBI8F(60+/I>H,.. .ѢyF(F2B2"Dp5J y@F1A1!D,0J0#y+yF(F2B2"D)J...ly!(F2B2"D@J y@F1A1!DJ0hy!(F2B2"DlJ [$,$0?P|al$@Kh(K[h opG$-O(L F#h +9M'h/7 T")$+РKh+'F>Fp`Kh35K(@Kh+)IH.IHX#0H KxR+jЎK0+e9+7щK(FIJKKKH)F.Nh)F0F((F `Oar0ԝ4 + `P3)FxH ')FvH `YFtNO )B  1F bKF(FlI `  )F RFF'80B )#@C9  2FYI(F)FVHVJVI(F(FX `Oa0  LI `l4 + aBHAHR Dbh"I?H>K ***8I:H:Kh9H j1I6Hm6I.Hd#3I+H\0!O*RFbh!PF(2hT&IFH@I"SFOrh?? 3 9FHIOb8D$ [$@$x [X$Ҁ$D)BPj$$ $,qKFhM+@iNl"BjKBBИB MeMhCdKhdIdH#` Fs(\Kh+ hg ``hc``h_`h[` iW a`iS`aiOaiKa Dn hf b  k8 c`k4`ck0ck,cl(dl$dD>8 xx||!hMK+$$T$$@ [hFhF(? Nk#BaBMhCKhIH#`Nk#}yqn f "`"$Z$&T& R N JFB>Ob! F#`##`#0caa 0#$00&00  # d##Or0>fKa4#ca0C@S 2`K-a_Kh*Fд$ & +7 [x3\#=#caiNl#B#i#|3 #ch#h##k#k##dcccf?H#h+=J+#h+:J;I;H#S8I7H5I ~5KoA 2N#A1C$9) 8:'I)H$I(H(I"H9-;B#IHI J"h*N*>*$$8Hh0FoJoIFF#:F!F3FO0iKh#hI"FhH\hKh+fKh FOq F(2hS^I"FF)FRF FAF F #C F FQKhñQISF*F0F>CJDIFF#:F!F3FO0_IF FCKh#4AH[hGRF)FzAFz0F:J.IF9Hc.#3FZF!F2/Kh)Kh+d#CD>"Kh['ISF*F F'E4 \ HYFhG FF.40FhIF HiIF"5q$@ [$4$<$8$($Q9-A!JKjh+GJHDKiEKBEHHDH4+?BJ>O434R8NF`h%0 Bo/B30FF(3/JPO?!&K"$ &H@&(9m@F5c9mH3h+0DhR`DD)BK Hm$΀$ҀT]$$hH/𵩰N3hIHLMch"PF ((`hSUJIFH "hb+`K"O`I:h hS5#h CCF BchF(FhhS#pIFkHvPFBO.3LF(h, COccI]HbKZ3h:`)^IQHN]H]\O58FZJ;59;99;9h3`EHIQH\PHX#h۱KKNJhNk#)FKI9Or#9#Q :D3s93hAKxt+>K=K F# C=KhF ( hRb"F I@F H Kh3"FI@Hé$4 [X$@ [-CFx2LF.+ FFCx/+!h-H 2F )I;F hx-A!h%H9!h#H#J h"IdJk hI^J/I hVJI hPJI hHJiI hB!h #h[I JJ$8"*18AJQXI pb-ANODFF8h "F (I X0 +;#0B#H+pwH!Fs% bĂīpmFFlF! F#xE*Oa&H)FPF $(`O0#xF+K"Z` mpA+ F DB< +#<H!F*I 2% bFF FFp K!FFh F FfBI 1F(F@% b𵅰(OL`OI NI dhLILH`KI PK aGI#ihF(Цh@!0F(a#p?Kqh?+C0`h*F:HY#9K3F@F `(FQ.*4K%hpOOpCco h6%AOq h$#"! h" h! hC ZҲ7 *_+-+H1FB .FAOq (c% |f}^ b(% 3$ 0ðFFFJOqpK" FZ`*FC0<% Lbh*IH#c`% D𵉰 FJ!FhFHH"iF F DB8hbq (I O%G b% p F JF FhF!hF6 NiFF0h "F)F0h !H^pL% RFJP!"H]X)Fð JOqH"C]O0`hpF FdKh*F ZhBZ`C!+I2FI D"h!6hAT O3@S` XBXAp#F% V08 FEx- -S*F!FF HN@h!FFHD8@H3!FFHƀd [r(7((R8HpGHpGHpGƛƨƎ M F0Oa\4I M] [I n; f+X1 񐿋mZe "ppG Z-OFF9AHO ڿ?H>I8FO51F"! G.  `kex#x;C3D21 *'  VK,F/;є6- - F# `BF!FhF  2FJ.!H"!hFHBF!FhFJ.#(FYFPFx'8 FFPFn7 /z [ƿ% % KFk+%x)ГH@ )xK)H@!HDkCDH+hBH[р Fl{A)Fh 9FO /#0 FIF젻 FBF8 FOgh.N Ff(NЃhkp#HFh FIF F0 FIF~l+nh0F(zh)F0F@hh8 % |v FCFиޮI"F V8FL h)F`h84$Cy ˆry**0D@ L@ ԺCOqJH:Hu% "KF"HKK]͉͟(}(F((H IHII;ʹhͥͫ0 J #Fh4" Hp 0BBLK,70 !" NF 0Fh.!\F( I0(p!h)OrHH0I%% v0Dhi,@-%-J#Oq+H1Mh-Е D! FO,hɹ-Oc-B%OqJHx ! FO(h)HOr4H0I-! Oq H JVOqJHJ% vKQ!pF+EsID.&"x Zp+p D p*ݬB"HppF% ,%"KsFhF HOq"`訹H.!퀱AOrH#xkIOrHHpK"!ex- - FJ+FOq H`h1Fp@ Fp@q%v% Dx,,x J#FOqHH@@K% R-AFFa)F0F,F F HA +*F+!FHA F"F!FHA b-O$FF FF"F"#!DOG Q:BII@F(GHXP(FFF!DQ(=I,F:HV\*5O `>F#"2K!F@վ?IFHb ^F [XH΄FBMM F.hs+`6(@a`H!% K6H  %πH I I I I HOr@a LI"" H"  F I" F HT IF F F@ Xπ0aύ%b% IFHB >њ [XpFN4hxF324 RFKFK,щ ;Bx1h21 RpI b(hp+Fk`&kckBPm# 32emcP#ep(F`5 7 FFS+ hh"hۚBF)hD)`"`0@pG-OFFP" !Ƞİ ,FLE ѝ0 +9F&HJ |" !J @F] J^`r  0#xRF !@F`F `3kD#G,; Y2 o`jD.#.<TP" !(E(@' b(-C$F%F'b V" Be#F*FIF0 JI "FAF(FP4?;HJI(Y;(^(R K IF K K K K K H (((((((c [X7MI,hF FL"h"ch I(h(hh3`0@pGZ%)8FLرh+;+J"2C#hPN8@IFH2C#h 2C |hP6IFH-8%%)Z-AF("F"0FAFP*0  I FPF(FAF0FUP 0 FAP K1+K9FHZhIO@[ B @8FV#5 6AF)4%+;)R-AFLMF F11[/1 Q-0/1#/׹=K>HZhQ- !F0FA 6K"!F0FA )/2HhQ-+3+!+ "F1Fe&HaN/7$HA &_ H/H:1F "F F_H"F1Fz#%aH_HH A %+ [Z)_)uykl)f)o,S J F)h]K3`pGL2]KhH\%)z-AF=Lm1+;HJ 0=!O0"AFF| #Os8F3`Os0 9F#h+ mT"AFOc3`VOsK5R# )o@# `#*s3FP0 hPFH,+ Hh#C-H\%)))Z-GF:LFF11[/1Q--/1/ѽǹ,K,HZh*Q- AF0FGAF0F$K"G Һ/!HQ-0#xutsCE/ѽGH ֺ1ixHF)1+PF2FAF HG P%+ [Z)u')-AFKNFF3h!F#,?DI FȹO3oB##C@FP0*Ѵ@ @"` FB /H"F)F3h+ x+h+#F1+#j!# CoBB?#)F8F,j2C!oCB?#)F#8F)FJ #8F#J)F #8F%**-OFbNFF3h!FE'O,P `. PFP(0RH)F|%@F F FF > IH"F)Ff3h+ H@F .FXF@F $&h+.PFGP0Ѵ@ i'F1+Ѵj2OC#)FHF,j2C$#)F#HFPF !J SFd! )FFHF,8F ! J ;Fd!")F FHF`%*-*?*\K-C8KMt}wBEO!/!!AF(F 0H)F C :F)FD2F( 8F#$CF+F FY K]h!F*FF H8)H2H,*%++pF F&#fO40 p*I"F Mj C3F F=1+K!FHZh1+ORL,#H*%++-OFFheKh۱#dH# p (%^U(F OFH PO6(%6O QF :F("wDHF O0 5 FOO %i(;B+EIBF DB?O%F @F &j#CV#(")F Z E6K !5J(5CF^F 9F(" F(!B(-ܶS v1@Sv@Sv@Sv@Sv@1FPF#HF########%+* ,G,Z-CF`"*x FAF4/#JH#P(FOFP o#O3%F%9FHFUO0 X F#COػ2B0I2F l0/#C#C  #"F1F%IhjC!F0F3FBF!u# #5BܻO`1H1Fb+ OD#)F8F5RB @FH+*% Z,N,G0FF%#UOL0 0*I"F KjC+F FU1H!F zH zgzg+z;g+;; ;R0;*%Z,X-OFjNMFF3h!FOZ ,o FF _J _I TRF4!pO FtHFXIO FOS AC818F hO0BѴ@ = M"@FFCFh"*@IBF DEx*;IBFEx(Ѳ?S  T# CYFD# F#F1+Ѵ j2O CKFOR(F,j2C Q#1OR(Fy7F:F)FF @<0h8FOL P0 Fp")F"FF @<0h FO5p%P\,h,y-OFMFF FLz@FF PF<>E  rDL=SE8O80V(0 JFSF[F5E(y;%4-@ KJKbh JP@3+4KB01+HQqz*@IHxalHt#3p+J* @IOrH+K IHOr܂+ pp+AFOrH+p IHOrAFOrH+ IHOrAFOrH+{IHOrdAFOrH+{IHOr<oAFOryH+k}IvHOroAFOrpH+ktImHOr_AFOrfH+[lIcHOr~́_AFOr]H+[pcIZHOrjOAFOrSH+K^[IPHOrXOAFOrJH+KJRIGHOrDX?AFOr@H+;8JI=HOr24EJ[F !*OrAF4H 2H*OrQF/JI(F(/\///-0Uи -d%3@cp#MH1F +\%3hИI0F^(dxJ#0FQ908CDtD @ "(PAB &(B#+D0@(Fo E#`##`##FN!0ILhN1FFuH"и-- oH1F+и-p#.!1F ")F0FOr"`"pOs#]KYJ8 p01Fh#CUK1FUH"#4qOI"0F(gkz=+ DJ8 B_ $1,DFH $0"!4@O #4OsOw+` F7K0!FX"AFZX$p4KXS,YoC,`#2F+`c+FNq0hNV!FF$Hrh#CXI H;+JJ"I"0Fv(aѫz=+ J8 BYO D=!@FF @FqO9O 0 -0p0<%00000,0dv 4+H;#4K ( Or @F0Or # K04/( )FH)FqO=jxBx=#<I"0FF(+z=+?oJ8 B&1.D+eHϻ h#4$ CFD@0! F1 yHHPFWF豆hN- NpjIFoHh"FmILp0 G#0#T"@ F,FDB@Ӏ(ЀVH!Fn0 ! FHO T'&bJF F ??Rh"+ LhN!FF>H#Bx;H!F30+-++.2#;3" #S1FN0 Ϲ m"2 &C '##&0##XFh+@,<,+,#I@F##I@F(%1--11:%1cZ1Q$ '#F,I@F# &#FX#&I@F###MxF(IHFAFFNj0G (FqOMhh+*FHF I## I"FHF3F #CF t%-MIFF(FnI"F(FjI"F(FdI"F(F`I"F(FZI"F(FVI"F(FPI"F(FL I"F(FF B [X?`nҍҨһ8FKhI"FpF CF H)FH` 8"F)F $*FFH%2mFFOahFW I"F `hF mpmFFFOa&W8H!F mp&iF F(ZH!F2H!F*M2C&h k`+h  &2F (Rw%mFFOahFW8 H!F mKh  hiF j(%F-H'MFF(/  b,iI FZ(I FV(+*hOa FWT H!Fz|I#(i4@ f FvIhN FsIhDX 0FhoI<F( kI(,!(FF " ," FU`I f F+x3ZHf(FM^WK@WJ @E @F *VIF(F(j|KF"FO FIHfB]GH!F6XEJ @EK@ *G(F(PX"FO F;HD4+ @t(6H!F '- F (E pC%FC K IF~P ?%IFv?.ѷF%FI#F'FHdI#F'FHZ ӜӠӪ-tӴ`LԔ' [Xl%-O'OchF9FFXCF!pKhSK"IhCH!r%K@%K %-OF MF0+<p/6F-M-I3FBF(hL(hObXF (%K"%I(h`#F68F MFJ0h320n+?+!a+'p+q+K"I(h`"FI"F(h#0)h# H0. I#F(h"F%K "%f\3 b$~Cf؋%Kd%KH Z-A N3h Kh M! L#'h+`!`c'`#3`%f\%K@%Kd%KH K$`o Kh F K Jh+#`H!%KP%K$%KD%% -GFF걩L "@< T1'h27 \ bE!T(HiN/z.F+L>H\+F@<O"]h27p<B7h7 pEMѐB٢\+ZbE.F"p$+$"!K2F!xx(<#~H+p,FK@:zм[\aм$@>Zxh7py@50*@w@</*R+bbET2*$( \(*XxB)3x2x(3_x0/ٓdEЧ1T$|Dl,7D$|O Ep0hD@H,3B#A$@ KO2`](( JiF(HYh(K"%pKc%𵅰8`/KO2`(,Jn()K )I$`P!F'Hx"M%N%O"FFP ;K`h#x +`+h+h!F(!F0Fa)h(K"`);h+K h`h+h3+` K`%pڷ%f\j%c%K@%%Kd@KO2`](+JiF(+HYh( Hh ( K" JiF(%pu}݅%k-GF hFVI&xpHDD FPPKhPKPHhGӾ6KKO2`GO%H@ݹ*й-)hF F(F:H1(Y6KO2` FGKS4I F3K3O(F F%1H4F#BF3!F-K8F,ѱ(H#F FOp.%HFx#K*F(FJF FK|#r)FF;#3KBF!F8FMUKBF8Fs%t%K ݘ%pݍݒ+b-A@MKO2`(X+HJ(C;R#!B#?Ixx|+ (9Ht($6Ih5K6I` !F3H/M$1N1O+h+;B3h۹ 'K"`BKs&J(ѓh#3KH,;FR$ `F)hKh{K"`h+h3+`K4%p@%f\j%%KDڷ+b%K@%KdݒpFm@O4;K` mp! FR$ F42,! /H/K/!(FF Fb`AOb(Khk'N F1hD1hh;`+ N-#KJ FhH!F,K O2`!F hZ ` "p" F B1F $1F c H%p[f%O%K %K40# 088KO2`0(5JiF;+1HYh((D.K/Hh+,HF!F)HF Fx!F F--h+HF!FHzF FZ!F F-KO2`h+Hh!F\ F>!F F%p,6%K >NYal%KDp(LO3#`нp@ K NMh 3xK43x+)h Hp@ JI(h##`p%p%d%h%K tޚp(LO3#`нp@ N M3xK3x+)h Hp@JI(h##`p%p%h%K >ް@KO2`]((JiF(HYh( Kh Kh# K Hh HYh(K"%p%Kx%K %@QKO2`]((JiF\(HYh( Kh Kh# K Hh HYhk(K"%p%Kx%K 9%-Am FFFObhFXo$B HiF@( V$ObhFjBObAFhFb4K"` m%@ KO2`](JiF(!H%pB@ KO2`](JiF(!H%pXr@KO2`](+ JiF(+ HJiF(%pKx8 L%h0Y KO2`8#B#`H%`IhH%Kx%pߊߕ8C L+%h5 KO2`8#B#`Hn%`IhHh%Kx%pߣ߭8 L%h0 KO2`8#B#`HL%`IhHF%Kx%pߺ߿81KO2`Kh+H+@%p%KD81 KO2` L#h!F #h!F %p%KD!F #0(KO2` Lh!F H F!F F$HF(%plp8~=KO2`p(:J(XhF33K4Hh/K1Hhz,K.Hh.H!(,I PF o[z{'Khd K&Hh Fa)F :!N"I0FFP0FR41D0F@ " FhAOh8GKJ h;#`1)F  %pj%K % l5%KD%`(%JKK`%|+%pJKK`%O8%p FOF(O3;`(N#3`KHh3h3h"Ih H33`;`, K"ph"@HY%p%x%K R%]%L(7&L %M#%H+`%Kh+h#`0 |O3(,+M !J##`(h` KhFK? + F !,`F#H#pOb)h,? +Ob!F H" JiF`(%p%t_%K %K4%K$%L%Lj($Jh+ ##`!J`!Kh9!JF(O3J`LhI FJpK"`KJ`KhKI:KhI FJ0 K` K` KhI FJ(J#`J`KhJ%Kl%Kp%K 8%p,rKJh+K#K"`K`%Kx%K%p%KKJh+K#zK"`K`%Kx%K%p%K8F F)F F8@ۿJKZK`%%pJKKK`%%p(-GF FFB(kO0(nhBI0FJ.(F@I0FJ((B>I0FJ"(&,;Шh,9h%! B!F =F5%,K+K`+Kh.%)K)K`QF "IF  &&%OOd%JKHhhIJh+ FI2.%KK`Kh+J KHhhIJh+ FIB%K%K%Kx%K%K%K ,8""HK`%p0KO2`H( Kh Kh# K Hh H( K"`# Jp J`%p^%Kx%K c%%h%ds F(vKO2`pKNh31hHp@(Lhh "(xkjhI0h#0hSF H Ip@ؽ%p%t%K %8L%h0+KO2`8H##`f%`%Kx%p-A@O3NJ`LO;h+KKLHhh(9+HKh#DKGHhZ$8h "DNYh`;hSAJ`"@Lc hchEE3%;Mch;c`+L(F (Nch;c`+O(F (E1JiF(ѨZabi2`+c` FCK%Hh#hZ"`x(p (;h"bhBZ:`"f#5a,Z=#+p5#hZ"`x +Ѱ0KHhu#hZ"`x +%p%Q%K %Kd;%e%U Z0w%e08RO3J`0((J^(!XhF?? FAIZhKhb-t##%pK%K 08O3J`0((JiF (!XhA??Kh]h I*FF F+s##%pK%K 0KO2`(ѽ@H @IhH%pO2K F@H2I@h?%K -A@O30(( JiF(XhF(H<F`xK*F(FF0FD4 F."F)FF<"FI8F"F1F8F8F^8F#0JN0FJKM@%p-O@9(KO2`(($JD(!HF(7xK*F FOBF0r|#N!FLF;#)F;`#` H#KRh(FJL%pK%%%Kxگڴ(pF FO3J`phI0FJXI0FJI0FJ($hhWBFJh3*hI$IJ`h ` h I#%p"%K *%O%OF-AFFF9F8K:FIAh @hJk#c`0FV JhF``B=H"hIAh%K q%Kx-AO2M*`((AAbhAF4*:F "0hn#h+#+`LNO "%p%K (NO3 F3`н@ Hh OF0jh8h I@@hJ#c`"hI8h*#3`%p%K q8 L%h0 KO2`8 Kh3 K Hh8@H##`%`%Kx%p%t%K 8CL+%hKO2`8Kh3 KHh8@#B#` H%`IhH%Kx%p%t%K 8L* F%hKO2`8Jh2KHh8@(OIh"` H%`hH%Kx%p%t%K &S[-OMXaJKO2` M(JiFS(ВK$M/FEяKrhIh^)Fph "5:4IOBO#w&h$;iB+FF+21 TzLF+x˹#p0hhCFdoKqHhLhK`;iB5$+ \+Qkx5;+x+5jxP1@'#O "eF0jx P1@:B  FBS+S+Di*5B B FS&jS&DO;HgTH*F!F8aO ##pmO (F#q@!F 8IKK`d :!(?O#;WG4N F%F6h.>4F7Fg'p>FaF{(F%Kh.7FO Q6h%F.й%F'F&FE6h.йѠFO &x6!I F&DFFO DFFF/x/?&I(F'%F,F/F.F <%K`%KD%Khj{'T%Ot+XF(?#8PF,.}/#x+@OObYF ` c4# 00+#x+|KKhvIIJHp DF/! F6 FF# F;-1+x+.9I `ObR>C c5N5O A3LOb%h#`3h+70I `: c%`#Kh93x[--TKh0FP&&OKhS###x-JH&/!H06##2BK`&ANAK  ?K8 hC#~##-@7K8J&8I`3((&5H!(~@#8#(K&L#C(##(&$HZ`#Kh[#KhO6F fL&I hK h#SK hIOR`%" %K1%%%K%pw%Kx%O%K 靘NOr!F0FrK`*3*SMHP*KJ`*+*x+𧀎H@(Vx+SfO: -F FFI-RF(&-тH3x+YFF0FEFӨ1F DF(8FIG-?Ԯ+dpK#C*nH",+ "0+,x+HEе& F*8%! F_H!F#O2V3(FUXUd1?XI0?sX3 USxCW#xcPI F(8OH)FUY FHUKWK+h#`K!Nc&.*LO /f1+X:Kcxd#e.F (hIFO7/HR++HH.0`'NO7" FkO  #!i@CiB(;3h+Fh!`hKHki,э%#%p%%#%K<%Kxg@BQFBFQF8F.i+ДHkIhf3hi"isi[ 8F(8FO7N#10/HFm(ۄKhk/ ==0 >>|K}LhhB!F@F(4(;wIOBwHuKhhuKh/H#/0< F!F Fb0H#01< F!F FR1H#1.(? $5\I [L h(< XI+((  h(< PKh+1(,4M(FLIK(FKO:JI(FII(FHKh.EGN#C03LEH!h#CI(F h#$@I)K>Ih2KhT<1$#H5J8Ih7I(FMP(F3Kh3H(:F1K(F1J1Irh9F(F6h(,J,K) FF)I(F("+O?,mѹr-KN%K U%Kh%Q%e%`%K8%K<%Oڴ%Kx %O%-%O@ ^Mj#ѝI(*(0OњH 2іKh+ЕKHh &-БN%FNKhK2FI4hIJF8F-ЄKhñK2FIhI*F8F%NIJF8F-,п~I*F8F|M W('"(h*!*h5FF3h(K ! F( 06 "3j6xF;iJ3h20X@3#FO6%F f^J2!Fh:(@Ȱ]XI4443 "TK(3x+O ((@,?i FHdGI4gF(HDI4`(4x*+Cx4/*ZxX4**+34x+9K#C7Ht7 "> 7x-+07 "40F B 2A77 " 7#I4(B4YFs,"(s(?eO3{x+^s>8Wr%Kx%K 4r b(%%I4 4BF%I4(oИI4HI4F([ѓHO ,@ـ8FH.-@ŀ?瀉J#hB#IP(@K))+@XJ2RL ??BEs ??@vH??.Bs)pKh+@#O 3 jI4NiI4IF(?"HXF"aI48(ђ ܺ/lZH9FX FH8FH=r*د#@ +xKOHGK#C^LHLJ2+ HH.D8FH(F;K@1Eh"ѣK?)FKFw/8FO Hf(FHc66K*F6IhO FHV"+K(F^,K*F-Ih,H, F FH<&H#x|+! 7!I#0))##H1-K'+5ٮH|%K [%%%Kxh%"#%K CVȜKHhH??I`H` BB#H&#I*))+##IK'I I Kh*K@a~JH~KB HuKyLh[ vK tKh3Ox O3O0 ,MhM( gHܸ#"!` ! 2BF^H|h"+,t"#!`SKWH "3!!x *;*PI!nPOH3!!x* *,&,0;0K=J" B!  #:# :#Bq:###:#:#+r:#"BOA :#F(>F(M(F8 +@Ԁ +WKh+@(F(H*1%K %0P{%O%"%K%K%GZrl%%KJ@A:#b# :#)pzF:F.Ch(#(]E#He?DD}Khs|Kh[|KwO hBr-FN +?Cd,??sKhKrM'9FFBF#[DbH@;t B2p+r (# bKh^KHx +?,?ޮ$)$'ZM(7VHVI (TH~,?IKh+DJ0(sDJhFJhBOtA?K he# a )'?KB&82??!FZF8#`^#')G)#Z0 (K8hN-IF FJ2*s (K) K xK!H#PBBA z t n h޾%K%%K|%K %KB@%K%"r0P%%('+1 K#hB3K`%K@%K %$ K"`KhSK"IhC H! J131#@;`(%KP%K@%K %$%f\KF "` Id" Kh0YFF FGH!%KP4%K %%K $`J#`J`Khxr+s+I F8Id"rId"Kh0YFFJ H! Id"%KP%f\%$%p`%K %%jFF0$@XN0Y@<# K>I0hS$ 0hTIF @+`IQF E ,@N(Kh*?$-vЮ&Kh+\,,@߀)&KB:$',@π"J h20[ջ OKh*+zѻ(d$Kh*j.$.j3%$]%p%O%Q%Kx%O%K %Qs%O%* b(%Q{Kh{Kh .#XF,.,d,л-2rK"`3)lKhlKhs.. XFrwiKiIhdKhbKXFhe.@`H0 !h3`>+.$/_F$+p CE8\#$+p$$hZ` ?`?6 IKh+5/.?'?DJ h20Z,?M,?6d,?AN3h+]:Kh+?XGT1/O5K"`IF .QF *2h@BB *L#hk*KE йٹй? G 1k"KE кٺк? G0+(d$0, ѻ)?eKB'd,($V%K %%p%p%Kx b(%K%O%$]%*-A!N 4hdHVKO2` FApGO I#;` AFF0h1hH0hKI@F"`@ J;hF;--k G)F |%Q%p%$]r%O-OdM"#JFLFxi #     (\hGFBFxH9FwKO2` dM| 4OrYi F@tBFiH9FfKO2`v9F # %S!i@CiP\I@BYI*F0F0Ki3THTI3Fhh!`hvOH2F:i0i"ici[ (F7((F#"ii:H#i$6 62F;I(F3`0 8HBF9F/K(FO2`k3h(66+ #"!F#(F*I(F)L*I*N `(F#h0``'H h0h(!Kh3K Ih %($"Oq(FOrOq(F%K%*%pj%K Ug%+"%Q%QV%Kxj%p-OMO#LMfj#ѢO;hO:7 hC49"!( `tHZВK"`"9!~( `ڋHB MKh#"Oq,97+ЁKh+vрKHh$ hO3#`|K8h[403xJ,h0O2 sH+0F(( 0mKh;+eKkHh#0hH0+(ѕ97+5[KbHhYKaJbIh0+YKh;+ٸ#ZI ' YH   (SFKSHh h~O3#`#;`(EKh *+7='<0F+?(;h3#O;`KJIh0+?ޭч?"":`%,%O 8%K%Kx%OXh%K %Q%KD%KSKFSLh h/1F@п:F!BF@! h0#h9FDO#0BKh+ؿ<#Aq!   t#9s Ozs"!"rCDXh+Th#+'H'K(6 h^AF @h+<h#+Hz# hD*F!8F'`,0Н90+ #"!#8FZ h1Fh( H h O3 #`%Kl%KbM%O%$-AFgO gI#;`eKhF&*𺀽*aMd``K`Nh1h"`*h`) Or+3`YN|s|ˆ6sˆpMKNIh$!$!`KKh(!(!`IKh,!,!`FKh0!0!`DKh4!4!`AKh8!8!`?KhKh+?m KBh!???[!# ##f0JpK hEmI*FF Fv:jH( hHfO#C,% #"B(,F Sh;S`+ :B? (4E2Bu# "#(IOo hY`x43 $ FS9h# 8h#hZ@s###Br3B# Sh;S`+" F ,+ [.\ Z h +gK [ j hY`x gDJ3A` Sh;S`+& AF ,M ,#. L%5%K%K%Kt0P%K ~%%K hY`x$L#$IB hA K h# HLI hr!hH $I 4Kh+?# |  '! " +?* G% %%K%K ~y%OpGKHh>%K 81KO2` L" hFz( HHKO2 @`\ %p%Q*FIFF FF"BF38FL hF F8)FEz(4 L#hK H I 20 `#hOaHhK*F H%Cz%CtL4S H I 04OaHhK*FH%C%G F H! FFhαF,FEмB20!FF"*Կ8FO08-OFF9I@FTFd, Ԑ<,3O ,,N,K-J ,M)F+IF0(hH F! FO 8 z+F F5WPFCFISFBFSFBFYFhf "PFh0FGCh " F I%C8?I08x!*$*(*+FxF2 , ,,Q("*&F%x",5& ,)&3K%"((x%K!*F0"8("("8(\,\x3$K8(3x,",%K3K(88+ #8#8#8%C8LK (8 K8#8`$8jFF $838%C%`%f`𵅰MLNN(8{IPixF#GIDH#OB1F(ڂ0)$8+ 8hhlCF 6H(8Kh;`+ & hZ ` "p)H'HCz3,8#H)h "#8F08` 8$hh`G48+zsh;`+ڊiB hZ `"phKB?tI iI e %C%` Z,ApGFI I"F @h L#h3 `KhB#hXBXA%K KJ-OFhh-CC˰O!#`h9t#@0s:4 &.z@08 򋁵@PF1F@0 P0<F FsS @tKJOq h2J{IEFPFIFPFJK 0DFJ[FFqDOaaPFOaaFPFF q0DJ[FD #HO0hZ`xMc& p`nCh;C`+!$CР + (,(\( `nCh;C`+B> hZ`xhZ`x)F `hv4%% FOF9FD.!0F^F!FDFp9F0F*Fp|]d F$$%-OFLFF#x{I FMhf`h+ВH!F m@+".!#1&(+0K(F8+p +VCS (}KhFF(&F;+N!RuG58jH+ ++3hn^ bI`(иaIXȱknD ( YHYHhnO0~A(0+IHknB(DHEH}G(0+8H=Kh[hn\ChZ`x ( (hnCh;C`+D1K2Hh (̰)*K,Hh"+OQCT xT(IhnCh;C`+A#IK"HhhZ`x h 3@ B""p (1)=J$pri2`5%K%"%pB2[%K$%K %e b(%QhnBh:B`*fBѩhQ`x!J`"qhKBKHhshnCh;C`+J"C p (0~ B 30@hY`x Z< O#p4IHF%U%e%K *%KhF;sI FDxI" FhK"`320[K"Z`I FDK"`I FD K"a I FD(K"Za b(P%tV`bh;`+ڊiB ( hZ `ppG@KANh5hO33`>H(6ѕH.!(#p;H(*9I"7H Ȱ6L4J6Ib4I2#4#p0#cp,"! F(#K"F*Ih#L(I F(O3 ??0+Cљ (;hch3#c`-0+L H!h!h |y%Kx%p%t%K %Q %Q "%O2!FJHI H/%HIF F !CIF C I2F(FF` I2F(FF(I2F(F F9F Cz FwOaL FN p%h K"-A`KL Mh'h.hO3#`Ht('H !6xCx"+0AF#@<x cE" '`.`"*Ѿ"0+3+#0%d%O%Kx%pT%Q%hp @BFFhF.hFIF  p E F)F:(H!F +x/+0Fb1FFF(FN((]/(а@ -O$hF&FB 0K4$hB#!F Fp9F8Do O FEB O +hS&6 B8F'+hXhSE  DE ;F8hQEFFB3 #%%K jF KIhhC0 н0+P#J``P#%K @th%(FIH*I ,hKhD` hKhD `h+ JhBĿ` h+JhBݛ%K%K%K%KJxh320[ "vx RxJ3h20b; * +  O0]@p b( b$F0L#h#AOq#Fz0)I #h+OS#`%M+h۹#AOq0F+F`0IO+h+$OS+`#AOqK0F@0)hH@#AOq K0F00!h H0pO%O%O1Qn-C&\5FO\] GBҞB#;p", , <)ծE5\,М@BDU85-O;FFF$  %*УE#F"TcF FP c-R1/---D%-zBc%!B٣ pM-|Kh+{K{Jh+FxZ#F)m-.)ИBT3m-n-mKh+ƀmKh:x#F)ИBT3cKhkfH.-hфF"_Kh#aH.-c-`Kh+LXKh+\H/)2cF  )ј0  FO 1_0  2!FpEsF|/yx/)/F*ݼ{Bh.-1&ѡBCcPB<pB74T8y#F/*?5B*T3sF9BXBc/%BP *O< ݙB9"B*p#+$pB>"\TB02*p K J9{BcP#F)ж%KD%p%`%d%h pGFFFF1F8FF ,o#`J"` J"`O08FDC\ *F"T,##`>BNsh;s`+ H& ( K#`o#`3hZ2`x +0 Z-CF OFF8FCsFBFH4 +IBFaB #H9D;U$BKI J K(hhhhB+`  2`%` Z%K8%K<%K -GmFFFF _ & #cIF@C@F6P}I@BHzI2F(FDyKh+6И FqhBi.F2i Fi0%v#! bh1@C1ii0eI `@B^ a`aHO0 m"! FNBFYI+FYH@! F>0TH*FzRO#0;h+ !#9h[Br#JFAF F(0ih$+7O ;h+=! `x\4 `$ t#9s Ozs""r!CDh+h#+hA+?|"H*FO20"OqA F0; #2F! F0I+F] L(<#`j%PoA%OFbM8F F=)F F8@?p FF I FFhI F#x 0FpH)F 7F\vFB( I"F I  F0I"F I I  2𵛰#FFF03 FKhB#HB#H(F)(KۊLNKh8FF(FD4 F~"F9FFI"F0F*"F)F0F&BzH(U(ԀwH>#h*F0h+>sI#rHP"M(5oKoI0hnKO2`%Bt#< F!F FBd#< F!F FBT(FYI h8~SHF F+ Fd!F FKHvF(FV!F(F,,BHF F F>!F F x+?n8HLF(F,!F(F,^/K`/KhB" +FF0 + K#`#obpG!X!H%|K!Z0K>13H1hGpG%|2Kðh#Kh;Kh,@ C|L !F$!F yH! ! tHqJ1 qHqI !<hGlKlLh!h!eKkH(F밹`MxA@+2dLxk#ZK1hG+l^H4xx,+x#Z"p1!h[hG(33MMMI(hFhKNCO"FOq(FH F)hEH&DHo1Fx8x + F=H_3(FZ"pl(6M)Fxi8x + F0H@3x;x,+x +x#Z"pMJ1h[hG F3 F$K!FFh 3&&\& %|&tE&xV&hb(&<K! `ع& < IK"`& 4u!KH`& 8% Kn:f*oB (КmQeppGI Z [-CFM O"(hn1+`&O  "(hd 0s FF H(>I"(hu&<%& 4&HZ! ! |CF3И BH@! f! bF \!F XK/!LA F`A" F. I Hh I !FIH^I [XrK"sLXhI1N[P+x;(F)FFphI"phK "h0n+Hp&& &( HP"iF} Khs K\A Fj(H!FbHlF &F K!h FjH!FBH@ &0(- K|Al#x[ FK!FFh , &< K7FLA/! FHAJ# F+F^0!FF pFx# + + `F+FKl , ,њB10kSFB10x*p-GFMFF|   +hkhFh!FH$FY$ 1C K`1H-1J! /K"&IXh1F lX mV(ѝ 0+ + +pK>1#4H!FJ[ERFEHK"`}&<&& 8&&(&&%CR&& ?0Ű*HOr0 &HE0F"H*"HOrFM ! FI Kk)F (݄B!FP 03 H FiyK-OFH"FFXhI&I `~J!0F|K|I"hD}=(RxKhxKn1+N"2 sMOFFFO ch;c`+@ FF0+H .fK1 /?(@ F F F FYI>1+@WK"SIXhUJ! rd~: #hZ"`x0+(ѵ1+F Cѳ(Ʋ (1 # &; (>+ѵ.1+  - & +е1+?~>1+-HAFnn1+?n#0 K"h B K0 b+h* "" @BѐBYf HYeHHx&&&(&&<& &?&R& <& 4p°9HOr F(@6K"6IXh! h! d1J!(F/K0I"h%,H.F&+K>1C `'H'K""IXh%J! t! 4! 0Bp (F`FF(݄BK!h !F !F H Fi&&&(&& &&<p°;HOrxF(@8K"8IXhV! ! 3J!(F1K2I"h~ %.H.F-K>1C `)Hc)K"$IXh('J! ! ! Bp (FFFB(݄BM!F(h!(h  !F ~!F zH F`i&&&(&& &&<0MF(h^I F8JCchCc`!(hx J! r 0#ch#c&<,&0 MF(h. I FHC3(h!L 0#3&<,7HOriF(a4LhF`a;+W\c WyO8E+0+їP+rKrIh(F(oI(F({(FmIF(kIfK@F(gI 8^K"cIh F(haI" F(c FYIF(?lZIQKHJh`dOKhWK`#]0 TIIK/!PFMNIRFNHVG "oC##"#"F F9`(?/ @I(?K"`$統=I-%'J#O1`9J`9Jp$$O4 O5 2IS"PFL ,J`+K,I R*I N(I J&I F;h$J !$H#H(N!IQK&x&$ T`&  [X'q ^ d h *} L& | & &4 &\&@6M <& B&(I"(K2``p0&I&H!"5-"H#Hb c\B\A#J1#<1K Blh#13h8hSh:h IHK$[h[ tI 3h#8h9( &\&@ R [ ^ d&4 \& rH!@&6I xs(2H#`1Khk h-Kh+P 0\h \&Kx+ !!#K`"L N h(H`K"`Kh+!.F h+O3#`:KxCC L! hX I h"! O00&&&@&< t -AFaM+h+j@_HF^I D]H\J x/)7>aYI"F>2VNDV)ySN3hCSI2F>0OS3`ONPI2FOO>0Oc3`LN3h+f#3`;h+@HI"F GKP``BO;h+):hCK`"CK`CK`"w:"I>:h#3`*(8Kh`KhI"F&   T`& 4&`]&&\ ; &x&d&    8& SuI:">`sK8 `0spKh)ր0h(8h@ iK:"iI`>gK" fI:">bK"l!bI:">]K"`_I:">YK"`[I:">TK"!WI:">{OK",!SI:">qJK"gEK"]@K"!GI:">S;K"!CI:">I6K"!/I:">?1K"!:I:">58K"p8I:">,(K" "4Kh 3J`3Kh 3J`3Kh2Ho2Kh1Hi1Kh0Hc0Kh/H]/L/I"F>.I0##`,L"F>+I0##`)L"F>0 ##` /L&4&x&d l pC t xܬhZ\Rd |&@ &H&T&X &P&D &L_&@ &< &8&jMIFF(FI"F(F [X  JhI f ~&Ѐt HCh;C`+C hZ`xK[h+ ##@ Z&L! %H`Z )F&J! &J! &0)MF (I#`\! X!H!F NhLDch;c`+ FB"p 4 0 KhXBXA0#hZ"`x (pB3 &6 Z9FJpGB pG pGKu^&\'+)"HpBIxF{YpF1 x,*F@2kZp FI*F^!?!+&4 ( K @0^"ed""f"HpG(? "de"&&4FH.LMNO < <Kh2ùoF0F  <T< "*"F8F 4 X  &0!MFlt!F|!F|#SC@rp"CCI2C32""bOr$ !b#sCcl!h 0#c&pMkh FB (h+ HH#x+Dq2;p@Hp& RK7nM0DKhIJ*xb Bl " FBjx ԝF HZ FhG 0) 5L&pF,L-M1 x[@h0FhA$I F#k`p!I F#k`FPI F@I F|0I Fx8I"FHvHD#!FN$M+4,B+! F!#!& d * 0 ^ 4 [X&AK1#Kh 0& HK"LXh!FK!F"@h`&(&& p°#M "(h&F0 +M##p1빴B"#1y#0K "Xh|BpB*(h ";Kh(2 I0FK`n#y#0#1& &(& HJ0[ `pG!m VN! TI TORI %3h#0;h# 0O2!hF^(ݽ0FL"0h!FL( #xS+W+B+L08hOb4 O@ %KHh+(Fn +Kh+!!FE"F 1+0+к b"F!x @+|'84E x ^+ xh:`* hZ `piB (J&;-&<&&& H8F L hF F8)F(Рh )F(4 #KCBA@  F F@y! H@'y;+&!0h&)F0F頱P0F?n(Fn`H#y#P#qcyCcqhB`+x !;#B`+x{FAL#h;!+@NX#h"+"`.h0F`#hD+y `;+O4NGNNNX3n;3f+2oB۳mZe "p9F 0{'I0 ` n; f+ oB ۋmZe!"p)hHX1! rH1Fh#h3#`4F#h)FD#`0h `1FH#h"+#H#`@ H1Fh#h3#`(F& L ZϘ pFF; B"BF*pp\+ ^+Bx@:Ӳ F;Cx0ֲ.Fx0:ֲ. ۲2x(ИBSxJx0:Բ,(-CF9I(=7O ! FF6=! FF(9#p FF(Oy5["(FFHFn4F`y! F4#h+L#h+HP##`LAF F^(FF)F?! Fpp F\F@y!nh(F#x!+ ` FJ!F!F8FB4& L~M$L%F h\1Oa!JhF IhFFFXNO"F@1hF F`u0#u0 M#y՞`#y4BT<hD<3hiF8F !hF&#phF3K&UpF FFy[ F8F(F pI0F FzF!F ~s$MNI"(h6 L(h1FdI"(h\I(h"X<H* Fp(*I(h("N0!HX HO!( HK!( &<@fP tx tyT& P0!I$ lK,3CLdF0 \ 0Kj\K "h FRPP&B +! :]4BCy& P&<H!H,0@Lw& P"%L&I h #I" h! h|?@ ! h|I" hpH}0(3(HtHr zI hI h"V n h!|I" h h&< tx ty@f0F(g=K>1"KIh@&<Q Kh "`]pG& |Q p Q 8Kh "`]pG& |oDBF FF(F 0F"F)F8FXHO0>O(0"! &O3FF TF5F4F7FF o 㹸& +IѸ2,e#H($ $ $ $O $и*F 4 D2?sHFO7F ,2 O D OXFvF,DT`ip{,F x)"+v#XH-??"`Z`8FIFOHOK"`O7F2 ";FF nt@$e x)О)CH2;$ U x)=H2;$ I ;%$ @-?P =2" ;$[ . ;$ E% $-$ ?1 ) $; ?% ) $  $- $J 8#og0(?H !gF3+:7359??)55556& |666P6k6q*<и?ʮ2F O38H]O7F i"(4H4H4H3H-2F#nN B'HO3F GwD+ $i+ظ?H h BH;2 $c+ h BH; 2 +o H66666677"7E7k-OF O0 >bFO0>]FnHnL8&2F! hah+F"  gI"OseK&&o hmFh_H4F@F?9(F?6O9OFFFm&FF'FFO2)FXF?PHO4^@F?(F?&F HF9FF6PD ùO2 AF?H<PFAF m Iy F !lF(4HD@F>(F> !l6()F XFR DC BђD+FO2 mHJ;O1(FC#OcC#_")FXF( H6@FD>(F>t5(6k7jԽ777-CFHFF 0DH#&O2` Fo??" F N??4H&4F8C0H$CF-H:FdH;CJG@@p@BgGG/7!KBv)&C2Oc!FXCzs!J kD I, ,."H,.H)FC@d@pDtv K#7788!8( [(p (HJRhpCO ##:J"F9,p$.F"F)F Ch$D K2F F!#$,HH& |8.868G-OFx]-+Cx+,FOO F (D00h++ F FPD0>IFHKh ]O}v! ]!F2Fdh ^DFH)Fs@F ]O>%pCOрH!F~O@W)F F !FuHIl(F6*8(F.nH!F8,vOb!FpCOF8F8F 0B>1F逹0F{0"(F(0!F TH 0 CQH!FPH#"(F#R 00Or@!8F(FfF p;H9F&0K"SF(FO6F1F(F4 F(FF1H.0F.H?? 8F 'H!F=*)!8F`AF"H9FP@H9FPl#EE #ZFHSF(Fn8F F+ F8BF"H!F(& |8g8v888858889969[ 0[#Mv#JOah#Fo hvhp20D 0vOr@!CFHvHf%P)F0FY0F 0+(F0H FH!F(+9 Z89FF+ * *pGF xx B0 \ܱ3\ %FA%F/ 3A/ a,٣A( 3(FO0KOh`Z` KhK Kh3 K"`   F& &F& ,H! A :>8FZ!D)FF{ F8Jh3`pG& 8Fh#x-+4`o8F " F (+hBO0O0KpFh+NuhŹ ! F Fh` F!0I"F`shu`+`hh!Fhp-hFJ@!hFhFtX& -5:F@Kh# F@!O0& 8F F@Kh+)F F8@8& FFF1F(` +`#` 1F8F `(H1F `K9;Fs(x08 Kh+ F@& 𵙰)OF-J+x+G9F(F(!0J1F(F^:0FM FkhB F!!l` 0XKhB!pG& K!i Xii& -A F xFx9 KF!a F M' J)j/`^nJ F)j/`^f+hCE4F& R-AFgNsjB$b/("#b #!wb kc<#c{ou>؆(i*K(c"(Y2(ZН0b03c0sc#s#xCOs$0#0 0"0n(4K"8@ؖ(:(/K"-,K"'O;ذ_4ذo-аo#K "_ K "aO'а?'аOK"KK"K"K"K"K"K "K " K " K" K"K"<ĕH& 'i&Ud7 (IjF'LH%'Hz(1Чt b0P+#b HjHf"(#jK b`#j+ܿ##bűfHU0P(nfn+ܿP#f0H( H=8f H(@th& ;:X; :;J%K((8(  #&) 1((2 H]HHHHHHHH(#H(#Hl0p#Cp #& T;;;; ;#;&;);,;/;2& 𵇰HNL@ 0`H#`K(FF_(H#`z#` HpHkHfHa aH]HXH  p(ĿK"ȿ`KHxKpHM(F+FH<(F+FH< |H{K(FzHx8F->L. (%{x-;۲L+JWVpQCFZx.+CF#X.`"`# o FXI8HO1@yiF F(())H޿K[Mb)) H޿ K[M 1)HP)H5;;;;B8FFF((F!8@չx ++!(F#x++4 F8@8 L H! * !% ! !#`& 5BKhCCH@ `pG8"MFF  "!F "!F KhKpo FNF`8 "!F& &F KhCJ Kh4@ӹI F@&G(& FKhX@0x F@& FF#XBXAKhH K! X;& -CFFFFr B??(H!C dO0 2??0 H!( (FBH!H)FE<,eT$oIGCH!DBLE4B<d-"F"C;;;<<0jqgKhB233BpG&8CMF+h3H! ,`8d*DwO2`(%HYF (ZF Kh("$&H&Gldh>Eli $ #S``B@F!  5K;+#c+$2x0: ($$&$&$<FKxb?BKxx?|cCCKxx|3Cx?C|`Kx@rx|C y?Cx|2CKxBy|SCJy?Cx|Cx|2C4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`p&$KpFhh)ݔB ,`pB <)#FBF;)FF x&B F4FF &$FI I F I Fh Kh+ I F8   &p&h&GFI I F I Fh Kh+ I F8   &p&`&GJ пò\pG&$(FIHyH( @F0ӲHJ !H#FT!p ! FpH#FX!(Os4$(FK!F"p=&=&$FIU8I FP8  &X@DcB ѡ"c+ !@%cXBXApG pG pG*-A FF F|FbF<`@0FrF(F ȹ(F2F0FO1 J)F((F( $$$&FHFHI*FSFI"0FLFxHI*FCF*F0F I@:I*F6F8F<, FBcB5BEBMBZBD8FHkFpI F옱 I Fp F8@}(F8@ (8BhjQBu-O F F2F(@( pCO5I FF F<|(*FOa48.I("F(J(F F+* * *# p(IFX(YFHI(@0"+Ѹt#h+ ;#`(*FOa(( AF8FGm+(!F(lFF F?BB B B((HpGHH3&!sFhF(F !* F"h#R3FF(FpFN F'h "a#i#1F(F'a$hB FFO1JFht+FF h:y&7L (8B8#D80iF(F+2 8 8 &pFFFɹ*6M+iCIJ`hah(hkjCI`hJahhip@hB Ahh K`hB&` J I-`h*F Ip@3BJp 5BBBK"8p ((((O2KbpG& K"( ((O2KbpG& -CFF|O N'#x:F!FB0# (FD ((D( (F#)FHF((Ft(#&&$7% L FDx(F0"F!5t&FLXN8xJ8x8B&hF 82h;DB8 8;D 8hF+8 && P𵇰)L#38B=B+8 (+DBO&8#D;h[scڢBh(0F8 8[ 8+2 "\D&& P%LN8#Dx3h[sczx8HI F>pD+&& PsL8xhFK (h2DBF(F8 83D 8 8x[ p;B8[x+hF+ 8&& PpLXB"8^]k. KO2b 8B x@ p 0F& K8x &8 L#x%X8O2pKb 8 & pFM F(Fn@sBD p(+BB KO2bh@ xU;;;& 7F>% xX!*F F (0K$ `pG&-CF xFF+7KhlhB)! F0Fkh%`c``l`h 1F@FPch@F0; F;LFh1F(#h`&GFF"FFpGL$XKjB"!F$8"a& K-OƲhFL8(h+Z($8+Z!](b*O(h088#h88+;#8H1FO +"+(F +08Y#DB0(h((7 #80&9(.ѠxJ!kBA(F(F(C+tz#=)pXde(#48&#48(؜#48f#488x8x +#488B< + 8Br< +?m:7#488Z#488x+?R#48J#48#48!#48 8#488B< +8B(< +#8B< +#48n#488x + 8x +8x#8$h#48V;&$&&! Khj*(b(5 /FB RFHFAF,(ѵ`N"HAFxdH8x+?48(@΀8 ;#88C8xF EyKEFEF-q8)/ sH#48H!8FFD8x+F )cIdN405!FE)oѺ*0xxFBшEFO x O Eث.F (ЈEFٺ ERF0F( 1D!6E F@ HiFYJFIFhF`I F Fx1F(F^(F;0F;'ܿh  h&F`BB5zB& KhB KhBKhXBXApG pG& & & pM(h0 cF, Fpd.`;Okh+ +.+7+g$ $&"p L#h;KhKh Kp@??h"! Kh{"hbI K hh``K`K`p I+ JO hh``%`&G& & &"&G& e@ټ-CFe AFFDO3FM``2#00CԱ2Bv#020+Л, 2 8 3F Ff"F &$&&UT-AF FL"LhFC`hh80FABh#c`O*Fh9F |h#" ۚO(H!0FнAٺ&"BpWF@]Mkh%+>+; +p; +R#CAAAAAAA% +R#AAA/AAAA7+E+Z/+ѫiFl#+biip@Rhq`p@ #x%F4++ ++L h;+x #`(F `Ax"kixp@x"ki@xKh+p@ Xx!+hj: FhbKh+ohjIHp@Kh+b I Kh.YF(:1FHp@̽&"& & B;BBpFKFFX`0F)F Fp@&"NKMi@4@F/#s`c(Frj(Fm Hi, , K!F`@|HZH&"jQ7B&"7p+LhH7#c`*h&H6hZ$H0h"H*h^ H$hHhHN%h A+F2F!65-ѣh HK"`pL##L H H&"CCCC&C0C;CACI&"t3!Kh@ KXhi8 pG&"COppGKiFH] CL!F KhD```&"Kph\#xK%;.FM%B p]&>#x5 &!F VJ#`hD` `Fh&"DF F-G#_Le&-]O`]Kh3s[;`O ch 0 C QKhO0*#hOGo ( jP @Kh0kP6Khܠ0  1+^[ 8#@ch7+?OCOS#;+?Je(EjH")F @ (? hFP0I#" f0+?8e&#+rzJ`2*s0sKh I"!`i#+riJ`2*s0"!`i]2*s#"#YKh+ 2*s "2*s"##"JK"FhyGK"Fh2*s#"#h=Kh+*2*s$ 2*s"##M"!2*s0=(Kh+"!j$Kh  5F #+r;`Kh+ "8hFG#+r;` "8hFU e & C>T&G\&G@&G2N*s#"##3`e#i+#c #e+rd;Ck+d#"##ck`i()p )p)#i+ yKh?SqHwnKh+ #}"l hK`blgK`lgK`(?mx bKhC`2*s##"#YKhCB`h`2*s#"#g)ai {8hCsh&LCC`2*s#"#Fai Z`h&s#CsFPBPA d+K.Hh`*K"dh`)Kbdh`d(Kh+@?&J &Ih#Kh+@5 ۭN0hrI&FH.0hHIFJ#I h"ZKh! Z0H! &GX& &$&G&F&F:S& CjQCC & D'2*s#"#`i(?{H0r2H*sKK H!2*s#"#`i(?J2H*sKK2*s#"#`i FFH2*s#"#`i FFHv0F( ???Kh2*s#"#`iC(?H!L?|Kh0F0F;0F#&abE-F(?1F"#a#hIF fKhKfJfHgIh.F0F޻dH!`IF F( -e& %P -??.O1(F!t#QIF> F(u - -?p(F.]#FIF F(^ - -?YB(F_R3Kh+9IF% F(B - -.%(FF(6&J% &I(Ph`.%#(IFx2*s%K`%JhBOvvcai[`K"` h+߿Khs[#D4CT;DCDTDgDs&GXD& 7& C\CDDDDD&G<&$&"& P2*sK`Jcih Dh+߿Khs[#K"`K`chi+?ϩ|0F I#"(F+¹Kh+?#c&G<&$& P&GKh0pG&$8FF ^$r!F"(F8-OFFFFhD%FG E[եB< +5#+p-PF>2F!F3($B!+JhZBB8FZB,<++*)HF,FBFIF2(FxQHF9HF9FIFEK# &$hZ`F`XxpG-GFIE6?h +43pF#xp+3pc!B"\ *+*F`xETDFhEEF=?0F+;M&FDpF FFR ! 9 8+hD`4D(``` pO0-MF'O O $ò0 *+pO `& |4O07F e 00;+ (ݝ0;+ A-@,A, Kh+B C Kh+C B 0m+KhB# K"`&G& &"-AFFFO d +2F5B$hxxBI)]Xx](g(B 5=`@(/+ '%@,A,,e  Kh+ C B Kh+C B K!h;B# 4K"`D( [d(f(Ѧ縱Zxg*F;+xF0*/*r32i &G& &"L h`hhh@&"T FFH(ڽ@!Hp&"TD FFH(ڽ@!H\&"XD-GFWKh''8F9FP)FyF(FnO7!0F9F(#"(F?? F92F!F(FF(FJOsKEE F9 S  #xCcxM+ѣx++xG+ <<+1F Fu F@U& F xpG%*Zx%*33s*0@0pGL#h#H ` hK#`&"GG-G!Fd Od O FFsh;s`+ 0F (F'#8F#p3hZ2`x - 2BOI !HF|9FFu8FGF8@F[CHHK(FGMH-AF!DSK"xxBFI4F#x##8F3p xBcxB4;;>FFF#x+5*FAF F~,D;; -OF8&F'FFr,K,JFq%!8FFF/3'p-x7BxB&-KJ(/D&O 6 F>!(FKJ)FxC KxF0F9F FIFuX,D0;F GFHF FF0I F@38FF(F!D4 F KJ!F;FF(F8I0FF0F8 FG?u-AFFF %(Fx+F0F!D4 F8F( K!F JCF/!(F((F8tt+FH!F"@Bc-AFЀF4F%?s!hFF?C(F#p#+ %+ѧBcx%+#KhB cx#+HXD<#+5<%+#+ѷBrx#*F Fut F8D%+ ѷB rx%*Jh,#*;,%*& & -CŰF E$#"(F??Or(F1F(p5lB,Կ  0K)`()F4*F!_0+F F8*F0F8F(4&$&Gd-A08KhF+]6Kx*F,F(Q2H$FA0K(F@FF FDq6!(F'%K)F$Jx$KxCFF^8F8MSE0Fr0D߹I"Fb0FVF0F88_8FPF8F+x[(F8+ F:FAFF F,F8& jQGG G ~H FKh#0! F3F!FJF(FcF^)FF$F F4F88F8(F8 F$& HF I `I F8I F@  jQ:SFmF iF F0 F m@zhFw mHK-OFhFF3EKhO0BH=FбFxFF3|*-* F(Fx(F 9H!7I F($C FF(FFXFQFD4 F+*F[F!FFlXF8ZPFqFPF8S-й *е@ "c FD((F(O3H;`F F2P H<`(F<F(F#x+ F8&G4& DHjQF*K-AFh F.IO0%HF(?(!H1FA(FF FF8F F(FF0FDD4!D F!F+F:FF0F8(F8@FF@F8, FA& HDHNiF\( p@CXBXA'] 0FL#hx(F!0Q)FFtI Fu iF(F0((FF F'0$hpCO(F!*0,)FFtI$&G`  FD((#" F#pKFh FiFK!6BBK!6BBѴ??BA &p  & &"&"HpGF, DB F,C/*FFO`4KhB Cн@ &F K$BB Kh@ӹ@&"&G8Kh 8$??oF?? FBB   &X g1@)p4 Kh"`(pG&"-OBO;h+$AKh+y$%F&FPF܀@󥀸EFDF(F!FJ00hC׀??@ЀzKh+@ˀyKyJhhC@Ā#0 ?? 'qKh+PpK(FpIh hB@rB)!O1!FE(F!FWF F/|0XKh;BBB (F!FO CaoBBu(F!F10L'O kHKhCF(^DKh+(AKh+@H>(F!FF?? FQ!Fa(G!FZ(@"K h9Q(?7PF??%Kh+! ( "! OP# 08K hC K"O0`OJ[4& &Gx& &Fd&G&F&F&#&&G8 ,`H&F&" KiS Kh( Kh+Kh8pG pGBppG&"&G|&G& -GFF FB(4KhB#3Kh.Կ&&??.Kh+-KhABOpu1 FO3*F#F&"KhCѹF (F!F8F?? FѸOEAO0Gae(F!F .F& &F&F&#&G8-OFFFd'p  X FO^oF?? F>!KhùOK h9 (#"F@F+F*FLO yF F (on??0$%FF F&& &UT-AF FFNF?? F &AO0<C*F#F8Fh8 MFF+hB(hBԿ  8??4& K(FFhB pG 0K(FFPhB pG 0F @F޿8F(M+hB F(`#IS``#hB Jhh;`7h7 F8@7Zi:Zah8& 0&"KhpG&"-AF F"@FDE/8F78! F0F`0F #BEF#wa#a 3+h 5`\`ki,`3ca#hCE'J Fh3`>h8F0FF@FB8F7 F@F70F\`$hZi2Zah&" 0hpGhpG@ipG Ʉ 0 FȄ#wpGpGi DapGipGipGapGcpGkpG8F@k FB7Nec8@kpG-OF FgFF8й5`O #!2F1@F;FIF\F-Ѐ= !FO??# ZF0QF#F(F@F x#"(F2QF;F2F1FXF(> \F< * -O FF  ?? O5,F(F!F Kh+sѮK(FIh hBEr) O1!!F(F!FF F(F!Fy(ѡNFF3h KB (MHFAF\SHFAFOFZFFBw>DF (f 8CBCA$O5,Fp .q@FF F +H{Kh.I&TN(wKhCѝ8I90m:F3FF6G(iKh{ к  6G ( ( 6:gw ҉#(е  7F euTSRKh;TK` j 0F"+9F!)HFAF_( BKhkXT FFHFAF=Kh+?+?: ( (0n O .# K`0F" dñ0̮ (0K'"`F F>FJh? `u . .*F F ( ( ( (F F'&F&#&&UT&$&G8&GP&G@&G&G?? `u+ Kh[ . . +F FF# 0W]&GP7F F-pKh*Կ""#(F!F#20"&$-OFFzO3 Kh+ўKhAEOpz) FO3RFKFKhC1j(яKh97Frp , ,шLj#h` ( (0~L#hR (NK@g(SO8FT# CF?vfKhofE (4F @p]KhC@\Kzh+| exn0K`8FmIF II h)&HK" V`#F"h(,:Kh+?"T F F 4I h) / /)v ( (4E ( h (4E4E (LEu /^FFST??{KhC / / +FFNEu C# V# # T"&F&#&G8&G&UT&$&GP&G??pF F!iB ( (< K NT6C+F#3#F F Fv 6 . FF! 0FRKh+} O(F!FF0KH!O< FoF??FFELEuA>O;h;BTO0 khI "3k`#`"QF:FOaD(8Fh MqI",nI"8!h!hg hI"~(@Fk=.-!.*<.Ц ^+)#` 0ZH>.Zx=*ј+&Zx=*ј-& "FFELIMHZx=*ј!JJ 3F*<.T+.W-.[ki"=.kiYКB""*?x(?uFFF; +L#+ѓ+<\+# p3x+ *=!0FF(SІBQ,+*M  Jx(f!hkiBԿ""kiB̿""kiB""JBJAH@ԵE&" jQ?IIIII;IIn p!B!F43x +=+ !h"0FCx=+:I;H!h !!F !!F3x + !h0FFxFFk . .#0#hhhFHIFHOd IHIFT3(PF`x*!h_i!hx(?:!!FO;JJ?J0 ZIK!B(¿Z`i`D`pG&"K T@ wYc&"JF XB0(O0pG (F JhBJhZBJhBKh&&&&-C!LOH8F5!F8F5F6@0F6 (hBF0FO(FIFHF6jh6g ep&"FO FF0BhU;iC$`(&"8FJi]a FFF F8@P&" JFhp`e  Z  O0pG&F8Kh+Lm!P M 80 L (8"!"!&Gd&";MBHLK0HK0!O`!`O`Oc0 aHH H H H#0MJ&"vM[Ml&#&#&#&#&#(  pGK8pG&"8#Lca#F0biaB$H%`U8 :UU@UPQ H} Hz Hw HtP8hT#iiC"Pi3&"&#&#&#&#&#-CF, F0+3FF>J0hC*0+8F1F5Q[ #jFhFPF2N%3hBOnF%BQ! <,K `'>F F)Ff%KOb!0+ L!M +hB! K!0??ЍBt I!BAJOq+ $! 5 @Q5&F&G&"&GPH&Gp&G8KhKhKh+Kh3pG&G8&G&Gp&Gp LeiiBcia0#`p#iS%0+h0FY]5&"(F FF0@77Kh#F(bO4 F1Kh (A(: F,Ni($$+2io@G;D)FR#8iD3iS'D(F3(гi (F,'хBJhABJhBJhD$(!F0F2iC;)FR#t(СKho&$&"&&&&-OLvF FF0??)1+@Ae#1ih+@O1wFiPF+ÿC!i3#ȿQ#0)F:F%)^s8F1FOG(HCD2??вBADv#1-%O kKh+oѸ| O  1B 82??08v+xHFFFEr 1Bs SKh 1C1+#1F!O HD| #C ZE  Ѣ1+\1+ј ! "v/  "S#h(F  Y/KhDE F0"!]60B#H& ")F-H_2BZF#aiBܣiN a0 1PBl1h" =}h\T!iQ"2A#3&"&Gd&F& P&#&G-AFF FFKh+ 8")Fg( Kh0D(FKhDB &Gd&"& P8FF*F#FOHq8 8-AF MF$x$1B  2F;F $4&$ O?h/ # F!O8 &GdKi(!h,!pG&"K(!a,!`pG&"(FK8  &"(F HK!F8  &" ( ! #3` Ch F) h\) \B\A` h+J\B[$)3`\+#C`O3` F( F(7pF FF!*F FW#hBF0F(p-GFFLFF P*01;0#10#0(1F(FF((JF!0Fx 01[h PH JF!0F`F(05KHN0qy0 ` G)F0j 1B qHB 1BFۣimNh0kN+D*FO1B ([^H3`05#01.}\Kh*[Kh):BF;FIF Gi+*_i+I`iBhD @%i@8U 0BF;F N8 g*9)/)`hO1DeFhBO1aY!iFi2FQ (FS< #h(#`#*) " F*()$+05F-aIhi h\iB"iR#PF_.2ѫE(BF;FIF0FnO3080 CE&"&#&#&#&#&#&F&G&$&GdE .dCKh+BJh*)CBF;FIF 8_.hEF _(E0FPihD1FF(,I0"h01+0݂B4A!F$d"N2F)F (v<,~I;Q#B;8AKh+?c.`0+0F`0FBF;F ! Kh+JF)F0F&F&G (&$,&$5FTLFFh - (#! -MJKh+IJhʹù0+ #g0 " F0$+I9$&&@&UT-CF=TF FFF??.0B#p JCc`Kx8HHRSjQ&G &GRW08(H!K"`pGRo& (Kh pG&G0L#h+% `&G0 L#h+HiF#V##`&GR0 L#h+HiF#@##`&GR0 Khs Kh[??ѽ@&F& (0 x J^+pKxp]KxEiFH Rp()0$NM4`,` x,+ I#H!F0`x,* I3H!(` pK! J FhKhH&F&FRSS(S.(0Z09$?+GK`0R++D+++BHiF0e *'*-03EZ+-+%У1* ;Cr+d+W+^+w+@@@p@`@@p@P KhQE#0 TDF!PDK!DN!DR!DW!!BH H )!BH-#0 piF&FSKSfKhSKh+Kh(Կ  pG pG>&F&FKh(KJhhDpG&G\& &FFxFFEHiF,F F!D8`FO!xi;hK\)cxS4;;$)#+p.0FP(Sy&G$xBh+h FHJ*!H]*!JH&FhSSLIF F F&FS(hS  pG(h ЀipGHpG3o(C HNSKl8 pG&FhKliFHH]&FhSyFh FFx-+0''x0; +,##`O0- HiF "1F(,-H ##`/@BSS-OFpNlȱh+ +Ci G#d Bl"iF ` FFx*\x-(W/$( (٠ ۲)F(+(#3e3#F F(#x++Dġ3`s F39(/(z$ 0 Fa O O F F,F,HVn(0+Xx-(3+(@3% FO@!a O O xF=*ూh**5H=J3h;+"F23+'H'H2U`ci!F G,n6[ 2-ѻ;#;#[xd0x +iRF (x+"QF%&FhSTT<&F& 𵇰@#@FF FwHW-hY qH煹 nHoqAx  h;+@e_bi*@h+5F-bi--l!i h[ `*`%h.gУh`*M%1[ `*C%-bi- ->!i h;#;#[1;#;#[+1H!l---!bi+#i`#`bi%H!Rbi* Gbi*- Gy-vh+ӱ#ih+H!#i!h3T# +#iih!+-tv#iihK"`lTkTzTTTU&"FhFF xF0; +#O F xF10:ײ / "+.`<##`,##`O0.HiF+ܿ3 PC3SKhKh(   pG&G&F H< K"` L#x#i h`h!ciFG$4U&F `FHx FpGBЁh ;B$0 `-O$,M#FF'FF*xb+A#`O XFnh~$5O 1hRF@Fv, A8(ټ- IEIE 0h7F0F#F@DBDAhպvhO # `+?h` `H((ĿK`gf  pGZKhYHVK" "`"SKhBQKhoo ]WGI# `GKhBIO3 2 13BKhBKh+AKh:K1+2!.0 :J&0h"oO213KxB ,JohC`&K"`+Jh**NJ#`!Kh{X 13 1+ J 1(Xh+?eRh#+?_O0| KhB?w(K"!ool&G&G&Ud&UT&&x&G, & &FH!F&GhFt]Fh2F(FF0F!D4 FJ+F!FF8F*F2(I"FHHgv&H-CFtF#F:FtD:F#F(DebEu&IBBA4!!@#d#"F]7L3EE0B@! K2#JKXChFj]bMB@K IhT "FXh`BK"` &H&"FK\` K$""$]pG&H8FM K*hB+h FZ*`p"K$8 &L&HKshK"`pND FFB-4Z4(F&UT&"&HD(-CFFFIB`@H Oy#0JF3FF0F FR `F=-8F-#<!Fog˿-AFDppFF# 09F#F -(-0F-",!Fog-OFF FO O O :F;0 )٣a)أWB6#4#FZCK A)أ7 O1O0-OFFFO O %BF;0 )٣a)أWB't$F C5CA)أ7 O0-O%FFFFO BF;0 )٣a)أWB"7-"4FC5CA)أ7 O0-AF F$x F%(_^4;FXxn(+c(/d(%(Ns(x("Uk3FF ;CF "U iFhFzhFzD #jFx FFF (CFFFFF fO`29F0F(FK FHEK"$&H ( Ђ*KAս@8o!JpF 4 F3 4]@)F F]p@ ǽKh [O`K)F FhEDHKhR K44DhBp@޿"K`k&H&G(& && P&"KJo];g7F F0)F F0@KxJ)FJF FN0 gg8F F)F F/F Kh+޿K"`Q, F8 3& P&"F'KQFFh+!Щ! "K!Fh!K:h"[ CBF3F0F2*H!)O4)J!wF ##F!FFB $(h 6(h2.` F(F2&Gt&U& gFh  h2##`@ pG-OFFF(V_MFDPKPDE pO3`+`&F"#FQF xѢA 2ҲEшBЙE!13B ,`3`#s`k`#KV#U# B 3+4+!F:9 "B"6  :  +!`p F9/ۘE3B#s!``) F#q  /F"@ E"\E"@ F"23F*F&GtHpGg؁B Kh8p@Kh8KhpGKh8& &L KpFh F K.2hOؿ"FCTp& &LKp FhFKJ)hOOؿ#DD!Dؿ"ep& &LK!hK"rh& &L Kph4Bp Kh#BO0ROVhBpXp3&L&  KhB B32D*t0 &LK h9& K)phڋK$O6h9K&h<U1 [h??1` U1 [h??#pB1D&L& NM2hkhB#,hhF! F12!0h3hk`F(`^??S;D3B`p & &LK(h( BF8pG& F"YxX:)ء.)F?)\)љx)И2*pG:pGFpGpF M+hFBF(1F(4"Fn@*`"Up&LH38F M??,+h;Bܽ8@4 Fy8&  #jFhF] "iFhF]8Fx FP+ b;۲+DB"cxj+B+ b+#+`m+ t+ 4(` F8oO0oKhK&GX8HKMhK;* F F p M(`ph`p`87&F&L7\ -CFMx..`;'#xC+hBГHH :+8 %+'.+𪀍0 p?+ \+cx+𜀍0F# 0#VxF ظK ظBۀD FFtL,S( !% i w        !!G!M(hB  X@0 9Kh+4=6Kh5I~83Kh+?sC -Kh+?g??]0(Կ  4(KhZ???Ay)p9C?5m)p.HC(a~(!Kh&L&L;&$& jQ&Gp& #HBF6?tS($1 "#=#Q     #   $   $G             """ #G#_ #y  ##  #  $1"   $U)h"B Fр+`"p??, #rCjKh)pfKhfK hE9`;1@??TQ! n9`T)pNK9LJhhLKhKKhsHKhnEKhgF@F1hk;KhZeQ5J@*s)p9`B(wsFF??F F+rHFAF\+FQ F?{J@*sqF F5 9 ()"" Hw HuKh,(tQ&$&F& & & D(Kh8  Kh Khd -U K KXhXK"`&G&F&L & Kh FhhH %i-5`FBrh,gBr- FF FFBrDh,`%FBrۄh, (F`h h\hZPhB S``Y``` `!``#hZhB `S``L`` `!``F@h1# Fc`@pFDhcBv! p0!F0Fk#3kh&``[`l`ch0 hYa` p&,`-AFFF Fi&K`h%K``@h(< `F/B$#J`hXBXA@KBF1F`#F(F( `h1Z#c`(FA )F``n:F!1(#1?e`O0&Gt&U-AFh F^ iBp 3BqڰjBrh"jE~/ۚBj2EEW## MFŔfF!BA۲hjB!BABPBEhC!EEP8Fhp`Fa `a`#ka.`Ɣ)hѹia3iS BB8F3i`F` a`5aKi+ hXhB hFBTi4 FHaPa"ZahBсB8Fmh+h"8FZa"h[hBJa ѽAJhBћhB8FhAxKhXhq@ h8 &U-C F FlT# Q@r!E#hbhYBѱEZGs2CB2AiF@FEchZGs2  4&U-OؠFFFh+Y2h*VLO0i[/:!BO$a!*F9F*F9FI@000 y_9FO$b2h*Fl3hBB4 0"#2"F( F&UK""`ZapG&UFKh /Mj>#bKh$b FM??7 FWd4;h;BO$&"&U&& 2K-Og??W-J h,KhQh #Oܹ&Kh %,F0;B(C2O FF??F@FSEs ۰??ЏBv XFQF F%DFPH&&"& pFh\ KDD  p`0 F04F&UH&U8F L 58@ $i!8@Hj[ b&UgH&U@8F Fy 8H"F+Fd(2BA &U@-O FF #K2h KhKh_!FXFKhFKhBOrr 3OxF@FYF F??+: #?? 3^F%F # Kh@ #?? 8J՜BF{MںK4+Hȿ4XF!FĿ34B!SFF3H??K8+:_F??F33SF??F'6se  B s 6 ),SFF;H8FLFO FPFIF'GFEKhk-mBoRFKF@FXF!F(@6Kh39KhS 6Kh 55K5Jhh+l4I h)k+F*F1Kh+E)FFF 20FFKm-O(lH#"!2b(Zz KpV+JEE& P& &GX&F&F&UT&Gp&F&U&F&F&G&GdE*)+А)&hb"!HLE{ iH00VFMFFLF!??ЌB{ #B{p-i-l ; +TKh+ KpV 2F(X+H!*E%XFBJ[!F`R#` Kv##FEvXF!FS(PO Ku##FEu ڱE+K `"*K` 5E0X0U5 # 7+!+! JFWCH7_FFR#` Kv8FAFEvکEO7F7x5FFO3&U@&F&$&"8F F H*F#F(2Bu(F!F8Ti&U@8F F H*F#F(#Bu(F!F8S\hB5FF&U@FF#;`'Kh&J2??NEt ۵??0ЖBu,F FHp F FHx(е??2BAڀj(/#;` Kh++Kj+Op&G8P&U&F&UHpFF +xKm,K"eK`p%i F F0X,F! #2F)F3F`a#( Fp@0@Km#a&U&"Km8  &U-OFKFF Fk[k(?aOEFr+F FCۨF& B3ѯK!??߀??ˀEy-&JKhC IyFF'F??LJFYF6( #@F F6F O8$ B|XE| 򹀌BuՀKhCBOpùeFFF ??ЋBx BFBu^ڑFFsKh&F&A&oF&F # #JF(F!F# [F(bJ 2 ??𛀊BsWJ2??ЗBz/zPF9Fh#PFF9FF?? FeEKcZcT BpY}F'FRv??$Bu84KhCBOru1eF,KhC IyBuOvFڜBueFeFFO WFUFTFeFF8O WFUFTF2FFBO WFUFTF0F+ F ѸYKh8@FqVKhF9f#FF F4??06B7O4%FEfF??FF(Ѻ?W8Kh+7Kh 8H!C,FF F??Ѹ&4F5F0FF F FO;#O2)FO3LFx#h+Kh+? { ?? ZF#h+ Kh+?BAE &Ugg&F&G8&G& &GXh I,JhC`Kh@ջ9e&UT&G IJhC`Kh@9&UT&G < I J!FhC`5Kh@9&UT&GFбI KI h+!I ! I@ F !F ! !F !F9& 99e9-K-Ah,SСO`'! D(F)F )F >!NI z zK"`bNM/h3hCE+hB +hJ3s[`I K"` Kh#A &UT9&"& P& & &G0-CFKFFhHF)FFFHFp3+] +@F9F# &UX-A!F FFF0F!D1F`l#wa F(F!Dn)Fal8 M,hB K""`8#hS``/i/ F/ &UX-OFYMMhWIF/s.RLPF#` F2FOa8FFx0Fh++hHF#`#c` M;x!+BF9FPFb(0 + +XFFx+F )!pwx+!FyFHFFkh`C``hh`3`ZZxx^*3FaEм ,$*O3!!pF\2])!pCx0a+[+\+TѐL[40 p!F3)K)J,Ihh[)ѣ.ɲ)GFcpFDF]cE 04FKJIhhFE0; F;n0 # p!F\BpF pB#0 pnpF&g&g^oJ FpFhF F+""p0 JIHh hd4 F"F)Fp@ *26@ b(&g&g-GF>K I  %I CF FxJFAF0Fp1Y(V1K1Fh0Kh/I"F+F }v\,ZxU38Zpx[,[$[%x[,[,ؤ./ * [-<[+%F], Zp3--[-,B 8, e `O\)O: `,,2 `48H8 \ px0ҲH@hBjKhJjIhhB ,,8)P8 xp8)Q8\!p )YKXJ[Ihhm;+I+#0'p+"w+Mi+1h8)x+?o310\i28)DKBJGIhhWO #089389H 8 "8 xFh"+,/K-J3Ihh-89@;891h48I8)x S38)x T"4pBKJ"Ihh 310X28) )Q8x+ FKh [Or@ a F0?8IMxkjiSaԹ#xF&_m&g&gH&gxjiSa1h;+?Z1 R;+ F(miMhQhaOp #haF@30 \+чKJIhh 8"HF)F\0KJIhh X8"AFK2hx0#320[ # FF.Fh ! |jKkJmIhhZ # FF.AЅB`KaJdIhhFcKh+1#T3 c hxѹ1hF;+?Z1 R;+}+?JKJJPIhh*h3`*` "!F%F,"!@(F.z0+F#cU5 c ( x* !.dF"U! |(h, !.VF x ( )h xT JD *hBD*`!TOH  +!Q JF @ v)hBFPD(0@l x ]&g&g@n _-G^$N!FO|`V[p4,Kh+ XCK`Kh0K`h;hHF:hi(FUF.&Uh&g&p0&o&o&o&g 8F F#`KTh``8 dF "B`FJQh`CKS` dKphNmh (F(h1FF(Ch;C`+ ڽC !F F& phZ`x F&gp-AFSLFF"j*8*\%(Fcj.3`bZh*hFIcjb h CI| h%#c%bh!?J@Hb>M(>Ikcj%c%hcej9F@FFj3b+ј #*ј n*a.j @3`cjjhcbjcm:x#*Zxn*"a@F:F!*7 ce#pj3b#3`EFxB *+!:Fceej""b)hhBab?jpj3b.#p"ceBp&gp &gLmchh Ch;C`+ڽCСm: hZ`x@ &gp-OFL Fm#hhkchI |4KJeX3eK"c#f#cfLMmCh;C`+ڽBСmImmbCF@"k I|hZ`xmHE p` (;нp0۱~H}I kzI kXyHp4rH x#p0p4m@@EнmH!k(F#egHp##fbn#hڹ[h#`#h+hch c+(!k ZK F ZIZK|#cfchxObOHahMHObpo"k NI|!kOb(!kOb `(},FF `}BJSFOa(Fo(Fpm@EнJ8I(Fe(?BB fm C`h%fb(I ke( !kH#aK\#f瘱nD< + E ;F`n0F*Fj 3b @ &gp Z&k&g&g9BkaK [F-4 I"F | F @F- I"F |8F F-(I+F"F |8F N F0h. )F# FnF;F)FF0` Fn0h&o])M)O&khB&Kh@>$Khh+5h.I"FF |n #*hsCX+6h!;h@hI@h$F(OR#F!hFF F<;h!hF 3 ]&o&g&g2sFMF(h#I |&`+i" ``h libF2H( h^IF | p &o-CFALAO2DF[ij2B AjbiDba"p&--\-Jx8h 0@0՘ \*&*Fij2B AjbiDba[i2aAF!"iOR Jh????Эij2*DB aj)DbiDba"iFJDQh*F1Di*DF+D&o b(FBhFAiF*DFSBAAai a `/*F1F#c`D2D"e`ZU-OJ#L`H!3#cKh-a#d. hBh+@ak!k@h(逫h h)@YhKhB@途Kh`.0+-hh*̀3h+@𓀋KhrhB)#B`+~=;>+R#iI^[^[^[^[^[^[`^[^[a9aS^[^[^[^[^[c^[d^[^[^[^[^[^[^[^[^[^[^[^[^[^[^[^[`ggm`a^[^[a+aIac^[^[ao^[c^[cdwddga^[^[gsgh^[gm+ bk"!kph38 +:KphhxBxA0hh)DQh2JhB>`+S"`"d2+)KBhhB?0 )+#d*h+bk2F!k@h0+(?# +K@hhpBpA(lbhB! hYCZd& `fh #"h!sC(i6Px`|`f`&g&o&p&Wh#! 1h˹K(ihKkhC ѠM!bk k+h k)h 1zl+M(k+ek5&kj !0Fj#cA0Fbc(e#H)#IH""## H#IH"#{K(ihLu#kwOck:hyKB<#03 uHPxCr0s# oI  (ѽ*0+0"!&BC06B9hbH9h$ |9h x;h[+[Khh+h-mVI"FF |" -9FP "!x O$ GK6hB9hAH9h$ 89h &4CDXF-FXF-6Kh2FB9h&/H%KBF!VDh( XF-BF(H&K9hhFBHVF!K6!I K8h LJO hB9h&Hl  K+Ih2SE^D&g&g&p&p4 [@thT&g2 l9 BrKkhC qN!bk k3hk1h jH! #cCeIcH#"aH!(5k+0ZN!bk k3hk+?%1h hk+ x !28FF8kcc#c!bk8F0`k# B.?ccc:KkhC 8M!bk k+hFk)h (WlbhB! hYCZd `fh "#h!rCki'khjiRhB i "K`"K"Ih{ck9FHF#F(#aFkibk/к#i @̀#i!kH[hz#!ki8Fj#ihZ9D#&g&g&p&g&g&oO  hhBB вH#9FRhki8Fj^#i!BBODO h_ڣN H 00<Ϩ H<jaki[hcO!rk0k;hhk9h Joih(Y!Jh C`Br}H9D#"#iO S2ADh"9FHF#F(hR9FiH_`BB2A#Dh "#9FHF( !k+;i3Or@ a8a0kihQI {ki iskBki"JIi(?h+?y#`miDk+pki3 (iOr@ aha0*i hickB4I"hi(?Q"m"0I#0H/N 0 <Ϯ 0<6Ɯ$k+ 4?J&kh*f3xp(p71B*#"1F!3x0; 2DB&o&o&g&p4&p _ #"1Hv#"H"! R BE 0F7BF$ !H (U1S 0D|0 h0<ǜΨ H<h x0h0KIhKh*&pL&gt&g&oKh#"I#Hh`~{) Rih&Wh&p4pF FO6Bp#~w+{+s+ciiB(cih I {Xcia$h`iC"ifa!h`i-CFFFF ,FBI {0#`@Kh`O>I8F \`nX.U(FC-mZh`B GFFFg`F;!+!У<Ѳ) *=<h(I*F {C`hYChChC:+h+ ;x+Ч`#0hBC`.ch+f`:!HFF(#;0B+  HF alN&pd 8F!Khı`h )F((7h+4 *3!K"i0SBSA3h(F8K"i0B##K"i0BԿ## K"i0B̿##K"i0B##$h&pd'i"0FMFI*F {NiF d0 I {DObiF F F M0- K : * B² *Iڸ QppG Z [X I0;0+ B0Z "ppG1 Z 2L!Fh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@ظ&qlKphkiAK4( t fx.($x hp|p~pqY}p, F F ɲv!ҲZu"'n0&qlKp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p&ql'n0-A4L#hZi5#2JhҹkC#h.J![ikM,N%,O3hB-%Kh#"hRi( "J!M#"hRi, J!M#"hRi40~H8A #h[im)FOh J!M#h! J5[iM9F@Ft+'n0&ql)&q [X=8FH`3I  &I0"F"HJHOqM, F8 !(Fx#p+x3,IH2L Z [XF&pl[sX%H( stF"Hx?+Cx۱0MFN! FO0 Fp/!D Fx(ЀhFS+ !F0F, F!F(Fh#`! {lDIFH  [XKD |<0BєB4KFIHKh[i1cxB [x;IH@{K,IH,؄@I@F H,I H"F I@H&qlĥ [X'n0 &0IFH2 . [X7F F"` F#xx<#`O00h"+@0O0 FF*hiF F0I"F {P'p<#MU#@BFi3XB0D1DBȿ""!FH}:"L@I4; Hi. Hi, A"H}A"H}&T&n"L@I4; Hi Hi A"H}A"H}&,&F"L@I4; Hh Hh A"H}A"H}&& I H0 I"d w J#IOp,v&Q&o I Hz0 I"d Y J#IOpv&)&G I H\0 I"d ; J#IOpv&&L h( h"O1 &t FN0h)q? @N!*O0$ h"F|A)h0h;F"(F F&t# `pG# `pG# `pG `pG-AF FFF@0B̿iOiĿ 0ȿB-$KAiB#S)Ѵ0iB"-aҲw*b1ʲI7j﹣k۱2F)F FG0BiAKA(1x"+ Ii7L8Fi F0FA&ڜ-OF`iF8<C@+Y(e FFF ! Fi/GO2AFZFA# iCB0 DBȿ81ѓB3ゴ0DB)ڴPB*OFB*#-GEcڣj:F FGFSF! FAFZFA;x+{FFB+F%uGE)#%0BѴ0+K2Fi9FA"iF802FKDiYJiOi )[hSX:F)F FSF5_FFpFFF>F0F:*FIF Fp@F)G 6:F=!JOq5;##Di@J@ JOqJ@IHXJ3K@ FOqJ2J@h IKOqF&,&*&+&)v&G&FBF)K159A#JOq5;##Di@tJOqJ@IH,XJ3K@ FOqJ2J@J@K!h+ ""KOqF&T&T&Qv&o&n& &F )N#'=AEhOq"K:""Di@J@ JOqJ@ JOqJ@IHXJ3K@ 6FOqJ2J@J@K!h+ ""&&&,& & &v&&& &8F)81hOq5;##Di8@J@r!h@"hI \3#2Oq@ Fh@B8&v)  JOqis J@ JOqJ@ JOqpG&R& &,& & )  JOqiL K!hJ@K!h+ ""pG&`&& &) JOqi(JOqJ@ JOqpG&~&,& & )  JOqi J@ J@  JOqJ@ JOqpG&̰&4& &,& & ) J@ iJOqJ@ JOqpG& &,& & )) aJOqiJ@ J@i!pG&R& &)) aJOqiJ@J@r!pG&̰&4& `pG# K`pG H`pG H`pG `pG# `pG `pG# `pG# `pG `pG `pG# `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG `pG# `pG# `pG `pG# `pG# `pG `pG# `pG# `pG# `pG `pG# `pG H`pGK $` F&xdK $` F&xdI"Op &,I"@ &  K` &I"@ { & I"Opo & I"Opc &,I"@ W & I"@K &  xK` &I"Op5 & h+#`pGI"Op# & I"Op &,I"@  & I"e  &̰I"q  &4IOb@r  &I"Op &RI"@  & F N0h)q? @N!O0$ h"F|Av0h)h;F" F&t-AFh Fpchc@ihFt(!0F``&0Bܽi7Y)ih]pi BY!6ǿFi7B j8iD j@##biEi@~#a%KF@"iOձ)<DDF<#c\2B5<3*- ! b@Q! \@Q!@ U@R! O@R!@ H@S! B@S!@ ;IHL  [X8!L#h+87t(6=h=BIpI"! IO09,O0@RM(hB``(hB!`(h6@ !`* ap J0C/B<##` 8  &q'h -OF,򖃟KhB@iS$@,#! +@Os>Ej#i FG#k FGi+@F P1O ##X  2HFx*@&F&`3i*0B@3O F;FB2FF !0F# _(0F2BFF #-omBBF 0 QI KhXFEݼݴDѠ %u@ DB"R!(=h=I0 xIhQ8I8H#F"7KBF.&(^F,J  hE&=>(J)Ih2F'HSF iO  HhX5 BF  0E? ѣ Oc -Uh-um8DKF*FYFDBa= I;F QDB &q [X^!6lIHO1i9iO1@#մ YFKF*F8DD bEd!jKhD` F!0D3BۚI i@S(F,(FIF+FF+ E60h@7r"F]K0h@+F"!0h@"!0hJ`0hG80h<003x(ʁq(Ɓ>(2d(0<(EI . *  u(PE аڰo|`D(/;K[h;OE`jO F@SB+x+0K[h;D=Ef0+?  [R#s"ri7x(c?a80Bi[??z(`(x(8 (8orD(?ɮS 9'h [X b('h&q b$+?ɮR#QQQQQQQQQ9QQQQɰ1ڰ?(?ͮ?<(->( ("C0hBo `p3D7D pB8FBֿ1ؿ OаBc@00ozwF.?@W&!A(F8FiXh *i3D]`3@F>.@FD@F?0h&qKiS 0YpG&q(KhBiS pG pG&q-OFFF*$PB*AF $ FD!m PPO U$() F<"@!&q-OF]L FF@#ga3ahGfhL3xs#i+РhBh !<#ca#GJhZ0 @%1FF+"20 U +$#CРhBh !Ky.FFh.=320[ Ը 7I .F=Dj>>.=320[b0d-nT ѹRFIF8F8F&FBnb"D<"##[#C RF9F#;U8F O*иKERFIFF&q b( [XFMh౨`AF0FADC4+hB F)Fdhh*F"##8F&qF M(hAKiBO3+`" FFBFO0p#"#N#F a (` F,hc I F 0b -4&q@u#BpF M+hZЀ N2jB 00iB,hD Fplh -4&qLh6"##&qKh&qKh&qwFUk F1F*F p@pGSK!F*zF @pG R]pGF F@FHu@FHٿ-C 0FFFX F8F ZIF*1"F!c+FeL-OFFF@AFA-F'&*)FF(FTFxCB 5'D3DB%F''+x+nDB,''?dtd  O !(VѸ*FO.ؿAFܿvv[Eȿ3FBF(;+Fi@IBF%F5F*9F# F6!FPFC*PF? FDb(F? F? 0D FC^F !KFhC 84F F8?F F? "F F6 FFl sB*`F F8 F0F8r F`?F0F?]'h&qL   𵅰F F FS{9F*"F!c+F L-C 0FFFX F8F IF*"F!c+FLSK!F*F @pGI8MhAFhA D8&q (7hFLjH ^<%h}hFIF(F h h\##`L%h}hFIF(F h hJ##` KhI H0&0&X"&r [X9-O7IFF`5O*F!hFPȹ(FA >jF!+IFF+H F)y 9FhF #H(`.0F1FFF FF( УD9FXF| =*L9F Fp ID FJF!F&T@F  ( [XPT90Q# -O#M`F F<F(?0FjF 5 "AF(F(h #`9FhFfVIFhFf)FhFfhFT( F(1BKPF`)00F2 Mh ``h)(``hF  K*(F`K*ZFKhKKh@f &\&H(^HZ  @(Op@ 0-A -M$O3+` F(? !FY+h+5B'iF +ڀY!#]" ?F(@Ѐ 4F(@ɀ X a &!F^ 0!F G(,`6nMF>!F(h0(!F /(h!0(!F $bKh+ !  4B+h"$!(6F *hX TI2 #(j+h)A (a(\ S(?uU!)F(LBp"6B(&B5/F.FB>$OpB>ӷBS(F)S)"BE$4U"B2Yk)"BE$4p3U"B2U& 0(F)WE6V h0G(kՃnczRnhR1 [h }4W (&̬&t&L( FObF IOb Ob `I `Ob  (  ` I#F"F DDDD!F a  FObhFIObhFDObiF Ob I 6 ` d `iF  ]KK0$   ` F DF Fɲ((9#H*(4!H%Fx dXKMhF"F!F(hH"(h5 (hEiF #_"Z! 7p! .H HF HCk#0&̬&t'h'h&K$`   (  FG FM Fɲ(#Kh*!$YFiF 3S#`"!F FtY#0&̬&t-OFOE 3x3FxF3 **O0F pO [E ZDD6  B5OL`D %)c Fx* * .Kh#F+*21 P#F)ЊB " Fd B $B5@5H`\(x+aF1 + Kh#F10IԑFBcc*ѻi :F)FG(?{3P,hC) UhPziS)lL b(7hFL%hhFIF  h h##` 0IH `xI(FthF}IF(Fl hlh); J IF[ G&X"pi KFh "FIF(Fp@W KF &X2&7hF#L%hhF* IF(FJ h h##` 0IHfF `XhFIF(F0 hKh[h)JIF[ h) IF H &0&TDM [XsF5M F(h5!(hA(h=JE e!F ?@F [?F@~ T!F ?@61F!H4L@n H?0a 4E(h@!"bC(hB F0IH !4G8h(h7F F7J(h>F F>" FFHD FE Fp'hb [Xr-OF- F F1"1.0Ā1&O ŗO:FMI+h뱢I*FF*h*ўIPFI*F+h+I*FKhKhCFp(@ *F!H1!(F;  Ϭ)}OCs)&)FzD18h8xI8hB=`rM(h@sI(h6#+`pI h@oIh`h 4 ^jH Yq& x \ "hFbH PK"`E\KO0`}XK!F h~!hVHUK! "9`` FO67FP C h C` T \Fė#YFOpF (x03.a'z $[" B "8FIF*Hn7$f,%K h3SBF"FhK `h$ w&\ 7 tptb@f&&X& &  h+VH@Lh)RIF F$#"(F^B*OrBDKhBK$`E0+?. p0,* OrB ` F&&r0#"2%K!" S#1 #IO3e I H< Kh H6 )F5 F 0@ 7 [X.& -OrFF(S+! (VHO0#0iOpG9I(|F6Kh(5J(5I0I(qLF(O OW 8F(dF(= F;ѷ:{Bػ(F([#0(F9F(/F(6 Fh>?F# FUѷ> Kh J( Ij0F&qO6q&;pMdн-OF'RK !F.@ZI"F v'-6)F !0FF0F5 FOAF(FI2FID3F@FI0F$pB x%+@+*!:0X+x'+5<*++/!PF0F(@րPFFF@FC XF(@ȀT'0EPF(XFI(F7.5x-D'PB3h/𾀝BѸPH>? >?@ET@@ƀ3hB@EH> >EB?HCh;C`+򴀷 <3hB(F=, @0h40h<~!0hAE2 #pPF/#;F$B{.*?+ AFF(  FhE7(F(?ή DISF?*Oh3`IE C<0%F(8U H F(28FWЫd()/ OpG0ð@Fx0c.!F0H"C0"[HH"!F&r &s -GFhVO`FB# F#p_-и/-у k20#)F@Fp[#1) F+FJF4 b(F!FFF"PCFА"!(F< I"(F/a~*F1F FF F,F F&t pM(FF@)FF \0˱) )D<.+(E`I@HI@pHp&r &u &s 𵱰,I "@0k"F'H$'I "@0k"F"H!"FCF$("!I"I FF FVMN1"OFH1F1)F"0F=F"!F0F~i!&v i%&v(&t (i8l&vF-O6]DFX6 +WтJ© $( KhH:~IH6  Bx'` F3x+PFDVE1,«hi(F(0F(/|сOrkH©`;F0oª2 *shcIP |(bOp(\#X6# IF0F1F|F(Fy#IFp0FSKh0DZi sOp")F04<,ѧF F (Fr ( \23 R 6ROs82(F#"S,(90F(6,r! FjO3! F'F(>-M rF B:%@u"FS1F#u S5O3U,FFOz t O3+`, )Ff+hX4 0F' 6]Kh `rX3C\& [X &8 b(q&t &&r 9 70 pOq"O 8FXI"8FF(𤀋I"8F(3чKMF!A`@!J#At0h~K@-~J}I[ht (y"A`"FV0ntHA1s+ ћ1l+oJ2h320YqlH©~(0v }"!!"!`I0@׀]LA]M"`YI~ #"F)F F^IF FZбSIQHTꨱRINHPꀱPILHJXOIIHF0MIGH@(@#:48Kb% O(? 0F'AI - ^3H©~F(@9I$(?DOrF2J#x F|0J#w Fv0F(\8# \8-@Ł@$J#y F\,!J#z FSIF(F>%uOW;x&t j b(i&vFo%l|&r &s &v &wEvHOA(?!J# F\6+?J# F#IHF(?IF DI F@I F $%FnI F:4+fJ#FjI (hJA;F #(AAAA'Op(VK XJ\IF(@b\8VJ C\8("QH'NH !D#pKJ ("HHl'EH !.#pAKx+\8C\8>J (":HN'p0s7J ("1H<'^.H !#p0+\8C\8(H!0 %i\8C\8%$_,FEo&xh&yg+.&t 3H ,8&wc&ٖ3&s &r ,NJ#} F\8ԛJ#| FKIx* F,YЛ:ĔJH< FsF F9żFF FW9  Fp  SF{IzHH43( wI"wHpvJ#{ F?+rI"8(pI":gJgHF< FFW  F7SF\I  :TOO;x+=XIXHFpWKh, !F RIlQI(FBHMJNIF0F60#KJ0FKI.;x#5J0FHI'HI # "0F3+<,@Los@I ;2'4IF dh-OP'[hFw8F&F@d&F(Fc #hZhBh&`%X6IhhlG("X6[FT[F"L QF #hP":F(F6&̨JpFiOp+hzFS "FIF0Fp@v 2hS1PWhF+h(F9FlG(H+h\o9F(FGF!K"h;F";FJkh!& SI" "hLI""!F~*0B; IcXIi29&̨_8Fi F[Fh F#`#8@v8-O'F FFFE!8F&0F(6&0F&@F&`h8 U)& 0Bah# "hR3 EBhB3B01F@FlG 76  !8F&F(FO   B;#4K"1FOp<#2#:FAF< (F<+ah h1&'(chZ `b`@3S`|U! 0B`h# "h R3 E B3B0HF lG h J  3C, 1Υˡ Fh/ *@B(аOp( ))@@Op()@"( KS K(FpGHpGHpGHpG;^8F K)F Fkh Fhh۲1 +zSPhhIB |bh+^h+hh1+H(ЗIt^(lh 1$1(1,1#L#1H F1FXJlcLOqlh!H5'F?F4^F^{J{IF@FXbzI"FPFX\RFxI@F^PFauJ$IF@FXF@FaHF nI $Xr40+C$arāOyJF!@FF#cI2F F6 : 3`#3qOzssa(ŀ2~*@@FF'*|7`D6kD2 l10()SH] )SWII$^(GI^(FI2FX(,OLO  x2"!@Foz6h0F|6Kh0B\310[#F0JOq8FH$a(hkh0(`8sk` F+F;\ )Fs"kDO O ,,Lh2"!@Fo,J#FOq8Ftp{D}Q b(&{lOJ  RF!0F x`!R" pV#0BF#OjBy81# J- F ,0IH90#x1-Nȳ{1 4 7#@F!!.9HF#A!  &=#! ,LO OΣ2"!PFoJ#FOq8Fv/,O LOΣ2"!@FozJ#FOq8FZ`Q𵅰%FFH*F!U&+0%$F`FH!U&0 F&! I FcP MF0FG( F& )F c@F< #I 0 ]# 0I]E-O]) FF&0F ]I@i(ѡIh(I(h(@chFx)@𻀙Kpghh-@h0$(h0+9FGFH0$Q-+h&'f"(Fr bxOcG+h"f(FroOcG+@߀xIc"YFai"H<qIHF6oOЁ&̑F-@h a,F(?r bheI5(F(gf(aYI(hh(?u[M[IcOb)h1WI `c)hOb `1fh0F>Ev]`.0a0BahOb)DahOb)D `x\)Yx36 `! fOFE 0F1ر10F,1L# ;Fph0S9FGBF2+h(F0GvQ-?$(h0+9FGCF$QIcObahI `bahOb爨"YFwF(?<(&%d&t4h ,9F(F AF(FIF(FбI(F먱I(F뀱I(FX" I&")F IFIӜ*-#K#I-A'$ FF`@m:FF L0K3`'8FGR###"(GF#F@FF8@#3`#h F0G0@F0G$A2-O]%Or F )F:`j)FMOr~d¨)hN)̿!! 0h:\BHe0h=& k|!F O3 ],Ӏ:Or`"ZJ`O2`"+H ` (# x # ` &1`FF `FO @ B s:OvP#K{K`oC"2:OvP#KqK`oC"2#!3&1 6:#O3CF DO6 D IF 8FQFO300X?iR#0rr#"O 2#~<*F3 3FCF0FO30` P)0FS"`(8F,CqAOp9L"F"5K`#""F7aα  OOU H  @%057F3q&: K T>F@"020FFKh*@"`oO6>!F0F(x>Fq10F,1L#$p &̬'h Zq 7&t+K(hh0(@̀(? +?+h$!hR+hM!JCF48F,K"B`D B@ªOsM$#&F B5Kh+?hªOs$Kh/EK"!Fh#T }1(`0U (h""0"!FvHL/h 1R$,!01(,48 1R8R#$)h1(1)\L $S ,!0pF (LO,!48 R$)?\? EA 1?O P O O  X!HFn\+h!@F$1h#RBR[nJ.KhP*h,I2QP H $1hh+h$1hFXhKF ! L PO : YF O30W0+@_=(?,$h0G$F&̬&(&&t&̰&z(( K@pGsXBXApG pGB-O L  O30##h*!*@𼁓)Q-@ЙJOa3 `I `"v`Op(𤁐I b f!H*#hJOa3B|JHBFHK!\ B!F8F p"F}K h@hn8hCE'p"Yh#Xbhgk Ct/rj*o:h8F3OcxBkG(Y;hO "8FoBkFOcG;h"8Fx bkOcGcm!@++;+Fx+𸀳t+#m@̀*ȀAI c F%/nB(tcn#5J!3I)I1Mcn#0J!mC!-Jb#nC!)Jbm+$J%I+ F$IlYI M Jm;"n*SCJ!IMhIIbMI&t%t/ H7`QWfmtp7F{*& &̬(I"'M(IE(I'M'I>m&J'K'M)FF%I1!/&% #mAF##e)9#m5-?24 FB"F(FF(?%#F)B" '' -OM+h*aNHenIH?F(IF0FN7hG+hI3F8F턹 1hH!F  FI(h)q/x0)F y|b霩HFbI FzHF`OH4>FER8F%^xM+x!(FSvI F]uI FYtI FU+x#nJ FqIN#pH#F (@F1jJBshJiI F5hHgHgH+xeHeHdI  F  zYF@(Fbf8F%Op!FCF8F%.NI*F FF}Op  [ khC j+km+k +m7hBa+hk x"#h#2OcxBFkG(CF# +~ km +X +\Q#_xl&t.4&Mh&~BHNW^.2+{O 8KFLIPFj()mHIFlGH@FJGM2FH0FCH 0F?HFBF F:H0F5F FF 2I1F0I$a%Kذ(F!IPFO KF5k `Ob K FIK[ kh*[BIbB FIHO epKFrO hKFl#j NJp &rFkڄ&t -OF|M,@g,&̂UFU+AF64,ѪJIr6v!60F$F0O4 F MԂLH4 Hh`H(K(lcc H,eTDO  ZIZF.IZF&KIZF;~Ka``~Ia~K ;84vKDCO4$O44 b(F#F#`iFSP) hK"O0}-CFrN] (`4h 4Fh`` P ,{!F @OI!$8('yh0F10F,1L# QA"0#YB#4vE h #kr (FF(j0F$ @C>K">I=KA#2##Fh h$ikh+Fkz+5 $_8F ]A0,!$ X`(32h#F", `$)B@#3$!)hQ3B3 h0G4#BR$#jhBуj+kz $'R$jh0G4#B $&q 9uFCz۹P4 @4`j[P3pB3BhF0G4Bؽ@$޼$&F%F,F.F{hB(F!F ;hjFS6IhhlG(EF60 cpG-CFFh F%F'OUxxOcG  #h bU1Fx FoOcG(I c m@ 6hKXBXApGbJF PT!ڂpG&p0 `pG hhӾ8F M0i(DX$0 10`a18&pOFx teh/-#1-!~ a0-`  %i41.nUuF`02140.55FeFC# `K0`# aKa&p}I0w}F F:OrFD ЉdETAD !LLAPAi#F IF(FAB0)2BdFK*"" F:L!:M&h9 1') D aD!DB @  #<1L P D T PaFH0F&LFHF B8NFD8FHFB8NFT8FHF B8F8F8NF! K JB(7FF@@FCK"H%==L"F Ff FL7Kh#F6J!x | "|!1Ht/I < r#H"+K !(FU)K #2 #"1#)F (Fr!  }O)Fb0FO32#(Fr! xx:J!J8H"F Jz&p&ڼ. % 98FH0iMxzX8F1F*ȱ0FF@8F#J!xj| V1H|!"t.Os K( Ji, F7` F@ &p. 98!F@< iF O3]iF O3]hFhE#hXh@"## 8FLch/+ !h)(F z84 9<JK( FF& &-O/IFЀ`,O-NȠO =Fİ(Fp"FQF GHF(82h[F I %O (KO F FKI"FS%@XF(ѝ0Py+[D0a#0030 &&0&  ڜ&`ڢ-OF-FF$K$!F0FnF)"F({$!0F`?=FF,;3x+h1F(F`0FDEE_5K@4J5H   "a V+щE Z! ; $!F "XF a F V*KEҤ1F(F"F,D FZ#P)F`(F|%$!XFF,p8F K<b-AFFF!FF"FAFL8F)F"F=FG(F# FA#-pC F-$!&oIOD " Fa~ V+эB p$! FFHS+]pGFHS+]pG@n Op F'h/puFIFF@q }I~H}I~L F_& +;+=(x8 [@o rIoHqI+) O3+DkO;x+jN3x+#x+hI `_ `bxdI b#F(Fv c`I2F;F_Kh\!\L@m ZSB'wSA2F7O3eUHT( + CJ9F0F7۹JHQP먹GJHK)FGIF FF(F_j@ =J8Kh2F!OpO3"3H' Y+3N3x+?X2O;x+?S#x+?O"I `_: `b(K bI(F%I c2F;F (1F*FI I b `F(F_ &&̰&4#\&xd 98bv &R& 7RM iFH!hF IjF N M]vM iFH!hF IjF 6 M]sx%8% + #Z H $S N` }0FY<IT  p K|+H"|+K`HK`HK`HK`HK`H K`&p&ژ&&ڜYl&&ڸ& F!F +K@h+&Tp$}"!F :#"! #  D#[HJȹpCOWH"hSI"TH^SITH"Z }pOr! NM!"F  f@A"@AaC"X(ۄB?K@'!?J?H>I"G)i q9K"p O3(?(@ )(I-H_(*Kh+!n R&H@&N"$2`B\`t#!Cl 1@33O3CF sm  FY F t!Q&,&& &L&<b&~&0&q-OFdðFF3qF0IHj.h0FqF0FG#FDJ!`!Fv<0F۹2;Jh3` I*F!!F F"0F"$(hGF( FC+JSh3S`XF6kh+%I P#ICF GF0F.0F"VJh3`I ?!FI +0;Kh#I FjhKD !B !/Ji3a& &ڠ?&d&p&7FCh F+ + HJ#)F F#40JI2+ Fjt-Oװ@FHFKhHDLJ%N)F   Sh/+S!`M#\ nh/.V8F`h+@ր!i"hB@р  }L/@ـ1mI HH N蹂HA0F 01BB|H{H&8zI hwIyHhP3D 1+1%2+h+J  1+Dchh c9F(FG( 7=c``1aK!h;6?)h#a ODWI"h%VK ** FK3D !B !ci3ca5U*$`iAFBF.FOi61+#c(F3 4  p iIBxL-#F  ' I #-K&0&̨>&4h-CFLFF0+@@OtO 0BOpd0B@V0BOpH0BOp:0BG -0BH 0BI 0BJ v0B@h0BOpZ0B@L0B+hhhZjBE-030iSJ/1kkSh_JB_JB^JB@]K"hqZKGh0aj X0BhGIBGIBFIB HIB GK GIiC/O/MS' # $ $? #A () Op\0 5I)@@)K"h(KhX0 'Ii-\K"hKhB0hIBѫjpi @   I#F:F0F-2IB#ѫlpim@&0 & ) Cm&P&̨ G  hIB ѫlpim@cIB ѫlm0 _Ii^IBѫln0[IB-ѫl[ns@i`@TI2F#F(FRJ!Op!JIF0 i,(F!Y *K0 AIi,ll>Ii,ll;Ii,ll_8Ii,ll5Ii,ll2Ii,ll/Ii,zllZ,Ii,rll)IiC&JBѫl30hP!+FS+hhdBFiiG+h "hhjSFJB`  1q 1 (A ' G-C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hY#hai*Fhho3FGh"İh F0GO1#Op"3#a hh0G D𵋰Fl$"(F1# S"#FO1AKh#F)F+Zpl4'x'I F젹#+v+m#+e 20 R, F FF///#" "+v!F!F`lmCe b(0 F%Kl J !~"O1 #Op3+F`ll`dXf(F 0-C% F! F(nOp8N%` `@a a@#b b$-!+#Y#/+Q`7 5!Op #QF3"+@O$-D `K@!JHl#"2 !JM 3"2#%"1#!FsAFP(F F! =t  a@9 bOp4K"!F0#M 2J3"2# "#1F(FG F!X=\ ( E -O F h%`h+Fp&(B-hO O  2"!0FjN#hh#0!8Fj>-@P"F,#hhh0P"F,~#h8h#hhFXhF@@BFg,!+FA B EL ! @ P CM"hCJF C "h !=JFHF- x"h !8JFPFD mF@hF8F(8 F@F,O-̿FO ZFF(,3ؿ#3D r  -! "F ,2FP!"U FJ. *k*J !g(rHZAh"3k@PGHe&P&0Qb-OF- FKh < $PFD(ԁPFQeho !8F F(Ł/F9ݓKO `h#  B A #SgE#݈KeE( 0#h#p# pD DX[@h h-FOs sQ%=O3:F<@u!S@eKSA#1#1F#=.990F #" h"#"h0G?F/ h"QF"hlGO8 7eFŖ#%"$ E ;B2E #1F(FT e  SS E@ E8S(E E(!hS E< E E2AO@F ^] Y-OFӰFFF?ӲGӲ_G":" :_ :O<:): `!" &O EJ$$#2F'(#@F DDG#)Fx0F FSF "F "*! 7[F6OK 8FK!D|$D<8FX #F aORO3Oq~#-A F aklO@ZkVh9FBu9FOOzsCCBu#XCBuOS FA@MOCOC@Ci-AF FñhhmG+hihF@ *OD hB*?н*khp!h T`+h1`i h IwF (D1Fz@q  E0#s K`ca3c# FA滴 61D: Xc; 7!-Oϰ FF"!(Pph/! WET0+ + ##3WEO3 Rj iFHKh O#F@ =P `eFžžŞ @T0+ + 4žŞ pWEO# 0*F|HYj#B%FWE80HFlG(?@F u`32 05HF0lGO2F hh 11  0"G(F #!###"#hFhkG"eOp "JF$Z X @żŜO % #S>HZ+WEh ghp3D  i RDDs;sch;c`O0|$JFvWE?t3q h h0G dh 3_kB@5 - #i@#p#h[B#p"ch[(DZC)DT i RDDFs F;s#hh[ ch;c`!F0FsP% B5-A FIhp&Fha  +h`hkhp `D hp"!@Dvi1  F(x 0DDAFK F 0 ca3bckh3k`#])F F F)FO0 2h-OF+@ A"hIF F  l G'W IFH  hBh:E"h Fl G(s2Rnj K B{B{EBWBx R,L"@F)FKF"KFF 9F 0FF 6JP! 2'h"1FXF;F;F"F FPFFF JP!vT, ,! Z1xO x&̨&P-OFh FFhmG+hh F*M O h!DD@F=Fb(qFH#B4рH"P X.21"`",3@`tJ 3C,@uC,"#,pJC,[# mK@lqmJmHF3B @qa"ZgJ 3C,@a"ZcJ 3C,$E#CO|_KBF_H^KJ# 7! 'M &4 *F`I@/! FCx p-O?FEa !!` !)`WGW[#  ??JPFSNG#1FOR\T_YX 7#ՖB )*GIR"RQ# );pF+#R0 ##`S0+`:HZ 8I"8H8 ##` #+`4H\%1KB=$0IB9OQ!1B4-IBі *ۨXX Ѭ #+`&H.&L$IFF F8 F"KB!KB##`!EE ##`-?f#+`b!EE\ ##`-#c](/+ F H&h& &kT 8T&&<8 T>-OFxFF+O0F "]F#;p#xc+JM+@"M+1C+@G+++/#;pcx+(Fm+)"s+g+*BFKFOA 4acx+c+ M+O FS+ !*Ьm+ F"BFKFO*PFYF-OMhF! #m#5(FJ (,#h FlG &h"  KhBrF F F# *F0Gh+޲`Ҳ F@ FJ!-@ a6J! +D۲ Op 'pB@KR h!hF>S v!F=T m!FU e!F.N-C<SkI3F:F8F0F(F@F0%S + s+F0" FXJ!|-&+x+"QI*FZ#O1& "F#BM)F(Ckx+@)x`)@ B#h0a9 FlG(0c2F#"##h F0Guj:CF!nCfDBFvAF0FfEv jBAVFF#CCEFA8  JI\H a6J! I\6# &̨"&P(^;dI 0"~ FF^Ih"6 V0AaFh FFSI&0V"Z FFLIHF&9HK!hObFB B   X&0#"VFF##h Fh&0G2F+F`&lFV FEz f  h 0FAF MO6F^&P8B;p F h#h#S e[BBp[b# p -OeFDFFFEqI G hoGdKhD/3D4F" ;F@ \";FF FTmfTEE";F FAFFE z4(,O4BjJve` 0`+Ҳ@F_J!R(\KO h!U PF=P !JFQ !BF-_+FLI:F8F'(F0F@K O65Fhs C;F9J!/<;x+96I:F#O1" "F#d0B8F  ;eT"J|"I\${FI:F 0+4Н0`)-B*0.a9XFlG("/.f=F6##H&̨^&P8;""0_,OO&FEF#Hr0XF0G#YCFt[FYI hD  g  ` Ez |  @ KEr r E|  GBpy( B Au  c F0XFP'0G+F:Fp"[/K Fh2FBBk.OpFBA@ qDJ 9FPF 3j Jz KF9FPFjkE| G Br :FF B A9 :F ## &̨ hphFIihlGPĕ#1h####h(3hh#BrYb ppm6 F&Oc!*\"1F")F.I FJ F mpd{Fx Iv`I Fr8I Fl@  Pp#$F F !DB p0FF츹-J#!O31!(CXBXA F2KO1-CLMh9`(U-N3hBph*1+K$A,GА)1;0p` LM"h1T# FGF%F$O hB+h!F(FlG  e+h" !F(FxOcG(9hlp`4 F&t&hJK( FF&Fx x/(BF]@/* F/*J/**JHOajK&pF!F@ϿF!F@IF 'Y)M)NF((h(?3h3%I"F10h0F#`@h(h`3h; I"F0h/8F jF!IFFH4(h I"F. F &'I"F"(h&&Xj [XqFF"FI@F {F(!F F@} Fb"FhF FZ"F@I@jF }0} FFC"FhFl(F;"F@d!hF0DI@jF g }0  F!F@-AFFFFF0UF)Fr0 ICF:F :F0 FK(FK$D"` %&h8 M4htIF FF(&D8&h-CFNOD%(F 9FHF@FF$hx IKFF(FF(#h F$B04&hFMF4@q4! J 4"9FF@;"1F D&hL4[O#4T- TT.FV;4#3F9FF (F)F(Q; 4/(F&hpFF F8)FJF Fp@ι8FF)!FFI*FF }@ 8FO@FO@FO @ۿ@ @ @ K8 pG&h0%*F!HU)$!UFF H I Frx I Fl@ @K` F0@ > &|  @?-A*L#h(a.K' h$*CF"AFF  hx0Q###"G(#h*$qRBqR#h$h i(( #h$h0G#h$a &th#p$B Op ! Bh"Rm*3  pGsj$ Fp6h4#hFXh/+F2F!Op#h F0GF(@!F pG Fб&M$&K!F&J/h$H,`#H I"F H Kh,/`$ F<K!FJ0Fh,!KJ0F^KJd!/`,F(I F@>1F x&-6E&|[?g&t pG[H@H pG pG pG8F#Q۹ҹOp F8@5suy (3B## 80F!0"hF@KhhOp #@"!#(FjF 0Op$#&| pG pG-CF\F F'Bcm+#~IFF$1h KhVOp5Fc #PeOpY#7p4&|?FQpF F [" N K)`" 0`p+C# @D,C $ ! &P&̨F IFF^X1F("H:F(F!F@ſ&1H[ j p$"!F#jF!F@ce0Op MC K!F+`F X*hkF^ I IjF @pI&,۰0-GFQ#0} Fh(F0T#08?NOra>H`=IFB"F!fꀻ F7L27H2F)F h4I3F*F h@90Na)H7Fhg+I*FF[ s!F F }QFBB (F)FFFHFF(0=+BBJ!D|V` F L h(IH6I| hJej&&ef"(F0 FQ#0h0T#0NOraO8h0 I2FD8h2F I H!F(F0 @9Na=&_rGKpF F2#K#FhFF,ж0@;U#0(Ѷ0OrU#0 a Op(Ѷ0 OrU#0apd K"`" &xd-A°'F F"9F$8F #OO8iF h+ ѵ0OrT#0 aB5+I VJ9FH_JI L(JIHKI A3x#I2F :!@M0@;T#0&,&+&)FOp^8F F0J T#0ha8&ڼR!0pFihiF0F#FIF(Fp@1g8F F. MXI 0T#0 Ora 8Ors8 F0F Q#1I0I T#0i00OrT#0a 8 @@@Is-COr-F!>,nnL%mO&F--9fjK8hhsb(sfJ9F ;h(4c(paJ  PU,HF[IJFF(F 4(F((Fbj@=%dh04([@9#a5-8LJ ,LIKHHAL&GFch+M+Fh65HKE<4(>K`@5!F( F(?|a4z2J9FF aF-J +F TOsOs(Ѿ#K$Lh:"F h= h* h:#@K2JF&!JF"!o2Fa9FF? F At&&ڼ2&+&,&&̬'h'h V V&-AF1HFO0I.NF(94h<@FA+IF F%H9F&H(4 K#J H((0h8*FI0h|"I(FF(Ff@ /F HHI*F F FJF j&z.>ef$!!npG pG-O%,F FB ``.=-;1 DBt  B Ey Ew # B Ey tsBBt h.6`v Gv@@51Kh"0pG&-OFF Ey 2UF FLFF*2vs#"#.w:F3F F)FhCsG2]D3F)F:F FZdBt&Kh H&&(-CFF FE3F*$+F"Fpp'B2B43Eܸ@a4 ؼkh J`   Fih  JkhJJF0K@QJH@h# F@?y8FMh WB# 2Bز8 J#3"+ K"h KhB (4Bx2F&&&-CFFF0'z0'-AF,LFh !- )O#8hFBі  #@"FR4eE(3FYFF(00"8`4'!_C30@FJ+F!Q@FZ'@sgr  J!F0FL#'p 8&c&&H&F;KFFh i&*F3FB \(\лBT0"! F7"!!!i#sC`a!s+Da. bab0cbX3bZ t1BB#iC #iC#a t0BB* h3BӟB62&F! " F8xC$OpW ` !m-OFDM3rKOqrJrHm#qK@mJn#nKOqjJCn#lK@fJn#iKOqcJH ")F@F<0bI@FZ808^N <F/ Baє80YI"Z 7'FF? BY&p>QIFVPIF(I F@ DM7hQ7I+:+ #;0a+I(F[#0#0#00 ++ ї(F0#KCI0(F7;B̿IIP?h b($;L.~WoT>8FM+h'(`2 IBs IBsڣh@#Oc"r#8#&8@-OOfq-FF$M PTF%Oc)Ft (*CF F' $M^I0( F0FJO1QEJFu FF\*Fy!`  X4%F'F+O+  e``` Fo0CE&0F>IP (qд *)#XPBB+Y37B܏0;h+` #0h3`5  +*1+0"t##"0F0Fx"HF` 0HFBFs C( #Brڄ[b# F<Ade-OFeF Ofq F(OX#t "* "O1 F F "*"O1 FPFcf#fSCfK#`ecae`` F IH"bYt#0 F9sh3`#0?FmFFF+Kg!JHNmKh!JnKi!JCnKj!JnKk! J}CL"ahȿO`h P@hh-OF Fh"F Ki i S ###"X@1O9D sY GYEw"- -r#]B0mG)F8F$ gu g]b% B F FA# uKErFFFF@ GKErڳ b 0&0O FCE ;JhBcӺ@{OX  h ٸI>*) O1[ jpj D"kx[@ pD(0h3`#Br[b#HF*ѱZF B#1"F&-OFFG0F#Kh O+hj4[h3D&H&̨-O h7h+hFXh+hFh(`#F[N:F!@M3h" (\0 P PJd!8F"3h"0GJ! FkhOp7!F F;I;HYR:HF@2h!5JFOp2h!/JF8F@,J!p'*H+hiB'I"%H:!I"P4#H1!Htj S7ZRF!"XFO,6 #D 04-#FEO,#73p4;&P&i&b&̨h-AFmFGhF/C<4! F(M F!OBЌE./Oq`!YFJ`"ZM3@M`J`1"a"R@ub"Z03JC,Դ#K@y1JH$1F"B@qa"Z J 3C,F4`&i x p @@ | sFN F(F|cap&H hph FjG!0F<I# FB%K "!F#2 #2F #>AF)F#A00F FO0 p3P ~ q-O F- h)F 4 HF( =hh1 [(hz$`-<"!F ,&+h(FlG:+FFv& !`(PЇO KEl )FWh+ŀ3 O0 !O3:PFF(ZJ !FQE-OOs@u!F0#2@QJ2A"#!RF#1F,7v70F:+HF1P+hQF(FlG8 F  :SE؊O6O S9Ih0PFlG+h (F0FG(D (F)h#"b #"0Gh# (F #"+h0GhC)CF+h (FlG#! "F3K2FCFZF!F0FT f  /#9 sI-C 'PŰk FhhoCj;D[h3;+ En*FkGOd*FkG#h"O1hj#hY hk*Fho3FGpFk0hKĕ#####0hX phlG(pFk0hK,lFĕ#0h0hho#GBb[B!Bp phjFlG(𵑰%F F.F hB-5џ#hhq#hFXhl*F!F@ FF(F#h1F FlG h* 5* ڛA####6-#h*?0#iF FGp#hh-#hFXh(*F!FOp#h09F FG%𵋰%F  F0FF8F K"O1g#S 3BFHc(F x-CD" FF! ! #@F(uPLFŔ 4@Ŕ@F0lGDK0"hTyO3FFF F!| h[kG7K"h ThBr *F#F#"0 G(J # 1F###Os""K"K6#2O3"#4AF0F # F0F0[ h0G0 (8Fh;3O0## B&t&̨ qQ p Fk#K hh0G@@0  Fǰ(0 h8hkGF@iYh"&'#h"O1h3#h0s#hhlG0Fa G-GF FD"! #!00h[j HFlF(?:IP"0P7HYj"F#B55Mĕ 0E0QF@FlG Os"(K1F&K6#2#JF#KAF 0F `32  F0Fp0s hB h@ G 6q(8F O0h[ [ B zI CL qQ p-OF-FhF0G#h FlGVKhTxwO7FF F@!hkeF[ Fx F#"0 G(Ft!" # # ###hi[k* "!"G#h"0 FGCFR#h FlGF(J#hi*G F#G? ##(#hkG#h" F0G0)  #hE0 0# 8   # Fx#" eG(%(FO &tK-OFh#(1+@ہ +h3K@AJHi.́Jh\(F3OJ#O~OxO FqJ>F"(O2)CF@=s$h 8$+h\ @ O Xh 0hFph&K"! @FdtO@C"!HFdh 1FOp  2s OpHm0$1hh0$1hXh@"!FO #+h0+H"]HOq`!Y`@aYHYaYHh(Y22VI b@b#@u3133o O3eGF RGKb0F<0F+++Z&7F,(FG(##z09K" O4 F-+h9F(FlGp#C !#h;+67hB~@ 8#Kh)"H(FF @+h0+!(FG\B\A+?ɮ!(F&t@@&̬&H sI t80b p p& q p&h"Ohh0Kh@!Cb@!$ 0F+OE&O$!(F=(?(zaR hR4 Ch(FQ$C4 YhB0Fd 14B$$!&t-O+հFOs K!O2h F*F@! F$F@@FO HFU! F (@8FK hS"+ 0BY+Nі(1+f#O Sf,ARd cErYO !IRBR F[!dFOpRFIO FvRG W @,>*5H@~J` C 0+0G( 3 rK hB-#O%FO6O @BG O ,UFO6 6FOp(!H1O 1F  QHD! Fd @od!FXFFHF 0F #D 3D FYFFX&XFO ! IFFXHF 1F  X0F F B*K@Q*J*H F#"AF23*F33#O3 AFBQ R#FEѺ Fg8Fd@Fa ^s?0FD TF[ O&& q A@-CMF FtH!O#`*@20F(*0/+ 3*OaBFF F*Ob FO0Fz(*Ob1FxoOa Fo0(#x/+0 fx&v  FF*3;DDoFIOb Fo*Ob Fo}(F( ڻh(F|`/(F F MF(  O F!B "iF0 ( Fb .\(ڀ@ XBXA-OFFFwBF(?иO&(Fyl0(Fwj8FC+ I" FF(#FRFYF0HN73FIHFO7tOp! -GJmHb"F@怜H(mH(h(@߀HLObF(t(bF($I( (@H(6F(чI(ObF `NI( bIF SI(ObF `8zI( buIF =qI(tIF 4F(@pI(mIF(F'F(@kHObF ` bI(_I bF(FF(@SHObF `RI(!F `UIF(PIF(FF(oPHObPPF `GI(oFX; `JFOa c `0 b;FQF 5 -$!@+0F Jm(t($/I(@@%+@e)pң%CBCA #;08hhlGFF#YC^Cf3I2.D FCFJFQF0Ff#kD##c;0۱Q bh[0BAO Op E@Ѐ#kC#cUNFEFQЩBpF F#k bh[0Pc#A# mBfF 8FK`e`NO3 F2h(z#;&̨z&P b(EK ;PFh#BKh,1dB_JhH &!4h4Dj+H@gCWJ(!F P$h2DkY񓀓kZ=# # JI&Hf(F)# AJ &!b7K"@F!Fh9J#k D5J(!F"~j$m@+JCF  УnOp\h&J#F`kh[o+h3Dh3Dm\@J(!CF F@$!FkkJИG(+#q@#o&̨z) Feh#p&FFB9(E+O+ rF, nP!%J#F "H* `!H- VJF!hJF. JKJ!H)hkԉk1#2 ++ ,P"F H, b&PA&Bh!-A2Fjj5 :NO FB=8HO@P"Z5"a2Ja@b1Jb1"c0Jc#hv#g hhCE$#OpE0 Fvj(ۡji j /k2p50L"BlhjFAFlGHGF kRh\gF3 5A Y -OF7FFFO p' E6ѹlp'q(a0IF:F30 F4i1 x#"tkih hb####ice+je8@ii D hjB6* Ѩi@x1Hk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  gK-Oh FF8F$I(th! XFF([I #[E$5FOsO H0t@uO5"AF@HKA#2ZF##~\@FKEkqhj1 F(bqhOp b  h0(Rsh` DAFrh!F  ZFIF F  : # #ccFf8Ff3hcc0F[ 0sh3s`,O03PW8F|8Fx &t -CF FOp 0@W"O1+OkD/ #30 /+ "d/#0eh'BAij F(ahp'hq (bh`!bsa:F  F"hO5FBcc"b "" Vzch F3c`(Fh 0(뀹Op!F(Fz7&̬-O FFF!4"0F `#%`Br i IBEA  bB! p!```0KhO:IO(r/p'#Op B qj(Hm3oO2##K'!hO3E򐀫j+@,O WFh+hRE&l(FGp#E٢hZDk3tH`(v0A mI#+:*@'3+#h ˱E@p XC;k2Zh9X2A9PZ`2A.y'0W ByE@QB<` Lp"G `F FBCHC 1DPs`p#hO3BDjUccPQmA+hmkGhhCDb!hhjCDBZm**kB cj+HhQXAh@QPCQ`hah , *B;F7#* IFȱIFHS )r T R"T "X *&AX&t&̠Ct7jhBh 9FlG(h+++# 9Fj#Fg'l QF(FGh+ #Br  [ BEs #FQF(F?  f#E.ye#f"F"8030W 3BV @G 0#efEW 0E@p HC98XIhYB FOfE@.:E7M!)p1p#hKD S [h_C8hF9F@FbhBzF}HjC _`chB7;B7@QPYG6 FQC2DBBp򢀫Brڧh W BfG F Y {hzDYB Ez 8k8IL Ez 1ahBiB@p b +FIDI rK` #+r"#I K`;kI #;c kC c##ByG 0G `Ep!qBBлk3 #S9kfF0p7F F^9@0b @2pp"I TC"FLD FiCDIa`I -O%-FLhF(Fp& #B#-u(Dp!F(npFO p70E"ӤDPԧK$\CBTЦK@]QJH03nJk՛k35Sh0pBp" F`nc#k)գk3&ѧpO p4 p" FJn.lhS8IhhlG0##W<[hEp4  p7`0!i @xKh;O'hlG4 1 BBO3 F&4F0BqBHSOp!e[e+ Z whu T B2E 2!F(FveC'F#+rDBrv[bJ s` %Op 0Bx (`+ sO3 3.@ O 0E0 'Opp#{Ck?8F5UhQkJ[BFL(XFhlG0DkX#j F-z ;B2]J 2)FPFj -F ,F70>J0w`mD& pGD;kYkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504M3h0FlG KFFH#0BKp"0k3t+kqYkh+rj 1h b0F#"0G(R##ihY#BpF F#3hjkGa"km!Fam#bmcb+nbknb3h0`a0FGCF#3hF"F0FlG+kcC +c2uG3H2GSFBF)F8F g 043tA#[ BB sp#p k3@#k@𬀞@񭀣n+lZhEhS8Ihhl"G(S8 hh"G( h   Xch b#"0G(9,FĖ##)F"h0GFHH*FhlG2F D ;B2D 21F Ff d ' hRB   o" DXchB#"0G(  05Xch+r h    b#"0G(9##ahX#BpF F#0jhkGacmam*bmjb"nbbnbha+?_j+?[#mC"e"~*?SC#eNo h   [B3 DbhYC2"0G(zk3r#knщXbh*qh  +dhhBO5l)F.G51. BB10 BB0ih'kjGacmam3bmsb#nbcnbpah0+u"1FGBF2F)FhlG0cccm[j+#mC"e"~C#e706B~#p O4BP$Op 0BP p$Pp# [b#VF#CElp!0FFp#F O1F BkO Op Ej' GE$p'0Be;P1FFG "3c0.!FXFlG(2!`.| Bk5UhQ-q wEEicd4z300B@XQhCВk263cp3C(  kCKkB k  +hB Pp"  vk3h.9FlG0 72d0##3hb.##5ce6e7p4XFEcXKhC Ћk3Pp"4JpF$M(h%P(h5(j+`h!0bO6 Fb%KOqUKF#1 #c#FHP0jBbڠj4(Fb p#!F00jj$0 V'h &`-OFM-(h)1$a#.@W .@R(!3F1F+F( 5(h#0Q###"GF(+h$A+h"0FT#GF4F&FhB8)h@1<1@1V#CR#V#JVh *@6,O NO 2"! a{K"!a!wK"8Fa#h*hhO& O% 2 7#hFXh2 ! [FPF+h #hh#hFXhZF! SF' YH#hh#hXh" ##P" # #0JKO #$"`GJ!GHY`"aFJhYa"b(CJYb ٠j0"c?JYc # 3@u3@73o O3CF u1Kb0F_0F.?+l+hTjV##0h0G.@vV!h@2EE@0 FG:F3F !F:F3F F+b4h&t&̬4p80b & #h 1F FlGP$%#h+  6 K&.:.h!F -#h F`lG"  FG( ####&#!'#FB=ܡ&BYO1F;#h F0GO0>1:F3F FGlh+?ieK@adJeH# g!F#;F2F8 ;F2FX !FFp3l!g#:FGFO0 gm 0F B̩<","i#iBX jci;ca#i ;#`,#D e;#a&qOr!F #"!#`OcD##OrI#P#KOb!F# "#`##b-GFFFFQF,`hB Oq |O0 ZhibX(JhD FG!8FF:F 3CC B~ )F@[3 P# "s@;(#2O3:F!FFe0F(F FKF GG4!pF); "*2i@'  FIiO pckFi@) kIF(Fp@i@* rkFi@+ jjFiO pb#kFp@JpF°OpFFQ"Fn .#$/7Ls^g{@9 i (IF F@? im%IF#n+#J!0iOp@A icnFn+J!i@B n+J!i@C #o+ J!iOp@E icoF T^jnxdFOpFF"FhF.3&4@LD)O`T# 40Vp8#*hsC"D lٱD3IDP l*hIF BDf(@Ё@"YF8F)h@"8FAD68.+h#Dj+ ݋J1FlB@"+h#Dj+ ݄J!\B@"+h#Dk+ }J!LB@"+hB #DvI3F(@FOaYOx+h#DCCDXIh)r@"!C<!XdJ+ n#y#@"B~+hCl!#DCDX[J+ n#y#@"Bh+hC8!CD#DXQK*[FPJ@"BT+hC|!#DCDXIJ+ n#y#@"B>)h("D\R@J!B@",)h \R8J!B@"+hx"3C`#DX+ /J!B@"Ox+h#DCdCDX+$J!@"B+hChCD#DX+ J!rB@"+hx"3Cp#DX+5J!)&&#*d2B@"Ox+h#DCtCDX+:J!@"B+hCxCD#DX+ 2J!B@"r+hx"!#D3`S3##&J@"B\+h"IB#D 3D6 x .+h"#D_Q1Z`Fl&082B`R/C23&x2(qBxlB K/D4B }18?I -CǰF FNxF@b@ ;#FJ!IKF"F(F#PG #!1z KBR!OH#`I"F\j<#YC-GFSH}dkWX;+π#L1s@I"Fi H}GP|1Op@3hx-чITx3h9F0FlGx1{S'0cxSOpFF yJ!H# ##H0#"9F20F"2#G(@phI"P"1FJdI"F ""R"ik#h+? xXI& `@Fhd0i;jS"9F&"QF,7EbjHI0F@ >!# ##FFi0Fs H}@ i"2F  F#h+Тh/I|&{iv@  2F(F1 @ D###h+#lki@& IF F H}GPk!Jckh*#lHal$hlG#J## vlbڌHO #h+?t6J!`YРD W<["9FOL"QFH87E`Q/B 12Fhx1Qt|@BѸa0F!J @. iMBF )2*sJ!"!Fx""Oc#@##gUd!@ FIJrF!##`# 3O3#cUd!z@ FIlpF5Mʰ F+hX @u! "!)"0(`0+J :@F(h!F~ Jp4#"CO1#O pj(@5$J! #"O1 F 3#m ( (`j,@6$#k0@7$##`O0 CdpAMO3 F FkjX @u! "!("04hb0 +^!BHNTZ.K"hj!FZ` p)K" +cb@ ! #i@$J! #"O1 F 3# ( (`ciOti@$i@$#j @$##`O0 C&d-OF$K%FhF*F (  0J!XF*#"O1@F+F0HFS##3F:FV)p XC1D&Pz&̨00Ű +&(06Cpdjv|1#"@F O1#Q?K1"h,1<@G !O0 k[ c E0Kk[ Kc81#"Op#O1mX@I%'J!#"O1(F3# ,(& `m\@J% n`@K%Kn[ KfnhOunl@M% o[ȿ# gKo[ Kg &td00 FŰ +K/7MUa #"SO1#Op#{/+ ")FPJ!(F*(FD8 D{/+#s E01[ 1!*AKt@! h,1<!O01[ 11+ 1[ 1 1+1+$1u@"$(J!#"O1 F3#Bb(\(` 1+1+(1u@#$ 1+1+,1uO t 1+?~1+y01u@%$# `nU&td-OmNFF(FkIFSO [ EF ` $?Qh{@ himB 4F*FTI8F" Ophi1mBFC '!bIKDhGJ!(F,h@ idB"FF@ hi1mBF+ 3F1[ 1s 2J!F(Fh@ idB 1K13$1!'J(FhOpidB 1K13(1!J(Fh@ idB 1K13,1!J(Fh@ idB 1K1301! J(Fh@ idB&&̨^dD,-Oװ#F F!J03`OO >h>H1FKhsвВ03D[hkK/F6B8h(𰀐}1a3;hB@>`0F$P|h0G$}1 }aC #0x"3D2CQX)RCPRXAh)rI D!3JO$;h+BѸ7  #0 Dy1S %1@,"U (1O81""0;h[0Op;`OrAFj x 3+fO1"(у}!1F1B11Y,f-c>hO< @i.@0;F"Z3B@Khs 0)F F3`j8N  ά3h)F F0[-KhӱOr##6-K 0TF#ά3h)F F0=$Khs0)F F3`+@0 P3I`Oq PK`Kh+3W&&& &ڜDd&&ژ Я &&( DPD "!i  O3`E 0 0)1C#80a34$q?hO #80F$@hCE%lAFGջ ##$GF+_(ݻ'(0" i$i $!&`E"c09FXFlG(7 0Bؐ+_+ " i 0P#80O0h-GxFxFF$O3`)hB@ e#"nhF\iXB32DBCFRF!"`0B8a.<` 4s&-CFDh,EiF'F&FPhjFTlGh#Br ,FFX04,Elkj+ܫJIh+#+`(h FF;+<c3bbb &,Y>K-O}h# }M$(h D(+h!J#DhIFx),IHKhI I O x*h|I0F"DSi#nxI0Fj,#)h !DP0+3ИX.F0 YDSPTJhOFoF#G*h'"DDZDmho#ImGZIF0F*  0VI0F!O ,#)h !DP0+6ИX0+2F0 QDSbPTKhOO FoF#G*h'"DDRDmho#ImG3IF0F  0*h0F/I"DSjj#+I0F*I 0FD +h%I#D hT+h!I#DhF +h I#DhX+h I#Dhz+h"#DZ`dO&ژ&H [X&%3N.f|ChF{+D2*s##` hJ0Ih+ &~K-Oݰh+ˀ$O6%FF D(tKh/@s-𫀻x$1hB4Y&FHF40dJ! 0 DDKF p_K 'D_J) FFSR1+^ "Dh)zUI hIFlG F  F$hKEqXК0+QF S DI*F1h!D l+$(hOoIlF#G1h!D l$h"  o#IlG3h'I #DhMED3h#Dl!2!MF((h(?mIh F0(h(?cI"F]кQFHF(h># 0O&&Q;&ڜ&lr&$1pF FF phBx1x1S%0FxAD%8 !ax(0F F ,"!v$1 J I4# K#3KKu0 g& h J+ IO2 K JKT]& g 00X>J`k;+إhݱ1{"L2Op (^#10K`0Kh0I*k#:*  ,0=!F 0!F $J $I2h2"K#J#K"J "I2h2 K J K F{J I2h2KJKK JIcih#KKo&&t&.&, e i ũ =& A 9 ȩ y& ĉ &L e Q %FL")FrPK%`hCOI "MKyh0:qXhhBkD";P! 3jDJ" F8 -H3B>Kh+6=I "Fx:Ny1h0;Jh hB41'D"$#h7'7P#o8G3h,J+DP! 3uqoѽ$Kh"#I`"K"zh0:A^hFhBa"#`mX`2,3BP!Jkj\""0cBчO0&ڜ&lB&& &ژY>&HO-AF$AF,)h'Z-O]NFOR `!2lL+ЄOD;h+@O4;hCOq 8`zO;h+@uO0+@mrK"O O`1XaO|a O`fK  1Ox a`_K`H X``1Xa a;hJwYI  3Ha`PSI`S03ap0"`d'<"!  a*F @sDK1FR"CKCKK#2#OpAF/`h+O0 ]Oa R(L8`IH! G(X8`UJq ;8`(WS`!1 a0F(0Fh+Kh$1+Kh+Г|!jOp (!F1 C&&ژ&&ڜ&&,&&&&L  &t&&H& &l&FbKh3"FI@P J&F p$a3F2F1F~F(fR###" G(K$hRBqR &tk+K@mQJHhD-GF F%@V)@U*Eܽi+XKE ѣk+ѣhh{#{5SEѣk+ѣh|1 F$1{CpF8"!FhFdԱ Fs$Q!1$hikO2 FFJ#|1`p((F(Fh)FhFK"iF FhiFhF*FhFQ(&-AF^8"!F$-O60F2(F($A#h F0G#hi" F"#GF@#h F0G$a4F#h FlG0"FF !VXK "hCD8"G(P"!hvc F 3"60G(# F # ##"#h0GBF#h F'>FO8lG!1B!F$$"(F $FhB/WFFE.K@Q-J.HZ#hk+G#h 1F FlG`BѸ?F76#h 9F FlGB 1BBѶ?>F7hBs!n1O2F(F{ J#|1`'O6D,D&-G}FFFFJFcF(dI2F c(bI@F&F"(F(D]I*F@F`0ѵh+XHIFO0 }kkcj`j`+k#akkca#@0#bB0cbklbO/{FI:F@F.0t@I*F@F(0:@IJF c>IM4QF8"F F"F:I0FF8I0FFN 6I0FFH4I0FFB2I0FF a :Ex#71 H B,ucF8E9B #FAF*FHFiErCF*F#F k J EEIBADsEr 6Br:B F{SA,u8E9B #FAF*FHF@iErCF*F#FBr h3Bj EzFFؐd0%###"U#"( (F)F 0k#pGB30pGD0+D0pG0%k#F (B05#lB C##d@,hEjB %jjCX@Bl"d 0 pG& L<'B##`36hhh&pF0K@aJH:k=`h Fp@0[`h`(F5F.D<FBh I F@npFk%O5(FpD1F( 1F(@5CFeK@JHiF H! F(K`8F`[0+e #8#c3#dff# c`eD0`` F\D<D8 FkF# B@3hXjB jBCXD`" 8-OF1LFFcB[[EF# 9B%3@B1*F1 hh*F)-*#p(@B l   *FFhXjB jBCXF"hF*1FhFiFD1*F F -AFh&F3F20h+CAk WTkBuF6  TkkEOkB kt ڸ @s"  TkkEWkBkt +`` FFFFĕeF#0 0F ##"###" H%@$(`O0hkB-@{ # BrO#F -K+` FA00*F!FC0 A(;i h3`#[b #0C03k+УB " 0 -AFkFF#F\B +i!@3Aȹ2 1BBC! KF$Kh;` B0#0"!F04:F#AF0#(0C0#[ba F)FA+ qBBL0&pFhV#kFB ОB % K` p(F3P-0й#c04#)Ft(h;`#[B #0(FPgFh  " FF(-OFd]WF ЌK@JHKh#KOqJ P I F(@ʀKhx J [(@H! zF(}IP6 < wI P*(=FFF&`` oIX +CjI(K C  <0k@08Px+Ц,3F F  "!PFCF@X,6..Н`0#OI"" "!Pj F "!Pb )CI@ k=I8 C  u +?r6I "! F[ + sXHFR d] kD0`"1F  5PE0[[  h(EP#C0@ 03 0%@G<&ڸ&(U&U4UH5$ 0 !X0  0 0$050#D0Oc0pFϹ=I(Fw`#\C FF0F(FHFd;hZk(F #xF`#pb#;hk+@0I(F|(4FFCE0k(#GkBBсk*#kBB !F0Bc"64$d|GKh Kh8 &ڸ&@pG{ {S{{zzSzzӈhJ0 ]WIpG FFhF @шzrF 2 B-CFF FP Fz Zz  ۉ0sxs+sxl+O&F"iF8F\p#*F FCjF)F FD'F"iF@FBh#*F FB7/67.H@-C FFxk  FIFh  7"I"F 6 5  3 2 1  . d ( ѝ0 00**+4'EF1F|0#S˄7/O0WH@pFpL&"F@!hF6hF4G. pH@-OF; zFF By&O P-X(ХMBMADqD BGлB?8DB> M EBF2FBtO  s9"HFFFF ) )+#ERBM)I)4  BѻX BQO Oq 5F(GFO ;))$Ѕ)"2"2[DB"FD"ZD""" Fp@"!O0U#1oU1 ,MO F-ACFhF82B #111111111+h1F8^aq4Bѫi+J`BF2+222.+h43B(2+ѐ-O$mFO !!FOc O5(F $mqI0s@"!x2Or)Fc2K13bK@!bJbH> t Z (pbppqbqq4 #BES2O[OC(_2FHFM(R-HFPF`XFL6`+H6+H&PFSCFFF@2E(FO(?1`p? A8pFF@2E(FO(?1`q?Aq0F>FXFAF"3F2F!FHF  xM$FBBp Or DN2F!FHFxM F FOrBVE?qO5q@dLŸFR5K@ AJHl)FFFkCK@AJ Bp"a4+F@ @1CLŸW-ALuN G$EO6FEt qi ` B xc p D6E 4Jh` /&&-OFFFFFΙ Ė4KB"2 #qFA\aEz3()8B,S2*K;`'8FD3B"+*" vFF4]\ ,FEF03+) БB /@8`Fb t3FB "!FHFiBr"4F $pCET3&1A\I )ИE36.BF Bt1*+O89O  ơ2 )iB8F F HEn/?X1KT&!{#F2ƑD1  NE~ π C EyÀ2*  и#\) * 3+ K@Ta J H1B| /?Op%&^åLŸ (B y3ZFq;F!D bF(?Ү2ĂH  @EHFD"06D&0B1E!Kp"!(Fx2EO32"\. (2*K@laJu+DADAEOAڨ/?h@c L-O FFFFĕ{iJѫB O0!SB<ХJ$4 O4 K@JHD2B#O5FF s\-F2* 4%+$+,Ѹ@K0()SD41 ! +q;h~h^Esr C BAchh C 2B s ڸ?r@8BT F2" QD1[BB гBA By"Oq WF(_Ѹ?CQKh!  CBpف!FBQ-=v"CF1F]@B(FYF8ZDPF+ tw#y{B?0*+"*@t4Bm @ |ES1#12*<")FFBKCF By9cC1 v 1F2CF]@BO(FNB&LŸ&]C )FHFFi By FD" C]CB usevCF1F7]@B(F2B2E sOq Q8FES1#1F22r-ٸ?'Osl-ٸ?@c" BqDFh"2 (&KEv$+g," 4[FF!F0FJf\Ev&\Fd29DF@ BOq ڿcC7 44"qCFl <@BC FB< *K p"!AT#\a BrPFD{3+PF ~1qB?wQ0q#U  - ЎB?f03+1 y"e 1Bp #?N@ -AFF{FkF(@4 F0F0"! Z# F  "2"Bw*F;F2"@# F # ##"+K )F0F#ks'h0G#k4 )F0F0 Kh #`hG c#+r k8hP2G kb!I# #`hG c'd?sF0K@k!JH4O3Ov]#ah86R-CX kh0G8uvUB`h Fp@.LŸFk Mh0G#!Oc`hCFЧh!8FSF8F:F(F0F(F F M-OFhFF0+kOp6M0*FP!P# FbyXCF>++O0:FP!P# FMyBCF+!K"hO3R[Er FF#FPFYFT+FP0FkCEE@31BFF@13h!X*FpQF#FGP@d&t-GFKFFFO hRL58AO2B|`FFo-?, Cc"@2?$%B FF;`3hP@@I92BEs  җO MNFM+h[3 ўI  +hCK+_(ДI MhKh+J )!EJ;sIPFAF_h{ @FYF( _*J@1 q(D! {:#sd+d#FzKhuK*"-:Dh * rKrI (DqSnJ[ mJD#QFBFFEp+@# 0 qX_J#Dh`h9t#@0s:A _AK@0)p9 c۵ _@0 P0f.$ z/CSO"p,J # 8Jd X q<*KD)plJw; s۵AEp M$JP {! % 3BR _+#d F4FF@YA.'5'5'5'5'5 :;W'5'5j'5Q;Mj jj$j9.y 5J9F(FD+ q0JD/K "FhCf*Jb`_@FYF_#K@0! p {jB?qOaa0FFJ9F(FOaa0Fx FD;jj>%j~yFpFCBCAGF F < F0 F .O4 1FV0h2ù! F0ж 1 p 4"-"6 Fbh"F (08F1hx2[Z`bh`eiUi F8@3h"+h jhZ`jh`hh$(F!+h jhZ`jh`hh(F-AmF FFO#xK4=-Ѹ.&I&H *F! FNX# I`!H5 mݰ7#I`H,CFK *F",#h3`BF9Fb0 Hh+аh#+8FgFNjjjm@2FiFhCF H FHO0 m( FiFy N@#BpFF F1H1IJհHeih1hIE#!R""H0Ѱ~h +аzh9+IH Fp2Z`jh`#+`#jk``ci%bsh"Khz0 IHg Գ Fp@վa Fu0jN)N=j @)kpF$ FFF#FaB?aFB?`2bC``p+pFF FF&I'H/ Fj#AF3"!B1@! F0)"! FC"@! F0F!F(F"hK0I HpHH FNRj @)k F" F"sOsFF FB*F"K0IHOs)F2F FCF" K0IHp BNbk B 8FMO5nO3p1'0%J(F8FPO31 1 CF FFCF , F*0 F,O4 F)-GFm FF$ݰ 7#`O0 mX&PFB o QF6LFB"FiF$&FFFF:#`O0i\! FhhBFhB#h+2ñZ`bh`h`h1Fq(,Ѡh Fh+,*bB2F9Fh*ihca##`i&a2c``aKh @)FH!@nNp-CFPqj44T<D#SD<T#X#C#D#qCCD0+3D&0 HF0(F5FIF(F$/AFTp+DP#L1;L1+DP#T1;T1+DP#d1;d1(F,5W2;2b.zb(F,5Cp2;p2pb.lflb7F# FFFF(:H1F! FD1N33@S,B@C,BS,B2C, FBS,BBC,)FBS,BC,S#N#0@0) FFIHYq" (0Я(#`H9!@)" K10IH@Nj Gk) FF$I$Hq"(0Я#`H!@ѽ1+گ7#||(#"1 K0IH@ŸNj IkCoOrF!Q0H"H wNkhF<1!IP03 F F033S< lKI FJ@+FkAk7k9p!FbI\#jFFH0"p1+kI033FS< F@ ~N(FCF!@t13t1c+H/!d"K!kQ I7)7F F2I2H`#|DC*H%!)F0@μ(1D1B0|18\ "T_HMQ-I n; f+X1 "K0I H0@𭿋mZe "pNj [ Z Gk8!F HfCFѽ8@ I Hp)F0H)Fg F8@}Bu8kgp FFFQ kHD0I F3 Br K F-)FF"#FF##b03 "r <1@?!p@pkwkkoF81FCS81x1[hh#j11QP8C5CEUH PA\A ! Fhh#j Fdhj,033S,S<_Q ` F s CBC % pNEsBC% px1hnrSCD#C sRC0F $T%usBCvh  F ! &! "<1CC<1<1sZF0-x1h F%($(2K1Hm)Fp@"(Fk%(( 'K"'Hmp@ mh81V H!p@##FJ!<1E.C!C+C F,", 0 H,O3,1pNpkkk MO0pFH N#x1Nh5!p@Ѻ+j+1F(F*mhC F<1p@TkkoCoF FsOrQ@!0"H#0  h+F9FF@H*F9FkO0@")FxF*FH9Fw h/ h`2F9FH1D1 F  hxP`OAkk-OFF gF`X! F 2"bFF SFIF h0 F32:C1C2X0#BE HIF. I F #j+032:C1C2kl%7FhFEQ0-AF7U< 8,H A׼U2a CБ&FV !F #!@Fx1FFH#hx1h0(#j+% F . FA B+js33S<0"AFmhH 1Fl,lDlP-AF FFF F.d$F F(h#j+/0 3` F)FIHQ F h1FEI FABH)F?AI F@I F 030+icj F0aѯ8h+\5HAF.h+ /H> "! F Fb0"A! FA.9#j+ "HP0۱foQhF)F2F FboBiF(Fb@#j3 FKI F #j#" FI F: FAؾ Hl{llk7l%OVlk9lFQ ;Fxbjl" F@glp+hF=03P=Cj4"!<1 033S<ݱcj030; F0 H"A! Fh0H Fp@i%FOkF F@-OF-hFFO 8,V)@FTUE  EUE#j+ЩE< F 2F)F F( FE)#j+0 FI32l2F)F F033S<KFBF F A FK F dhl-A FNcZG!(FW(,"p0>I>H(< ((>(D9H)F(S(5J6I6H@903H2JO1I.H0M+x+#+p<12F;F FwAF#+p#JF%IHp#JF#I'Hh!J"IHb FD!\1)FH1x JI HLxmv"!O0g(mOjmkmMm[m mclm'5mm#m-m5m<mEF F$I$HJ", AFH/! 81IH.,,O3,1( I# H81H!FOjmmmjFa!b#j3 FE F@?-CFFF*xFF0#`O4jC JHwII FB2S`h F$`P FxJ`O2iFZF;H!FF~O4#`8h(U8FOiF0F xIFFj# )H/cjkb> > ***V jF9F0F+j(F$2{`h`#c`x1Zh``"Z`#j%Fz`IFH F#" F2+`h`z`mn Onn+-C "FAOq<0NIOH #%LH0Ob5OzqF(FF)F@F7Ѯh7+Юh +:H)FW# FF01H  x1hݹ5h%0Fx:x Fx> F5oh 50F)F(*FO1 F=F2`h x`FPKF"!r`x1h`Zh``*Z`+j+#"(FOCF:FOn?nNn R Q) FFIHh FE0Ѯ<h7+ F@*2h +Ю.hV+ Ю(h+н@H7Oj-AFFFFFF-+ٮ 7#:I `9HABIѐ>p/R"BJє>p/%j-Tф>P**F1FAպ"B+є>pB8-**F1F<(#j+<#9F*j AFFH)F<#0F]AFFH5F#j+H ;F'FjS>0#j+ф>P.Ю5FFO*nnn-OhFFIF F8I"@F OI FH00A Fp!FBI FrF(𯀘I Fj(d0C0 S&6N0DB F F(ҀFO EG$1FHF LF0FNKFJ4`8FL}J{KAAO6h<1FCC<1#x1h/[ "(@x1h/n<1#C<1$&S*  F"FFHFD < # ;k( N(4(6($U(IIp( x( n(O I IYAQO $FF;j FPFS+8  E۱E "F9F qBDh;jhPFS+8  E۱E"F9F@FR0<1#C<1O0 F0ծ\#` SXmзB T(FKF/!F>x1? *P Fooo o0o@oI T`Qo^(FS*,0  E+P5R Fб"* c K Dc`> F*> FD8ǒp1pFFcHJqF(p1tAt&p?J!?H Oph+8I9H 6(6Hw$p>02H ]3hx1hll1+,HQ"1FF>0 dh%H @&Fl11F+""t#FF*(C  "!,jDF IOr(F0I Hl1+?|vwPHw)wLwwxKh*hQ`X`pG'5܀hpG-CF FFF0&K@G%J&H#KOq JK@#BѮ#`O0h`''`okg`<`lc4FbwPw0KO$qJHJ#eT0wPw0K@!JH6#T0wPw pG pG0K@1JHdCd wPw+K𵋰FF@#  0&K@Y1%J&H'$DDkB 2FiF R0O0 kS$0;>+ٮ#`4Z R( CB(<$DDkB k"S$<04 _wPwX! FH 0 F -$ F"F#4B ?"a"FB(?b"FB0?#bc#es,=%hE+h.hRHh ЈB0jhZ``(F 5FBjhcZ`jh`C$h;`b`b`l #UU0hXj k#V0p@pG2+Z`Bh` "a2+Z`Bh` b2+Z`Bh` bcO1F F@ -CFFmN'T0۹3h;3`Xh#l+alGcK@AcJcHjh+ my F}h+h*A2cZ`jh`0G#+`ckk``ecb.oC"#KFmFU0lVp+5lKE"IF^h l"h2hh?QhkY`Qh `!i`Q` `"aFsha`a0@ |HB ,U CF*FhlICF+5o.h+?i(h@B?\cm/W0S0;YHB  5 BqX0G AqAa*-?)'5wPwF HF IF Bc4 FF [X-AF#OmFF43OaCF2FzAF iFFF F m4((@- ICFH2FF4BF1F(F a$ D [XR]pGM FFFd3F*FOahhF&8F IjFF FP` M*R]pG R]pG R`]pG R]pG RD]pG R]pG R(]pG Ru]pG R ]pGKpG DK0 pG DpmObiFCF ( lN#`O4 F mpMI4d DKpG D@L  _4Խ@ V D8FMOcH")F^4O % %խ")F 74VV#`O08 D [X 'F F Fs h F@ JF 6O31C,O31 F@pF FF!"hFr "hF+hIjFCн0C$ B I#(hjF0O0 $p iiCjFl3x00PPMV#O5`(F-٭7#">FF"CF"=2ѝ0>0F#C0<#) F HN> 1F FF(є> *1Frx8h F dhh7pGh F dh#DFB +"*+ ,F$p FF6#/x+F" F( "1F(F(:!(FF(\"0oC !# "rc;`O0p3p")F!Kh.F;#Z1 R4oC"# "0FF#!c3px.+i+oC"0#! ".acO3cc O3c:+} b(0 FF1$hd#`(Ff0$E ( F0i+dh𵇰hF F' h۱ah(FhSx+ai2 ich01!0F*F $hh(b#` iB@hx1hpGCj@hF"!hF "hF hI#jFC$i~-OٰF F#!Or OC F8H/'8FY#0 Fu0ѕH8F  0[x+gF(_عHQF$Px^xixi+yҲ*"#+  *> 0D<1%JB (FS0"HQF++,йIRF  $$)# #(FK(d(FizsdD(F>0#P0lcd,b(F #k`{h`d`5}`@xx-AFF - i#\x!hD\#` FRzh* - -*FhF( "H052i%BD!DB,D#iBdh{F0O0 I" 0I" 0O0 D04 %#F3SQ 2AҲ %D"0 !CQS"bCS!^!a"2C!S!^!A""C!S!)""C,0-AFF FF0H(FTAFr0F H F 1h"(F1^HH F s8F p3hFZ2`@#pP-AF FF x+#3`#` /!FFh1F(FsF(HqPy pFh% *i#jBi% "fjUjB `j # 3p, `5, `5-OF1;FFF+ m  w            | ? + X       +Zm=Fq !z   5     G Q [ g q    4'-?(FF{ *F!([" 1](N7 Z' @# 0FoFh$+Ah 4-# 40C0 )-40HiKhB !#*FFFG #1H?O0 (#*F!F0x#I"( #1s@@u-0"p)F450C#0*Fp#!EѐIH!(.*юH4T<"##Dp40C#Cc0)lQI(F#l1I(F#l1I(Fй#l1~yz zz85zRzzzz)F8FF(?`p jHV)FpztN40C0E-41# 2>I(F(4# 23I(F(4 # 2(I(F(ФI(F 4 H)F!40#0 40CS0m0*F #!FFѐH40 S#cC#040CS0ݻ40#0ӻ40#c0ɻ40C30-81?3vO:041F8FBFKFZ(ݬ0BF1FKF8FZ(Ϭ#P4S-81?3xO 04gAF08FJF3FZ(JFAF3F8FZ(PO:JF3FAF8FZ(p43FJFAFZ}-==!(F4H03I "F(F~F4O0p#0#0 :F(@0#sC0 I "(FTF4p:F(?I"(F<F4p:FQ6zzzzzz{{{I"(FI"(F`I"(F0I"(F([w4!!p")F8FFHO  :FF Y0 #0 RFIFM0 #0F05F(? 4  8|2F9F(?_pJF)FWI"(F(Bw4!p")F@ :F!0?b0FF(?[ O(> 94 822F9F(?pBF)Fq tI"(FT(rI"(FN/?? "D##" F8FI 4+?cH9FbI "(F*`H)F幷0p)FR 1͹ *F(/!(FO3 4"1\(?ש7 @#  'C` *Fe(©/!(FdO3 4" 1\(? 7 @#  'C`s-j40?iX*FpX^40CS0T40# C0HHù40C0;40#01{E{>{4{1{M{g{p{z{{{{40C 040# 02!R0##C0# 2"@@0OR!KSP0#S0#T0KsV0Gs^0ո4#0θ-ŀ81?ƨ2#4S470'(?h+H)F-4$ (F$(H-<1 33S<԰H?" F(F  I0 S`40C30i#*F!( (Or(rcrH)F]40CC0G40#C0=40#0340C0)40#040C042#C#Bb2# -qHQF40#C04{t#``-к$G4{t4{t4{tXHL-hUHD$ (4(FFPH)Fƿ?"p F (F Hd FH)FpF0(FF#;:!(FbFб" +oA HF FH8 F1H0H=!(FBF,I(F iF08FFF0&HڿFF&"I(F QF(E8FFVFF(8HI(F <Fh8FFzF(O6&{Q||'~b|7|]|z||| |||I(F Fp8FFQF@FHsI(F Fp8FFv<F+FH^I(F PFOщH)F(O  OЄKBфH&v1@H/@Ѐ}H)F|I(F FFyI(F FvvI(F FVsI(F FpI(F FfmI(F (kI(F |FhI(F tFeI(F lFbI(F dF _I(F \F@\I(F TF6xYI(F LF&pVI(F DFSI(F < FFf^OI(F 2FLI(F *FFNII(F "F&FFI(F F&>CI(F Ff6@I(F FV.=I(F F&:H)FD!hz1,"\R(x1HP8F  8F3F"#p*I(F F8(FF(FVh}o}}B@}_}z}},v}a|Wc}1Q m+hB@kh+=  ,5EфFO %h#j"`,"3 36 @FAFFF0F0! ܪ >A`=(F8к,`(-?H4P7#P740CC0 40#3040C#C 040##0-?(F4@h2+~ H)F較hh2׼40C0ͼ40##0ü-?(FF(#; F|I(F8WHwI(F vI(FDeG.>qI0F0oI0F(~IC25$e40Cs0z40#c0p42#CBr2#d40CS0Z-?Q0# 0*F!oCMHr4 D40C0:40#0040C@0&-??" F(F 4 H +> -H)F-??" F(F 4 H +>H)F-??" F(F 4 H +>ЫH)Fػ `Ļ }}}}}~~~~~0~J-OLFF &FOY 0@6n.81H [j+Ѻ HOLD'BFj(F8OPy~-OF FFF+G%K"`Q33S,S<Hy810FTJZFKHHBFO ""J)F8Fh"FQ(Fm22!q @A @2 F]PFO T`o^Q'qo]-AF F)4 1+W1+ax1+]"9F0F"   $ 0g47+Y0 8g<7+Y8 @gD7+Y@ HgL7+YH ( (FA ٺ 1Y7(F ' 1Y7(F '"F8FjrF(Km T"0F,6v47;470F,6l<7;<70F,6bD7;D70F,6XL7;L7-O=FF I F(HO4O IU#CBbE##"-/#0O3`P7CP7ijN2[BU0 K@ J H!KOqJA hC`YL#8LMT8(FYX0-BF F$Q050! QT DDQz1KO 1OhB%/K'/LO hB4 QX" `V)hF Q̳`O0W;;>+٩#`4Y  Q@,CA@+٩#`7Y  Q@,CA@<PDP P<P@3FRCFO4 F0@pG)F ~*0F FFjOV?  *F9F FC8FF F&B<K!J +*ѣBx*K!JH6 {Bq"ZD({z<FC{B"`)C+Y>R-O {FAFF,@qpHJF(3h<1Y@;I:F F^008FIȐ(I8FF I8FFI8FFI8FFI8FF`I8FF0I8F%+@ɀ3h<1Zڀ FI3 Z<[LJJ 0l+JI+ FI F0𘀲l FI0𐀖P F}I0rj FzI00FwIF F0uЖP0soOr!Q0mI F0_Жx0+@3hI  FQ0;Kl*?(8I FD0!-?#@6 1+@Y F FZ&CF@R%H'J"'Ix F0^ 0+BhkAk9k7ln koJbl*5>XSh\YYX_HXF F(?jBa"FhE T FxI 2V0?Q"YFtJ FrIJ0EqI8F@(|oI8F:(vmI8F4(pkI8F.(jiI8F((?fI8F (`-?`K`J)FFF^I Fl0? \I:F Fd0?0F%(F>0h%%(F?OBQI FM0?-? 0+?0+? FEI2F0?Ю F@I3!A06O:F5O3J8I F0ѵ3hx1hG%*2I F 0ѧ8F%(Fh F*I2F]0? F%I!0ъ-9F F50? 1ZY*ѦO%CF@F(?k F'kAk9k7ldmx8F h(FCF F8@=8FFF:*=lb"P$#lc $0۱Ziʱle1F(F0O4 ,(J (J ,( F( J1F(FO40$//$4k9k7pFIE<;NB H #`O0p"1F F4 Fp F0D [FhF1AT1F:F(FAF:H F8I"8F8!F@!0H #;FD^BF(I)H}a$.3i y0Fv06I Hj6h(" Fa0 ѩFh+IHV# O#I"FHS(OsB I"FF H$YY*YFxxk$KF &F;F+Z[X#` &F *ѽB Њ Hch0F (@(ѨV#`O0(яBѨ"#|Qjx C   B)F+* FBDPHE٨7# F#O. 9D ;B@BE٨#O [FFFD,B ",+F+##p-OFF FFF%CB*뱻,ب~7#`O0TKO X\YF\  x1Fp@MLy"F1hF xiFlF(Fpy.x1h#>0B*2F!F(mh !FAEi!F(FP(Ѩv`r/#0 K@!J H!K@!J@ xQc+Fh FFԨH#`O0Cx+Ё)F1x+x:G0А"! Fh Fcg9FhZ#h Kx+ыyoC@ghXkkgx`e h8h0F"L9Fx+Ш#Ix(`e(7-AFxFvuE5|2xEAFzx29FD:xFF.8x2F!D|2 +D|2%O0𵯰FFF!!"8F"! "1F >I V@@= ,٨x7#`O4 F/ "F(Fpi pG pG pG/J0FQhhz p%FO00"%I" F3#OBOq#v0IHI#@"Oq#d0IH7 #""!V0 H)"! (`0 IHp0c;I\8FQ(hC(F#x18@8pF>`ư FBЧO5#`(FFpOr!hF6 "hFOCvB02F)FD`#hjFIOsh~> *FD#hIjFOshhiiFI`LT  ( c1 KOq J HKh++P@B O0zcCjFlCXBXApGQ FhBF#cgD#Q00F F("!hF")FhFjF IB + ")F F{CXBXA 0 (i8pF"!(FtT k"!l"!FI *p i:-CF<]F1K@!JH&Km#KO2q}J|K@!xJOb!8 F.#pHF1p31caso`#`-F@+hB`hC`FHF;xsmXihC`hC `hC`h/Cso`oDCc`2#jC#b# 2h"! ]um^hC`B 0i.5x1F"0*FT-W=E5.Dh /N /F 5ǜhY 1F(F:F2/K?G7=Dh F 5Ϭh 1F(FXo2F솳>F65D*"!F0O0 <]C{%IFp(F:F/?G7=D''&c'-C&FF"#Fb!#6"!0bD0F F/.F!F0FeF(PF!p0 ѧh +(FpO0,F.DBxB ҧ#`(F]O0##DBӣh@/ "F8FF H} "fIF@FfEHF"#D5Fc𵑰Ni FF@"!hFV {"hF1Fh-A0h00 "i 0 I@#jF8F-I@iihE|Fi"  F#04C |2""!x2<-C]6FObA  (н BЧ#`O00+ѝ0+ۀ+++w*<+6(Fo0@߀hV8O0+)*+:ـ96սx8F(н 9> :0Н0+ ajѐ" "6hIP0нX0bj FlBKx+++vKh #Zx* [h# #Zx* [h# 4@"!"!F AX0;hFI 0}ѧ0h+Ч,h1+>I?H;0+3;"(F#Fx$**0;+ O1 !(F9 ]*xF(?: d Fq8F FN(?8@/:'B"0+ٮ xM N0 D F!#R0+i@ic KF#!3 Ffc+  pG+#`$`~V#` F+ F#` F$`nV#`FF+I"'O0pGc-G%FF )FF"! F(;#``3I4H(``0ܐ+FJF !QF5``0ѧ*h+`hB%IjF0 нP-ѽ0cH8`hC F$' " I`h 0I`h0AF FG(I`h0 a`( F.@@BqՀBlBp@Bf-OhFFFO#`eihM"i`hCF+FhsD Fh2RJEFeFhai rDB- B hFYF(F!hB`YFJF0F5iUD%DciaB!hC`?HF"O9!jFI4]Bgh-AFذF+)#L5FŔ x"Dhш4(O3jFO!8F,I#6$#`O0X4(O"O31F,#8F"dB0h%-O5P*P䍭 iFP @$#"@h 0! FF@hh F@!Fv0O0! Fm0I`h0O0 B~0h!DBDx#`@@C0F0[+DFVű.ا#`  `(Fmx` hB٧|"#(F#;`BhhB9`3,1-OFF *ا`#DKB ЧVV#`O@F$F#F&F"FB  `+dAFF@F˼Uмl QF, lBБ Eؼ4ѻxFE\DB!F#(DFAFFDZF+2Fѧ#`cSc FFF0\8+x #pO0 FFF0F8+h #`O0 FFF008+h #`O0@mShYhm#e@!nK h nO3#f03F$ F@Z8F0P33S<-Ր>0+)D&0ke#hx1h8B0YmkmB Rh>0+  H8@ 2O033S<ԛ@he pF F OqF]0`X+ha K0#h+0#pOppOr0 0cSc-OFŰFpFȠFF3 ѪH O0E HOs; S<VOq  F(d0 `ñ*.h( B "JBњh ћh`#+p(0> kpS+ *p#@R,hùOCk q"%? Fp(Os++T0k`S,sgH $@D,FDB. .d9h0щhB C#0$00#)@kFCQ$p$yDB+.<0(1+@Z#;`#.0;#F狱<0s,@<6#p#q<0 0.Ѩ+8##p#cp/KS BB 4.P.A.ћ 5+K0+:Ш+@3##p#cp00+@rF7#;0" F2,3"ZER;O 07,34'bE@t 5cF$2cScZ 53B+#; %1 Fq2x 5.D..LS<ը+@2##p#cp04D<S(? S,  ҲќBМP  .ѡ:*DEl  ,3}2x)B&ТBFS( S,#Ҳ|BАPB .ѡ:*DE:  ,3V;0W0 Ԩ+@#9##p#cp4 ;$< 4˱Y 3B M#; $1 F 12 43D(1x3B=#;( F x2(1x3D.@..􉮗W0Z:F!;% 2F+(o!50BbpQ##pa 2PF Cp#p#q .y..LW03 20<1Ի~՗Z0Ѩ*@"FP!cpF3 2˱3Bs:<#;1 " F 12. 2.DOs@~+UQ#p#p# q4< #<S`6p(p*"(1Zp(> 0>! A}jF*@# FHH3O0kAd#p] `FFi0/H.KBBABF!Ѧh+&Hi '8F ] i H"F(hBC!F(FJ H(h<1E[ 5# #F0P F0`H"F Z*d-8#(F$ Fpx+pTF(2F)F#U-OFɰFTI@FRFF(d(hZFQFF(mФj1F*F@EHj0FIO)Or3F0F 6#RF[F(h4# RF[F 5FU `0#0,0+A.@ѝ0-N=@#+JOq8F ,xI\$ICF*FHFhILF(HIO $I>ICF*FFHFo F~;hNdI*ICF*F`HF]NI`Id#e@N^Eq-OF$M F$NFUb FO, ,62B&p%B&F, ѽ0FH V,XB3BѱFV ,Y,PF4FHFT5,6#T ,@FT,5$F0FCe~*-OFFئb#`) FB1F z 0 B O #DBҦ>"#1F z0O0*O!FZF\D*HnCFIFF0F20T HbQFF0F&0m*F Mئ#` & FS (ћ(O hH:9FF(F03)F+ z"F@A0O0 M I(FA0#` zx04 31]aS0[#h5 +D(8D 0-OF+[h@p_0՗o0ZFIF0h#FK ZFIF0hy#F(ЛK+AئZ#`T0@$P0RZFIF0h#F(GC "E=0FF(U;  89Fk(4$B77W<0h0  mHW9X_|Fkcjq 5 w-AF@F` "hJ(h+F"!A66V<%w! *^!F #(hAi;(F*cik`jHF F&H(F:F!(FD(h+F"!'h'`iwciV,Haiw#bR(Fi#3(FcbV##c"F#A=AF(Fcfh0-OFpPFF(45 0#՘J{mH\#2F!FBFhPMO O8xB3Zh*Kl[@+(@#OzrdO`|zsD F|(5 0uJzvHwzgjz {m #xB3Zh*iK{n+$*F F($<и?._J#hP([J   " *" "*F  0uLH  F-0k F$F(\2FQF0#kr"`5 h#F"1Fh0 $7S : h1FK21 r G\1FF H F@sHC1FJJ ԧv,8 PFHh# F3d8@J!. 8FP+h;+h#F J!hjG  FH# F+`Y# Fd8@8 J! +p PF1FH1Fk*kHd hJ#!+`#FS#c Fd0p@32"b!2 J! FP`6h;# 3F F(C0H ;#h<1T,I Fd@6 F2F9FH#h<12  H@P9F F!/2F9F 2F9F(a F0K@!JH\  #hf+` (ah F F#$ F@2dmex !h0Ch0"2-CF` F hhiBrjBX0F(h3Y {̀G IFF&H hiі@0 F)F" F6F!%#F"!eI FdN##C"#[ [C#h!{(F h"!K%l% 0Fh<12>#F!$Phih" F# F+`# F 0iZЛO*` FQGt FH F 0@M8F0P3 FFȹ HI Fd8@V (aH F8@ 282d8 PF H Flh0 FCh0#d8@J! -CFph7X<@N#33C23 4FFѧHC"K0ѠIH81 23ѝI" K0(F0їH C@ &qdh9fX6(FC7v2C(FCܽ33C. (F-h a3i2F(FyIFh BiX< X,r2CCi#3h*6$#i(F1F#@0ci1F((FFHF`a hJF#i!ffah0Ch0(h|hQK B#3h+E(FCBHX<#k3(hiF(р?? "k `rEv 4H th|#3cbS#cck Dcck Dc0KE0@,#h+p##`7dX<C (F8H CMXl?v3C`jG F H9e k0cScl,10+?]h+?Y0KE2`jGt FH(F(h+F2F!cX<2CД@ r K(h !(FC7(hKM 8 0FP33S<Hh0Ch0# Fd8@H FI higl%@t"hb 2qs C ]KpGcn#h0BI]Kll%-OF0PFFF# x+@jmKhBCF:F1F F'Oe> **(#j+;7 cE85# 2F h;F0;#0 ?0"Fx;33FII e" ^"\" B2BGv FHQ#Rh Bł30|H 'Oܽ+h+wI3F"Fx (+tI3F"Fx#O L pB:F h1Fv@dI3F"Fx \P3+ѹR60X6#2F h;F0VI3F"Fx3FTI"F x81F h:FF@F LH0F~+h +#h<1FI Fh hiv h!AK*m,+m##+e'[<+<##F 0B"1F:F h06+7#3+[RԹ@3iO #I3F"F x:F h1FFH HCFV3i+h;3@3i;3@I3F"FxF%1I<8 vl#2F h;FX(+h3+!J+h+х@3ikb0kd#c3FDI"F x+iBh8FF`( **XFZXH AF;FRF)F FIdhv-OF FFFCB AI AH+F O-! F*F-bٔ@+\cz+YѴUEUO.OBK T(F½ *>2DB;ӽ D*7h1F F"0/T(½ 2h P"iP" ʃ !F)FXFXF F H !DkFHF ep)`]F FmIH\h#`hBBiF F^AF3hCH  I6(F ]phiF(F7`.m,ej*-A"hhF AH uh- xhF< *FAF H 0+1h;*FAm+1h;*FAe-A!]O0FFO RZ` FBF!`* "a :`"Z` x$:`"B`I2FH0n "FbC H !]  Fej FFh F!8F@|iK`iHhE(A F>,hx1h K bO32BпXO32#38 h*[h7FP50f000>1(R<(C#B<#+ +R4 F(HO*hGa`2h`"a` B``3h`(hE F0h F J! hBѸf 0-GFh O Աi'h.hxn! RF4CF0F3HvP0 ##`  !HF(쐹`hCh;C`+ڑ (0hZ`x +AFhFvT(-&1F(AFhFvHAF,hFvB( "v(x+0B+K"F47Gtx,(  pC+"BJ" ` (* F pC+'6 '9H'6(K[h;"FFe(HF( '6 '=HF:K 8G'6 8%L`h%`te`8'6 F "F! 0K87F ,H'6 '=H8+FO*` Ȅ ,`8 F !F" K87F ,H'6 '=H-OFFFFȿ`O̿OO8m0@F4`hBh [(QF(LE!FIFB LEE$0O8U B0 pG pGpGpG pG pG-GFQOF(FF;hS9FF 0F61FF (F.)FF F&!F@F @O30F FA Cc"BFܱB)F0ѡ@"h_KhKIGKz #F0 H2'A-AFNh3б3i( 3iwi@FB8GD8FB` TF0 i"FD$!FF(D'A8? M$?i*j#DBiDa8 F( 'A𵇰FM$0+DLEKEH&hFFG&hAKCJCIDHG&CJCK%)FAIBJ/z( F@HAI&h/F?HG*>J?K))F=I=J(p( F;HRTfśbF`D\^YVŴŻiFizHjOiC(D#@S@a j30B P#@JjOi*DC "@b@E! +a3-OKMD+lD(#XC00F(yEI0`l.h$4FO bkB"O(xO 2( DB(O(xO 2( D*lDB.8F@FIFH`6 1F04(F4IF` k01F+k4F30~F4IF` 201FDjkF#D4@ dF KhK IFG+z klh'Af Hf0p$NjulB(hpU$0LE$4'AK[lhpG'A-OMoLHP-@b !"#&@F#,#Sr0#bxObAF(3 `aZHO3d^C`UMGF\??6.. OH_PF(#0'm&/A9*t ssssss&s,6ssss?GsTs_esksqssssssssssss"s(.ssss;AsNs[asgsm##r##&0##%0#lkh2B;k`kh+3#$0#h+;`lh:B3h+;`lh:B3#'0##(0y##)0s##*0m#0# 0KQFG]'AA HR(b$0;H:M&h2BO`@hfe`cc@cl#cA9!dYe@e#jhi@ca"fY#bf!a2*B"f1fn@c`'0CH "#3I&H`| `Ig`H`p j`F`d  Mj1F(`(#H0 &u HlNf@'B'B KH0 pG'AK h pG'A-AF4LFoB70B3 0BѪBpB0B hBр`"1F(F$'BF(`cia@F`ciD1F(F0ѡ@"iFh_KhKjFIG#z ciBF(ci`aHA'A H2'B -GF9OFF=il @#i@"#aO3D  0 0&0"nB 030Da`{nBO jHiDaVaciiB !F@F`Ji!F@Fca`iB#ia{h!F0`8&0K,yi,@yi FG'A0$BKlD0v44'AKpiB l@.j&DBЛ@DhXipi@l`i'AJpil  @@@"iuBeO4 D0Da bTiDap2'A-AF_O;iB lCh@% /DB{У@Dh!BFZ! F2{j2Ѹ%FKD00@*iC !P+a@i Cakii3kaB-:hB##;`i)F0FAO1K#/03 ,KO0CCX AF7+8)F`<+9hB=`BKi+8`8)FAP@*FZ!*F!Fl`6FFl` %0#"iZ!h0@#`'Af -CF>MkiBki3DB*n1F F(Hh3/$ F"F `F/"9FHFh`9FFHF`0p;`oB0B F"1FFGF +i@FB<F`Bo ٣S@  ј%0+ЬB*8Z!7 )|0B0B!  O2H_FF/H_l`0" 8FSFCF&HIF_* FFh0B?o*Fp IFH_%0[B Ҫ0Z!.c*0+ЬBbp!J #`h)0+KhKIFGH FFlN H'Ba'AF K'0CH "#3@, F@6'AlNܹpGpGpGHpG H,HpG H,K0h3pG b(K0h3pG b(K0h3ppG b(K0h3pG b(K0h3pG b(K0h3pG b(K0h3pG b(K0h3`pG b(K0h3 pG b(K0h3@pG b(K0h3pG b(K0h3ppG b(9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpG _WhF;+`ڌiB (]KB h\ `p]KpGipFN$V4(F Fp4 , gK +K[hG pGgF0 S pG0pG(h9!HBpGXK0h30o O0 pG b(@FFR;BpGFpGF FK0h3pG b$K0h3pG b 7Fx M K*Fh@I+F"FH0L%F [X(9 xH+ pG pGHpG HdJK3( FFpG0;+AA- 3,۲ ٚBГBO0 , 2ҲB+F0-OhF3hCs`,q(FO #"!<&qh B  \( 9"p0DD 4"FPFDD ` ;ѹ і.` 3 -6$`O0.9,7KFXhB4`3,-$`#\C Y ++$0rlкB@F(:F^D-OEҠP #`qk-*`$tKhBKhS HpG=t bȠKhBKhS HpG UȶpGpG pG F Hb I Fs@Hh IFH I t@H [X<R]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBР#` I)Ft`J!Fh 'EhFhBӹh "` J"x46@d(T`x10: ( b('B4FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00[\]h;iP!0xCC@! pGh`K3pG'B48FCi FB "iQF( F !F8 hpFFFS2Bңi5C"iYaB#Pp3#S(K}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhFi i$HP&`S/B2`jB2bBѢikR:D.#iQ-AFZSBF FSA'0ip0iF FG2BҔtu(F)4YB7x\*CZx|*@0iF FGhKiBѣh #`t0+u 1R"B0XB`x\(]Xx|(Z32#`x|*xBoiF FG3)YBxB[xBBx|(632#`*=*7ѝ0+3c Fi DOAA3OAi Fi FSRi"OA F3\Z*ѝ *ЙB! F+  FiRiOA F'B4UiFFAi)DXi#iDi+Da8F-AF FFFhiû/$ݷ.󮀰F#3D+(+++)Y.ݶ@)F F?FFOݸ &&F#FFa2+FROA FCF" FiOA FRBi)F FR"OA F6i" F9"OA FA(V+FrOA F8iiOA FRi)F FR"OA F i" F9"OA Fi2F FGhiF+'2OAR+F F6iOARFF)F F.?>FHFFi F!AF&N FF3h+#OsB-#@\ CTkK52hh*!Oq30B#@"\C#TKh30B#@b\CcTj"j1PJ 8F !@pjbZb P _ b$ b -AFs*hBPBxB Tx], N ,8x(`!(FA "F9F@F8@FB0y6! H#BFӃh #`K31BґBx[)Yx.)3 F#`2B ӣh #` K3"`xYBx.*Zx]*3#`'B4 HJh0')б` pG pGFpG b(pFN$V4)F4 p , |)KS<GFpG|F(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(6 _ b$ b -OFhBhOkB"I(FFPOA Fa#h3#`"|I(FFO A#j@"hh1P( ! FO##j@"h`i`!(FF#jiD#c2Bx^)3#`#c#hB x]*3)F F#`C-*\Nt1Bx]* XB-*@ׁ[x]+ `)F F(2BXh+KK3U-*@ȁ ! F3#`Bأh #`f#hx-+]+ѣh #`f;Kh"hBx300 W/ ! F#Bӣh #`f2BHYBEx:*BZx]*?3#`2"`:FD '|F(l FQF)F F70:+#OsBij"(j1P( !kj(bZjb h #`fM'B4 b( _3#`Bأh #`f#hx-+]+ѣh #`f=! F)FF Fb#Bӣh #`f2B YBx=*Zx]*?xh+#x-*@ZB@Yx])"`-& FFWE0+5WEݣh #`f0+#OsB ںE׮:F7)F F?3#`Eɮik"(k1P !kk(c #p3kcQF8F(ݣh #`SK3O YF8F{( QFXFu()F F  эZ"`x]+h+:k>#jiBkxCkp;K Fh/8+9*j+Ckk+@kj+=k+:ѫj?4AF FY#jjg(k@>(j7D@"!(FhB"jh;`#`W i\A B2F0#jO@Q FhO0[*Zx:*?@=*?Ϯ F1BF:F)F FB'B4 _j FpFi(KI h1!I h10Be F#`]#0#0 c` se pIOQ F p@۹ b( b$ b -CFi `\ и[@HVB+xChBӃh #`K3"h@)S#`xBxE𶀸Dڸn"jOA Fl]d -*Fb2B YBx\*[x)+)"\! F -OA Fid*Fo6BtZBqx\*nZx)*kѝ%`BUٛx^3ܸ"ڸ"Vt<+_Т0O`Q F*FDVVt, F1*FOA F6#j"Zdq/Тh"o(Q!@{E ! FZ#jifh#` c`[KBV@ O Q>"OA F"O Ah #`KK3!! F ih"+ #`@Kh3* FVB$XBXA0*+"Ѣi;F F52OA%`i FOAi F;F2OAiOA FkB+x\+kx{+5 F%`1BF0x,*-Z"`B1J[xh320Z) FBFݢh "` J"*F9F F2BYBx\)Yx})3#`S+F'B4^ ] b(Os!`#hB YBx\([x}+ ! F!6h #`K3ܸ*?K.?hG'B4h^`Fxi?)πء$ڲ * +^) [)Ҁ\)Ҁh+ {)|)!ChBӃh #`K3"jOA Fl^d .2Fb2Bx)+o)! FE .OA Fid2F2Bӣh+FБK3Z"`x)+!0Bx*.@?*@3#`1hK*53i+FOA F2RiOA FRi)F FR\"OA Fi" F9P"OA#`! FP"OQi#j!jBbZj2Zb"OQZ#jjBbj2b !ji Gh` C`UKgO Q F8ChBӃh #`IK3#hZ"`x<) >) РoX Fe"OA"O A!h:K)+*3@𩀢iOA+F F2RGiOAR "`${*ZB,H[xh^0@"`h$K*t3,+Уh #`KZ"`c`h*#` F2BFx,*@Z"`J[xh320Z@ FBFݢh "` J"2F)F F 2Btx})q3#`?'B4^ ] b(3#`)+*Тi+FOA F2RiOA FR}iOA+F2 FRiOAR Fm "` "`+*O 3`?X"**1BTx*(?*{*JZBFJ[xh320[= ! F7?*?{*?e3FOs3#`#hBx}) ! Fh #`K3 b('B4+-GFFFJ ЇhBCL nF KB s "FF'!W%0 F)FP" GDu O" H)FI+FK%HuPO5" " R""tpOa!hF)#a+DaY#B #}K32BC"OahF"KaaaO6``( !hF]c`)@ch FFF !cPFP{xC@_->س_!سo𔀳_kB)Fc#k!cO1ZhFx2*F)FhF_rг _kB@)c#kF D)F#c)1% OسOسOтFOMгOOG9سOeFPF'xGhxCO5гO2гOk#jC#b-?!@`c(@!(FF(@🀠c`kX#cc+k#0O $pB OгOpkB0)Fc#k!c[)F#cxGok]O3#c`h"F08Oг@OUUT P D Du S'B4-F5x))D)e)D_F!c_hbcX+xG_+B%s"T}AFk+"ME##`#ld`s`Oe#3`#j[!hF:0FP[rC_Bjk@!0;X!(F*c8FWj#:@#3B<+FbFG"0Bj\E:3Ҡ Z\B B2W# B$ P#AE@#@#W#03ELLBӫBB8W" 8F\,k+?n3PxAOбO бo+?_#jC#bYB8F; F(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(6 _ b$ b 8FK Fh+#OsB \k AX@8k˱ K4(Fh3( K(Fh3x8 8@p _ b$ b -OF-FF FBԀ2hShS% xCO9س _س_ހ__𥀳`_𣁥L F@_𫀳O𞀳O !سÓOiS' B@Ɂ?0O:س OM(O𑀳O OOOѲh)xIh0FO  QQ0!FBFsSFqF(ѳh+D8O@O3iB"xS10 _*2Fi+kh  h  EKj)bk*8k?_DEw;xR#0+e=   BZљB! @(!DD#DFD7#k+E8F' RFYF(耸cl+? ' RF F(83HFF |D [\#0R B,?qEM[FSEF8x3 xBkB8F  (ѺE~0Fzcl+C 3 l04 +?L 3l"B\ blcC\ ZFعFYEh 2 F(\F w(и?y ¸OqOr#?f $@E( 6  =F(EJ2lX#3 ZFP+0( >F%& &&pGpG pG ~ pGpG pGpG8#MF`+x %`8Oq(FY( 'B@7FM+xD 0(%`'B@Fhx[@(/! F8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!H>HH˯'C@˧ (  pG pGO-M@8p<`P0p`T01*@00 0`  R0Q^A3#[0002 T 03*@ P00 # 0T 0C2@TPT  # 3S R0 YS#, X,H X000' @ 0@?oR20S" 0P  0@# PR  # 3S R0 YS# X00 Ѝ& 0S"X 0H0SX0 0 0Ѝ 0fP0  @yXHm0 q$0@-QM@00 $  P"RA\ P(EU-00ĵЍ0~0s \G-M0p`@0W PV P%X P.Y PmZ PNx P4 P `XWf  YX TXV+  MX HXX  AXt S JM+;  6"` `0!P P3P0 p* 0p +kp@ kp@  p@@@d4k k.k,k P&kP`Ѝ!k00@|ŸO-1MM @PD 0"$H"Ġ "( zp C.F D`pY;@D8 (@~0Sn pȱp đ`  ᰱ00$ %0!`Ot0p@ !0 0SP P0S Rj001ݍЍj0S 0K0S RS Pp 0)8D<4! @P 0 00Z  0<-0h,R gHo1ݍЍrp h` h g g@ gH g40@-M 0P Mp Op@ P ` Ѝ00 0Ѝ0@Ѝ0A-@@0s- :PP0P0 N$p` ``0`01jppX`p 'j``0`0j 00h8p@-@PCM3 /MZP5 @@|pPC ` o@i000t3 8 C>@F0F 00 P4D@@_0S VS00 SCލp|@@0Si@0P`0` @0  P@1:i?00@i00  cL cTp@-MQM@P4SY TE /YPB QP0s* dPQa0P `#pH @0@ _pq? H p8 ۍЍp+0si/%@@00p +TEi@P0 @0 R P@1:Yi?00 p 04Mi0#S @Gi@Di@*p@ 0d0?`000T0?P00<0?80|0D0?@0x0L0?H0?X0\ 00 0$ R p@Q"2"2B S"2"2@0 2 0S,0"0x0$0S"p@xyp@00sp@2/0 S *$(P0<^00 =S$00$0@LX \00h000c0] .: 6S ^00\$0/,>! 0E  0E $ $Â!2c 0R,,"΃0,!/#1    (  ͌ ( $ 00S %7 \h0p@@0dp@2/0 S *Q00 <S$0 h000c0 \ ,:6S \00^$0/.>! 0E ! 0E 0%!E!2c 8Q \?H/)L 0 ́/0,0S$00#0S >! 0 $  .1@0HL  h0M 0C00000S P  00] CQ 0e 0 00 N00 00S \ ++;  +; i= =M S= =O0yz O-M@p4`k`00`T00 W) 0< PL  ?0P  0P@v>P 0 1?1000?0 0@ p0?0:  :K<[ 0+2;!44p0000  000W :0x0PZ 0TPM dPK4`P0S| Ry R u R q 0 0A 0qS A ?@$p'@TpET0}Np0q A0i`쐝 0vD HJ0 0I0!l00R0(S1R0 x00 ,0& -$$ QP|' @  "0@RS0S S  xp@ X Z 0S0Y|0[x0 Rwt̰ [[,80>C0: :J0'0p@`P V x0S _Ї000@pD@ x0@0Pe l  0 0 ^0 0 0 R1 R?Y0 0 0#/!!  . /J㪐 B 0S!0(0S00#0S>0 Av.@ B Q PS000S Q0ŕ_ 0 yq  0pq_0Sr@T`p VP} 0 ?oR20Sq_00ߍ!i_x@!pwq@1 Q# 0  pS@'NRp$ \TPx0 P0,P\000 0  ZR 0S 00@ (_x` 0"p_0S 0 0Y0ZS 6 x  q  x x x x4MZP Fp@^0SF L6)P L@(㏂@"bX02,:"  @b"R0% P&qLPP& @dT0@l70p@;^0x`P帐开0@@pD@|P ?v  # K R#0P- q 0X/0 U#10">/ 0%)$B@C "!!b0C0/,[0U @`0&"0 S@D=A^ >0 $|pq8 p@8@{eL^#00I^0S8p̰@1x p@̰p[@%< 0 "2#@T!+^!Q  sP^T00^0S  @0&"^00p@ ^T00^T00׼@-@ aBpFC@TnL00P 0 0R/P/ /} 7 7  DP 0 H Sp@-`P P 0@ #  TQp Pp /}l 6 6H  P/j.0 0# /P/|x000@-PP Lo>O@ 0" P0 0|A-@P @`pP@0% P PPA-`X@@P jNpP@0& P PP{A-`X@@DP H@pP@0& P PP{,O- M` pP8 찟`萟 PP P oN@ & XP P0S d Ѝz ,/@ W lV cC0p0S /dzA-PpQ `@Q #P@D 0DB(000S  u4@- M`ppPP( \  00S@ \0"S" 0p000S0 7/ Ѝ\0"S1Ds\0pT000S @ Ѝ1Ds$ t < t8 <$@-@ @O-`P MU PP2S<pPK P@N P K <10`0@P6 0nS# =tLPP00Q Q P  K@^ B"  0\Q 0 000oS@d000S vtp Ѝ4 9ifd , r\O-BMM@p[X 0 02SP:LPP $ &SPr00VU0P0 C `KP@@%0 PP'p 0P0  0PPp p2@P$ \zРD 0 dQ`k`V` pP } r| 0VP  @PP0 PpS  Q Pi[ 00BލЍP/U ` P p@S[0SS  FPBލЍ F0H 00PPp?  _F0[ P00 0Fh!0 0 0[D 00 0oFP`[0   #^00!Z 00 0HFPP{Z 00 0-M  0  PЍ ?-M00 0 JPЍ 4--t( 0P    0/ 00wwp@-PEU@pRZ,,0 ? P  5/pwd 4\p@-PmEU@p:Z,,0 ? P  5/pw 40@-@P 0003/v 4@-\@P 0003/vp 3p@-PU?o@20S 0 003/pv 3p@-P`UV00P00@Sp$ 0P5/pu 3Dp@-PU?o@20S 0 003/puP 3p@-P`@PpY((0  @p@/u 2p@-P@P p 0 003/pt 2-@- M  up@(0$003/ Ѝ@ Ѝ/t\ 2t@-up@0003/t 2(O-$M`Pؤ@ 0 0N0Sp$ЍZY0 (P@@4/$Ѝsl 1O-$M`Pؤ@ 0 0m0Sp$Ѝ/Y0 (P@@4/$Ѝr 137$ 5 $ !PpO-0@DMT؆p 0 \0 0  N \0 \o:#5B$0. W,0 @S 5#37 ,05Q0,0m,0 S 57,05 50,0S R0#0C R00CT,@DЍx:#5B$0P$p 0 ]T@d 0S1 `@@0 SS( S R 0C#@ Z0 R,0 Q ,0 0,0 RY@0S80S ,0 S 5>37,050,0 @Q , 0R0537, 5 05 , RS #0C 0S 0C 0S 0C`V  FV")VU*0FSQONMLKJIHGFEDCBA?><;:98765bV1 ?R/0S, 0 b32 B012 00@l 0 R,0 Q ,0 0,0 R @RfV ?R0@SQ  b@S9 B88  C# 0c1#00FV , Q 5075 5,5,00SQ05= 3 7 ,5 0,Q~@f uF͌(Y P>C͌ 1S PD>JB͌81S P=̌[ P=^B͌ 0`3@@@ 0S7800PH0`@P@P @P@P@P@P@P@P@(@P@PP@(P@Ppx@PqP'( @Q78 x00C40S000C,0h0PD 00Hp(0LP@ (0a P[ ,0` 0` 0[ k V2 p @T   @T,0[ 00 p @daXh@0 0p@paP' W 0 V `0 1S@ ,00 0 A1S D 0|0 0?piߍ00e,,P࠳0A Q X,@<00@ P$8 Z&  B  @R=     pW  Pp~W0,PZ  p,匰$ [ !p0@ @pP X 0@0 @RP8<0\(04 0(0R"DHpLP@1H00PXPPL$P0P0 001P0,0P00T0JX0`P `<@@(p08`0P0J0DXKD0T0p`,  @  V f`p[0@0 PU0 PU0V,  @ Pܠ就ZP 0@PWP U ` [p0 @X @X0 0SX , \ @@ , XH0 p0尡_D0|H 0 >p` p  0W  0Hp `  0V p 0G` P  0U `H P  0Z I P  0Y JЁJ P  0X Kq Pp  0W L^ P  0[ M,00@P0(p08`<@,  B U+@@0, P  , 0T0H 1ʙ D@  |=p+P0(p08`<@0@4  P ! , @PB BZ [ Tb0p㸀`, 0(P0 08@ < DX\V f!`pX3@ 0 P U  @PU 0V,  @ P封[P0 @PP U `0Xp8@(P0@<DX\Y2Z< ,0pPC`@ U*4 @,0@1  ,Y0 0H 1 DP  |!=p}pP`@@0 0 0R> $0SF 0P,00U 0e1$0PS7 0H @ @  Z  @ Z , @ $0Q1B/P`PiP/ Z   `P 0,0 SS,0 P 0`0C 00 `, U# 0 0 B 0!0`S:  0 P 0 0 @ T @T0,00 0 @0,!,0R0@0 @1P``P$P Z  P`$` 0SC 04 ,01 X 0h1 0S3 0 L0 P @ 0T0p00 @fT0 ,00 P @T 0Q1V@` @0P T  0`,0 S\,0 @00C00, Y# 0 0 B0!0@SG  0T 0 0 PU PU0,000 P0|,0Q0PPa-@ p @`pt0P: W  0 `@ 5 0 0R080000SO-`YMq0tcSA P T3? 00K͌0 0u0S3?HPK͌0H0v0S2?p`F͌(0p0t0S{t2?@F͌(00w0So(2?pC͌ 00y0Sc1耍?B͌8 00{0SW1? ̌ 011s0SK1?81NB͌ 0810 @Yߍ 00u0Sl HPv0Sw p`t0S @w0S py0S 耍 |{0S  u1s0S N m<@-M@ @ 04@P$( ,Ѝ0@-M@ @ 04@P$( ,cЍ0`0` 0 R/DDQ @Q$00?H/`0|$T0P0/ D @  R #@ R 00?H/|$0P08 A-D   R'P?HU0`@S,p10 0D C  \(  @U"@U #@ R 00/|$0 00t0tP h H ?30 R - D#@ GR<0@ 0G//T|$O-PH4M  0pS4ЍP$|  L0!1009|@Pa 0`D0ZP`@0PZ0 TdP V@|`@`9P! ?3 R #@ R< Dp H0L |" 00( 29x9`P0S R,@PR @P0 9 R0`Sb4ЍT `@000  0`Pv @|`|$0 00_d0`0` 0p@-0PU 0@S PJ+ppD0p@-@P 0PS P3pp0P0% H -? \| 0DR0 0 0R S0@ 00\R  /|$0 000 0 0 / O-MpR@l2P0`0Vu T2*PP0LrL 0@2@Ÿ8,吒002唒圂  $ T X  \ ! ` 0l01 0m010p0npp 0@z0匲 0吲0唲0圲0$TX\`lmn 1 1Q0'0 0 0 0 pЍ|00 0t000x000`0\0X0X0T0P0P0D0D0 @000| h (d0C-pP∂M@ `P `2Z@0@ @ 0""BBB `@"C @@CC3PU C pP pK 0p R\ @B0 @@@e(P9 0 @@@Z(P. p* #p& p0 @G(P  &c000S :3S ЍP ZBk2T@ T`Ѝh0S:?pPb XA-Z`ppP qZBB2S@ T*000 R A躴 A 嵴 Ȁ1[0@-0tM,@ CS*>-0R< CKD[1C+D;1C Q11^0fKh[+v0x+z;0#0| 0:01_01o01 R 1 R 0S8Ѝ0Q x0 0 0D\l0A Q Ѝ0'###|<>*!fX@\0l 0 S/G-MTؤPpk @+(@pT($p 0CS0S|3hPXT$: 0Hk{+K[@+;, @`-@8.@0@ p <8%`($P4x,~@fhjlnkp{rKt[v+x;z |#!d""e"#-@#`"h# #:p R 0S |(@0800S \ЍQ (2 0 0C'~l J @@\  0(PU(p00Ѝ>A@J@ < ^v#x:'# #H#p--~`_{|xouprroylzi{f@|ch}`v `afghijklmnopqrstuvwxyz{|} 44 L, L@`A-'n\PP p  @ 0^(PU 0(`O-M`6 6006006000Jҽp−00SVF ) p :p PP_ N p?P4S S SV0S$pPr 0@p   $ `00 4S 0 0 40 s0 0bR$ 4S4 0P%00Ѝp PP 4P4 $0$ s 00bR 4000P ?21 R R0  ;0 $Q B q 0 ; 0vpP/4 S S040S% 4 000r0  cR$`S ,4051E ` prd0  ; 0F p PP4P0uP0PcRT T4Sz0y$0P s 00bR4S 000V0SgpP 0@  ` $A `00 4S 2 0 yS 2051E `0 pZ p 0$ "P0 s0 0bR40 ;0pA P= pi 40 s0 0bR4 4$R2P0$0$ 0Cr?o  aR2$$1E00#?c p p 0pU 4 00 TP0uP0PcR TTe40 s0 0bR41E00#?c0`00$AR r  `R$ $ Q 0 0 0 4 00 40 s0 0bR 440`00T0! P002P})())'%($4" x0*- 0 00044 4" O-@PTDM4P0+ 8 `$Qi w :Q|#R3Z 300S 8 X1P@P@P@X@-@<P @<P :P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o" Ҝ ҄O-P0MpfS`pdvpJP T0ʍ p 0rr I"Rp 3S(0$00 0~9PK ዯTt9P Ⴏ 0XSڤ%$ T 02P50 |504S0300SR p0SO 4SI 4S 0d/、 @V㌑T2p" =PS 00@p2Z LQU P P ϋP ᥽ᢽoY=t3@x2 P[ 00@x2X>3@|2  Pn 00@|2gЍH5S4S 4S0?o20 D $l h $ <% p 0$0(0fX :P Y :P Z :Pp2?;~0p220PY0$ 0rr H"Rp2XF  :P_Z<3@x2\  :Px2?;~0x2V  :Px278x2Y :P<3@|2Z :P|2?;~0|2V~ :P|278|2u1S0. 4S*yL%R'oZVd  :P_x2.#@|"78x2XY~Z->#@3@tx"|2KZV/  f:P*x278x2>3@|23p2Z0@p2RZW8t2=3@x2>3@|2%P ᠼ>3@|2P~ Z<8t2=3@x2>3@|2 P>3@|2n $ м Р  0 00Nh8Ƞ00- $ Tx Xl l  \pT 0t 0x|" Rh 804  P X0 0//gLO- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-|\ Q |pPl0@`P QV00` cPB ,0 R0200pP00 <P @0P  H  ర帰 就帱00S0LzJ<0 800.@k;fP Ǽ x ǬA-@P7Pp Pp@p `EPE`0 2U @0 s 2@ p@-\`P@T 0S1 RT0S@@V0SQp@yG-l@`pS0 ST0S"Q0S 0ST0A-0M`@@᝹P, , 0 @S@j0 @ 0K~†"  2 0QU 7 P*#( ^@Wۍ໻8? X - LM  R  ʂ0   ЍaX0 Q0H00S :\@- %n/aȼ0 0p@-P0S :@#RA# #p `0:P #c#p# B#0:#!BA##a,T0 P-0M 00S ʃ0  A Ѝ`T804  P T0 0//_p@-PQ|``p@0@ <0SP0P0:3S 8 L40 0{0 :#p_ O- Mppl3 dS0`P\0 *`B'WX p p PT p   r  `R  00/"1 R# @0S S9 SW0C S p2051E `qpx  @U ` Ѝ R k  P   Ѝgp P ` Ѝ0 r 1 `R R   S7J @y ` 0  S $q 1lR Q   Ѝ@p   B/oq"`Rm0E00#?c Ѝ 0T0 P00N,4  _ $     G-@P(c(3`pZ 80$ RG V ʌ3S23SnX " R .8 lLl0@-$MP" # @ M;X  p@ M2P\ @000:3S X !$Ѝ0 ;d 0 000:3S/>:T0T 00:3S 03@-pp9(P`/:@0< 0@-0 03, pp9P`:`<0< 0@-0034pp(P`:0@-PP MP* 0Q@000xP 00 02000*CG% Ѝ0|P H00 024000*3% Ѝ09l/ P0 0@- M@0:R P% P P Ѝ0P 000 V20% Ѝ0PtP 4000 P8l0 000:7!0\ S0 0 Q/p@-@Pp80pPU,Q (00C 0PS0\@Tp#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p (@L0pTЍA-PPM Q@`Q00?`FV`V` ,p (@L0pqTЍP/\ , 0 B0/\//A-M`V,P@p (@L0pETЍA-M`V,P@p (@L0p+TЍ@-PP M Q@6`pV00Ӣ?/`FV`V` W 0 @pLT Ѝ(1@ RR( RR T 0 p@-`V,@a Q(0P0C0 ^ S0Vp(, 0R S0/0@-P0PU,Q (0@0C 0PS0 U^00@-P0\0P", 0 BP 0 PU0,Q (0@0C 0PS0 U0\0O-0 lM4P1*YCTb ,P@QC8 @$^;RC 0p0P00@0 0  0Q-P@p4S-`0@PP# @ p) ,%4,  [ 0$ }* 0 6 lЍB 09lЍO/O-0:$M $t00  PU $ `P*@Ta 0 `P ڮ W):0`SI   0{@PH$Ѝ@`00S S9 S0PV!W(0004S$ЍO>0 @0S G 0W B20RP  pGP3/V 0pG P u/W  P#/@ G`QO-M00P0SH3 `3S,[*Y> @00! 0@ @00@ )TP0 { p @` ޭP @0S  0 `PPEЍ` D _P 00 C40/Ѝ @0 -t 0P0  0 /$400 000S :P /+L0 H0 0S :-P /+400 000S :P /+8L0 H0 0S :-P /*400 000S :P /*H@- @@\ ʌP 0 @z*XȀ0 0@-0@T J 3$S B0pQ E8@}.P 1 @*804 000S :P W/)lX PT 00 R0S *P@04//)$000 000S :P U/(L0L 000S :P @-Dp @ /(0 0A-0`V* Z 3$SP! #Rp@4S@pp3Tw A1B0tQ 7A-($,0@- @  @^'D000 000S :P o/' ȼ00O-` MX$ p P 0 ᆬp @P  0 Pzp@ 0 #@  Ѝ@&P  P /p@-JP z3S P`4`0Pӫ3VΫ  0s3 S00 0P 2 $R 0X0S H03 20X #$04p03ppǬp@-jP 63S @P4P0@⏫3Sp@贜A-`PX JSU"X p3 @R S$ S'X 0lAQ0, X0p ,0\ 1B0010L10|10 A0 XP3PSSpP4PStpp3Upp@-@P X0P:"C0T0XppG- Ԁ\.P@p  `ᾫP LTL VW PT WV  H000S8 0ᣫ0 0 "|O-((Z Bp`PuP@9P ( ,T3oP+ T eP 0  @+00 +0` WXP @ RX #@(  !(,0@!|0@-?S0Pp   0 P0X( @`b& p@`^  0000 t, D | 0P0q00_p  B PY 0  0CIJ0 SP 1 ЍTYS00CS``STZ0JS` ZPZ0 P0C Z|0 0040@-@P`Pp0^0C (,, 00^00@UP 0S 0@//P 0S 0@//P/P/P/P /P/P/O-PP! + 1СD0 , 0S 1H``?c`@ p0 @s'W#갑@W0 8| 0 0p@ P @0@00C U0 000X ?o 2 R0S P 01 //@-(^,0R0^Q!R@!1 O-MA0@0S3, @ P `p0S! S#A 00 `0C``P  (0R0 (000C0T0 02/p 0P@S(  ЍlH |(0A-S$p4@`P(0P@SQ Qa ppQ p 0p(0p(0S/p@-0P`@, (0@SpP0@-0^ 0 @ 0 Q@R`O- M@`P VTppC0S  00C(000@0 T0@ 0 S `%,0 R@p @ⴀD R`Dp `|ip Ѝ@0 S RQ Ѝ,ߞP ,0؞0P `00V  ppG , B(p!B, A0 T`  `  0Dp4୞P , 00@Hp`4 0Tp `0Dv@U   PB  0SQ 0 0$ PC 00\R >@U 0 BQ 0C R G-@Ph 0pS: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R00 0U1Q0/P00` 0S 0 0V(W ѳ`F`V`0XPU0P`W`V``0 @p 0 $p0PEPUP  0 0PD Q P/$ $\/ P/tA-`PAPQ@P1p0$ VY 10 0 QV$ F 0R U ERpL @10 0 QV$ F 0R U E@p:   0F  Q SC$ 0R U E*p$ 0*$` P0`00BTP @T 80@Tp` 0U0 A-PP0P`00pQ0 0S:@$0P mH00@T 0W<P, 0S) 0@- \%@T \8x ƌ8 t ,0@0@PU 0P0U00 S0/0?o2?=X?A-P$@`V0S4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P 0 Q0@ B( `p0,0,0CA@1` D0S( X @- 0B 08SE?080$ 8R  R 00S0!R$R R d1S80080080 O-`QMRDp0[~PPy ሰ P,r ͛P@0e W4* H0X S 0` @``F @ 8  < @0H0|0$T`8  \0 @`08 d0h0l0p0Ѝ㘛P4. ԚP( :"R! 0 RH0SI 0p V0 0 @@  ʧNЍ -+ )'P#A-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,APP D0 D0RH0!b pH000$`P@0SЍPЍ@-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ`@HP `JU@p_WNVPED 0    PI L1D00S*Y p$`(D0@p`0S00,0UD000@UpC0@aCY Ѝ00H00H0t  P PEP` V IIP ЍP @|$ 0@-@P0M0 t l 0  B/o"  lPP ;Ѝ0PЍ00H@- @  0M0 KЍ|P-00 Q08SM$ 03ЍP8 /-M 0  0N NLN ЍO-QP00ph04`p 1a!1 101 S1 0C s020C s0渰S80rD 0S 1 @P 0t@uPTs00p4`h 00`000 00 `( 0000 00 0CQ00( @0 0 A\8 `( A^(   `   BQ  88000^(0 R 00(0 R0 0SU 0000!0R !!01Ḁ}0Cs020C s0渰SD 0Sr1L0|100 p@ 800p0b 0D  1L0| 1 p+ 0p0O<Ѝ`0BsP,00s0 000 ( QS 00ã08 @ 8 8@8 0C0C 0s0 0<Ѝ YU YR 80&PU,`0A0s0 ,pNq ,p  B   S @ T8\ @A-~,UM5@P`0@00?5p 00TP 50 05 0@00@0  00P P50 0@5 0@00@0  00P 40 04 0@00@0 00LP 40 0@08@0400S@0@@0 0 (P !R 040 00@ 0,@   8P !R 30 00@ 0,@ T!R   P 30 0z @0;@0  00P L30 0i @0:@0  00P 30 0X @0:@0  00 P 20 0G @09@0  00P 20 06 @09@0  00P <20 0% @0;@0 004P 10 0 @00@0 00P 10 0 @00@0  00P p10 0 @0 0@0@ 00P ,10 0 @0@0@0 00P 00 0 @00@0 00P L1S 00 0 @08@0Ѝ00@P L00 0 @00@00@"\l`|0@- Md@d0@P006S 0  Ѝ0,0 000  Ѝ0@xLlp@-PQ|A`@9 Rl1000S 1Sڸ0  @T @TU p 0  0X pp!R!& B(0r 0(!C RC$0!0R0ڸ : h2T000S  @T $0@0| -M 0ЍC-@PP `?/LN \_@pG ࠱ L@DI\ JP 0$ PC@-PB M1@`0@0 !p Q,  !1pP0 01 0@00@0 "~, . ~,OP6T10 R00S Ѝ@~^P, - Ѝ 0pP0 000@00@0~ 0 0Ty0 @00@0P l0Pp  PL0 0L 0^ @08@0 0pPTl|`A-p@`Pk,TV!0000 A /? O-lM( 0 L0:3Sk(?@0T400 X\ 0  8 @8 @) @ 03@0ST(p?@? 0<000DL00 0SM @<000h0S80@080 L00 R0#>P( 0@g0, 0!0s0 PT- L0 00S3L0 Rq 00S0, 0T LLH DR4  , !$  Q$  P  r Q , R  , ,!$ 0  R 40pT@D0|0H0000vp 0SL01H@400 0,0000,00 0Yf0Y 00S 0` S0F 0RY4000,000㓉(0#I0CYLڸP0<0/o"0L0S0 R f 0YP@l00P0P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[lp7 0 0S 0 @V P0P ` P R  0R  ` :(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s H  H R 000SX 80 h(9( 0`V 00P0 0C S80 @@0D  LL l80L\ɟ`Vuq8( 00S=0 5# X0:h2( 8@0 0B4 `0`0`, X Pp v'00S0 @0006p| 1`11qW7r'0 z<00 00S 0 5# X0:h2|40V @ 03@0S ~$7( 0pQ?0A 00C04ԆP 0 S- PP$ 11 1R@Y RRQ 0  n &(0 R 00S0 0p!5`F0PAp`P@ 00#?3 1pGW1aFxP `p?0<000L00hP 0P40P00%` `0ᤁP0H0T L0 R 080  400 L (4 0 p`lЍ` `R 1@ t@T,0Q0@t@T40080i 0aP TD<00 RW 0 R PP!YR   fY $R[  0E0 0pS  0E  <000$R ( 2@ L  R2( 0<000h0S0B  0 0{hNx 4000Vf! B0C 0L0 R d1SlЍ4 0080@080+P00C\L0 ^%0SB ;X1( 0, QA@`.4`! ,\@XP pp@XP BP0@, QJ   4p@,@ APWp@PT ``˸vv |p &8 &opnddcbpal`PTp P0 @`, AV@ TqL@DPP " X @   \`Q  ABQcP P4 BQR p @ p  ,@ 0$8 R p p P p , [!, !`u @@`[m P0 p WPh   $  Q p$,@P08 P LPA\L00 0`, Iy# @A]0,  \* `@0040 0 ~80'0 @00C40_0 pPWzp  P,0`  BQ W G 4  DP @ \p 40@ pI U L00I D |p0TpP:W W0P@ r@DT 0GpG00GD@d00: 40 0Rpp,@0A0W,000C0P 0p00 p0E,0 P0Ua U R R  W R R"R10 S0@a 0 R@8$ LD`P@@@D ,@ST \E$ P `0B8 B0 B0A 00C 0U40P P0,0a0 00Rh400,@P d1S ( ,7@ Z <000!R 7Q R dP  ?@ ``E 0E00p 0E  <000P+88(  <0 00 E0,0 0000Sv 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S< ` zT9( @ 0  `c@ 0 `C0` <000tW  s0 U<`? 0 0LcP6Pj <00p TU YʕbH5Sp@TL 0$`P@@U= 88PP `$= & ,04 S5(&0CP ,00xP0S L(0P0C(0Bp&@  `&0 0@,@ R 50(600 80RpfF`@000 (P0 80@P0,@Sf 40 CRbڬ%% pp% t5@04p,`Y | `nR`F`V,00P0S  ( 0P00B(0X``!R 0[^[ $ $0 0C,@00000C S[ pH400@4 0,0104#0{d4`000P 0 ^% (@(#P@ ,@j4 Rw 0U, q  P+ x# I l# ,@(@?QW, 0 #\ (7 ,@  P J0,@( R @ B P  @ $@lP " 200  0 l80 S %\ "'H2 0( ,B@0S  ( 0P00B(0( 00P0 ! 40,`V7ڬA@ 10,`4 V0`F|!,`0 xP0S ( 0P00B(00@&A@0S  ( 0P00B(0 0@[ ZZdhYY$XXXX|XtXWWWLWHW4,VV\V@ UU U0TTTTTSS`SRpR$R ,QQ|QhPO-ds M`3p\C@4 P ᙴ804080,c`,0P Zn38@3`0T'#0CS 802PL袟 X0@DS,00S0 0l0S R "0 0 208@0P0T0hP XRP4 @P 0, 0CS EP 20 0 P1084 0, Ѝ04S00h0S40~0T104 & @ P0P<1,`0 R*T$!P0 0 @T 0 R 0 P$ 0 0 00 lP @T000P0 0, l0  8@0SRC0PE@DP8@K 00SL008Pt OOpO0hOlNNxNMLLLLX(@- 8 40,0K(@- 8 40,0KȐ1!0O- @ M *BT8 `!O L!0 pR( X+ 0S#,PK U`0   R    PU0 PU0P0U0 S @T ЍpW,0 qP`00 P0 [SV 0W0\0 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/O- M|upP+ p5` 80s. X SD Pr 8@R!1S 50 50 P\`崦 40 00P 40 0|400:@ p0 @ l%R h%R 0ʀl20 h"T0s# 20T0 $,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SO\Q*SvVrE Q SVW~V= Q SV_V5 Q SV@, Q SV# Q SVWV Q SV Q@S  ![=0Y2 0 C S :Rpt p2! 00R"R ŸU0 8@=0A004 1OaLO`PU* 0S 100S H0Y 0H0,  Z000 0 0 00RYPU Ѝ0 0 !R 0ʀl20 0 !R 0ʀl2 %R t5S 0ʀl2Sy Sw Su Ss Sq So S^lHlE0|E|p1P0Wd PRP% L QK\I4 00ʃlœ\ 1:t“ @-'^# tƒ'΃r 'tƒr /A\ !B\ r^tƒ    /, 1P0C 00` P=ʀ: l2'΀S00r200 /@P%0000CS 00000000000000000/p@-P@M@(\\" rf Ptf vf0 P P 00 000 0qЍpllPd-X\\ rtv /Ȑ0 0 t 00S `0008=0!@00 R/@-*H?`?<441 @-00*l"R @!@ R  (1:'.r"tB00 R @R  AR x)|>>p0 000:h/$p@-`@M0@P0*l"R R   P 00 00@  @ &Ѝp`   P H00 040@  @ &ЍplXD2C-0 P   @0 0~00  HPr 00 R0S0 0?P4/ZWЍ H\r 00 R0S@0刀0pP4/pWr(SS,Q" @-@M R ! R "R pP^  0 0@aЍ /@-0QM   S S PpP$@4R @ 7Ѝo00- M %Ѝ&x@0<< -M Ѝn&,p@-0@R P\RQ ^R3 @%c ,R'Rq{ L @RQa0 L !a}0 p  % ?{ R`VD 0 FR;h!@P`   ^0@! cR{E0\R:R '  px @i%L {i{bnXO-M  {PP 0%  0  S  g ` @s\,S0Td 0@ @  0 S$  QS%S  +0BGSSQPNMLjiIHGFEDCBA@3>=<:s876543210/.-,+*)('&%$#"! 8 0 S|F 00PЍiR%@0 0 `fv`  00S1.R0S*R 0 Sg@0 S[0@0p0dR% @00@  d 0 S20 @0r 0  0 0J0 St00@ s0000  00000 0.0 S0[0@p  0 @  c% 0 Sr[@0 p @0  00c% +%B0 0@kP0 0 @ r 00  C C0000< @0D@00T0 S\R Z I00 S#0<$  o>  000S0\S 0 S00 C0 kXJJtILp@-@PM0P`0S PS   0 00Ph 0 Q00QH  < x0 ЍpQ0e,PpA-M0@HSD!00@0p0S= `0  1N;AƒKa1#bP0 P  8 g=M%02#cQP 0 pW$P@PW 0fSPЍЍ 0 Ѝd8FA-M0@HSD!00@0p0S= `'0 q k<7@ƒCa0#b1 ! 3>C120BQ0P pW$P@PT 0nSxPЍЍ0"ЍbETO-M0@S!0 0  0000S, Phqb*cE 0 pƏ⊡ - ?DB%.b CĠ #W =W =pP[ 0000pPQ  XW   RRl`ayPP U  <0 mW  m0SU $@(0 ;"K%ᚂ!b  P嚃!2c 0P 0 02#c0U0P0 pX00$0PB0P =p@H@Y 0S`@Ⲁ Nm `p`Em Y00\Ѝy$p4(0 ,(k@C3>C lᐡb  ! 120B P0Q p@00K$p℡ j(0 (-8 ?p A-p@`0\ %\0PpS sS lS@ 0\TTW b000P1CP0@CV`1D !Q00O-pQ‾qM  P`P. 00S0407  l@    H Z 1  RSG @T P  4 @ p@T %T@%T ,  R:PwP 400P,<=% , ,P 0 @@  :T T) 0DS%;#"8  XT c0Ds0Ss3|v00 00D p2"7R 0>T p -000 Tk@@0A@?SX>T0 p0A0Ds=Q=S9|7I_hm}^0S -00X.00  X@ E0l@! D0 Cr 2;0X'T OP͍ R'R ͍T0   R'R'Rp@p@I@`VuP` 00040uP, 00000V0R 1X!RL 0BS11ऀI PB=&@DQ1VTxvutqqomlkjihgfedcb^][ZYXWVUTSRQPOMLKJIHGFEDCBA@>=<;:987654321/.-,+*)('&%$#"t1S 0C11ऀ, R 3@ RX*P  0kp 40P040OU7 =@!1ऀ0100L1S 0C-11PSU #,Q!*P  4 P@6AT @D=AA0@a DrQA DR3@D1@ڕ#0S ?R ;RH p0S %S0 0@a0Ds RA0DS13 DOS !01000@Sl00l0 0St00t0QU PE=@Q1P uOU?=-!1P@ Q @10Ds R-1!ORTP=@1p=1 !T!R   B!!0 @RS^  ?R ;R QeR p0SP %S0 00     00C2"0OQh0͍}SS  0S}S}S@p@r1S 0C1XX   R!#@,Q*P  0\p 40040@N, 40,qߍ! 1KS00PQU PEQ1- @@OU=-0@0@P1Q %-1 1OS000@uP 400@,T 2 tP 400,X ᛡ(XPPÐ@oᨂPX ွ@|yvQA@pQA#QU PE!TQ1- @OoBT 2 tPT 400,S000 0 0. 0 n00@Y8 00&@D0Q0VT1/.-'*(&%$#"! w dR<*C@00N=!@DOo0B005@000- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/hA-pQM@P 0S! XB sP W`V! v00* V U{ ``ЍpPU00c ``U  0 0 R Ux U`1P0S U,  hDdp 0S R s0r (0 000SU00uP e  p0(0iP we  p00PਭU<ࢭ0 L T  ` l 0R@-M  H0S@ 0 Ѝ0A-pPFP U) @T`V 0PS |h@P0DV  RP JoA-pR `Q 00@ PPz % P P (&0 GS  rP   0?s s0 0/r R0 /r R0 /r R   Ͽ|Q Aq0U ?pQs0p pWP·Q| 0?s0S #  pP o   1@pP V0?s0 q%$rP w0?s0S   q^ 0 ?s0RSqp!U ppqN q^0?spWC 0pⲀḏx$SCPC " X$6  Ž0?"ss0nQ6 sQE fQ+ p00R00U0S   pP:!qP!qP# $ pP xr$ptr qP$V    p03?/U  R00   0 S/r RUp p0?s0C-@|aMx!P`p 0㿂 P 000S< PЍ`P P9 0 p R 0S 0PP  VPP004P\Ѝ 0 1P @`+` P *y`P O-M Mp0:S*0:SS@ 0PS:S``#E PXP  L;0  0dAhP 0P:S  ۍ Ѝ@ ۍ Ѝ ŸC-P M@M`ptP# 0/SC P/.P 0 ۍЍC0P ! p P,tl0P 0S/S ^pP WqX &0NqX P 0 ۍЍC0 PۍЍ p 0%qYW P0L 0 $ۍЍ404 0 $H 8 $  ` |@ PG-p`@P  ^0@pT  TP `@P@ @P PU   0!GV&&<-@- M@]00 Ѝ@ Ѝ/D Ѝ@ Ѝ/@-@ppp@pp p0p@a0 0p@-s0?0@ 0?0P '000p 0p@-PS@:pS oP!pn@- ^ @fR^ qSnR sR^q 0  Q A- @X `PfS@X pw0w P 0@nS sS@XOt@@@ 0 0S00@PA-P# P 00`p`0,SS00 0\,\@CnP   `p`@ 0G-pl@`P#P;pWU*nUL sUC fUH0D Y%R> @ ?oPH H0D@ /  H0@0H0SH0nUp@0 H P4 sUD fU< L00L0@P@ RP00W ,0 0,00 n 0S000 0 0@SH  $03?0H00H0H0@ HH@,0, (s0?0H0@0H0H0, 0H0$?P0s0?0H00H0 P O- M@ ^Z pP WpY ` P`(080H0mPS 0  0u0?0 Z0w / P   PYv / P  00 R0 , 0R0 < 0R0 0L0S00@ ЍA, R ;< R 05L0S @/0 0@- 0 @S* 0\ Q \R 00\ Q  @00 RER\\x  :Q  R00\1A-p0 @`P`VR mPA0 uW000 x /   0 0 0Pl 8  O-@P0 $M 00P pMn`pV`300 `V m P  p 1n|PP =Pm0P n00$Ѝ 0 nn,`0 pV 0(0$0,0 P P2/Rq  0S00eP_ `V X P/r 00mLp0@W@0H0D0L0: `fS. `0i0    P pW Ͽ|P|0nS sS`ov v`X P`5_ `00 m$Ѝ P`_uP$00F^B^Pl $ A-`@0PppW!S$ lP uv0Ͽ   ?0 000  0 0Pk0A-pW@P`S l0S u0  00` 00 00Sk0O-TMD0D $00, 0K:080`P ||@P00PP9 00"PT P8?PP4lP  P< U 0:T 0-$,P `T 0`0#1(00 0p0,0sc ,00s SP\ $,P9 0S6 ( .S  ROSD = @P# PP] @ p@t , R 0?s0T 0S00 R.00 L*^L00S P PF 0 B 0S t 0C 0 00 0000n080TS 0 0P40000S-X 0k0S(`[l TЍ i@0@SN p@tP00 000 000f0 JPlV 0`p@W  W0` Pg  (\W  RYX%Q^WQi @pT0/0FS G, r ,0 zP 0`20G|0SE0G/SVTSRQPONMLKJIHGFEDCBA@?>=<;:uz76ks3210/[-Y+*)aokp0W@ W8 x5p0 00@ p00@0<58 0000  0Pp`pPp`00j3 04 P Q 0 ?s0T R 0!P 00Pp`00 00 00 0 0 04 0?T0 /t 0 S00Pm`p <@PPT 00L<^4 8 QTW0L<0@P[〰Pp`L 0 0  000s0P 0`2P p@tk p@tH , R 0?s0T 0S00 Rv0 0 0S00FP xPOTP P0  j 0 0`ẖP00U P pPu0] 0@s 0 $ P0P8 0  j TЍ 0  "0`d0  hD   p0<@PE* 0    P/$P0 00 //8D0@-M@Y0 KP 1N;AhLBH gMMl1#b 0 0#% @B4d0!PЍ07 P0`0>//7l0@-M@"0 CPl k<7@hLBCNCl0#b 2 "0#AB@C1dPЍ07 1P00&>//6@-M@0 5-8 ?=<;:9876543210/.-,+*)('&%$#"!  " W a  !00 (ЍP P 30W 0B00> 0W9j!00 P ~Pz L# W0 00 "rP 0SI O!00 cP00"200W 0 YP 0Sn 6!00 cP00ʄ20W 02[D +a  <PR  cP00n020W 0_0 "*P 0S  !00 cP00XW0 " P  qcP00`ʌ10W 0!B0[D2/'D" 0JP   XcP00,W0 " JcP0000W 02/'L"P 80S !00 0cP00ʔ00W 02/'L"P 0S !00 GP }d | | | { {< z z zH y y x xcP00$00W 02/'L"P 0S k!00 cP00ʈ00W 0W0 "uP 0S R!00 cP009002[D 0 +a W  XP_  cP00&ʘ300W 0 FP 0S #!00 cP008300W 0 -P 0S !00 cP0020W 02/'L"P t0SL !00 lcP00t20W 02/'D"P  YcP00g,20W 0W2/'L"P G0ST !00 ?cP0010W 02/'D"P  ,cP00ʀ100W 0 ^ P 0S !00 cP00%$100W 0 p P 0S !00 cP0000W 02/'L"P 0SE f!00 cP00d00wW 0B qP,   x x w, v v` u uP t u t t sp r r sP r rpcP00400W 02/'D"HP 0S %!00 cP00ʘ00W 0z2/'L".P 0Sp !00 cP00@00W 002/'D"P>  tcP00D10W 02/'D"P!  acP00Mʌ10W 00" P P0S "00 HcP0010W 00"e P 70S "00 /cP00_L200T 0a W  P  cP00t30W 02/'L"P  0S !00 cP0030W 02/'L"P 0S k!00 cP00%ʬ20W 02/'L"tP 0S Q!00 cP00H20W 02/'D"ZP  cP0020W 00" HP 0S %"00 cP00ʠ10W 00" /P 0S "00 cP00@1000[DW 0   P v0S !00 ncP0000W 02/'D"P \0S !00 TcP00 p000W 0g P B0S !00 : qh p p q p ox o n m n m l l l$ l(cP00000W 02/'L"P 0S$ !00 cP00ʔW0 "V P  cP0000W 00": P 0S h"00 cP00810W 0{2/'L"qP 0S N!00 cP00ʜ10W 00" XP 0Sv 5"00 KP 0S (!00 202[D +a W "00 |30t30l30W0 /G"$"00 830030RW0 /O""00 n20W0 /G"2"00 `20#0Wh!00 S20Y20pW0 /G""00 B\20T20W0 /O"'!00 1 20W0 /G"g"00 #10X10hW0 /O"!00 10s10W0 /O"!00 t10l10d10^W0 /O"q!00 010(10W0 /G"2`!00 00#W0 /G"kR"00 00\00W0 /O"A!00 00|00  k l k k j j jX kP j i j i j jh iH j i i< i h hP id h h g g g f f g\ f fP fX f fH f e e et e$ d d dW0 /O"d"00 |x00UW0 /G"!00 n0000p00X00W0 /O"!00 T10r0W !00 D810W0 /O""00 6l100W!00 )100[D0 /G "ZH ZH  0/O"W"00 200W!00 8200Wv!00 h20*n"00 i"00 " 20A } PH T @ U"00 P"00 K!00 F!00 ?!00 :"00 5"00 0!00 +"00 &"00 !"00 !00 !00 "00 &P  [D0 /G"K}P !H H  0/O"0S!00 j20p" "00 _"00 Z"00 U"00 P"00 K"00 F"00 A"00 <"00 7"00 2"00 -H lH 2/'L"|1 00X1 0041 @@.0 ^1 000 @@X0 0 800@ !TD- c$ c c b c b c b a| b` bl b `p a aP a a aL `0 _ ` ` ^ ^ ^ ^ _0 _ _ _ ] ] ^ ^ 0 |00^40 00#X0 002%!00 0 000 00wu0 000n0 P00e 1 p00\D1 @@0 Ox1 @@0 B%1 0091 000,1 000'2 @@[`0 {L2 00'p2 002 00D2 00>2 0013 @@!00 j43 P00HX3 p00|3 003 003 00!3 00B!00 @- M{VPLOAQ"Q@\Q\P 0 0 Q P 0;B 0` 0 Ѝ{F Ѝ3Q Q 0ALL1\1 ^`0P  010b0(#6(7`0{F q p   ;B Ѝ$#t/ /P 0S $0S 0S P? @4@P//A-0Pp`8P' , R( 0"0, 4000R40G@BT@! V @D8 ,0400G,0 4 00(@  (8/P8,0S0Q 400 @-P04 R 0    $ < @ S. p T P  +ˁ0P R $ R  R S /0?>]DE08MUz 0PEt@ T 2,0 SRWd @D'w h0`d>0zp=?0UZ 0PEt@T7p0pp@>?00SA 0??000CS>0S 0@7sN?0 QP?0 C/(0 S@p0(0W( ?2Q5?0U 0PEt@Tw0pS =0%T0PEt@TU C0 ` 0,0 SP0\$ @Dʈ7~+D?q@D0D 0B $0Sp0  0p7?@0+'8w<#0#Y \20?K?HL0#0DSB?0` @p  20+0 qS2@D0P0;T0G?0 C2q@D07~D@N s Pl0{1r0ರSl[0PEt@[UR!B"0$ 8 Q 0l0S>0X p0P0tXp0  yP 40 /@k @400@p 0O?0( 7(pc40E?l 0H[m0PEt@[gU0 C00Si 0 0000 r$1岐T*U` $U\ PEt@1岐^ 7sQ0D @C7{D7~D@NqJI?L0Y$0SW$   0X@6?p0 (rX0p@+P7~@D@ 0@Dⲷ'q @p0F?l00`P 000/ S  hP00S   0S R?0P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000@P`^1@0SS/Q  < 02!0C 0  S"$0M< @0 QG Q0c  B Rp#p2W S Q6 00S/S` @0 < 0@0S2!< 0l0^pP[ G R R 0c ^  R S R 00S  0Spl0Sp0p0C0pp)x 000 0P,04p??0x p0 0 0 30 Ѝl0Spl0@@@xфP 0S $0S 0S P?,A4 BR/A/Q /@o/A-<PXPv@ 0(+`3/PPs 8pWF ( 0(3/pP00@a  0 Q    +P04 S:oSS0C0P0T00C0T0p0W0Cp1 (0 8#8pPp00Cp0@0 0 Q    +P04 S*p00Cpp$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-R|M  80⤰@ 0    0xT0SC0p@X0s\pW0 p  p0 |Ѝ0`\`V30sBJP:P0u;J XS1ZP05 0Xs00R 0xPS0RSCP RT@!T0!01 00P200 0! P0S|Ѝ0W0P0S |Ѝ0@ ?o2,0%R00S020(0@0$00($0,0@?o 200040C0 0000pP 0S@3 :^N $0%3!`@3@!(0%t@&!<: 80C1 ( R@P00F#3 0Sx $Q Br $ARVJ  ` V  \ F C 0 Z(  V F*x $R AR  BR W 0 Q  R_, %Q  RY  ! LAS4 @P  010(0! 0, 0( $0Wt O-p04M0C000 CPU?PU@PUA0PUAPR@oPP 0C R R0 PR \:0S@\!f!glU!1^  RX  p\h$X  p\h, Rl R O- M`؟ 0P0\QpY 0@SQ QKW0 S  RE R  R( (pQBWR BQP"S6Qt0S R: 0S S > 02#03/0@S0P P0W W0S0(0 Ѝ0Sp>00000 S *S0SWq00Q RG0@SP20 W0Sq S00U0 00#400 00 0  0#400 0 e0S0c0?o20 Ѝ0 0S&+B(l0S0 B8@ B0 #22c0# 0l0S q0002 R0e9S ;0 0t0 0  R ,00S0Q01$ QP0 R1 2 00 00 0#400 00 00 S0 S 00R01 00 00 R  00 0#400, R E  Q ! 0P B R PE [ P ! X*H K0 ,0 SR B000 0 0 0 0 0 S0 S 00R01 q00 I R}0ES IS; [S3 gS3 90S0Ck0Wi  2RC0SS@ S  00 # #8 00#"0  0 ,  Q R I   R'   0P P0S0  0 P,0SQ4: R 00, R  R [  $ R  9$ 0P P0S0  0 P,0SQ: R00 B000 B000,0S+  Qg0#0% *0 B000,0g  S  0Q| R00 00#40|0q00d0SZt 6l8&`6 &!6ƅ909&tl0QIt0l0" Yt0SWe :W㴖H 6SX \0l S B8 0 l0\000SFK\ R8 C0 l0\0 00S90 Zt0(l 8`R B  ^C 6&!6ƅ6ƅ909&6Rt0l 0Ct0 l S:t0 SW S Sl 8`0  W 0S0 B000 ^ ^  [ [ [ [ [ [ [ KPo᫲[@ ``S`051:P&0@ƅs04!ƅ0 0!1001  &6`Rt0l 0C` t0l z\0S B80 l0\0C00S=r#  #800#"0 00_P 0000i*W6F &RA \ R80l0 C0@0,0k 50 0 005 B0  00L0D!C0C  at0S*l0\06\0l S B8 0 l0\000S201\ R80l0 C<:86420A-`pPSq@PG Q00V0SH81 0P1 : (0sQ Q P00 00000 |0 `ap" 0S$t l00\ R6S S L0D C0 C060P5#0Spp~l~,p@-@5PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV00PpPO- M`p80S04< 08Q1S00PP 0 0S| $0St wpVkV`F0HSt0FSRp WnZlFYo᫲[eV @(& `4/@Pj  J@*(0`, ` X  P "L  BPT  A4  6/, ` 8(6/L ` @(6/j 0 D(3/80S6! ( @ R% D PR! 00C60p删$0 ЍOv `fh00$0X(0 | Ѝ",0  000%-M 0 DЍA-PHPUPn`0@0 0 Q    & 0(3/@PR &@z 0, (P3/ 0, 8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 , @@ L DD &!0 0C&006 0&;> 0$0;/ lO-Q$M R0   0S "r ! "0`pß P @`0$0*) ` "z0 `& qy0v0 p0PAr0!1:SuPPQp'9SuPQ(6SuPQ+P5S>3uPs01@$ " "@QP`0.HR P \!R!!P! \ ++ +P ! @$ @$ $PD!"  ,Q!$"0S 4` @`R@DPRT`&R v`a &P%uPa PR d& R,| &, pa R,d& RP%uPQ&T%,| a R%d& pQ&T%,| % C 00R  00#^s01 #$Ѝ, ,L0Â""`BV2c' @l 0 l ” d 4  C-PRp cmN P  0!\00#@B .P @N1R C 0 @$' @@ P $B0R pR 0`RpR`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0\`0 0@0@0C 00 Q q00H 'ᑒi7n/0R#@-qHp@#/Ǡ3@-6Sڸ6 @@0 #40&006Sڸ&0 ? 0O- MʀPDR"Xp `kẰ[ * PW: 1Rʵ?0aT\˖ QPW* Ѝ P U ^?0 Ѝ O-Ⳟ 0 A 0A  00JR<G@ 0 q0CR Y> 0 BZ0 00000C00 JR 0^ P0 0U00 0S@\ R 800SC0 R00@\<ЍW  =xQ / !02@[1Z Gೠ69#6pQ^p N ÀA-P@`QT0R`PE+~P p0T S#|T` 000U0 S@S |jT00 T-`0R V1|T0000` S +-T000 0`0T00 0``0O-M@T00R!+Z+8ʀP c W ~㸐|㸀iQ6s0 `IP000P#406`0cXfx0Z㼊PḀeY6Ps0`PE000`#406P0cXx0AUVq`U0uPPPP0`#406Pc0CQ6T T0P[Q p@`DQoob`V Qf0W Q@z㷀+}hpY6`Hs0000#406`0cW3sp VfPE0Tv`wppp`0p#406`c 0CUVP6AP0[Ѝp尀 phYp6`s0`H000#406`0cWsw0 Vf[ PEpTf0v````0p#406`c 0CUVP6 P0jP0e觮  P`6e@pE SC0t@0P@@@0PP#406@c0Vdv@Q@645P0V/0P2 `fP, ATq6`f0P0pAT6qv`fpP0bv`wp>ʀO-f6M⼖S0 #`P  #  # #  #  A @b9 Ts0@ Bp000@p#4060c^~00἖&R @ P$ p฀n9 Zs0 N0 00#4 060cXx0qX xq@DphWt@>挥s0pH000p#4060cTCt0 BR@@@CAԕBԅApಐpiX>s0I000#4060cWsw0 0@༖^ hD B@n Tr 9s0=@Np000@p#4060cR#r0&0R἖f b ^9 s0@P B0``00@#4PP06c Qq0&0Ѝ0἖=0἖9 ̸0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4&&&&0YXA-@ s0`P Q!r  pp "$  a AS2s 6  u0U0U$0Q  00  0 000*0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 S0q0@PP0#4@@06c 0C\| S600@PP0@@@#406 0CS6 S0ظ0@@6 0C606@PP@@!PPƂ0O-Q0  MR@, R} 0p&]P+(+0O p ! RBAQ j  &!R:P3 "[w6 S7p3 s0000 #406 c 0CPp 66 O.V G.0 0R0 0xS0  0LSX4&&&&, Ѝ O  \ P+R +R ,RE R  Q ,` &]R3 "[jP ЍOPj 0r\ R3 "[&0 Zp:s00 00 "$ 缦0j JP3s0 Z㼦,N(r :s0s00 00#40缦0j JR#r0{ Z㼦:s0s00 00#40缦0j JR3s0 A Z㼦r :s s00 00#40缦0j JR#r 0 NΌ⼦  Z*r   "$ 缦 j JPp Q ἦ & #  P3 "[A r :s0cq#0r  0:Q0@-!DƓPV ƓPV @Ɠ@F !6@o0ƓAQDƃ<  Ì!!ܕ"܅  d0S A-@pP `0 C~0@*TUT @&P %/@- M@Pp*`P `吶 P    *p n: @P Ѝ @@ Ѝ@ Ѝ@V:T  Ѝp@-P)@P @@_pּ 00p@-@)0P 0O000ż 00¼p@-MP`)@P P @: 000*p :PЍp覼P:U PЍp0p@-S P@ `0 C0@V*T 0 p%y1r1FP@p@%0p@-S P@ `0 C0@1*Tc 0 p%t3i4FP@p%0S p@- `@P0 C0@ *T @=pp/0S p@- P@`0 C|0@)Tp%y1r1FP@p/$0S p@- P@`0 CX0@)Tpz%t3i4FP@p/$0@- M@ P )p  @P Ѝ0ݻ@ Ѝ0ػ@ Ѝ00@- M@ P )p y!r!F@P Ѝ0@ Ѝ0輻@ Ѝ00@- M@ P )p t#i$Fp@P Ѝ0襻@ Ѝ0蠻@ Ѝ0- M Ѝ- MtiFx Ѝp@-@P%t3i4FPPpp@-@P$l?o2FP p#00pp@-P`@P  ;0@)$p@-@@ @-@@ @-@@ @-@@ @-@@( @-@@8 @-@@N @-@@d @-@@z @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@y@ @-@s@ @-@m@ @-@g@@-@a@p@-P` @P  0@#pp@-P` @P  0@#pp@-P` @P  0@{#pp@-P`w @P  {0@i#pp@-P`0Pc @P  g0@U#pp@-P`Q @P  U0@C#pp@-P`? @P  C0@1#pp@-P`- @P  10@#pp@-P` @P  0@ #pp@-P`0P @P   0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P`0P @P  0@"pp@-P` @P  0@"pp@-P` @P  0@y"pp@-P` @P  y0@g"pp@-P`y @P  g0@U"pp@-P`0Pe @P  S0@A"pp@-P@"g>t3GP p!0P 0pp@-P`@P  00@"pp@-P`@P  0@ "pp@-`P@"aaFP p^P U Lpp@-P`@P  0@!pp@-P`@P  0@!pA-P{@"g>t3GP p4`P  P `Y6p@-P]@b"g>t3GP p0P 0pp@-P` @P  0@!pp@-P`@P  0@!p@-@R 0@u!p@-@H P$"l?o2FP pM00pp@-P`@P  X 0@S!pp@-P@P  0@D!p@-@ @ @-@ @ @-@ @ @-@ @- @-@@C @-@@S @-@@i @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@" @-@@. p@-P`@P  0@ pp@-P@P 0@ pp@-P`@P  0@ pp@-P@P 0@ pp@-P`@P  }0@x pp@-Pv@P 0@i pp@-P`e@P  \0@W pp@-PU@P 0@H pp@-P`0PB@P  90@4 pp@-P0P/@P p0@" pp@-P`@P  0@ pp@-P@P O0@ pp@-P`@P  0@pp@-P@P .0@pp@-P`@P  0@pp@-P@P  0@pp@-P`@P  0@pp@-P@P 0@pp@-P`0P@P  0@pp@-P0P@P 0@xpp@-P`@P  k0@fpp@-Pz@P 0@Wpp@-P`i@P  J0@Epp@-PY@P 0@6pp@-P`H@P  )0@$pp@-P8@P c0@pp@-P`'@P  0@pp@-P@P B0@pp@-P`0P@P  0@pp@-P0P@P 0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@zpp@-P@P 0@kpp@-P`}@P  ^0@Ypp@-Pm@P 0@Jpp@-P`0PZ@P  ;0@6pp@-P0PG@P r0@$pp@-P@g>t3GP p0P 0pp@-P`@P  0@pp@-P@P @0@pp@-P`v@P  0@pp@-Pf@P  0@pp@-`P@aaFP p#P U pp@-P`@P  0@pp@-P`@P  0@pp@-P @P 0@pp@-P @P 0@tpA-PG@#g>t3GP Ip0`P  `P `1p@-P)@g>t3GP p60P 0pp@-P`@P  80@3pp@-P@P r0@$pp@-P`@P  0@pp@-P@P R0@p@-@Q H0@@-@R 0@p@-@0 P 11p@PP"0S "pz"0 @- @@u"y)P 0R @-P Q o//|P ݮ0t 0 @-q @-P Q @Ȯ@ f<0< 0 \( g$0$ 0 S ` <x 0S p@- X@P`@@CPpiP p@ (8'A-P`p" e/@P  +P` `pp!CP` ! 0! `00X'pp@-P @`PpP p@*@- /@P $ 0 0 0 &A-pP /@P"  0 0 0 嚬P.`P  ` P0 /,0, 0< র@&< H@-@P x@ f }0 0X  \-A-M `V $P 0P@@P.pP  0P@ =ЍAЍ/ЍAЍ/ U0 0t Z X,h@-@P ,@  }0 0X @ ,p@-@P x0 0 0R0 Pp.0P Q # p@3pp$p@-@P `0 0 0R PN.0P Q # p@p#pdP/0 0 0R /"P/<0 0 0R0/P///"@-P d0o0 0QP  00SQ :#"ldP/0 0 0R/!@-@P \0 0 0R  -0P Q #00!P/00 0 0RP///!P|A-PPM 0/o0" 0P R Ѝ R0 p 0 p-`P 0 S  R @  ?`P /  00 HA-@PM 0 0 0R ЍQP 0  0pg-`P 0S ` P i?`P .000( ;$0$ 0  p H P H0-0/o 0"^ R  R9/P/D0 0 0R /@-P >oP/D0 0 0R /@-P 'o`pP t0/o0" 0\ R RP Q $Qf O/P 80 0 0RP f O/t(0A-SM`.P@U Ѝ0 P/P ,pP 0 0 0!P* S'P0S0"Q00" ,@P X U0 0 0 @Ѝ( P -LP 00#  R0SSQ///  @-@h,t0p@-S(M-"@ RS#  P D>` `P  P 0(Ѝp(ЍpPH  (>0  (0$ $0 ͭ,80 t@- @ኬ-T@-$@@∫$,@- M`@pP P0Q!s* 030 Ѝ0"S@- M@Pp߯` `~$pq  000 Ѝ˯0"SA-Pa`#A;@P l95(+pP  Z("@P S -lW@, M(0( 0 (h <0P S0 P \0/S 0 P */\03#//2P S0 P \0/S 0 P */\03#//-M 0  cЍ-M 0  XЍ0@-M@P0  @0KЍ00@-M@P0  @0>Ѝ0@-@P ,0 0 0R /P/0 0 0R /2S!Q  P*0  S */@/0 SR* R0:/ /P $0 0 0R //P $0 0 0R //P $0 0 0R //|P $0 0 0R //DP/\0 0 0R /!\  P *s00/S : P/\0 0 0R /!\ P *s00/ S :P/\0 0 0R /0\ 0S/ /R0:,P/\0 0 0R /0\ 0S/ /R0:P/D0 0 0R /2 S/RLP/\0 0 0R /0\ 0S/ /R0:P/\0 0 0R /!\  P *s00/S :P/\0 0 0R /!\ P *s00/ S :P/\0 0 0R /0\ 0S/ /R0:P/D0 0 0R /2 S/R4P/80 0 0R /! S *s00/P/80 0 0R /!S *s00/P/40 0 0R / R/DP/40 0 0R / R/P/@0 0 0R /2 SR/P/40 0 0R / R/`P/80 0 0R /! S *s00/P/80 0 0R /!S *s00/ P/40 0 0R / R/ P/@0 0 0R /2 SR/ 8 P H0-0/o 0"^ R  R/ P/P \ /QQP/Z P/P \ /QQP/Z $P/P \ /PQRQ\/ P/P \ /PQRQ\/ \0S@-M ppP `   Ѝ@( RP +B 0R xR#  P 0S t P KЍ P PS pO-MM(@P p$`D1000000  00[ Q`$ 0`;/0 ` 0S Mߍ P 03/P 00$ 0:/P 000  0SMߍp@-@0@02APLs07LUa`L~0 0LWLP V~u0|0 ^P0ppO-KM Pp|O03@0 0 @@@$@@@(@0 0Cs0S[30 0Cs0S[G 0fSI W"S_ [Sz 2 0 @3/P 0`00S 0  0Ls0SR3 /SU p,p`0 S S   S S/S >S S 0 S S FU  REP0/S4 0(00>S7 S> 0S 0Cs0S` /`/OR3 0As0SQ ` 0 S S/ S- (S 0 S S%`FV0S pW0(00>S`0   $ 00 0 b S =S`B`0"S0S   0"R R  "RC$ >R|0 pL,G-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R@" tR Ѝ mR8 pR oR sR ;R@' ;R@< tR ;R@>P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮fk]\"R /R@S00S@Ѝ!1 0   0 8Po 0 +r  R7* R0f* \Rc  uR_ #PZ p  RU*6+IP0%0R"R    O       SP Y/ Yy  ͕ 0  YY#*-"-   )& l}}O-@p` 0Gs0S OQ3p 0Gs0SQ#WWR S @0  |%@ 0S>S 0 @>SSS @@ @sP (0SP  R @R%W' W0S@@[@B%PV `IP @P D >P0S{{|zy5G-`-M0#@PZ ,ppQ pQ 0PH h```SI# 0 p PPu5   p `8$Ѝ0p ۍPPu  000 ɍp$`$Ao/A-PP #P`p @#@P$@@ #@P p40,p0P4080<0L  @-n@  @-$@@q t@-@@O-4@T ,p P @Dp@Ѥ@T `P煑Q@0< <0 gPZ PZ Pv dv @-R 0P< P 4Q ,  D )@0@ 0 7, (0( 0 . cuu\ cuu8p@-M@4 00R0SP,0SER 1`V- P` 0 0tP 40, 0C40P% $`ЍpS' R#W#Ѝp Z0 0D p yl0l 0D ݣX cT0T 0D ԣ@ i<0< 0D ˣ btt bxu,s bTus b0ttsA-@`,p"PP W 0 ! ,P0`t#,P0`C-`0M@SPpD  qPZ#00Ѝ!0 UP ,0ST !0 KP ,0S(0S0 0 0+P 0S>0S0"S0:S 0}S "S000"S P  P d @@ 0P ", (0( 0\ rt _r`q0p@-S \  Q @PmPhp 0 0  ^ppp0S 40 00$  0  0 @-p ^qp40@-S , 0C40P @ @ <0< 0 ͢( $0$ 0 Ģ ^8q<o ^po80O-M@ Ѝ@p` !PP @ ` @ЍȒ W uoPP0 m004QY  4 R] , 牡 0Qw  ۟ P 0YIW  B B!B,0 P 04 `<0 4 0<0 =8P,UN<U8U+ Y&  ᔡ@ U P ! PP) L 0,S<SS> !kPI @, <0P` 04 <0x<\ ! ,0P BYP {,H x 2t0t 0F/` W\0\ 0,H D0D 0 X ZlXll Zn$lH Zml$p@-@PP60S L  Q<0  0p@' 0 0K/ཡ Ykktp@-@P 0`0V PP p l0 0 0@S<0  0pPp( $0$ 0K/t8, Y@jj0O-S M@PR z`40SM x `vP@ ЍYP pP 00 0Sq 200PX 0S. @0R*  P# [` P 0 IP 0S $P' X H` ЍO=P 0  03/P  40R 1#PP 0 0U/L 00C 0P |`9@zd `0` 0U/L H0H 0]/ڠI0D Vfhph Vih Vlig@-`@Ꮯ0,S<SS  0 0 ఠ Uhg@PG-V `p0VSV@P8 404 S `  S` E000!,0 000,00$ 00, ,0P ?o 2@ \0S0S P`P :  404 SS`  `D !@0@ 0c/F, 7(0( 0c/=x Tge SgetG-PS @- Y`' T 1p 0R  D B 004 00R% TP 1 0S 0 Gad 1`0` 0i/0,S, (0( 0F/H Rfdh Rdd$G-`P& 0 0R! 54P 4 R @,0Q p  ,04 P@Tp:80#   0P 4  Q@-P80080/Xp@-P@80080p@p@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P00S@#:p@p@-P@@pA-PP 0 0R4p`40S @40S ,0@ PW `A-@P 0`0VpP0S P @T @ <0< 0]/ @@hH O8b`A-`P /o0P0"Q@@T @0R pM ^@P @T B@ 0 0]/Ӟߌ NPa_0P \@- ^ 400\@/ 0 0F/ഞ M__P0P @-ox@ T\ @\400\@/ 0 0F/H M4_X^@-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0Rp@ S*,P$1 B!1400C40<00<0r p h ud0d 0s/DP vL0L 0s/;8 w404 0s/2ݬ L_] K_]l K_]H P/4?o 2 R0S/0@ S/00P D- ?o2 ^0S 0 SO /P/0 0@0R/۔P/0 0@0R/h P H0-0/o@0"^ R  R" /< 0S /A-`@PpP (0Sp 0P  pA`d `SHO-0S@9 0@S7  ` P. X8qPp@i P c P ] P HPX0UUUB#1 !0@<  ?,BH PO 0s 0 XX% X@0Pp#r 1Ѝ̜0"S4@0@PpNΈ >QQ/P/< ?o 2\0S /0SP/͘p@-4@4P@PL 00GpL0S   0@-@<< T (@@,@@ @l@-@P (0 0RpP/0 0R/4P/0 0R/ 0P D- ?o2 ^0S 0 S%/0S /(0p@-S@ `P0` P 0P llh@x @ @@pDDD@k @00 ,0࡙ <~|~HNNA-PP P`p @@PP@@@P p<``` 0,p0P4080<0ʀ@-@ @  @-R 0P< P 4Q ,  <0Q8 80 F(0V$ $0 >M :MN :MPG-9 pP0`W:W@ 404 S P S0 2000P,0 10,0$ 10P : g e 404 S P ] PSPL H0H 0( ( $0$ 0( ޘ 9tJHL 9DLLTp@-M@#S+RP, R7S 1CaV( P` 0 0&P 400C40`ЍpR Sw sЍpd k`0` 0< L |H0H 0< 4 l000 0<  8@KKP 8HK, 7KKA-@`,p{PP W 0 !ϙ,P0`7,P0`00p@-P4Q8 @Q k4 ,040<0Q0<0pPp o0 0P @ 6JHI@- MpW2 0P`@S#   PL00 Ѝ 0 P ,0S x @0 @{P  Ѝ0]S$ R 0  0` D 5IHp@-@P 0`0VPP p l0 0 0@S<0  0pPp( w$0$ 0 ͗L4 5GH0G-S@PK Tp 40SF   P@ P P 00 0S>xP7 0 03/P0  40R 1#{P' `P 00C 0[P  @ꀐ pG \ X0X 0 a8 404 0 U\l"H< 3P@F` 3 CF040S 0C40/ 0 0 @-; 2FE0p@-S \  Q @PPp i0 0 L 28EEHp@-@P 0`0VPk0S R<0  0p@^D @0@ 0 , w(0( 0  1DhD 1xDDDSG- p*W`@ V 0P 0R `00 (\` "V 0S  Gw@ <0< 0F/ଖf0,S 0|DCA-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p@-P80080p@-@P 80 0R@ pP0@p(p@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P00S@#:p@p@-P@*@pp@-P@y80080p@rp@-P@m8@j@@pp@-@P 0 0R`PZ40S ,0AT Qp@p@ a0 0O/ -L=8@\A-@P 0P 0R Pp`-8040S ,0X ,0QP<00<0PFPD @0@ 0S/ࣕ, (0( 0S/ ,X@?h ,4@?Dp@-@P H0 0R@ p`P@pA-@P1 0R`P4P%80,0!qW&  P  1P ,0P < 0@400<0AkAD @0@ 0W/=, (0( 0W/4\ *? = *:=0P D- ?o2 ^0S 0 Sf/(0S /p@-`P@qP (0S p p@ t > X0 //@-7SP0p 0 = *=O-IMP ; @T `p0 R 2/0"S\ P Y  9/0  p_PV @T!1 0 ૔003/Y@ 9/T RT T @T@" 000Q 1/0R' P70S+ 03/P. Y 9/R@T 0 0( i 0 0 `Iߍ 0 0( U 0 0( LY 9/Z 0 03/X T0T 0( 9 )=(< (< ; (<; (;; (l;;x ( ;|;,P0/O-MM(p@ ~T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT0 00=P $ 0R000 Mߍ0 #,0, 0H ໓ R00 &(994 0/0/@-@@A-PPMp`2 0S/ z@0U  UU 0 B/P 0CU/PU  U0 0 B/Q 0C#@ T@! Δ;@04D .<0F 0 R* 0 0Gcp@  V 0P/@h뢕Pۍ蝕?00@ۍS0p `Vp -p 0P@8< p@-R 0@S PR :   PpB0P  ,0 `09\ \0 L0:H H0 80;4 40 p6 #66 #d66 #D6p@-@Q PPpQp0@-S MP@PA` Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPUt p0 "QQ Px, (0( 0 )58444h H+3 0S p@-P@ @Pp 0Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ #0 0@ ෑ )10p@-S+@PPU Q PpQp<|Pp/uP PQ mP Q>p@d Q0 0` { (00p@-SG@`PU Q Q EP<@Pp PU Q 4P QPU Q 'P QpPQ P Q/P >p@  c0 0| # 0'/pA-PP4 0Q`pp XpW*S@P&  OP V<`p p0 8/PP`<``Q# PP P 0S $P P PP@ < P P 0 d .p@-P@PP  P0@m@p {z011/@-\M@p`P \1S! 0 € ( P 1ЍP (00p` P10 m @80A4 40 g$0B 0 _-( p-@-T P- @-@^ P ^%QRS  T00QNRS"  TŒ 00 Z0 0  X,, G-@R(MP00Q P 0 ` p Pl `®0T?o20S00(Ѝp`0 ,( 0-2/    S-0 2/     S0 0000000 0 00Q0/0 0000000 0 00P0/p@-@P(MP`/ 0S, R00l$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  tV P0V00(Ѝp@ R 0S V00*Q0000 00/@-@6p00T000'@-@T @-@T000 000S/@-T(t000 000S/@-Dt000 000S/@-4t000 000S/@-$ht000 000S/@-(t000 000S/@-t000 000S/@-t000 000S/@-ht000 000S/@-Ԑ(t000 000S/@-Đt @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^ \#lllT0 02#/l0 00#/k0 02#/k0S@-@1/00/T0T0p@-@ P`0S PpzpN8t/e000 000S-/@-<-t@-g000 000S/@-)|tAo//p0@-@ MP  vHP& Ѝ00; 0 # T#p@-@M  wDP pЍ$0; 0 # #p0@-P M@ T T T  0 Ѝ0 H@ Ѝ00: 0 " T#0p@-@ ^B @08 0 ઍ" "p@-@PP (P$Pp07 0 , "p@-@PP (Pp07 0 ,\ "p@-@PP $Pp07 0 p, H"@-@P  <Y.+ < 00; 0 R+ "8@-@P ( 07 0 A(+T "@-@P $ 07 0 /$+ p!R/-~x` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@ᢍ P//-~x` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@P8U5U5E03#0@3#C#!@11@  /  Бf0p@-PQ@ : Sv P Sd0 V Sb0?0 !-0r-w0-0 R0[ 7RJ @Rx00 0r -  w -   R< R7 Rx 0  r-w- R. R( R0 R  x:0pRs  ! Rs0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- A0a0-009 0 ໋u\ TO-P4A@:  ሇpPA PA  ߇pP% 00犇` 0@T' ṈP0=S AP` AT BX ! _니fD0>@ @0 o ꕍ00( HC-PM\\"@X2T 0D$PT@g X`P @刐@@@@Tpk pp Mp` $Pn o   p[ X0p 0S8@<@@@@0R040040K,4,,0l, L1L 000D000$;,X  #,0S op@   o ЍoЍ @0 0   ܌   LO-PMp 0GW"S00` 0t@ᇅP-TPe +T@`0> ǯ0  0  P  @00Ds \a0DSW0DA0DS"70DWUY:P Q S \ P"000T9 W. 0p 0U00S 0qS 0F0 Ѝ0S U @0` 0d 0R00  Ѝp p㙉 㙙 㙉A㙙I XR 0AA B PR W `@@0?< <0 PWppn 0M0 00Ѝ52O-PMp 0GW"S00` 0t@ẄP-TPe +T@`0> ǯ0 D 0< P  @00Ds \a0DSW0DA0DS"70DWUY:P Q S \ ŋP"000T9 W. 0p 0U00S 0qS 0F0 Ѝ0S U @0` 0ꗋ 0R00  Ѝp p㙉 㙙 㙉A㙙I XR 0AA B PR W `@@0?< <0 <PWppn 0M0 00Ѝ5l2O-M`P؃@D@ [Hp0V:V^ U0DPW pT"S 00 @00`Ѝ0+00(0 0L0{@0S 00000S0S Q .:[ 0:0SV00ЍW00 Q0!:[00:S0S @ d0K` `0 ่VH0MD D0 ை"00@ "00  -M000 0 0 000 0 mЍ(hO-pP$MS@PHL T P0S X0S 30 000@ 000@0 0;`Pᎊ0"SA Q, 0b CR!o)pp y4$;R`P ` 0*S# xS! S: "0 @J`P$Ѝ5%%;R`H"00E" 4"0 1X0 00T0 0P000tP00S6#0Q``PU 0OZ0WP 00$Ѝx!0 ?/%1R`:*%6R`$0S`` P 00 0 S`0 0 งT50 0 இP0S-0 0 ࣇ$ 0PT  `Pl` 0PT  `Pa8 @  H P   0   \ L@-M@" | d@ 0S D <0 0 |0 30Ѝ @2P-M( , Ѝ mD90 0#0/400/4`G-@SP+ pE`J2Q" 2Q JNXP0 S 0C0P Y 00 0    $O-Q4MIp0@: RO Se 9 0 09 P0S009`0S ) )匩匙  @t PS0+0CO TI @p  q 0 00C 0B0000 S00QE 00X0-SQY஁P0-S0` 1 04Ѝh8hH0d@q 0p<8 0  `4ЍH@q ( 0/ 0 B0C0@ܧ:Q`  0+ B Rx0P WV :R 0S000d7@0| | -Q0870,7 0(, ' 0S `=x P  0B 00Z p` @ @$PpP @T  !0S2P x   Q Q  0@RTZ pBx 0 bZR 500S 0:S  0S|5 00+ C\ :S] T_PePU `P0 ᧅW 0S 0㝅UeP4P`0 ᑅ0S $4 0$a4  0{;R10S00DS0x4000400S 0:S P40HN4W 0 0+ C0:S1:` 0S0  :R 00S!  #0 00S000P300S 0:S |0 30?`0JSR8 0 0 `S``X0S4Ѝ pB5 巀 200S 0:S  p`2 0 D200S 0:S xZ(0 1S0,000100S 0:S 00C(00!S( 00 00+ Ca1 0ൄ0S-QaaP1`0 ᨄ1 0㢄Wh1h!0 000S 0:S <Hz000+ C* 010L0 a0u|,(222A 2 11@1T1400p0H08?@ $@  x <L P$44p p+P2 D0  pp #PP!@T Cn`4 P8T P{P @T@0S  N p0 0 <8 30!ݍ\00=LD @0@ 0 `~)p08| n.. $hpO-@$FM`4 M Q0琴t0d40㘤 T V [ ZX (d 0H00;PP0S 0H UPW 0 LP(00dP $PyPt$Wk ,Pk(,dP $W , b X#P3 0 d4 30Fލ Ѝ, 0 P30 {P{Ph / P@ @W  C0Yj Yt "0  6t p 0TT P$$  "y2 0}TB!z1 0x}V9!{1 0m}[0!_1 0b}&0$0S〡 / ᭂp! 0 P  ;6H1D!0  @ /6 1!0  @ #6  @ s l( d8ml`( 4 @  аT Є8 X ,x$  X< 84 (  @-P@!`P<1M @0000; p }T T* /00@ 0 0 0 30/ЍU0000 @@P00P0ݡ0~Pc~PU00P0 ,0, 0( |'hXh \ @-@P  @ ~0 0< | ̤$O-MMP㴲!"  2,$00|404(0 ,0S 0S 0S $0Sy @@`P4@0Pr   p- P8p2x`00380 O@P!  PZ~00S! V~0=S0`S"`V`X`V `ሀ#fPC~0#S 4_PU0 800C80,~0 @x000004nP~ @;P x 4 \P 0 d P$ Zi<$ TiffDTa$ P ( Ŭp ń TX ĸ$<(0S800C80  0<0PPp`V8p 0 ;w 4w0X0P@5P5XP}0 0Pھ5 40xC  0PU(0Py0Se Sc Pw  Pw $Pv  P< R10"2 0 |4 30ݍЍ0@V}3\ 0hW 0 @ <(080<0 S  P 8pW (00 }0 <    `hP؟ Pԟ P`l#p3p H 0z{#3 0H z 0Sl#3 H 0zb#3 0H z,0SP#3 H 0zF|0S V,P,0D8pX~d%C-`"p2TM @PpP0t0L00? VH WQ XZ u0!,P   x0 00  PLQ PQ,P[PgP0 @ !0 0 L0 306TЍ 0 P 02zV 0 P 0'zW 0 P 0zX |0| P 0zPӋ@ Ph%^x] l޸ @ތ ` ޼4-M_ЍO-``"p\2\M @P‐0焰删0T00U V^ Wg Yp 4P"x0   0    ?Pc0Q Q,P\P6gPEP 0S 0 !@lH!01 0 T0 30C\Ѝt0  0@ i0 \ 0yyV j0 \ 0nyW k0 \ 0cyY l0 \ 0XyP@ \<$\H,[ ހ , \ۨ 0| P-MEЍO-M $4 0 02000qX [ 0S Go0 0-0P lkPe 1 S S   #@ # S]  0s000 S SP S0 R R R R @ B RQS 0S1 @+S7 -S[QUp @Un0S 0S 0  00_op`R0+S4 -SF uPPUpwV WPR4 Pp S 0QUp @U40S\ QO 0 u000+S_opR0S @S0 bPP '_opR0S @S!0 NPP`  _op`RU; ! 1 0 2 30:ߍmuPPpPp p~ S!@FP L d 0 d 0xt p0p d 0x[T 1P0P d 0xd#YPY<$U T ؜, ؀O-P#@3M MpP`0080r T{ X 2U 0&N M.0A 0;XPY 0SV P +Mel+e~ 0  0  0$PP @PP3H0: ST 10!P 6 {4  !1 0 8 30_ލЍP 0 @PPP * Z4T100SP<104!010 t 0gwT!1 t 0\wXz 0 t 0Qwp/4 ᦀ]P \0S  S 0000H0000  @P"Tp0d S߼(h @Ӏӌ ` մ4՘A-@P0M`p- V6 W?  0    P @T@T 0 pPP 廈0Ѝ @ᵈP0Ѝ| x0x 0vV\ ]X0X 0vW< ^808 0v ԔL Ӱ t@-@ M 00  @0 (0 0 0 30 Ѝ!OO,@-@| M 00  @J0 (0 0 0 30 Ѝ!NNO- PP`w p B?w@0   00Bq PpaBQWpBABQ7pB R0 S1 0A0CS: 0 $S'""  0DSRQ0 / S ,*@D0 TT@0 T: 000 0 vD[00T0S  [?0*00}| |0 u00D\0CX X0 u }@0`< <0 u @l`    дO- l1@0`@? ` R<T !4*4.0q0 ,p( ??p?0 SP#20Q *00\*0V0 R* Q *0V000?0R*00t?RPp1?p# v R ? Q*:  T: D T8@-PL@ MH0`@p 400 0@ ЍJ4h@-@PM  0 0 T0 H  @TЍ$03 0 )u\d Ό@-@P(M" $0 0 0 0 0 ;P d0,(0 $$  (Ѝ( B$0$ 0 tx `ʹp@-`P0M@P& T/ U8 ,0 0(0 (0 $000P;P00 <8(4, $0 00Ѝp 0 0 tTt p0p 0 tUT P0P 0 tv 0 ,  p̘ l0"02 O-P0TM`0L00v Vj 80  00 0 0 ! PPO @p 0 p`@P< 0+S+0S(( P,0(0 $0 003P0 $T,$,0S1 0 0 L0 30*TЍ0  9P SP0Fv00h Yd0d 0D tL XH0H 0D t~dF \ E  ``!1 O-IM0p010oWW -PPN x@` r0 `@P; 0+S+0S(P  0   P   N0SI0 0 0 1 30Iߍ P pPs0u00< 808 0T sD,Ch d0/ l 0 p@-@P0MP000( U! @` 0  "" 0S0 0p d0 0 0 30Ѝp!WPP004, ,0 9sB $ALj nj!1 @-@P0FM Mp0d40. `t!PPd@!ᇏ+ P 8u@4u R@d \0 0 d4 30Fލ Ѝ0 N,0, 0 rKAt@ d|T@-P pP0dM `00\00 @' AUX P0 0 \0 30 dЍ0 h,0, 0( r@0? ň77@-M8@ 4@*`0 Ѝ8xP1Spp// 0 0@-PP0M@000& T  MP0 ^#2 0L00(0p d0 0 0 30Ѝ0)t@P00F, ,0 Vr> >p @PG-p!@1M ࠐ0 e040$UYP&0E T07pPUo0 ;u0+ @P   ^U0 U ~AtP=tTP 7t@3t@  rx p0 0 4 30܍ 0_jPpx`|PH=<- M0 Ѝ@-P pP0dM `00\00 @ 2X P0 0 \0 30 dЍ0 ,0, 0$ q<; 8 80 O-@Q0M0004 40S ;TT@@P  @0\49T:EXp  @Pb!  !-@ (  " LP \Pd<@@.H@``-a@$ @ M Db!d,! .h͌ dAl"+ P% (  lp $ p' `&n*! ,   " t` )x@.-@ p'ap p(|@$ pp p @ p%PMPb!,P!PP%p͌pdAP)" + * (( ]lሀ $ eQPP+`&_p'`&*!毠) `'8``p` ` ,` . " ``+@&`-`&O `&)o韠``& `&, .o$`*. ao )` ` )(. *+꟠0()럠0 ( * +ꯠ ((뿠 菠8 + p',ꯠ p' p' `& pp ⍈pb!p' 0p͌`& `&`` P%pP%p!P%php'P" PP%`P$pm @$@$l@$0O@ @(0@ %@$(@. ".@ fa "P/  ,. P " ;>F`@& ,-@$ (a ,,0@ 쏠@$ @)b!,`P! @$P%@$͌n䟠@@ @ P&` P $`PM,"+ Pl]!( `.!+ `&dA+$ `, `&  $`eQ &`- +.,`뿠.`$`&` ( (` &`%,`&,b!Ϡ$@ `͌*`*@ `@$P `P@n]@$ `@$ *@$`" `&lO8@@ꯠ@@@`M $`  ``( .   ` eQ- ,` `, `&dA0` &8`..ba%.   (,- ,,$.`ϠP ͌% P.0P._PP&P%$P@p'p'b!p'@P @ P%@`@PlM P% P%P% `"`&n_PPP8P,`](`(`( ()),, dA`  .0 " !0 " "m "eQ !⏠ $ !  "0fa0,`=, /H @$+ + @c1) $@ 韠. +.뿠O @ $PaA8`%,P!!PP`P (P * *nQ *00 0&`͌ꯠ0#(`0#? 00a00@0&@ .=.lAo$`0` &` Ϡ(c1 P &,` P͌  PPnPP`P`%$P !!m lPP@Pf, @],(@,@Ϡ` `0 p'0`͌p'0p'`0eQ0@@@M 0&la  0#0pp0#pp p }  dA 0 ,͌?)$))gppP (P(p ]((,p pplp` p `&p `&eq`& Po``PP@P`++@`+ ]@ @@ +nMo ( ( eP菠P  P 佋P,$ p*0 p' P% p' P%  0! b*LdA0 00,0<0`) `&͌080 0k_00(0 `=&`. `.$o` `$ `&l` `&(`&`& P+P%$o0``@c1@PM`)P `&`&p Po``, `,n `'p͌p0#0#dA. .0 p=lP @$@$c1 @,M,n0#0#͌0dA.= .`&l,p @$@$c1 @ p,M,n$p0#͌0#dAP.0 .=l @$`&8@$c1 o@0,M,n0#0#͌0 dA= . .l` @$4 @$D @@-`Hc1LP 0#0# `0m  `0 0 30ЍT0P P0 l40S\400 00 lSK(  @-@P 0+ EF/N Iv 2A!#L0 0 0 0 l ,8A-PPp`7 W+ 100.!؁0% "0 0%0?S@@h m0hS@H"p ` # *0V@@p`F AmH D0D 0 l, (0( 0 yl ,8 `!1 @-PP0M@0 00B TK ` R0 0R1130 0~? S pp4p 0~? S |U PE "0 0R1<30 |0 0 0 30Ѝd `0` 0( lTD @0@ 0( lo&| 4%l  \h 0 0@-PP0M@000& T MP0 ^#2 0L00(0p d0 0 0 30Ѝ0)@P00F, ,0 k'$ $4 lG-p!M@1M ࠐ0 (e050,UGP&0F T08APUo0 ;u0+ -@P   IU0 U mP7mTP m@-m@  q x0 0 5 30܍Ѝ 0cPPmpp`|P#"- M0 Ѝ@-P pP0lM `00d00 @# /X P0 0 d0 30 lЍ0 ,0, 0$ k~!!| X   13L @0+/ gE#ͫ2TvO-tM0 p03?0P+D0 Eh0@`p$000#!00`c<e $P```&P `@ek4L(p  8h p!, Pp'P0 pap=Ffk TDp  , e[dK|l`  j, 4ˆn! ᘈP  !`k  < g{!4 l[L(  , 舊ilL8 ,` h a LlɆ`H`  !h` ` 0`adK`` ` PPlˠP%PT`p ` p`HY`&k`p ) a{fii\ )` die[ P @ @fk@$@\ (aˠ Ih`  (i D荎p`  *` \8pp .*X a{ndK   "ꭌ %hie+!4P, /HP P0P P,@nɄ@dP* Pa0 0) P%fkj錈T@l@ P eZ\0! M0,0p (6m:Glɇ % ! h e[PPPPPXHp$Pp!P`,l[ !0dKmn{ @ . aP ,  . l̈`4&fk   ,la芄 !  <@`lɇ @(\ @h  @$@p@. pp!l[p,ldIapp'n p `k g},d 0$  , dK ! a,<j D' !lɎ `L g{(`a* j荆 a[ !, 8 !l@ lˠ @@d`` @.`@`@$hpa@n`(pK p ` `& ``{)Thfl D !  )L` $ *i PHa &dK * 8]fk ͈ X `  *h@00 p)p` p'ip % e[ "gz `0b,@N=S9J.@n!l @ @a@$(l0 @䫆`"X@,b+g{ ͅP@@@!D` H` `` aD$ j! T ``PP,P%`& PL`4lˠ[dKj p  p'` a{ b* n%$!  P 8e[` @" @$ @ fkLdI$b8 !,a ,   "n H)lͅpPPP%h P` eZ`$ `&`d{@@@$b+ @$flM, .,lˠd 0d $,e[! <a\0 &<0fk 000#` 0 dKa{9 . "n -T, (!lɅP$\`k  c,:" b+ @  ` lˠ. np p p, " "ac;͈  00*P 0#0 zn c- p tЍG-`p 1Q0@@e T0 U?W@@P@@P"W*TP(@T(pG  GFf  PeAf  W*0@-@M P0 1 3/1 @ cR c B  T 0E P,̠,ĠD 80 0 0 30` Ѝ0@e1 pP0Q- 00 R. Bx@-d @@4  R  *4 8/ x0 S\ R `0S Р@- d@ 4 *8/0뾖BxM Ѝ/;R! /Q/--M  Ѝ Ѝ/0  0c <cA-@PM`  `Pp0 pp pY Z ,0pp  pM P ,0pp  pA F ,0pp  p& P 20p  B@RQ 1 ! \' +0̠ p`Ѝ&f0 S sD0<@ @0 c  lxx@-PR0 00//@-MP `@ pdpPU0D>S 0!3100 0odЍ>SH 0!3100yd00ud00/-p@-MId@P@U0 ` ` SPx0x 08 R;0Ѝp@Ѝ/0 a0,( $ 5ȐpbA-@PpP`V =UB 8X ERR14/.-,+*)('&%$#" VP&2!0` `0p00+Xp -X& =X00+0E0VPpppV-0`0p=+00+000@00(0]$ $0 a00 cxp@-PP@^  0RuSpWSPX0CSE4 *pP0R Q PSPQPQ  0   I0 0+S -Sp0 b0 0 4a a4 O-LM0xSp _8@(`  GE 0 0@c @ j 9c@T8 P00p00003 0 a0GS\ RI$00+W@ 0-SQ0=W00 0`@ X B R j b\S  "=W  R"   P:0@$Pb  b R $ " 0务@P   s Y# @ T:$Pb@ p b0S$0" @务@DP@ @T 0XX 0 0 0pW ,Wsp`TS `! Z0`$Ptb $ mb R$ "0 `务`FP` `   !` =W +0GY?o20S# Z$PKb `$t Cb0S$0"" ` Ⴁ`FP` `V 0X`0 00X00F `Z$P'b `P b0Sj$0"" ` Ⴁ`FP` ` 0T 000  HR;I?I00 HRl0p@-0P`@T @T0rS Ppp@P0+Spp@A-P@`r\ 00p<0p0 ` @ 00p@- M0P0100_ 0SS c0P 0B |1 00SZrp@& P Z0 01 00S0 0 Ѝ |0 0 @l5_@Z0 00S  Jca_@ Ѝ|WpSd0` `0 ]L0H H0 ]tddddP@s Sprl SLr@- MP !I 0SP 0P01 P1 00S.p P 0:1 00S&0 Ѝmt_0 00S@f_@ Ѝth\ X0X  0"]@ <0<  0]t|l Qkq Qxqp@-PP\A M@G P1p0S'@1@T0 `0`S@# 0SV00) 0S"P_0S/ Ap u Ѝ0@T0S ~^00hv\0 0 L H0H 0 \Kt  OoohG-`PHMP6 p00 0fp@ p@ HЍ YP 0 Op p@ HЍ^0S @XH0>D D0 b\@0P R@n` NnhO-P4MP@\p WxX0S: `00 S 6 000 0?!S5 0 0 0;!WpW0l Yj X00U7:GS> G1@000`"  0 P(0@`0s45`0$0XW 0S@0`kW A,0 qW`W00V0S ,P@(05#K 0T`X2@ 0 $ $Q T  S #.E!b)L@T(\/H0#"A $1?"!!#:  `V4Ѝ3 00 0;!j3 0 0?!ct30$0H\/Ld0L``00|2pST0, P `@!`VQ 0V ^ ,P@x ^[$:6S T00U$0%%>!E!2c(\/H)L0TP%"1 #1O"QX0 "0 0 0$00?S%D PP@J`S8 5HT1>O00` 0 0T &.60S 0 0P@0(0\10X00`d(0@t0P`d(0 V  R3@<  R00 ှPZpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #Sy R BqQ #R I BqQ #S H BqQ #S G BqQ #S7 L BqQ #SR M BqQ #SH N BqQ #S> O BqQ #S7 D BqQ #S E BqQ #S F BqQ #S 0S:U 00S! R B  gP 0 `000  00 G  TS0-Z +0S iQ 00paQpX 0 Y[ XQ00ݽ@RQ@0    @{  `# 00 D ソ,#   3000s00"   2000s0000p@@}p0,4 (@(s L Pk0Sk[+ O Xl$2_ " 0 NHP00_ Pc  "]d 0(@ 00: L0`00v0`0 0SCo \ H x0020 P0SY00/[ m0S0 M  ۼ`00C0>  ̼ [M DkAx:$:L|9 990488d8$- M0ˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpF1pP P Ѝp\G-pP`= A@0S&A@Q0)쀟\@@\ }  P sp0 R * ap0 Yp0 ,0<( (0 M5 5p@-p`pP`PV@T T0T0 R@@JpP00?Np~~xNHA-`Pp@P@10S |@@'I R"@`#@NƼP00O0@M~}M@-阼 00 }PC-`4MPdH@P 0S|0V ! XUpЍ  [0P;  =R6 0Q*G B&R&>$#"M = -ݟٟRpY WꘀqꈀvKSБpໟ0X{FH ௟ 04H[4h||33$2ZLU|52282lp@-P@\ Pp0SpO-BMM3#003 S0 0P3 0040   +0 ePl 40 4:P# ` @FP 0#S 0000P Y20 $Eb@`P 0#S 00P 0xS0xS0S 20 0sS'0wS$0S!10qap`0nP qgP q!x1 0 4 30QBލЍt10000MP p00EP p 0`Fp+  100n9` 1@P GP`[[ IP000xS0xS0S; t00P_ dHPZ/2,zz y11 yX x/pGwpw<p@-d@@0S P Hp@P@P 4P ׻pvv-/ p@-@P$ P0P 4P PPHP Pph`h`PLૻp4 000 0 RKv$v-4/<\ '-p@-@P$ P0P 4P PPmHP Pph`h`wPLqp4 000 0 Ku<u ,L.Tt &,p@-0\PP 4P p<`<`JP@Cpt\+-@-@@P00sO-@P,Mvp0Z 0SN 0SN l6P 0` 0U 0E   0600{0?SO Sm *S00 *Q @S50*QMU 00  q*QA[SU \S0  0 @ PQ8 ,Ѝ?[ [2 *[  @[[2 \[0S @@0S /Sy .Syw 0X r 0X/So.Z^ Q  /Q <P } /P P,ЍQ /QU 400 000  ^[![00 $0 00 @ p p /S \S? S -RG S0 U@ ᱠ0s0]S^$0p Sv tm * 0Xl  0X/Sfd @^2U/00 0 /XU0@  0s0U ᾠq]QQ \Q  @S QU@  qQ! @@ #0^ @! q p[Q @H1|D!D0 I01{,!,0 yI 0 @0`p pC0U0   峠zZ  0 mP/ZY  /;Q /QV 000 08$& |%# X%@0HP@-@ P RK 0 Q 4Q?o2c$$p@-@lP=FP X7FP T00pT 00p K 0 p$D$4O-Mp!0@  "  Op` P nl10230Y ߍPT 0 0pI  P: [ ;` 0 0P P) @@ 0  p@ 0 P0P S P I">0  "C0 p@J -RTO-Mp!0@  "  Ƿp` P 10230Y ߍTPT 0 ᨷpI  HP: [ ;` 0 0P -P) @@ 0  ᒷp@ 0 wP0P S P 2I">0  "C0 rp@ J -RL@O-Mp!0@  "  ?p` P db10230Y ߍPT 0  pI  P: [ ;` 0 0P P) @@ 0  p@ 0 P0P S P H">0  "C0 p@I -R,p@-`H@P@ ePpPpPhP p@-`H@P@ PpPpPQP p@-`H@P@ APpPpP:P $0 00 µ-H- M0 S0 0 0 0 00 00\100 M\  0S08 00 0 0 30KH Ѝ/>\-H- M0 S0 0 0 0 00 00\100 M\  0S0 W8 00 0 0 30KH Ѝ/t -- M0 0>+--M  --M  A-PPp`p Q @Q {PD@L0 0000AWk$0 0 bF 0P R   0//1\X'X7 O-@P0LM0D00 4 tP7f/0GA  00 0S* R 0 :R|RF  @ 0 P 0 x P P\7CPuX00X04: `P & X00X0$` 7E @p$0<(0, p$000$p5$ 0,  p5$ 04 E @P)l 1`50 OL p$00% ,00  E  @U80 P0p<@`(p8408@$40<4 0p4 0px4x 0pT4T 0p040 0p$P 4  0p$T3 0p$ 303p$ * 333 3@a@0`00400,400,̠0 Ġ 04!!8..<""@ ' R 8 @0Ps@qT?  A@=@9@5@1@Ip㔐 (   @p$   9p㜐 $ R , .p ,qAp "p㠐  P > _10@Q0 P0` B\P"#$#< 00 1@@t@p$005T0AW5V2H@00;p!0 0 D0 30LЍ 810p"  APX00X0!h0 0 yD31 e8ed8hPd$chcc|{c@HcbވbbbxbL|b Ta,aaap|xtpy_T^8^ x 8p@-@P> 0S0 ?0@0T9  T04 0R/Q T: T% 0 \/RT0C"/QT 0C: B0PU0P!Th00pX@@PP +E04@@0/S$@@@@^(^@]ԄA-MP@?L0PB @!0C`0 0 0   ! 0b0C S/:-,+*/('&/$+p`E0 0ፖ0S@ 0S 0SE0"S D8#Ѝ T1r0:E00Ѝqv{pH$ 5@-@P6 0S/ 2?@T3 0T/  0C/Q T% !@# *0P@/S  B3@T@!0 0D  T B3@T@!@@4@0/S @_xtd-DM0  000up 804S DЍp@-`P*p' P@ @Qp V U phUX ੱp` ᅲႲVᯱ@dP?o?o 0@-@c^?c(0C^! ^ P@`c5$pC&5'&`c 15D0c@00Q!  "0Q;:0 /0 @- / 0%D00D0;B 00@ 0/ E0 0%D00D1;B q1@ p0P/E0/! 0QPoo A-@@aT?a(AT# T `Ppa6ŠAnj6Ȍ&pa 376U8a P0100S 00#!Q00;:00 /0 @- /  0#D0  0;B 0/ AC0  +0#D0 Q1;B p0P/AC0 J!@ @-q@ J@ @-q J@ @-q J@ @-qPP `⧰@-+D00p@-@PP  p@蒰01 0 A P ?0/R//R/?0S/R/P/R/p@-MPP`V @T x00BЍp :   S*p@`$ ñ] \ 400 R [⊱\h,@-C00 0S@\,51Ed 2 Cr0b0aR0cR0A1R 00$I"I B``C/)P( L%@  @ "bQ0"G-@0D \ͬ ̬LP `L,@0L0D QW ^ࠓࠃ Yࠓ^ S\!:O-p(BPPX `< @:PPY  @A-`8 41Mp,0P00S9 @200S ^@#@3@,,C000RP0  x0 0 2 30ߍ@P PP Pu(P0$0)yxxPO-PC 0C,0P(  E Ϡl b0,0 W0 00 000ZW 0  L0 S0pP( 0 0 0GWp0 09P(0P(PW%Sa7 , l,(,0 Wv>C 0C0P(P 00 0!0W0G|6  00P(,0 ,0$I"I/A!b!b0C 0P( ) 0 Br0 S>P(P&Wp , 50 P(W 0 0 0W  =0 P( WhWp 0 ;0P 0 p0 S 00W((Pg0 0P(\c0 , 0SP( 0%!E0?d"c,02#,0 0/ 0 0 000 0, , } ,00C0P(G 00 000 n1, , g W,00C0P( 00 0a, c0 VP(Y(P000nW{ 0d 0 0-0 0>P(/ j  RR 0s$ @p 0 @00v 0`` K0`b 0$I"I/A!b !b C0 0 B H P=US ZSP @  P,20(00 0$0 R0P  R0F P,X %!E!/0#bbK/) P L@"(@bQ: 7 0@bS0#03 \!  !1  B00,0DSd0,0&4 00(00N~0 S(0| ̜ |L̜@@ `WooO`F_O  OG @DV@ 4 00N~ Q@ `(0P 0(P0 0}w ޴ ޔ L \ 8VH(PP @ ACLCq| \^JS S  00S3P0Sp z H/o("PzXbpTQ(P9 ppp@,CP(#?0 B ,##Pp> (' P%!E"ad2c;S,0<2#7MP P(P @ @C>0P( $(0  @ 0 @O0@0S 00@0S 0@| r,0p0 0 0P , P(01(000C.$0\,20a\Mc^ @P$` @P$`i   0P , P(0q0(000C.$00 00# p  0P. , P # (0(00c$00M0 00Ѝc1A-0Q M@HPP PM Q%d1 P01$T G@@ Pp ʵ. R! v` PU  Ѝ0 P0  PgfF ` La `U=T 0 ЍX  0 01=00D L C<@-0M@ /0P 00Ѝ@-0M@>0P t00Ѝ@-P@hBp@-PT!pP10M `@00,00@ U5    P00Q Q Q *= 0 0 0 ,0 30%0Ѝp ,H ,H ,HP0;L L0 :80:4 40 :-a4`  p@-@PP U 0DPp P @pD07@ @0 :U(08$ $0 :4 L8< $G-pP`' X/ Y @;6VP0PES  R D PE'#0V R  SS0@0D@ D0H@ @0 d:X(0I$ $0 Z:X <`d 8R@- 0BAs @ Q0C@R ";@O-PP┡ Mp U WC 6@PI ,7PI  ^6p`M 50101S Y"7 Ѝ0(60P@6P- 0 0P 50 0 ";=00 ;l0Dh h0 95 <0080C4 40 96] L X@-RQM @PЍTT ;@㾸Ѝ; 00G-`-p!p1@ MP0M050G ?PR @pJ @\C^ X0p00 t'0 Oc00 TV8qύ@0ˠ (, @P - P |0 0 5 30ݍЍX0DT T0 L9u;00@p;00[X[@Z< h00- $  M  Ѝ{Y--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-@PℒMp ` X X00?u/,00P @ P 00 P ! !  GX\3?OPE -VP WR Vp[XPVppPW` A `f0`0`׶pPF P<881 0 08W`00!1 00%/ Ѝ:C0 P P00/ Ѝ0 8`ᙶpP V ᒶpP `<0?8 80 q8eX ¨8XҐ  @-@ M.(0S2 D,0 (0 pp1/`vqP0)  0 0 PUoR <0PUo. ЍP`TP 0S  0CPo.Q:00`P.@-P M.(0S: +0 "(0 pp1/`vq@0/  0 0 @ToR <0@Tos.1`V ЍP`T@ 0S  0C@o :T00V.:00O.p@-PPE 0eBS5 @Tp E2 Rp00P0 S P 0S PcP0G 00(C 00 ?0 S:,P 64P 28P .p@VL0MH H0 70Sp(0K$ $0 ~7  p@-P$@@#Wp@4@- @@W@3p@-,PP X@px3A-@PaM`c 1 P0p00S   0 XR@0@  SE `@<( \80C0`HS40 S0V^,*`N^(^& N0 Qs0\   "V ^ #R.S @` 0A a 0Cb@0@Ѝ "^ #R`$0F 0 6QT DX4  R  *4 8/14 0X\S 040:8 R РS /hBx@-Pp`8P@P@0@D尀 U   O<֌@-P`@80 %A-pP\`@P1 T&  q0 SSS7 S300v S(+~#f[*7'0 F67'0 =6t70000E00H00 00#R00 00P;R cPf`rdP Q1    R0 00 SdP \6 0100 R =R R 0 0060000  l 7 Br 000" r00BS0100C0h R R 00] 50000  M70Bs0 0 Ld0000  00Bs0<% 0W0Cs0 20:0?V` 000 100000+-V00! ^VU0000 J 00Bs0$ 0W0Cs0 0 00BSE0100C0\F;%o#00%0F?o2300&0F?o24 00=`Foob%d  00! 3010P$;R |30000 00C1 0FnSrXGFEDCBA@:gSKIC:-$ 0 B0 0L00I 0 0J00A 0 0B 0 0= 0 08 0 03 0 0. 0 0) 0 0$ 0 0\ 0 0 0 0cP`dPx?0 Br 00Bs00<00PK00N\ 4  8 4 $ O-PR M`pE VN @[ 0  0H\ #+SC  0 [ ;P1 XD00I600T 00 !0 0/ 47600 Ѝp }l0l /03VP L0L /03XH00 ,P H (0  00  OA-@ R`PPo /.#C=1"#BbQqU? 0S$ RV 10 R RQ 2/!1U 0000( 1/P p $@!!0081003/P !p0  $@V00 p00 R (㍱000P3/P! Up  R  SVp   0S=&P00U %%| %D$A-@ R`P Po / "H0#BbQqU? 0S$ RV 10 R RQ 2/!1U 0 000( 1/P p $@ 00810 03/P !p0  $@V00 p00 R (00 0P3/P! Up   R  SVp   0S㕱P 00U ##8#Hט"PG-@P P[.`P $rp^t F 00\c</.#C="#2caqV; Y p/PY` $00100S p \1003/P00H 0 $0(100S100S& p3/  000``0S 000S( 3/000(WP`0003/P 0| p 0000S=P00~00!8  0t0hG-@P P-`P $rp ^t F 00\c</ "H#2caqV; Y p!/PY` $00100S p `\1003/P00H 0 $0(100S100S& p3/  000``0S 000S( 3/000(㻯P`0003/P 0| p 000$0S_P 0$0~00$ߘPtSR: G-P0p`00S 3/0Y @IOP T0 0 0 0 Y @IOP TT0 0 H H0 0p`P   /<PSR; G-P0p`00S 3/00 Y @IP T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  / 0O-PPM M Q@ \ /\F  tP ,P;/\p @ @1 D\0 _ `P /RR.\'  B Rm/0 FP010E   PਠpU 0: S 9S0/\0Sy@/\` FQ .PQ[ 0t/SW00O Up# P&O #,  RB 1*/\ \p[ 0/ލ Ѝp` @ @.<0 @q2 [? 0 /    MP @U_200 @Z2>00 @U2?00 @P200 @K200G200A-@P Q P`\Pp@P P`V *20"S ᓯ"200@p@- PHaM`=  +4QP00 P; 00^% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P A<0 0  1 0 @4p\lTp@-@P`P3 V( 0Pp:P@ P0R P:U P0@Sp P P@Rp:UR:Rp@0< <0 ^/(0$ $0 U/X 0 | 00/Ռp@-@PP" U+ PE0R R:Q|Q00Q0S"P0@|R  :RRpT P0P 0 /U4 000 0 /p ( hO-M MP |( 0 pl800D40o 0Sx 0S t4!S S(XPP `P  pP 00S `D R"'  0 00 Pi 0\0P0s` P `@V 0 S( [T :SZ \S S S 0T:H@D៭P V@p+ $P P`0 S[1Z@#QQ -Pd6@0`0S0@VXD0A0 0p & 6 0 D4 30cݍ Ѝ:SZ @@DV  00 0S m00խ@ KpP; @~d5@00S0 H5p0(`040,$000= Pw 0:RL P0Rt4@<0 0 E0$ 0 3 30KߍDP0 P P0C S 4$0@D 0zSnNC~}a{zyxwu1lj|ea`^ [GW000P 0C0PG 0SH00E 00 0 0 0 00S 0  JZ 񏐺m:P0P 0P0C0S0000D SL*0= $0R $ (p0J p 0, 00A@Q bpzxs T0@p +ZFp80P @T0C0808  0S%P 0 p0080 80 0CP/ 0T@0 0 0S0G / #RR 0T000C0 p0 / #RR p0T000C0 SP P0004 0@D }1T@!@=$080 + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Z} 8 00C0Sr000@T80MS XRl    0$c0     & $  080   $ 0CP000&}   $   S|@ @pxl& ZʱZ|  }864&40 #Y6&0 # Py hP 80lP qP p0 T0C0  SP 00C0S@P0 S0  @ p p,0SP00S[z 00C0S000X0 Si p @ p,0ES[ kP 0@0C0SZ0 S0 M @0 pES p PS[ R,# 0@0C0S0 S000. @+ D  p@ B R W5 @5P 0 p@0C0SZ0000SW +D @AQ 00 R @ pNTI 0Tl@AQ_ 00 R p p@XQ[@AQ  R @ p0,0Kg0=0=$0Z  $:P8 00 0;0 0 0; 0H00DgIT  (p B@R  00[ @` P 00 Rn @ W?P#  R `#  R5 WW p B PR @  PO0 SL 0iT nT  (p B@R  00[K @ R񏐰D" AR> p@ B R 00R@! NR- p@ B R 00R @W (T @ B R 00 R@p )T @ B R 00 R K 0Z @Z(Z 0@0$0pT 0;0: 08$ / wn00 500S 80SX000 [ZP 0@0C0S~0 S0  @Z0S BP0[ 0aP0[ 0`(P$@p 0 0 0A ,P0W 0@Xp8p / #RRi  @T B   8 00. 80?03SS' 0@T0C00008000 0SP 8W pA00000P90 S6 0@8pQ*{P+0 S( 0@oP0 S 0$0 _T?o20S0 p@0C0S0 S00000C0S0000 S @, p PZ 0T  B 00 0?@0K  `0᳟p? P p ܟPZ 0@DpP 0S%0p 0`(P$@!  (p B@R r 00 Rg00 $8 ?m00 P [ 0@005 P]U تt@ 00 @P00P `, 4 ` V   v@P  PP0000@4TP0S 0 @;PG0SD 0@P<0 S9 0p@5|PA0 S= PP`8 6nP0 S. .J+bP0 S p0 p,@TP0 S PP` DP0 S 0@ 1W @ pt)T R" @t[$ S C8 Sp.P0 S 0 p@0,08 @-0P   (p B@R  00 R)(p` P-P0 S(p VP0 S 0 p p@ 0T@3p[\p 0P 0Pp00P[ 00`d?00 0@00 _ PS p?0 BC  ` 0 (p> P.[P@DB 0S+T ` [w yP'0 S$ 0 p@) p@D00iP0T0SpJ0000rp0STP Z ` 0@00W^[P@D`$0 0 00C [`A-@P`p?0 P@@-` MDP@p,8P0 P* ЍA-@Q(R`Pr v 200S5  0P1S010n C00v`0P! pW@0PA ნPPZ 0 0 0 C `C0000 Q  Q*RQ0 <008 @    B`0-P$00P0s0 LP ;0#B0T0`P P0 % B0 `De` Yp@-@P  Pp0@-P$L M`T 0S pW 0 7/@P  Ѝ8084 40 0p @ Ѝ$ X P0M 00 0Ѝ0A-P$LM`pT 0S $X  0 8/@P Ѝ< p808 0 0$@ Ѝ W,h0M0 00Ѝ,0A-P$LM`pT 0S (X  0 8/@P Ѝ< y808 0, q0(@ Ѝ VH0M0 00ЍH0A-P$LM`pT 0S 4X  0 8/@P Ѝ< 808 0D 804_@ Ѝ Ud@~0M0 00ЍdO-M@`Dp@PZ] U? 0ST$ZE 0SB [? 0 ;/0S) $\U 0S H[ 0 ;/@PЍ 0 0 0H@Ѝ0$\ [0 0 0h Jd0d 0h 0D }@0@ \ 0 S~}8 S~} Sx}| SH}X}`(@- @MvЍD0@-P$L M`T 0S 8pW 0 7/@P Ѝ< 808 0 u08p@ Ѝ RX}({0M 00 0ЍX001/@-Pp`\t@t0@p@ U  ᒿ@0  E$ liiX`0㫉O-$MpH0 } 0P 0400 0ʿq@P`00! B b06< @  BU^PE @ 04BL3@0S i MTRTVMTSQPONMLDCBA@?>=<;:987654310/-,+*)('&%$#!  h^0DS13b0 d d P 00Ds0S 0S0 S  \00T3p00 01@000@0@PUc*$Ѝ@\ M00 * P- R@ ^^? 0 p0  "P 0J ZS0 - 0J ZS)1 0000 $Ѝ 0S0 H100000\  s  p0\ 00Cs0S00 p0 0p0\  a  p0\  b  p0\  t  p0\  n  p0\  v  p|0\  f  pu0\  r  pn0\  @phD QA-@p`P ἙP=0D! D?o2]R0S d0T"@=0 !1 U U 0 P0 A A-P@p`XP .T T!0DI1(0D,TS0 Ae_T $0T"@%0 !1 HO-`'7WM @P(0無0T1070$010 ?o2V0S Z Y y P20P 0 rp*0P0 [0 0 190 P@ @(U1 p00PU`p! X U0 1 #'P00? PP P<68&80 PU`p 0pGGq WP1 P! L`ܗpPG @ 0S4 V L0 G0CSa1  5* 00  R1  X5' 0(0  R1 001 001 001 "001@\001001 d̔ Uc `倡PU^ 0 p9/P00PFD B @\$84 0 T1 30Wߍ0SIP/4 $ 0 \YP 13z#0 L3#0 s3#0 jZ3#0 `| 00喘(0S 0S,0  -Y 0P00CDp(0<@(0X(0- p`0480@ PN nn:0p@ 0>@@\@TL 8@,@ Tn*0 4L3>|8050 W (0$ 42,@0 D0R #<`[PPYM* < #000S00Dp P 0SR000~| z8 ڗPP2,0 Sd1`!`0 P L0 ϗp a(0S 0S PP@P4~p20,0]Dp00(0h 00P P0Pp 0ڸڔth It H HPPr Glqq G,qqX G q`q` Fq<qX FqPo` D|nl@- M@ (t@0@ 80 0P@ 0 30 Ѝx4@- M@,  (00X@ @ 80 0P@ 0 30 Ѝшp@-@QM`P0 0 `PЍp0@-@RMP0 0( PtЍ0-M0   dЍ-M $UЍ-M ($FЍ@- M@@  0,D 80 0P@ 0 30 Ѝ|@- M@( 0xx  @ D <0 0P@ 0 30 Ѝ0@-@QMP0 0$ PЍ0<0@-@RMP0 0$  Ѝ0p@-@Q0M0P`0 0$  `Ѝp-M4 0 ЍH-M  Ѝ~-M $  tЍ~-$M  0 00叄$ЍO-MM9n S`< 9Cp P@0 @]p IBIT`p&p `T" P 0  ST U L ܍Ѝ  R U ? 巓PP 00g@-p@-PP@ D!!!!@ጔ0P0 @p0y 0 uf ;f$A-`P@P- T6 $0S:0@@T(0  0UA 0S@@! 00x( p⡿p0S$  0 0 5T| ?x0x 0 *$0S%*P( pyH0S$ :e e$ :ded@-PPM@`u T~ ,0PXPI00PY0: S Sr  SЍP P :ڄP 0pބ`PA0 `\0`.S0@D`H08< 0L R%0L R!8 <P\@ D^V0 0U :0Ѝ]0S \040.SЍp $px ЍT :P0P 0 T4 000 0 v 7btbx 7bLA-pP`P$ V- ,0 `}@P\0X0-  0 0P $0R 0g@P \0 00X0T P0P 0$ CV4 000 0$ 8@ 6aXa\ 6K4a0@-`QM@ :pp.  80<RP @0DRP @P00V Ѝᩂpp pP,@ᲂ(@ЍᧃPPЍO-`P  R0@PS0B0W000p@@ Pt ,0  0.SY P  @P X:0 0, L000 0S0S505 0S (0S ,0 0\00 05 0"H20Q000PPS0(0m P0( 0q0S 00$0 05000P`0S , 0$00 0 0H0S 0. S P000 0/  00$0J 4P 0Su,0) 0 S" Y $ U00" 00YSL0S,00IS啂P ,0 %<,0(0(000P0 $ 00BUY (0SYc<Ѝ0@\pXW  @,0%<,0p<Ѝ 0 @g5P0500S|! hP ,0 00C /Ry 0P00S  \R   B  0SL0S0v \R   B   R00L Rf <ЍO )0 00 XjS05}0$0$0UC L0S,00S\ 00S05i0$0 /YYO-`P MP U0@P} (PV,P pW P UP1QP UiP`xR PPV L [ p PP Pp[#   RQ y[\ 5 , L PXUp0 PP[XW [Pp PP , 0P 5: W S ЍPMU IGE@PU pUP1W0000 0 0< [ K0 0H ^hp,00,0 P P pnm +VV +VV`0p@-PP5 0S %#L R6@T@L 0R@T @TP ܐڐ,0 Ր@p(0p@ T P0P 0X $@K`ᴐV C` *LTTA-PP @TZ ,0,WQ Q% R} `@`T L0S 5S0S $4 0d  BQR@ @D Q\ 5`V `iV`05`D`V   <,0`XV`P`,0  `+ zP` `5V0 5$  0   0S00 /\,0  C ^00  /`Q"U2 0d vdb`L0s ,0 @L0SK 5_ ,0( P( A,0PZ00\p ,0/P WP `  00` 00@S ` P[,0 X~p(N 505M,0' $0S005` P 05(~+,0  P ,0<,0?0S P ,0 ~p( 505r@@"@(~@ 0%$0 0%$0 )XT0S 'R$R(`Pp@-@P T UUp 0 pH "D0D 0p , (0( 0p  $4l0N $ NNA-PP`F L'p@,0 $5 S9 S@T @T V,0``<,0L0S00/S , @ o00 }pp@ \00~P}, 1(0( 0| 9} "M0M4p@-@PPP 0P0S 0`0q0S᷎p@}((((嫎$0B 0 xtL "dL(1(0A-P (M`@P @Ppp 0 00@T P' 00CS(  p0 0 0 S0;1:(Ѝ 00?G0?G "00(Ѝ0 " !0M 00 0Ѝ|@-@P P PP 0* 0 0h Kp@-@PP U p@ P0BL L0 {U40C0 00 qp@ =x `J= 8Jp@-@PP U p@ P0BL L0 UU40C0 00 Kp@{ < JL< J$O-PMp 0GW"S00` 0t@ P-TPe +T@`0> ǯ0  0  P  @00Ds \a0DSW0DA0DS"70DWUY:P Q S \ P"000T9 W. 0p 0U00S 0qS 0F0 Ѝ0S U @0` 0 0R00  Ѝp p㙉 㙙 㙉A㙙I XR 0AA B PR W `@@0?< <0 PWppn# $0M0 00Ѝ52@-LMpP` @000{P LЍ`0 LЍC-P!M1M `0p00<0]! @PX t1 0S OP(3 }  |P* sFR P $PPP) 0 0 < 30*ލЍ o9n5G㨀R 0 P P0n S/P0S  嗌@㔌%P"P P(}(刌OPt >> >O-PLM`@< X TV1 <000$0@ 1P Xe <0Sl 0VP@000p00 Ѝp@-@ PU 00S  R Q Qpj0P 0  P  pH0H 000S@-@(x0(@xtp@-PPM`& @T @T T0 Q 0RS ``0`P 0 RЍp0i 0 0 1p@-M@P% `0S$00700 00W  wP( p$ PQ# 0 00CR U 0 S R 0S$0Ѝp 00 `$0P0P 000S@-@(Xx0(@QxtA-p`@ PP 0 00S (;xP   (/x 0S  sP    0S `(x 0S ` t0@-@PMP # P w  0Pׇp@ @Ѝ0f 0 Sb P(0<$ $0 -  .``1@- (M0R0$00< 0SQR@ 0SRA!0 0 $0 305(Ѝ@@    (00 $\0R0$0L0S 0S ( !0$ R0 @P <0 0 $0 30(Ѝ@.H  (0PX@- D  R4 :  ,h0P@-X  S H@ D 0( @$ TuXuD,tu,A-`PpP@p U! T 0 F0PU 000\ LL0?H H0 ]U00@, ,0 S$ + X+000S x0m.!D900 /P0  \0\ 0 /12021 0 0A-Qp$_K aNCHO@Q0?H8c` P@R\0 0P 0 pqp@@T p!  P1101 p@-PD@@ v0S,000P p@ v00/1A-0@Qp`P`FR  uv R%100 UNUd!0` p000 <0 Yv?UU'U9? 00A0A100 0pP0p0P 0\  B0B10< l0Yh h0 lT` v| 0d/0(/T//,/./H(D (P.(@1A-0@PppG@ `< p@cH XD0D 0 , W(0( 0 h0 ذp@-PP@, T Pp PbP 0S Sb`P p@\`p0p@/H xD0D 0( , w(0( 0( !H, ׬p@-@PP U  p@UbL gH0H 0< U, h(0( 0< @$ l0@-PP M@ T#  `P Ѝ0aP 0Sp0 0cP L0L 0L tT0 ,0, 0L iVl T8 (p@-PP@" T+ 0R0 p_P aP _P _P p@_L H0H 0\ 1T, (0( 0\ & H, tG-PP@7 T@  R R  `V V  0` 0 00 `V00!`V | 00FS62-)%!  I0 0l T%p堐p 0l  R R 0  ` 00 00 0000 0` D Ӹ @-U/ 0SAS/0-O$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/p@-PQ@`0 V% T ^ 0S^  S 0RR00Ap@@Tpp@0;< <0 C(0:$ $0 : p LC-@!P1pP M`0030[ TP A< 3YPF `YT 0S `!X1 0 3 30Mߍ(#@@ R R  R P0 R    p0Sp % 0 0 |0x x0 d0` `0 D  ؉ ]p\ D O-IM,M`X$@PPJ L4 pI 0$000 0S S  $I3$ 0 0 30Iݍ,Ѝ RJ-  Ⲱ RW#  B J=00h)J=0h0 H<0H H0 H H H H H}4 <0H hP J- 0SJ=0 H" 0 XJ- 0Sv0S@ S# UV J=000pO J=00aZ> O< 'XPe 0SP u0S 0S  0S0/S S0S J=UV0  0"R #< QS( S DJ͍0 ?1嚏*0 0 000H0,0 TP @](& 00SLP P P J=00Z0  WPJ͍^P [@Z ݜ8 8O-`\$@X4M Q@p0DH 00010P0CS+H5('&%$#"! DQWX000S R|  R RY_`#X3 0 0 30Ѝ8,30030H 0 D@pЍO{QWX00VTVWX "0 1 X%:  0 l" pP5T30Sy0S D ," PTVT00P 0Sj!0 T@@O 00!0 piT 1i #FYxP``1p\P0 ppW@D 0   ŇT00? Ypp} 0䠟䰟P0 0pY@D 0m   ᥇T00? D PTpyX  ͢VUUD\$XPG-p!`1FM 00104 P@p, P PV kPV> 0@Sp0 00q0M 0 0 0P 0 0 1 30Fߍ Y:wp0SX 0S [P 0 0OR Q A-@ 0P`p{0  0P 1p@-MP`P@@P@T 0S  R0S @:PPЍpPPЍpp@-@P ppPPp0@ 0  ØH0. SAA0Cq .S .R Q P -S /S /Q P _S 0 S@-FRB0\R 0R: @PTT 0S`[ DDpW` UZ ^" DPD`V` S`" @@@0T\\ /  R 0 0 0R0C?o20SL`V0^ R 0\ 0R 001 S0 S 0R U ^( D@D0T 0U ^^U ^ D`DPVS` D@D0TS 0R0Sd!0@- $M0  AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S R' 0S  0S0S0S/R /0S S/@-/ 0  00S S/ /0S//0@-@P M 0S PP 0P7G@0S0S 0S  Ѝ0$0n 0 @ h4@-PPM@p`( T Q Q Ѝ0SS ЍS PPW0S# S!  0p 0 000S SH0 P 00M t`8p@-PP`@ V T! 0plPpx t0t 0 VX T0T 0 T8 404 0 |D TD (O-M<0 `PC: 00pq\P0  03/P 0&,`&<(0( 0 SS0080R0ST 5 RDP(PՓ[B W?Kp:4p$00@,p$0  pC 0p:\@P0  0 3/P @ 00\P\`\Vy80Sh U &<(00Sk&<(00SD C!`P E0/o"SQ\pEorR,0S D0WppP@0@C<0Du\< W^8 @0 C00P4 0P00,00,0&SE @H$44, 0 0 30ݍ4Ѝb\00&<(00Sd &<(00Sf  E'UR!`{ XK^4p0@W,PD [o <0H  ZCAӛh`X Sq[. p 0 0e   fP $@r @0S S000 P0S$q[UK <0LE0S/ [00UK UUU1 !U U4D q!`P!pE0orS  R E/o",10 00Sp[00TD (0R h<0.ARC@@\oD0-%yrb00S@@[@5D0zO4 00Z`PR0  03/PJ W 0SB0 0 `0D2<0.RC@\0&<(0@,`)P (0 `@%-r@`@X 0<@TL t xٔ h t8 D< 8 <0< 0P (0S\ `0` 0P 0S 0 P 0Z 0 P 00  0<(5$%0 %?R ,0Spg np[P [[zO4 00PZ`P0 ! `) P npP $4 0R T4 4S Q 4S 404p0VZP4040S 0R $R R $R 0pfꠛq"O-SM`$0P4 00D10@npP  0 @P30* 00S  Pe X0 SR zP 0 f@P 0 00S @P `@@ @P , X,<O--S/ M0?0020I 0 ؀x☐06 ` &     " $ ( * , Z, 0S0S  `  00/ ? 0 2 30Fߍ0S0SP;0S^01@3>` .> u/0`  0`V 0 Q .0 ^ 0S 0F?oP20Q00S0S  00 p pW P`@ 0S   0?SV CC" 0c6#PpWp @/0 RS S0 0 0|`P  <`p0`0(0$@ pW g872 G52 0W00S   S  R  R Q ^  ^$ \QRSW PX0S" 0 !PsQp h+0 0Si QRe 0pS %0P,0 ڗP , 00 B  `0PpW ,00X ,8P<P@4@DpW 0S@T 0S 0S S 00S P.00 0=& RX R R ^ w0S ppWpWB@$T0S ``p$`,`@( S R \  PV \D @T) T 0 d342 D52 0S0 S P  ^"SpQ^*\'@,T$`5 Z 01 0`P0 P`UVU Bj0P 0O ȧXp  0PPP PPpTkPXP= j0S5 0S j` 0@Q/o" SCRp  0![PLY0 PH RE 00S> RQ: 00  pP 0 Pp, Pp  00SSpRnkRm \8R P @0 XpP 0$0[- 0['0%05f 0ZX @_0@S 23(PX000$0XP X@T0 40(PP 000 mP@T 0S S00S0$00$00 `xP @`) T7 R4($c$4$ 0y/w 00?oR20S x8P 4@ ,ipRSQ \f@`Sp` V4 ``i@ ,0,0pP  0P# `@"u2 .0(P pW i`@00-hP 0 PPjPX Hp W:0 `$@Ph@P  HFH H`)T WP @T@*$@` ji10(0 00`P$ Z@P p@;E \`|pV00E V~0 t0h0p ]$0( ppz !Y0P0 \XPN E, L LuYP00EC,|,0U S w Sm 0 S,P 0Cb*) ɠ$ $$ L ˤ^L 0P03 !,PS*0S:VD  Xq @ 0`l0$00J'0 0W  00hP@P P0U 0Ph 0R PP  h00P0 PW(P$\,P E0n. >⭹ I LYP1x00x0 hY`P`$@ P P0U 00P~hT0PyhO-PLMc Yl ԱQ0 @P    3 `P00PG 0pp R R R0 T@0P p R ((0( !P00 V pW X 00  XppWV$@LЍTT hP0P 0!.mY4 i000 0!.b $8 G-XM`@+|P pP@0 0      0%|P 40S0- XЍ NP g  0|P g8<8 -P 4PP{R 0 O-"M28B0 0,*7:N0j 0" 0# 0M : ! ,-$@ lȃ *, !9 )M  #8 " ۦN b.0,D*<?A0ꪂ 0! ,e64L0lȊ 0" 0#0D)O4  " *Db- ( ৃ㔋Ja 9p ,|Opp0ȁi 0[eF0#08p5``  p " l oHb-`` 0p!}doOa` ` p,meHȁ``0 0(p0#0OnoF5``  Dp " f,nOb-``  p!ccJa` `S7Oe0 004p 0#0 c= 5":-K    "  Bb+ P!0  P@0,0## +N@  0LЍ@-@P 3 E7FN, 0(Iv420A 0 0  zA-PPp`5 W) 0!Ӂ00@@h00"V>0: C0hS@H"p ` # *90S@@:p`F AH D0D 0 S, (0( 0 I y$`$ x ! 1 p@-`P0M@0 00' T0 P  !7R8 bx b(   0 0 0 30X Ѝp@` \0\ 0 T@ <0< 0 Z xl( w wdDŸO-< 82 M4"0 P00p  `. 0\ @ 0 XS@@|[0 C" T. .0N|0[.\'^V*004!$1 0 0 30@ ЍT  r Aa B8 LR\ P 0FS0 S S X[P0@^*0^0 8< 4^*0 8<꽍dP L- McP ЍDD!@- 0(M S $ A \/o"S R9/o"S R L 0 0 $0 30)(Ѝ@@    (  0$\ S $ L R \0  R ( $Q C \ l t t`A-P!1`P rMp00109 UA @^X0pA00tAR0OR00TAV ?2D 0_P5  0 |ypP& 0@`P 0 0 1 30 rߍ0<| |0 Ud0=` `0 P /a00P 00 x v rl r00- $  M  Ѝ  -- M0 0x ЍЍ/-8 8- M0 0   gЍ Ѝ/ Tp@- M`@P @x0`0P0000 @X@0@T  Ѝp X\ X1! @-`0M000Qp P@   L$Qp O@ 0 0 0 30*ЍOPpW @@T PU 0SP@GT 00@>006 ` 0p@-P0@ 0p0_`(0P\`(P,PX` 0\0PP 0P 00,,qP 00pX 0@-@ 0 0 0  0 0 m 0 0 00@-P M @0` 00P 0 vB?o02c Ѝ04 00 0p@-@P 0U0 0pp@-@P_0PP_(0P_(P,PpO-P0Ph `UPa @000 S S0 S S `DpPP 00 pZp8 $3@P q0p00S S S@ 0A S  A 1 @P 0S 0000^P 0 ^P @ @$ O- M`p@,0(Sv: (TZ0 T0V 00SR 0 RL@D@T0PG 00SC000@D@D0P0S, T0X  0!0J0@PH 00S#0AX0偰0  ى0S000   ȉ0S& p0@^0pp^(0p^(p,p@ ЍZ^P  (,@w(0  Ѝ0 00@- M@P  0s P  Ѝ00 0 $$ 0 P Ѝ0Dp 0$ $3 Ѝ0O-PLMV E$P`@0@ ``_PU$]pPQ 0 ``_PF$PPU @0`Q QD QR Q4 0U00S} b\P  ` 000@ p R  R/ RY R  0 @U p8^ 0J[0K 0 LЍ   @ Q`A@0U   0 ἐ0  ,0  p 04`0 0W G   ` ``@`` @U 0]00] `^ \LQ  QA@ \V ^ Q\ @ , p 0     S QAR`  R  P@T( Q  AX  # X/ X5 p X @ P @U&9X X X 0`p`   `  Q@` ``  `p`<0]8 80 :] hH b @-@P @XN( /$0$ 0( @LN bxM'QO-b P`ټPY<[(0;[ p970@$0` $p3? W`(0,`2(-`P [(0 # 3W, `0!(-0P QFf& U`V3Z` `V:PV Y5WW1!030#O 0 \@F000W; SP81 `3 `#S41`F2s2`Fs1`FS0`Fg`Fx0v`4:0;`0Y SP81 `3 `#S41`F2s2`Fs1`FS 0`Fi`FY0v`0809``` bhp@-`MmKp& @Lp) P0u00 @ a0@jKt `0 0)P ЍpLUK00OK / @-\(,@\ \  Q:^: A Ͽ|q<Ͽ10000$O-\MP @P0( Y 40:;pɁ B$`; -:^*bI:1 喑a@9837` # ^  0008` 19P80 @A4ƌ<ŠaЍ /r 0?s0q1 2/3?10: 0 0@-S@ 3/@LA-pd Q㹉7I@P-7I @P @D  T<Ͽ2/ p `6o`FLPV% L`B, `F Ef& BL&&"L`F, `F Bb& BLQ"L`F,`Fw&Tp}" @D  2/ 0t 2/P HPEV%ApG!pG Ev' BA'&"AG!@ B BA!" A@!@ 蹉 Q7IP' N ^<Ͽ2/ `@4O@DL@ F$L B, PB DF% BL$&"L@D, @D BB$ BLQ"L@D,@Dw$^p ^ ^ | x 1t 2/P^$^/ ^+ ^-  2/PT T @D 2/ P @D 2/  2/Pw^u ^ ^ ^ Pl    \ X T [ Y Yl@-@P  @7L0/ 0 \4 X10 @-0@0 0 0L#d.\ 0@0\ SC@ k P p0  0C00 00L  00t@  X, W0@- M@M  < ` O-MM&(<ਤ |$ `!0,06@@R@@0TL06fW0P00 (`0 0p0/ 4 L& 80hP H TP6&0  @ < P0D0(0 LP, ?oR20S <0`1  D0`V 0` 0V XH CjX.h0SX 40PepH5`00` 0VG W80? p50= 0Y% W0 j@X400)S d00p`( pAP* 0  I,\4  0p @ 44p0  40 p 4 0p} `0S1XP V0P00] 0 #<3 0 |4 30ݍЍo`3` 0Qa0S ,0ST<0`1   jY i"2 0 |4 300ݍЍOI80 p$T?0prR( uiW^t2t"0P0l2 `0X \@dPL bi`GpFW.xD `R- V P Ti@  Mi Y 0 X1L  000 .+Y`GpF 0 W\@`dPl 0  VL 0 x 0 r @ P  iY 0 a0L  000 .J+YX h\ ` $P ,7H ,} }D} |||{ {{h {D{{h{X{Dz0zyyyO-tM@@  `kVPPhP0 0 p 0 0 `1弴4Sᾤ,0   (6< 0 V 1P806< 0B>PU  0R408 00zh`1S   ;`1S0 0 0 PJ0 0 P7P P P$0 0 P0 0 P0 0 P0 0 zP0 0 oP`1SxYz < Php0pW  0R 0gWpW 0pW  0Rx 0gDpWf 0pWa  0R0 ,0g1pWGpWD 0 PS 00g`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 %0p01 00p01 00p01 0xx1p0 [F#WL JgtЍ tЍ 0 10 0  0 0 } 0v0 ox0 h Hx$ DŽww dv$uuuP xsHsrrrs sTs4srrrrrt @-p0 AM@M 0`$0 40 0 t?PP0S j@ 80 0 4 30AލЍ.% ː $0,@- M@ p  PpI?`P&P 0S <0000 Ѝ00S.S 0S Ѝ(4p@-Pt AM `0 0 $ @P 4 ,0 0 4 30Aލp蠀 $ p@-P@`Q  @Q .cPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P 0`W00 Ѝn p@-@MP`0S 0 @S 0S@V00ЍpO00@ 0PV00Ѝpm0@- MPi0@0@0@T  0U Ѝ0l0 0PU:H@@ Ѝ0840 P0@ Ѝ0 Pvln lQp@-`M x00<@/P 0PU  0VЍp_40P 0`XЍp @@ |l 0@- MP 0@0@=@T  0U Ѝ0p0 0P3U:L@@ Ѝ0<80 P0@" Ѝ0 ktk|lxk80@- M@ T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPPl(kkkkpkkkjk jjjkjj\j8jTj0j jX0@- MP+ O@^P Ѝ0 0( 0PX Ѝ0b0@- MPh0h@0@B>@T  0U Ѝ0O,0@ 0P7 Ѝ0 hxgMp@-@ML `P 0 Q@0P0<00 0. 0T @D F000T H0 0 <0 30 @Ѝp@Ѝ/T.0 62~ i( |O-MP`@PP  ~p z0 Q ЍSr RSPP 0-S  0+S  0x# P   00C2"0d  .S 0 @ Tᘀ@@ ✀(P  S #3 @ P 0RQ  S  # 3!# 0T#+<'(0+8 +((0'<0'4 0(< p 0(4 000Rp 0T  @ P  S #3 @ P 0RQ  S  # 3!# 0T U 0T @ \  S #3 @ \ 0RP  S # 3 # 0T (0 0 N 0N 0 0 0 00J 00 0  ;3 O-@Q dM0 R & @\|)g/O2 0\0^mnb`AS0N0P0_>88H<Q¯a&sf~e~rHpl0W0E0T0=b0AE1D88H'ᓾ  La@L<@<d+b@ "gࣲ2X0+kK} G}C}ZX0 H Y J XL , @ 0P0( L 0 $ \ 40 T D0p < ` H /CZ QY QX QdЍ0& @0 B\0@R@0@j x  0 0dЍ@ Y 0X npbbaCCC@-@P 0D .R\0@*S0T .S@@T QA.@S@@$  0  0(  1$aa,p@- MP`P`@H]_0 v> 00      aPc Ѝp`C-`@ MPp䀟@POP @U ^P@Wy@ Ѝ G@P@p0 0000  P"0S0Y@OoB@# ]h T`<C-`@ MPp䀟@Px@P @U ^P@Wy@ Ѝ @P@p0 0000  PZ"0S0Y@OoB@# f D_4p@-@P00C0S S u P 0` Pp!b`u0 0C0SpSr P 0 / b0@-M@  00000 !R !PЍ0p@-  0S0@Q0 R   =0H04S Ppl@Q0R Q    R Q  Lp@-@@P@0P`0pp 0,0p@X0/ LD D p@-` P@0pp0,p@ LHA- @@P`p0p0 A `LC-P0 M`p0qp@ H0  D@ <8 y@Ѝ 9 LxC-Pp0 M`p0Gp@ (0  @ Ѝ 9 XL0 00/ L0 00/ L 0M 000Ѝ@ LXA-pP0 M@P`0 p 0 pЍ `L0M 000Ѝ LxC-Pp0 M`p0p@ (0  @ Ѝ h9 LC-Px0 M`p0p@ 40  0 @Ѝ D9 DL<@- @  $M0 vЍ LH0H 0p@-@0pP p@y9p pL8- , M $ 4  Ѝ L R) p@-P`@V )P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0 Mp@Sp` v0T 0C0 ЍL0H 0080p 07/0X 0 ^^O-Mp`@PP*W3*00V.:Y `8 @1 <0 ppZ, f `0 P P0  0P0`00000Ѝ0 P`Ѝ p `h0 rP0V`F0V0S00, ,0 #,^@^4"$!] #\O-M 0000==80p=0P .=00=< 0(0=Dp0@ 00=<0000 TPL 0S@& H0P00@0⯽0  NL 06P0,00Hk= 0P=40 V@PU *( = 0 000<0=<;:9876543210/.-,+*)('&%$#"! % 0Pr R 0S .S 0S 0S00S.S-7< @0-< R' 7d @0 0PD0D0 ShH7H$.40,0,0PJ 0@B0 CY 00p000#( #,  @<[$p@D0 PYʜ0 P  0 0pP`600#$ #(#< 0( <60 0C00.0 r  .00Q$0A SP00D0Z:0<H+B 0?R0S %P5 0 0 30  ݍ Ѝ0Y =<00S--45< 0@T- 5< 0@N꯽H0 00@00 0 P@0 80P,0$ 940꯽H0 00@00  0P{4@4P4 @0@PD;2 40 0P_0000 C0rPU0H< 0RJ0Z0S~#%3 0T t=<00S4@0d D;X30P 0 P(00 C 0=P H00P@C8p4` 0P,P 0 }P0  P0=<00S pI4d 0W00W00D{@20 0WP=P<0 0@C: pPF WP 䁟W# P@E 0 9P0TE 0 00P00d0@D0WWh 0 !PL1d 0M 0 PG 0P <@P 0p D{ 0PYW.   0&P}&=<00@C00 XWWX$SS4T8TFzS PdP\CQHOO 0PN<ONNMLMLKxJJJ PI0HGF:FdFF k  XhBDA@f?@h?t>??>=;;<<;;@d 0@00 0 P0Pd 00D 0 P ^30d  0 sPpD{X pQ@P0d 00 0 ]P0DK0S3Y  0 NPDD PU rp0X@H1 0ES Y=h=<00S3P@ 300@DK2d  0PN 0 P P: @2RDKGPd 04 0 P@2DK40d " 0 Pr20d D;30 0 P`00 C 0uPX PD :@B D PpPy 4 $0 @0ZDr: T 0 P60 @Cd40+Ys =<00SDd 0@00P 0 P 0 d  0 P 0@DK0T*UpPTDK 0d 00 0 cP+@0X 10"3% 00;@0000;@020!200;@000300;@0S100;@010 0;@=0;@ 0-P0D0 S[\@pT P0tဠ @ Up  R @ Z$ 0d 9 0P@T+A0X 10"3$' 00;A0000;A020 0;A====C;+A0X|'1 00=-0;A>A C0==C;+@0X 10"3' 00;@0000;@020!200;@000 0= +@=-;@>@ Cu00 C0GP*0DK0S|P\2 p$P P 0 W%  R @0 Z$ 0d  0 qP@T0=<00!V5U5E?C0 S`  0 YPP210@* *JDK1#0p0W  0 ?Ps=<00S -9< 0@b00 C0P0D{0PCUQVP@倀 @UM1 X2  0d @ 0 P=<00S -:< 0@)00P@C84p 0PPu$  0 Pm 0  Pe`  0 P]0DK00CS# @;000 C0fPI  0 PA{DKpP0D[ 0d  0 P+P~0D[ 0d  0 Pk0P h0p e0<d 0pP@DK 0 uPH=@<0  o 0cP=<00S 0d 0X=0  0NPZPpD{6  0R`@ 5 7 = 0H;@$0 0$1YP *( >0 @000>04/$0ZIp= 00HD{F 0S @ 0| P0-$0d 0>0,  0P&{=<00S/@/@@?2 p0D{   0 P] 0  @PUX t_ 0 P@DK PI 0 PB] @ 0 DK P8 0 P0P0$ 0 D; 0P%00 C 0:Pn/@k/@0@p( 0W00D{=0 P 0 wP=<00@CV5U5E!?C0 S< 0 cP=<00Sk-=< 0@=<00S0SH:=<00S9 Ld 0@00o P 0 4P0d 00D] 0 #P 0 d O 0 P0PD[S1jC!  07P7-;< 0@,=<00S.0pd D;\;0 P 0 Pn008@C4` 0  ~Pa 0 PY 0  nPQH=<00Sf= 0@0H[0 "#ṿT *( X;` 0 00H:08/= 0 @D Pd @0H[0:0  0P0DZ1*؉pԙ@ 0 PZD W 0  oP p 0d @ 0 aPpG@P 0Z 0 OP@00 C0@P 0 <PPDK. 0@.H. ,5 /= 00P@ ,9( L 00<8P 05/K@_=<00S='<0@ 709=<00S-0d D70$  0PJs00 C0Pi0D[0SC* *J1#00 S  0 PR= 0@0H[0 *"T *( x70 00608/0- P @DH[P@D[= 0@0H[0 "᛾T *( 6(0 00608/0- P @DH[P@D[ 0 tP-5< 0@%E5 0T $P0 PD[0U:-d5< 0@-P5< 0@|-<5< 0@v=(%<0@ 50u-5< 0@h-4< 0@b4d 0P_  0%PY T P0d 00K  0P TDK ` 0 P P0DK |Pb  0P00@cPC0`DK@ Pq0 @Pi0DK0S 0 P[P JpP5WW Lc`P@Ľ 0 PB0TE 0 0P900d0@D0WW 0 P)-2< 0@-P<  @P{T;T prpP`ኽ 0 ~P0VE 0 0uP00f0`F0TT 0 fP-1< 0@= 0P0H0 XU@8*1(  00p1P 05/*\ 0 :P= 0P0H0 2U@*D1(  000P 05/;P::l9,9h78865666]5(,33'34042$111dd1 20110100011x100//..4.--L,x,X-++*X*(()4(''(H'&&'\&%%&&Th%l%X\%04%$%$L$$###|$P#T""p|"PT"0""!!!! q+p 0 D PP#81d P0 0 PP 0 P  0 zPW+ 0 D PnP=H{ 0` PPV *( 10 000209/= 0`Fp`` H{ 0uPx 0 =P + 0 D P0P=H{ 0` UPPV *( 20 00309/= 0`Fp`` H{ 07P` 0 P* 0 D PP|=H{ 0` PPrV *( 30 00409/p`F=P 0 `0H{ PSH 0 PK@*DK 0 @P>=Hk 0P @P4U *( 40 p00407/=PEp 0PP 0 `Hk P0 P H 0 {Ph 0 rP=%<0 0@C50-5< 0@=%<0 0@C500%@C5 0 0 JPvpz f`P@E 0 8P0TE 0 0/P00d0@D0WW\ڄ 0  PT 0 Pf`-6< 0@= @0@D0Y:87'0 50'@C7 0.$ 0 Pz@P@ fpP`WSW tg`P@ 0 P^0TE 0 0PU00d0@D0WW 0 PE- 8< 0@ 0 P78h`=D(<0 0@CT80=`(<0@ l800@C|8080Hj 0 Ph`8(0 0(@C8 0=(<0@ 80+J0X X10"3) 00;J0X000;J0XX20!200;J0XX00300;J0XS100;J0XX10200;J0X0 0 ;J 08PPUD @- MRA T  ,@0 4@(@@0 0404040040 Ѝ M- (040 1Ѝ03/A-PS`+p@ W@0 V :00@PU (PfP(00TPD0?T0S,0l( (0 %PP  G-`X: 0X: X : p 0 PP X**(00@P0S P UT0 $P"  P@QA-Mwp$0P@S` 0(01$0,0v(`Vf0Sb(0S$P1,  0(0, S,400'PR,0,0 RMU,,  4TP(0T0(0 SP$PQ0(00,0Ѝ0F 3P&,  (`, \:, 000\, :$( ,00(0 SP$PU 0"ꍿ00ꈿ(00QA-Mu`$0P@Sp 0(01$0,0w(pWd0S`(0S$P1,  0(0, S+<0<00U*PN,0,0 RIU,, (0 Q0QQ(0 SP$PQ0(00,0Ѝ0G P%,  (p, \: ,010\, :!( ,00(0 SP$PU 0" 00(00A-pP@P`x Um T} V@D2"!00,2 < !Ì?Pqp PV@D2"!P00< (2!Ì?<: 0  T0< 8400T! T 0 00#2< P0"!T 0 =@ 0@  0=  ^*@^00@x0t t0 b`0\ \0 YH0D D0 P} D l   ޠxO-P cMPp` U Q@< 2 @ܲؒ `002 Ă0000 02 0@=QR |PS [ 񏐑,4U WH0 @ Q[;@YbЍU W1 0 @  Y 7:P$U W@ U W0 @  Y 7:P[ 3 @[Q 0@ QU W R 0 T 0e 0 T 0Y Z0 0T QQ 00@=Q e  ۸ ې`P 00/ `lP 0/(/ ///@-`Mp@pPT@TL0 < P@`L]S0< at4A-pPQ@`PS TH 00SA00XS= 0ST.C+SQ2.!q` ` p 0000s0  0C` Q70V0Cs 00000   0 C R7 0 0C20L0?H H0 ĺ40>0 00 ໺ a  D جA-Pp@JU`, Tx0 @W``W 0 PE.p^p P0070 2000 S037#Q00 ^00 g0  0s ה/go/g|///i@-DM` @p0 0 < 2 &0 RP- 0 0C0< ,0 0 <0 30DЍe ^ L ]O-H MHH0< z - @zJS% B`R3>hP>"2d'2#g# C ኡj CB*ZJWRT/X p 0 SP7[0S  P 0D00 00000S @B0?R0S2  Ѝp  0 MhP X  0W ]P@ 0D SPW p H 0 GPTX 00e, ,0  Ѝ ]$x 4A-`pP60S- @ᬺT 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@ꀻ( 0 $0p@- M@P00 80P k$`P6Go0 (0 0 8 30ލpd Y Yx0-@-@R M00  (IPP * Ѝ@Ѝ/ * Ѝ@Ѝ/odPRp@- `@9PPhP0 ?p@(V00pPRp@- `@PqPFP0 ?p@(400pp@-@Q `PQP&P0 ?p@(Ӻ00pp@-P@u(P  p@ p@p@-@P 0PS <0S P 00p觺00pQP@- 0R R  蔺00p@-PP Q@ @Q Q QT00A D32{00pP T0DS@pP p@-PP @P  T P5 `PVp 0P P   $$P V0 P pl Ch0h 0 T DP0P 0 z< E808 0 qp P , 0 08@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-0r0000-w-x( 00#000S wS -S rS 0S /xS /  @-P@20 0 0 P P//0S/ S S/0S/0S/@-@^0@0T S R RT/ ?/PP/=?0PQ/?SQ $0p 0 @-R/L d ??SQ $0p 0 @->/ 4P P P`/AQ/Q/Q Q/?0 H0pD D0 @-Q/?S0?/0?/d |QP00 / /@-Y 0  A-9.P 0`0@HpH PrZA0S;P/7Ppp@-@PM` P0E S aЍp  PJZ0S 0Z 0 ܯ p@-@PpP Q 0S PPb/0S]/p@ A-@Pp X P@PEX `@P`( $0$ 0 `  O- M` V$ p@KV P@Ṭ0P RV F!0 0`F `! Ѝ0 Ѝ0/`0\   /G 010/C. *    /G RA-P(M`p |@ 0 @0@0 PP00\ P@ 0 (Ѝ D 0?G0 5CS @/0cS#:3 3Q31:0CS! 2#0p@-PP@ T Pp S 0\\0 0NpD0L@ @0 ҮT(0M$ $0 Ȯ  O-PM`p 0FV"S00 0] Pቩ@P-UO +UP0+ 6p׫"; @P00Es Qa0ESW0EA0ES70EVTPSQ @0U1 V* y yA ` 0T00S0 S` 0J0 ЍS T P0 0} 0R00  Ѝr `00XS 00AA0C PSVr `Pr `0? 0 "fT D\0M0 00ЍT -(QO-PMp 0GW"S`@ߨP-T0P| +T@`S 0T W p  Su?00 c  00]  @Pp0 Q 6 P Q  S  R- " Q 00Bs ^a0BSW0BA0BS(70BS%| YZ  P Q  S  R " "00꺯"0 00S \0F0 ЍS@ ` ?00 0c 00ꓯ 0R00  Ѝ0T0d XR" 0AA B PR W p Wp pSp `@ L40?0 00 4&W=pp= 0M0 00Ѝ )X r  Q0?0S @-yX-- Mu ЍЍ/G-PP`O VW r00PE !R !U5  4G 0SPPU pWU@@9jPp X2 00L 00 @CpGp 00> 0 @0 03T0BP P0 બV80C4 40 ࠬl L \ݬA-P`ᚮL@L@H0 @p =U  P A &Lp@-@P00C0S S u P 0` Pߢp2>`u@-@P Ƣ 0`00@Ţ06 0 > D- M0 / Ѝp@-PP@ T 0000 pD0M@ @0 T(0N$ $0  \ 4۴A-pP@`% V. 0S 0SP0S0 000 R F``0Q00L 6H0H 0 ֫V, b(0( 0 ˫ P $ڜO-p#P3OM @Pd0 h`0410`10 V V 00ԭ/00 Z.` P 30 00 [ .Q  Q\.Q O :!!PH [ 00:[.[<##=[0Q.S7 Y_0IS00X0 0IZ 00 0O  0 P00J `` 0 0C S::  f0 ` %:[ 0,$P(0000Ӧ$$1 !0 `@$ P00 0 0 41 30)Oߍ Z_00+004 <ቺP@Wx Bt0t ( 09 T.R  :LP u?V # #   t O-M MZP P*0: pxe0瀕0D50t50 0S  0 R0 !2S2 0*0t: 0 D5 30ݍ ЍP:0(0((0P,0 0 @P[S#X` ,&*|5  00SpP0 (03/P p[: !232040x P0H`X`U, 0  P [|ŝ@p< `E-8 @ DL 0T0XP 0 C0 `P!0 (03/P @ Zl 0` S$0_ R $@x TH:,00 0@0,0<Q 0d0D 0W  Q B/o" RO h ZO[PP<`BpP0 0 00Po ! R soQ \ V\pp0PX (70(03W  <0SP0 B@Gq 0PS!P" SPSP@Tp`0S 0  0X@@ @PC0@P0CX@S:@p `@Ū/)D0PX C0 0CS:巪04 R 0S 0 S9 0B'RSW@PH 0P%*F0 SR40 80 *@P>0  $0@S8Y 00`S/8 `̖X` P"0 S S S o087P0 0S0S <0S0P֤P0X@T*T0D 0R*P  A<0X@0DP<0$4 0@  0SI#3 @ 0? 0H0m4 0 0@P0 ? $0@SL0, @00R?*,P䈤P PXP偤0 CR00Z^@0 0,0@00,008&PdHpg0XP CR00@S2@PX@(03/P XL0(@ 0L0B'0P @0, 0,0,%(0  0% P)Z p ΍ 0 00A8!?R=I, 0X0PA `6P 0 %@P90 - $0 S<0S0,P@0,0@T @,DP$'0H %Pc) 0L @0,1Q *,@0P,0P ,0(@@C 0L0!'0P  @0, sS@00,0~   `  t τ T A-@PMPD 0 S`05 S Ѝ0p 0%PP> (P9 80 0PP  0 0Pc'U 00S S 0pQ' 8 404 0 ૧A' 0 p3O-PP0BMM@040 0 00S0. S` p @0vG#"0 7P @T*X\$ ǔ P 0 4"$2 0 4 30BލЍ 0     ! p7a%@PH `PC 8 0 0@媵PJ` 000 00000 0a0@&T@ 0p pIP J00S 0  0pW/   0 ` 0  & 0 0 0 `&G 0 @ 00S Sy w6@R 8ɨ X ǜHO-`PPM X00 X0 Pߍ0( 0$P 3 p0000 0 P @000 "n0P> S0S S#Z 0S @0J0T:@D0S \@D _ @`꣧ ` V@DN R & 0 叨00 S S0 S S Di`P0   CoP@ {P  Yh*@[V 1@0 00 S S S@ S Y2* @ 8@P4 00 ``ǡ T: @D=0S, Ca4  V " ᭡  T @D *($I P # p U ^0 0 00r%($I P pe%^ p\lLp xtt1@-`P0LM@0D00G LpP0S- @.0 P( U( qp0 0M 0 ~9P (% 0 0 0 D0 30LЍW9Ptpp  @ %T@ <0< 0 dP X  TA-PPM@7 q`p@T) X pp00  0&9P $ 0 Ѝpp T@$T Ѝ8P @, (0( 0 D @ G-M`0pE@P0P0 V 0   0 p,PDЍ 0  PP 0 0٤ \A-M`pP@P , 0P (   0@Ѝ, 00ЍA-@P M`Pp@R UV'0S9 0S0S9 P`<8180$! P <Pp0}P 00 ЍU U- / 0 0 Ѝ0S  0 00S000/S S 0S @P`8 404 0Q0 t < <O-DMPP d$0h X400<00 (H"0P ,t@`p#0 `(@P 5P ,0 0P0ç RR RR$ 0 0 Q Q R R d 00 P Hs P@p`@Q Q Q S*P P 0Q@ (PC" @P 0`@ 0$R0 ?0IPB Z0  6 PE Q 1 ܤ  PEV U!:  PEp̤0 Sh CF @`0  PEཤ q [p5`6@U* @`## 0  0H!41 0 <0 30DDЍ 3P8ڧ P2 0 0 0尥0 B` @ `00""  0 " 0000`00 `@`@N H\ p@-MP@` 80 00ɠ XЍp@-M@} (9$  Ѝ@-MP`j @3pP0P0 D0) 8 00 @  P2Ѝ(<0@- MPP@T p00P   ? T 9 x@ Ѝ0 @T- 00A-@PaMP`A UI !0  p  ` 0S  0 C RR0 0 C.S2V 0@ Ѝ R0 XR @ 9S 0m 0 _U0n 0 US @ `F V0  RU4 8<00 h yd y<O-`#PQ3,M @00$00K V Ph PV@00:T  l Tn 0# p P ` `P@pP ] pWX @ `VW ` @$pTᰐőJZ T 0DE S0 s Sb 0HIDrDp 0< СV@ T T[ / 0 !1 0 $0 30m,Ѝ!1 0 $0 30b,ЍO@:TP ( P :V=W& 0S 0$ SpP$qJ 1p0< სT TU 0 0H tQ0S oH 0iF0H 0b$p@k@.TP `@$pTP\ʦLTf t x$| w0 H ul u0@-P!@P 1,M `00$00& V.  p0 0 0  ?1P* ៎ 0 0 $0 30,Ѝ7 0 X0hT T0 V<0i8 80 UL  P t8L4 t$O-lMp$0Q4 @00d00 W P P% / 0 p$h4 0 d0 30lЍHdHDTD`P0 ṠW T T 0㮠@ 0 4 0 0h 1R LTTP   0q0S P q u \P 0PS qL u00 \0S PZDU00C40Pb@ 0T00` VQ*TU:00R "K0 k0P00Y0S>@T# 0U00S 0S"2 0 d0 30w lЍOuP0040b@ 0`u PU 0 S *  0CR00:ᐍ80 S8:/ 0 /Z Z9 Z@P( ?R0 K P P㘛PI`0P`0 ݟT T0S 0 0 ͟: 0 0Ÿ00@PSi U:0@0uK D DD s(  o oxTO-@PMĥp P( 500SL ([O U U U  0 Ѝ0` R  ?0[' + TP$P 0;/pq 00P @ P 00  0 0 0˕ЍОp pT0P  * R + L UY  0pp?P 00 0 SM  0 00;/pq 00`QQ <`V;0 0P ;/yq`0 y 00 0`VßR <0`VßpX0P[ Rh0ۓ0cX0`[MS  00Qd <`800C`V0Z*" YL`0`f/ `0;/pqA 00  P @ P =00 0Z 00 [P*0 S': `F v Z1!0 0 0C03PT` 0S  0C`ß 1G!0 jA`V0 Z 0CJ` J`P @0P 0000 00Ĕj 0 帔D0@ @0 00 4 j|jt j,p i Dp@-PP@` R 0AUD0 qV p<0H8 80 Vp0Ppl hO-P$M`@ T0\0p#p 0 000 0Z0`0' 0`B0S0 Q; `V00S  F0 S` 0 00PP  00  T? X 000P6 0SW @@RY00S@ 0`V00`SV[*` P Q@P R  _PV 0Q @`H05 QY1 ֏P- 0S $ H @ P H00S T0S S. S3 T9 P@ 0R00S0 0V $Ѝ P` `B`V 0@p \ D 0@@yW TT SSD h@0@ 0 @$ん  ddp@-@PP` U 00 FGp 00p06| |0 Ud07` `0 ל0 @p0TS00dP d c\-M0 3/Ѝ/0@-@P MP U( 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0D0@ @0 U(0$ $0 ~ bTh b,0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L H0H 0 HU, (0( 0 = aT ap(p@-@PP" U 0S S S pp0p@0/0p@0/H D0D 0 , (0( 0  `t `Lp@-@PP" U 0S S S pp0p@0/0p@0/H D0D 0$ ٛ, (0( 0$ ϛ _ _p0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L H0H 00 U, (0( 00 ^ ^l0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L %H0H 0@ XU, &(0( 0@ M ] ]h0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L EH0H 0P U, F(0( 0P \ \||d0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L YH0H 0\ ֚U, e(0( 0\ ˚ [~ [`0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L aH0H 0l U, (0( 0l Z} Z\0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L H0H 0| TU, i(0( 0| I Y| YX0@-PP M@ T 00P00 Ѝ0L H0H 0 'T, q(0( 0  Y0| Ym`0@-PP M@ T 00P00 Ѝ0L H0H 0 T, (0( 0 X|{P XPl0@-@P MP$ U- 0S S S Ѝ0003/P 00S00 Ѝ00 0S0003/ Ѝ0L H0H 0 ൙U, (0( 0 ઙ Whz< W<r0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L H0H 0 tU, (0( 0 i Vdy8 V8LA-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP *L0L 0 4 #000 0  U(l Uw Ti8|A-PPMp@`3 W< T% P RP P P ЍPX ~00R X# ЍAu &0 0Ϙ ^0 0ŘW _0 0ຘ  P@ K0SPA88 S8p SvxH S| Sv$p@-PP@ T  ;p@~L H0H 0 T, (0( 0 t Rud0 RdA-PPp`@. X7 V@ T P  R 0 R 0\A/W 0A/ 0 08 0 0.Xd `0` 0#VD @0@ 0 Qt QLt Q  PA-@PM0P` 0A UJ 0pS SW ᦓ {P R`V V V Ѝ{00x0SP Ѝ W`# h0SPV\ /0 0 ทUh d0d 0 ୗ z Pp,, OtrH OH Orp@-@PP U (#p@~L ?H0H 0 U, (0( 0 v Nql8 Nl 0@-@P MP. U7 0S S S Ѝ00 03/P 003/P  Ѝ0 003/P 003/ Ѝ0L WH0H 0C/2U, (0( 0C/' M\p0 M00@-@P MP. U7 0S S S Ѝ00 03/P 003/P  Ѝ0 003/P 003/ Ѝ0L {H0H 0G/U, (0( 0G/ؖ L n Kp@-@PP U p@WX T0T 0K/ྖU8 404 0K/ೖp@? Kn`, K`p@-@PP U p@~X T0T 0N/U8 404 0N/p@f Jm J`p@-@PP U p@X T0T 0R/nU8 404 0R/cp@ JLm  J p@-@PP U p@.X T0T 0V/FU8 404 0V/;p@ IlL I@ @-M@%P0.S00ЍG@-M@xp  B0?R0S Ѝ$0 0 0C J R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//0 0 / L0 0 / ʴ8// 40//O-M`Qw 쓟Ű@P 51E0< ^A Z`P 00  Q Z%0T?\P0` RP YAS"`!0PU`00\(00@4ЍP`(00X0S $0Q *0F S(0S 0 `(  0AU0S " !  [W@̒Z0 p w  ABQ APApFU Q   p  r  0B>S?0A0 S;`P R p0 S P`\I0,[ ?0,40@B0?Q0S !J1 0S/Op0Sw 00tn00s0  0R5 P`b00p,@J0? Q0S`| jx0x 0S/#V yX \W\ 8 404 Q/0J 7Ltlt 6ssX 6LsLsp@-P0 M `00 1000p !@p < 40 0 1 30ލp@?< dA- `0M P@(q0 0 100ip 0 pl0 (0 0 1 30ލ< Q:/R/0S/S:00/@-\@3#* 0^ @R R R (000S0QA^ R! Q 0Q @-A?S SAQ  0SLB舒00胒(00N/G-p@`0TS'  V WT P@0TS P?^ V00Q(000QSp@-P@` P@⇉P`V  0R p/pA-APUQ?UU@A`pP W ځ1AP(00 00?00Q A@-?S SBR 0@S A00(00/-- M, ЍЍ/@-M@ p TЍR/0-S0 \ S 0^C00O-P M@P 0DT"S ` JP-Yb +YQ0Yc T@ @Q ;`paWP;`pWP" [)SQ" K0Iq P0aIQW0IAIQ70IS| V[SQ;+D?0S \0J0 Ѝ`Q0YXP 0LA@ ^P @ 0R00   ЍT@@0? 0 ֎])$ .fH0M0 00ЍK HA-`(!$1PP rMp0010+ V3 @^X0pA00tAQ0O00  TAV P@P R&0 @ p00 1 30rߍT0FP P0 V80G4 40 {9 *@ -iXF -`i000- $  M  Ѝ p -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/ O-@SM _ YXe 0pS000!R !3  lPP E``#Q9\*Q30A 0#1#2#4#8  P;   /0U A 00 pQWKP 0@pQ 0S  Ѝ0T @00Ѝ80@4 40 Ӎ0 0( *fA-@P`p50 xP6$0M 000Ѝ Tx0 0p@-00Sl@@@p\P\\P%@P @P   Pt4| Vp@-P@᥏ p@A-Pp`yt@t@0h@ U  1<0 a  A t1P|JG@-@ P0S 3/000S@苏 WlA-P p@` F  u000 % @P p@-@PFPpp@ !1p@- BMa@0PD`040  D 8PU h10S ` 0L!  P4A0@ P; 1 0} 0 0 4 30/Bލp!P `P  6/P Q Q |0 0[}l0 00P 0 0 `Z8 c4h8 bh UHO-MqQpAP@; ype a$` Q00]1PI 0SP p Z [ @@P 0[ pP 0P U:Y `P`PSP@ TP@ 0U:W  @0@00囦IQ|00p@@UЍPЍ<0 0| Tla 3|x R R(0@-@P$MP U"  0P' 0 0  0lP $Ѝ0`0~\ \0 ދUD0@ @0 ԋ_D #_H4 "_ G-@PS  RL `10\<0SA HqPDDp  #)/)0PS-0a 0000S 000000 000 000 hG P00H D0D 0 f-^{^_^D^8^(^Tx !,]d]hA-`P8 0S@P$0S!0Pp @DP0S PU @@P 0U 00 s\@ 0@ P 0 ,0, 0 $h \\O-dMR0  H4 刀0 R X ($`000SYD@0S00 0#000 3 0  0_0P Yڰs@3Pp00300VQ QN  QI P0S_ 3/0 0P@ Up@ SP00SJ" 00C0T@dЍQB@@@,F20\ , 00Sq  R2$ |0 $@ (0-0L 00LP 0S 0 <<00@0000P 0 S@ $0S( @ ( 0PN 1S@iPQ 00C0 d!&`1` 0( 30S X @0!a,1, 0( #X!b 1  0( 0$ 0 $@ (0wP @$0S( @ ( 0@J$ $ (0 t Ml`( Ld L  L4 K `YTX  XX\ XX0$ Jx JP J84ŸC-`,2 M08@00051E@PrgQndea?#cb m!"b[n!3: bQmn! 13c.c0 mA #c[ 3nA3: c2nASm1@  00C@aa0C0C Cr  \< @P0$DHd(T,@VR gR 0` Z` 0 S} 0W0 `0R C W`e 0 `0 IISQ0C 0 B2 ;00P/A!b  &W0 `0R C S 0II Q B 0/C!b|: 00PW0 `0R C S00 ~`0Q 0900PW0 `0R C S0 \`w ~0Q 0d900PWe0 `0R C^ Sa* *BQ0/900P b bR  WE0 `0R C> WA0Q 0800PW-0 `0R C& S)H0 `0 l_`8Q 00P  YW0 `0R C S* *BQ0P / b bR  `' 0 8W0 `0R C W Q0P  ' 0 W0 `0R C W Q(0P &  0 W0 `0R C WUPU P Q0P  & 0 W0 `0R C W 0Q 0500PWt0 `0R Cm Wp0h PX00\00`0 0d00 x00 |0 00+$% WK0 `0R CD SG 0M0 S0՜W40 `0R C- W0W'x0 `0R C S!0051E!2 Cd0bSӢ Rӣd B3PR  b0  OW0 `0R C W 0h   phh0 S0R05`0P 0(30$W0 `0R C S0 `0P S0020W0 `0R C SWd0 `0R C S80 l` 0Sh @ Opq s pqf AP1  0S! -R8 S6T! P1QH<00ϠPWl  `(,/Q `PAP W/0 `0R C( S+0 ` |   ! !     l  p   (JleL5t1H$1T=GlFt xCL@4(. -4 0S<  P   P W 0S `0QC'P0l `0 SD 1hW0 `0R C W0S4 1W0 `0R C S0S$ W0 `0R C S 0UP l! 40LII< @P$D?HA1cd(0T,@S%!E_d2dN`Re0eϠl 0 bSӢd Rӣd B2PR  b0  WA0 `0R C: S=0Q 3 00PW+0 `0R C$ W'``#` `=o  P7 */ b A-M@pP`Q400 p00@00pT p`?pFЍ9"00Ѝ(@- @MЍ C-Pd@ M`0`@p !@@0  @  Ѝ 4C-@`P M\0`Pp <(0 @  Ѝ 4p@-0L| ^ࠓ P0L|@ T.^ԅT00p^p˅00pp@-@0M-S` +S`P0 P& 0.00:S V00c0Ѝp;0 P <0!" :R P 0 00Ѝp@-@0JS( MS 00C S! m1 P 0/S <0  0 P 0.S 0 }P 0.S  m1  p@0 f0@-e)P L@,(@l^3f*Sk Sq @ B 0T@ҜS_e P#Q@P Q\< 0\QTP@# N$0,@L ^0#S S 0@0C @l^#3S0@0@;S0C^:= 0T 0 P /0S/ 0 S/0S/0S0@//O-M01 S @ `< D`P`HP@L@ $ 84 / H`<0n/^`#x "xH q~~N`AN0S/"w ?'P P00 #1?B! 0/Z0S< # Jd"p J㩀A0S'"̃ ?,P P0 0 1>!0ϢZ0S* *Bhn ^a Q R SptQ)|rLk  NQ @( @\O N(  @,\H 0 $ `q @@!@m#W`ף pC@)n$A[ O@:(@P%! P,$3#`o0RS@0oS]Q\H NQ @ ( @\O N(  @, )|`rL$0` @H@mHQ!P$W׳ pC @*n$A Q O@:(P%! P,$3#`So0S0pl0E) L\H NQ @ p C$  @(" R P`[ Ϡ! +P@. PP` @ R  Ϡ ,ό@ ` ` ቢভ` fR$  ` & , Ό(` Y`3`# 0C Qp{ , SWl08?Op 0t cSQr`0;SdER/` ;0S ;0`0qP 匀Q@``Pe P0T UTN WVU V08P0PPpT0@`? 00?0S  S   P0T  ;/PT P0RSR@T@PV0PP`00 4 0S< ` UtMT00ЍWV `VT`pPp04S Qy4! @Q!Sx8 RT0SQ Z 0SJF|Flmph` p8`Q Y:Q@PTJ#M @AT剱PϬ P ;N0Q8 5@0(<2@0\?5O 0>;N$0S33K051E010@)y(.L@x/ᏒL`F(b@b BV+kYC  2,Ƞ @,c,0? yD@`|o'fl /B/_@@00@01>A@W "6e"$.B@- c0 Vy(: 6S X00[$0/!+>0 (A O!2c0Xÿ0+"  ?00 #2>[?`FW' @PG`m1%0 p:#0  ό"!/ W n13:$  p C0!".#2R> ' @01 30 #1`0U05? B4sppp0 0/S [U c0 x(: 6(aS X00[$ o0/+>`!0 Â!2c0Xÿ0+" ?00 #2>`T[j@tc0 $ x$: 6S T00Z$0 *>Â!2c@T0:#I0$BNo : $(sc0 (a ox(: 6S X00[$0 +>!`2cX0;#0(``8?O0 ` cQ0 R$I"ITY BqgqgpC(1 ? 0c0Yx0(: 6S X00Y$0! )>0%!EÂ!2c0) XLß8\?H)" ?00 #2>r?E$0CI"I0P0/A!b,!b S3 1I B !.50c((H<" 2c4 0S/  `00 \000U PE 0 S0 0(0 P P$0<Ѝ8\?H.+N)<2LQ @ 3 \O!EOό"!/ T(@[:.+N0 pC#". RD 7 0@0 030#!R̂"*h  “5.2L O\, 0C8PC@D10@e-0Q40000t )1 ?0c0w0):6S Y00X$0%(>!E!2c(\/H) L0Y("0 #2>N` QFw`O 0#"0PPQP02%> 0<R0  0 S! Pv}00Ѝ0 S. 0Q0' V 0V? Qw9`0O  "3 P  PQ P0V %  @0R Rh!Y0h&P l6Ym&N0@0W㉱@ 10:@W7  vP0WP@-0Y@0\0C0 pS.0h! /O0 BQP PsP t<,S 4 @AR|ZpXP 0 S RZ Q\ }Q! 000 0 ^\ 0 # 0 C!@0z@!FSp@0G@Sh50P0 Z 0hS01Ӄ!10 "0xY0Ih0  0 000 01Y& <Y90`S0S >S@`8S*S0S -S0 C R0p@0GN<)hh0`hlpt xЍ*YY -Y00I S0@0ISz0   S ,S;SQhAl b ;S,Sa Sbh^$- ^ 019mPhj0 @K19mo\Ϭh6Pc^9l ukt bhp& l&w&, 000 @ 0N\hP1x@PP *x @0 P 1 0 0< 10,p00P 0,S040uP 0Sh lub`$ `(岧p&Ft{,l6.Ow60k 0H!S1ð1e,p0P,0   ͸̼A-PQ@B 0S !1h ? @p Dh6l6 `V`P 0:S UP XpHPhnW pP0PT`X\PNLg@_`PgP`T%`P xA-`PA@pP pPPPW:rPqpATW  P>UH QP x1x!0` t  0V0 m``@ vc=D0C0C P S\@0d@D/  @DQ0?P0S00#  1PWPࣶ IK0U0h|,bP@L0HH  p 0 < tǼ (dp0@-$0$0@!R !  @-\F<l0hN 0Q S \Pv 0 \ F<h0 0Q Sp/@-xv 0 @-$@@uZo)@n `@-@@g@b p@-Eo@ p@-P7P  @`PPpAvP`0 2p@-PH@@;< o0 E?!P-p xp@-@`P"T000SDo80 @p X 0@- M@PF0 @~P00p0(0 Ѝ0(@-M@540 EόjP00p0(0Ѝ0@- M@PP0  EόTP T $00t0(0 Ѝ000p0t\p@-M@`P0 P8P T 00t0(0Ѝp 00p0p@-@nVt00QU d 0P@Hp00 P@ X |p@-@PP 4 0p@0 p@݈p@-@QP0 0P 4 0p@0 p@,ܰP0 0p@-@PP0 00 p@h @-DM`@ P 0` 0 m 0$0 $ 400(0jT0 (0Sp`DЍ0@-P X\0H@0Q@̌ 2Q0p@-P@000S 00Q 0"*X T 0SZHp<02@T_m  8G-Pp@b0jX` T[0SZ 0Q I0SZ0 R 0 R0\Z0\U T R 2R?T0Q 0 ^ 0SZ0 TUT@@@ 02 ^?<02 Q?<0p@-Pp@Od000S T00P  0zP@0=pm dP tp@-@P`P` U 0 D0Pp000\ LpL0AH H0 qU00B, ,0 q <$D0@-0@0S $000S 3/X4p@-p?LP@TpP  0 3/P t;@Tpl0A-0`pP@P UP }t( p?p `@G-P p@ ?o2W0S Z +` @Dv%:/P p@@TP0F 0 Vqt`GpPp0`P0 KqZP0 H0Cq80H4 40 :q|A-PP`@! ppT 5P ` @L2L€000#S €^"R804 40 q  4p@-@R`P  p@ 0 0 p(p@-@RP`  p@ 0 0 p`4O-`A Mℱp@|| kP2 0P2LB?0T- P R; S P@T" V0S !Q L/`3/L2 S1P2S? T030# T 03Sp0p0@T@@P20CP2,P2SW p W ЍS @  L3/L2 S @<0(< &A-h!`d1M @P00100P0Q0S0 V8 T?p `0xq80|q8O8T@D1@V  @@TAPP@P0@ 0 0 1 30ލl0Ph h0 pVP0QL L0 p)rT 0 Z 5 5(l|T0- 0 M Ѝ 4p -<0< -0M$0 0 0zЍЍ/ 4(0--M0 lЍЍ/0 0p@-P@X+f`00C`0Sp S u P X0` X PX"fpXu`u 3\0 X0`00C`0SppSr P X0X /XV 3-404-0 M  X ЍЍ/ 2-4 4- M00 XЍ Ѝ/ 2TG-@SP`n 0S:X( (S Y" UX e0p W W2* bpJ0P00,PQpTq0T @0 0` p0pWP PPpx,P Ik`C0 00 e /p0 0S Z0 0 n0 0C 0 00mel0Qh h0 nT0=P P0 nVe Ijk`|TTd8@--M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-PP$a$M@`< %+pP3 \n@P0 !?0P(/S!0p@0 0 0 0 00  $Ѝ0 f$Ѝ,p0000@$Ѝ00>, ,0 gn /t4\xd@-@P d0SCd0; 0 In p@-P`@i R T0U:T0T:p@[oRV@-p@-@QP> 00!R ! 00! \ uP A`0? Q0S0 0S 00C000P0S 0 U00SpHbP#bP ` bP \0<X X0 mD0W@ @0 m  Ao 00@`<\ RA-`#P$@ R0 ,°00aRK 0  a0R00S 00@0A PA05\ &l plL<0@^㖌 1c000A X \00X00S PAA0 S< =<;:97310/.-,+)('%#" wsrq" %: spR V@8VL0V & a0 Q V  T 4ЍPPؠPPؠ0 ## 0B Q00C$RNKAP00 x3 0S0V `1!'  x 0SM0V `1!  x 0S60V `1!  x 0S p 00B S0 @#"00B 0B Q$R8 x 0S p V0`1 ! xO 0S 0V `1!xX 0S0V `1!0 *RS 0B@ Q 00B S@@@ x: 0S0V `1! x  0S0V `1!    x 0S pD 0V `1!dx$ 0S0V `1!W V  x 0S]0V `1!F +  x 0S p (  xz 0S px) 0S0V `1!x+ 0S0V `1! x 0S0V `1!xn 0S px 0S p 0V `1! py xp qp jp& cp \p Up"s R 0H0py V@ `1 | x 0S0V `1! | xm 0S "pT 0V `1!t ; x 0S40V `1!e ; xX 0S p/ T- * p# p$ p7 p#l x 0S0V `1!'P x 0S p[ x 0S0V `1!  xi 0S p 0V `1!$R 0@C p7 x 0S p 0V `1!x 0S0V `1!x 0S bpx! 0S Vp@ x 0S Hpz 0V `1!  x  0S 3pe 0V `1! PZ X PU S PP N pG PD B P? = P: 8 0B Q@  "0 B  0B P$Rh x R 00p V@b P  p  P  p pO p P  P  P  P  P  P  P ~ P y P t P o0s 0 S ~p  0V@`1! P T$Ry@00 P I P D P ? P : P 5 P 0~ P{ +y Pv &t Pq !o Pl j Pg e Pb ` P] [x 0S pP 0V `1!p PE C P@ > P; 9 P6 4 P1 /O-oMM@P@ .H0> L0060 @0St 0L00!R !0s00`00  0S   R @0ܰG/@ \ 0 0, 000$匰D d0X00@T `%T @T PFU0pJ000S0P00pT P0r010( 0 0EZSf> 6_9'3u?pCD/{'(P[P    R\00sX @0S P*=RnX1R XOHX.LQT @h@Q0@F@ LD,TDlύ(8ˠ0<PPP_[PPP0@ 0@00h00E@ `P4$00E S$U (@F V U6 & <, 04   S !1R0q-0r0 0S^  0@TS@@ 0R00Sr0m@4 dp_, @TP<4P$0000S 0t0倀0@0S0000XX f)8 0 6 30 oލЍU_ }QP0r0@T0P0<040!(R PP  8 R 儠`@VwS 000Sr00001S \00000S00100Z @DT0 %0p0S0?0 (0PCU80Q0@0$T0W0Sz v040 0S@@0S , 1 0,040Sx0| 0t0 | 7R1|0P` x 0BD00?R0S 00S 0P00 t0S-0r0|0s<0 P0PJ$V"`9 F 0$P@p`FVPp P)`F VF p 9P0` 0r0UP$[P$dd0Wr0- XT U0ڀj@p$`PEU0S ` 0^PPEU000S;P00JIPC000SL;000000 00 `00000S00b|`V# 0D 0 000f&Sp0<P0$ 3SH0 ,  H0 0 rS ࠡ 40,0S R@D0 @RU_ ,^<  0 0EaF000NSe `Ur0|pP @@ T@P@<@@V}@p$p`FV0Sp 0P5`FV0 0 S` 0  @B   S,  H0 ppH0T@( P S , P1sO 0P0w ] @   W S,  H0 ppH0a_P0$ tVP0$ vPT\00P0S ?hP0PP0 s04$` <0TZ pU\ U<0PEKJ\0E40C Y Y ڐ \>Y @L @TTڌ0 @HX\  PsHX@ P0\@PYPQ/x? 00 %`x00CD0[P6P7r0$sV0x@ 4P$P`@K[0S`0P0< 10R0bB+ S- C S!!/ N L ScS!2e00 P a000AE0NQH*nPN0 ` 00ST>`000N4.0>0 0 0_.3> 0 0_s@PH0, 00 ,  H0NS , P +SH , 01H S`-0r0͵ 0SG )SH0 ,  H0 4P `00S=`000.P~$&X _0p@T P 4 cPn$?0 <ps0,00,mdpX 4,oHp   S1 ,!1SH , 01H   B  r S,  H1 0H ' Sx ,P   R S,  H1 0H    S  ,u|P$?z,@p`U(ʼzp0r0X R <A R R R <PXT@0p_4@4zpvHP$os0^,0< p ^0my8X L\ <\LP8T8`#pH" . @S ,eO&Q!Q@!Z0H Q S 00 Q00S 0 0<8`40dPTH @,00S@H0@, 00 ,  H04 0 , S |0D@s01wPD$4 n00 ER 0 "! 00Bd00?R0S d Tr0 @0p@_T@P@<@ PSH0, pH0p0mSH,, 01HSH ,H   . S , P1nsSH ,H  pS,  H0 ppH0ZST , P1s'S,  H0 ppH0G vp @ L LPmĎ8c. D 0S." 5 0001? @0 D0d0up x04 S0 1(0PkP$S < a @_0p@T P uv0`f5@4PP$`FV(0SP0 Pf0|tpM40 ,E pH,00H0S0 004P00S4`000|`#3 T 0] @0 WhH0 00H0H0P00H0H000 H0H0PH0 ZH0 00H0ThP4X W p!H0HiSH0,H000, D <@BO? p`]L  0pP 0@00S ,P!?DS ,S ,?">2 0 0\x @BD@0?V0H PH ^ 0  0 @00{pm^ 0  0 P|`$H0PpH0$! 1  H 0[\~@n SH0,, H000B @00Ep 0SH0 ( H0H P0H uH s(sot dH(j 8 TiT,hg\ fl~hH0PpH0-|0S P,@% T P J0IP00E SE@ 4$00A S$Q0S) 1 0P 0@00  SH0,, H000^ 0  0S,H01,  0, H0 @00pD 0SH0  H0 @@-` MDP@pR8P0 XPR Ѝ XA-@P`pR0 CPRO- M[T0p/ Pfn_T  ЍO 1[D a `Y: 0D @0S0C C.\0S  U #R   CU&b # 3S RUY *CUR"W + W@`pG@0S1@FZ`U00 E000DT ЍY:`?C0C1 0 ЍO1 0S  ` 0SQ @e@`멟P/ P P0SA0D@  R=U0 0U,  sR  Y 0D@ R(U 0U  sR Y0D@ RU 0U  sR 0 0000D@ 0Ҍ `hO-@؄dM4P 0{VS0 0 @PhV0ʳ?G ` 0 `  @  YR Y X\@P *:X X ?C0C@Q K; t:+ A A{ zZ`pGW BBL3 cJR040$00p80 0I?o R2<0FR00C00  BRq|20 Z70  dЍO\00C QA΃@a a7̠0C@g  A040Z0b$00$0W$0p0C$00gp80u`P PdЍIoᩒቐh0pG400PD0P0(P00\0Sp Rmʤ10[00ӥ?+ [ +b +xP`0000   Q0`dЍ 0   D [ (0(`P (0 [00RY  ( R S{\0S]0SZʶ 0 UuDP 0 0 0 <  dЍO?҇coCa?Ɗ(`ȳ?DPy ^4(`x0 R1 @ RC$0X6h0P0e $ R00Z00S R0 0HJ B$ 8Q 00S2 K0P0J 0P80E D80@0P= W0 Q <  `R$ ` $ 000 Rh1 0""1  1 +00+R 0Q `  4 R J [: + A H$ %AL  H3;B00SD21+S| 0K  +{ * r0  qK; P7 `a{+* p 0  J+t+Z SP0CVd  s9R  Hr ` S( : + @ %A +1;B r Ba J ( \ 30 c0""1 a  30 0 a P  k( ; $$XKZT4 R[0 Rcp @PP  0PP0S0SH Wp 0YZ Y 0@P4 00PHX= H Y9R p nDPe8@P8080@P+0 0P 00R0P0 D00[  B DS $QWp F 4 P<` 8 0`P R50 $$$$PQP 800 SYXQ& 0P<` PW 0SW  pP`U 00  B ;[ 00J0PP `  1 0Sx0Px 0 Q < }p 80!80 `4;bF +0{* p@ 0 r  +s  Pq 9J\0 (R0?0S ^0$000\ ` 0 .;0  Q `{ A *N pN@  BB*N*0 r  P`r< `  s0R H0P`0fXs40 S`%  Q@P 0W H0P0  ApP$0h0P0$0H Y0R p&p$0PP    !WI$0pP P ?0b$04g40w40PX0 0C0@P 00S40D RL  B DGDX0So 0  k QQ(0S Y Y~ R0P<`0@P{ 060P9UT 1P[ DQ+0 ;:00CH0+c  +" @P% %@k0P0H   1 (Q Y2 Y p b )& PH| pP5 pMXA0S 0  : Q Y0P<`n 9UP Pk 9  p R R R  !**R WpH P` [P `X 0SOP`P R~ Y p  1 2 0 +h( 0Pp<`0P9U<` X[ D P 0 A-`@PWUTp 0S*P@ Wp&@@Wp$S WT@pW@P/0#S00/\S00//P@-@00@ R/P@Rp@-@`0P0PR*0PpP R 0 R VpP0 @!R0O- MPSWPE@!a0p  Q V`":  0  ơ R  RW0  * 0 S 00CX:XPE* R P  P  00S 0S W0*!1R 0CX:XPE* R P` ЍP0.- UM,@00L10U    M<` 0    VV H-,@-`@-p@-p@-`P@ TP 0FP R @P  U00pT P,0?( (0 mT0PAHp@-@P P`pPP  Up0: 0 NTAdHP-M ЍpFF|~pq1hpqpq1`p- M ЍP/> 3D-@"M @Ϡ#90c 0Ѝ0@-@PMP  0  Pp`Ѝ0(0;$ $0 S  J0Fl p@-0@Q r P p0 S!P00p PP    !T @0O-M`pDA@0DQ00P;5X# @0S S] @   b 0P19  P  0- T@@  0  "W @TQ 0P@020  0 W` ЍQe @0R AX00@P00  p 0`00R-@0QMW 0000`VBoPQEp0 0 `b V 0 <T@P@00AU"000@000G @ 0Sd0T 02a PP @ 0"0! #000 $ @lx`@P 0Q/ R  B /A-`0@bSP)p`B @@AV * D0 BS   `S0 pg3701@V * CQ B   S i PPO-p -@M 0;0 0 44N0 l x $Pt0-P-+*)('&%$ \c000P0(0 00@ S0040w`@ #T0`Cڜ T0 @t@00@ S0`\ 0 EQ"(00 tp0t00+S\ -S80800t000C ^0St`t00S 1C`\y@X 0l@ 0 A00S< S6 ?o2D0zT@Xg  XH  ڐ*8 g +01S B 5[XӰ00S 00S0 %0hSH0pHp |p p E Px |0p0|0 pLW( |0 p0|0 AH  R Q8 $pCWM px Wppw0p000408 S|  H00S~80H000$0 ˷00 00@ S J ?( L0TT@9 PT    !Rx0. @PI x0   !RpP|p E `P: RP8(0L0( C0EL PP PE0CPpPU00 S 0SPEpGK(0S}EQO00SW[  `P   PP 0S0Sc p D0P S X+ 0S#i W<H08 S0l0 x [0[| KpQ 0Z00S@00X0L0p 0#Z00S|0P0I hd\ 0P$0 dQfh[xp  !f $x Px 0 S B\VH08 Sp  Bp $  XP0p |00@0C?oQ20S K x!)I 6Zɋ;0S     0SpЍ 00XS PtP0P P0(0)x Qt000Sl00l0R x lЍ ( 0 RiS IS NSt@TP t 0000(S0l0 0x 00nS 0x tpl0PI `P ^ `H0pH00pW|UWX  @P `JT t 0h 0C ^0t0^00000t00tp@000t0Pe P00W'"40bHC0 V:A?CQ0C0 `1{F`1{V bR\zGpGp04656(0 H0`a 00 S  Q`a <V fmHf0S` t00S l` 1CQ?tP00C0P 0#00Ct00C Y2` >.t00C0N YL`\@"8Q@a@jt@mP* t00Ct0d Pt00t000000x l0x Px3 p00p0s^H0|pH00ppg  1 01 po W'"1bHC0 V:A?CQ0C0 `1{F`1{V bR\zGpGp04656(0D 2`a 00 S  GD0 0l000 )Pw|H0pHW 3 01 ` PeE  OW 0@X0I$Px  B\ 0S. p 0 p 0R00`P n0P$0 $0@r > Pv LPnx2 Px} H0| $0C BH0| x:00 W0 0X0 ዴH^@UZD0{S相zI87 S' )a0P$0I  p l0X 0l00Sp0K0S xPx,  |00C |0 0V TRTPN|0 R# 00S S SJ x? 000 x  l"!@Q*N000  0c2300x S 40S 00P0l0!P"000Sl0000l0z @0 pBxPx 0p0|00C|0HR00x0  0l0O"0 000000@ !0@l0 0X0I08000D000cD0  L\I\ R0t 000x0Pl% 0x Stp 0p( A+H0x0H0| $ | X ,00[a K Px H0p0C|0 PxK !\ \  \\Qʡ 0%^@|0 T[@0X 0@00 bX :相[ "|0 S|010180|(0 &| l80 `0!5S 00 D0!  l  `` HP x000 0 P `I 8@XXQ8@ `X]Q 0ӓ" 2  0D  @  J1 l000 ` P Y 3l  D0000hA1! 0 ` ` ` 8A+!^0 805 `0800 0P0l0 AWS!00l0AWa 0Sv p0x |wQ0n80  0 0Cp |0!0l0%WWZ!0l00H 8R0PPJ 9P |0 x 0Cp|00l0Px90Ss'@  000x l0Sc x 000080|0P0l00Z!05 l000# [00Sx 0 WZ 60l00 3S 00l0 Px  p`1`f`Pp00p0!0l0H08 xSl 0S!0l00S40040|0p 0C|0v@-~00&G-` 0pQ`pp@PP PP `q0Ws #8z *8 A"80A# G0 BW`E   3a V F A0Rs#8ᶐL)80L#Y 0U 1 PP R`P    !L@P@3ßO-0M@p 00S 21`C`0 000S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WJ:Q0 X  \60QR T0#03\0SuWa* G0V*0F@S3 F\   K0WN 06S ЍW*@DPD@ Q0; Q0Q l@ l@4 Q:@00XS Q0nM)ARo 婒Y" 0^0 n12000 QP0Q0l 1 c0R:|00Q )Q 0 xO-M<0 THT8@`00Sp 00Qt0P00Q  EB0SG^E@0= PQa @0 \ ES YH P 0S S SC `Pb@0@00 00Vp@ !KT q Pe 0@S50000S Y 0 @PQb R  BPQa S@0D0CSڣ0SPW 0S] E00TY0 p0TDX@N S0T0@ T  BB! BeP DRy`0 S0 S C U 0S S S KP@"00ЍRq  BPQ+Q~ -Q  NQ @N AY  ^!#AAPPn(@Ѝ P 0QP0Q 0S00 MS S80S "000 b@0 0qK"00@B{`P D` 212 Q`rQ  Q P PR  @V 0Sf Sg S @00ЍaF PePfv0 S_K@"00ЍP@0M@EPL K`"VpK`W `2 p 1 PE@7`DQ@!80Sj80S 000i U U EP 80S800c8080S `T0)  RP!@L#80SU80S Q0   B @P Pwj 0`e  BR "@`P3 `2d"P1 5 | P /A-@9>8C RP`.pn3 ^P W0@00 pU 0`PEPU 0 BP @` pV  p0 BP0U`0@-M@Pd ` 0 B0C2S   @ JB@ Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ H0"S1 1  !2R / 3RS/00 |0 c R\0a X0 c R80A 40 c R/SPTS0(S A-B^0000`Q1 !0U a2!!p(  U2!NRA!1! 0U U0N10CSC10R 00@-@MS: P @  0Q P~@ЍA-P aM1`p0S3 U10AT !0S 000ŷ "@T0  0S00 0Ѝ0@0D!1S<000坷S 000啷 `t8H >p@-@P00p R pPQ`00App@茷D `v80 0QApp@j $tH0  0#10/sP#8s R#4#2#10 0// /A-`P@100("@Up0p 0S1pP@P;pP    !G`~P081#3S412s2sS/1J //@-@P0@0O-0MZ  @SpPA PaU* F B  F  ^'* 0H X0C0003 00ZP@T   `d`` XZ P` @T@T 06S @ЍG-0؁@pQ$A/ QPiV&10SO`P[ 1q0i000S h1l {0P4 p@ PU `@00SbPP# 000S 0B0=PU 0C  pPpd0+iV0S 80 (0R0i ( tH \G-`P塢0P@Tڃ0T P$ Zp !p'F0  i )  \2!0L\0C0003R @@JpG \ -0P1 0^$23\ *G-P@p0@DTE1  0\D*32P ::P  @a P@0 0S 0SQ 0PApPEQ%Q  3!!@ V 0 0S03#V`F `F` 02NS @0@PpP 0!QQ!P3 p@- @A`DPD P 0`0R @ *\ l0D1R %& 501 P%&0;BpR `C5,5#11C,C-` MXP=@P XzX0W6Y0 W   0 C~GpGp50cp0 Ѝ  0P c2# R   W C>C0C012`0S0/0 R /@-phaM@P`D ?P7PP5 òpP/0 S Q8 p! 0: S1CP 0uPP@0 000  0 0 m ЍF00Ѝ\PP0EL L0 CF00EO00 T48D,㯳p@-@P 3:00C0S0 P1:pP0= 0 C\PC@-@P 00C0S0 @ I0 0 CCp@-@P`S 0rSL wS aSP E 0 pP0S! e C+Sr0 SR)# P0SPPp0S0S0S0SP0> 0 #CAdAp@-@P7 0S= 9P00 P! !& 0S 3/PP೼000P @ P 00 `00aap9?`` 0p6P008, ,0 BEP 00<T@@-@P 00!R !+P 0C 0; 0 B@L@-@P 0 0 S @60; 0 BPx@ p@-@PQPU 100SD 0  [Y ;000S% 0'$0 3/0:s00P:p00P @ P 00< R 8000SV70 0PᆳHၳA36P00s0l Jh0h 0 9B 0@0 00 pZD0 @0 0 $tp>l-Ѝ/@-A@QS S S :D 0 6@@0@K6@@0@c6@@0@[000 0 0000/4P 0p/@- D/41Su C-P ! M ae`@`2/A/0@0 Ppf APMOĀmpZ@Q 0p jPU`Q 0pjPJQ 0p jP@ Q 0pjP6Q 0piP,Q 0piP"Q 0piP@Q 0piP  T Ѝ/COCp,q<Q@-P @41S b P iP0iCA-4!@O `PP/1S 0L1P@CPPPU!RMPPP !Rp V ,C`_oR'C`$C``@-@P 0@@A-@`㴿P] VapP᧿PQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ   V BPCBPSSO-P M. Sy$AT`p$a a(qp A`TU XX`F( [ʋ Q `(q0S 0ZP@  Ѝ0C$!o?P$ (xp ₰\} Q 0x@^`S0S ?^0C pF p(VB (  A$!T$$( [ `( A^ \ :0   @PB, \$!C(1s V(0 ?Tܰ0 ?Ȱ 0 ?갰 (![ 00Q($1@ (A$L 0 oPd $_ 5,50T5 404O-,M  R0 1 p3/,0 (Q0 Pt @P``^$`P 0BZ@ P@U pWW 0 m`PL @R㲀( PUJ[K` `,Ѝ 0 6nPPu/  $`tnPB $ 0 D`P# @R㲀/  P^ ^5 ^ 0Q#`[F PP  9fP0 CiP@  ,Ѝ$`0  ppJnP   fP(pLW AT(Q`0@-@ 0! \ @+@00,1@00S@-@0 @@00,1R@-@1  0@@,@G-0⤕SM ? Ppw`Y@P WQ   z @P 0 p $ 00,  X 8 4PD` a>?@ :?H PP X P0^4P P3S@ S S0@4:P30a D PH $#gP E1 0N `,00(<` Y5PXJL P 0 ]p '0 Xl PUi A/ Q僬p APXae`@YS@ZO2  !2/@PGP( QPC 0a0D!NB1\ Q!tX QW0 p$4q$弻Pw R"1`qQ@A `  ލOp>!?pl P? 0``p?p?Qo?Z. P, 0  8P0h 4`D 5>@ 1>x?P R m?00j?@pd?pa?p?0~Y?`U?` nX- `O-@(P0P!0`5R5s`(P5QܻؑP- (q ,0[ D D S 1"1 O]hꁡ P ر % J= xؑ@-@ 13/, (Q0@-@Q .00 2> 0 O-SMf `& 0[ p0P!W G QZ Z R U UUU  >00PЍ5 p% 0 P !H@P 0$ Q10!12~PP- 0|%S@0 2h5X  00T50 0L50 0D500<50045000 S S n>00P ֻp л 20 2 P0 p ,0aWp W|3Wx# 2[ 00 20120GqS  000 1S 08 G8@X*xwX 0 3#-P0 "  -P 1S0S1S .1 29 21 29 21S 28 2DR3S # .8 [P~P80b @S ; D St<@ 0, !pSxS<#0^4%0^8&0\4)0\8*0R4-0R8R,.0/ L0H $^(\"p+R'+ ; 0RR, S$ S(S< 0 +;+ ; ;2 SO<0SL@p`|0x x0 7z_P00@ <0< 06?ᑶpl(ht A = 111Q/C- MAT' }PT# `P 7i 0 dAT R0 X 0V@T Ѝ0_P  000 0 1 01 0/p@-P6p U@ ᣦp p8P<8P@x!x1 @-CM0M@P0,40eP9 D10@!,`@  P@*_p  p@ Kp#  p U ap ̤ 0 0 ,4 30CލЍhR10P_8 P㳤W8P@S8?00 Npl MO-p@P\&`X6TM 0Q0L00 ?(00 2mU  ,800%5 0 L0 30rTЍw0 0St1S7  'P䁄0  0少0! 00 B0R{?0尠ἠ:1S ZY00 wP 0尐00o(0S !'( 0P0 0(00U P0尡1  0C SY*0 00 P U 20 2(0} 0{w R!/*R$: pl 0 0S$0<008004p@0<040 pW 0 0S$0D00000,`H0D0,0UZ &P@ 1000EJZ㪠*z0Q* C 0@! B1r 01 0!!0(0  0RG 1S RN  RQB  -'m 2 T 0 zpM 'PF ' 0 QIY㩐J*yI Z00 P000s000 0 1 S0"1!{/010CS`* v00CS {?!0b 0 4`600\0bX X0 4D0b@ @0 4 M Lˤlp|HLXO-(0Mp D @a0cPX0yP P FPJ1ZuPp01a@0  Q1S@10CS㣰M* 0Ks0S0Cs00  VrS10C1(0 . Ѝ @Q! R b0(0 `p. 0     QPL p P p 0 0R1 S0C1ȁ2b"0 3Ta Y  0Ip1P(00(0M QPEUP*0EY!:YQTQPEUPi*u00CY Vp崑 (00(0N1b!0 3u00CY* 0p1\PQ Y Q H%PP  @PAHPA(00 (0%0!0!0@```0 `p崑P j %PPe 1P0CS㣠 * 0J1P(00  %|0bx x0 T3(00(0 %@0b< <0 B3ƜDTTp@-@PQQp $P 0 0T%Q $P 0 0G%ppO-,Pa V0Fi 1$@T `Vp0ഀ0 0 vpq 10CS0*S0SS 0S P 1b!0 20p 0 Hxs1FV㴠0pp1  0 S001Qp10CS㣰5*0Ks0S Cr   0Zq00R10C1 $ R `P 1 ! 1 P $ $(0b$ $0 s2ĘO-pP$M@Q $00 2T T 400@$Ѝ(  @h @$Ѝ踷0ⴧ0 7 00 `Pc  R at@ Y*P0 PaA 2@D @`T㴐: 0 b2갑@IY00*0S0C0y   Yo0pp 0BRs00010CS0O*SUP@0 #pP 10CS0*SP 1 [10CS0@*S#P #m #gT*TP^ 2@0 2$ЍX5bT%T0 1T #(5b$%$0 1 #Y꺐Ioᩒ #/` #00 VP" 0 RH  @`ph S9 `V #q,Z@ t@@D X ?#q Wq 0G 1"P AᴀW@DT@:0b 713b#0 .1 ^#t Z# "pPI Pe 83b4#40 10@W1 @0t@@C 1p 1 0@10@pC1-# "@P Y0*  # "P 0zd2b`"`0 0@T} #T 200r` " Pd ,` 0R X "qW@D "q0V! @0G 1G"PC WR  B1T@Dr 0ⴠC 1 %!0Its0p崠1 加  @D10p" "P 10CS㣐:0b 0 d0  " "P<HH@-@PM 0  0P Ѝ05 0 )0hO-p"P2JM @P M`0040h VW00?$G?7O0S 0SNIPIT/ i"P '200P"H2 0 4 30Jލ Ѝ$ >X00 0UXS 0 I0;w0. T:+[) PK0/S  0嶟00P0: S 1000S0I S1?00(1C$!$0 /QPPV$ 4- 8p"10S X 0C \0 RK Y !P100W np wmP 1@ol 58 4 |R Q0P:Q0Q:}0@-@-@@ $ @ Tp@-@P#+P$ p@#ܟ d @- M@0 @ 媯P 0S  ЍD༟ TO-\MkeG3@aPdF`xF0p P  $,04@< @PHy     @(0-C8`DLpTpP `` ` @$ . `&(dHnfhlȠ 0#PPp' c:P "  @$b*P `&gzeZdLfl `,``l̠ . "` n0#P%,\ p'< P| P, @$ ` ,.dH```eXlȠn `0#  p'`c: gz P% " ,e\`   "l̠fjb*   @$ 0#.dLn p'\`& "<̠|,r$PP Tp(pP0, `0P4P8PP<` PP` P @P@DPHPPP 00p  $( y",`-"C0 4@8F00k0e4G0 0\Ѝ@-` Rp \M0 @ T 0 "P  00   /@ m X P0 0 T0 30 \Ѝ0 7,0, 0 -$ , ,$W|x,@˔˨lˀ`@T8,̼̐ʐʤh|O- `P@P` 0S7 2 >`0p! Q0C S   yPN 10CSp'*w0 p0C 0r P&0 0Rᴀ  `崀X 00p10CS`7*v0W 0b 0 $0 R `崀 `V `崀 0R P 00<0b8 80 d$ ȐȠO-pP,M`Q 00 VV 06J  (0`FV񏐒ea0FSW&00@,Ѝ(0VP ,0`1V 0` 10`1 I0ⴐC 1< @P a`FV`:жb̦&  0  # 0 a`FV`:v` 0b ` #밑1I0Y㩐`1: 0 b#1,0@1S 0  @0 b@P 10CS0:5b%0 # @ ⴢ@P 70 00(0rυ@ 0⸡0 (0`=` 2  00@[  V0SO 0SL 0 @TG @崢 0 vp@8 0S  00 @P' V@ V= V(0 YSV_ ` rV @P 10CS`*0FsV @崢긡0 @(0崢| P@ J @`F v洢k(01ḡ0CS㣐z:*y0ZV= ` .V @PIya @`FV`: 0 b" @괒, @ 1 @P 0VSTa V0F 2b"0 ",ⴢ @ 1 a@P 1ᴠV0CS`z$*v0Za V0F  ` `o10ⴠCአ !10 @ 5@P[1b!0 ~"0Cs 0 K 0FsF 1!0 崠C@ 1 @P3 10CS`:p0bl l0 Q"X0bT T0 H"$P@P4xD\lp@-@`PP ơ0 00(0`0Q0(0pO-M5p@,0 0弱 PI 10CS`06*V. `s`V P @ `Ft@@ 0P 0%00 10@@ [ @Kt@ m0@$b0 ! 00Ѝ 2 P UQ\10CS@*t0UQ 00P RP @ ` aQ P a0 [0 t00CQ a[ 0F 1&P A0V@DT0@:3b#0 i! " PQ@P Pw 10CS@t*0D@  1 PPe ya0 [0N ma0[* P0F 1P @VT 1@D Ut@0@CPE 1/1b!0 !1@DUPEt@ `@! @ 10`6 PP 10CS@:@1b01H80 0^@/0S(00S1!R00:X Y \c/ C c/? 0@ 00S 0 Y@!SR@T 00 R 00"00\'L7 0 2 30ߍH2S$70< R(00, 4``,‐\ 0(,0(`40ᴒ 0 P -p (pV:: :J'` #x6 03l6_W0ࠓࠃ4<Z00Sg  0\ XppW` p```ZX 00S <  Q(( Q -`p00S !SR @T 000Sk00r<Qm 4Zs p`p Zl X`G 0SR 0 OWP Z\Y〰JX  R+ c/k@) Y2 !SR`@T 000S $0S !,'0 0S 0@T` $ p P!SRPU 000S?00 ZY〰 \c/ $, p <Q!SR@T h000S00\c/@@ +Z ` V&Z"0``0S$VX``&pfX``x2 0

z Tt0 000S/g t0 0 0S/p@-@0P%zU00 \A\Q X! BX!R p@z`.{00OT!nz00p@ z t\ \0 -4M0 0,008 00 0 ,0 304Ѝ䟴 p@-@QP  ,Dp@Fy09 0 ( #_4O-M`P؃@D@ [Hp0VV^ U0DPW pT"S 00 @00`Ѝ0+ 00( 0 0L0W@ 0S  00 000S0S Q .[ 00SV00ЍW00 Q0![00S0S @ d0K` `0 VH0MD D0 "00@ "00"$!-M000 0 0 000 0 mЍ (hp@-@PP` 0S'U  ppwP%0T0?P0p0:0pl0Ch h0 iT0AP P0 `0S 40B0 00 Uh \p\D \L\H \ p@-@PMP`& 0S/U8 0  p0p0 0pq 0p:p 0Ѝp@vQ 0S%0: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A @0@->R0M@ 0 000P0 01200 :P0ЍN00ˠ0@ @->S0M@   "00!,3,0 P0Ѝ*00@-@n@n0 00/ l,0,0-M 0 000 0nЍ ll -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ lt@-@p@-0@ ,p8pP&h0Ppɼ////// h//1O-0,MPp`W 0000 00"02000( 05/,Ѝ@PK 0S PPP S0S2*,! 00S S' !S000S  0S S * RpC 0QW0010 0 'S0000p0l l0 )0T0P P0 룉@0ʌʈʄd$;T;(:;/Z/[/O-M-0= 00000P0Q0S7 X@ ZO\=  0 0$0@=0040< =<;:9876z43210/.-,+)('&%#"z 8]>X7  eTY+ p<0< 0  0= [00K0"2 0 0 30Ѝ0 0 /  ,  0 @p$2000 0 <0 0@r   0 90 0 00@ 0 0 lQPI00 0$0@! r 00 0@s0 0 00 00 0@r 0 0 0X 0 00p0T0  0\ h:|2` ]4---A-P@@ x0`pP@PU J0PEX@S 8/`upW$0: 0 g Zx,, 0SS S 0R / 0R0@o/ @-oO-p !P1CM M@`00440\@ V 0 @0 44 30*Cލ Ѝ0`P 4 PP zp 0 dP;L+ k  0k/W Y Y| Y`+G-`0S+ S'QU$ pW!@0 S0P@0#40S 0S0S0S# $P Y Q@0 0R!R  "$ R R \O-0`BMMVH/ Pp! `V' 0 MbP@P Ubb0 ZP?PD <0 0 4 30BލЍ꼣 W V`O-8!41 @ AMT M0040/ 0Y,:0`pPx0(S2 0S"W0 0@T bb 0 P pW $ 0  aPH @0 0 4 30Aލ Ѝ0x0(Sg V UO-mMM?x /| 0060y @x?T080 1S 6 S`1  8 ?,@ X@0h0x |=  @0P0 .0S3 SH0uP`【  R SP4 p O ḐgP* R!Rㆃ>P @`PT 0STup P```0SPU @  Y 0S(ڐ- @ T |- \ x X < l Te 0d<0v?HL00D0< 0h S1S D 300S S00`01D 021帑Y[0P0S|000x0@0<00SsATp D0CPo L0PPPym 0;[@@ 0 P E@C0P>P  D0< @0 < TL D0 L dH0S  P0S Q <00ox0. S00P00SS |`P@*pX 0@9/PU +: 0 6 30qmލЍpW? <@PL0Py !fL0P0   8 : X0X 3L0x<000SJ0`0KD0`Sd0c  K`@p0G0 $ VG 00P`/.$0G A D(4, !00 0 4000F00dPPB U0S0  QN `1  8 l9T0 X0H0[H0  0H0: $0,0 0SL0@ ( ᐐ#/E)b,"dP A0S =@;0P w8t(@' 06 4 H0 H0PC Q   0 0@ P0`1  8 7\0 X000 0 1 01 0H0@`00 @ FdP& 0 Ps `1 s 8 60 X0aO00 0 0`04PW80&D $X ÆLP0@!@    0 @01q峐1W @0@D ` PT!> 0v/$ W G |$   0 T$ 0$ 0W 岏  fv@ Š01粐0a 8 4P|@ X00H0  cP0kL =@;0P v8t$@$ 06  (0l00H0u8$@# 0 04 2!  `1S 0    0P0H0`PTgʌ PH ?`!!! Q;   <38 @ X0 [ 0P RB @ aV @*Px 0|@6/P0+S .0CS@0PPtPU a8 L2@ X0 0`!8 2@Xࡅl S0d01SD 3h0h00S S`` ``P19 Uh0 .dPm0 h0bP101@PDp^pP 0@ 000 b@00P`00P 㸐D2 T Tx&&& O" ht DxDd,d|pd|XLT L TP0D Br DR vbP0l0P0@@ l06SV `p$0I^[pY0P0{ D0P TP0D Br DR CbP0l0@0P t8D!@! 0Ȅ| RW00 0R 0`1 k 8 10 XP0 [0  Yyt8!@H"H 0⛄$0 P 8 @2 X@0[0  k TP0SZq=00Kt8"0" md Gr R000 P T Br DR  R,#aPʏHp0 P @ 00IcPhP 1011S1$00u8 30 X00<0l0l00e8 4L@" X@0o[0  B00P8 t4 X0Z`mW 0p0h (0l00l0@0P s8%@0%0 0؃0+S .0CS"@0P s8p%@% 0⽃ `0l0`h0 8 fP0@ ws8&0& js84&0H&H 궝8 h6@lX/ /M-   0 C R1#0e(6, Ѝ /M- 0S  R BC0S N  Ѝ /M 00S 0 0 0CSЍ/RЍ/0@-$MP@aP$Ѝ0 aP0/0$Ѝ000 $Ѝ00@-$MP@aP$Ѝ0 aP0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-P#2CM M,p@0Xd0,401$D D$ 000 S  - 0p p P@ȡ0$ \0Z PN00A  !< S 0 Ł\4 0; P0 00 00; = P0. [ @010,430CCލЍS  [ 0S0Q( Q" Q x[     q 0 Xc[[W[T[5 ;ژx 98 T \ HPC-PH AM@M`p0 4" R3 40 @ `ʀ P,8ĝ0  0 0 4 30!AލЍR@ PP 0@ .R@@T  ࢀ@ @ Zכ 7  78ל  O-!1AM 堡M0  0 40PH`pPLpoPG `PPB @ t+0'CP7 0S4 `  0S+ 00@ p6P00@S 0S0S 00@ K@ @b @ D ,0 0 4 30AލЍ_ 6X 6@ x 4O-p#3CM M`P0@X0,40\@_Z0S  .S@0SV :T d1#T#*0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $Z000$0D DR @@ 0S+ .S& 0Pʩ0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@( 4P/d!"" 0Sx0h 0@$0000^0@P@Tk0!0$  00$0s}0S 0S YV0 qO0  Y` 4| 3O-p0\MP2@0`#T V 0US#:Š@Č&Œ0/O 0pV 0 `\Ѝ"0R 0  =V X0 F0 0XP0wps2Y.Y0崐SUPPR   B RX00 B 0lXP YYY `H Y뺐0?T0%0 `F 0S0  sXwX X0sX0SP` 0  P `B0?T0S@0< <0 Iz`H0?T0 0HŒC-@0 Mp`(P)@D T@9)X?XpX뵐0  X  @X U@D0 T R00  ЍP D 0 ,0, 0 @D0DG- pPᶒ@Ẃ`- F0SP`?0WV!;` aXP]X, `EV00W0S ?V0*vG`EIX@T@V@T `Z T =P0P  08 A404 0 `0O-䡐 MP0S5 @d @V%0V@Q\ 0\\"  p偣 pp p +; O-aM0 MP@060U0L+ 0 qT =0H `fi@01%,)d!0"d! . 0`1111A0500jP 0ʏ 4 lJlz@p", d1 0d1s, /P< `@ ]`0H SD@_i S\  S S00 Q@0S SR: C0SQ0 0CQS00000X9X)|`P reGaoF( 0e-0a.F$0 t"o#G i$p/F v"e#G, / X  +0=P 2#S;S 0 S" 0 S 0 S> 0 S 0 S 0 n?R 00sS2 S S 0(( n9R2 S S0S 00 S S SS@@ `0 J]_A0(0P@ 0, 0S? r5R2$ S S400R00S 0@0 S S00 P"P0S S 6}_  05   `X10K PiTP ReP $0LTP $0R@~C$@Q$0P S( 0d10d1a AX|1|ZAp 0τ`0S X `0`H@DSH .S0SX P`.HAX00V0S 0 P % +0$004 0 6 30!aލ Ѝ t3i* S S00 QP0S0000(0+OϔP.JP `&\1 PxDQ ЍA@tP 0tP 0S@ R @tP  A0"g Ѝ0   g Ѝh0d d0 PP P  DmmXǐ(XTX\ 䤰0A-0PU" 7U"P7UP!q|@@``FdP $dP 0!E`$1(`P 02~PlkO- Ff M@`0, S0 4 V FPp$@0(RB 0vW\0g(1<0 BRS %+38< 5 0(< 䕟1 c 0@0(@'p4< P( P| ptqpd 40Se0S H 4 0Sk`6S (% 4 0S 00S S404 RR 4 "S , 4 ğ0 0  ( XA3*0210S Pq00 S^P40( D40 0Sp (408s1%40(8p(JnP4040^30( p Ѝ 00R 0Q*# 08sx30!8(p04Q(A%01Rx8# 30<!^ ^ w䂟 S:p 0(" <!%p0(0P^4)|20( p2 0(< \2 0(< H2 0(< 42 0(< 2 0(0 2 0  8 ( 쑟0 0(0(1 0( 긑 (0(10(0 R 00! 0t1t0 0`10Xp (4p Ѝ:p N5p 0o ^8snqpz2 Z 00K  ekD kjj`jHiiiihiLihh(hHgxgg@gfffxf`fHf0ffeeeeedeLDl4܈,H1O-0$M pW G*$1 Q0AP01o@0^O, 0 ^/@5> 00S@  @ 0~0 T0 00Z @ :P80 0 0Z@ R 0X$00 $ЍcPH84b(0 $0 @- t|q Ԭp@-@@`V 0 CQpPa=bP  `FP    paP 0`0pbT<@-@00 R \\  $0!0D0 0@  ( $ TaaL@-@PL  0S  T0S@Ssb@S`P/0d 00 0Q,0/01P/0(00$ 0/`p@-@P0`H 0(0 P0S  1T  0"00`p_p@-`0P`@P  P`P 00p. A- @0S  P p00   ($ 8PP(p`P0_H_^*O- 슟b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH zP (0$  (p  2 00P9 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p  ЍR @-`@ MpPQ 00U,0`V( 2S * 2 P13/PPF `P 0 p 2 00P Ѝ  Ѝ00PO-1PMS-:00 X0*q`I`[ 哘p@ p W  1 0& PtZ 2< 2ЍC[PЍO-MrX>*`00Q̱P@Z0p@ W [KPE [P0# ̡1PE PU0 Y 2< 2Ѝ1PE P0 0 Pt YЍЍ"1C-S` M2:rBW R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍZP"! ЍG-MpZ Rb'*Q* U@0U @ RD0 Z P X U 2< 2ЍE@ЍЍG-`p@ᴑ 0H PP IPuP 0/ @0 @ 0CSà101a?z0S0Cs  0S001R@10CS㣐4*y0/ 0 @00CSÐy0S Cr   0Vq00R!2 B!0C2ph0d d0 P0L L0 8 b404 0L$(p@- @TP ` wPP   pPp@-`P@Q 00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-`P4M@Q 00 Vv 2+ RJ 13/p* 0 00" "0$ 0 004 p`0 9/P 9/P H0  ^ 4Ѝp$ 0  rq0 zP 2: 24Ѝp`?(0 0,009/P  S0!`$P@  @00CQA$0@D3@N0qW T00@2!$!ApP V0 < 0hO-0 `tMP/V@` ᖜ0P(0d 0 ᎜ P0 \ (v`0 000 00p0S7H@0P `0 PP H pPp0 0E0 0Pᴀ  Rڴ R HD @d0E Pq 0` v`AL0H0봀(00`p@~ PX 0,00 $40<8P00CS0s00 R*< @0 @ಐSr 80 አZ8  @ಠ0, 000P,0 \f 40|Sf 48,0400<0 \|PdP00Q0  00R`P p 000z PD0 s00᳐Y;0 X0SPB CTP P\Ζ0S$0Q0  00R 0P 0Z 0 $0s 00040S,08400<0 P$` P^40S 4,, 0 0`00 000P(d0S 0$ ``0V$0 h0pS,0 40l0Bs0@0@U:0@E@0pP( 0000 000tЍPX ST0T L 0* &8 404 0X 0c$b  O-\p? P0`S0@L$P R QP' Y  0z S40  0 (!S$10$10 10 0S0P  0P0 S0ۚP  00S 1$10$100O-MP@Y 0  00X00 ``FV&:S 1 !r `0Hp0 pG0wwp>pF00F000 B 00p@0000 ``FV>*Y0v`G V  1` !I`Fvv`0p0wps00አFZ`p01*0p岠00`00PP} Y```0S`00F2y"0 A02"v`0 60Y0``FVl*Xv`V \\\2 00 00000``FVK*Xv`> X 1 !r0XAq 0H0@ pp橺`0`v`s0p0pIW㳐`01 *0X`p00ഐ00 00 PP @ 00S;`00FNЍЍ0 00 0 0 0 0e 0 00k 0 0$`t0t bp0 ___P@]]]t]TH](G-0p`@PQ"  0\~U@ T9 0PX APQQR0 B0Ӳ0Sr 00ô000 0 S CY 01*s0  0000kUU800C80?㉐CY 01*?V8 404  0 0 S㲐[DO-P0( 0S 00Cs0Z@ ,WPI S 0S"@P  0 S 00Cs0 S  p`V S@  0/P@@A-`P 0@T@ Tp Q Q\ἘPTG-@`P 0S 0S  0Qᛘ@PS" 0 00ᲀ\S: 0 BS P= \0 P  0 (!0S 1$!0$10 PkP 0 㾐@pᲀ 09p 0 S 10 B\ᾐrp JP $1 (!0 $1W00 O-\?  M0P`p0CS0@L P O NP& 0 0  eP 0{ S0 ࢸ Ѝ0 0S0P 0 0P 000@- M@P p10 Ѝ0O-M@P 00 P`Hpa  P PK0SSD0Z0 0@@   0 pWN0r pG W@s 0K*0@p@ 0000S 0C⸰ s0ppW㲀0>*0p00ഀPP D0ZPPЍ0 P rP f0 0S 0 0I0 pd }`0` 0;H D0D 0 10THS4SSxG-`"2(M @0 0$00w?0Rpy2S:0JS uPP 2S p )6 ^P ZP崐7 Z1! BR9:0CS㣠S*z0Y(:ቐ @1p01 p@q” 2 0„ 2!0 0 $0 305(Ѝy C 0@O0 pP202 ٶp  0000`0p 0u,0b( (0 ~y 0 p4P,A-p@MP`Q 00 2   Q `:1Q0" B51"000 VI VFEXBAF?0PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E E0P VP V$P 0  "Ѝ)00Ѝ0PU Q:(0 $P0PU`PKP  LP 21 sgM@--M" # @ ME<xx  0Sd000S 3/j -<= 8 80 0(Q/$(0S/ \ (LM<<00 R/( 0S/ \4 TMD-AF hFF #x =/! FD M)h1 J#F I H> F60khBF1F8FAG53 [X-OFhF(I SM*F1F F*BьK<h$$*nO@2 !   0^рI fB(Рb+I+GFF"FFFFF&F+FFFF05FCH" 2h*7H(a5L2h>F O !OFbh:b`*ƀ F2AFw )@($*] -t/@ -@,$Z^ 0^I 0Y)F/$*q$'*A $B JIHd U@ $"$ 08 %(F0 T`'q c [ [X ZA b($Z$ -  .I/HJFd SբR )H" "`d S?DE4 FJ' -w'$*- M 0- 0j1 ^ 0-E@? ["hP `x<碉"`0F< [-OFhFnI SK$J&FFFFD!(F9FJCK^R(7G((>ЯUfO  9h(mH8 (Q          y  O Ox(e(X( d(!uI hO sI hB:W" -ђEђx ; `iKh- (,й6*aM FP0B^I"FP *x JIn*jxo*5#(FO c,!  ,FH!PFQc0>I ( F(FJ[,!FYJ3IF3H j0K!h,F`cp,IjC*Ij+)I#bW%0+@𩀢l#l*H%F@K #lV<ԣlV<0FL`#m @B+l8FB5FE)!x&6P [X T`0 'qk*+#m+Q!Feccl{@B!(pI `ObOs*@Bck'flYE@&k.@EckB#kcccl(9F l](9F Na `Z"0((@B}F@AQuI >@I#ccV(6( 0hFcm+1hjH5hpCO(FmF5hak(F 1(4l  j(F8cm+TH)FlbZ 0cm+NJ1hNH78FXHcm+GK:F1hHHcclЕ8+hD0BF.[ШhQF1,#L,!1.#L.!10#L0! #12B2#4# [B4#6#[B6#8#[B8#:#[B:#E`9F6_|Fsh(,hD#2B23`#p( E(S("8IFH s( x(фIHKh|K"zK""xK""uK"!3; F(NsI h! dpI `oH^F(AgIlHvlH,^K2#hJiI_H:ZM)iѱ(tUM1+b.@SL]H!FN\Hd0F(S23SK"VI FUI wAK" hxh!Fh( F chx!+"AHh+/I9Hhx+ (7H6H`6H4S2kL2+T !zhy T`p [Xd'q9C!z!}l4-!|0b [ Z"M&"L#H)Faz!H0F,(2+?PK(F"I6G 8K"IH*JI H$ L H!FL (֮J2+?%K" [X!zh!}l-AF hF/! F4D FqIF(BЁ'mLBF1F(FCPjK!hh)𗀠i-! (***BBh:W"P+iF(F P(@pC O@#`RI*F PJ1F(F0KKh*V#Qh 0{!F w(e(L(2P(3F(,гf8(S #"# #""""# """"#""##!an#c`kg`i#'aca`d`b#ga#a^'`\aZ`X= a jai)gcIV#g.yh"iF(F F(upCO?WB F")FICH!~ T`M-OFhFfI Qp %C4FJF9F@FC ]KhW#pFFF-h!F8F X  (1h^FQH7h/U%m(p(OеJL hF "h GI @FPFQm.FFAI@F?I PF(FZ9*-GFh Fr2I 2NP'O2F!F(FpC,KhBO;D&Tp0FFp(v("K' n(!hHFb&0 h/%hO /!(F`0Cx++x#C(F H( H)F<;F0+(F| T`"-p! " O#"  F F B7  L ! p (``Oܿ#c`LI` P>HK!8  (ŀKh++'+шK"% nK"!"K`#~Kh+JzJ6 *uJ! +wKhwKhtK`qKh+ rK"`qKh +.#cKxdlH*kI#FkJ(F FCF$ FeL hCh;C`+ "hhY` "_HphZ`+:#MK6 0kGKxSSH(f;#OK"`@K0+cAKh+_ =Kh9K(a7K0S8Kh;AKh?K`v+ G.K60+:H5H8K$L ` #1g ~SKF0+(H#X#x+px+#M$&FU 41F,ѓI "4Pnd"."."7".".".0یpxۖ":|".~-GFhttI PsNtK$tO`3h BY#9FPFPFPFFEkJIF(F`B2h`(.cI a+R#3]33333a3$! (  PI$$MI (KH4JI (HH*GI (EH ,У+h3=M#3hq+F (@6I0[ع*hh#x320[ F FF!F>#3I" F a)H!FlKI L(H  T` Td.4:@ tBD@thO@tZ b(le-tgv'qh^ P-OFhFPI PL&FF5FFfx `oSBSAJc`K9FXFJCKтK + iֱ+\5h0F 0@uI2F vR(&G((1H8 (Q 655555556#56O%h(d(f(!v(!XIh!O%OO !%%+=5 йFI %EO33.chW*+=:!@FkW*`3x;#+'6I0F-K`  ")FXFF(@.I .!@F((I@F0F$I0F0@Fch ``P0; +onn4nn]nn]nh#")F0FV0FF(h+c I"5`5 `Z5`5`aZA5#aaHTvHNFO&AF:F(FAѡi)@}I" 0Fl8h27yh)wI2F uOA86(!9'-15VQpī#fB Љ#55#53FF#5#5#5VKVIHF AQIHF @@NIJFJKh "!R?F h"+ BI ^ "!8?Fh"+ 4I "! ?Fh"+( (I#x Kh0#m#5v#cas##i#1k#j3#bg#X#V#TI #iAB%@BB!I"<rܐ'q0"%>WܮA `i"!%O hB ѴbhBє%BcE#;`#55KuhOm@ .#;` F%b-t%*oX#&! -g)bX#&#JOc[ڃJI -N%:..FX#X#!I5s PpCO#55>.Al(-@F#58F-@F>aHaKaJOa`K(F22BFVH2'XIF(Oq0F LJ(Fq%OI(F(FML #3# !E*F  @ 8 b?H.>K?I(FF22Fù:I >h#+ " 4Hv2  /I0JFCF0FP FB(" .#I2LF H2H1FOrHj(F9F(F`~@FFP2 v< T`">L"< Zw?_Hp_Hch;c`+ FF(F (0#hZ"`xch;c`+ F#hZ"`x +% N-'c-@F(0OS00OS0@HAFn-5@F1 1+1[5H.3H-(?d0J-Hq%+I)H-)I X(?@F4F#-2I2@F(I #=-?e0F,FI2F HOrH  ")F`H(x' ["<">L?dmy"<(-CJh(KZ`,p$NO XV[8F)FiF Z`0;`0+ AF "4, X0ZX "p18<"b Z-OO#FFFFFO   AF:F FA ђJ ,$l-&t(c(S(P(FdE  Bn( t(#Fa(J&-d-ХrQBQAIxH" <?FsJtI !d-A R-S--Q-mI*F p-wr-Bl-",;X*XF2FY # X*"^IXF 0[I X*"WIXF 0UIX*" RI XF 0OIF("! \X* ""IF,<OFAI"F&WTE&6BE:I XF 08IDF@5J6IF(F X* 3IHFJF2I(F>1JYF(FxF(F0+JIF *I J&IxF$I ,@𖀈"F&X*H&H!F" FOLB T`'q 86D~D#D{1>(D|MZixD}(I F(F,%KB.=s@3B0QF(FFOEW(O 0 IMFZFF*1F(F"PFFdF(F4IRFHRFFOtaray [X-OF-#LO8222 23322JIFCcѐK Nh2)L C C C C@-dR@SY"03`d20hc @pCO#d210hC3C2Cd2% FI I+@ekO@C:FZ<(0aC^9Fh+@:cHz(IR( 3(B/(C18(BEGIS8'(9^8888888888888b@88fj888r88888888(  . BA8(I#0B###6N "#20h` x (2h0I b*KXa&#d2"# 2#2#2#2#2!M$!Njh4U0Fr, a#2232#2K/!h0F(F3x+?:0F0Y:"f T`,"i'q!F#;3x;:0F06:/!(FFF! yx9:(F0":/!XF"prx*?:XFu0耐{x+?:(Fh0:I J#O 2:I8h(:h3h\ I3ocOc3]J N;F2I0hh(2h;h\#BٌI*DX2@N/!7h8Fxp8F H2hpCOрKa*6hO/!0F^hyJ3FyIyHiHwI X0F! oH*: 0WBBVsgH2cHcIOR0F |`IB [H0F  !ESBVH0F'w 'r#3FK `>Kh3;Kh?KFX`CB?CIs!cAHO;2#23=H2+?si38H-O #::*F!UO0?NF(?F:!UO07`%HX7`d20i+: 0C1hHP0i O33ao" 0a01hH8*"i'qGR"hoy,"i"p ?\V#1OqH1hDVW+F@CI AQ\2T72P7OsH72L7H7O \wTs`L7P'?+鈗"2.!2銗P3i`uh;(FNE`(4pI*F nJoI >01hmHiJlI0i 401hiHIHF9F-@!@)F 2GF`_H0i P5a\J!  YJ! VJ9`3232 32HM\2#SC#)Z FD PObB\"ZBX28K"Fy()@Dh&԰FF`h L2F HOrXF1"(H20rC'F:Fl0@H0#P2#H2"2*Q+@QKZiH2BI "mAdrAde"f"o@"o"hF},"h2o22?+"\@3?! 2JBYCa) L '8F 7O(MPFP:PF>(7:: ƥ2 bS! fQCFp2(F1CFqH2  /lKd2+ٮjHngK1FF\PF9FCCFE5 L  HF( @3B  23B  NKo(Oere1IJBsOc\2:?31*?+?ᮗ!2)*׮)Ү)ͮñ Fw@2AD2BAH23H2*?^Ev&F+S2"C<O2B+vN ( `xi?@IHJ Hd!(@ހ Iܻ`"f;,"hIp ZnH(П흛O&8F2F2rOs"H#2F2b?#"H##"#2F2Q{H(#8IF FL2+Db.@|K\ibF2+@wHvH!LtOO O#8F#FhH Fd(jK6!.!,߿$0c 03+ 2+@ZH\2O08$)CSHLSH*(oQHQHf0FO FLI(Dg0FF4\2::E,2:O :LF$>IFXF, : ʹFFS"IF F {i3?ĮB1F,H#C9KXi1,?c!F#H]2C"Cs EH~(HVHv(HN),"f'p"o@"o!| "-O]M-#O$ 0F+FFCOka+FCO@E`JIF0FFXYiYD#aiD#0KhO ;Ȳ OWOajJFXr/!(FMF(FP `KOaJ e.HFXFpHFFHME9(FF(2 jOaXDF(@׀Ij y+c+P+UT+]xKyIFyH& "d*Q"SSMSSMSMSMSMSMSSMSSMSSSMSMTeSMTSMTSiCaRiBaYH 09iB iBiB8hB7 *?1:!PF.HI "F"+CHBFQFQF( AF* +h 8I:h) x 5In)Qxo)2)#1J1LȀ`!F 0Fr}!I F 0I  F   D<`BI  ya;0!+I JTm,  I \" "Adem-OFP FL'MNBF!F(FC-$G00EH'DKh"! ~(?I x0O ZFYFPFVHF??F,h+&ZFPFtEFF,IRF x+h+?x3r7 "I[F(x-+1CH 7NFP 7 IZF5$0JF)F FG0 Fs'q? T`??`?Hͼ( L I F F4I F F@"Dݡ-OS} $(O rF!FHF 8"!FO8 ``O FH0$ѬI K$h0 2h  #P4ĕi483,H0њIH0јIH@M,NїK/NO O (I@5FH@E`EF8FJ?F2чKhO0+@Q,@N5+@I  ##` *FCKF(@~F(@_tJtI tah(F$hz󽀻` ܻNs>ܻAZлCAڀaK"TaܻCL𕀛a"+=AEIS`dhW, oA "!ihuhQ iuhm I DHI@H"X-8 L I F F4(F I FI(F F8@"`Ǥ8 L I Fh F4l(F Id FIb(Fu F8@z"|  mLO (9F0FA,(F<0F0?(F8:@40F I1(F I+ I F+0F>(F1 F@@"Ș) -G :(dHdcH(bH\aH! (8|D/! [H F!YH tXKWIXJXK( FWIWH "60 QH*HH! V0 MH LK"LN !LH$O O O '3`GH#"!%#AH"!?H"F!O3"!33# 2#"S ##-"F D"F DDT"F N F (F  # #! D M>0hh=%K0h]`G e4AM"-OO3M 'FKFL>FF*FQFXFFB$ѤKh .πM+h O,h&4khBY?+ 5u(f(F(*R(g8(S hggggghUgggghgghm& h "hyI 2 hx#+ hK h " x+"hmI 0 " x+uhr hF(l"hbI  hx#+ h (?\ h "| x+?Q"hVI 0 "n x+B#?#!Fn젹!F8FTKPFTH@F p6 4=+?Q0FZ"P 4F 0 CtQx)Rxc*p*b*JDDDT F?,O 'I DTO FEF..O@,F'!F8FZF !F(FF(ڀh+I*FM Iv!'q T`"vvvvwvv#F `h C& x3 ^Ihh+63.0VKh KTK#B 22 32pA_FZ  EIx h310[BI 0F GFF*?a;IF\2FCF!F(Ff+?l(F (KѺ pO#(F !F(F%2BBEpO(F 2FCF!F(FxpO@#*?B!F(F(,  @3? (F0H)F<pOO(F xвwR" b(w?we-O%FFFF' ZF1F FC>ѧKh#0B@)0 +w,,@V' qOaVF(𩀸@ЁIV'l(@AF F|BF@h+I"FA(Ba8(€(< /27K`E}Kh x+ EvI ̡FE|lJSh3S`wEt#O o";B 07idI8FBXbI8F<0aI8F8(@𛁰hAF(@hYF(@7hQF8F"Xpho rhQI |gOaq:FVF KIq |#3h +F (LFY !F=I ^ AF(D0Y (Df  E$B@F QV'F\HV' @V' %I ( i0FHhI0F#`BF 6OaqJFVF(#3:F 0F+F`F T`"'q%;Wla۠J`V'hFV'FP\F(PFF(_I@FJh^I@FF@\I@F@V' ZI!YIHF6hV' (?k iv PFp (!F POb P/!P(7F0FsBCB!#"9Dr# P3p!CF'5J0F5I0F0۱̠#33!F PF+F G V(I 0F00F F D=I#"DH### h"5K-5I#"=HoC## h",K ,I#"5HO3#OS h"n"K$"I#",HoC## h"\K(I#"$HoC## h"JK,I#"HO3## h"8K00T T` "'qCN [Xp`.>KhK[h FJPJ#xh320ZԞI"FH FF"HoC!F##"KY`yI#"HoC## h"K`hI#"HoC## h"K4V|I#"Hc### h"{K`FtI#"{HoC## h"nK84kKh0srII9I"=H , z3h(4x+XI O P#M!!V0щI2F4+F \C"4p /y6Q4"I/ p poIOcnJQF0FViJjIF 04dHRF9F`JbI4 !F\J^I+ZI"]H \K >  SH"_0'OJTI$"PHg9F(GOr49F y0@JFI `C 4+4 ?IC1j#C3J;IbC:Il9K-J9I,NGj#Ie1j0 $Bp -I"]o 0ZС2"(F0# I#2FEt(F 0qH1FOZQF KF(gIRF|p"8K4"Zn $8"Ȼi $ 4*|+\ 4$Z4 t+rPFAF*F0F.kB(F& &ܡ$p 4y4+5HJF;F1FOs/yXFKWERFYFy(F:FB&I b?iyIFOEzOc 4 44IFOPEzOS+ЃF;F \OFIFEzt|IFOPrEz R-GmFFh"!pBF9F FC Kh<,@U@85(S -AW_uKIhor#40nKhj}KIh_byKhf([vHO2wK!hp0C@ p0KnKh GlKhCjHOrlK!h<8dHO2hK!h._HO2dK!h$ZH"`K!hHUHOr\K!hJPKh NHOrUK!hPHHOrQK!hRCHOrLK!h}T=H"HK!hsp0C V6H"BK!heW1HO2>K!hZp0Cu*HOr8K!hL\%HO23K!hAp0Cp0KHF0.eeO RFQFHFS&F?? F h+RFHFREF F,IJF l T`'qFv.{O?<x+h+HOrK!hd4W#@/! F0#CKOaJFF "ih F# m'q4#-O'- FF:F! %LKPBڡI :F! ()F0љH@j0іI'pFO5FJIF0FtCяJh @ @+@~<;+@(IC84(ƁgP8#5:T[E_dPhCC`"x ( ZI NhCc8;C8;xhCPKh8oHGJ x"  DI8 RR; ?I"x ( 7I< 7hCshCSh0I C@`-Kh@; hZC~hCzhCv8;C"XxF ( IqOsBIhCThCPhCCLA@bMR`#( #X!Q T`  & D'q b ~4"vxF( I&"xB* {IKyIhyJCcyH`# h.sIhuJC tH`# hoJ x* ?q iIO iZ#fI#dI2+aK n(?i\I YKMPWJFQ` ;F[ @08`( {*(+ KIhHCIH2s<+D>2BKhBoCEFFOs&&O&]&&&&''P''2'l'''$x#2F9F F$(?|HU#2F9F F(?wHJ#2F9F F(?sH?#2F9F F(?!xnH hʮ1F FR0+]+?+w'∰H zF0F>ZH5+њ  ,/ :* DNHD ܩ oO   ; 3 FF;   BF F/A0I+E1JF@FT@*H :%HJFAF0@ ' H|D ܪo + H\ /HRO0' ''''(+( #(((!( (&-OFF>IxF-+4 F(=ѨK$"`OO FF:F1F(FC9ѢKhBw'>3FS}](FI$FV)X/DDd*(Y JIF $I FF(цK"@Z`d+ '*!$DtDOvKh SDdDD4D$D$O O XF/(FYF(F%)F FV?D;+Ѥ NF$3`+~r+UR+i+D t+x+O d ؑءV ObFQFЋS#+d0fBF;F< F$ki+1 ' 2IL*sj:FIGHFH j?IBHAH#"Z:H kicj1I6H5K"2H#.H!j)I/H  j#I*H%H#"HwgHN `MObV F FSlIk($)LDshx*:B FJF F/Ik($)ԀLDk@K$33sh 8FCsl+@9F0l"FCF@h7+hVFHXO4h3+@0+xg+AH0+= I Jh( F H`x% H% % % ń+_HF,@[Kh+XhFXH2 HZHWHTHQHNHKHH  /FC+Fd#b F- @"p$@I0F>LO =I0FO :I0FO 7IFO 4IFO 1IFy&$h+?TWx+?S +?OiQh)?J2a  h0$=,?~(F}FHx80 F#)FC(3C<0C ")F FOB H,F`% <k% xʆʔʥʲ$-GFh F퀹OOL)F:F0FA ѵKhBvR HaIF D(DРb++R#------------- -Kh 6#$6#(6#,6#064#6#86#<6#@6#D6#H6}$&B4&< C"<&,&28&rHr4&r<&Z0mJmKnH) FF`U#P\gI(FH(ZeK #D#xhaI(1^MOjO W(@F #+p#kpWHSMP&khCM`FOHvHF(=h1!oF(f.@9CF@+?HH +x++ .F0F37HF(F !8Bak,Jhkxh320Z.<#XCKX`P&BD#m 6۲20 Ѹ:V(3x@ )%@% Gi. b(*xkx0:0;3+]d3\*x5<0:0;3d"SClssa ,080:"Dsa*Fkx 09F31;3a*Fkx 0;09F3`*Fkx 0;09F3`*x !kx0F0:0;3s`??D?X`K(PY`ͮI 435sah+ˮO6:F1@FD(?̮0 EӰE #5#5 FEEF(F9h5DHzK H&0F "!HHMihP6@-BsNOohHCPBy_ۧ @M85@-UQOU 5U#C<6+K46+I0&qMrK*FqK*FqI 1H, mH6kH O56By۾#"BpHF9F0FSMU2BsqTMKM,6{RHOr@aNI"z0F+FKJQ!KH%JHV(FEH |DH<6+K46+P3K?M@6+C=KD&;JC+H&9JC+$&7JC+8&5JC+0&3JC+3J `$0H`"F(F~,I*Fh H}v)F`(HTK&MY`! VF%@2 Z[xT*% ЌЙп϶%H%GϾgjmp2.πtщϰ-AFF&ODBF9F(F:CRKh-AH(&Рh + +R#mmmmmmmD4D4DD$D6KhT5K`3Kh3KZ`&W#p"0H9F8 !,K-J-H,O!8F)I:F 2#OOsD0d<09h $ !(FBI I"F(Fb(h+Izh(FIT(I6!FI#33 T`'q4%l tyـ tC-GFh#F`MLD*F9F0FdC!хKL1 1h$C!+&#h#4wKwJ`x(`(A(:M(U a+R#3cccccccccc'3cccc?h3`434434LKNJZ`0#`131x@33@3r131l131f131`131Z@34+&#h#4O,p%%aTGUF/I Д *F)F#$(F hH#IF "h !I O#:FF(FF8(Fh8 3x+AF0FG.?0.W AF>p1x% T` [T1?%'q-CFFIF"FL"F9F0F2B/ѡKMh68.I,iLI F I F ML*F9F0FC BF}I}H}IBF{Ht(p@(A83(S )7CO[gsyz(cci+_Osci+X#ca7ci+Q#ci+K#ci+E#ci+?#ci+9 ##c`#a#a#ci+(@####`#`##bKhj`ci+Osci+ ##i+ KIh a(߮#cb T`%-'q [X:ܮ-!#j+?֮chh+Ю&i.̮W)P h)F(ۮqI*F #i+chh+&i-5-gI0F(dI0FpcI0F|(@-S4-(-=-?S%yMI0FT(cj+?L - -~W)'3е AMBN(cAF@Hc-ei#"jihZi##"jih(NHhW)/W)A" 0(H22??#H&OBF H FJHٲ2 C #B"Ft`j(?ѭ i)F F(1F F(AFH\-Ӝռ.H[kՂ-OMRNF\ F'2F)F FCMKhB<(=4OU/@F MR(f(O#4'I*OaQr 9I* /e a* (@ `(>pCO@гO5 `jF!/(> d ZFOa0F40F/Kh+H1FV F<0!F*PFH `jF!( `jF!F( H arOw*׹ T`׼%-CtML%&I G[OghKH8X<8KDX@8K`XdXhXpXtXXXXXXXXXHhLhPhThXh\hxxxBFD8O3l8cHC #8RFF:F"B? G$I*FF yL H6 ~K<}H.FX|IG(@nK"T(XvIFN(@fK"XT(pHbK x_K_J,]Lh8C<x%gHhXeH(cI"d aKALJ^K8(BHEM&`h$dh@K$RM&FL*F CF@9M#F"XIJ!|h #<,y( F#C   Z(c (@4hG_0IF"F9/I FGGKTP+I FG> K"h(H'I FG40 K"T(X(<"H!F7!I F(@K"h(:$^%CvYTLgmL~| Z [ T`l4D+R#9ʓCʓʓʓʋʓʓʓʓoʓKʓʓʓʓʓʓȹʓʓʓʓʓʓ5ʓyʓɱʓ=ʓʓʓʓʓʓʓʓʓʓYcʓȋűȥȯʓʓʓʓʓ AQɃɫ%KʓQK"(HK"X(T(K",K"hK` x+?KIh K,B,,2,~K",|K"H({ zKFh&uK,:`|x`kqK"L(fqOObrH9ho\? (BdK8=\KhYK<(7WK"T("X(/UK "hPK( x+? MKTIhIK"t(IK "hDK( x+?AKHIhl?KhFI "48FO8KhIFpx+1K;HhN G"@F$0-H 5G!K",#K"L(KhnFK"`(d(K"O8hK( :hI Kh?)H tMHKHhI:F%C'q=%K2 [XRfz}'q [䶼L#H<<(x (@EIF(@𢀮L(*@ŀ)@𪀪HK OI "LFI "(FdH*FFH#8F"FF8FO8F"FF8FO8F"FF8FO8F"FF8FHJFHHJFHH"FFHH"FLFH(FF !F !FL  !F!F I +@Ā+W2FPFdK88+D FEkF(?V]M<; j(xI hDUK JOb F$oNL? \G")FFcH#8GK<+>6^IOb Fo! , :!hȱhrMH!@LI KI   FH!2F(CI BI @!h0FF F5FKFOb'F F FL[h P|Px 0H,8P+ ,*OK",+-:F)F0F%C0BLNxZ`tju4,%P A,8+AF= :,8+Л-GFhFpLVJhJgIp1F(F#3p2+"l!J߀\I - 8(:VI 9(/(-08 v(%3331F:F(FJAIKh/V#PFJ+xh320*(F(@I" [qh@F=OO O )F9HOr=? 5K5J !4 31I /I -I +I (Fu (I .p0&I!%H$%H$K(F4!H4KMid i IFI4+FMiO(??&z  h T` b(  & 6M B R [    |l"!b(wM wI,ť 1#c1(/K"`n(*b(9($0($.J08`c +R#ӝӥӍӍӍӍӍӍӍӭӍV(JIH I*F K"`K"`K"Z`JIH jF!< h.T?+ѕ9& |: T`99(5 [X9-AFV;ELH`#` / M#`^I##a }O`a Y ]y hZoI#;`8hmJmK( FF H- 3hx-*+*[xK0 nV{AF=8Fd(8F& WH axCTH a RKaRH a OKa!j!!NH F-ci  (  V = F?Kh;?Kh#iC=H=M % @+h+8K9Ih(5H! J(hhV(?? *Kh#c*Kh+!(H  i7 ,c F(N3h+(5`Kh++c& :$:/&F:U$:4:;:D:S& &G:j&Fd jQ:&GX&L:&G&GL-OFvLF'hsI Fg`BF1F(FC*nKbih:CV# 5Q(h(=U(@laK!hN_H(]I u(`(G(DI(FE(;VIFFVH6 2a+R#------/-I---ץ--OhC`h#s7K/Jh+Fc`#`t##aqO 0aF(IHFIFPFV#K 'hOhCsKJh+Fc`##H"F$(?:H5#a2# H"F(?*H@Bid&gp T`&Wh [m [X'q(L-OFF IN(ڟI 5F,ĕ0FXKC(AЎIH p(Dr(RF9F0FdB&)H X pCO'+&s7H*Fȳ'0F\@{+/ 'wK"`CsKtIV@#0ر'0F0/'F@dI"dH']F]#F^MIVH{ch(c"oO OHNI LI KI Yb@FH6@ # :Ec F@ E^F @$ FE` BEX FEU  F@F E1H"!F #0-K`" +K`c'Kh)ɀ 0|/(^"K" `1 &9&0&&&(&T&&,& [Xh&L&7FuUM&L&&P&̬&r&̨&~'q'h&T(?k ,H1H  +I ( (-P!(FE F(?H 0#XD#@#3B #*F!F #O3CF?%, (FAF(Fh F` +Ѯ H XP&EjT&Ef6 51-OF˰hLF&FF O3`RFAF8FFhяKWE!ݹN"HFF:HڈIJF p-a-b=-   " 4z--5O|IoC"{H## h"3sKqIO3oBqH## h"  hKh`6OF[5 8FH pC_&##&^J#aX)Fa 0YVI(F0"0P##bEF(iNI.л0ѹ-JIJFIIfFGI > 2FOqLF( "  "IF0F0(9IEt L(5I3I 9F 0  ! &1F8F"  &I&J3FF(?t#I(!II@)Fb^!FX*>X* I'5 T`'q#5i [@thii"?i-iLipiziiiiiii&;I 4O05IF8F+O  BF(h+ 5e+IBFh+ 5Z&I) #DBr#DFGF+OqB #Bh+5EFV 5%! HFE, F8FBІBFFF 5ii-O(-OFF3}  0LhI FHHv 3}I F(IHHO(r! $ K! FVKhO3y3v3U3J0 F6!FB0 6! 80d OE6@#FFFX1F8FKTJZFCL{(F0BYC3Y8Z80 [vab;# FF:QF(@X@0BgK gJ+!3YC3Y0B@$^MV(&M( 6(~?(s4(O h$N8(S ))))f('j8(?v(?sS ))))))))))4KhVMZEQ1KhPZD(L%E=$9X%CcX%e0##*#X?%HF%O |$x$F;F !:(1X?EH(#[oooOsss DQo^;s 'qo] T`m8mm0mH(ѓH0B)F :# FV!:HF(F;F !:.; тH3 4'0?#Y 5[0xIxH7 8^h+@փ )F:a냘EE ;fE 8r 5gKhBEvX^@@ۃUD"*0@كWIZH71X1(Q,QYCB(!X#NJYB?zMH0EIKH7u7 ( (C?IFHC3#CCSCCY?^b XFD( $8YF`7H7I$3K4JF2J +!2[F0JX D,K$! 2)K*I"7+|7<0I#H,KXFKCF+AAFH7!FF(h+.H7ssPv Dj@tt tZ>D;ys>% SP t't=tY 8X21݀CX3 C 0rIFV#5dY1 30rV#5SY3!rF5H0IYYԛH7^ 2F9F5X(.ݗH78X2RCX" !K70яIHK@?|HF76XF5#|7z(oIHIH "K7T0,h+xIH7;YH[<, h+wH78h+?ޭ h +?حX#3"SX2kHOq0 h+eJ\IeH7eH@0 h+_JSI]H7 KdFXH MIYH7XH7WH 7 5><1Z_RI" 80OHCFMH81 Cc81,1"EK,70N.IAH7H ,1":K,70#I6H70I3H>A0XCX.H怘7DF+H7/X C@XJFFI%H=YGԘJF V0AFV#50:IHtyt D}Pt@t^vt Gttttu uu2uX0uou U!kuzwuuuN2V IV"TJJHLKK F80эIH! F5 SOq<0чH7 y"K60IH7a*YY\CsYb 7h(4tIyHbR#7PFbS"73ahBh X*okIL  7 5"YfHxj+HFbS"#j)[hhFh 7 7YY 5hh.>NZԟF2 TR՘PԋEIL  7 5)F F:x1>Nh-?+j;3F"!7mh 032F9FHF53jK0F50F7>(Ovhx!h:՛j 2Rh*?!K72k`h F`7hh,Dh!B`o;o+oPuu XkuvJvdv R MvvH7X@C77^ZDHiD{X?v [  Q/0@-0 ph P ^0P@0 , 0 010$x|@t/10!O-bM M b [ !b1 0 0 30`bݍ Ѝ"]\ P\ Et   $# Hp;` 00Ġ80G( Gˠ xp x8_S0 @G `0 0 00⫪ 0媪J LP x8`@##[*AP 0` l840GV ` 0` l840GS=d$JJؼ0ƒ S"*0@- R P@ 0\ R^D00"@80 0 0^ 00"@0/4@-M @tPЍ h  \/X-M 0 p 0 S 0*0 Ѝ<<` /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ Y*/*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@@*/*/*/*/xGw xGxGL~xG!xG}xGxGxG&xG笍xGRl 8xG 5xG/xGyxG5xG xG皍xGxGxGxGxG xGxG%xG }xG#txG砃xG.xGuMxG xGItxGxGxG]$xG2xGnxG-LxGFTxGxGxGʱxGPxG xxGgxG籫xGxGxG焐xGxG5xGxGW=xG xGxG_xGxGxG62xGxGxGxGK ;5xG穀xGExG21xG.#xGxGxGxGG"xG[xGxGkxGa"xGxG5xG^xGxG)ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics formatsector sizesector size `%s' is not a power of 2.maximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectorssectors/track%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u%s: can't write sector %u1601803203606407201200123214402880usage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. %s:No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandsentlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraecsctbdchfesprdletdvcmiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderr Terminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeBootUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. # sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPE11.0_BETAevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv7hfeb/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hfeb/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicant/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)/dev/r-t xx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/random/dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crandom.tmp/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigmdm >= 0 && m <= n%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c---%c-%c%s %s %s %s %s%s %s %s%s %s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%cr%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEr%sparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2efsnilfsminixfs3vmkcorevmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitiontc/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d YK } R=kVY!\#_#e%qh&F&l)p*Us.{/z/~245 5 81?@%CsRIVy~W[^Ie)gkpppp pq q##q=)q=~4]@i϶mmFENiT]AfmIYvΉzΉ}3֕ةܝl=Qpushdnepopdne92 f enO@@k p U@@v | EmeT )  5 @@ } @@ unblock and -DNO_CONV?L|(p-4100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directoryDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# unknownline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/tmp//usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXEDITORmalloc-c/bin/shre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesAutomatically adjust partitions [%s]? Invalid answerreallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tableQrounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] Usage: %s device %s device command [arg [...]] Available commands: nonerwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grewfalseArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%x%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%#llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %s%s%d%d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): ???CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address boolquad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexNODESTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendormalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<liLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELLlessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETAKiBMiBGiBTiBPiBEiB.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0link#%dsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLinkR ^ t҆ҐҜҩuҜҩuԩEZ "<R#\ \_n^nFn<n>Ӄ?ӖөPATH= ztfZZ݈dݏ݈sݖcݠ݈mݧ݈lݵݼr pn݈v b    EOF reading here (<<) document!-59=BGKOSX]p^bgnu| ڇxR}-+?=Q@@ڜڞڪڰڢڦڬabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'";0d";<1l";(1r";8|";0B";0";0";0";h0-r\L ;7  e9<8> @ B  Dn8FmJN !xRvڪڜ                  | F PX@`  0@@ޯ@@@@@@@ @@@ @@#@,@4@߻;@FMU[߇ahnu ী@஀@ುกȁӁځߨ߽$,3:B@Qaݒݣݷ 'CVa!jށ_37<DIOU[bimNs;yKbIRPZdmt_ u)/ާޯ޵޺ #*>4=DMV_hs|߇ߌߓߘߟߨ߭ߵ߻_37<DIOU[bimNs;yKbIRPZdmt_ u)/_37<DIOU[bimNs;yKbIRPZdmt_ u)/)Xt y    (=\o  % A  ]! m# m$ v& m1 m2 ~3 m4 m5 6 m8 9 9 : ; < = @ *A >B zC D E F G H J L +M <N CO SP cQ uR S T U V W \ a c d Qe sf g h i p q ms mt mu v mw x    ( G T i x    <Tn2LRkkk# m m m m-EWpc   9Xow.6h|3 m mgl m m5H[g[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]t &t*28BLV^nv|rY*returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock,,,,        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read0z~W@2 s3@m@@w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-2 :\:x:::::;;  ;:Uu>>>>>?X`l8Lp,@Thǐ|ĐĤĸL*28BLV^nv|rY*A@A1A:AVAiAAAAB B[ Bz B B BBC BC C?CRCCCCCDD$ D@!#$DP&12DX345Dt68D9D9D:D;D<D=D@EAEBEUCEDEEEFEGEHEJELFMFNFOF.PF>QFPRFeSFTFUFVFWF\FaFcFdG,eGNfGbgGuhGuiGupG|qstuGvwGxGGGHH"H/HDHSHeHHHHHII/IIIgIyIIIIIJ J'J-JFJFJFJfJJJJJJJJKKK)K;KTMUKlKKKKKKLLLLL=L\LiLLLLLMM M(MZMnMMMMN%NYN^NrNNNNOO&OIO\OoO{OOR@Qpe@R1@T&)@MV@<HFS0eCXKUFS0eCX!haHdInotNeedEFIXX*s(ҺK>;XXQn|n֏- q+XXQn|n֏- q+XXQn|n֏- q+XXQn|n֏- q+YYQn|n֏- q+Y*=Gry=iG}Y"Y-M;t?Y8YCWmCĄ 3KOOYNYZyD¢<#*=(YfYpРD3h&YzY \M}-YYޔM@jy֬YY-ıܹчHY-ܹчHYIZܹчHtZI􍂱ܹчH&ZI􍪱ܹчHY>Z&I2ܹчH2ZALǠ6 %?aZMZR'S@ۿ )ѸZ`Zh1*@ە )ѸZ1ۏx )ѸZZ=ƥ@\Nbackupstore_gptstore_tblF @in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps`l`z`setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatushEprintallmaindo_setifpreferencedo_setifcapsiz3@iy_ibƨbx_hjB`HigiaTŰiŰieieiij jj! j-j9jE@jQj]jijq jz0j@jjjjjj jj j@hEinit_current_mediasetmediamodesetmediaoptsetmediasetmediainstlGll\Nllhll ll`ll@llll\Nlmedia_statusmedia_constructorllkkXklkkXklklllll llk~k<lLjpaddr_matchiisiisettunnelmmprint_link_addressessetvlansetvlanifnhoo LoBosetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanuuuusethidessidsetapbridgesetiffragsetifrtsu=u<uDuCuDtxqt *uJXuP uOuWɨuVuW *u>Xp(ukUtYtYetbtboo !Аinvalid major numberinvalid minor numbertoo many fields for formatffs@ "*mW19D@JU\cl ~  @#4BY@zxxx ,dݖxxxx xx xxXx@xxxxxxxx bnorripbgensbextattbnojolietbnocasetransbrrcaseinsxxx ,dݖxxxx xx xx@Xyzx@z @zzxxx ,dݖxxxx xx xxz& z/@Xyzz @zz;x@zC&xxx ,dݖxxxx xx xxx@xxx ,dݖxxxx xx xx@Xx@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorxxx ,dݖxxxx xx xxzXx@}}A} }@}}}}}}} @|n|t|z}||| |@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvXxxx ,dݖxxxx xx xxx@zz@x "8k,MtHo%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@)B:CIFUInLxNO5SabcefhKiWkcmqnorsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp  ` @  $1м|^t0 Non-system disk Press any key to reboot WSOKGC?;7DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY0Hq˛#Ó̩IUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefFPFP*0 XXX,,x<<bitmask_print2>]2>22&>2228>2M>222Z>2h2z>22?2@2A=2>22>22C3 ::3#431>3A3I>3A3]>3A3m>3A3>33Dm3>33>33>33>44>4/4:>4M4T>4m4>44>44>44>45>55 EE5F>5X5]>5k5r@59M9M5>5>5>5>bitmask_scan1m1111hw.disknamesfetch_urlEpsendrequestrecvrequest***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]aGzuG~u: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data;?/\ ^UH_&xfo& |&&L&`&&&,& ,v&5&>&H&RQY& f&~mt&`~&̰t&4^& &V& V&&,&+&*&+1v&):&GC&FM&TY&Sj&Ru&Tv&Q&o&ncollectvT*28BLV^nv|rY*NAME=& jmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds*28BLV^nv|rY* edit_fs_type_ext ) Cm G    ' (A 1q 11L e  u edit_and_check_label *28BLV^nv|rY*disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijz [ c c e ba e ` ] d ^ `) ] ] n b{ k ae _ Z _ f h jy Z Z ka ^} ^o ^ ` ]disklabel_change_geom? DKouter_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default&&&L&,pm_from_pepm_whole_diskgpt_freegpt_create_newH } Y q 9 I = n !    e  9 S e  Wt2YzYzXXX& Y"XY>Z`ZZ Y!N2 :x::; *2t &  `%Yj*.4>ZFYgpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - HFS0eCXKUFS0eCX!haHdInotNeedEFIXX*s(ҺK>;XXQn|n֏- q+XXQn|n֏- q+XXQn|n֏- q+XXQn|n֏- q+YYQn|n֏- q+Y*=Gry=iG}Y"Y-M;t?Y8YCWmCĄ 3KOOYNYZyD¢<#*=(YfYpРD3h&YzY \M}-YYޔM@jy֬YY-ıܹчHY-ܹчHYIZܹчHtZI􍂱ܹчH&ZI􍪱ܹчHY>Z&I2ܹчH2ZALǠ6 %?aZMZR'S@ۿ )ѸZ`Zh1*@ە )ѸZ1ۏx )ѸZZJ J^vJH"YZąAĖĠĨIJ mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new?LL   i E 9  !  !  q +      U n ( +  = 1m '% "E        2 39mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************;jfjjjnjrjvjzcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2vvdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionmb~c5dIexf~gylhyi<j~k~lm~nco~pfgq rs tz u!5v'wttx.z>yEAKBXCwD_EiFnGxHzIJKLMNOPQSTUVWXZk14 6~|0~<}GEN^p~|D|sa|W {_#)16F~O~[gzdefault_configread_configrt_compare_proto  rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt rt_buildrt_delete sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init"t!,y~4script_buftoenv make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @DCHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcpVam|dhcp_boundX8| dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa $A $A $M $M $9 $9UVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\Bǐ ;ǖ ;ǜ ;Ǣ ;Ǩ ;Ǯ <Ǵ <Ǻ <1 ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ b0l,t4p,t<ǐǖǜǢǨǮǴǺ 1@A?|=xcs_pathXP bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_maxǐ# ǖ#ǜ$ Ǣ$Ǩ%8Ǯ%Ǵ&PǺ&'h1'()  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%KC00`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareg_Ctocg_lstatglobextendglob3g_opendirglob2g_statglob0globtildeglobexp1globexp2_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'B@;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54<Ҳ؉9I#ը32D=%[όh(doC_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internalgetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddr_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseekoisescaped_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf__sprint0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒ<Ҳ؉9I#ը32D=%[ό (doCCAy7FnM8O?ZwH02uOs<_fdopengetcgetc_unlocked__sflagsfclose__srgetlflush__srefillhash_seq__bt_openNEXTINDEX__get_bufnewbufNEXTINDEXNEXTINDEX_mkstemp__gettemp0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzVcrypto_prng_bufQcrypto_onetimestreamuޝ3r(Ѿ唵V dj٧IY:Jp,.*ap+ѿ#K`_arc4random_addrandombt_rrootNEXTINDEXbt_psplit__bt_splitNEXTINDEXNEXTINDEXj ggQR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqx6|0pY9 1hXdOj ggʧ;l٫Ak[~!yB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHO_getpagesizeqsort_r__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEX^ ^cd!didX $N0'`x8<@HL T 4@`LTX `h p Z x |                    t <H x< w  , h^ *  < X;   X x L  :  \Q   78 lP 0u       <md x    E ,$,( h,h0 48 <@ DH XLXP XT X& \ d h l t|    L .  Z   \               0 0$0, 0Xdltx      $,48D    9U            cc $ vXv ''stngtvunmbrLdictt`D4 _''dkey0 l#0#4dH ddataDŽ|ǸboolҠ@Ҩarayذ4T&HydH L/00 0,0H0X0t000000011 181D 1X1d 11 1Pp 111122242@2d2pc2>>>>>>>>>> >>>(>>0D$>>>?|===========>>>> >( >0>4$>@>D>L>PD>X>d>t>>????????B0B<B@BDBLBPBXB`BdBhBpBtB|BBBBBBBBBBBBBBB,BBCCCC CCCCC C$C(C,C4C<CDCLCTC\CdClCtC|CCCCCCCCCCB0CCCCDDD D,DHDPD\DpDDDDDDDDDE E$E4ELEhEEEEEEFFF,F@FTFhF|FFFFFFGGG0GDGXGlGGGGGGGH H H4HHH\ l**IpJ,JJdIIJ I JII@JJdIIII JLK0(h(X(|(x5QSSSSTT<TTTpTTTUU(U@U`RQ5Q5Q5SSShSSbb$b4b<bHbPbXb<`T\[([,[8[<[\[`[|[[[[[[[ [[ H[ [[ \ \ \$\,@\@\T\X\h\l\t\x\\\\\\2 \\\\\\Z]_]]]]$]H]P]`]d]p]t]] ]]!]]"]^#^ ^($t^0%^@ad&`T^H'^d^l)^^*^^+^^,^^-^^.^^/^^0^_1_ _2_<_D3_L_X7_l_pc__________```$`,`P`X#^ `p$t`%^@`&``'^dX(``)^`````Vbdbhbpbt`b|WYYYZZZ Z,Z@ZHZXZ`ZhZtZZZZ ZZ ZZ ccZZ[[ [[aa$a@aHa\a`apatbaaaaaaaaaabSSSSSSm`m`S~ bj7jcfhklmo op)p>pGqQrXut`v pwhwuxx}zz~BԮCNJOPSTV2VXZZ ! ) 6F(yyeUD(-%)e5  N@6/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin"/}-+?=###%%%}"5p"5taEVeFI piLlmCnf&,p3b:uBKVqscoh`vxVV{x"7@=x\d B3:(=1< ?:9<(-';I/;Xve?;!x;2;UmV`Ru~Py;NG;N;R W!;P;WuM)OMM<C  ... ... tz0~0223Hu>Tt * tTuW * uWTuD uDLu[h,Kw"w"w#w"Ew#Uh"w"H(!w!w"w"w#w"w"w#w"  '@@xxx ,dݖxxxx xx xx@Xx@z...... ...... lost+foundAd.##.f0znti_|  C! ʝ  ńŊhaJʻʮŔHŚb_Ť` ŭ!Ŵ"Ż#$%&'(V)*Ŧ+,-/11 23!4&5*6% [X1I11111111111. (prog_root)`ٶfٮhjhpvټ\L%xRQr ٶq){Qٮqxi~KMj~1iM{m"myqv=}w!}{jq#(.\4 ;mt}Dw_}JqqPXs!w]s!cin4=v|>~||*1r lIPjww%]MA s1kr |^zqټqM{p %}< f)`|"j@$!ve+H 4DYCE<<#*!^</*>M+tf+p, |!$$C%+%c.uu (%(s>'?K8u#\(& EJFP ca ls h & !"$'(+-.03569:&lB /bin/sh:;=c=i=t=i=o=i==============>>>=>=>(=>1=><>G>N>Y>_>g>q>|>=>=>=>=>=>=>=>=>=>=>>>>?? ???? ?,?7?B?G?P?U?]?j?q?~?]???=i&$?=?>?>G?>Y@)>g@M>|@k?@@@?,@?B@AA?PA6AM?qAa?]Ay?A>A?Bb\ z  * . ` d f o404?sz _###)#*######%%&&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&''' ' '('('L'L'N'N'S'U'W'W''''''+++P+P+U+U....////0000>0A00011/11111122 2G2PMN`|ף0RTfhk`oooop"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|  ( ( ) )oK_pp0J#%')-Y[  : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----0*0-00ooprt} %&,,&-GQ).1256CCLL||װ /vz       8 : ? ?   $ 'FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB4@4@4G4Ujjk0k6oOoOoooo-0Fgi{тхыѪѭBD6;luuڄڄڛڟڡگ!#$&*06DJ "" e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<GGGG is a directory is not a regular file (use -f to see it) 0 0 (J$JJJfKK"K>5K&K,K9KKH;KS Y7K[ Ke Kn K|#K2K8K KK K(eKK!KL9LLR{L'&fL2)L>LH5LQeLZ:LdNb%LlLv6eL4KtL L+L,L-L.L*LL?BMEGM/M/M"'M.FIM; JTdJJbK JgJnJ| JfJJJJJl J J JJWmkRkRkYcWbkCkc kG ky wb YMYrWca &GU)UJUhb @&GhUUB &GlUUc &GVVJVJd &GVqV A&GVVD (Ve &GVVWf x&G`W.WFF p&GWbWg h&FWWWh `&G|X,XEi X&GtXhXXj PXXJ H!&G8XYk @H 8HK 0&G0YY>L (&G4Y\Yzm  &GYYYn "&GpYYYo ZO Z p HP -Zq &GZ ZHZtr "&GdZZZs !&G[[7S !>[T[dt [tT }[zu &G[[[V w "&G@[\\5x (e\l\xX A&GL\\y &Gx\\z &G\\]" )]3~ x!&GD]<]`? p!# h]~] `A&GH]] X&G(]] P&G,^^) H&G$^E^w @(^ 8&G^^ 0&GA___7 (&GY_]_~  &G __ $&Gu__ $&G` `# &G`C`] !&F`v` !&F`` !&F`` (Ia" !&Fa1aE &Fa_a| &Faa a &Fab &Gb=bQ &Fbkb b !&GPbb &Fbc+ &FcTcc &Fccd &FddNdtdddddfdbddde ee1e=eGeQe[ele{eeeeeeeeeR{eeKeeffIff(Df1fAfUfg fmYgftf}ffffffffffggJg(`g4g9gFUgS&H (press RETURN)8C88   tags643{}abcdDgGhHilnNpPqrs tw xy !:#=&g&gp-e^H-i^C-k^UK , ,T|  +%  + +r +d   +Tr( +r} *s9 *D  *ugF )D{F (z  (  (t (TF (uamF '{!F '4zF &zQ  &#  &d  &4F %LuYEF %NuQ$  $;  $ $d2$ #y2$ #2$ #T  #  "  "  "T  ![ !Zc !tuF !4jF fF juIauuuuux}1uuuedgh\^]_uu 2buu%tu18u=t tt$t#t.ttttot}ttWyyQRy-S=TXyexyyOzCPzQyRySyTUxVxtYt_ytg<=>?[ftt1tEv-vu~i}ytSvvvvi~}vUz}sTsss:s[fsssK]qemu!}w%w vvWwiwUw=Qw}%ijCkKw=U= smts '/7se!ww1IxixQx9x!x w~~wzO  {e{U{E{u{{{{{{{{sMsUs]s?usE|U|9|{rr&|'|(|)|q||ze||%|}'}}|}rr5rM rer}r'rr/P`otxTt~ j "t#%%&%&r'5'EQ'W'l'p't'w'z'()+,e,,;l,,,,- --&-C-]--...../t/:/[T///0#0a0o0v00001$151111228234W4457C8l: ;2>?P?d???@P@FAnAB5BaBvBBBBBC CC)CUCaCsD(DEEEIEEEEF EGGH!HII[IIKLMMMMN&N>NfNOYOPPyP~PPPPQQQ0Q=QQQ_QnQ}QQQQQQQQR RR)R7RCROR]RtRRRRRSSSTTwTUUVWQWXeXYcYYZZ"Z*Z4Z>ZGZVZnZZZZ[[[([4[F[b[n[{[[[[[[[\\4\P\k\\\\;\\\\\\]]]]+]D]V]o]]]]]]]]^^^^ ^&^7d^@^X^b^o^x^^R^^^^^^____,_:_I_a#bUccdddee#e5teXefejenese}eeeeeffCf`fffffgg,gUh!h9i h!iiAi`i|iij jNj^|Bj{jjjjkk5kk2llalolmmSmmmmnnn@nGnUnbnjn}nnnol\,.>oooopp7pQp_ppp{pppNrppppqqtPtkttT;ltttttuuuvhbv{vvvvvvvozvvvww$wPwwwwwwxxzxxyyDyfyyyz8z=zCzz{|M|}l}&}>}h}k}v}}~~H~w~o2bQw/Lbw/L,p~ *5GXgy;l\,AL^ju~ 3G;lVav  5GPjNi +Lh 0bl}l2 bbfY>^Z/-˹u   h0  10&`'(#)**j+/,7.1/ftp8@.@[fKS@ `mx U6> V# Wi? W-7@ UQ UaAJ SBO SCT SD  TE \ SF  SG Yl SH ` SI S#Y S S w { z p1u p 1e ~]u p  '4BO\k] \ U] \ 1v % C   -   ' * 4 7 GߩJNRVZ^bfjnrvz}ɁɄɈɋB1 ɐ!ɡ"ɰ#ɼ$%&'() *+ ,&---:.A.// *0 01L2P3V4[56`7f8l9u:q;{<ʊ=ʖ>ʨ?ʶ@[\\]^^$_/_8`E{P{c|q}}}ˑ~˗ -dd-ddTdd:dd:dd ` l@t@`p|#####$$$$$%%% L%%&&&'$'0'8(D(P(X)d)p)x***+++,,,,----...$/0/</D6P;`;l0x0011<<==>>?22 2 3 3 $3 ,9 87 D8 T: h4 t4 4 5 5    !  "  #  $  %  &  '  (  )  * $ . 0 + < , H - P / \ 0 l 1 x 2  3  4  5  6  7  8  9  :  ;  <  =  >  ? $@  0@! <@" H@# T@$ `@% l@& x@' @) @* @+ `& `' @, @- @. @/ @0 `( @1 ,@2 <@3 L`) \@4 h@5 x@6 @7 @8 @9 @: `* @; @< @= @> @? (`  8`! H`+ X`, h`" x`# `- `$ `. `/ `% C C D DEEF$F0c8cDdHdTeeX#`#l&|&0$0<LX\p|lx | @@Ut   @@@@@@$`,`8<DLT\ d@h" 33333333cc///,/H/`3333<<<<<=UTC33 " # =  #= u " [33(`339gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA U U U V  33UU33UU33UU Z Vp [ W  [X Y@ [ Z'bHbbbbb4==bbbbx   @ O333333333333333333333333333333333333 33 33 _` 1L1L 0000000000000000 (3333\ 3333@X33 ` ` ` (root)`33J4T`0_! CH$ D4Ap%IwνIK)]~wmYgj9/A<"Wvu5Y)mxewsCc/{ZֵF_ 7vU+o.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BpHppSNPbVb$bbgct,y  b2 b2(`2p2535MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5771 5805 6488 6776 7484 7540 7614 7710 7885 7908 7931 7937 7946 7968 7972 7976 7979 7982 8087 8290 8529 8970 9408 9443 9458 9470 9476 9488 9537 9557 9597 9614 9631 9646 9693 9731 9779 9861 9985 10121 10162 10200 10237 10272 10282 10331 10481 10487 10492 10496 10516 10626 10646 10652 10666 10678 10689 10726 10760 10784 10886 10923 10945 11044 11099 11157 11168 11184 11236 11404 11611 11782 11846 11898 12171 12722 13252 13685 14023 14356 14469 14484 14493 14653 14824 14974 15138 15161 15185 15200 15275 15415 15592 15747 15759 15839 15940 15986 16012 16082 16093 16102 16115 16141 16156 16172 16185 16240 16251 16266 16470 16703 16732 16747 16816 16890 16963 16993 17031 17085 17539 17565 17594 17698 17804 17989 18101 18216 18320 19007 19266 19406 19442 19612 19653 19789 19812 19849 19894 20145 20241 20295 20394 20405 20442 20479 20506 20515 20549 20556 20581 20608 20643 20657 20671 20700 20714 20731 20740 20762 20780 20797 20808 20827 20853 20871 20894 20911 20926 20941 20959 20986 21013 21035 21074 21092 21124 21352 21426 21469 21515 21662 21818 21862 22141 22168 22527 22711 22863 23044 23191 23349 23370 23418 23428 23436 23447 23458 23468 23475 23490 23502 23541 23571 23610 23663 23721 23742 23749 23768 23789 23796 23820 23842 23862 23884 23915 23952 23974 23988 24034 24063 24097 24137 24172 24200 24248 24257 24266 24271 24280 24289 24306 24310 24315 24321 24325 24363 24372 24399 24419 24442 24461 24488 24510 24542 24558 24563 24573 24596 24618 24635 24652 24665 24674 24683 24689 24716 24723 24747 24768 24792 24805 24824 24849 24872 24888 24894 24906 24936 24944 24984 24995 25006 25017 25034 25051 25065 25082 25298 25602 26050 26266 26530 26802 26854 26890 26926 26977 26994 27032 27046 27053 27070 27073 27078 27087 27099 27110 27119 27140 27182 27220 27236 27267 27292 27327 27383 27423 27444 27464 27505 27534 27582 27815 27850 28057 28076 28113 28174 28212 28251 28407 28422 28468 28516 28539 28575 28585 28595 28606 28611 28674 28722 28766 28827 28860 28961 28979 29118 29140 29263 29277 29287 29310 29415 29471 29587 29618 29623 29649 29688 29698 29741 29751 29767 29782 29800 29823 29853 29874 29900 30097 30140 30144 30150 30156 30161 30172 30186 30215 30247 30259 30306 30356 30396 30423 30439 30448 30491 30497 30505 30509 30529 30546 30558 30589 30845 30894 31470 31497 31529 31557 31609 31615 31621 31626 31647 31663 31685 31714 31855 31989 32002 32138 32140 32142 32144 32161 32174 32192 32219 32223 32229 32234 32242 32248 32288 32290 32300 32315 32332 32366 32398 32436 32465 32494 32516 32559 32585 32629 32765 32767 32847 32893 32941 33046 33148 33187 33254 33261 33322 33386 33390 33397 33519 33588 33876 34014 34155 34236 34283 34289 34312 34358 34361 34387 34430 34495 34557 34627 34695 34788 35007 35032 35036 35072 35090 35118 35160 35204 35268 35318 35394 35416 35468 35512 35551 35585 35615 35646 35671 35680 35692 35700 35711 35723 35742 35766 35815 35832 35856 35899 36221 36224 36238 36251 36263 36270 36281 36288 36295 36304 36314 36331 36347 36397 36405 36413 36423 36434 36452 36469 36490 36512 36521 36531 36558 36564 36574 36593 36609 36627 36647 36656 36667 36674 36691 36710 36731 36741 36758 36764 36780 36795 36810 36831 36853 36872 36882 36887 36892 36910 36929 36948 36954 36973 36993 37013 37031 37036 37042 37059 37075 37096 37109 37117 37137 37161 37178 37186 37197 37218 37224 37236 37258 37272 37281 37302 37320 37329 37363 37386 37413 37445 37468 37488 37499 37531 37547 37558 37571 37594 37616 38124 38154 38185 38213 38227 38428 38650 38817 38904 38921 38939 38956 38985 39032 39043 39062 39084 39163 39355 39383 39501 39523 39664 39683 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_BETA. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_BETA ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_BETA ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_BETA InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_BETA ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5768 5795 6361 6661 7302 7349 7462 7555 7589 7608 7626 7634 7643 7668 7672 7676 7679 7682 7804 7989 8217 8737 9088 9117 9130 9143 9148 9168 9187 9208 9267 9284 9298 9320 9365 9391 9432 9510 9628 9742 9796 9825 9857 9896 9902 9935 10058 10065 10069 10077 10101 10183 10189 10196 10208 10222 10231 10264 10283 10295 10405 10467 10486 10605 10656 10708 10720 10739 10791 10995 11203 11394 11454 11503 11771 12231 12898 13322 13644 14069 14201 14233 14245 14423 14620 14781 14915 14935 14968 14982 15051 15164 15336 15471 15491 15603 15695 15718 15741 15800 15815 15836 15851 15872 15892 15917 15931 15955 15967 15985 16195 16445 16466 16482 16535 16603 16676 16713 16739 16815 17310 17336 17358 17465 17572 17773 17846 17930 18030 18525 18763 18914 18948 19083 19127 19266 19307 19352 19399 19643 19776 19838 19932 19937 19971 20005 20020 20048 20081 20088 20113 20131 20157 20164 20179 20194 20214 20254 20271 20291 20312 20334 20349 20369 20391 20406 20419 20433 20445 20457 20471 20494 20517 20535 20578 20629 20666 20851 20914 20950 20999 21090 21220 21273 21533 21580 21941 22091 22260 22400 22520 22652 22692 22739 22749 22757 22767 22775 22786 22797 22811 22836 22879 22912 22945 22980 23034 23059 23078 23100 23105 23111 23142 23159 23186 23204 23225 23247 23266 23276 23306 23332 23359 23408 23436 23463 23516 23526 23536 23542 23552 23561 23581 23585 23590 23596 23600 23635 23644 23675 23692 23719 23740 23760 23779 23805 23818 23826 23842 23873 23904 23925 23951 23964 23972 23983 23989 24013 24023 24035 24053 24064 24084 24100 24126 24148 24164 24176 24196 24222 24228 24258 24272 24286 24309 24328 24347 24365 24383 24606 24912 25330 25531 25771 25955 26033 26088 26155 26195 26218 26252 26263 26271 26294 26297 26300 26306 26317 26329 26342 26372 26416 26429 26442 26479 26493 26504 26515 26526 26543 26554 26601 26624 26673 26914 26947 27202 27223 27256 27309 27335 27362 27518 27524 27567 27587 27606 27635 27642 27649 27656 27661 27710 27748 27782 27839 27867 27912 27929 28030 28035 28112 28126 28136 28160 28283 28364 28474 28502 28507 28523 28552 28560 28601 28608 28622 28635 28643 28662 28695 28715 28735 28951 28982 28987 28994 29001 29005 29019 29031 29046 29079 29092 29147 29205 29241 29259 29277 29295 29332 29338 29346 29350 29371 29388 29399 29421 29599 29643 30345 30369 30403 30422 30467 30474 30481 30485 30509 30520 30525 30588 30709 30832 30845 30979 30981 30983 30985 30995 31004 31017 31044 31048 31054 31059 31068 31073 31100 31102 31115 31127 31142 31170 31214 31261 31277 31299 31310 31343 31363 31412 31512 31514 31579 31628 31677 31781 31879 31920 32011 32018 32079 32143 32148 32154 32263 32322 32573 32714 32841 32909 32946 32953 32980 33026 33029 33050 33095 33146 33205 33274 33321 33426 33569 33594 33598 33632 33649 33673 33725 33776 33848 33914 34012 34029 34060 34096 34130 34154 34178 34211 34231 34241 34249 34257 34267 34278 34292 34318 34366 34389 34409 34450 34749 34752 34766 34778 34785 34804 34818 34825 34832 34841 34851 34868 34884 34932 34940 34948 34958 34969 34987 35004 35023 35043 35050 35067 35084 35091 35104 35139 35156 35175 35195 35205 35221 35234 35252 35272 35293 35303 35323 35343 35356 35375 35388 35412 35435 35448 35459 35464 35471 35489 35508 35527 35535 35554 35574 35599 35617 35624 35631 35644 35653 35674 35687 35695 35715 35743 35760 35766 35777 35808 35816 35829 35851 35873 35882 35903 35921 35928 35951 35970 35997 36015 36035 36048 36063 36084 36098 36105 36119 36134 36153 36698 36731 36759 36788 36796 36833 37145 37322 37399 37416 37434 37449 37471 37521 37531 37548 37570 37629 37787 37811 37941 37966 38092 38110 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_BETA. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_BETA ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_BETA ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_BETA completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_BETA. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_BETASalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_BETAEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.diterGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5656 5683 6259 6619 7304 7365 7443 7538 7578 7600 7618 7624 7633 7659 7663 7667 7670 7673 7795 7980 8208 8737 9155 9184 9197 9210 9217 9237 9256 9279 9322 9342 9361 9384 9428 9457 9498 9564 9676 9790 9844 9873 9905 9944 9950 9983 10061 10067 10071 10076 10117 10254 10264 10272 10291 10305 10314 10346 10387 10400 10525 10583 10602 10721 10777 10829 10840 10856 10895 11145 11317 11489 11544 11579 11830 12235 12535 12804 13165 13345 13664 13684 13697 13886 14030 14226 14360 14380 14413 14432 14533 14688 14876 15063 15083 15162 15260 15298 15321 15411 15432 15455 15474 15498 15528 15572 15605 15628 15640 15658 15926 16245 16276 16311 16375 16450 16520 16551 16581 16673 17164 17194 17211 17351 17492 17689 17808 17955 18122 18680 18976 19157 19202 19365 19419 19554 19590 19650 19700 19991 20100 20157 20254 20259 20294 20329 20344 20368 20401 20406 20431 20447 20470 20477 20494 20509 20528 20560 20564 20584 20602 20614 20627 20645 20669 20687 20706 20733 20760 20772 20793 20823 20853 20878 20911 20946 20984 21237 21306 21361 21422 21540 21699 21753 22014 22065 22441 22596 22740 22880 22988 23173 23203 23246 23256 23264 23274 23286 23307 23316 23322 23354 23396 23432 23470 23507 23555 23579 23591 23605 23613 23621 23650 23667 23696 23717 23740 23749 23768 23780 23824 23862 23889 23933 23961 23988 24041 24052 24063 24070 24080 24089 24123 24127 24132 24138 24142 24177 24187 24217 24240 24269 24291 24313 24335 24362 24374 24386 24405 24439 24472 24493 24517 24530 24542 24555 24561 24587 24597 24608 24632 24642 24662 24682 24699 24725 24749 24762 24782 24816 24823 24852 24875 24898 24914 24929 24944 24959 24973 25161 25466 25897 26088 26323 26511 26553 26603 26657 26705 26727 26768 26779 26787 26811 26815 26819 26828 26839 26850 26865 26896 26942 26955 26968 26998 27012 27024 27036 27048 27066 27089 27134 27157 27217 27469 27496 27758 27776 27803 27852 27882 27913 28045 28052 28101 28124 28148 28177 28185 28195 28203 28208 28261 28310 28350 28416 28449 28493 28516 28617 28622 28699 28713 28723 28747 28870 28951 29061 29089 29094 29110 29139 29147 29188 29196 29210 29223 29231 29250 29283 29303 29323 29539 29570 29590 29596 29603 29607 29622 29641 29667 29676 29688 29742 29800 29835 29854 29871 29883 29918 29924 29932 29936 29957 29974 29985 30010 30188 30242 30933 30952 30987 31017 31063 31069 31076 31080 31104 31120 31126 31201 31351 31470 31483 31551 31553 31555 31557 31567 31580 31597 31624 31628 31634 31639 31648 31653 31680 31682 31695 31707 31722 31750 31794 31841 31857 31879 31890 31923 31943 31992 32092 32094 32170 32225 32275 32374 32469 32517 32607 32614 32675 32739 32744 32750 32853 32905 33151 33312 33467 33538 33591 33598 33625 33675 33678 33699 33745 33800 33859 33928 33975 34080 34223 34248 34252 34286 34303 34341 34394 34434 34510 34575 34669 34690 34728 34768 34804 34828 34851 34890 34920 34927 34936 34944 34952 34966 34982 35010 35062 35079 35100 35144 35486 35490 35505 35516 35524 35543 35555 35562 35569 35578 35588 35605 35621 35675 35683 35691 35701 35712 35730 35747 35763 35781 35788 35806 35823 35830 35840 35871 35890 35909 35929 35939 35958 35971 35991 36011 36032 36042 36061 36080 36090 36107 36121 36144 36168 36181 36191 36196 36200 36218 36237 36256 36261 36280 36300 36325 36340 36344 36351 36361 36370 36391 36405 36413 36433 36459 36476 36484 36495 36526 36531 36544 36566 36581 36590 36611 36629 36638 36682 36706 36733 36748 36765 36779 36810 36834 36865 36872 36886 36901 36920 37465 37498 37526 37555 37563 37600 37912 38089 38166 38183 38201 38216 38238 38288 38298 38315 38337 38396 38554 38578 38708 38733 38859 38877 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_BETA. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_BETA est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_BETA est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_BETA Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_BETAExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5750 5782 6274 6563 7108 7154 7258 7344 7380 7395 7413 7421 7429 7456 7460 7464 7467 7470 7581 7766 7994 8470 8804 8833 8848 8863 8871 8885 8903 8924 8975 8991 9001 9021 9067 9097 9150 9207 9318 9439 9483 9516 9555 9589 9596 9629 9706 9712 9719 9726 9755 9867 9873 9884 9901 9918 9927 9956 9968 9978 10079 10141 10161 10281 10318 10374 10388 10409 10446 10656 10831 10980 11015 11067 11285 11600 12125 12488 12778 13171 13306 13319 13330 13476 13655 13786 13920 13940 13973 13992 14075 14190 14331 14456 14470 14578 14671 14700 14720 14796 14813 14831 14847 14866 14886 14903 14915 14941 14953 14971 15172 15411 15438 15455 15511 15573 15633 15664 15688 15747 16123 16153 16170 16278 16388 16528 16602 16678 16756 17248 17468 17579 17610 17737 17773 17901 17928 17968 18014 18230 18354 18422 18522 18527 18563 18599 18613 18636 18669 18673 18698 18717 18743 18748 18763 18778 18797 18822 18834 18856 18873 18886 18898 18916 18940 18955 18972 18985 18996 19007 19027 19056 19085 19109 19144 19179 19206 19393 19442 19474 19522 19619 19752 19798 19990 20020 20342 20471 20611 20751 20868 21003 21047 21090 21098 21108 21120 21132 21140 21151 21178 21212 21249 21280 21315 21351 21398 21418 21435 21453 21458 21465 21492 21508 21529 21546 21563 21581 21598 21611 21642 21667 21698 21729 21764 21791 21844 21854 21864 21870 21879 21887 21902 21906 21911 21917 21921 21956 21966 21995 22011 22037 22054 22073 22094 22110 22123 22128 22136 22151 22177 22196 22224 22242 22253 22259 22265 22286 22296 22307 22325 22347 22364 22377 22398 22418 22438 22449 22462 22484 22491 22516 22531 22551 22563 22580 22597 22617 22636 22813 23097 23407 23587 23798 23986 24052 24099 24154 24198 24218 24247 24259 24265 24281 24285 24289 24297 24307 24319 24334 24353 24389 24400 24411 24450 24462 24472 24482 24492 24508 24526 24575 24596 24641 24885 24911 25165 25180 25206 25263 25297 25332 25474 25491 25540 25561 25577 25606 25611 25616 25622 25627 25666 25701 25731 25786 25819 25865 25879 25958 25963 26017 26031 26041 26065 26151 26199 26305 26339 26346 26361 26388 26397 26436 26443 26465 26484 26500 26518 26550 26569 26586 26743 26774 26781 26790 26798 26805 26819 26837 26856 26866 26878 26919 26964 26993 27014 27037 27056 27094 27100 27108 27112 27133 27150 27159 27178 27324 27366 27876 27884 27908 27926 27970 27975 27980 27984 28015 28028 28037 28083 28209 28300 28312 28376 28378 28380 28382 28392 28406 28421 28448 28452 28458 28463 28472 28477 28504 28506 28521 28532 28547 28575 28619 28666 28682 28704 28715 28748 28768 28817 28917 28919 28987 29027 29072 29147 29213 29248 29329 29336 29397 29461 29468 29474 29573 29629 29905 30029 30140 30202 30240 30248 30270 30319 30322 30343 30388 30443 30502 30571 30618 30723 30866 30891 30895 30929 30945 30970 31018 31054 31115 31169 31250 31272 31311 31348 31380 31404 31431 31457 31471 31479 31489 31497 31511 31524 31536 31560 31601 31627 31644 31673 31997 32000 32014 32026 32032 32048 32060 32067 32074 32083 32093 32110 32126 32169 32177 32185 32195 32206 32224 32241 32254 32280 32287 32295 32312 32320 32337 32361 32380 32399 32418 32428 32439 32453 32471 32491 32511 32520 32543 32563 32574 32589 32601 32620 32639 32650 32660 32665 32671 32689 32708 32727 32734 32753 32773 32798 32815 32821 32829 32839 32851 32872 32888 32896 32916 32936 32958 32966 32977 33000 33007 33021 33043 33060 33069 33090 33108 33117 33148 33164 33191 33210 33230 33248 33269 33283 33303 33310 33329 33344 33363 33908 33941 33969 33998 34006 34043 34355 34532 34609 34626 34644 34659 34681 34731 34741 34758 34780 34839 34997 35021 35151 35176 35302 35320 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_BETA. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_BETA zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_BETA zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_BETA zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_BETA zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_BETAWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_BETAUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log run spool ... ... ... . .. lock . ..