08PV!i'&<  'V!iSV!iV!iV!iz$V!iV!iV!i~$sV!iV!iV!i$V!iV!iV!iAV!iV!iV!im V!iV!iV!i$V!iV!iV!i $V!iV!iV!iAV!iV!iV!iAV!iV!iV!iAV!iV!iV!iAV!iV!iV!i$QV!iV!iV!i $V!iV!iV!ix $V!iV!iV!i$V!iV!iV!i$V!iV!iV!i$V!iV!iV!i$V!iV!iV!i$V!iV!iV!iAV!iV!iV!iAV!iV!iV!iAV!iV!iV!iAV!iV!iV!iAV!iV!iV!iAV!iV!iV!i0S*T CM@^_JOhJ=u3+=~W]aaA=YC~"MVxF-GOF% M~!K`DӢXp~C'$+mt{`fn2-. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4l$4 (@@ZZ " "z\z\#,,$T ,,#,,NetBSDAPaXUSR&ffffUVSʏ( ,9s 9r[^]UWVSՂÚ(]P PLt,1t&tuAt[^_]Yuڅtft9s1u+z 9suփ 9r}tt~t111us t0#t&wfuUSQE$uԋ}{̋CE29sSU]MȍXE9s1u\tED u|E9rϋU]u9r09Jt*tE9ǍvuUWVS%(E@@9s{*`;9r[^_]UWVSé(E u  -M <8ME @E  -t/tu~~,9s 9rEt E$-,p$ ,9s 9rP"$ED$E D$E @$$y -0MD$ D$ D$$1ɉL$L$(<[$SWD(5u1ƃ5$tЃt]$l_[SW(4uYƃ4t|$]<$kt(?t<$ktЃ_[UWVSh "h "h-K# %1t:P,YxOvh-j XZ3hn%h- # h-j \jUEU MsMU HE]UVS1ۋ %tVP.ZYu $%C܍e[^]US`:Ph!"h-x"h-h!"E`% CtsPh!"h-D"j+UWVSE tuh!"URhc@5-v t5-h!"j谒u俞#5!#M𻞍#5!#E躞#5!#WVSQRP5-h""E t#5!#RPh/"" u5-h=""1e[^_]U5-EXUjhc 5- t5-hV""j1USRj EPSr xU:t Shd""j肑]UPEU Ph}"" JtPh""dEEEPhc5-  t5-h""jE1UWVSSuE H1ۃv>PW+ZYtC%uދ%Eh&"W+ZY1tFEEPhc5-y t5-h""j賐1e[^_]US u Sh""jb]UVS1%tSP*ZYtFSh""j,%e[^]UWVS ]u} Sh}"" } ~Sh""1}{EFE} t!v""1UWVS`] u~ uh""Uȹ1Rhc@5-E 5-h!"j0-DPEU Eu>M9Mt66EE1EEEK>tt,uh#"b1}}}}}E뺉t9Wuh#"jU9Uu\}t }uEEEqEeEEVEEċ]9]}t;$}t)}t(u9ut8Eċu9u}l}uE EEEԅu.u9u<E4%5-h#"$ "}t}uuu1ۉ]EuM9~VQuh#"jk]lSrEYu h#"j1}E1҉Uuĉu܋UUMM]]}}Ph c5- u EX@1}Wuz5-h$"j赊EuPE4%h#$"9CE rh+$"(8^ElU9U|@-h@-hUW$XZCtCPh1$_Xj ^CtCPCPh@$"d CtC"PSha$"K Cts؋C4%h$"+ C$Ph$"ZYucyXE\1e[^_]UE-]UE-]Uh&"jUh-&"jUhD&"j݈UhZ&"jΈUE E EE]m#Uhjjjuho&")d--Uhjjjuh&"c--Uhjjjuh&"c--Ujjjjuh&"c--Ujjjjuh#$c-----u(Ujjjjuh&"Gc---u(Ujjjjuh&"c--UShjjjuh&"bӉ‰؉-- u j ]Ujjjjuh&"b0 -u jM UWVSu-1--1->WXuWh&"j=SY_u Sh'"j蒆xxuSh('"]hjjh %EP uu뺋-#H t uhB'" P-WPZ_-t/#=t --tt hr'" X-ƒtuh'"<ۣt?%t4!t$t -ۣ -h'"j藅-e[^_]UVS-uX------;--rgj------X=5-u-E -)EU}t 13A}uke[^]Ë-- t --Uh2%hUW$j襄UUh0%hUW$j艄UUSË@4URs(PZYts$hUW$j~S4K(E%= u!HPhm8@QR @ C !jjjQR Bu@u,8uK ]USQ-9s SkZSPEPlƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h("j軃C4WPs(Xe[^_]UWVS]uVh-j4C4uu s(P(+8jVjw4$+8؍e[^_]UWVS-}t -- --EUEUEU}uH - t?11ҋ}9׋u} ytEU--E-- t(jRP5--P Bu@u 5-h("IuSh-Ɖ 19|4 u5-h3("%*8t5-hUW$j@11-E - tKEX- \-5-5-QP(P-T-0-4-1ɉ - -5X-=\-9}u;9uu6E9-u E9-t8-<-|0-4-l8-<-9}u9utT-t%=-u-5-hE("-XZ-t5-hi("j)u}--+EUEU--=- -9}Er }ME EtUR-)P5- --- -- t88-<-0-4-SQRP& ujhH%j1 e[^_]UVS]M Eu fft3SQHtlpCQSCAQSCAQSCAQSC AQ S C A Q S C A Q SCAQs[^]ÍL$qUWVSQ- -t/jh"j0 - -tjh"j/ jEPli]eƉߋE׉ptid-%`-Ɖߡh-׋pt)ptZYt puDžp1t5<-58-54-50-5,-5(-5$-5 -h("jd]S,S$Sj.H-L- t7ƃK% tJ#QRPh#)"jdSlS$Sj.$@-D- t7ƃK% tJ#QRPh<)"jdS$SX$Sjm.$P-T- t7ƃK% tJ#QRPhO)"jdSS$Sj%.$ X-\-iቍhltpRP#Ɖ׍xPjhtp$WVxPhlSQhf)"jd]S>$So$Sj- eY[^_]a&Uuj#UWVS--5- --u3jRP5--P B@;1S0 -v[H0 -S5-5--P$ t -u:5-hUW$j|-uNu<)u-h)"j{t5-hUW$!XZe[^_]UWVS-- -u?j --%-RP5--P B@4tAfEEEPhm5--P tS5-hUW$j{11;5--5-5-5--P$ ~fEEEPhm5--P @t;5--s>5-5-h- ;-C;-7벍e[^_]UWVSƉ׉ˡ-҃Pj h5!#WVRuV&VSh#(e[^_]UWVStÉ׃=,-t%tPh)"h Vh PV芆 =P-ssVPh)"&s$s ssssh*" 0sxs1-`-tPD5`-Z1҉`-YX1x---1U塈-t*P1`-ZtPC5`-:Z1`-ZYuKUjh-h -h]2 yjd-d-h-d-1`-@=uUSUE -`--M`-Ћ] Ӊ)~`-@[]Ã06w $`%1Ã1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HøUWVSӃu]1-2--@ujjh-h-zth."hUW$=Y^----`-)-󤢫-1-2--@ujjh-h-th."hUW$g=XZSjjh-e[^_]UWVSƉӀ:0B؍}01҉U"<%]BuʀEt@9uSfYthg/"hUW$|9XZe[^_]US--9--RPlPZYu[' 0a[Ph#h-hı% 9-H-ua-tjtJj]-- -u -ųu١-P--M 1]UWVSSU-=-CE;U tM-119~149u1ɉs19~H -9E~@1Aˉt-X[^_]UVS5---19| t!-H<u -1[^]UWVSfEp E}u.h"5-_Z]tjEP_ Y^uD1Gh"R^_FP-Zy }Ou PP x. E uhr/":-| zf%,-Ѓu-h/"RZYuu h/"6X넋-jEP [_bE --9-=}\SRMZYu[f 0XPh#h-hı%I6-H--tjj-- -u -uΨuً-EH--8lx #xtދ-PRRe yɍe[^_]U-1----5-P1҉--H-Yu-tjtjUWVSP- t u h/"5X 6ƅu -8u@-S5-Ë=-X9=-|^SYt=-tj jsPEcUjjjRVV;EtGSZyh1e[^_]Ë -Q-y ;-| tx-J x-Uhx-PXZUWVS u1ۉ߃=-tVI NyVXHF `=- -9^-؁}U|WQJZYU=-- -u-tjtj-u -C1 mCE -9-؁}ULQM5-;JZYMUuX0*UPh#h-hı%2-H-t -/t1 -- -u- u - KF @t.Z0TPh#h-h/"=2tt- -}-8=-t=-te[^_]UWVSu VE=--E衠-E1ۉ--X=-t5-11҉UuiEZUU-5-YUt(EEtBD-PPjAƒ u- -t C-tjtj -u -uݨuEVu9uuHtg}tIu-=-tEu~h-h/"SP-Y^=-u3B=-u-d-=-tJE -uh-h/"OXZ-t!=-t9uuu$-Cu -19uu=-=-M -=-t1ҍe[^_]UWVS];!uh*"CPXZS h*"Pǃ u$0QPSh%h-Hh/"Ju WYXyh;!u7WZy4R0QPSh%h-h 0"4/Wǃ=-uVh$"h- -+E e[^_]UWVSu] }9tU=-t VP*VPZYy00PPh#h-fh$0".C1e[^_]UWVSQu VJ[=-tW1ۅtW;uRWNZuZW95-u=-t =-u BRUPu xËUF?륃=-tuX؍e[^_]UWVSPu]>!uhr"FPY_V u Pƒ u$0OPVh%h-Jh60"RuSRUǃ Uyl>!u7RZy4L0OPVh%h-hN0".-Rǃ=-uWh$"h- tE)؍X؍e[^_]UWVSW11 $-yh -^u -P -s=- -9-؁}U|WQCZYUu[h0NPh#h-hı%K,-H--tj j =-- -u -uΨu١-u-1ۉ߉ u--0--u,-@t?0MPhg0"h-Nhr0"+f%,-1--f,-9t{t ---މe[^_]UWVSW-C{ u)ÃE-:TRPx Y^tE--9-ށ}VRA_ZuZ0LPh#h-\hı%*-H-t1-tj tj 5-- -u -uҨu١-5-ljD s} us*Ext-M| thr/")YoE--9~P-߁}WR@YZ=-- -u-"%-25-NjM}t/s2PR_Zt-D } +s#- -9|R-؁}tVQG@ZYM5-- -u-ux-Me[^_]UWVSQ]utuh0"XZ} 9EueF95< -}hx-h'% H^XP^w<\u7\t.ˆUPh0"ZYUtF-0"0"/B000CL r1e[^_]UEH!-EPhht@j x$Efv@ -Efv< -U=-uE-E ---9~ 1;-~hk_%='XUWVSSu -}t69-+=-=-=-t1C~ Ku"=-tn-u=-t[uSPEZYtI=-Mtj jqP;jjjWu/t9-Hh0"Y&X؍e[^_]UWVSP]U u hk_%.&XU19-~BPSYX%KM-uSwP(x?]9tWZu̸1e[^_]UE 0-DBuh0"%XP<-u-E -1UE0-DBt-Eh0"R%XUWVS-0--EDJ@t t E@-޹-0U?& } $`%}^@- 0--8f|y@t t@-܃tQ18j h-5-XǍ vc8"uh0"A^t-u18UBQ@u^t -uօuhk_%$^1ۉj h-5-&XÍ v8"unt@--.j-_t|%1Ƀ/QP_ZYt-M:+@- FP-@PX.t(@--;u - --9Et9-}؍e[^_]US1-----xL---- ;tK,tF -ʃ~--IuA-H -˃~-Iu J -:;v-l9t-t1[]UVS-11Å t]9 -u 1ۉ -J@։t-[^]UVSuj3Zu+0CPh#h-phı%!FV CS FC؍e[^]UME 19tx\uHPQZY1҅‰UWVS=-ujEH!--Pjhr"h0"/ykh"a^tZP[=wJ@ P2Yt:WPrXZ|3/t 3/D3h0"S 5-jhr"SjUM=-tI -QU=-ujEH!-jh -UWVSE-1ۃ=-u-9t =-| t8f%,-=-?u1-B-: u)u ?.u tԍ4-WZu# -uo-tj=t[j-t PTCXPPj0à t9u- --u른e[^_]UWVSSu-Z;-|1ۡ-x-@-9t9u SEWá-ZYUSWjq/ u -t$195-~FPVjB/ u)ϋ-tj&jSS<[t<\t.RiZÅu!h>|$ { uh2"-[1C뵉) -=-9-Ё}UtVWZYUu[0 !Ph#h-~hı%-H-t-tj2\j 5-- -u -uΨu١-5-lj-=-tj jRPe[^_]US-< u h/" XH< u=-u$h32"XJ -R t8u ӡ-PKXu1-t=-u PdX9j-Yu(0Ph#h-0hı%hK1҉-5-S5-6>ƒ -t+h'h-PRi%5-1-R]UWVS-P-M-1ۀx%u}M8Huu-h1"[s9}n-P-- -\P--2< -=-} -U8u-ف}|Wu[ZY=-- -O-tj7jm8uCH-B=-du f%,-1-| u6/- -9-؁}tVQZYuVS0Ph#h-hı%6-H-j-U5-- -u----e[^_]UVSVu] 1- u 1ۉ-U -< Uu 1w8uA --JπwEN1ɉj h-5-s. v$8"uh0"1Zgu@-늸e[^]UWVS 5-]-=-}+-;-a&M 9}y;M)9 ڋEE-}RUuZYUu]]0Ph#h-hı%@-H-t '-tjtj-- -U-uΨDϋ -M9}}EMELE B19}})É>\GVrω0;UU Mr3)9 ڋEEW-}RUulZYU-- -u-t -M9u}EMELE B19uu)d9|T-ځ}tVuZY45-- -u-_b-Cw}9|T-ځ}tVunZY5-- -u--؍e[^_]UWVS] Sװ^|=-tj jsPlCjPjuMp1ɉ E-}t9U3 9-ށ}V5-- _Zu[0"Ph#h-蓯hı%-H-b-tjGJj5-- -u -uΨuك=-tjj   -NjEpSP-  9~U-΁}V5- ZY5-- -u-=-tjj S6 -Nj󤋅  ?u9Ћ)ȉË ؍x-9<t t tjPjumo-=}tV5- Y_5-- -u-~+ uEthG2"TZDžW=-tjj S -Nj󤋅 -f u1e[^_]UWVS--H-1ۉ]1-+-9U졤-@-Pmuu PuƃU-PP[Z-3E-1SwYu' --tjtsj-t PۭFZPPjƃ t9]u -u -uuE-G-E  Euh0"XE tu RRK x1e[^_]UWVS-E䡠-E=L -t =H -uhb2"NYm=-t -j--E=-ZZk EtTuaPR@POwGHm uu^13^@p][sHZPJJ@BE4qE@E܋]k  9]}3:}z}z}׉}8up}xK Ń=-t聺L --EL -H --EH - -u-tjt j`1e[^_]UWVS--Ht7k X< u'ʣ-B0Z9tSe;S ZY1--L --H -e[^_]US-9-}Pk- -EuCk- -u C-P-k -ZY]d-j Ph-* tPPh#h-舨hı%5-? 1--1]U(Phr2"h-@j, -Q-y ;-| tx-J x-Uhx-P&XZUWVSօt%ˀ9u RPh2"RPh2"> uqRPh2") `{tZC<i1ҍ{t2Hs!t ,I< ϊG< ĸ>e[^_]e[^_]UPEEjEP5- Uh4"Ph4"h-jUWVSf@8tXu1P1҉hW3à 8#)tSWV 룍e[^_]UWVS} 5-EfDž<^苿1҉hPjà t[M8?8u 51ۉh/#Vf8uFt"SVWP yF8#u51ɉjjP @uܾ8th4"j]h&:%)+jWRjafDž=-t fDž9DžjRj fDž9fDž9-jSV @u+8tJfu ft>(@ufDž=-u#K,-@tftfDžftR@u KfDžCe[^_]UWVSQ}u VWU[ZÅuzjjXZu h 5"j;s jEPWkƃ ?tE8thh5"jt8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19} 9xu90tEEEE1,]9Xu]9XtiB9xt A,9|90uU9P uU9PuACk,QMuZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPHY_}ËBt1UjL$qUWSQ---w-ڞw ]]5-5-h5"j 5-5-h5"j  5-5-h6"j 5-5-h6"jv  5-5-h36"j[ 5-5-hI6"jC E$h_6"j. EPP$hx6"j  =-t>u-1 uj贒eY[_]aÃ=-tUE Puj\ UWVS}u _Ph6"j3<@-B9tT@-e[^_]UWVS$ ]5(-t(V膨$V*A0Y^ugh6" j0Pu l% yW7p4$0ZtWVP! u Wh6"Q5h%jj0։( y0h6""jju ։ƃ C Wh Vp%ƒ jjWt%‰ Vx%h O_Xuh7"j[^jh h R(|%y RY߉Rt Zt-w1ҁbt#bt!tu h>7"1 Њ Јt u hJ7"jYu Viƅ/ t jZV8 jZVP< djjP7& D-0tS SQPR(&,7kPƉ4W8t t10hb7"jw \9s1BFu h7"jG 1e[^_]UWVS\]ƍ}ZE5x%(,a&V&048vEPSSe[^_]UWVSĀ]p$tVP:V9Y^㋃p tV3:V9XZ㍅xPH1RPuu1t5 -9ΉЋt}"Q_85 -VPh7"/e[^_]UWVSP] AEH1RPuu8ƉMt1׋C|1׋ujQ1RP<t2uPh7"jgE01RPuu苰‹N tkvkk ыEe[^_]UWVSTE>E8Iu EuEEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉU1EUE}t EșŰU9UuU9uM] E} uWVE,# E: =$-EEIu E5E@1 t1҉ËM ʋUщe ʋ}t}\SQE,c$h#5$-gÃt#EUSjPVzHt h7"mXSyX--E1--E<1EEt E\]ԋu)։]uEEIu EE1 t1WVuu袮9E E~1҉ t1EUWVRPm9E cEEEEuuԋE,#EЃ EtEЍDEȻ8&ELEЍDEȋEۃ0EЋHatE/haQuuPh7"3REЃP2‹EЋ^_9t"ERQuuPh<8"j&E؉E܋EԋU؃EU1ۉ]]]ċEEEЀt)X@}99EEȋ}ȋW:X@9]9EEȋ01}WE9L9U)9E uuE,!EujP1Eă1ɉMEEËE}t;k;xd[}Nj}ljEu 9EcMQRPuEPE]tXpXju5XZ9u9]EE@]k,PuY^Ek,tԉEVFF EUFVEEtP4@0FVGPtP,@(FVGltF Ek,Dԉx(F Ek,Dԉx(@P$]Ep}}EJEt#1 t1EU!X1 t1EUEU9]LEE܃8t)E"9E1EE܃8E\]ԋu)։]uE)‹E#Ju E`Ek1 t1WVuu Puuh8"jt E܋P @E܋@1ҍMQRPuEPcE0ju31ۋE;pE܋EE9shI9uEtpp E_uuE,#ujP=.EċE1 t1u}C<҃<DEE܋}k,PuE_Zu E}81ۋE܋EEE9k,}}܄t3w 0x}܋t|px u}px}Ћw04/81p}܋tpp u}px}Ћw(,px}܋wp J9utGE܋@ EMk,}D$uuE,ujP,EċEk,E‰r(Er$ t1u}CЋ]E<҃<]DE܋EEEE܃8i}Eȋ];\9E}Eȋ}9x }98EЋP9Ut,EQuRuuPh8"jE]E]E Eu--EEUEԉU}E\uԋ})׋E^EXIu EEEÉ1 t1RPWV9PuuSh|8"jE}8LEiEe[^_]UWVS uEPF VM]_9EEr )ӉM܉]Fƒu>uFt 11E`E9sWu h8"jN1ۋE1)ډEUF@]t[ ][]ԋ]1ҋM])ӉM]E9Es 1)EU1U9ЋU_U܋EЋE]ÍEeM1SQRP@FVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW }EEPhEp%ƒyEqRPh9"jxhj,3W}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QRPh/9"1ɉM؉M܉<EPURvSE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]<E1Em}----EЋU--ẺEMEPhp%ǃ yNQWPh@9"0FPhp%ǃ yNQWPhf9"j1eY[^_]aÍL$qUWVSQ9qD-8-,H-L-?1- -1$-(-1h9"VW  ta#DtNJCLp7$-뷃b$%P-0-C-CT-u5Lp7 -e5Lp7kH-R5Lp7D-@4-/5Lp7-,-5Lp78-XLp7(-h-h9"YXP-)lj80!h-h9"XZ= -xh:"!= -x 8u50-t hQ:"j3tjj)hw"5h+jj[_@u h:"jj hw"hj蹞00h:"@Pi@ uh:"t|j/SiZYÅu@rx-׉hjOhjCj$8@-P<-1urh ;"jjz<-؉8hDj803PyP3h(;"jhW5<-OG9=@-=0-tf95@-~W<-4FX烽(ta1(,,9@- -_=4-tjy -xrP<-0j8-dh1҉ldPh <-p%à t$蓟8:ha>"j11ۃ=@-*6, <-,4@lXRjPjjT($tPhI;"XP :8zJt&Z JZ04z($J 04zh P&1--8Y_9t4VZyPh^;"jPhw;"j 3‰.Ju lxtH'‰`R840Ph;" tH891҉ t1҉Ӌ+049׋0|9؋4}Y 9؋4}s8014߭0ݝ0y11SQRP葟1ډ߭ %ܝ0v7ء<- 40<- <0[10=T-pݝt{\P$Sw ݅y+؉Ph;"j 蚚jPh;" \`+EU58-9Ɖ 9jSZY@݅u؉NPh;"H-ܝp %ܝ0 LRjP011RPl$01tZL9rKjQ4#^X0290Q_|OlaGl막 9skQ k4 JHJZH XH J HPW4 D2 D2GlFhjP88P PuPh<"Y[# 1҉D<5P-D-8Hȉ9r09rÉ014#840Ph<"k840Ph<"j04 4111W9m09Ћ4J8JZ8<< 89 +4i۷m۶R<8SPh_<"PDPhX-SW(~LFD\`HP\PhX-W\DHY, X049Ѹ4}u014"80Ph<"p1ۉ898r;D\`j\PhX-W\D𙋝09މЋ4}88SK t+4i۷m۶hQRSPh<"DPhX-SW|$~FL,NY8&D8tX-011҉VPh<"K=98~k,0D$Aۉ7<1߭߭------1XT0 11198 P t$k,0Ћ 9Pu9 tyt_|;TRXR801RP  1RP1F P @ 9| ,PQpQRPjW'k,0Љ1;P} PTQXQ8)Q t p|룋Tșڋቅ044؋ቅ=,-t 1PX-k,8 $98p 9~Љt$DPSh="pPhp%Ã辒豒JQSPh'="j#tV":t&PhL="jK,+ePh^;"j+, E$) 048<11ۅt9 k"j,5<-(,{jAY((9@- Ph>"jI(5<-~=@-th*>"h%hh4>"؍eY[^_]aUE UMQ1]US]C Cs4SjS)1]UWVS}uj Zt"Å~{kP‰C X1ɅuS9[1A9}XM1BBB BUWUYMukC t 40YPSXZ1C Es1ɉKE CC{{j8"_u.1{ YC 9}k4GZP|X7p 1EZB|DBAB @Ѝe[^_]UWVS]s$tV6VXZs tVV^_{G 9w~k4FYPW1XZe[^_]UE@H]UE@1҉P]UWVSEXC9Cuz@CPhp>"jkCPs #ush>"j9C kS41FFF FsZush>"jK kKK E UAQMCSEUCSEURPuu E UMA Q}} EENjEe RPu13|%yEsh>"j EC1e[^_]UWVSQEXCE19E~4kK qy9u U|Q 9U UQ} E )C@1Z[^_]UWVS]s4FECS,K0UM{ stQRVu t EWEC C C[MEHEUBȉEEbMRPsW6|%9CugCC\MEHEUBȉEEbMRPsW6%uh>" YC$Cs4SnXZ1e[^_]t@Ë@ tËÊtBRtUWRPY_}ËBht1UWVS L 1󫍅xPEfE,ZYËEtPhEQuЋ}ԉ t֋Et+ +@|)‰1,0,9r 14DP0,us F(tȃ0tBE;Pdr,9u:s (tvRPwYY09us,9uih(_tZ t @ (jS#EY[t8(w690u9,GjSXZ (w t WV^_Ɖ׋E t1 $DH 9|([ (E9s@(ERPWV0,h>"(u  袋9.}*WV0,h*?"j(3fk,V4Z1ɉp0PHD0,hP?"j+ (X k,4 1󫋝,0rrz E(t=@PtȉB DH9v@l9}&E}t8Phj?"4<@E0]\)Hu E1ҋ] 1ҋ] t1RPWVIkDt 18x, $$y11jDP4Pu2DH1 9؋$}W $) $119ʉ} @H9؋}{ =-h?"jY^wM t1WVSPE(|%=DH9}bk,4_$StG(ZjY0P4t0$h@"j"MH=-tRP0,h(@"jEHa‹E1tIu$X1IuEC1 E E t14k,kD,49Et@E@8RjPjjEj8P h PR v%<DHk,49s"4jh Ep% bRP@8tGpBuE- -Xe[^_]ÍL$qUQ x-t-5p-5 -%EM MuQQ$RPhA"]MɍaUS]CtS P S tSPSCr s ZS |-X]USEPsH) h-l- `-Hu0-Z[9u -u' -uh%B"jhP4BPQ X4CXZ@]UWVSu EEE# --p- |-M11ɅtJA9~ʳ9M}#tp-h9B"h%hhHB")s}9x4u }9x(u9p$t버tp-e[^_]UWVS]uuu SO trNj@thjB"h %h1GGWX9w(~6GthB"h %hhHB"rwVw jG [^WY`- -;|-X=-u =-uBGWu-GWtP-WGtG4WPZWX|-j@j~VjtG _4E UG$W(G,W0wE # -G8-tz8GC GtWP { _ Ge[^_]USEM PuhB"h%h4hHB"OqP ʉPHPPP s E]XPs2H h-l-`-1ɉH -H-.1ۉXt -H- -H-P4JH8-9t!tXYX tAP]UWVSUu }uWVRcËECUtx-Rt-EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq= -Y,A0Éa,ڋyY I4 s RPWSQ|% RPWSQ%e[^_]US]C%CSjS]1]UE UMQ1]UjUU P-PYtHJ -@ -UWVS] -C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdϻC${s譻 ]e[^_]電UWVSuE EEEE%-1҅9su}K}9y,u^}9y(uVK0ts4q4s4 -K0ts0q4--C4-=-~ttpRZg{$u{uCuڋ[0n=-~ tRkX--t$;3uEE EEuCe[^_][؉؍e[^_]UW1---11҉-_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE -K,ϋS0c,ʋ{s K4 es RPWVQ|%9Cu CC17RPWVQ%uh>"赼YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPY_}UVSӋEU tt RPY^CSt RPY^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈS^Z19tPQhB"S Ћ]Uuu %jbIUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus 蝋C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPY[L(ștșe[_]UWSvh2C"hX%h hCC" hÉЊӃttRPhY[LXștșe[_]UWVSvh2C"h%h"hCC"gƉӉȊʃt$uҁTXe[^_]UWVS vhhC"h,%hhCC"(gƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8jlËEEC1CC=_C_C 2h1C C$hj1Ehj"M쉁j`jMAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmE貮Epd觮u蟮S虮EE싀}@u jR^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u-EE %-S0tK0J4--C4-C(tS(P,-C,-މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hyC"h<%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhyC"h<%hhC"3^@]9~ ]B뫋EEPJE̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuhC"}t/EEtP1uuRPhC"辧]9]tSuuuhC"蟧uu] SY[9t$PRuuh-D"su1҉U uXE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRP]MeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPWZYU9닋E芀{at WVhyD"wtC M苉9t.CM苉p9t$1SQ1RPWVhD"蠤C(S,C S$]9UrSPWVhD"rWVhD"^ ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/E"辣}hFE"hL%hhC"JVEzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRPZEuuWVY9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWVY9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhME"臡EuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^E":=hx-+Y^tCpStCHuRPuuEU}t hE"^ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhE"F-6EtM}`d)RPhE" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8jtE1҉PEMAx[A[A [1ۉY Y$XZ}t.hjtËE쉃P^_ u = -ƉE} t hF"N][1ɉM -EPjh WVu*hj'tËEp }쉻PP P jPXZtS Su -}URjh  t1RPuhjsEEp }}M쉏PP P jPW^_utCHSLC419|} tMh7F"\Y@Et} t#hlF"[Zu uuS9u u0X S'X]=t SXktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjqƉ_tCtPq^tCtPoqFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h5|SXZ؍e[^_]UE Puj - UWVS]FHljL1RPuu REUt1EUEU싃C|1EUEU싃URjW1EURPVtPu hF"@ u~ 1RPuu =QtDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuQ€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhF" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhF"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt PhF"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhF"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhF"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuuFƉ׀}Mt1׋C|1׋URju1RPQtPuhF"d Ep 1RPuuaDt֋F Ft:_vkk փ~t*uuhF" tFVC(S,FC vkBHMQjPjjRt PhF"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhF"ZYEP tu}rz}zP4PR:X17-t C0S4C(jjP0uu Se[^_]UVSUE 9| 19[^]USCPPh*G"h-+h-haG"聑 -CtsPh"h-+jgUSSE] t$uh!#s6ZY¸tr1EEPhvd5-' @u35-ho"jݛ]UWVSPu }t}~^h"S<6Y_DžtFh*"S)6_Zt)hr"S6ZYthyG"S6[_t뫿}}uh$v5ZYuUEPhud5-& @u65-ho"j e[^_]US}tQ,Shzd@5-& @u5-h|G"j'.x@uUWVS։ˋ=P%. T%.11~B? ʋE[^_]UP%.?T%.jh>RP8=vuX%.UWVSQ5(%.Ctt+ t&Pσaw <v ;v ju_{Gfw$k A E1E)й 19u5{$ 0-1TtDQt!@ u 9u1 Z[^_]UMU 9|]UWVSƉ׉MP%.T%.ÉEE1RPWVw7E)Ɖ1UQh5y%XZ}UtT%.H9uP%.H9u u9rBRWhL" e[^_]U塨!-=$%.tvPhM"\5d%.5`%.5l%.5h%.5p%.hM"4 5L%.5H%.5P%.5T%.5X%.h8M" 5).h_M" PhmM"hwM"8h%.l%.5!-5d%.5`%.QRP5p%.hM",hN"8T%.P%.5L%.5H%.QRP5X%.hN"k 5@%.5D%.hnN"R UWVSQƉ 31ۉjEPV5 >u#ËE8u28"u w܉1e[^_]USS1P"$5!#Ph5!#Ph5!#Ph5!#PShN"h-F,j/ UWVSEM !-9uh9Q"5!- hOQ"j訉ًEEUMjؙ]!É]]!Ӊ]uuW`BuAtV!-!-=PuRT; 3P50.RB; 9!-uNE!50.}e[^_]UWVSEUϋE E컙F"ti"EU@uShlQ"XZff=Ut+=$.t fuuShQ" ff=u%CthQ"d fLJ_f=Ut1=.u ShQ"7 Y^.tShR" XZj(VP x0XŃ~X %.t\fLJᵃVe[^_]UWVS9).u).5).w1XƃB'.e[^_]W|$wUWVSDEUȉM̋EGWEUċG WEUEER"EEtEZ"11}=!-ET%.P%.U1҉U܉E1ɉMԹEM]̋ERPSQ2PE؋UEUuuRP1RPuuȋE؋UEUuuRP1RPE؋UEUuuRP1RPuhMR","uuuuuuuhR" h -jdh ).  u hR"jh-#h )./Y[ ).U슀 ).< <$u z Ћ 0-DQu<-7j EPh ). Ɖ׋EEh%PhEЃEPhR"u tuhY#u t L =!-Ήʋ5D%.11WVSQN0ƉuhR"u蚔 ui D%.ω%D%.Ɖω uEt5@%.1Et @%.1Et @%.1)Et @%.1)׋E؋]؉E]h-#Sx.YZÉ]; t,h ).Zƀ).uh ).hR" 9uE|E9Ɖ]}.uuuuWVhR"uȋ}u}e[^_]g_USE PuvhR"t$-H$- yh -Y -P -؃ t9@t* $-y h -Z -P -8 u hR"j61Y]UWVSEM䡘!-E@u hR"j!-EӍEƉωؙ!M!EjuuuBu @u!-!-uhuP]3 nR50.P4 9!-uVjuu5!-MBu@t0.K!Nju5!-R5!-2 9!-ue[^_]UWVSRá).u ƀA Mz΍). S}8PR ). e[^_]UWVSEыEU u1+ˀ @%.1ۉƉ)߉u}};=).}=). S"EUEUE9).).}= %.t Ev).KiE9t 5).tމ&ʅu+@%.9UE}M1E܋E9E܋U}t0}t}utsƆj/S"ZS"ȃ[^_]UWVS EӋEEh).@Ph).訑E 5).t h~S"j7EU9E|E9u|硠).] }) VRP5).31fǂU }u@@%.5).֋M)}CsKSCPKSs FSj).Ee[^_]UWVSE}u&B'.ƒ<1IE E#֋EU EUEUE9`%.d%.M%.19Et\tSMM1ۉ]]9ً]M}3M9MM }S"= %.]@uE%.˃t ). ).t!= %.>).1hjwi).[^u hNA"j}fǀUE裸).EU ).).EU).).).ytbt]t E^).QHu).<= %./hOT">Y7T"g%.=).).;).KxZ 5).t1;EM |9UE}= %.t`룅).E 9).u;]t~).H).1+]9~ Fu%uF PPR ). *@%.1RPEU ).+E).XZEU ).).EU).).S"S" T"S"Ѝe[^_]UWVSË@S t+5`%.=d%.9u9t hT"CY]sǹ󥉍1󫍍@u'CT" CuF"RhT"6XZߋe[^_]Ã=%.u x t"1UWVS|Éסt%.tPjYj/S^ZuS5!-hp)%ht%.' Syt%.Yt%.u hNA"jdzjP,XZy5t%.hUW$u[^xPSmZY@tMuи 9E} 5t%.hT"T 5t%.hT"?h h@.S+ 9t5t%.hUW$f=>.Ut5t%.h U"Y^S,XS,Z tje[^_]UWVSÃ=,.u1Ҹ-#,.f=<'.u1f=.I؁=,.t#(.%.@..f<'.f~'.Ut>'.1~'.u[^_]UWVS á<'.fET%.P%.X%.%.11t#f}u&'.t9r $uɡ).E ).19E~+f:uzti 9t@Ћ %.t=4%.uaf}u'.! 9*= %.tu7hU"Y=,.t f=.u/hU"hB%TXZ=,.tT.!9t%.= %.tPhRU"\_XPhU"ZYt 1=,. =,.uL-#t"%1j,.tr.!9tSP5t%.hU"= %.t1~f=<'.u3 .5t%.h/V"ZYu'. !%te[^_]UWVS(ÉEU EUE؉uF=(%.EmV"e[^_]#11ɉD11ɉt<u ȉhjhh%P%tPQRhvV" fu1k t Ph5!#hV"WVh5!#hV" =!-RPSQPhV"RY[=(%.u" @%.9u1ۉ)11ɉj-4j) XZt'.E̋EEE 5!#1҉UUE%.fE9).~5 ).EE̋EEUE$1E9$&E$1҉U9$1ɉMMMME= %.u(}t"uPh&Y"'uuUEtuS&}t.Efu ukE ]PEPz E%.}u(E@EċE̋p1u}@ E1E}u E@Eĉ u"E̋p1u} u5@%.1u}E E4E̋@ E1EẼx `%.d%.)EU}t= %.@%.1҉EU}uE9Ɖ115).=).).E).E1E]9]~JE8t6EӋEU9ȉ|$E@1ڋ}w1EE뮡).).)9E]| hGY"u}= %.= %.1ɉ tG@B'.t0F'.1҉EĉUȋE9Ɖ|J'.1EU9Ɖ|1Eċu}E0'.B'.t8F'.1҉EUI19Ή}E9ƉU| 1EĉΉ볋E@Eău;5`%.d%.Q=0%.DhfY"2_1}uEĩEęjhjjjщ¸tY"E (%.EuE1uu11}t#).).EU).).`%.d%.EU11ҹuuRPQw%VEĉU);E}EE}]u)։]u}tt).E).19}9}tH>tC9Eċ]|N1ӋF19Eċ]}|]9؉ӋM}EUG롾%.19}tHt?19Eċ]ȃ|19MċE}]9؉ӋM}EUGu EċUȉEUEU+EUȉEUE Eu hzY" E Et}u9}E}}u@%.D%.1RPuu,u 9tۃ}u E9uuujjR#EUEPuhY"hY"h -jdh ).ju hR"jgh ).][vEHƀ ).t'). t9EEHPh ).hY"? uh ).EP uċ}ȋEEă}t6juuWVUċE0%.uD<= %.1EjuuWVUċEu=0%.tKt$|=0%.us= %.t PhUW$j[P]juuWVUċEt)/juuWVUċEu}t }tPhUW$jff}uf} E U u }EfukE } 1E}t Dm:}ta}tE @%.1 ).).9u19tuugZY ).UӁþ]EU]̊EĈC})}̉Guw OWPE̍HPD3}̍_S^_E}tgfǀuEPkE }P %. =(%.u= %.<t ).(hY"Ytfu'uEPkE }PS =(%.9= %.t hZ"Zu(%.}ft= %.hY"[E̊@EċE̊XEčE@‰X%.p1WVjjjKZ"E1ɡT%.p1WVjjj^Z"Ã(Uă?1ɋ5P%.1WVjjjmZ"^}̊MO_U? ˆWGEĊ_EčG‰X%.p1WVjjj~Z"E(1ɡT%.p1WVjjjZ"ËUă?1ɋ5P%.1WVjjjZ"}̊MO_U? ˆW(} ).uKye[^_]UVSá$%.u hZ"dX1ۃ=$%.u Sh"EY^jjڸ%.CXZu҃=$%.u=).thZ"X1L=).thZ"u ShZ"Y^g ).RP1҉8XZ=$%.tC$%.9).A=(%.~hZ"5).j5).5).RP 믅<f=<'.th:["K^h["3['.t=h@#'.Y=uh[""k Ph%["XZ hZm"XhH%X=$%.nPhO["Y[=$%.8'.PPhk[" j= %.t>u Sh["|XZ9).} h["pX; ).RP1҉u Sh[">Y^jjڸ%.XZe[^]UWVS ˋDžF" t DžT" @uh["JfZYߍ1jh["S~ t 1/9Cu苅9Cus Pj# ;Cuă=(%.t.{ t(s$s sh["e[^_]UVSPE!-;!-u*=$.u!URhmdP y h#ZeX%.11@uh\"B=(.u111H,.~ ف@.@uh>\"d^E).01C;).}. ).).).@@uShS\"dY[1҉U!-;!-u*=$.u!URhmdP y h#wdXe[^]ËU;Php"h-Sj?UWVS|E|x).wSh$q"h-jSQEEZuhS6EXZEE FEe[^_]UVSSPPVu ujVShM%e,@uLetv"t"O0KZv"tv"PShw"jSjUVS]u VS贩YZu Sh`w"jS;/t"Shuw"TXZu Ew"e[^]=e[^]UVPhw"h-njZUVSPh*"P[^t,PjPuVVt jPhZYSXe[^]UWVS EEu EE}]EEE1҉T+.$%1ɉ X+.`+.hw"Vu= NtJb$@%1=`+.`+.d+.\+.X+.뗡Lp7T+.jWh%5Lp7 u hv"jRPJ YYh+.JP-4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjP-0XZt1h$9}PZY uċ2jWSh%b@uL<tv"t"&0`H^v"tv"PShw"j\Pt%@u=X+.p&X+._X+.MDžw"=`+.tDžw"T+.t #P=h+.t ~%=d+.t w"=\+.t Q6$1ۉXPMhw"h%jOShx"h x"Vu h 5"jrOj/G PNZYt|E?Shx"h#x"Vtj/C PZYt|>XjUVS]u VSYZu Sh`w"jN;/t"Shuw"XZu Ew"e[^]e[^]UPh;x"h-j@UWVS]u1 11҉t11ɉphxx"u uf9 athg$%5Lp7`CpX5Lp7!CtXDžp5Lp7XCxXDžt뀃K|wK|njVh@%5Lp7+u hv"jMPX}tWWV~Y^Ɖuu~YYEU0`}tΉȋUʿBUƉ4s {$s({,s0{41{D{@{HUM䉓CPsKC 1sss$S{l} E 5+.=+.}t M U JpD1HӉ5+.=+.}tCS}t#RP}YYCh}t1ҋM M  t1WVڋE BY^1U ~ 9~}t 1҉TpTt1|(@ԃ} }t1E 1ɉKXE HpED1Hy~Fuh2C"h%h"hCC"j}t1҉1҉TX1HF붍e[^_]ÍL$qUWVSQXAAA TAAAAA A$A(Q,A0A4PA8xA<@t1É1ɉWV1҃t0119s#hx"3+ZRPZPH0jjjjXSËP%F߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY PCh%VZYth%Vhx"( u&;s5;slDž:DžDž u;tU('DžuLDž Dž;DžsDž ~|t~(uydh"y"'^_PDžDžt9t h@y"&Y9~Wthsy"&XZ.DžDž9|ċ9|<t hy"(&Xh5+.hy"zDžy(hy"%^_uqhz"?YI;rhy"%XZu) u 111(4<81L\0,$H1dH@D uj$_t⋅9t PhPz"G$Y^Ht2{{ @D0{{@D#Zt⋅9t Phpz"#_XG1t{${Q!#^t <8(Ch4CpHt ǃ ǃL@tA"ƸY9t Whz""XZHd 1t1\{ChX\Clg{ OtIhz"h-D8ljPhz"h-wt@t)1L@t31#LC LClC XkT,Pxu(xtJxHXCdTCT~*0CPPlxtxp1PF ^t1P YttuxPZt*1 t1s{ %1t t1s)Й t1҉p11Ҋp t1Ҋc t1hl t19s hl)ωptct hlCS s{C`hCpC1ɉt‰ Ju s1 t1WVtp@ct9Ǎ@4pp4CtǍ@pp11҃ʃʃ p t1ct"uM 1FCXS\u 1Huw?ǃH3Qw ǃt)t%@ @ v#vxǃ ǃxd‰9rw~uZ9$}Ldu2Whz"h- 9Huh-h&{"w*XZdѽPho{" dt$h{"h-COPh|"7 v$tpPh.|"h^_j 耿Y@uhL|"Sh||"IXZ+1߭ڍP %WW$h|"HuƉƉ1 t1 ‹)ЉʋCtSC8S< C$1 t1OD1t 0 ‰D2耽tC|P9YBu@u0*Phg~% tu `duCPODž1v 1񉅰 t1 t19u9t h|"_ tG ?9|$ tj jh}"q$t*uQ1҉Ɖbu 1҉h t1C` t1)CS\)CDž+x|ƒu Q]1 t1҉Ѝ Ɖ1҉"vJt\9Ћ}x|) t19r$mh}"^t+)CS)C +V ‰Ju 1 t15Q‰扅Q‰扅扅tV׉sX{\׉sh{l׉sp{tC`Sd*\ȋΉs<ΉsDCHK@h Yu jj}-@1󫋃@t<<f<%fGXD@<f<%fGdDSP1R_ZtT81RP}XZ1ɉtpxpx t WVb^_Ɖ׉ t19s=Pd/D ]jƉX PYPFZ@HRjPjjt PhF"N>^_@ Gt3~S@1҉P-HG 1ɉO$)~\@HG~F F <@4PXjjXjjS'ptK KS1P1ZY$~dt.<f%Tf-f1GfFjs ,<f%Tf-f1ɉOfFjs1)щ1 t1҉GW jhZY<f%ffAXZ1ɉ19sDA u҉=v D PjVjj{@ Dž%Dž1pn_<҃D 9sh~"5+.ho" Ft Pt#u?RP[Y^f*uGɉf1VfN@ tBh1~"hp%hqfFu=@ A)G G p 6p<uGG9rhK~"h`%hhCC"W)9rhj~"h`%hՉϋ)1󪊓t@@tf)th|~"h%hh~"LP4PRAH‰ljX1OtVjR1RPQytPjhF"66 H TƸ1tvkk ʃ@u51rrrrB 1z0z4z8z<@1OBB~B1ɉJJ(MB 1BBZN9s1BBrz 1BE]9s1BAJ1B$79s1zAJ 1r@4PY=/.u jSqqXZt 1{@{D1s,1ɉ9\FH|‰1RjQ1RQVAtPh}"3‹p JuI!F u1kF FtL<1 t1F tX1 t1 ‰ ‰1 t1ҋtC@SDC,F t 1 t1҉щ‰8ubvVt \Ɖ 1 t19Ɖs)щ‰jVXZ$t,CpSt'CH\+ƃu 1 t1WV@Ή+tC@SDC,)ȉʉщ‰_1v- 1Ҋ t19sƋ1𙉵st'{++C8S<++C$BHQjPjjR t PhF"/^_A |tVC@SDs8{8tGpBuE0.!-Xe[^_]ÍL$qUQ 0. 0.50.5!-%EM MuQQ$RPhA"4MɍaUS]CtS P S tSPSCr s NZSG 0.X]USEPsH) 0.0. /.Hu00.Z[9u 40.u' 40.uh%B"jP4BPQ X4CXZ@]UWVSu EEE#!-0.0. 0.M11ɅtJA9~ʳ9M}#t0.h9B"h%hhHB"o}9x4u }9x(u9p$t버t0.e[^_]UWVS]uuu SO trNj@thjB"h%h1GGWX9w(~6GthB"h%hhHB"вwVw G [^WY/.!-;0.X=,0.u =$0.uBGWu00.GWtP(0.WGtG4WPZWX0.j@jVjG _4E UG$W(G,W0wE #!-G80.tz8GC GtWP { _ Ge[^_]USEM PuhB"h%h4hHB"蕱P ʉPHPPP s E]XPs2H 0.0./.1ɉH 0.H 0..1ۉXt 00.H00. (0.H(0.P4JH80.9t!tXYX tAP]UWVSUu }uWVRcËECUt0.R 0.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=!-Y,A0Éa,ڋyY I4 s RPWSQ0% RPWSQ4%e[^_]US]C%CSjS]1]UE UMQ1]Uj2UU PL0.PYtHJ L0.@ L0.UWVS] H0.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd C ${s ]e[^_] UWVSuE EEEE%`0.1҅9su}K}9y,u^}9y(uVK0ts4q4s4 `0.K0ts0q4`0.`0.C4D0.=H0.~ttpRZg{$u{uCuڋ[0n=H0.~ tRkX@0.L0.t$;3uEE EEuCe[^_][؉؍e[^_]UW1H0.`@.`0.11҉L0._]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE!-K,ϋS0c,ʋ{s K4 es RPWVQ0%9Cu CC17RPWVQ4%uh>" YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RP)?Y_}UVSӋEU tt RP>Y^CSt RP>Y^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈSZ19tPQhB"J Ћ]Uuu kj訉USt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRP=Y[L(ștșe[_]UWSvh2C"hL%h hCC"SÉЊӃttRP<Y[LXștșe[_]UWVSvh2C"h%h"hCC"ƉӉȊʃt$uҁTXe[^_]UWVS vhhC"h %hhCC"nƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRP6YYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8jËEEC1CCCC '1C C$hjwEhjhM쉁j`jVMAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmE Epd u S EE싀}@u jR^_}E UG(W,}x0xdEtFVtRP5YY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM uH0.EE %`0.S0tK0J4`0.`0.C4`@.C(tS(P,`@.C,`@.މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hyC"h0%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhyC"h0%hhC"y@]9~ ]B뫋EEPE̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuhC"}t/EEtP1uuRPhC"{]9]tSuuuhC"\uu] SY[9t$PRuuh-D"0u8 1҉U u& XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPʝMeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPZYU9닋E芀{at WVhyD"wtC M苉9t.CM苉p9t$1SQ1RPWVhD"]C(S,C S$]9UrSPWVhD"/WVhD" ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/E"{}hFE"h@%hhC"萖EzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRPJEuuWV79EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWV9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhME"DEuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^E"}hx-kY^tCpStCHuRPuuEU}t hE">ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhE"d@.6EtM}`d)RPhE" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j3E1҉PEMA2AA 1ۉY Y$XZ}t.hjËE쉃P^_ u =!-ƉE} t hF"蔝[1ɉM!-EPjh WVu*hjmËEp }쉻PP P jPXZtS Su!-}URjh  t1RPuhjճEEp }}M쉏PP P jPW^_utCHSLC419|} tMh7F"^Y@Et} t#hlF"?Zu uuS9u uv X Sm X]=t SX XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjƉ_tCtP۱^tCtP赱FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h;SXZ؍e[^_]UE Puj!- UWVS]FHljL1RPuu 5EUt1EUEU싃C|1EUEU싃URjW1EURPVtPu hF"@ u~ 1RPuu 胑tDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuɑ€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhF" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhF"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt PhF"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhF"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhF"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuuGƉ׀}Mt1׋C|1׋URju1RPQtPuhF"d Ep 1RPuu规t֋F Ft:_vkk փ~t*uuhF" tFVC(S,FC vkBHMQjPjjRt PhF"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhF"ZYEP tu}rz}zP4PR:X17d@.t C0S4C(jjP0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP諅 e[^]UWtBRBR t RPPY_}ÊtBRtUWRP%Y_}ËBht1UWVSӋEU ΃tt RPY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]Uh"hl%hhCC"|UVSuE H$X(1y9)tNp1SQRPH e[^]UVSuE H$X(1y9)tNp1SQRP e[^]UWVSEEEH@}W4}t D) D)ƅ  Ex 19}5uVSh":e E|BD1H)CNjEahE@ EDžp!-pp@tUkl1ɍ9~ډM}}x1:xURjV1RPQdtPERPh}"E‹Mq EJu KE! E1k֋^ jQ XZE4fHEu_ƋEJƋE1 t1E虋uƋEEڋ}tG`Wd}G@e[^_]UWVSEt1Pl@hEUE1EU}+GpWtEUG$:EPDUME@`1҉Ɖ׋E@H+EU)׉u}E@1ɋ}9ȋ}7UMEFuE^$EEtphxlppxt@DƉMAHE)׋EEIu E3E>1 t1҉MRPWVo‰C0E}Mtp`1 t1s(EAHEpNjEƉ1ƋEURjW1WVQ賹tPC01RPh}"kE‹EEp {0E,Ju I! 1kF t2EC 1 t1Ek( ju!EZYv{0t EEBƉ׋EE 1ҊM t19Ɖs)щ‹E[M t1 ))s(댋Eu})׋EEIu E>EI1 t1҉MRPWVmC0EUM t1C(1E܋Etppxtpxx|E@HƉMALE1CCC$C@CECE‹ER t1RPEPEE}8W S E1CCC E}EEDu1 t1ES Et=p`xdrz1BBaB8C1B8BPC41BHC(})8OE@@B 1zBaE>BvB0C1҉PS41p C(})҃0C(E)ЉC,E@rEx<u/.@0.0.E@@]CjSJE܍e[^_]UWVS,}E @u +FEHPE؋AHƋE X01ÉURjV1RPQʵtPE @01RPh}"‹EEp E @0E܉F uMMЉF <u v0E@4uPu:E܋E PEHEXYu܃}tC1ɋ9H~@ Ɖ߉UPSUȋ AAMX뷉Oơh@.l@.Nu"h"h|%hXhCC"bct5C0S4C(S,C 3C(S,PTPTC S$pCE @0膮E @BBEPuϦ CPCP赦^Zu{ ‰E1 t1҉É։1 t1Yt)G8W<)G$}u h"jE Xu9utpE MAP9q4ux@.|@. y(x@.@. @.@.A%AQE@@.@.EY눋Ep@.W~Z} 1e[^_]UWVS<] E@(E؃} G,u1uȃ{1ɉMȃ{E9C(rC,}t-wSu"XZEtEPt@pEЉUvӋE@HEEԋEYE؋E u1 t1EE}P{}̍OKu؋uЋ}ԉ t1WVR8}̉CPP}M؃1ҀMt)}}9s6H 1B׋}d}9sH 1qBC EsE̋E#u1 t1EE)C(C,}K S$u,C,E Ɖ1u)EЉD1E,C,EƉ1u)EЋUԉD1T11Eh@.l@.EUE@(E؃} G,u_vjVh"ƅM oPB YuS'Z ?E ot ⋅4)ȉ1Ɂ11ƃtjhhއ"*S&GGG GGPh#S< Hu GGS&)XE ;ot$PWh"[) ve[^_]UWVS ] 1h*"u3ZYuuhZ" )_X$-"^t uht""WVPh0%P@t%WVh0%P%t h"C1Ƅa2=uc,)%Yueao1ɋ0u<1ҍjhȑ#P< tj2WV2 9u+]hh7"P药ƃaȖ"+tWuh<"\' 1ɋu׍PPh~"VuP:Z;v.Phh"&aPWh͉"&@Aƃaa9tRPPhى"&ƃa*."7^u 1ɉ]uh"VhV\ uVh")& S"j2P2 9~#1ɋ!thE"):"mZt1sZ9{~c1ɋt Wh؊"6VhP[ uVWh"O% j2P9G2 T)r"Yt uhc"1ɋ.th"s]PPPPh"Vo\\\\\]th"n$`!XZ4]`%t 8t0Rh"9$+! G(p SP xG؍e[^_]UWVS]CjP膊 _Z1uh@%h/"[^F9~?{jWN ZYu Vh@%hL":19~DBh*"u .Y_uu h@%hl"腤 z"‰UWW6Zt uƄsh"hPM(shŌ"hP4( RJ6$RWz7 DžuƋSS9VhQ" u RWh"CPPPPh0%QGtRWh0"! ; ȋC AEV_4V^19s~4辌 FY诌 Z1e[^_]USRÍEPjhjjj jSTrU tShO"Rj]USYCPh_"h-o+Sh"h-_+Shڎ"h-O+$Sh"h-<+Sh"h-,+Sh5"h-+$ShX"h- +Shy"h-*Sh"h-*$Sh"h-*Shҏ"h-*Sh"h-*$Sh"h-*Sh="h-*ShT"h-*$Shk"h-p*Sh"h-`*Sh"h-P*$ShĐ"h-=*Shې"h--*Sh"h-*$Sh"h- *Sh-"h-)jUSRhPV u ShUW$jr]Uuu u4& @uuhD"jrUWVS(`؟ԟhV"Rh*rPEܟП119П~7̟hW؟3 ̟u ԟ0F`ܟv1ܟȉܟ9}J̟hW؟A3 ̟u ПԟEܟF`벅u؟hi"j+e[^_]UWVSlj։1EEjh<$%Q蠨 t(jh"S茨 tjh!#Sx u Ejh"S[ uEjh3#S@ t}~Eh"EPhrWh"EPhrW =@.t="}t"PVhˑ"# }uE4%Vh"# e[^_]UWVSÉ`hPdzlb1󫋅dhx|h"VhrS`h"@#|xh/"#0tplhf"""u"RPh""h""D1҉¸1 RPh""0Ph"s"XZ"4t"Ph("S"84%h;"9"Wh"h-C &؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃShF#%hVV ^NjP ѡ`P.a5`P.kƃt(@hH%PZYu)5`P.CYu*LSh"h-H 7Sh"h-3 Fh"PYZu5`P.Z1Sh"h- `P.Ƅ=FVvhPSh1"h-:hPSs1RPSVH `P.;5`P.Bơ`P.Xae[^_]UWVSuS_X؉8/u@1Ҿ1hC%PkXZۋtm;thlu1WP ѡ`P.S^5`P.Yt@9uVSBP) uȋ2lЍe[^_]UVSu@Y1ۉ tÅtƋS ؍e[^]US]3X]]S UWVST=@.thx-hN"X[^@. nVUX=@.E}tPuPuS uSEZY~/9jPuSjSh"h"h-EPSlEPSb=@.tuuuuh%SC uSRY[fft uP Z5dP.^Xe[^_]UWVS}E U#ÅuWuu h"=hhWaƃ y@Wh "h-Kh-z0W PhǸ"h-% 1S ѡ`P.`P.0Nj[Yځ~RQW @u55pE.5,E.5(E.h"h-0W Ph "J=@.uURQV @uG5pE.5,E.5(E.h"h-P0V Ph6"h-4$j%WVXZe[^_]UEU ]U= "-#tjjh "-jh "- 8= &-#tjjh &-Fh &-7UWVSƉ׉ˉ t;5@.@.rWVh"; $f.RPWV(f.s{ S$=@.t [$t9{ u9suh0"S<XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh?"Pb<XZUWVu} 1 tC;5@.@.s.$f.RPWV (f.t;x u;pt@$e^_]UWVu} t;5@.@.rWVh`": $f.RPWV(f.t H$9x u9pu 1pp P$WVh}"i: e^_]UWVSujj[_ÅtJNJ/t tF@PW3ZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P _Zu1,VeY/txtEVh"9XZEe^_]UVSud.F `.9s%)P6S詨jj*9tC/vKSh"Q9XZ؍e[^]UWVS}u hū"09[uYƉ< d.uE5@.B Zu hϫ"8X)@. d.9r  d. d. d.uS*؍e[^_]UWVSu= f.uF5@.nB Xu h"8X@.Lء f.19r C$؃(t f. f.C$ f. 1ECCDžuPE  EujjY_t Vh "8XZVV_C[ٸ1Xj/V^Z@PPC{G C_ Y^Et5uu XZYƅu h%"7_E UCS FC^1E E t)uu ZYt h@"N7XًE U<؍e[^_]US]SZ d. d.]UWVS]f{t hQ"S8Y^{u&{t hd"S7XZ{ t h"S7^_s{ t]WVqZYuh"S7Y^49uWVKXZt-~"ЅtP9uSP h"S{7ZY3 f.C$ f.Xe[^_]UWVS]E ?ƅu h"S27_X9stsF C^ j/u &ZYx3WƉWC$8VPfCu fCe[^_]UWVSd=@.thx-hά"LXZ@.E0hr"ue_Xu,-0gO Ph"h-uh"55fc E1uE9@.@.ErFuuZYƅt)GE~SFPj6v}ӃEU1E1}E9@.@.EuuPZYDžttj$GPEP诣uGƋG@EG t@EGt@EG t@EċG$t@ESjj(EPZ눃EUU(f.Mt@ESjjEP"E $f.E9ʋE E̡@.@.EUMԉuС@.@.E؉Uܡ@.@.EU@.ESjj(EPC @t,E0M Ph"h-uh""M3SXe[^_]UWVS=@.thx-hP"JY[}uXjj5@.5@.$f.jP@ (f._Zu hj"2^jjjhH%fHwjju>ƃ y,q0L Ph"h-uh"y2xPV Y[y,20lL Ph"h-uh":2EЍXjS.@ XZu hӭ"2YSWVa y.0L Ph "h-uh"1j(PPV xV0@.Z Y P5 @o.Zuh-hA" Cj0(*-]UVS]@.PHo.=@.tPj |^@. -j:S賾ZYt"j.pS3[jh#S ZYh*"hh"@.Y^ud0E Phh"hq"h-~h*"h%@.u(0D Ph%hq"h-Bj.`s.Vh`o.XZe[^]USD.D.EU]S?zPh"hx- D.D.MU ʸ"tS zZPh"hx- "=XD.tXD.hD.PhC.5C.h"h-hC.h#h-o$=@.D.D.EUSyPh"5@.7 D.D.MU" tSTyYPh"5@. "=XD.tXD.hD.PhC.5C.h"5@.hC.h۰"5@.$5@.h"~@XZ@.@ @t h"jYK]UWVS} u=@.tWh"hx-Y EE]99ru4=@. ";]u5!#Ph"hx- {CPCPhȉ"hR=@.t R3C4,*-h"hx-t}t?SHK))PDPPCPW\K"uSHK))PDPPCPu\+"<SHK))PDPPCPWW\:"@:{Nhα"PZYt h"PZYtJt%uCDPjW˖ w"?CDPuUZY\"CDPjW g"@{atNt)CDPjWC w"?CDPu͗ZY\"CDPjW蔖 g"@t=@.t/Rh"hx- =@.thx-h"@=YX=@.thx-j XZe[^_]á8*-x=j.ti0UPXUWVS `s.}tt=h"]%[154k.5j.t=@. 11ɉ1Z{._Zuha5"(PD {.^u hξ"j {.0&K[t{.j@SZYtR 0-]}t5xDyu$_E-„UtSh۾"賝jE@{.jh"SV{.@Ph{.Hã{.V @. =~E{.=]UjShh5{.YEj]Sjj5{.YE(jSjj5{.Y'jShhRYyE-q{.e[^_]USu uh"hS{.MڋE]Ã={.u U"#e1{.]UVS u h"j]S蚡ڸ/#/Ã1x19}-)PEP5{.  h4"jω؍e[^]UVS u Vh "j]S(S\$S5{.mVu5{.^(&:%e[^]USPu uh"jP]SΠڸDn#c]USU x.Ruh"hS芠ڸ"]ËUEPh%"褡XZffUSPh+"h-h-hQ" *- CtsPh"h-ڤh-hz" @*-XZ CtsPh"h-袤h-h"j jzUWVS]} t~C7h"V躯YZt:h*"V詯YZt-hr"V蘯YZt#hyG"V臯^Zt1 @uh$wXZYt|1j}Wjj5.^e?E? EEEPWS5.$e[^_]US}thjEPjj5.]?w5{.hӿ"ПXZE5!#@uG"P5{.h"謟 G"y5!#P5{.h%"芟 G"}y5!#P5{.hQ"f ]UWVS(}tE 01iб]ع1XuEEʉUUfEfEu͍Uι 1EͶEjh'jSj V5.e[^_]UWS}t!]U1E5jh'jjjS5.e[_]UWVS ]} t~7h"VCYZt:h*"V2YZt0hr"V!YZt#hyG"V^Zt뮾 1uh$wZYt|1j}Wjj5.e?E EfEEEPWS5.$e[^_]U }tjEPjj5.UЃu5{.h~"PXZG5!#tG"P5{.h", G"Et5!#P5{.h" G"}y5!#P5{.h" UW}t5U1jh'jjjR5.}UWS}t]U1Ejh0ujjjS5.e[_]UWS}t]U1EEjh0ujjjS5.Se[_]UWS}tY]U1Ejh'jjjS5.e[_]UWS}t]U1EEjh'jjjS5.e[_]UWS}t]U1Ejh'jjjS5.ne[_]UWS}tt]U1Ejh'jjjS5.#e[_]UWVS] }~j PW5.K Rt$Nuj@EPjW0Ph"jj$pPjj5.rEЃf=t Rh"=XZ91׹󪉍,ƅ8fEf;} 14zj 0P3跍ƒ 08t3h6"jD,ƅGʉLj Vj5.ƅ914}t1"jhM"s衧 uƅ5jhtj4Pj8P5.<hQ")hx-茇[^1ۍ>1ʍu1ɉMfEEE'E0VhQ`5.٘ @u h]"j E<u 5{.hj"<u5{.h"h- ~<tP5{.h"h-_Pu󥀽_y-`9%CSh"(hx-苆 j RZ<h"Xe[^_]UWVSE] h Zu h"j 1󪍕 19}J jQhF"蜥 ujQh"} u#Fuobu 4jVhK%0 ÅtIjVh" u'jVh" uƅ7fDžjh0uhj P5.ƅp9؍t h"S诏Y_uu"-hF"SXZthC"SY_h"SXZhI"SY_u hR"S~XZS5{.5{.5{.5{.hc"轕@tAtif@ffh"SՎY_`f@ffh"S褎XZ(/f@ffh"SsY_!u h"ZEVhܒ"ShUW$ٔX4S׃X9uEe[^_] e[^_]UVS ] }t3h#VkZYthk%VZZYu E'j EPV[E U:uy 3h#"Tsh#VZYthk%VZYu E-j EPVE U:uysh6"jEPhU5.Փ t hF"je[^]UVS ] }t3h#VxZYthk%VgZYu E'j EPVhE U:uy 3h#"Tsh#V#ZYthk%VZYu E-j EPVE U:uysh6"jEPhU5. t hT"j"e[^]USUBBPJ R Ph`"膒 uEi"]vSh"cXZ]UP}E 04EEPhQ5.8t h"jxU}tqjhQ 5. t h"jCU}t"t"PQh"VSf@Ph"VS1ۉ؍e[^_]UWVS]}hpVjSzPh "{vTh"Y {yj h,"ۈXZ,C@tPhA"ÈYX,C t PhQ"諈XZCȅt Phs"蕈YX{w j 觇_CȅtPPh"l S C h:Vh"JC t Ph"4XZhpPjSuj 1Xu'tPh"j  W;} } <;u GVh"辇YXujh "談XZjh "薇^X>9tR;U }MuRlh "cZY1ɋlhlPh<$>hAlBXXh"*Xe[^_]UWVS] }uh"^X1C9~D3Ph0"FZYj X}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`uj @u h]"jEtU{.<uRh" <uRh "h-證 #<u jSRPRh "h-舉jq|e[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt2uBItu< }[yt ut܊ y_vCm t4\ 0H2N0H2N0HB]9uX[^_]À\um tf\\M t݈@U誟PhB"h-‡jzUh"^}UWVSÉ֡D.PD.uhh@.+Y_@.h"h"hWwhr"Wx_Zu h"Ph"jH J. u.h@.Ph"h"h["h@.Ph5!#h"dž1X9ډ}Dh؅.$ $h"蕆 .tWPjh.i?;9}~ڃ<# u5!#P<ؙPh"7h`.蕃YuRh 2j荜Y[j^Р1<$1$jbXZh9"XZ?e[^_]Ujh`.gU=ą.u h{"XjxUSh{"h2jh2jh2jh2jԛ$hhh{"D xVj"h"P讦h؅.h#j PS蘦jh$S苦(h.^$h.SpSʨ]U赜Ph"h-̈́jwUWVSы0-:֍RD{@u1ҊBuT8t9s 0-DY@tJB[^_]UVSËHuPs8tIS8kC4`9s `R 1s0s4s8X{Xu1ɉKXCXtP Z1CXe[^]UVSu] EPu36~x9s)e[^]UWVS`ƉUUP 1ۋE9߃u*E|fE|Sh"j EP~EEEEPh1"j EP~UfT ȃ0-DJu.D=uUR諡P U_Ce} t EP臡Yuh "qXZe[^_]UWVSS1}11#tAEtSWh"PShG#P @u h&h!"5We }YCu}u#h5!#A%EZuh&h&"j.Ee[^_]U#h+"Ph?"PhH"PhR"Ph\"Ph}"Ph"h-8juUޙPh "5+-. t5.Ph"5+-ҁE Pu5+-o. USÅtN .twRtF .ti贚0 Ph`.h"QH . .u=.u2j0t .t#n0 Ph`.h% tŋ]UWVSEEEEujj}WjVPX @u"e[^_]ËEƒUt Ph"jP ZtjjWPVu @u ]=.u5+-uhW %| ms5!#M;Ms"VvvPh"|E f3#j {X]e[^_] UWVSEE]EEjj}WjPSc @u-u YtjjWPuS0 @t̓=.uuh "|XZv<9t's sss sssh'"{ ՋE荞 kT؋U9u FE1}h`.h="ZYdTEM9Mt?Sjhlj"x{ :1;{s֋TM4PhP"Q{G ,j `zXue[^_] e[^_]UWVS}}} }܃= .É΃=.tO=.u:=.t }u&}u35+-RhW %z. 0hx-juV`N}u!Rh "z.Y_~7j yX.~#.~}uڋUe[^_]уtut3]ߋMtu*E r4s6Ph)%4]ߋMEtPEPhU"b sPh#Ph#yXZM]ߋMtuuEPh\"y$M] s SQh@$SQh#wy }uEe"e[^_][yE e[^_]ixe[^_]Ã= .t.URh`.4+-hj"UWVS=.uh"sjmoj=P-^Y^Xd 1Dž\ Dž`hj`Ph`.\PVSJ@u!ڋ\==.jnDž`1Dž\YdX@DŽdj`R`PPQV @u!躔0 Ph`.h"WBuh`.h":XZ& . .uPh`.h%w e[^_]UWVSWE}u = .R˃=.t>=.u3{=.tNu%"u25+-RhW %%w. .hx-jWS@]u"Rh "v.XY~7j v^.~".~uى؍e[^_]it1RE rGK=.tUPh1"vYXUt2=.uUPh"\vXZUB9|SWhȉ"Dv NuEe"e[^_]+vE e[^_]9ue[^_]UVS]=.t Eh"S„Y^uEEY舒1҉jEPS腸EUE 9u%Suh" =.jk8u98u̸]1PSEPuVuuI @u1t = .1. .u}u}tPjUEPj "UENY^tF. .u}u}tjjMUEzjj "UEXZe[^]UWVS]=.t 'EE18jjEPEPuu+ @uuh"kjSWu u%Suh/"e =.xjOjjBuVk|W+w8u|1PSEPxPuu~ @u1Ft = .x|t1p. .tpjxUEY^?URV胩EPVhL"jduVqpPUEG$tk. .tjj|UE~XZEURtEPthL"jd]S!qjPًUE$e[^_]UWVS(+-8`.t f./.`.SViWZYuVh.訧e[^_]É)@E̍EӉljDPh.hC%h.puUWVS`Eh.~ZE&1]M;>r2jPRU= Utj@uVRPxV3hV"WGjEPjh.RU4 UuE Eu1}u+E9Eu#/tj@uVRPV3hf"j7GQ1EEe[^_]UWVSEUE5 .$ˋ .. u' . .h`.hv"[^=.tu*jtHu!u05+-uhW %Tp *hx-jSusVHu"uh "'pXZ=.~(j 6oY I~I~uڋEe[^_]1v{9}E0Ph1"oFYXt Wh"oXZE e[^_]ne[^_]UVS]EjjEPuVuux @u Be}t Sh"j. .tjIY2=.u Sh "oXZuuuuuh"oe[^]UWVS]uEEU E$E . .=.J. .t}jjEPjuV @tdMt]QMU XtMMMjjEPWuVb @tM;Mt W _j`.PY}e[^_] }tuh`.h " = t)tu*Sh]" uSh"Sh1"Sh"SXZe[^_]UVS]E jjEPuVuu @ul} t Sh"jEUEU . .tj cXP .u EPP5+-Shǧ%%m&IuRPhLW$m uRPh"le[^]UVS ]EjjEPuVuu @u}t Sh"j. .tjE=.u5+-ShW %il EU=.h RP` t PFXuuh"+l e[^]UWVS,EE̋}uu<= .t3EjjEPEPh""E܍Pk((U܉UȉMQM XۋMЋUuwuM1BH(jjURPVWy @uCEԋU܋M؃t (9t$9uދẺE1uh"j\ 1C(9~ˋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPh+-uh"jURciUUС. .t7j(EY(}t GE܃t9]e[^_] =.uuh "NjXZv$v vvvvv vv6h"%j,뗍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph"|<Dž|tWU XuJHxjjxPVphH @ut9xt Sh"jIl%EpujjڍE_X= .t=19|Wh+-Sh"jURfg jjUE{G ŋ=. =.t jQ=.u Sh "mhY[|~+t4Wh7"PhG9|~ hf3#:hZj QgXue[^_] e[^_]ÍL$qUVSQ$A QEjjMQuVRP @u}t Sh"j. .tjYd=.u Sh "gXZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$hA":geY[^]aUWVS@]=.t Dž SI Xuh&hUW$j71h·%RY^x18jPS]Z u.V8"uShQ"9t8uShb"j9tҀ8úw܉ h·%ji 1PSPVuu @u1t = .1ǡ. .tW EZ)APr<$PUEV tV. .tj EvX1P6r$PًUES e[^_]UWVStx|h`.ql`.$ .qYh .h)ȉl)ȉ .u`.u|uH1ۋx9t担tH%u5!#RPhAV%PPC뿃} t~|P+-xw5!#RPhW %PP|PH%xw5!#RPhAV%PPU Dž|+-|+-Ã=.( =.th .h "cXZh .h`.hx"nc EHv ht $h"<4&h"Ec_X}uC|@0|psPh"cY^P|p4h"b |p@h"b|0@.XZpt 5!#6hh5!#h@.hh"h@.·%ppu/hWh@.}hh"h@.i揃·%ƀt2hWh@.Fhh"h@.2·%s2hWh@.hh"h@.·% s2hWh@.hh"h@.·% s2hWh@.hh"h@.·% s2hWh@.fhh"h@.R·% s2hWh@..hh"h@.·% s2hWh@.hhɬ"h@.·%s2hWh@.hh"h@.·%s2hWh@.hh"h@.r·%s2hWh@.NhhNW%h@.:·%t7Vh26#j V^hWh@.hVh@.(h@.|p%Ph "_|@H t Ph"__X|p(h$"_j ^ }r=.= .u }|xXDž1DžtxTpj`SPPWt @pu\t|@9uߋ|@(9uΉdQpa ^dtNjp󤋅|@XPwP Y|XX= .uTE tN|@XpHv9} |pUE"<=.uh`.h "]XZ|@XPvh-"PX}|ps E z-UEÃ}tP@uj-f Ph`.h>"jSs u|xtjh .h`.|@@uojjPjxt @uD . .=.h`.hU"|@@EH{$&|xt|@8d uq=.:t.s j|xtjh .h`.S  . .=.h`.hp"[tx\=.j|@4p\c _+jjPRpx@Pt_ @pt*|p`t7|@4`&R耿 ^Kw8 nЉX1ɉp`9ptkp`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQTZ ZPtރ NjTCXpsR跾 X1.d1ۋ|;X4,F\s . .t%xQuujPtC`jjPSxt @jjjjPSxt @UjjDžjjVSxtV @uIv8 u3 XjjVSxt @u jٺ`.|c^_9S4 [DžjjPSxt @tgjjٺ`.|^uO Yuh`.h"5+-[ KjjPSxt= @u jڸ`.*Sn XZhƀ .lƀ`.e[^_]UWVSƉLH.j=P =_ZƅTt9sx?u @ƅTGhh#V+Y[.t+-+-8| 8Vs tG=^jh$Swe P` F<=t:+-M  T=.u h"s 41Dž81ɉh 1ۉtpƅY1j,T;_ZƅtF1ۉH1DžL1<1ۅkj=V;[ZÉluh-#V7eZYu09@llh-#VeZYu D1j,SO;ZYDt @Dha%VdZYHt;"Hua%PTh", =.jLTr10jlPS9I"!8up8h%VbZYgp10jlPS?L48l 9uSTh\"8u p8u48,0,90r48he#VaZYuTh" ډlHw^$&PmPaPUPIP=P1P%PTh"1L DžLpB^VTh"u D1މDu DžD<tTh" D$&{n1ɉjlPVSJ<@l 9uSTh"8u4n<@4849Ƹ8r9u-u F0j PV x;3ue[^]UVS@Ë5(.=X,-tjtSvRZYuFl6j j5SHFSO$PFShZ-%P%(.5(.F PhX"j@]SYASfe[^]USQtPs=x.uS0Z]UVSÉu=x.u VS\ZYe[^]UWVS׉΋]Uu E E!UuU[$t5!#[^_]USt<0„!1=x.uS(Z]UWVSLEӋu>hh"V^$ZY)ƒ?EljDUh}bSP&EUDEj URPEU:*u%jjWSRPEP,tEuj>u7& E9h}bSV e[^_]9`,-t3UVSRPjuVV?`,-e[^]#.t úȘ.=.u̘.UWVSƉӊ>uuV.HtB1t.hp5܋.V=t.1҉t.hp5܋.S9=t.~؍e[^_]UWVS,E9p...}]6SPc8Y^y#...=l.u@. l.S5tZ=X=&wAKw2ifF.7[nRfF.7D=,w$==!fF.7=XfF.7=KwJ=w$==` fF.7 =%fF.7 ===fF.7wfF.7lfF.7afF.7VfF.7KfF.7@fF.7 5fF.7 *fF.7 fF.7fF.7 fF.7Eۣ.Eݣ.Eܣ.eẼEfE1E@. 5.KdSj5.]Ep.e[^_]USEPhht@j3= 1ۅu E]u+hp"eaZtPy܋.X/.%T~܋.hk"5aYtPyZy܋.܋.1ɉ \,-=܋. ܋.t.0h{"`ZtPry.[]#~.hv"`YtPByZy..=. .P]UPUE.1J$& (U"U"lyU"U"U"ۍU"эU"ǍU"뽍U"!u,U" u...1UVSPh"_P_ZYX,-hx<%_[u%1ɉ x.Ph.[^Ht x." t x.A".".".Ư%."."|.!"y1ȋ.ċ.ԋ.؋.̋.Ћ...~1҉.E.U%tD.7UJ#u5!#.U#u5!#.U"r.U"`u".U"Eu".=|.t8=T.u/U".U%.=.u1..5!#=.u .5!#UE$̘.t8u.̘.5!#U%Ș.=.tt8u.Ș.5!#Ub#^И.t8u.И.$U"/Ԙ.t 8u Ԙ.5!#1҉.EPh5!#h5!#h.Ę.#$"EP5.5Ę.h..%" EP5.5Ę.h..[$#EP5.5Ę.h..[$Y# U%#Uu5!#.##t .n%Ub$ .tހ8tٍU:#Åu5!#Ԙ.5!#8t&jjPPu0uV#DDE".UN%Åt =\,-u5!#Ԙ.5!#:t+܋.HPjRPu=0uVCDE"Yܘ.U#6u"ؘ.Uq#Åu5!#U4"…u5!#=.u5!#É.;u .e[^]Ë܋..n܋..^=.tg=x.t =@.uMU=.t=4.u܋..=8.u܋..1҉.]1.á.t 1=.ú.܋..ܘ.ؘ.USc=x.t =@.ul=8.u<܋..f.8t.8t=|.u.=4.u܋..!=.t.=.t9܋.~j CX]6]Uuj5Ԙ.D =.u.8t ܋.Ã=.uUjlXË܋.И.q̘.bUWVSu M1+uAM]-}tue[^_]USÅthD$PBZYu "tEPEPS tt<`Ux& "Ux<& "Ux "Ux"]]ÅtVUVSQ覰Xue[^]t<+u;+uC؍e[^]e[^]UD$...|.m1.]UE t <-@t]USuZù¡.ڡ.ڡ.=.ttS蘯2XڡĘ..]US=.t.u ]SJX]US]SZ3.t]]]UuZu Y9Ã=X,-tUh("Xú.UWVSu}]E Et#jYu7u21ۉ] E-"jYut$RPyZYtRPjZYuÉE1ɉM EA" t9Et'hÃu1҉U t EX"Eo"vOԺu Y ̍1EEU҃Ut<9u t0G9Eu߃sڅu}EU e[^_],1E E"e[^_]@.B@@@ 9uUS]t=h,-tjh"XZh,-]Ã=@,-UWVS.@@ˁ1 }1119މM}Z .9t+9xu"9puUpP5@,-S Uхtjh"FXZ뛍e[^_]Ë .…t8=.u/US@t &11Ҁu 0@4@[]UWVS$.$@(@u9t9pu9Hu,@;Ps D15.%uމuv@E9t(}9~u9NuF9,@<vԋ{9t utt=X.t @td,-x; @~QMh j% ZYMu 1X.0 @@@xCSP{x B C{WG B POE܉G1GE@Gw x Ex.$@(@ EUF1҉E܉UEUEUEU9EM|!@uWE9@u E9@t`?@]juu@R,Bu@ujh"[^&.M]艈@@h,-Ft*Th,-=\.1ɉMܻ.@Mt@ &T뾹 )QDP@ià u.u}艰0@4@Et]y*jh"XZ1K@,-yZ=\.u/@,-x&t"SVTRPP 1E 1E .ؙ@@^}t-=.uAEEPhUW$O.ZYEU艁0@4@=.u2j2X=.t!=.u+lt.8=.+.98t<WQ Gz8OW Q JMԍJO]É_ y z,@;F0De[^_]Ë .t&US$@(@ ,@1[]ÃÃ=.tCUu/ .,@w B,@$@(@1]ÃÃ=@,-xzU=.t,5@,-P@,-5L.y 1ɉ L.XZá.4@uƃ0@u.jh"nXZ;@t.tUWVSu} .Uy 9}!@u EU@uG@E䋋@9u9t0E%@؉EPE9t8E;BuE;BtREU$@(@%,@1?E9ƉV.@9@}A@4.t&[^_]UVSjjY[t@.9t2ʋqY9t9rr}ы扰$@(@1҉,@1҉Ѝe[^]US.u1Q@t@h0@4@[ut RPPZYs@t.t]UWVS .t @t e[^_]pE11E9t:EP@ EUE@1EU9Ɖ}Ɖ׋EEWVZYe[^_]Ë.,@t H,@cUVS$@(@9}Q@u#%@Ћp9t.9^u9Ntv퉊$@(@,@[^][^]ÃUUx1ud,-]US.@uǃ0@ǃ4@|9t@@@g0@4@.1ɉ@@$@(@,@jjj@R%Bu@ujh"XZ]Ujjju%%!Ѓ@UVS.0@4@ut@@9} 0@4@[^]UVS]u 5|.q.Yh8@j.@1҉ @@1ɉ@@$@(@,@ǀ@ǀ0@ǀ4@XZtSYu .@5.5|.pXZ.@u@e[^]UVS.@ t4t&9tPQ P X1ɉ @@uB u @JZ.t ǀ@P裇 1.j5|.*p e[^]Ë.1t@UWVSt/Bt/; r"H19|0<9Osr;s B1[^_]UWVSR1ɉM1.G-t.PSo0ZYuFFt! ̅ujh2"*j 1e[^_]1UVS]utO=.tڊt <^w7Bt.}t&<*u{t{tjnCPjnS+ZYuހ>*u:Vt3st!dt1k1uUE 0e[^]UVS h5!#j hl"Dh.o h.e h.[ h.Q .x..|..p..t..h..l..`..d.hG"0D1[<=:tjh{"?j FWZPÃ$P&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=.tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=.u~ 9sSCM9sICKB~PR_<9r)S{Y"9sC%[tS[Z1Me[^_]U`.E1uNh.Ev¸u61-E^u =.t,-ED]U`.E#1uNp.E¸u601-Eu =.u,-E]UE=.tE].]USQ]uh"h . w?SSZt'؃@PCYu@Sh"(S5.SZt. S YtS5.j h ."yE .SEPEXZ .]Ux.E¸uH--E]UU 1}Du% ]UWVSSEIuRfPs#^X[RVZY1uEV Xt SD#Y-h .jEPVPhuV)ZE8} tE 8؍e[^_]UWVSRh"V:h"J:Sh"PQOucjh"V=Oǃ u.h":Sh"POu0Sh"V O Sh"PNEWy Ete[^_]UVSh"9P9ZYu3h#V1$ZY1t=h%V$Y[1t(VsZt ؍e[^]te[^]UWVSlht`ƍxPVY[{%=eh*"VVx GShVD #jh"V|"  1҉p1ShW t t u@h"W"YZh"W"YZh"W"YZt<"u5vptp~HpSPV t!SjEPU)U t1e[^]UEԚ.U К.t@]UWVSSuE 8=.u ^9uO tu QM6ZYMuGCQo Wo _Xu s ZYt,jjEu VC EC3FC^ Fe[^_]UU Et1ɉME U]6t E]鋙]áԚ.t);4?-t!Ujh .PԚ.@ UWVS]=.u3Ț.=.Ԛ.Ě.uP.Ț.ÀuĚ.%=ua%=tSSHĚ.%uF .A.Ț.9~1!PhȚ.ZYu(1Ě.K1=Ě.4LĚ.15Ě.=.t1ۉ.UU1;L?-u PS_/EZYKHA$d&}e,+1.#1=.15..t.8 1ۉ..= .vx u-x .= .w1ɉ . .5.GZq1..8\<1.I1.E1.:41.)91=..= .v6x u0.= .x Z߀x I.= .w15.1ۉ..8 u.8 o.oZ.Y1ɉ .=Ԛ.=h?-y.- .h?-_h?-[} t9s RUVh . Uuω_1.ItVh .. .XZ.8=.t }.tPj 15._.=EP[¡.u=. . .u"z.tމU&U; u C9re?-Ed?-E11ɉM .9t)9s"RUuV Uu ta}t%8EEF9rL< u+9sJu/8ENu9s,Eu뾉9suՉx1F\..tPei Xj.)@P,..)RSP.0e?-8uCSm<XuSA._WA.Wh Y[..t{}t1.Phؚ.o-1ҋE7_Z.E%..9.s.u,15../]1ۉ.Ku5.DY..= .v d?-8Huh"(ZuC%1.vȚ.e[^_],e[^_]UVSQM1uu .EQЀ w[jjjj uuuVtjh"Y[11RjjE0RPuuVuɋE@1҉PU8.uEPjEPc EUeY[^]1Ě.9.| .áԚ.t @@@ Ã=\.uUj11ҸgXUWVS\.t`?- 0?- .1Dž|P)@$jjWPVT:QDQhr"VXZ$fSftxRPxZYx,E%=ufSfthP+YXh"%Zud P>X~P?-1Ƀx tA ?-x t tlph"h#S|1ɉx =\.u:pl)ыt)PxG jjxPh"SSWV)V/e W)e XZe[^_]ú9.t9.t 19.‰USR .t>BE .Rd XE=@u$h.t t7tut g ]UVS=\,-u=x.t =@.ut/l.p.u ujjj5t.RPV p.u)=\,-u^5...1ɉ .-5...1҉.u H5zY6Y5..e[^]U]UWVSt e9ZƉׅu‰ .$..=.u0t;5 .$.}jjjG 1..ld8e[^_]UWVSQE)ơd.ud.d.ǁt#t1 2ux%d.Su5d.ád.ƒd.`. t;x- st jk1j1Ztjh%"蹱ZYtV1VJ)Xe[^_]USVáh.$N   tw #5X.jCP7tW6%I/f5D.S5H.5L.q1L.?E4X.؋]`d.d.PS5<+u C< u.tPa Z;u 1.S.X5X.jPCP=\.SB1X];!tl.tP` XSQ6l.Y=\.uil.uh7"h5!#XZMh7"P=\.ut71ۉD9tt KtXEC<tiи e[^]Ujj#UP1҉ .YYu . ыuUS]t CPX]UPKPEEUWVS<d.܋.@h.e=h.t1h.1X.\.L.=.t=`.tj轳_ .t x@jB8.<.Yu*:t!u5|.YBZujQ_=x.t*:t!vu5|.&BYujZ1x.=.u1.=P.tjh"1P.:͹t hS#Xt?uh9j::_X Ws^Y=.we{Ã=.Zh.$/t.-7iCЃ . jS_ZdtehT.X.\.^=h.t1ɉ h.d=L.uD.u_un@.ƒ@+t2tA!uI1D!-tȡL.=@.uLC1@ ‰D.j@D.]=@.L.  =tSZHOEa<H.1EЍEPEPEP虝L. tDFEĉE=H.u Pw P1_=E@Ƀ}XHNuEЅ:EPh" 15@.HY=L.S贜L.YuSEЍEPh"CH.L.D.Ht!5D.h5!#5H.5L.. RߓZt5L.j1ɸ/eu;&7C!$&*t0@tg!=h.7u-%d.=T.d.=h.7t%d.d.=T.=h.7g=h.7tWjh"j#]Sj^SvRPσH=h.7t(3d.P_d. tA tS u݃=\,-u yhK5h?-jYO =h.t)SZH Fu]EE1҉UURPvƋEY_tPnXi Fc $&j1ɺØ#7 X.19\.}H.1;X.\.|ϏX.\.X=,.t5<.58.G^_jX.19\.}H.1;X.\.|mX.\.j1;X.\.|X.1ɉ \.=,.u+;X.\.}5<.58.YFXZjj5X.1;X.\.|X.1\._jjQjj5.V=jj5.v1;X.\.|X.1\.=,.;X.\.}ze1;X.\.|X.1\.jj5X.1;X.\.|X.\.=,.u5<.58..E_Xjj=,.t5<.58. EY^1I+X.19\.}h.=,.u5<.58.DXZjj5h.K7 X.19\.}h.jj5h.8tFm謹G5D.1;X.\.|X.1\.D.Y5\.5X.F5D.q=\.y1X.\.T.X.\.d9|d u=T.tX.d1\.T.5T.5X.H_XX.\.19|, GX.\.19| G{RPEv=\.y15X.5\.5D.5\.5X.YG\x-1EȍEPhUW$=|.uEtEPZ9%t0.@.,..(..jYj譧8..d.1;X.\.|X.1\. d. `.`.d.1;X.\.|X.1\.X.15`.Ѓt+Ѓ$5`. t d.1;X.\.|X.1\. X.1_5`.x1FP薶XdW[@.0.15@..,.1=..(.1.h"?맃=\.j 4?-" =\.z5|.6h#P u jh&"5|.P7YtjhA"ԝXZj ?-$t5D.jPoPt jhl"<;X.\.|X.1\.5X._vt\,t4uj^;X.\.5!#}"EȍEPhy"t jh";X.\.|X.1ɉ \.5X.Zi;X.\.5!#}"EȍEPh":1;X.\.|X.1\.5X.XuMjh"@/1;X.\.|X.1\.5X._u jh"V^ u 5D.RP>1;X.\.|X.1ɉ \.5X.ZJjh"?|15|.V`2_kPYt VVT2D.1@.P臇Zu egjP1D.@.j1ɺzm" =\.u) ?-$t,#j=\. jh"[Mj1ɺ"L_  1?PSq'@0j1ɺ">^  Sq?@j1ɺ";4Y u lpSrj1ɺ"%[Ze4 t u.Sp_e$.j ?-$% j1ɺ"^X.19\.}(.#(. .X.\.@.;X. \.} X.=\.+X.YX.19\.}(.#(. .X.\.X.@.1ɉ @. a@..=h.it Dj1ɺ(%iSXZ=t.tP.̯UE=.t@]UWS]Sj"XY1ɅxЍe[_]UWVSu}t ME  u ZE EE EuEE܋EEM9EEujEP5ǃ Ethuc;us^ .EPU9@%=EtPU9rtEt>WSXt1E9EsWQMS_ZHMt QXYKEPU8EtWFH Zt WJ YWEP.XZ}tE)}+} MA ZYtXX1҉Ѝe[^_]1UWVS E1E1@< vEtPENUjjjj uWVuVnu&jjUƒ0RPERPV&uC뙃e[^_]UVSQƍEkyex};uÍEP~};uߍE>Jx҃u̓@tAu=. =.B$}mu;܋.}Rj#;k.XZ끍e[^]UWVSÉU΅!CEC1ɉ}M98P@uBgtB$@ur5X-(@t Att+e=. =.B!5܋.V9}Pj#Rj.XZ믃DuA1x8tLuxgt;AyuȍIty@8u}O@Gdufu die[^_]Ụ.ȣ.|ģ.r.]gUM Ụ.y1E E"]7]UM Uȣ.y1E E."] ]UWVS\.Et Eju[^xPƉUY9E}jV= XZu W5XjjjWBu@uSB W^_VSWEWMș}9u9tSA 륉 Et;u{Mu {+u{Gt|3t|3uHVSY[|3Eu3|3nu,|3du%{GE uVtXtuSUES> Ee[^_]Uhh`@-hh?-jh"jh jh"h"htjh"h"hjh"h"htjh "h"hUWVSEu 9.9.9.1D=GD=EPEPYXiuЃueue[^_]tKv1u u CvtCv u dudt4OD=PHZE܅tPX둉؍e[^_]UWVS(ÈUS膓Š[:E1Ɋtu0<\t0<:t< u)ЉE؍}ܾ &}1Cu1C뺉UQMYƋE9ƋU| u&VMQRU Uu݋E)PVWXZ;Ee[^_]ÅUSP[u(h%"zEEPhUW$au; s=.tjÃut[UEPh,"F=t3t. tSrEEPhR" ˨Bu@uEEPht"XZ]UWVS}] EPƉ$PEU‰WZY1E1ҋG9t#39sVuS u \3d}t8d?-ECG9rI8e?-St< uӋG9s,uAډӋG9sEuA1C\e[^_]UVSu] u SZ؋V9s 8u@9r1e[^]UEM u@ 19sA8uH9s xt 9sH1]UVSuV"Yt]ujVx"XZe[^]US j]SBXZ}u}tS5|.!aY[`5|.l"Zt-5|.u5|.j!PSj5|."1|.أ.ܣ.У.ԣ.]Ã=.t%|.tUP!Zt 5|.Xá|.tUjPc!XZ|.á|.UEt jPB!XZUt P荂XUS]jSZYxIPY=P.u9]EPh"YZat5DOtAt Xdt{ouNhSU@,-XZFj SM@,-jjjPBu'@u$5@,-@,-Yjh"y=@,-y]EPh"GXZ]UWVS}9=|.tQƃ=|.t1 Ã=|.ttVZH V5x.XuV~[1WQP:`WÉh t,DždW Y]`\Rh"`|YZttV`_u U|$WV& XZtu hC%Vhǧ%WS}tjSY^y S~* ZPX؍e[^_]Uh"ZjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'|.<%tx.tRPY^CGjCŚXZutKH݀u=9us8Ft38Ft1 |.<%t x.tQPS躾S4ÃCFe[^_]UWVS]S^u1jjjS-Bu@thVS2 ~ˍ19=.t)RP芨ZYu FSW_XSjW]ƒ =P.u9P4Yt"SWP;5Pi:vRgZd1e[^_]UWVSu'X=\.!8u#P^h+":PEyZYUt""RUƉ$YPkL$QMWd?-Pe?-PURh4"MQV$W' tXUV8ZUtRhK"PCG ShА#P{CVt' t'YW[Y>u VR' Z SI' X؍e[^_]UWVS}1ۃ=\.u\WX$S~WhS"SPUVuPǃ VPuZYu S& Y1W& V& XZ؍e[^_]UVS]h#S;^Zt(h"S%ZYth4"SZYƉe[^]UVS]SYuVSiYZu]e[^],~V&~Ze[^]UWVS u= .h\.ZjXhc"Y_?|uC؉E-uEh#VP_ZECHtjhW"!u[^VuƉ<$T$RUF}WuURP谿WX% VF% YtsfGftjEPV  Ht-WZKtcu_E18E h4"|XBEP;E8E 0h#|Y^WZ;u S$ X1ۉ؍e[^_]UWVS}u =\.j֐h"nZY~1E E"e[^_]sVWSE4$E<$UMT$RU{EWVSURP=$W# V# E@u# t]e[^_]e[^_]U|EPuQXY1xE%=@UVS|u=L.u1V[t&V$P{VPIhB-\|PVQZYy VjXG1ۃ=L.uu#jjuuuulƃt*u Ee^_]+e^_]W|$wUWVS4GE̋G EȋGEċ7uu2,=.u2=.PkD.RPWVcWV4Ɖ׃ - $.uWVcY[uu}䡴.Eu藊t ub EUcuu3uuEUEU9uE.$ uuP&EU ~ÉEf=<.Et& t uEUĆ t t)E]Xȉslz( 艆E }  Eԃ.g} t}uS*(EƉ׃}s}t$ @._E@)1ۉu؉}Z~Nt;} t1҉U诅RPu%à }tA臅E؉U.襅t u`Ɖ1x. <.uM9)ډƉ1ۋM} t} u.Ɖ> t t u* uxuuل)ډƉSDL=<.t)} t} u}t裄ƉE„EWu؉}ܹ11Ƀ}t&=,.tM\RPj =$ Mj}!SQ{&uu+z^=$.tMWVuuRPEU$=p.t;}t5 u.t t@t!e[^_]g_鵃e[^_]g_UWVQM1yHL¸u 1=@.jjPWVeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|'EEH=.ukD.9EE}11軁 $.uEU)juuRP蹁EURPǃ[^y=p.tLۂւ t u, u.<ͅ u@)蔂.訅 u B@u2E؉Uuu+ZYZuu*_XE؋U܉EЉUuuY[1uuЋ}EEÃ.Ex u5#Å^IJ @.MCEă=<.XmRPSO!Eă J…u =@.~1҉x.uȉ}E=<.u  t umU4 Ut u uU Uu uE9ƉM_u}EUI}u}uEę)ԃ=<.t t u}tu}EE9ƉMq1҉uȉ}uȉ}̺1EjuRc"uuvt EЋU=$.t.WVuuRPE؋UEЋUԍeY[^_]aUWVu} ut\WV趀ZYu[t t u݉5H,-=L,-΂Hw t5P,-=T,-e^_]UWVSu} ucWVHb xb)ޅ~j2ajjjRPV tEjajjRPM)S=,.Ee[^_]3rWVEZYt1ۉ] E"e[^_]E\j`EUj`EUEU!YY@tE9ƉEU!ЉE9]}O}t-9uE|#jjjuuE܋.)HPt%x=u\P-Ux=uOP+Hx=uBP=ÍP^wƅPh"jW覝"5j PWO‹ 9u5!#%# .Ze[^_]Ë.;.~~. . .‰.US|.X|..(.[]É19F-t @uUP`iYt̋.tԋ.t.tċ.UWVSD.UjS EjS }tUuu; YXtP5.} ljE5.5. 5. E.E.D.XZ1e[^_]UWVSÉ։9D.~..< +t[^_]UWVS׉ˋ5 .V .Љ[^_]M=.tt*ttt t XÃ=P.u[USjm5p.~ZY"t:t1ɺNC=.tl#t1ɺ*C]Uht#讽p.PYZt p.?"h#艽l.PƽYZt l.#jh=U.jh,U.D.h.h.ނh.Ԃh̦.ʂ hئ.轂1.ZU1}]á..U.1|.1 .9.~". ..1ɉ .@1......\...h......h.(h.h.h̦. hئ.1҉.UWV=\.uu uƉXZ11$. .u=\.u u$ZYt.@=$.tʺ@b P,-T,-$.ut79MM |-M9 H,-L,-U |.@x@.c B.9|.H1Ҹ WVY^1 tj uVRP;FV胣ƃ1.)9~1Ҹ G19tD=G1Ҹ |..e^_]á$.t.=\.u .DUS.9 .~$.<u.Ph.€XZCԡ. .|..]UWVS]u }Eu@0tjxYEe[^_]銢=.tW~Z=.tw/P'x_uSQ~[ۃ .~K1S|YuSWV~_ZV.t2dZYu ..DV c_tW .uVb^ƒt Ћ.V.tcZYt t؋.t.tȋ.Ӊ؍e[^_]UWVSEUMЃt.} u)}u#=.Mh.}tuEPjEU RPu ugu=.t[.tR E .$.ut;UE }EU .$.h.u=h.tr1ۉh.1D=h.uf=h.uJ8u u1ɺZYG9{Ft.1k .ك}u E1O. . E1~RjEPy .1҅~ .TRPuu&Ã=P.u}u9EEEE55.+5.Ee;5.'EPv_@.9.uY=.u=.uEU ..1=.~+9=.~.81ɺGh.w|Ym19}E81ɋUG@.9.|1}uEPh.|XZ.9 .~Չ19.~=.   .<<@B)5 ...9@.}1ɋ. JKݸe[^_]UWVSƉPS[=P.t<.+.;.~u u1ɉZYuFu1e[^_]UWV։PsWV ~ e^_]UWVSƉ19X.~ `.t X.)C1[^_]UWVu} =P.uWV1ZY ie^_]á .L..H.áL. .H..UU1wR5p.suZYUS]1w%SZ1uS5l.>uZY]UU1uj jL1҉PPYZUSE] xt+uxxt \tf1҃‰PTx6@E&9tu!ـuJAE&u'@S$Yu SZt놸]UVS] uVjSu 93sPuCZYHte[^]UWVS ÉUu} .E졸.=P.uuS.Zt .1..dSPEZYtJHWVM^_.xt .Sh. yWVMZY5.m 1.Sh.xh.k. .Pdyh.x.@}.2.@.9.}%h.xX..=@.9=.| . .؉ESjEP8tU$ t9r)ډh.w5. 1=.[^0.t .u"uu} U . p .~@9.| .|t .D0tu u. u#uWV11ҸJt1Jutq.ЉERj]S*sƃ .E9s=)У .RjSsNj. .?4WtVL).~뫣.m} ..=.u.PapY . . M9u3_u(t M:.t E)M Ma_uM.UK_uFM@t>SrZt .E) ..PoSPYtE u1. .t =.uuu} U .+|.4G- <.~9|0G-)ș);@.}sD.)WV(%U ZYu K=.tw.PmYtu} U؍e[^_]=.t+=P.t"SqZtSarWV WVMUmZYe[^_]D UWVS]u }.t4 u ti5|.5x.1ZYt 1. .t =.uVuR=\.. 5x.=|.1P.T._@X.1ۉ\.i뷃=.tH=\. X.`. (=.t\.unX.`.ÀuWV1҉ZY%=u+%=tSl\.5P.=T._1%ul X.AX.`.9Ph`.'l[^5P.=T.th`.lWV`.. 0X.1ɉ \.uVF-Sm{XZ1jjVM u뾍e[^]UE1҅x F-]=.t&.tUSJZ P+JZ HX[]Ã=.y-U=\.u .1\.jh#A5ZYá.xW@d.UWV1ɉ .5.=.,9Ɖ}jh#5.XZe^_]ø. @=`.u1`.........1҉.....1ɉ .UWVS EE} MEE..t"C 9Ku}9{u E9C֋s..t . 1.ЉpHMH MHxC;4-=.u`.PHE8}.t'Xp9ډ} EӉEEډÈ}tE죔..@B [^_]ÍL$qUWVSQQEU=\.t E]!@u 111]9؋]ع5..tF U9V}}6E9F uE9Fu N^*..1=..~t-uF"Hh$(V(h"( TEj舦C'j9jWjWEj-by u9Xh#Xu>h!":tu R5_UVXtˋURUFÉ<$<L$QMt5蔻WPURh]Y%MQSw Ww _urVZ5YSSX j]uuuMjVj8}t&u'h#'X,j &u& VC.u蜬X1҉Ue[^_]UUWVS]EEEEuu OZYt jh#hr"SYXujh#,XZFh$&S&h"&A%j 8jUjj }u}u)NÃtNN@u,E UM;M MM|E UƉ @tt t MÃuVɕjj hj`Ujs7B.jTe[^_]UWVSu6EU_}u }tcjT/Ɖ[u u11j:/Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k.GPw'k.1.'t'.#tUEEPh"#**YX1ÉUS.w$tX.'^|..1....tPG X1..mNt jh4"g܋.K |. ....jh.{/|...Y[뉉txux ujh9#5)XZ1]UVS.1۰#4t'5t C'Ca1ɉNF FFFtP` Z1FC6ue[^]UE]UVS E%tYu EP.UEY^u uT@2M5|.sS CKCtP Z1C.e[^]UEt*xu x u]?@ @.]U Pu]jEP-UEYYut@ |. ...E ..tP, Z1..UWVSPEf=.uJ=.uA=.u8|..1..D. ..tP _15.{u#jPs蓾Cs 1ɉKs {SC;|.u RWV UP號ZUte[^_]UQMt|.9PtjhF#&XZP@ UVS]u |.1k9.u$9.u9 .uPa~#4t P'@5u1҉[^]UU19.uǀ .ǀ.=u]UWVSu薾[1.t:PPV uE..J 1҉.YS; Xue[^_]Ã=.UWVSu h#u0u. C Suu.ue[^_]j }WRP` su sʽXh#V5ZYtVWsPh_#utUWVSEPU8mEP8 UtYÅE8 u@Ej URP!ƃ xuu=܋.E8 u@Ej URP Ѓ xCU: uBU1҉SK C9~CCtP Y1Cu,CZe[^_]USE] =\.t1E En#tS_,L.XLt1ۉ] E#u=@,-x1ɉM E#^S*áL.ZtP XS茫P軦L.S 5L.K]s@=@,-y1ɉM E#]J#L.EEPh#4#XZ]P.S-x$Ujh@BRP܋.RPD.USEtzE 8.MU u4@E Qh%RYS- }t jh#}Qh%RC }t jh#kD.S-aS-yD.EEPh#>Ph%#j ]SmSB{~P|0uD]EPh,#"XZ]áS-x$Ujh@BRP.RPh(.USEtzE 8.MU u4@E Qh,#R<S- }t jhR#}Qh,#R& }t jhj#k(.S-aS-y(.EEPh#>Ph%#j ]SkS%z~P|0uD]EPh# XZ]US] }u!jSŽYZt]EPh# XZ]US] }u!jS^YZt]EPh# XZ]UWVSUE t tP(.^w=\.t1ۉ] E#e[^_]/ P['PR蠗?UZYt]e[^_]3"SƉ׃utS莗5D.WVe[^_]USEU tXtugR%(S-YYR&áS-Zt=S-tP XS|P諢S-YX]] S-EEPh#QXZ]US] }uC=.tS'.Y, .hC%rrSlrXZE@]%r]UVSE]  .E.* .#tRGYEEPh#XZ]UEtHw1E E#]X.]U}u=.u]g.]Q.]UEu=. M.]UEu*=.~!EEPh# .XZUEu*=.~!EEPh#.XZUEu#=.t=|.to5Bu @u]]UUE t#u?S-^u2@t+S-!S-PJFEEPh #@ US E1ɉ . .E 8,t)EPh 4$E P }t jh- #3.E 8,uf@E EPh 4$E P{ }tjhE #XZ7.05.5.hf$j]SZa]܍EPh_ #u]UVSE] J1 RD+~vQQ r/d~Q wG$E&t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPh| #1CSPh.Y.E sEEE sF@tK@sN@ sR@sW@tY @AuU9uE-EUEPh #XZe[^]ø=@.u=. 1=.áH. ܋.+.UWVS }8uMEPh #Y[1bÉUPm$@PƋUXZt=.t <\u {t C<$ut PWEZYtFFC؍e[^_]U@uPh #j*h@.^PRh #j*h@.^@.UuBPh #h.I.UU1t 1BS]UU"t B tB]U}ou<¸#u1]1=.U..EEPh #KZYUWVSu ]E0`_18-u@JЀ v#tuKuEPh #&j uP yu˅tӉuEPh #Y[뾅t1҉t؍e[^_]UWVSM.tFPtu)QjP_XD.ZjPEP 15.1ۉ]1U:BE<-t><$<~,Ht<+tO<9 ~1EM؉Uu7u*à U܋M~ZEE܃߃A<vG}-tA9u}t%9~-7cZ9Eىu1ۉ] 1ۉ]EFt}u Er]$I}t}t E1EEȋu} t tE Ee[^_]Uh#zYtPZ~S-øU =.u[h.VZtL1.EEEEjEPj:{ M9 .t._k..;EMMEEE=.t=.t=.uS-=.tuPjEP{ EufE=.u);>S-9u .&P\Xʃ=.t ƒftըu1ɉ .uu u { 1҉.=.u&u.@.~Fj.Y<1҉.y!Iq8m;q8#_M9 .tu1 .Ujh.TUQEPEUUWVSp0 u`É4$`|$WVuho"WPR؍e[^_]US]S ZuSh#h. .]ÍL$qUWVSQ Yq AQEU}WRPq1kˉE؉UM܋EuƉeWuuRPyku؋}׋EUE؉U܋E!E1҉UԋMЋ]M]E1E9M؋Er1EEEUeY[^_]aUuujjdu uUQMAQ jhi@BЙRPq1U EEUiEi@BEjEPxXZUSS- .t,S- .Sh .5S-w 9t .]UES-]Ã=.t 1.s U=S-.r|S-PS-M1.E]UVSP.t .E1.EPSXZt'u> E.Xu{ VoYCe[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uu}MQuuRPlK}Њ# u؃}yC-^SuIXZeY[^_]aTUVS]1)EM}I#uyA-NQu IXZe[^]ÍL$qUWVSQ 1AEI1EEEM؉E܊PЀ wPwW PwO79ʉMЉU}?jjuuuu}W/;jjEԙRPuuW9 ]F8M덃}tE0ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPwW PwO7;UU}AjjuuMSQuVs:jjERPERPV69 E8늃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPwW PwM7;UU}?jjuuM1SQuV9jjERPE1RPV8 E8댃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%.e[^_]US5à Hw ot tSRX]UWVSu}  .ouWV"XZE e[^_]$=.u`~hȋ.WVhS-nċ.\B1s9. .e[^_]@UEU E 5!#E5!##]UVS]u .uu ]e[^]S-P-ZE #E#؍e[^]KUS]tu uR4=YZtg=. .j ZQuj>X؋]UWVS]uE %=`.t >t:SSW$PKfPjjjjSPwf$9twV薮 Xnjjb1=`.1҃=T. PSW ÃtWU _}t-jh#[^tP6+ ZY>1؍e[^_]US]tPQ3 ZY1]U1}]UWVS|}ue( u KV[E E`.x9s^U xu Yw 8u 9Ut 9t'B@9Uuu>}1҉W1ɉNG랋E10E18](11}$1ۉ]]uuPEPjWu" ƒ1ۅtEUE}yȍI|5xj9E E HMM9|_y1UE1ɉ e(s )؉ùE(tE}|9|u1Au߉؍e[^_]Åu1뎋M1yyuu$5!#E<:N<%<.uFu RPY[ +!@ *u5|.蜋_vG9^.1u؍U؉ƋU؍C<6$F& L.1Jk@.RY19. ܋.{9)ISQRP_[u  u11ERP[_19r ܋.+ .ISQRP_1H.N5|.5|.P5|.PDwS x(t u(5|.pRY EӃMЉ]1۹}9}RP薿Y_9nRPZXZH'u70EЉUsӋEЋ}!@ȉ9څSQZREЉUXE E)ӃMȉ]1۹}9}RPϾY_9RPuu@'u j ]SRPlWIx u ȁ`.wtL.1&t b$EV/";5|.KZtP X@=L.`.`.e[^_]U5S-US.=.t¡S-u@.PE1҉.]U5S-*UWVSSË@ 1uuC1uEl@tg}tC E;P p$}p tJ;V ~$}@}tՋpt%lj;Pp|;P p$| putC C 1Z[^_]UVSË Bpt9QuAACPrt[^]UVSË Bpt9QuAACPrt[^]USË@tPU Y1CS5Z]UWVSNjXt 39s|=jjj,VC 31CCGtX_CPSk,C e[^_]UWVSÉυu/1ɉH `.`.13CP褟 1ɉK^։URHZ9Us&RUjEP!P谠 Utܺ1҉S `.t `.SuWV>ƒx6Ct P 1CZVG@$jCVP4{1e[^_]UWVSE֋xtBE3ExMAA ;NF |"Gt=NjEFOW9M}ԋE9G(u։NV ΋O W$9M|-G뿋EFOMOMW(]9]]|~E9G(uˉV;NV |9Uu=NV 9Uu9MuuwG\_ t;C$uE;C u K S$=EÉGxG tC X_ h9UuC;G$uM;O uFV G W$WtNZ9^ u;JuurBE(ÉGx GtCX _;C{u 1szp9uHtyt1ۉZY@9Zu9u E[;Zu;Pu E2[1҉PB;XEu [^_] [^_][^_]m.uU5d.Z1=h.UWVSE؉U܋uE)ȋ} )ϋ M]܉M]UUX9QDP9u9u>EU܃EU9EE} Uฌ.9}EU܉EUC뫃[^_]UWVSEUM}EȉE΋E?UtW tP9sFu h@ RPMEUu  @P4E4MEU Cuu h@ 7PMEU9r9ut6F5l.jjWuE)PV5h.5d.$'e[^_]1d.h.l.t.UVS=.t 5.}uuf.1ۃ=.uDSgYuu C܋.H9RPSjY wyr5.e[^]UWVSP,-ET,-E@u }H,-EܡL,-EH,-L,-P,-T,-=.u e[^_]=.t11܋.H9~qWEUwZ}u}tQVkUXE9E܋E؋U|59MEU|!Au#uuoWZI `x t e[^_]Pe[^_]UWVS]3t~v V ZY1CCC ....e[^_]Uh.XUS]d.#t-=.ujh#XZ]1=..E]Uh|.'XUVSu] t1ٸ|.t;pX[^]UWVSEUE|E x.p$l܋.h5D.ux.tXsmSϏ Zjj1CCCj y]e[^_]鏏 x.Cx..e[^_]U€u1=x.1]UWVS4..EU衠..E܉UtE؋M܋]MjEPjujuuu $..u}u܉}Mut}9Nju|M܉]E܋URP ZY..9E}|!@uc1}9}}Uuu[^tDjjuuƉ׃t$EUEUu}M܋]Eu׋EU裨..E܋U࣠..,jjuuEU}u}tu܋}뙍e[^_]U jEPXZ}u}t j)jRPuujgUj1.=.u]]USj5L?-#ZYt8jٸd.Xx =.u=.uS1]U=p.u `.`.d.l.]xUWVSU EEt :CM@tE3l. s+jh #Eu jh#=.=$.=.1ɉ .MMM1ƉӃu]5D.+PXZe n=.=$.jh?#_XE:jx^@=.@1ۉ..1EPMd.Zx. $. j1.#X=.t =$.TƉ.u}tp܋.xu }@u}uQ܋.HEP5D.X}tW&jjRP艞ƉӃ*W ƉX}CjYj111 ƉXF=G;=܋.}W؃&MxuƉYjZGMEPjEPjuujjE Mt=.t =$.tZ}~TJEu2EUutjEU9u9t5D.RPy =.t =$.tjFXEe[^_]Uhj< .XZ=.t.Uhבjc< .XZ=.tUE]Uhj%< .jjm=.tU}tOhj;YX=\.uבPj;hj;jj;hj; 2jj;jj;jj;jj; jjy;XZUWVS.1҉.tijjK;/jNjj,;jj#;jPG$hבj;j. tH=.5܋.y9=.u95܋.t܋.@h.h耲.t=.tj"Xe[^_]UWVS E։ϋ.SRUE-$EuURs. u.{tUM tuWV袠C SXZ1e[^_]UWVSSE։jj)u,$@PCuP9s {E C}u1C%u,$@PCuP؍e[^_]USS-S-t%CBs较 s趃 S调 1...]UWVS5S-'Vh*"P"V Z1ɉ .+[ÍhV i!tSV, uNJ< t< utZ8tPt u9_8bPjP蛾 u1Px^u ȋ8t6t2\uG@x9tzP‰1Ҁx$‰uH11WQщ‹MS-S-PS-.ZY{cX=.tS-..1e[^_]UWVS u!b1ۉ.S-S- -TÅ515.hQ#AP>AZYqI&STYuC)Z1)lj4$')$L9QZVh`#P`9tV[ Xh*"W6WG f;?SXYSXjjщ‰S-S-PS-. VhP> th=.t -tV9XGP(_t u Ƅ@t V[ u0- u -DH@ZutfTP@tCu* fLHt@u C@tC fLHuDPttDP@yulDP@tG UDH@cBV8Zt1...%S-S-t..1e[^_]USS-hk#S(ZYuwhq#S(ZY¸t_hx#S(ZY¸tGh~#Sy(ZY¸t/h#Sa(ZY¸tjS?ZYxP@X1]UZu E ‹E2ttHu jh#jh#jh#XZÍL$qUWVSQ .p x tWV虛ƉY[jj1EUXZ.uBEPEPWVNE؉U܃E EtEU}u}ujh#=Y[=\.tuuuu誗=P.tEUju4P4ESj:jEPuuS"4(eEu5| S/| XZEЅu u؋}eY[^_]aUWVS. .]11~1t2S-t AFKމt . .[^_]UWVS. .]11~1trS-t IFK݉t . .[^_]á.á.Ë.tUrIZøUjZujhh"M=ZYyjP8=ZYxU.]øURSjEP5.hU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tP.z Z1CC]UE1҉P]USUBt XZL[]UE]ÍL$qUWVSQʋEqyIZJ ZrʉWVEZYeY[^_]aUWVS]E EC9C|WtjjWVRPCPltjs3ZYtKljE3!y XECHKM e[^_]US1;]}E Pu[CXZ]UEU 1ɉHr2P UWVSS] EEMȋEeƉϋE EtuuWV9/M9u"9uu uEZYe[^_]Uju-jh. UE=.t&uf=|X-tE#].@]]UVSp.1=P.u.1(h\jU-XZh\jG-Y[h.2^tTjj--XZjj"-Y[h##5^.u 1"15|X-=.t j[P ֋5t.T-t,PV!ZYu.8@1ۉ.#Z8,t@8u݋8tH5x.R.PZY.@8tSFXh*"5d.^Xuc5d.h "Y[#S$S5.I& BP5W-Pm ^ZtbShVE  Nh%P#^Zu @׀8 uS`Y #h-#P#ZYt @׀8 uS!X'#8t%8,t8 t@Ћ8tH5x.R.PY^.t SZ@.P 0y#Pe[^]Ud.jj*XZUh1j *X.XZU!`.jh@. -Q-y ;-| tx-J x-Uhx-PTXZUWVSREƈEj}W5.$ f=X-tk1X.5X-脏jW5.5jo=X.t.V]"Ph7# Ktjh .5.# 럍e[^_]USQhN#0jj(jj(| Åt4EP^Z9u< hT#0jj(jj(]jj(jjv(X-j/SڅtPjRSh-h#whY#j蒂h-h#whe#jwUSQjh#5. 3 f=\X-t#E tPE Z+u}f= Y-t WVh? #WVh# jh.5.)h@.jjѦe[^_]hV #&X UWVSEhVh#F 'jh,"5.q)jjajjXh.jjQ(jh.5.|*à yh # &X11ft#j~ƉXPY~G9uAj5.j"jjjjV Vhj #j-f=|X-tjT~)RPh| #ejh.5.(h@.jjsjjc jjWXZe[^_]UWVSE[hVh# 4jh,"5. (jjjjh.jj(jh.5.)萻à yh #$X11st#j]}ƉXPBY~T9uNj5.越j5.詊j谁jjbjjY$VVhj #@jf=|X-tj|)RPh| #jh.5.'h@.jjjj jjXZe[^_]US,]S5.|h+"u@.u M e@.Sj5.芣h@.jj|]US,]S5.h+"u1Eu %ESj5.* ]UShSh # S'EW-[tEW-jh$5.% UX-tUX-5X-t5X-5X-t5X-f=\X-t_X-t$X-f=X-th+"h#uY%Y-t%Y-,Y-$.5Y-t5Y-jZEY-t$EY-f=LY-th+"h#X]Ujh{t 5.j=jhzt 5.US]Q1u蓦jP[&XZ]US]CStu RZYt1]UVSEh #PZYtP輇^yh#y[Ph #hP蜇ƅulX-u $,&$ &X4)Z&$%1ɉ $Ph"SSju*ht"xX%X%X1%$h@.i$à y%XPY9u tth-h #AgXZ댅yh/#TxxuPh #uPh #h-  Cƃ@.?.8 u =@.vH@@.e[^]USErjPh.h # uxh.hhP#|.yh.h #ZY?hSh # t h.JX5|W-5|.S ]UVSjPh.h!#] h.h.PY[vE!#e[^]kHu ..5.hhP"Ãy5.h #"XZ+5.h(!#hVh4!#SVe[^]UEjPh.h # uXh.gh*"P uh.h6!#XZ)j5W-P f=X-u.ER.UVSjPh.hH!# h.h.PY[vEO!#e[^]$.Hu.Rh*"Pà uVh6!#XZ@.f=X-tPhg!#Pho!#hVfVh!#S e[^]Uh-h"#cjUWVS}<1ۉx..X.%1u~11Ejh U-hJ&#u u3P=.uh-h##scjt&`'FtrE96/ kU DЉEX.뉃a$J&nEtPt=Lp7W}Yvh%#Z?95Lp7jh"V jh"V} h"V'^Zƅh%#jWmLp7h+%SZYkh:#SZYLh"SY[Åh%#뫡Lp7x.Lp7p.Em=.t h%#sLp7j/RUYZUt .5Rh12%h.9 EPjhjjjj5Lp7X.U P5Lp7h%#R$.teh+&#tML.P. .=.1vldZRP-E)t8HuR}t hk&#KE h%RUMYZUtp."L.P. .h@j'h@jh@jh@j 5X.h&#j h.h.u h&#@u h&#jhx-B_EXZtKth+% h:#h" Xt 1N11҃=.1X-LY-=W-1ۉ|X-=$.t ,Y-=L.t5X.' Yu.t h&#j=L.u"5X. Zt5X.h&#jje[^_]U.jh.U4hejEXZu2EZt1.=L.u!ujYX=.h.`Zu(j u= .$uZY.jiuY.yuhUW$oXZ.Y=.LjP?tXY.tPLY.!URPXZ= .uM@EPj5.诖 jh t 5. jjYX1}UWVSS]=.uh&# Yu h&#jqhh'#~Zt8/t P$ XxV-|V- '#ShtV-EP, ƃ 1=.t6.x.\.L.1P.=X.u'X.%;/u%.jS=Y_tT.t t u!hF'#Sh'#XZ h%'#_jV-9u QRP. V-Euڃ=X.u hX.h.#P 0 @u X.%hT.h$u/ @u T.=P.y15P.=.u\)j:hw'#u# 1҅‰P..uShz'#"t%=x.ux.=p.u Sh'#jfj:h %%u# $.=L.u3x.tP.tR5. ZYL.\.j:h%u># t X-j:h$%u# t X-j:h"u" t LW-j:h#u" t1LW-j:h_$u" t \X-j:h2#u" t lX-j:h%#u" t |X-j:h"ua" t1|X-j:hO%uD" t X-j:hO %u$" t1X-j:hyG"u" t  Y-j:h %%u! t Y-j:hI#u! t .j:h#u! t LY-=8.u 8.hV-=D.u D.`V-H.t Ph"|^_@.t Ph9"fY[4.t Ph%PXZ<.t PhF%:_Xh0.h?%u, @u150.h,.hb#u, @u1ۉ,.h(.h "u|, @u (. ....tj,SZYt@..؍e[^_]US Ph'#h-Sh'#h-jU=.th.htj jY U $-yh -Zuj -P -=P.҃ !Ujj\.h"|jh.Uh@.jjc Uh.jjM U E E1ɉ \.hj!EXZjjEYXuhUW$XZh.YtnE sujYXujXZ=\.uXE M9Hh -WZtU < tU EE9sE @E $-xˡ -P -UE Mtt @8u1]UWVSu..FVtI)~@'#t8u\Q ^@P u f^?봈@.[^_]UEP^vp.^?<tP@q.r. p.q.p.]UVSEPh (#sXZ@T-;t[Ct =t.uGW-PPh(#@sC <Ƀ*PZVQPh(# 렍e[^]UVS,u]S5.VSVSEԀ€Uԃ= .t̃Ef=LY-tMẼeewfEf=X-t %‰USj5.we[^]UVSuU ]=P.tSRVQ y@19t . @8u h$(#E&:%e[^]ee[^]UVSPW-EÉt.@T-t68u-Fu#EPPhUW$SV1%tك 8]tjEP5. Íe[^]UVS ފ< uf=\X-u"0U)څ~CCjW5. ǡ.tP_9u1ۉ\X-ƅy0hZ"Vv.ZYu ƅnƅy\X-jP5.Q  e[^_]1f=LW-LW-UWVSjjjjhjhj.fDž.fDž 1ۉjjP ~Ft=jh.5.  ~$.!S 9X<uY8C L{ t VWRZYtAEPuWI YV見C Zu h)#CXc9s ts tC Ke[^_]UVSá4.H!vd3VY4.4.Swt^'-H-x&x-Px- 4.P4."~;-}hx-j 4XZf{ u<@4.-H-y;-|x-Px-!hx-j!^X3hUW$%Y[{Vht#4.C ^ZtaP;4.s Vh)#>Vht#4.C Y[t'PP4.$hUW$ =4."~14.h"Ze[^]UWVSQu E]K:EE<\t<^up{tfKG^KCxЉwŠSzЉw>#)#t18uG(NJKyЉvK KNjUBbM8t1ۉZ[^_]UWVSS]hk%S^_ug@W-; CteE0ƅUB@tUQMY9MU~ R+#QRhW %h-Ãf3#h-j fXZe[^_]UPPPh+#h-w.t@th.XjuUh,#hK&hqh,#.UWVSSt ÉֺlL&"h,#hJ&hh,#Ru :u!USPZYUu=.e[^_]VSh,#`jUEuh1#hJ&hh,#@0h1#1UEuh1#hJ&hh,#@0h2#X1UEuh1#hJ&hh,#y@0h/2#"1UMuh2#h\L&jTh2#F11f3A@=uUVSEu ]uh1#hPL&j`uh2#hPL&jah2#t0ffPh2#SfPh2#?fe[^]Åt$1ɀ8u"UJRPRP k 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4L&>ZYt4G (uh 3#uh%hTW$h- L&E24ݠL&h"h-C uh-j _X<sR@8t54Vd@W$WVVEPMU1e#sj@HEPW susuh03#@uhF3#3uhS3#&uh^3#uhi3# U$19ŤL&t@ uRh3# 4ŠL&hu3#[^}tEPh3#ZYh0)uuh3#X,01e[^_]UWVS]uh1#hL&h{uh4#hL&hh3#11{ uh4#hL&hWVhPsu s h14#=ts h>4#!ZY1=߶xt uh4#Xʍuu-WVhPsus hW4#N노"=thPs hd4#^e[^_]UWVSSljUQ/ ^t#u uSuWpÃu V[8 ZHWu uSVW9uSuVf u V#8 XV8 벉؍e[^_]UWVS@]uh1#hL&h8C@uh4#hL&h9h3#{ uh4#hL&h:߃uh4#hL&h;ŋuh4#hL&h<뤋1ɿ 9lj}Ph4#99|CƁ t!Ph"5# 1jjh V"= tS h fUtts h5#9_X1jjP9u 9t-uRh14#VLPRhP5# tu@ku h5#Mu h5#m󥍵ѶxԶx9t PRh 6#`3e[^_]Ë -Q-y ;-|< tx-J x-Uhx-PZYUPPhA#h-j躵.W|$wUWSˉ1҉.M]m %h}fU fUm]mURp pSQh]-0hD#h-T$e[_]g_UWVS]E }܍p(}p4EPSY^tShD#9XZe[^_]UWVSPu} FM% FVFt5RPW[à tF1ۃ8t/h]-hD#8[XRPh]-bà tŁftvW#ZYt#/vh]-NZYu}u2}u$h]-hD#!8Y[}te=.u\VlU:1҉UtRWZY@uT8-tRh]-KZY@u"~lth]-hD#7[XuVh]-VZYt؍e[^_]UWVS.dt2h]- h]-Epd h]-!jjEp(` @EuphUW$7_X-xP=.t . .t 5.t2} F=.u:xPh]-N[^@} 1ۃ=.h]-hE#h-$-H$- yh -萳Y -P -0 t+@t( $-y h -^Z -P -Ѓ߃Yt`_(,h]-h{$5` DždWxPh]-xM[^@t1E%=tEjhGPhh]-wà uA 5.uh]-hUW$kh]-GPhh]-6ÃtNjOGXW\X\t;X\E@hDžl]-X\ptX \TX9и\T<0XPjj`jjPjdzTjwXP> X1ɉX\vRLP)TPSs L9th]-hUW$3XZDžd:)։1X\=.tX\hoPT^KY^EphUW$h3XZ=.Džd1X\t~hh.`ƃ ~KVh.S 9th]-뎉X\=.tX\htP`XX=.u`XM=.t#S`d)Y^th]-hE#y2XZ`H^du S8[z.dtSWLZYd=.um} tgG t^.9GuTxPS Y^th]-hUW$1XZDžd$E9Gu.#G%PS|Y^uSZth]-hUW$1[^Džd=.tWh]-9ZYde[^_]UVS]hVs u sh7E#'Ƅ} t'h]-xZth]-hDE#1[^.h]-VZYtVhOE#١.t jsPZYe[^]US]} th]-Zt h]-hDE#sh]-ZYth]-h[E#0ZY.t1E ]]i]US]} th]-Zt h]-hDE#$s$s sh]- <th]-hfE#0ZY.t1E ]]]UPPhpE#h-Ÿj豫UPPhE#h-襸j葫UWVS|Ӊ΃= /u\F=/tGR|Y_u%=@u"~|hUW$+/XZt#h|V5 =vQZVS,GY_u%=@t=/u^VSF_ZuQ%=@u?V3^u?XPShp)%hS蝲=΃= /=/|8/uVPEZYti|hF#UhSW4W0t=|Php)%hWVWEt|hF#-_XVSFZY= /S|^_uS|hF#> j/|iZY|tpj/ShY_xt@xxV_Zt= /|)~= /ix)؉t=9|u fDž.Nj|ƄPRoDZYkx9Íu fDž.׉ދt󤋅tƄxPR#D^_|9;x9 ;p=/hx-֟ShF#h-$-H$-yFh -_H= /=/uS|bZY=/u -P -0t- t( $-y h -莨Y -P -΃߃Yth-h G#=/t%=@uS6ScZu4= /C1=/ PSj|jqtS=/u1#|/PShG#޸e[^_]UE TET]۾UE MQTU TE]UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_]P[^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]˽[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_]I[^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]ļ[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_]B[^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]齻[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]bZ[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_] Z[^_]USU EAHtRSHtG t uF u:] M[]9t=t/uyDutJt] M[]%/1 []UWVS(Ul/ x/ D/01d@DHLP4TX\x|hlEE8jj h5!# SQj]Sƽ@u hG#jShG#mXZ=5/FډWVRPeG#=|/tG#RPQ/ e[^_]Ë -Q-y ;-| tx-J x-Uhx-P蟢XZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPx/tvv RhG#@Ã=D/=/tBjj h5!#v\vXjURG@Uu hG#jURWhK$à L /AF`VdEUQRuuVG#=|/tG#RPWQ蜚Ã\/ X/Et*=h/tU]Ã=8/u=4/tF%=@u FaÉ؍e[^_]W|$wUWVSEUEP;EZuEG#EC u=L/tECu}EUE؉U܋=/} /ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut'C  CtNV [[^]UWVS(]j//X=(/uEԃ}Eԋ@ ẼM AqP=x/tvv s hG#荘=D/F`VdẺUЃ=/tBjj h5!# RPj}W臹@u hG#j WshK$+ K /AEUЉMMuuRP蛷{G#=|/tG#RPWQޗEPv[Eԋxvs$EPhG#赗=/u7s,hH#蚗 wshH#臗 =/twsh:]#k F%= u9N % 1RPs4%1RPs0h H#%dVXN\=/t3jj h5!#QRj}W7@Ws(hK$ "{(G#=|/tG#QRWP迖=/tF(V,=@/tF@VDF4V8[\/ X/Et"=h/tMUF=8/u=4/t@uZF%=uE@ Eԋ@ 뗋,a-虚ShL#0j@$a-/X0Ht u hL#jhM#jܛXZe[^]Ã=/<=(a-/UWVe-wh8M#j薛XZ=//u6~OfEEEPhm50a-| y/~uz1=/]xl15/5/~SuOjjj50a-|xFjWVRP貚)WV50a-|x(a-"1ɉ /=(a- hgM#hM#j蓚XZ1e^_]ÃUWVSPE1҉P1;EE (a-/jjj50a-|Ɖ׃xtEU =/ux/] |/9É}EjRP50a-{y%PhM#0jК(a- )}W =/t1e[^_]ÍL$qUWVQ1y(a-I/u9hM#9jjj50a-{y(藗h*N#0j (a-)y11҃=,a-~hWN#ZjRP50a-z9h|N#~"019}oMQRPWV_U UthJ#j茘XZjfEEEPhm50a-z yuĖVhN#0jC'(a-1eY^_]aUWVSx-=e-t-PX+5/=/X u1=X0=e-Oh5#WV5"05"0՘RPVhN#hWw5"05"0hN#hVw0WVhN#hVw}}t^=/tU5<0580hN#hVVwVh/hO#hV:w(Vk$Vj耝 =e-ubhr$t01WVRP֗RPVhN#hVvV5t0hO#hPv0h5#"0"0"0"0WVRPpRPVhN#hRkv5"05"0hN#htWIv05"05"0hN#hV$vRWV5t0,a-HPX00h-O#hPu8}uV50ho"Sz%V$Vj }*e[^_]Ã=0a-y1t0//UP40 0t@=/u7= 0t У050h^O#5У0z5У0d=/tGh /50a-oZYu1(/%=u |/ x/u5/$1/X=e-w=@0t a-~ jPٜYX50a-l a-Z~jURP虝 40 0t.=/u%5У0h",1 05У0d 0a-/ /u 1t01//=X0t,a-40 0t̃= 0tУ0J1 0=X0tg50hO#ZYuQ"0"0 tjhRP褔jh5"05"0芔RPhO#5У0ixj5У02c1t0ZYUVS Shԣ0j y]hO#0jݓ jSjܙ y1hO#0j豓 5/=$a-B 5/6=0u50hO#[X/hDa-SZYjhU#h4~/t/CFtP50\YZy"0|Sh\U#0jK=|%=@t50hU#j&~ @YA%ma=L0u )؉h%'2\yDžlh/BSZth/&Zt80 ,0u#h/%h/XZY )P1=///PV) 9hsh/hU#j3}tPWZYu,0=80t:t:090W 09$0u090jh/NZYy'jhԣ0j蔃7`% 1ith/,YYSWh/O xݡ0 0u+=405У0h/O* 0XZ}tPh/mYZu=0t;=0t090| 09$0090]t0=D0t h/ h/Y+p0tE t@wpPh/YZ h/Zh/WXjj505l y80dXydRhZT#0j{h/Wjh/XYy#lPh/3h/^W Rdlh/\ dy Rh/ Rh/XZlPh/YX=40~= 0qУ01ɉ 0Ze[^_]US"0$0="0u X0@"0"0=~~ h~PhU#ÁthPhU#jyK"0Ta-5/CZx&1"0"0"0"0‰"0"0 >y밉؋]U"0$0=e-u>"0t5=~~ h~Ph(V#thPhVV#jy@5/Zx%"0"0"0"01"0"01 y"0$0Ta-~"0~UWVS0t hV#jf"0="0Ta-u"0 yI"0+"0EU EUTa-EEuuuuwu})׋E9ƉM}u}WVMZY+u}"0 Ta-19}d"0 "0"0;"0s5"0PY_"0+"0RP_Zxh"0Ɖ5"0Ta-"0 "0"0Ta-"0EU)"0"01ɉ "0 "0ze-hV#jwXZ؍e[^_]Ã=Pa-US=e-uhV#jvXZyx1ۉ"0"015Ta-5"0ZY~%"0"0‰"0"0"01+Pa-~C9}PhW#jTv yu뙋]ÃUWVuM "0)ȣ"0^_]UWVS$]CDž$$ x$|$x $= 0u15xPu O^_y狳sVh9K#0jmvPuOZYud%shBW#0j(vۉ15Ta-5"0u |ƒ "09|Ru -WQQRu<9uUy%rVhjW#0j@u79|$u9x$t hW#jtZPu 1NZYyQrVhW#0jtNjE49}u;0thW#뗋9}3t)1;x$|$}Ru ye[^_]Ã="0t1US5Ta-5"0ZY~'"0"0‰"0"0"0=u.=X0u"01$x1"0"00]ÍL$qUWVSQ Q1ɉMM u15"0="0)9}Ή5"0)ډ tƋ"0]؉}܍MQWSRPpƉ׋EUEЉUԉËU֍ ƉύEPWV yEU)u}"0"019<"0+"0щ9|gx t%u؉}9}M؉]܋E"0+u}뢸eY[^_]aUWVSU Ӆ~H"0+"0U U  )څ$ 9~؋5"0}5"0)É}봉[^_]UWVS}x$|$hlGdDžp } xAxPu JY[u]%odhBW#0jqۉtE1҉P`1h9Ɖl  "0+ "0 } ^ș9hl}hdSpPtPQ5"0u O]hlS} yE] Cpt1;x$|$5"0=00\t`A9\u\"0)hl} xdptZ;x$|$}L pN;x$|$ap#ƄWVZYp` `D$@$WV:WVjVhZ#V PiZYVh[#j_ U ^lt lt)w$V#pZYxDžl=0tVh Z#RjD`뒉l<$8$VO lxDžl0=0u =0tCi<$8$Vy =0t#($tA$u($(($$u ($.($($tbYX$50hO#NYZjVFYZxPVYZy+\thA[#0j_WV@1$H%# PVXZ=0u ($j0 e- e-t[j $P3VA=e-u =e-t51$PjL$H$X$T$t1e[^_]UWVSu }SE8uEEME;E~])])؋ME8tR<9rt >8u9@}jؙRSu>+[u hY[#E18}t}t:00E06SVu譽 9Zu hw[#i00E0ҍCtPR XY P譙 Yuhi[#j%\XZ>CPVЉUPEU 0j\̍<+E e[^_]UVSu] }u1NjjjV=y ZSh[#jhĢ0V@b yYShw[#0jt\e[^]UVS]u x@PadX=<0t*jjL$H$X$T$xe[^]UWVS(]} $(v(11ptWPu b ~ pt1@9uNjt9|$up9x$th[#jsZ xPu 4ZYyXSh9K#OT$9X$u;t h[#jjju ;y$bXSh[#0jZp1$1e[^_]US0tP苍1ۉ0آ0X0um1 $-yh -2Yu9 -P -9d-uu%1S 0 t뭅u tډӡ0Aܢ0uܢ0 @ܢ0tϋܢ0zyP1ZO밣0j50h0D0 &1]U=$00=(0t0=0t 0@=0u'h 0Yuh[#jjXXZ1x<0t9UVSut>uh%\#j 處 Xuh@\#jXY[FVFZH~ 8/u3E ؉C1C=0u00X01e[^]áܢ0t@=@0t Ԣ0= 0u4=P0t+UE$uآ0tjP50 US=<0t801t6{u+uhg\#j(WXZ3h#h-B< [Ƌ]UWVS]=Ԣ0u =0u$15Ԣ0yx50݋آ0YtHHQf $O&=<0tȋ@PURURpp p0;9xjjuuuuآ0pph\#j6Vph\#h\#p jW Rph\#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=<0L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPy\ y$آ0pSVh\#0jUƄ  ǃ$h آ0pCP.h آ0rP 50hO#D t1ܢ0@8e[^_]W|$wUWVS<ÉUMMQEP$u}j 9ƉЍM}Qh]#Qh"]#j@Snue[^_]g_UWVS\]uCE=40uPh#V8 ue[^_]R#}W($bkT$X$E(j8$]Ej<$HUu5!#u5!#PjRj4$Wh.]#V8$ w'@$  R%Ph@]#|$x$hK]#V7uEPhT%V7$Pw ShR]#u ShI"Vj7 Vj 0ZYV3"Xe[^_]UWVST]}T$X$uV($jSWVhZ]#aQe[^_]UWVS]u fVfuP+Zt%t0SRjP}W/nVW蓜Cۉu ]e[^_]{e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVS EEU1} t EE1EED}u^9r^MHYW wY0Xu}u}} }u,HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UWVSS}]u 9yK@G?ș9GG1 Ԋ< u G9r11҃G11ҍO9OYЈ\$ w %Y\$v Y\$w\ D$G맊YЈ\$w0GD$9r h11Y[^_]UWVSUED1}uo9ro]H 9޻r0WHM] M] u uu,HM0Hu} u} } }t9sԍr19r)A9r)‰ð0E E [^_]Ã=00!u%U00hc]#jMXZ1ø1UWVSSu] E}MM1҉Lp7=0u0K 009-u B0 P-=0u" 0Q0u 001Ҁ=0t7tMM}E] ue[^_]̈́E] ue[^_]:UWPZYtU:u W3h]#(x:u9P-9}Lp7@P-W3h]#h-1?e[^_]1UE E EE]=W|$wUWVSjEPS&3Ɖ׃EU E9Es 11M9ttuj,VZY…tUj=VY_DžUuh ^#Uj ^ ZUuh]#jJS͐ ju0 0B010Boe[^_]UWVSQÍEPSH^_u C #ƋE| t@E]Sˇ Zu01 KDe[^_]Uh-h"^#&j6"e-t 9tUe-Uh-h^#h-hV_#h-h-`#Ҕh-h'a#Ô j!UWVSPuhC%SIZYhC%ST_ZÊEhViYXuGVha#0jOJ }t/1e[^_]UWVSlj/E 0^_0t@E 0he#P| Y[d0e#00111҉U11Ejh`a-h7b#u uKzX$ P&Lp7"05Lp7h b#d "0렸1Pa-덡Lp78-uxu1/Ej/[$0Q/!b#BH030$1e-=e-u'b#>|100=0u 00e-c@0T5Lp7=Y140oL0` e-G/99%80Lp70#(0EH9~2MxPVe XZMuh]#jFjEƋLp70PM/=$100005Lp7E/`e#f/e-W/e-H/e-9/e-*/e-/e- e-Lp7/ģ01xe-1ɉ 05Lp7"DZ4P00P-E GEt0>}150jP$Y[yRFEMhb#S2ZY;GCjP[^u}uhb#P~2[Z_uh#SX2Y^ -uS(…u_h#S52ZYtVy^=0tShb#zFtjP8ZYy*h*"S&XZuSBhb#RU1ZYt8jhb#UR0 UujjRZYMpjP؃jSu1ɉ Pa-}J/t 88hˢ"/Zt 8/2" 0!"11jh`d-hc#u uxz$ R&1d-ă뿃Lp7"05Lp7h b#T0P0xLp7/fL0 T/!b#EH0@3D0΀@0 Lp7Lp7h-hc#5d-hn%h-# 5,e-hn%h-#h-h$ӈ/99%000Lp7Éѣ"0"019| 5Lp7h6c#%thhMc#jV=X,0Lp7Sh"-ZYuPa- S[Pa-Yyhsc#j5Lp7Z\@D(0/$0Phc#j<j/1ۉ$05Lp7Y5Lp7*Z0 0@|0g0U1xe-Iģ0:Lp7/+/=$0 - h-j #Y[{%E1 u1e-У0x-nEE ue- Ge%1ɉÁ ue- 095 u e-܋E5 _e-.1 t\50hc#h- 1 AI!T&Ph[n$š-P- e-uuX0,e-v/t1jj} 4 P-P-9EmP-9Ehd#j9ME M0PZy$jj} 4g^_'P-P-;E|1ۉPa-e[^_]á0t P0Ã=0t[UX00h7d#jN9 tp0hfd#h-[50he#)ZYu1UWVSM11JqX?tCt*tK[t~=P0ttjMYZF}uvQUtPU!uX1C<]t:m~-u Vt]t:E :U|^:EuĿ1}!9*A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puhe#j7D։9r KNKNp19r)XӋE}tE9r NKFC1e[^_]UWVS 50he#6[_Vh&f#6hVf#|6hxf#r6h W6h"WR'ZYuhf#W?%[= u hf#&6Y덊uhf#6ZX<.uuhf#5X1t3L@LuL@L%H9s tFCC@9u&>t!tWDh>g#j3|tHL@t<uDhag#h- WDhwg#h-t@th WD 0 1e[^_]UWVS]t K΄u hg#4<\u FFu8ujKp Xuhg#j2^_DžoGjQP t2hVPSVhg#jd2 WYx [띍V֊t\uF8t)F}W'x Shh#j2YRZu%GWw hg#j1$N1GtYuh7h#jn XuhLh#j0[^C31CVsZC 1ɉKECE C=0u00X01e[^]US01t6Cu+uhyh#j0XZ3h#h- [Ƌ]UWVSu0t$tS=@0u S1u=P0uSu$t9ut0}FPYuhh#j/C_Zt/1srCt/1ɉK;WDZC Hǀ?/uC C$c‹@t 9uBSSyu 1ɉ$[:hh#ja/XZe[^_]UVSu1ɉ$0u,=@0u1=T0{C |/t[t0CuPFP3 KVPZuɡT0u '$tVZYx 1$e[^]UWVS]=xe-tjs{.u{.u Ct:u hj#j/V[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVhj#j& TE@j$d Xuh k#j&Y[0t;u GM1GtAt0yVhSk#&O}thE8t`W yuhok#j%Wk bGƒWt+G 9OG}Vuhk#j%Wk 1G=h0u=h0d0x=d01 hk#e[^_]UWVSM=0tPÉֹ=1:t9pt@9u9U}tjb ZUuhk#j$[^1p1ɉH xe[^_]Ã=0u1Ujh ]f 0YZt1hl#j$XZ1UWVS}0$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujsa YtGGPZt0 $$$CSEC ECECEC1vSi Yh/l#j#XZ\Uh 3 Pa 1$$CHCUwC3Li SFi [^e[^_]UWVSM04$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3h X]e[^_]h e[^_]UWVSS=0t51ۋ4t#1ɉ v0EZh EPQh XZuC u͍e[^_]Ã=0UWVjhGc 0_ZuhMl#j"Y^Cxl#=ȣ05̣0Qe-Z@u"5̣0= Vhl#0j"5̣0:QX1e^_]1Ã=0u1Ujh'c 0YZt1hl#jp!XZ1Ã=0u1Ujh=b 0YZt1hl#j3!XZ1UE$$ $]UWVS(}=0$ $$$EUE 1҉EU苟,$0$E1҉!މu؉!ȉE9u9tE1!É]!ȉEܾ 1EE11ɋEUÅt#@ u9pu u90g@E]!؉E̋EU!ЉEЋEU3E3UЉ Ӊ] O $$$Å}uIE EtAjX] X11q $$$AQ C AK 1St$p0t0p0t0 u+p0t0M!u!9u^9uZtLp05t0 t:Uj\ Zt+UM܉HUPp K HC $$$3GPhm#jhIm#j$P @ $$$E؉,$Eԉ0$1e[^_]Ã=|0u1Ujh=C` |0YZt1hm#jXZ1Ã=|0tDUVS1|00tjjs sss3觵[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ |0=1Et#؋M9Hu9p u M9Hu9xt@$uj(![ X҉UtMu葥UЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!RTc XE m#Ee[^_];e[^_]UWVSEEE EM}|0tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3b Sb XZ1e[^_]1UWVS]}E=0t";/tPSs^ZuShm#j$Y YuShn#j. hSZuShn#j ue[^_]a GFG4W8F VG(W,FVGlFF x0F5x0e[^_]USx0tvCx0=0u{ t s3hXZe- e-tjjssss 3輲=|e-t s3YX3Ca S=a x0XZ놋]UWVSSUE @~ T@119}At41ɉMU1ɉrE1uZ[^_]UWVS u=0FhGSPl <9tjww 5e-/;Wu;G t h1n#*SR5e-+{ 9؍thIn#0j SR  yT$X$G9__W1j=W Xjjj5e-vG WxNS5e-z 9u)T$X$GW0W8han# hn#0j7 W3_ Xhn#j#ZYe[^_]UWVSQ0uhn#jXZohu u Eޅt6uM Y_tcvj $V ^t;u藠ƉYt#u膠GZt _E81QVs^ XWl^ _h o#ja[^0^SuZYtS@^ u1F_Zuhn#e[^_]UWVSu} 0t=h7V t&3VwZYuusVz [֍e[^_]UWVS EЉ1lj t׉ EE1EEL} t} t} uA HA@ AA4AA (HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=0-ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh1o#h S9SyEVh9o#h SSy=VhDo#h SSyVhRo#h SSce[^_]USSˋ t%RQP7xE3Q[ 1U1ɉ EeveRu Px ]URPh]o#jUjhoø1҃=0t1UME1҉01Ҁ<u=Bu} u,J=0t01҃8]UVS]} ~;uqjhe#P" u%=e-u e-ho#j0ZY1e-jjPƺ 9؍e[^]UVSiÅ3ho#V\ZY[uh1b#SHZYt)SVho#jh1b#ho#ho#j e-vSVh$p#jt0o1e[^]UWVS]u hVZYy\- 1{ǃ4$K<vCVh00 x Rh00 U jjFdPG%($jjFlP/8$jjFtP<$$jj F|PEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1$$$$ 2t|,1ǃ$ǃ4$($Qw\1ҀKƒ $x$|$ށ$1$$$ǃ$($w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%$1$$$1|/uDe[^_]UWVS]$Hwv$PT&=0t_hJp#j hsp#hp#hp#Ń d~ Php#뮋p3Sc~Rhp#땹1jdRPr1ɉ$$$ u#EƄ5/jj o11_Z1u9E2jd PEPrjj o11wE1Ex$|$ƅz ynH0P t9uon19r)J9r)lj°0󪋅 thq#$%$1$00 ,0t5T0=X0 T$X$($1jjWZY8$1jj_sZY<$1jjgRZYjj {5^_un1jjMZYuJhP٠^_y>jhZYx鋓$  Ѓh-q#e[^_]11UWVS}} ?jhe#V ÅulhRq#VY^¡0 0 u0hZq#j XZjjPƺ 9tPVhq#j ؍e[^_]UWVSu] hS2ZYy- 1~dž4$1E쀻Yt"h YPW*oz/@E K<vM E)Sh00} Rh00 } jjCdPo%($jj C|PлEUUEщx$|$@uAjj P T$X$H$L$`$d$ƃH<$P)P至yjjCtP͹<$ ƃ(8$P PQZYyjjClP藹8$ 1$$$$@$D$<6tL<5t_<2Pπ2s#hP莕ZYy|jj ԕ[_x졬0u$  ЃH50PC¡01ۉ00_Yx)ЙRPnZYy넸e[^_]UWVS$ƍ@- 1U ډe[^]wUWVSu>-u~t2h*"V_Xu$h0N PVh[s#j[ -1EPSZYt/G}vEVWhns#jEUt -u1 SeXe[^_]á0t UU RuPCI50dUVS]u F50tRPS tD3j SZYu1e[^]US]}t 00 40t= 0th-j [1 0ZY50h "h-Su h-zHh-j # ]USjhh"Y[xEhr"Pc0YZt&h*"SM0YZt1350ZS7X=L0thh"hs#j ]UVS] u}t 00 40t= 0thx-j ^1ɉ 0XZ50h "h-Vuh-|G~Su,Ƹ^ À~|tH;= ÊV~-t >θ(%)%#Ƹ Ƹ^0e[^_]U50PhRu#UWVSQ5d00d0PÉ5d0^=Fg-t ru#uKt;u%+1҉jEPSoƉ 8uE8t+8tu#`Ba& tBUUue[^_]W|$wUWVSE܉UM7E܍Hw$U&u# u u#!AuEU Ѹu#t݃} uWVuu WVuu&MΉEEUM EUEU)?EU t1?EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉM][EU11 EU11 ۉ]1E.E!EE!EEU11 EU EUEUe[^_]g_UWVS }Ӌ7VT_=0%us Љ UU_EU=0&t u#wE𡤥00S1 VVڋExYtEUe[^_]UWVS(Ɖӡ00EЉUtSUЉt@ vSUиƉX^MƉׅuGMIt!ElM̍YWVщ‰Y[ƉWVh5"j]SjSu e[^_]US7=0)u _[]W|$wUWVS4ƉӉMЋ?E1Eă0HI00SuЉE뭃$9 "tFكPE4EȉU̸u#=0#4EEЍpًt(SEȉŨwhf0SEȉUYEȉŨw><0ƒ}'u1EURPh5"juVjV3EУ000S]U]00SWڋEXY E1ۉ]00SWڋE ЉE҉UXs}t u#V00˃'u1ӉMȉ]SQh5"j]S jS50  v#똋M̋EȋEċ}eʍe[^_]g_W|$wUWVSEUϋE܋sá00EUVU)0Kvu^*U&8U&|u0VQ{0YYuRPUMY_KwU&9M~ ߉EUce[^_]g_UWVS}USƉ׋ 0AZwSjƉXZ=0uJE졤00MQ1  SUEY 1ۅÉ!1e[^_]UWVS}USNƉX=0uJ=E졤00MQ  SUE X1 1e[^_]ÍL$qUWVSQ q}W50XjLPaZYt5xIu,xNu&1҉Uj P@ZYUtB@)։50@뽉00m1=0t v#EЉUWEЋUԍeY[^_]aUWVSRE} 5!#_f-f-`0`0HO;t(`0sx&P ωʋ7`0tx BMסP M҅xJ 軡H+ f-QОX5d0SƉRPhLW$k1 e[^_]Ë0Ѕt /tt@1ɉ 0HUS]u1Z;/uPhH%YZY@tEPSYZY@tҋU9u;Eu3E3U ]UWVS}VVPm tS覝0Y]e[^_]kSeZ8"u뺅uo02 Ph6v# e[^_]UVSu=0uE=e-t.1҉e-hMv#QPYZtS0Xue[^]3e[^]UVSu4t =00tP^* YХ0@Х00010jRХ0HХ0Zu̥0tG =0t,j50hJv#Lj50hMv#:jhMv#[^1VX@$]0VPþf-f-`0 >/t[50>t'`0H`0FxFCXVԀ~/u#`0Kh"VZYu$f-9r :ƅuh`0K;/u>thH%VZYt `0x/4tX/ gXV>t`0H`0FxފFC9f-u `0x/C 'X/=`0u`0Х0@Х00tPx( X005f-Ӛ0j50hJv# j50hMv# Х0HХ0u ̥0u@e[^]UWVS} ]Х0@Х0uKYy Х0u̥0tuj;ơХ0HХ0Zu̥0tut hQv# Y4u1-=f-u =Vg-t50h#XZuÍe[^_]UWVSf-hƅdh{v#cYt ^t>h#WvZYEth"WbZYEuEE1}}FHπ\ut}tnxP0tB<wV$U&NE1>: 6 2 . * &щǍ@0w\9Eu}g-HyPg-H X JF>/g-HyPg-H X J }u-g-HyPPg-H [ J 5g-g-fBYtfBhAw#j(1e[^_]UWVS]u }g-tg-9tx u hg-Xȥ00uPh "hg- ĥ0tĥ0Ph "hg- t&WVhg- x0h%hg-ZYxS7( PhUW$hg-g-HyP#g-H X J Eg-e[^_]e[^_]Uإ0uUԥ0jPUU 1̥0Х0@Х0tuRj uХ0t ̥0U1̥0EEEEjEPj =X0t=f-tjQjjjJ U=(0u (0E Puj:UEPu u(UE(0jUS]Su 0uUguu 0uUEPu juUuu j}uUS] Su0^ ]Uu u0A UE Puj+ Uu uj UM`V&ft9uPU t@QhQ%j hܥ0ܥ0á0UWVSP2BYuOƋjjPǃ t 3;ZC jjPaǃ t s{Xe[^_]USh5!#ĨY08tNf-g-M0thB sXZ0XjjSP50#j1]W|$wUWVS ƉӃ=0uj'ck<0X 01ƉU1}m %M1EmPP$hx#jS;6u{0ujh2$Sr9F SZÀ{0u K{.te[^_]g_1 0000US]tvUUt[F~#CtVj RPWjEpS:~5j Rs cWE@C us XCX C @C[놋]Ã=0USQjj]Sjjh$f-@ @tBEP0Zt,jjSPjh$f- @t0PATH@=50J 0f-X0]á0US ]t6;u1Ct*p~Zt0PjEPCp1(]UWVS }W1t@Х0BХ0PWDrE_XZsnEX;t.Ey"xVY0" Phx#1Psus ua Х0u̥0t[~5jVJXZ}xu ju0 jssYX}yjs_XZxV^uuYu u|Z upX10 Х0u̥0te[^_]UWVS}u g-tu u101E܍]SÌXZ$PW&uwYX=g-m= 0%jw~XZ=g-K0  04jwNYX=g-= 0=0= 0t>VW VW=S- = 0tVW= 0tjwXZ=g-= 0u=0uSŋZU ?1=0)= 0tuW = 0tfuWSi = 0tAuWfك= 0t(www+1ɉ 0jwXZ1=00jwY_=0tr0f= 0tW,S踊XZTjVW S蛊6Rhx#)hg-ES{SpY Sgf1S轊X$0t}=f-t0t tPtj=e[^_]UWVSE ǃE܍uV5d0ju^1jY=g-tKt>=g-u5tUXUt E܃PuRcXZ= 0u V苉X^VZu10tje[^_]UWVSWE} _f-f-`0`0HO;t(`0sx&迊P ωʋ7`0tx BM蓊P M҅xJ wH+ f-Q茇^0PS}ZY100e[^_]UVS]01js&XZ=g-= 0tT 0u0H0x1 0뼃u 0Q0 1ɉ 0MwE50=0; ut-t)E Ps50XZ= 0Ro 050e[^]UWVSu=0=g-u1EPIE؉E܋^Yt$hPSO = 0b[E؋E1҉0]؅6Fd0=g-P0P莦PCh"9v 1g-xWPyPg-H =_ J=sg-xWPYyPg-H X J 5g-?_jsv E Pv =0=g-uJ 0t:u0H0-1ɉ 0Hu 0H01҉ 0 0=0EPPXe[^_]UWVS]uV薅E؉E܋S d0jPsiM[= 0{tuGd0EpWRZYtV1= 0uZ=g-uQSC ; td0u P 0[_.[d0u P0ZYu뇋[g10VlXe[^_]UWVS]} 31EsZ=g-{5d00P*Phx#Stj RU5g-UR hx#Xu hx#Xg-HyPVg-H X J 5g-XХ0@Х0ujSguSPEq}trt8u4guu Х0u̥0t3js"WsjХ0HХ0u~̥0tunUu;Rf1ɉ 0Х0HХ0[̥0e[^_]Rr0Х0HХ0Zu̥0t tJ=g-tA{t;5d00PjPhy#g-Ee[^_]e[^_]USDإ0EE1EEpX=g-tlExtc5d00PZYEP$x#[EXtj S5g-X [hy#g[5g-XjEPZYtlEإ0ԥ0jXEuKt&:EP$y#X5g-XԋEt0j5إ0Х0@Х0Eģإ0j EpXZ1ɉM Х0t5u Ep-Y[Х0@Х0Eإ0j!X Х0t̥0t뻡̥0tEt"EPK$#y#?X5g-Z]UWVS}] 1CCC =g-EP聀Х0@Х0E^y h+y#xjWfdjWPyu31ɉ Х0̥0tujujWuE؉s Х0HХ0Zu̥0tEPwXe[^_]UWVSE ,1@0X`0(\0$1`0EP{X10E@d0ptEXt8sl_u&Cd0hpPSG [u[ċt1ۉEp :^x|EXtCd0sYu|1҉4pjxPSF [븅t4B4닅4P}_0pt0J0H 䋅010T=f-t"=0u4~0@T40)Љ0=g-u 4fEE 5d00P}ZYP0[xuvp1s%Zg-Hy`PXg-H =~=WXtNg-Hy8P_g-H {j=W襊Y^ƅu뽋J=뫋J Ӌp t:g-HyP5Xg-H J s^X뽋EX g-tRSP t [HyPXg-H J 5g-h_gxsjhW&V薲 u Xԁ} ``041 Huw)4)400tX4t-X`0QRUR0af}Zf}tJXZ:-{z-uzu apu CSu>E- `tfE= 0u Ext,AEftfwE= t= tˋE@fat5Х0@Х0ju^[^nf-9tߋM/t/CUuSƎ1ɉ $0U^_}9uB$0<:ttB1::uBMuZD+f-Ee[^_]k1e[^_]UWVS|uj/S*zY_tAuu VS\蓱 xP6&_Z@ j6EPǃ tjMy\=$0uSuu VWu>!8t48t* 8 uxPWz&ZY@t WkX뀃 h u tCƒv~ (0PSP6ho"jUWVSuU F^fftfftdN0$U jS$PJPj IU yхtvhy#XZWPXtkhy#<XtZhy#+_MtIhy#ShUW$Х0@Х0v~P$PbХ0HХ0tShUW$NY[?̥0thy#,Phy# PShy#M~ t-g-HyP^g-H *Z J*g-HyP1g-H X J e[^_]UVSuf&t"8u%uCVP豠ZYt؍e[^]UVSu`f&t8uVPZYuCݍe[^]US,f-1ҋ@0tHft fux@ |u[]UWVS}Х0@Х0@0t,Pfu9x fu9=,f-| P[ X҉΍^0t Х0u̥0t e[^_]Se[^_]UWVSSu0X'1E8Et$}u <:uWE}:u uW@u6u#<%uUFPhz#uZYUt>:uGFC딃=,f-y t ,f-u1҉MRM ,f-Xe[^_]UWVSХ0@Х0@0t!f{usS) XZٍ݉w0t Х0u̥0t e[^_] e[^_]UWVSutA%<@0@0tCVP3ZYtdߋ} tXХ0@Х0V$eÉ1fCC VCPiХ0HХ0 u̥0th= 0؍e[^_]US`f&tjP)f@SPXZߋ]UХ0@Х0 0 P Х0HХ0Zu̥0tUWVS] j/us^_t[EtFxPuu ZYy 8t8tתffCf1CƋM09tMEthz#QpY_tM ju_Zt>HftftfuEEu E u=,f-yƀx u91ETtE,f-tuDYDžDž\DžXDž`juEP` Wd$0Z?/xPWYZ2E%==$0NEWiLȉ`+f-$]cWabjuƃfx`QWTfXZF FfF CfF fCFC,f-f~tF\`9\HPhz#pZYtuYDž 5$0hz#epYZ`9\~8C8k58]'XKWuhz#5Х0@Х0dTujuY_f~udfF`FDžX t@Et$jXPuh%5g-Tf`Х0@Х0dTujuXZf~udfF~ Х0.̥0!1 e[^_]UWVS$EE111E11EEh1z#yEZtPEbw$W&1EE1ɉMſE뵾뮻E랃}uutjLY1҃}u/}u)}u#uEEE081@0tROft!ftfIu:}fu.} }tуtEЉUSW>XZEЋUԋ?몃|u5g-^g-@h;z#[EjWZYt[@ft:,fuu>0P08ufHu*}"fu}}t˃=,f-x t0PuЍEPW}t f}uA-tf}tjW~Y_t jPFXZvd]uEԉERuIEe[^_]UVSu Х0@Х0ju!Ë@ZYft&fHu sgXfCFC fFC FC Х0u̥0t e[^]e[^]US ]Х0@Х0fEEEf-fEu ?EEPSLХ0HХ0 u̥0t ]~]UjuTZYtfxup)X1UWVS 1ɉM11uhz#@vZt(ptvtVuEEлɋE 8ctu ދM Mt4Phz#Ht}t5hz#40:t/1E 0:5!#0:gz#RPhz#m[&jjV XZu}jV)XZGfEGEEfGfj/VjZYEEԡ0}tEjVEPGEP\My`uh#XZ0P00Ihz#.j w:j hz#wh#0 8g-HPg-H 0P00YV_8uVPQZYmIwh {#owh#J 0P000PjEPV1MfHf5!#tuz#Ph{#iY^jVB_Zuu h=J$FYV`K0 Ph" 0P00 u%h{#uh.{# uhC{#fVh#0P00_Xt!0P00E.h`{#YEE~uhz#넋Ee[^_]UWVSEPyZ0+f-PYf-XY}GE܊_tkta}t\} C<v2u+:t$ t/t6EP=Vg-t"E u `0xB [P}눃=`0u[`0f-8uu@h"XtVAZ^E %E1bP YuVZZPd X VZXu‹E|}u5F< v@ `00y8[P0Csu2c& <w `00yZP08t8}t!߀u8CuEԉEtCW tC̃W8uΉ֋EԀxAȋE1҉U]}t usu]uM΍HMЊ1uEΉEAx<EЍp[<:Mhm{#VYZYEąM9EЀxupx9uBa&EEE9s2>uF9utsEBa&tdU9UvsԋUE͈@ĉƃEM9MUP` YPEP{ EXZt\uuЀ>-utF<]tm/uu}NtFuc=0Uqxvtu@r t@١0;}u50S[rxRP=ZYyZ9tt1t9s'@ZxvttE]S@ϡ0;EtP9Uu8/t}G H%C%PXE90t@/Džp>t F1ptJxw@tu@o̥0tSYpu{F/uS0Zt߀x .u o.uǍx jWt tptWuk50 덋EG@WPu@/VP_Xle[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFuĦ0skY@uP0DVƴY0u+f-,+f-EEt;t}1ɻN)ЉE=Fg-8<@.<*&}tE<VE)HPhp{#(1ۅI~@`0H`0Cx0P0S։MAP0SM뻍G1҅~օ)xu u܋E%PV1ɀ} k0+f-ыE))00 `0@} uSNtZ}EtsŠc& <w2 `0x0H 0U@H 0U `0x0H 0U@H 0UԈC뇻11EԀƒ v! `0xM0H 0CuJ `0x0H 0ĈU7@H 0U뫈U@H 0U뫻1111ɋE%Et>@u=0uM @1 1E @€}E$PX&U50Q80^_Uzu LuЉU E PuY[ExU^1 `00yB?P050+5f-uuuuVuu%0+f-ʉ0)@`0uZ0uuuVuiƒeuXE)d0 Rh{#誩}O#uOQVHPRh{##u EEEPVE)HPRh{#gSu9u1ۅu"uԡ0+f-Pu 1Ҁ}t`]uu E]Etq|wt ܦ0 ܦ0׃usuKt@뿃uHuEe[^_]UWVS]E %E1ɉME tEg- 0u $0E0+f-E;~uE t u SXZE 1Es}B~< O$X&:=J{s{u{y{@u{=uz10E} t `00ys<P0e s `00yI<P0d0 `00y#<P0 t=0t"0+f-M9~xuH0 uE uE 11 `00y;P0҃}u C< w `00y;P0S `0x0H 0U^;H 0U߈ tsd0E#E PVu Rܦ0plܦ0ܦ0VrXU `0x0H 0U:H 0U߈E {~=u}1Eu V[X ud0 `0x0H 0U`:H 0U߈EE RuEZY0+f-jPHP wމe[^_]UWVSEu ]=&g-t1҉0P ܦ0f-0f-`01ɉ ̦0 Ȧ0Pd0Sp_Xu&0=`0u90`0 `00yg9P00+f-Pq6Ħ00XtAh0W&Ħ01҉Ħ00Y_ÀtS50+50_Wj6xĦ0Ħ0Y[kĦ01҉0tNFe[^_]Ujju5f-@E5UWVS$EPEߋ50+5f-hREС`0H`0ZYx0>8P0=f-VWW]S60+f-P+55d0WݔEԉUS6f-0)Љ0`0`0 70uuh5"j50蝜0׉Gu}"tj)PV} 0)O0)=`0EЍe[^_]UWVS]u =ܦ01}DPSXZ0=`0u70`0=ܦ0}=f-}t }tAbL;tWh#hg-褛jY&Et{#PV)KSh{#֡jWV肥+0=0)`0e[^_]UWVS]u=ܦ0CvKE%PuXZ0=`0u560`0=ܦ0 f-}M  t?9s@UVWQM MUt <CÍY9s1:UVWQM{ MUS9st{u8u@@9r9sS륍Y9rVSQM, SMt9s{u8u@@9r9sS뺉A9SVSQM u;Mt;uCCӈ)ȉ+00)`0I9tKCCG+00`0x C04P0 0`0e[^_]UVSu]Sc2F ܦ0f-0f-`01Ȧ0jv`0H`0 x04P00+f-P1ju PES2Ee[^]UWVSuFPh#蝘g-xWP[_yPg-H Y J19}E 4fZCWhG#?g-xWP_YyP莖g-H [BJE 4xg-xWPYyPFg-H XC9| J1e[^_]Uh |#Uh |#םUUM 0f-t 9PuH]Ë `01-0f-B t xt 1z1`0 X0UWVS}u ]Х0@Х00f-z tj.0f-J B ZB$B X0P`0P\0P XtK =X05`0 Х0u̥0t e[^_]re[^_]UWVSQ50f-^ Х0@Х0{t-WRUdZtUD< t< u g-Hg CX0C`0C \0F $9tSƻ X Х0u̥0t e[^_]ӛe[^_]UVS0f-H `0tBu y8 `0xxhg-Ǔhg-轓XZ0f-=\0XX0hS0f-p| qu`0\0j\s8tġ0f-xuGs8#ujjjv} xtPjj^} xh-|#茔Xu\00f-1p 0f-PX0X01ۉXъt< Y\0t,1ɉ \0 `0hJ|#Ϛ)щ `0H\0! H\0)H`03=g-t5X0ד5g-[XZX0PX0~e[^] `0xX0PX0U=~u! `0xX0PX0]]U0f-`0P \0PX0P4f-Pj8r+0f-@1҉P P$P0f-YUVSu] Х0@Х0hc[ VwjjV{tt0f-@~PwY0f-s{uh*CZ1`0\04f- Х0u̥0t e[^]魘e[^]UWVSĀuХ0@Х0jVzY[y Vhd|#ÍxPSxL_ZuE%=upjjjSS u]jtWSy u"jhr|#W uSzVhw|#jjjSS tSzVh|#MSu^9uSzh|#2u PxХ0HХ0ZYu̥0t蟗e[^_]UVSu]Х0@Х0} t5X0V_Z`0\04f- Х0u̥0t e[^]=e[^]US0f-Х0@Х0CxPuXCtP۶ Y{ t0f-S 0f-P `0P\0PX0@4f-Х0HХ0Zu̥0t ]顖]á0f-US]0f-9t = 0tD 0t h|#і]Á=0f- 0uU=0f- 0u]U}u"0f-@~Pt0f-1҉PYUE9f-uE f-]UWVSU0)i5rO9f-t5|0u1#f-(9tC߉9} }t}tVǁ[f-t?iӀu.tiրuf-f-XZ[^_]UVSu95p0=X02f-tPmsYjhh"vf-[Z1@tI5f-rf-hb Ps5f-сt0y;"Szf-Z@uCt S&HYth|#!g-X4y;t0t jjO[Xjj?jj6jj-]y¡\09t PjZY@u>l0x hd5\05f-言Y[@l0K hPh/}##x¡t09t&Pjq[Z@uk0 hPh }#5t05f-<ZY@uk0 h5f-qf-jjGjj>jj55p0e[^]UWVS]u+0i5rOCShW}#Х0@Х019~Qi@tǃu=uFjRZY@ujtP Ph~}#9+0i5rOCSh}#輒HJ΃utBƃs Х0u̥0t e[^_]e[^_]US]Х0@Х09t P誱 Z1ƃ1҉ Х0u̥0t ]霑]UWVSTÉ։Mt&uPh"Sv =E,EtM}~EtEtCzMB9tMtEttt t tM IuɋE0u#E@VYEEHEvE9u]=0)i5rO f-+9t# ti1;J-R@Ph}#jEP舊h%"jEPs URXZEUt%‹E0h}#jRUDURYXǃE@T=uh}#RDYXu*tQh}#jRfhz%jRTu =t̉UQ) j URP/E@Ut$RWǸ@)$D=Ph}#`/ U:PWlj$URXZKyS赇P Y P G~SEPHXZEu EL}tzKySgP _ P KySEP|Y@P|4M}tWh#S藈 iEM0EKySP Z P EEE}S{X>e[^_]UVSMt.t 119}9ivtC䋉11tJiD} u&ƒuu=tă[^]UWVS utF>%~W..[tW-XY~#*Ft~uH<-tB<%t<+u:f-}#f-i0}#0|0E1MxdtS~JH~?u(UFPQM+YZMUt UQW,YZUu뗅uV7-ZtjV,0|0XJxRt~i90tM΅x29|0~*i0t"~# }#~#1ۃ} uVPL؍e[^_]UVSh5!#6X=x0tYh$~#rg-HP5g-H Y肈Sn0Z8P0xj00Y^u h4~#請=P+0i5rO@PhV~#8 9DiPh# FXZՋJ ;1e[^]UWVSQ111Uh^~#5ZUt$jtptguܿպλǍH~hb~# 0tyt h~#辊UjPYXUt 1t+0i5rO@Ph~#t$Ph"'XZ1tiHi0i0h&#g-BHBCY_y3R4X9H g-z99y9H y:؉؍e[^_]Ã=x0u!UjuZYu11áx0u!|0 0Jxu 1øUE=f-t@=X0t7uR+0i5rO@Ph~#5g-趂UWVS=x0t.5|00NxtS{X1x0|00JХ0BХ0uh=ViP*Ë|00i߉_19~i9uFP讧 ^0|0iƄDŽIu|0 Х0u$̥0t膇t Х0@Х0=Ng-1ɉfǃp0)؃} ~iE PZ Х0u̥0t؍e[^_]UWVSu]=X0tSSzYXuM1X0إ0 0jcjjz1p0XZ}u*=f-}u=f-)=g-t u 0Vj_X}u-V5f-rZY@uJ^0脭 hPh/}#\SjrSjr{}tx0}u`SjzSjzu }um߃u2`u)jhhjh%|g th%hd|#Ѕt$=f-tSj\rSjTrSjLr_e[^_]US]U M=g-u1t uEM E[]hUWVS}tE1ۉEPu EPǃ u\8$0tХ0@Х00E1i|0M9i MEEM99u]Pu Uu6$уu>t6Uu@ƃP}uuPtуut 1ɉM1҉UY}t-}u tƃ<tƃ1҉[tgu tUP=X0t =f-u;u uEɃ@ ;u uEuEug-P Х0u̥0tȂe[^_]UWVSjjjà ~ jjj=g-tQCtN5f-o^9t7P5f-.oZY@uZ0Щ hjPh/}#訂1095|0|btPu=x0u>SX5E t t&tt M ڋE8F떍e[^_]US1h~#,Zt$ltptZu⻀ۻԻ͡0u t8t PhUW$rGcjiGY[=f-u =Vg-u@t4j00‰١g-0P0YZxuS5g-?XZ1]UWVS411Eh~#+Xt)ntput h~#&50Eƃ}t1E̅u4x0E̅trH08uEu=x0tO*jjV~ uVh~#jV9Y_t Vh~#蠀=x0t}0 |0=0Ix.}t ?u1҉1E؋Eԅju4EZYtxu M؉}tDE؀u8jPqZYÅt j7V薃 =f-)ugXE؊u CM؈`08tu E؃]ȉ1}ܡ0|01Jx8t(t uEuEĿʼntEĉE܋E܅u%}jbjuV贂 OuA1ɉM܍EPjj @usE܅u ߉:tU܊jRU_ZNjE؋U9t}uuRY_Eԅtt h^#'X6jsjs u7{t1hx#Xh]$jshż%1[(hb#js u h#_hI#js { t&u h#n^hf#cjs T u h#H[hm#h"hq#,XjsZYu h#Xhy#js u h#Xh %h"s h#jsyhx#js h~#Cph#s t=jvih"djv U; uh#h#A_vh#s)h#sE#1H#%1i"1K#1N# B#S9tRh#j}W^oWV^w-C yh#YXNMuf-Nuf-tA1ɋpi@@} t u PXZ؍e[^_]UWVSP]u }/tu,EjWVSE#K0I Ph#&sPWVSe[^_]UWVS}t 0 =0dPX0u 0 0`1\\90~jhY&`P蚗à u\0dP_KP^؀;.8t@x/t@xPS芿ZYy1EЉEԋ\Ť0\u940E} $0u#e1t:t@u=`0h#S[b^_19f-XaXf-5$0߉Sjg-xWPYyPig-H X J EЋUԋ\00\ne[^_]UWVS}uV[1ۡ$0tCe=f-u\ujJY=g-j5g-jhg-hg-jI=g-uQ1~jIZ=g-u8u{=g-ur;u=f-t`=f-tWh#iXC+t'=g-u1҃=l0‰l0jPvY[1V4ܑZuVyXe[^_]UVSU:Х0@Х0jR_Q[^y$ Х0̥0e[^]4ojPХ0HХ0ZYu̥0t o=fg-u11.1=g-t g-1ۀ=g-t g-j蜑jj莑 =fg-ttg-tg-e[^]Xe[^]US]Х0@Х0jSnPZYxjPХ0HХ0ZYt Shd|#n̥0t3njX]UWu}~E pdPBec1Uu7 Zu h#GnUu uH ZYu h#'nUVSuV 6@$VP{"؍e[^]UVSEX9f-}]ށ}Х0@Х0FPbf-Pf-5f-f-Х0HХ0Zu̥0tmХ0@Х05f-f-)f- Х0u̥0tle[^]UEuj h'#jIM~f-)f-f-UEf-f-Pf-P`0P d0Pd0]US]Х0@Х0f-9tf-P! XCf-Cf-C `0 Х0u̥0t ]l]UUХ0@Х0Bd0R~Х0HХ0Zu̥0tkUWVSW f-\ kХ0@Х0=f-5f-G9ui0taf-CPW¡f-f-J f-+f-`0f-d0^^t5;8u1H+pp X@MSNjM󤣐f-f-X Х0u̥0t e[^_]je[^_]UEХ0BХ0f-)f- Х0u̥0t]j]USf-f-`0f-[]USf-+`0f-)أ`0f-[]UUf-)f-f-f-+U У`0]UWVS,ME 11˅t MPz2ZMwDGƋ܃}tE0v h2#PjFPKE0u _E1t0wLG V2YMVuMM̋3XZ̋EЍe[^_]UWVSD011EE hO#wE_t/}pt}rt}duܡ0EЋ0E뿋=0?u hU#ijE^tt Sbe[Ejh e"pEZYuE̖%EP 5f-f-`0X1EEЉEEEÉEjMQjXJ HMu6U߉Ӏ\uN}\}uKjQj*J Hu U߃ u Eu}tjPa[X9UUtRUuZYUt@Rh%ZYt}tc }Eu[}? `0_/}] `0xFUpUԈ+f-E1ۉ]E`0u#EJ`0xFpUh e"71ZYUu.J`0xV }P+f-RE^)u\`0j5f-7k 5f-f-`01ۉ]3=`0u2`0#SutZYt*Sh%cZYtNEf-9s}~}tjuh e"j j5f-7|j t jhY&PEP+E؍e[^_]UWVS1h#/E[tХ0@Х0jPХ0HХ0ZYu̥0te01rErǀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD5wFuD5xFD5EPEPEPh#C_Wh#0__X0 wI112NЀvSh#%ɍD=vB:u҅t Sh̀#ePХ0@Х0S.^u Х0tW<0 PSh#dׁWPE,ËUR. Х0HХ0 u ̥0t9d̥0t)dӁS Y5g-\\Zg-@th#]XEEe[^_]UWVS,f11}Uh#E^Ut*}St}at}HuMЃMʺË]E`Y&Eԃ8t@9tE Sh#c08}Ѕuxt h""c}uEh"u-ZYEЉE1E؉EEȋE@HЃ w7̋}9 ErXk] eډΉ׉u؉}뷅t uh;#IEX 1RShj)9}9Us uh(#}e؉[}uE`Y&11114Eh"E\j h%9\ Et‹u}eh"\X}j h%[ YX;EPC PsCP3hJ#[EE|u}eC 1RPWV7ƉRPh`#[ *C 1RPWV7ƉRPh`#][ Oj h%I[XZ M؉]܍}WE@ PZY@M؋]u,90f Phf#HE}tXEtM]tM]WE@ P<[^y80 Ph#`EԀx udj0/tM] EtM]uu h#qZY$E@ 1RPSQ6RPhLW$MZ 5g-eXZg-@th#YXEE̍e[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPS M t#9t9uƉׁvSh!#Sh #_e[^_]UE0 w @8u1]UVS]1tSf'Z1tpVhT%Se ¸tVVh3#SK ¸t<uh+"Sׂ Y^¸t0 vSVZe[^]Åt2USf-t1:f-uf-Auf-[]Èf-Uf-PSg-PXZ=0tM=6g-uD肝P\臝PB0eXYr%u,#jPh9#b UWVS}] Fh=#UW_%1ۃ0t 0u7;0P00jPƿ00XZ=|0t6u hՂ#XH 0|0Pt0000001ۉB9tt 50 0e[^]U}ujjjjuXEХ0@Х0jc0Z8tPX Х0u ̥0u1~WUU0 wj jRܐ Hu100UWVSu}Et8uLu+E@1ۉ1۾E?C:-uލBztՃz-uztĊ] :MtKu5>:u$EEEjEPh#}[à uVh#cJz:u벉뮍Hz:xuWمuU6<:u!EEEjEPh#[à tuVh#hg->Pjh#`1H9ujQh#Zà 1Mjh5!#h#Zà M+E@1?1ɉE11ɋU Ph#j MQOhMQh#_Z ÊEEEjMQu EZ( t1E1҉URjUe[^_]UME  h#UP u0=0u01ɉ 00h0h0RppUVSM0t:u>0u1:-uztX0z-uztBu 0ͅtɍr8tuPh?#9Yy:u܀y:u.zu 0J 02u PhR#T50150e[^]UWVSj,0^_zthh#:8->E 010j0Ytzthy#(T0uD8-u @P50P)Xg09Zyh#9|EPáХ0@Х00 0)<}_߉ƋM9sω9s x19r )ЍpkME9s 150 Х0u̥0tRS[PY09} h#Х0BХ0)أ00ljNx=0tE74r ZEy1ۍ 01u10 Х0u̥0tR1e[^_]Ëg-z8U `0x@ 6@g-J8g-z8]ÃxuUSt Pq XK]HÃ8uU1҉P8u]UVSƋXCF~hy1A1ZAf@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉Pg-JHR P UPUSUJtXxv-u~u C $t hv#g-B0+B8PCXe[^_]UWVS4f-E=u6E8t h[&3=f-f-`0} E=f-f-`0\C`0\GNà " `0 G4f-(=k`0H}t`0G u͡4f-@4f-=-} uE( u ƴEu 9E@E菴t9u& u4f-g-HH FՁt| tf,jE)VP+ &kx\[x `0@x 4f-g-HH `0xO Hf-)Qg-X4f-U)Ѝe[^_]UWVS@} g-B ]urVY wVh#Vh# 4\&h#j"S|GSZ؅tWhń#}xM4\&hڄ#jPGGSUWVS]S;5f-MM E,ZY9f-ulP_H=09s<wDu 9rMW50i ZYt%0=0M܋=050 ##S>e[^_]ø5!#g-ztGUS0ttt* ##Բ0054f-P0ZY]UE0jZEEU\uHر u"4f-g-@8xtjjX聮jjh0"耮 镱UVSg-Xt 1ۉXX=x tjbg-1҉P Yg-1p84f-P0 `0xX0PX00Fƃ)c t,~tŁF $ Z& 4f-g-PP @\ |td;Z=t 蘰 uc?&ug-@19g-@_|ug-@g-@$&t;u,g-@ g-@ 訬g-@g-@rg-@_蒯=t0 u74f-@4f-g-B0ztjj[Yg-1҉Pjhe&Và ؍e[^]UWVSSág-@tuxt =g-,uyGEt7[&t,O8uQPZYu[&^_8Et2jwE.Y_t XS4$PSd Rt g-1҉P؍e[^_]UVSg-p$ t jjg-ubX(x,u{ upV Zuh$#P: uBPVLg-BC1ɉ ^t‹(wjpVe P0+P8RuF Xe[^]Umg-B]US]V9tjS]UWVS 3t u%j 8XpZʡg-@؍e[^_]UWVSg-@}t11[Wt\&t1MHwRFuvg-@@},jEu-뤃uj p1AXumtCMuj 18XMHXj 1҉WPMHGYljރ}t' }uZߨjE#BW}uGg-}u:g-@@ t\&}t jjg-@e[^_]UWVShEӉMg-@E1Eإ0E豮E+f-]jEPZYtujXY>tt-uVƉCY;0} ;0~0}>uQy>u |u &u !Utv&uya1ɉKg-dj`dB(g-@(X4f-PZ-g-@(u @  1҉P 蜘y1sg-X$g-@ Wg-\H,hP SVg-pg-@ X P(Xu1 `0GD`0r5H"0ǗjhډMX`0HXq{t Ba&`0X+5f-T `0`X@Džd{1d#kDžd}tmBa&uW0-DruJt?:}u500jjh0ٖ 1ɉd躖Džd Ba&`0t> `0x`@`H`Ba&uKЃ wC `0x`@`H`iÃdt@@Ѓ v6t'H`0X`XX, Džd `0x`"p=d%:t #u)Ph[&`[Z…t!Džd[Sh[&AZY…uH% `0x:F p:Džd `0xF p[&{`@9Ë`uBW``Dd u(}t# `0x#F p#Džd詔d1ɉdGfxufxt dTf-Jwd@ ӈd ӈ{dNj@f@f@dK@e&1҉P:'uAW|e&u1`0X\Nj@@c&f@`0X$諓H `0JNj@@bb&@f@e[^_]UWVSSg-1ۅtXC1g-0x tjRg-1҉P YF8Pv v^S‹FP U8tSjg-pZjhd&P`g-HUJ@ B 萘]e[^_]UHu+]UWhPTإ0lژdg-`ȥ0\}1󫡨g-X1pjEPZYEإ0ȥ0Eg-Tjh` jhd&Pc g-B t$Pt=^g- hppDžt1ɉxR|T}Eg-jjtP袉 f-pnXg-`g-d蜗Zlإ0\ȥ0ԥ0u jlDžp5!#u^j-Džp3#Xg-`g-d.Xlإ0\ȥ0pu hpp}UWVS g-@1ۉ]}U g-u@$x @40$[&j袿jCjj Cu;jiF EjUBjbjUB뻡g-xu jF Y1҉V @j]j ág-x 14$pCjj_Cjg-@A. ug-x,u pr[u hK#j腾 g-PS @0CBg-Yx u`x,uZhK%p:^ZuGu g-up0pY1҉US@PvjjfHu?8j@g-1҉P Pg-J0HCBHYvBg-@-ttjjjCVg-@^Xjk g-B0+B8C j fg-p0C5g- ~ uhK%vZYt hK%CEFug-xjƋE0FEYg-xu;g-x  jj p0‰EEU表g-@Zu UBE밡g-xt jj@0FjF g-@Yt-Pv jj u g-@FEM1҉@{j jeC1҉SY^tNjjLX=Vg-tt3jg-@X&}tg-@uWd^_Tjj g-u@$x@1ɉutt;tj ;XZÉs؍e[^_]UWVSV} uE E1ۉ]1]g-xn g-u*p0QƉXYtաg-pZu1뿋H up$E0FE뢋}9u}} uwjg- 4f-H4^S ZYuha#SZqj/v t h#t g-4f-+A8F%Fg-1x4R@@u} u jj1E1҉j1ɉHEFE F g-@0F[e[^_]UWVSSg-@1uG u=Vg-th#g-@puWj Y1BUjBËUBpXYUj)&C^Ut1ɉ ֡g-@tj)pZƉe[^_]UUg-1ɉHHPtjjYXg-1҉P t/Ht3g-@jg-Ytrrh#n&g-1U11ҋE]FUU Et 9Pt]UM0tPt9JuB]US]j袷SCU PUPUP X]UWVSEPwi[y h+y#%u;5g-~5g-ExWZ=w PWV% `jjj uNujjzjjqjjhjj_$jj SSEpujuEe[^_]1=0UWVS}u }t~h@VWhà VW#hZY}t9u9t:W;X19t-y0K PVWhy#SSVWh#$9g-}g-؍e[^_]UWVS]{tN7Gu 0} t} t&Wxjw PR+GxPYWC Z1Ce[^_]US0Х0@Х0uSw0SMC Х0HХ0 u̥0t ]T#]UVSu0t1u(jS#ZYFxPX6utse[^]UWVSu] 95g-}5g-9g-}g-9t7SjjSV%9t8VW1J PSh# #؍e[^_]USg- @g- g- ~.CPjj x9g-}g-P,X͹ؙ } 0]UVSu 0 ~;0|l5 0j Vwà x9g-}g-9t PSh#A%ЋM !%9t'PjSJ @u0:> PSh?#}j 1}PMZh^#/Xe[^_]UVS]u M1P1<\&t#KySPMX P\&<u~tvh#S S4\&ZYt vVuQSh"MShr#EF y)KySP-Y P-Ph#Sq SvXZۍe[^]UVS]{0u&= 0u 0uХ0t]=0uTY= 0uZ0tO08tCt>0$0@$0=f-tuХ0u ̥00[^]US]SVYt ]]ߴhC%S8 YZtSZu]US]#t%SdZuSh#j h0V0]UVS]} t"KyS P ^ P VPhUW$S  t?uSh" ZY?t.!KvyS9 P X뭋P 롍e[^]USХ0@Х00t8t P33 1҉Y0u1 0 Х0u̥0t ]-]Ë 0u0t9u=0u 1UWVSu} = 0t=X0t?u;0tۃftGtt;@0Wt2<=f-B0uQ=|0uH=ng-t?$=f-=g-@0u> uUT0tY<I<tG<0<#t5<<@0uw EPjV  @}ttKtR1N=g-t tFv =f-u <t9uy PVZY@t\u@0u jVZY1E܉EEEN>v \ DjEPj e[^_]UWVSu] uh%s*ZYtsh6$VY_uh#B j5g-h h#V_ZǾ0tlХ0@Х00P0 1ۉ0^u Х0t̥0tjWХ0HХ0ZYu̥0tG@u15 01ۉ].{h#W!ZYth&+"WZYu/p[vtEuEu11j1}h%3ZYDžt}N}u N_}10t@taGwuu%h#WPhn% WvPhn%C ~h"__1똅t h"L^110t\08uPu%h#"VPhn%'VPhn%tC ~ h"[1F@ut h"Y1ۋ0t708t+hȉ#0P SPh0#C@u}u3= 0t63{Zu;?-uu1t 11EFhщ#EXE=}}uU0t0Ph#tY^PƃX?vsh]#5g-- hȉ#0Zu h# 0P XVPh0# 넍FuuzХ0@Х0Х0@Х0u1 WX0t0PU, Y<0t jVxXZ Х0̥0L EEe[^_]UVSuu  00tJ8tCХ0@Х01P-0PХ0HХ0ZYu̥0t 0uu e[^]#e[^]UVS]u @0u VSYX@0<vjSXZuƃ@0e[^]á0= 0u t8u1UWVS01ɉ $00u@@u 0e[^_]1҉0= 0u‹0t0}W-50SjP9S* ,t }wW,50Xe@Ht 0tUS]90t$jjrjjijj`0]US\1ɉM=0u'=0t0t EE0000$0tjEPm[Zu Eģإ0jEPOZYtХ0@Х0jEP3Y[uO8Eģإ0= 0uы0tǀ;t 10jSXZ몍Eģإ0ZjKtX]~ ~Cvv1ɉMMMMEPjIXZjSYX1EEEEK>v @ DjEPj BkSP XZ50U0E0]UWVSh]&PaZYj'VE_Zu <)ș19e[^_]áХ0@Х0g-t,UP( 1g-g-Z Х0u ̥0t Х0u̥0tUWVS]߅~91Wu ug ~ )Dž~E u F ~) 8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu0CfKS u>Х0@Х0s6C CCХ0HХ0^uV̥0tMFfu9sХ0@Х06CPRC S)SХ0HХ0ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9g-u]e[^]e[^]U5g-uXZU5g-u~XZUPuu EPE u hw#ouPJu% UEPu u UE Pu5g- UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'V_Ztt~tnh#V@ZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h]&VZY<tBEt7KyS'P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KySbP'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9g-u]e[^_]we[^_]U5g-uXZUhg-Mhg-CXZU8ruPh#PhNJ#@UWVSSEPE X85f-f-`0j=RUZZYj=SNZYU))9~߉Ӊ `0I `0t$<=t xFU蔗p UCɅxUvU] Ue[^_]UE1@u,d0+`0Rpp h#jh40 40UWVS]} Mt t9u t113Ba&ƍCt9tBa&u1@t)؉[^_]UWVSS110tZuA=u܍P襓EY10t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uEʼn#e[^]h#SL<ZYSZ9u;ShUW$j'SMY^ƅu+Sh-(%XZ/<'uh #sXuS)Ph#t e[^]UWVS]} sSt"CtS҉XuEs1Et Wh$!Y_}t5uh$ XZ$g-Jy R` g-z9 _F>=u y:Cu}th2 #FPZYg-HyPg-H X J e[^_]UWVS=L0uH0 h8L0Y11ۋ0tJG} tE t8tEt.H09P5L0L0%H0XZL01҉Ѝe[^]UWVS0000su"f-s f-s  論YVCƒJujvXZ=StuPF K DPY_F u v ZCFC FCFSh X`e[^_]UWVS111Eh#{Xt2vt&etfuEՃxuп뽋E u0t0}tUP( YUtW2U XZUʉ؍e[^_]UUE  E U?t h# jpp 1UWVSUUu Х0@Х0j臅XU:-u0zu*5f-kf- f-C 1ɉK^1jEPRUǃ UuSj=R_ZUtRVVP?VjR E81ɉK C1s@C O t0KOKGt u tGG <=uRUVP tjRULXZU wh0u1 t0< =u\0H`0{0000 Х0u̥0t e[^_]e[^_]US]tu s?XZ]US1ۅuh#'NtxtIuhϋ#貜Yu 塈0P0t SPXZ]UEU )]USME )u AR)[]W|$wUWVSZ1҉j EPS5ƉA 8t948"u/EUE9EsShH#0-9]u ShY#EMDJ@t@E}u9tՉe[^_]g_UWVSQƉ)ukIe9Fu[~~R9uJjjRY_UP(PURsR Hx N9 uW XF!؍e[^_]UŠH8-u>1tfzuhd jjh_&1zuHhy jj h@`&BR.uhd jjh`&hj#PZY1u`&UVS|ƉӀ8!uxu :\|fxqpftft!f u&PȢZ?;*;"|f uPS)=[^1PS<ZYuNf$^&|&E%=E%=@E%= E%=`qE%=bE%=SE%=DE E E 6M;MU؉!]詋]P9>(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$_&SV跷Y[SV觷_ZYSV蚷[^SV艷ZYƉ׉11 Ɖ׉11 ylj։91lj։9rlj։g9(Tlj։I9PV':^_xPS:ZY04]E9uc9u_E98PV9^_uWxPS9ZYuD04MU9u9uE98f9]PVw9^_t1PxPS`9ZYu鋅|9u;xu͋ 3E3U >~u5!uډx!(u;)u{u ?e[^_]UWVSu] h$3Z_Zu!Nu xtP!zUWiYu UR0-DPtÅt SZ@tM}th%6RZYu }tM1EE8%u!Pz^X6h# _Xz1ɉj EPu.ljыE 9Et:8u5 t/u u5!# 9uM虿8Mt#y޸"uPh# EGSWf YZ@u'`#|x"RPhT%$ Etu jW( XZMurUVS@l<0 080 05<8t j=SXYZt hSLXZ Ph#j@]S萠jSh$#|j hg-h e"k(j h#h#Wƒ r%u,#j Ph9#2j,h)#h#!j h#h##$e[^]UN=ԥ0t 1`0\0cOg-01Ԯ0ܮ00=0t jYg-g-g-g-g-tPH 1g-ZUjR1ɉ 0Nf-1p0f-Zxt@ۆjХ0@Х0jXZ1@0uƀ@0@@u Х0u̥0tUEt]UVS]u tVs XZe[^]UVS]u h&$h&Vs [u CEe[^]s 褬VDF4$VsJVs Vs[Vs GsdVDF[ ]VsVs C[XZD[*uFE$Eh`&#VhY[EEE8.u(px*u Eh`&#V._ZEEu uh#}f?f}‹}G}HE @,1e[^_]UVS]ss 3sh&#衍j&tVTRPhQ# SO S VPhX#]e[^]UWVS uj:u rZYE u hm#j\@E } hk&E P}Y_8j=P;r_ZqxEPh#W7E #u=#t">#E#uD#t"E#L#uK#t"L#T#uS#t"T#rk\#@u[#@t"\#KDe# ud# t#e#$n# rm# s!n#y#xx#y#y##r#s###r#s##}#r#s##[T#r#s#2+ r#a'# s##>}w t2#&# u##r#r"##@u#@t"#y“#Àu!#y-“#Àu#PIɓ# rȓ# r#ȓ#' ϓ# rΓ# s#ϓ#֓# rՓ# r#Փ#ݓ# rܓ# r"ܓ##u#t"#~#u#u"#^W#u#t"#70#u#t# u^#?'#t#^#}wu1 #% #u ##u#u"##u#t1#`%Yt@!#J)#@#>uM #*tO(##M # (##^/#3@)##^/#^/#}w s # r#%=t)wt=u&r#=uz# n#v#Q# r#<}vw s37##'7# r6# ?#r>#r#>#F#rE#s#F#N# rM# s#N#V#rU#s#V#oh_#r^#s#_#F?’#sÒ#sjÒ#^}uSf#Pj&;t3CaP3hm#jd,W!{ 1 11ɻj&;}t SC8t{$(Whv#j ,(PzCPhv#j }(Pz$A u,PW輝Y_1Ƀ bt,P蠝EP藝XZe[^_]UPh{#h-~jqUس0#=ܳ0u"PRPh #h-~jqUWVSQÉ10;#uCj EPSnҗ 8t ShUW$jOE8tWShx#je[^_]USÊt%<#u"S}Zt@0]UE E EE]mUWVSÉU}utj VS#n @t 9E s 8"u"3O;t)t:Et0-fDB@fO1e[^_]UWSPhʕ#ZuD0.j URPmà u藖8"u hڕ#j1ҍe[_]UWSPh#ZZuH0.j URPKmà uD8"u h #j1ҍe[_]USÃ=80t =$0t?<09t6t2`#t""=u`#QRh(#Fr <0180$0]UVSƻs&t[PV軇ZYuICƒ@0D0CH0C0C 1f‰80te[^]% VhD#je[^]UVSÉ֋t8uVh]#jURM1YZtVhu#fqXZ(01EEe[^]UWVS11Dž=P0~ Vh#qXZ1 RPhSX =t=P0Vh#&f}Uu1.=P0Vh–#p[^v49tVhx-h##Ea6WhR#hx-,vvWhZ#hx-vF (tl#{f=L0`PW0%SVhi#m=`0t e$h 0Whx-50Whx-"WW`V_%eL0 1e[^_]UWVSƉӉt \0tQuډ=\0u1It 00= 0 09s Sh#jh0P$ډXZe[^_]UVSƺH t 1҉[^]6U=@0ɀU E]UU EtPh0_#XZ1҉UWVS( 0 0 1hSd 4 h#Se>^_th-#S!ZYÀ;tj:SP^_xh-#WZYǀ?u=1ɉhp%Scy^_1jh%S hp%S(y^Z w&t"SPZYu w&f50|w&uhP11҉\^_thu#cvSh#b f0he#SuxZY1;ph6t"SY^u hAt"S_ZuhFt"SY^u Sh#'b c0h#Sw^Zƅuq;jP11҉ZYth#a_X 0Fe돍Vh#S# HuEt90s(h-#Ka0f 0[^f 0uƅhݛ$SvZYujh0h{%SvY_ujh0eM {hJ#Shv_ZuAjV11҉Y^0)hk#Sv_Zu.jV11҉Y^0hy#Su_Zu.jV11҉PY^L0h#Su_Zu.jV11҉Y^ 0lhs_"SYu_Zu.jV11҉ZY0-h#SuY_th#S u_Zu.jV11҉Y^~0h#St_Zu2hV11҉@Y^<f0hՁ"St_Zu2hV11҉Y^f0Wh#SDt_Zu2hV11҉Y^f0hÝ#St_Zu.hV11҉wY^uwf0hН#Ss_Zu*jV11҉;Y^u;0h۝#Ss_Zu9jV11҉Y^tWShW#f0Pa<w{tSh#;=0rSh #b]<~!jSh*#@]‰0(0]‰0(0h-#S^ZÉ;uh]#\Y[v&1V/pZߋt ujPSV uOv& 0VoYÀ;th-#SA^ZÉ;1ۉw&]0-DPt7hP11҉ZYt&hu#[^X Dž" !v&ShK#|[hz#r[1ɉ 0_ ƀ0Ft<$p&u^ \0Ì0F (0!(013FfF0Ì0F (0ta(0t613Fs0(0h0Ze[^_]UWVSP1۾v&#ZXZ]W|$wUWVSƉ׉M1EmF(1҉EUm %$QN81ۉM]mRR$hU#hWY e[^_]g_W|$wUWVSÉ֋W t>$u ~#EPV*<EZY9uc_8t/j^} tu Sh# Sh%_X뿃} tu /Ph#ؼ 벍/Ph%¼[^띋$t $PxYPkZ}tEGjPSi y hH#mXAЃu ƀt/tu1P׭$u ho": e[^_]UE0E 0]á0á0UE Puh-蘨h-j A>j7UWVS]^8ށu=0t50h "AYX= 0t"=0u50h#@1 0XZuu  ZYyW۬Ph1$@ t7=0t.j ?X=0t\P50h$#@j7e[^_]UE Puj' UE Puj UE Puh UE Pujj6UWVSx1ۉ0PhC%F^_yhT#hVue ]t Ƅ1PSZYyShc#LY[u%=`uz 9u;u0Shh0B ƃ uShs#뜍xPV|_ZyV끋%= Vh#e= u:u*ShV芋 t ÿ"Sh#0S[+SY0hVmn u|h0hUW$5XZ|듉e[^_]UEP5ZtPRPhȭ# u uh׭#hh@0<@0U$0tjXj YUSZj0h@|&jc (0jjWZ]USZj{jjWjjW~Z]UWVSÉ֋x CPww wwփt=0~j 5{X0e[^_]UWVS1=00010001 Dž,u/hݭ#h#@6[^Dž SUYu͙Åu~3hVl ǃ uVhUW$:XZAP~XEtVh#< Euu듋CuOHujsVsUYE >9 C 8H1u"Wh#h-? Dž CC jhPjV߃ Ãt'$Phzd@S; @uSb [WwHYD 0-9rDYt)PH0t4KRWQqI u <tPȉjs WBs C1ɉK C C1{;0C00XZ{ t%VwIYZuVh*#3XZ?jks Vr Gr G r GG1CG8{DžaETuDž0Eu0} u:E 5j /9YtshF#9s _Xtvhn%96M 9~=0 1ۋ9U tE 9}?Cԉ a^ EtPs sshO#F9…g=\Qs sshh#h-<ҋC'BDž 10C0 1F0H0~ + 0(P6:^t509F6냽tr0t`5!#:t#h#Ph#h-;0t/";tf3#Ps sshή#h-;͋ p Phܮ#1Y[0F1҉StPVS ssSݛ uU89;00?uǃ tuU E t$9{p1҉ e[^_]UWVS]fU ffCffBCffBfCffBs sY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssY^} GWssY^GWs$s Y^G W$CDȉGDs,s(Y^G(W,C@ȉG@s4s0YYG0W4CHȉGHsNjCSMEAE@ufFZ[tA 1h0Ee[^_]UWVSu^8C@PvYh#˷ZtWC jj0@0 RP Pk^_D0t@0Ɖ =p0|L‰ˉы Љ\1ۉЉ\P@)GWWG)GWd|LL1ɉLS C)CS Ch)Ghtp8谽1h0 e[^_]ÍL$qUWVSQQEUAQ I@QRP2$ƃ 9jj0@4 RPjjWV fh-0Hɉfi- fh-fh-fh-fh-Eh-=0tEh-]E]C WV XZ=p0t CpSt+ C(v1ҋ 0I4.xtWV(Y[11tjupE" 0fi-UJ 0@4B9s$Ujhi-QMM 0 UB fCB u0C‰UjjȼUfPjjSuu褼YZ8tuu蒼YZ8WVStWV,UMPHPH QR_EWVUU$WVDYZ8u(CWV+fXuuf@uu XZA@fAEeY[^_]aÍL$qUWVSQpQAQ A1~ ^_EC:ffӦ"f@t#Ph#蹆=x0t+=p0tC CC C u$h#8Yh#TZu1=h01_ t貺f@[^0 0jj ¡,i-ƅDžǺ Dž1XY=p0tB>BBp+BtPR|[^t00 h#qY=x0t-5(i-jjjj00 h#Zu5,i-RPjjPt0=x0tohȯ#"7b50=0 t(jj[[XA!HfAWV#100XZ=x0tj _00 tjjRPe0 0u hӯ#+5050[^f%f=@h#h# ZY50=05(i-jjjj00 xRP5,i-jjy\jj5050ƅDž9 WV@@PP WVf@50505050蹷^_8th(#1ɉ h0[ 0$0 tCjj RP6. {C9s#Qjj RP:+ N019r)#u 5050u"hI#Ah"z41h0XZ謶fH^_f@t 5050h"u6!@t%h"50505050)Z[@@fA\5050f@5050Chq#<$u th#6 =x0j @XeY[^_]aUWVS}u w wTXZCfEE9ucP0t=x0t =|0tj jjjw w'uP0jh#W  w wNYXG 09O u,i-;0tf%#f=@uӦ"Rh#w wgE)Puh#=x0us=|0tRyNj hư#XZ=x0t2hܰ#1_=x0tfE)fCe[^_]Z h#eZHt1ɉ h0x밍e[^_]UWSá0p8hSY t& 0q0RP¡0H01z 1҉Ѝe[_]Ƀ=D0tf‰Ã=D0tÃ=D0tUWRP Y_}UWVS(}M] U 0040;E] w+EU 90p8}E9|+F]!É]E !ЉEEUEU9}"=0tWN#uVu uh#550}̉Euuu u- EmEԉU؉E܉U\TtFЋ]!FEU؉E܉UFEUӋEUEU EU9ME FEU}9Ћ}=0tlSQu uh"#b  0\Tumq֋]!qISQuuh:# ZE̋UEU؋}9Ћ}};=0tSQu uhZ# 0uuhs# $럍e[^_]ÍL$qUWVSQ0QEU}9Es9= 0$0Esuuh#"{H0L00sx1uЉ}ԉ t9E}rEU9E}\1ҍMQRPuu?$ ŰEUEUċEƉE؉Uu܁Tt-s։!U!CЉEUuuuu& K` t1Ɖ׋Cu}ܡ0t`s0WVխ00@x1҃ RPuu% M])Ӊ H0L00@x1RPuu$ 0R=p0tЍeY[^_]aÍL$qUWVSQ8QEU80<0Ӄ 80<0}9u}9u9=(0,0Esuuh#y0040E؉U܋E9EEE 0@Ẹ 00\1ҍMQRPuuA" UEUEUEƉEЉUuԁTt-s։!U!CЉEUԋCx1RPuu$ K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=0u  00 00EUܣ0040Suu505\0腧=H000})E50=p019}VVdf%ZYf=u Gvdv`胳YYF`VdvlvhpYYFhVl1tttpMVYYM؉DpTtA u1M+YYM؉Auv<=80u 0(1E؉Ẻ}EċM9MSuu505X0躧rVVif%ZYf=u+=0u"}uFV c9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡0@0@0=p0@0ЍeY[^_]aUWVS u} 0M]1EuuWV  ‹Mt WVh۱#u1(0,01H0L0580=<0500=401 0=08#AH0=p0态1ǣ01ã005 0t C0 =0 0Qhs0ZYu h#te[^_]á0tUP%jZ1ɉ 010UWVS u=p0tFVFV zEU0H0AEUSQRP$  w 1҉UtE4PaX30RPuu  01{{E U 1҉CS1CC E UC SEC$EC( p01E v 9st DpTtD(D,T0Gу} w0090ub11tDXGu뺍PR:eZY=0u h'#r00d0P00e[^_]UWVu} 0RPWV 0t9xu9p tWVhF#re^_]Ã=0tQUS00\;0r 3gX50g50g100ZY]á0@ UWVS$Ɖx@t@VЉ_uDžo v vv 0p0vvxNjH0P0@t 1ɋ9}=؋ÉA빋EU RP3 É19r=@0thp0tF1ۋ9}&G q1۬YYQCG W5X0ɣ[X9}W ʉ@~; 09Ht09Xt~zG=p0t T <tYv vh]#hRRV莤t"G=p0t 1ɉ ؉L1҉G 1h0C|W5X0[X"~@)EU 9GG=p0t ȋT tdtJ1҉FVuVЉYu uXZ]gE E H1ۉh0FV RPRPhS¤Sh~#o h#蟛Xv v!ZY=p0t@V+EU FV@V z+EU oFV h#w!T0gX g؍e[^_]UWVS uE 8t18E 1ۉX0X4p0tFVFV щ} G$W(ff%f= 0fua(9=80t;9ظu!t F Fu~hu)}t@󥋅 󥋅 w0NӉWVSQ 1p0 t 0#8tU@DNL!Ή!؉HT t0@8] C t`d E x@1҉h0P @RPRPhS聡Sh~#hl h#^YHE p p^X=p00tp0PCSp05050'=D0t0PP膾[^50pf0E%Y=t =t)=@EE@E0p8 Eh@0舖`0uuà =p0VQAEЉUԋUЋEԉщSpCtZ Ef1{XEPlEUC S$C0S4C(S,0HT t1CS CSV譟C(Yu EEaf1҉SdEP:lE\CC C0HT t1;CS  ChX0 0=0tE }̈GE؋U܍eY[^_]aUWVSX0E01RPu u EEƉׁ\TtCЋU!CQC RPh@0豒5\00}=H0t =D0t =D0t50u5\0耾 ExU t U tuh#__X1EU1E9 EU EURP=Y^=p0t@ECECX@pECtECdz EEPS8XZ=p0t 0@ 0 u u袓^_}tjjjjuuuu. 0 0}ExU uEp\ơ01RPu u  E@ 0EL@h R50謯5050蕗=D0t0PPY[50a0h@0A`0XZe[^_]ÍL$qUWVSQ0AQEUA Eċ=0GPEp0E}t%f%ƋCS0}E#f%ƋCS 0}E}1҉ft1uމU!U؋U!U܉9E؉}ыu}M t 9|N}tFTFD1҉ zuRP襏}ĉ0@0 E1uȉE1Ẽ9Ή|m+u}̉EUE9ƉU|6+u}EEEUEEE9ƉM}E,E#uuh#0[EȋỦEUEE؃}t DT1҉ uRP貎à uuuu EUp0EԋKMЍEPuuWV u}}MtT 1҉  c 0q0RP,à MqEĉ0@0eY[^_]aÍL$qUWVSQH9p0E̅tGWGW EU50F0E}tE1ɉMԋGWEUEE1EԋGhE1҉UNPEU t1҉E؉Uܸ ]9ظ]|bEƅu1%0X0EU=p0t`M؃ωT@‹E؃T ؙ]UE؋U܃EUċE9EEċu]Ћu)]uċEԋ]Í E؉UM܋E9EEċu|G]؋u)]uċMЋEȋEԋ]eЉE؉UM܋E9EEċu}E,E#uuh#ZXEЋUԉE؉UEEȍp}t/B uvEE̅u"EȋTT tډ1G0X0EU=p0t# uUDXuRPpẼ uuuuL E؉U܋ p0ME̋pEPuuuu ËEUEUċMtTP :1҉ ueEƅ0@0 EUEU=p0tM̋IىTŰRE@ `uũf 0q0RPzẼ 1Mu h߳#V0@0EU=p0tGWEUuGWGW ESGheY[^_]aUPh#h-jUWVSSƉ׉uEPQ(eU 9t:tWVh#j7[e[^_]UWVS É5x0PUXZ=0t=x0t h#VXVScc^_t u=x0u1h#YV[P0=x0u60Phȴ#GV7UZYt hߴ#2VXh#'VX=0t8=x0t h#UX=|0t h7#UXhZ#U_=x0u h~#U^v(=x0u h#U[0=x0u h#UYe7=x0u h#UZ9=0t=x0u h#`UXQR0 $( @8 $(RP50505 050h#T0@Di($ʉ1WVRPI jj RP RPk(dd$WVRP RP ($h>#W@=00 0+ 0$0 00 0 50NF)ڋ~,f,00Ӌ~4DӋF8׉֋ $(+ 0040 00 t/SQh#] RPht#L =09z=0t4h#'0XtsshĶ#  j X=0t4h˶#0Xtssh# j X1=0=0=0=`0tm0jK]04h 5050蛣5050脋=D0t0PP[^50U0Y=T0t1҉h0jX1ۡ00;Z,sDtPXFXCPNF10X=P0t =T0th#Qh0X=`0 =x0u h/#zQ_=T0t hV#fQ^UP0PhC%Y[u70t-1҉,j,R PhC%hl%gt=x0u hv#PX e[^_]UWVS ]s{{@u(EUE9E;s WVE܃ WVhr#s sD80<0EU80<0 E9U}Xs sh#/P =x0th#F_Eh#{^u1ۉh0j jC EE}n}uPE1ɉM؋EԋU(0r800jWV tEWVhu#s s0040EU0040 E9M}s sh#j :Zu#1ɉ h0h˸#Nh#z[^px0u001҉ 0 09t9zu9rt9yu9qt0C0S4MEEe[^_]Ƀ=D0tf‰Ã=D0tÃ=D0tUWRPWY_}UWVSDRPlep0t&uff%GW$Off%GW KftGj`h0GpPup urjhP0P[p uNuJG G@j0h0G(P.p u+j h0GXPp u uhtkh߸#Lh #xHu=*^_=p0t 0@ 0 R1ۉh0 (0,0 0t04A09؉rEA09؉r#f@u;9ظ=0 h#)=x0fh#owYHu|XZ=p00@4t GWGW f0H0ASQRP y%=0 RPh#O p0f`t f uf=0:9h0G(RKd1RPS5\0xt h6#H=0t1ShJ#PG(PȚ=p0t 1GG1Gh/0(p0x_ș9rL=80t;9ظs)(t G Gtht)t 9ظ Dž1~V@tʋ롋 p0 9ظC tNDp Dttރ=0u0D(PShq#jj|(볋DpTtRPSh#55 0119Ћ}{AtRPq C뷋ORPhֹ# t uC~8|X=0euDXPh#@^_AWpq[20 0GfBf[j 1Yu01ɉ h0h#Eh#q[Zu-jjJPH00f@u> ЃW0  B=p0=0tzGf@t`r@GpufGGhtGtSfGyXZ G=f@u1004080<0FV =p0tGFDG FHGXGpFDGtFHGd F@VW[X=p0=l0t =0G\uG`Wd uGhWl tlh #Ch(#ou 1ɉ h021G\G`GdGhGl f!0XZ=l0ub0X4 ؙN0ʋF4f0F0V4=p0LGWF 0W\tF@I0D11 0 G\<#8ts@DYL!É!ÉIT tA8F D`Td uDžFVVV[tbGhd19u 9RPhP#mA=x0t h#Yh#7mZ_XF0=p0tV4CSCh~@jjv4v0vHvD wh#@h #lH ZY=p0t 0@ 0 4e[^_]UWVS0E1ۋ 0;Y,EUu\TtA!A1EUAEUEU11tAu}׋E9ƉU}=E1EEU(0CBHLY4DEUE9ƉU}:E1EEU(0븍U1E; 1ɉ 0 0 0 0M0];X,}|1Eu| 0EXZ\Tu]e.Qҋ}!Q1E]]UuI SQh@0p5\00}=H0t =D0t =D0t50u5\0P =p0tE@x 01҉EU=0t60p,kEd1<SVuPh#h-610=x0=|0ExU t1U u E#uhѺ#=_XExU uۋ}G\M]ȋ} }tyt<҉UEyEE0ËEsM]1EUH뫋u!Ƌ}! uEU9]u9MuډM]EE0ËE} u 1s<}%?}u}9t uuu)(xYuuh#;j1xM󪋅xC|UEUpt|}9r WV/XZ Mt9uɋp9u|]5(0=,0|U(0,00M]11 19E}eu509|]s1-h1l|]+hlȉ uv^/0]1t_}}9u}9to<%?u9tSQh#:j:M]Wx+Y[M]u Wuh$#9MEsE)lj1VEi1@0e[^_]UWVSEP@EUE@ E}juu# t@0t`}9xuPu9puHEuuhu#Ep p{ @0qyEpxu}qy @090u 0u덋=@098tEUMK؍e[^_]UWVSTU1EE 0@0111E0x,9}=0t2kEd1E7uWuPhQ#h-1=01ɉM0M;9ظVSXZts]uD0=p0tGuEG.GptEGtEGEGtEVSlZY8tEPWZYuEHEe[^_]UEU @,+B,]Ƀ=D0tf‰Ã=D0tÃ=D0tUWRPrY_}UWVS EX8=p0t 1Q=0tt1; 0$0slj}1RPk@C^_DžE@4} G0.3ChH%PZY'Mqy u9tXY_8u6950|_ssدFXZC SCS u950|)js s]Ahy#,#h#%O 3ss訦1ƅs{Džq ^_=p0tBBBpBtVR`ZYu h#["_PsstQDž: ss輥VPtVf@Y[5050~VfHXZ:e[^_]UWVS(EP@EU0E0RVuuj EEmƉׁ\TtCЋU!CQC RPh@0S5\00}=H0t =D0t =D0t50u5\0 ExU t U tuhȾ# XZ1ɉME@ Eܾ}juu |EE1E؋UԋMUM(0EMB0Åt4}9{u}9{tPHSK0PX#E}tlExU t}G`ǡ0RPuu> ӉE1EЋE̋Uǃ00Ex@t+jj0@4 ؙRPEpHpDp pa 0Ez89x t0}t*E@$ EL@ EUMM}ttto0E{89x u^E@EL@jRPEpp K` tPuSYdh 5050o5050W=D0t0PP-zXZ50"0h@0zR`0e[^_]Ã=D0tUWVS\U1E9 1u0X,9] =0t/kEd1VSuPh#h-胱1ۉ00u1EE1ɉM0MU;9WVWVQEu} p0tCECECXCpECtECd EEP$D}&EXftbWVYZt=0WVh#!WV^YZt!=0WVh=#Ĭ SEP襛XZ0Ѕ9xu39pu.JZHX0Rjh#EPLjh#$tC CC Cu jhe#jhq#EP躴`WVPhy#E?Ee[^_]UWVS00|jj'P1󪋅h_X=0xX$=x0uh#*G^uh#)[=x0t؋1ɉ$0h 5050Bl5050+T=D0t0PPvXZ50t0XHXI$~6#9)#~$tl<hNjH`ltW,Ћ9G0sVhο#$^_n=x0tVh#Y[h#EZC=x0uՋB,t|Fl$1~H`F|@ltË#XLS50 |^_u h#|00h 5050i5050Q=D0t0PP/tY[500Zp0tt DžPLDžHLPP1󪋅lPP TCHX$~@=80u\t`H`CXDžU X)Xtu{xlLtuQ+HhVHXDžU 1DžPDžhDž\TPh)#1hDž\L1 0׍G@tutL9t G@L9uՍ1󫋅<8tx@8txؙ!lj!׻9tx}^x`1d`dtx(0ttx1tX,9t=0t4ktd1=VStPhL#h-10tl1p𙋝ttƉߋ\Tt#@`Ћt!؋C1Q@ RPh@0F5\0|=H0t =D0t #=D0t50|5\0r =0u-|xU tU ttht#[^=H0th@0(H`0Y=0t =0uH0 0 0 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP505X0kC 0𙋽l׋pЉ`Ɖ׋`ǁ\TtAЋt!A1qhARPh0E=0tth#XZX0ph5050c =D0t5050*n_X0\8 uǀ\T5050KY^=0th#PE_Zu)5050CY^u9l0u 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP505X0Aj50HXZΉlߋpËlቅlpplp8T<DT9ƉD} TDp0Tl)Ƌ|@`ui@,L`tLH9t||`t||`tLH9tușD1ff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU u H1׋h󪍕U u P1׋Xu"xLu DžU t11ۋ;WVBZY< <<tt<<tM U u P`ك⋍`9s WVPh# CVtuPU u PU u P1ɉ`T9lpD(08lp1ۉL1[8L9˃<1҉@<@8 rRځU uT ڋ`Lى4ً4 @LC99hHd`1HU u HU t PLP1~\Hd`11ы1Ƌ1f$H```ktgU u Tjj(R``)ٺ!PMH8șlp`3$\`x`11;dsV`!։lt @lt$9~؃҃u`GCl뢅t$9~ș`l tLjS P2, =0`t'W3VslsQs th#(h:#PX<ZYtej PSYh 5050Y5050A =D0t0PP-d_X50 0^1ۉh0=0tP|x\|P4+ uT|PTxU u |PTHU u HhRP* h^#\P@;ZYtw\S|X HU uHڋ|xU tT |GThRPXh@0c;`01h0=|0u)|xU |P\1ۋ9PU u P|U u |W\ !8uC<1ɉt[|xU t |B\u0tȉlPhv#,YXlAu1ۋ|@H9=U t | |G`U u T !8uC<1ɉt[|xU t |B\u0tȉlPh#OXZlAu농U u PXRP4( txh#P8Y[taU u P|xU t |G\XRPUh@08`0t j SV'  =0ts h#Dh:#Pu7_Zts󥋅ƀƀh 5050T5050<=D0t0PP<_Y[50&0Z1h0e[^_]UVS1;] s8Sh%b^X1E0Ph#JFZYuj YXÍe[^]á0!UVS1ۍsrT =x0t40i-hO#ޒYX" #t7#P.Zty=x0uɡ0t4象01ɉ Lh P50S5050;=D0t0PP]XZ500X15h0Kt00=x0t hg# [h#-Yti=x0uۡ0 h P50R5050:=D0t0PP:]XZ50$0X1h0jWjWYXuj]Zuj]Xe[^]UE0E 0]á0á0UE Puh-Wh-j j腇UWVS]­8ށu=0t50h "АYX=`0t"=0u50h#謐1`0XZuu ZYyWPh1$聐 t7=0t.j 苏X=0t«P50h$#Jjņe[^_]UE Puj' UE Puj UE Puh UE Pujj`UWVSx1ۉ0PhC%"^_yhT#hVu輵 ]t Ƅ1PS!ZYyShc#LY[u%=`uz 9u;u0Shh0ƃ uShs#뜍xPV;!_ZyV끋%= Vh#e= u:u*ShVI t ÿ"Sh#0S [+S Y0hV, u|h0hUW$5XZ|듉e[^_]UEP/ZtPRPhȭ# u uh׭#hh0訌0Ud0tjXj PUS蘪j0h`}&jDz h0jj譧p]US]jKjj胧jjz=]Åt3USӃ=x0tPh "CYXSh#XZ]USu=T=Tu =Tt=Tt=8 uIL0t=u 1111D0<0 @0H01<=T=Tu = 8u1ہ=L0묃[]UEl0 0t,\Tu ǀ\8 Tu ǀ\ 8=0t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXCLj PU P&L$shU RS e[^_]UWVS]U CBC B 󥋃CXBXC"Zu"hA#'[=D0t h`#)Y=H0t0PPQXZh 5050LG =D0t5050QY[0\8 ul0ǃ\T1\Tp0uSChEZw#= V 0΋0ѡ0ƉϋKdC40RPWV 000 =0TC,HEƉ׋Eǁ\TtC!C1uCRPh0'=0=H0t0PP^PY[0ph5050E =D0t5050&PXZ 0\8 u ǁ\T50Q50u tc=0u#EKh#3=00shX9s΋9tRP+0Ph#h050*H0 0[^ 0t[h 5050D5050,=D0t0PP#OZY50 00Xe0e[^_]UWVS]u e0X0d0xPSgY_yݟ0PSh.#f=t0t(jS{ \0_ZyT謟0PShA#5%= tSh]"wh#p u1蕂=0t X0=x0t"hT#/_jS X0ZYyShd#G1ɉ `0x0 `0u Shv#%XZ1`0000001000010h h0h hmǣ0h hW0h h=0  ʅ ʅˆt h}#VSY_¡t0t"ujV衧 _ZyVhd|#^\0=t0u%RRjPVM8@t00t:0 x0 t0PDPj5\0S7@u Sh#Y^Tu Sh#hl%tV_Zt%h#VZYtVSh# `LuSh#C\uSh&#+50V4uShR#uShy#f^_uSh#܍X1‰11p~u 1ۉ0}Tu%HSQRP蒞 DžTӃ~ ƅtBtѥPD1D1É1P1RPWV OډSWRP؝ h#Z1ۅ~;srPƉρ}Tt!1׋ t101t ;r5Ch#h #h)#hB#hg#h#h#}}50h#@^_=KÅt0\Tu [t1ۡ0!`0=x0tth#[u h#YY0 h P50=5050%=D0t0PP-HXZ500_1ۃ=0t0Ph.#Y|Y^0=H0uNtJt2=`0)#=x0tR6$Ph:#XZ=x0u h_#X08<0040C, 01=$0C0k NKt鉅 ׉ ЉNj׉   =p0=00=0x=x0t h#^h#[01҉XǀP1ɉh P50;5050#=D0t0PPE^_500[=p05=x0t h#Yh#ZX0PP #0ǂL1XǂP1\h0RC h 5050:5050"$=D0t0PPD[^500Y0 tyPh#h # Hu^0  h P50$:5050 "=D0t0PPlDXZ50V0_0vuh2#ghW#`[^Hu\01ɉh P5095050!=D0t0PPCXZ500X0@_X50?00^0(=p0tx<Php#JY[=p0ăx0(=x0uh9#ZHuqh#7_=x0th 5050;35050$=D0t0PP=[^50m00Y 08<qH։9u9RPh#q0BHЉ8< =x0uh9#. ZHuqh#^X=x0th 5050b25050K=D0t0PP<_X5000^ 0@DqL։9u9RPh#0BLЉ@D =x0uh9#U [Huqh#腒Y=x0th 505015050r=D0t0PP;XZ5000_0=p00PH҉8<PL҉@D1500=00=0?,=x0t h#i[h#I Y00ǀ, 04ǀ(<PH҉8<PL҉@Dh P50405050=D0t0PP|:XZ50f00X=p0OL9=x0t h#lXhH#L _00ǃLǃPǃT\ǃX`B,F$1҅~K`F@#CLh S50.5050=D0t0PP&9[^5000Y =0tv0=0uhh P50o.5050X=D0t0PP8XZ0ph5050+.h05X0 50Sh‰L^_u Shm#1׉1ɉ509)~09~NjLWF8HLNd t1RPS5\0 t>t Dž)h#h#^Zu1ۉh0job=H0tHWSS6 0WA8HLId t1RPS5X0 =D0t WSS6 0@0 004011Sh£(0XYu Sh#1׉^,jS0_ZuSh#}=0 0$0 ȉڃ9 sA0001ɉ 0 0jPSã0j50?0…ˆt0Ph#"Sh0_Zu!Sh#[^1h0jZ7&0 |0=t0u*t!h#PxZYu 80 0>hSP505\0ƃ 0 000=LBALt[=80hF#h9#Y_jjjjjS6:=0fGW69fG 0CJtejPhe#k =x0uh#BZu9h#qX=x0tC=0fGW8fG 0_fCff=v]h#Y=x0uh#Zu8h#X=x0tfC=0fGWZ8fG 0_fCffuih#Y=x0uh9#lZuDh#蛉_=x0tjjjjjS8=0fGW7fG 0f{f9}zD3<:uƃu}EEUEURP50u uE 09u0E ;}|v0EUtJ9tFRPؙUEЉEe]EUSQRP RPhj#`RPhĶ#` Fyj _Xe[^_]UWVS}u EUEUEE0ؙMʋEeEUMuuuVW 9Eu`0UM"whx#d_X19]~KؙEURP50VW詊 09tؙEURPhĶ#_ 0E e[^_]^e[^_]UWVSQƉӋJt,B=0#9u5!#s sRh#C 1҉Sss ssV01E1ۋ09)؋r09~ƋL߃=D0t VWWj) 0VEA8HLId t1RPW5X0=D0t VWW) 0X0Ede[^_]UEU z t]]UWVS]0Hdu } t1 09{ u9st7S5X0$0uWVs5\0Cs{ ECe[^_]UVS0500t+NdEU  t19S u9CtCt[0uh#uu uS$SPC00X0K؍e[^]UWVLU1u} uĉ}ȋEER艪Xe^_]US]U tuwtttoPh#9{@uRs s8 RhUW$XZ=x0th#4~Yh#Zu 1]UWVE500x=D0t50p50 * e^_]0ÍL$qUWVSQQ9 0 $0s RPh#H50 01ۍ}WSQRPs U Ƹ8i-;sAeY[^_]aUWVS\]u EUEUEUEU uEU3E3U u uE C%)uu1_Z=00u <vuE "]e[^_]00U1EEƃE9Eu E9EEUEUEUEUEUEUEUEq ]uuMURPZSf)lj$SW+wG/ 9raEUEUE Et@EUEUEǺ E"RPMURPcZC1ɉ 001҉00100E EtF?N)Eu ]e[^_]UWVS]\TUH} FE 8uh`} XE u h?#h`SP =0t hf#z_L=H01@J =D0uE PP1$Y^E \=D0uPP#XZ1fEfffE@9uރ=D0tE PP#_XE \Ǎ=D0tE PPy#Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\P9 UWVS}u=01h0X0y \0h0P^_=e0=0=x0t h#v[h#VY=x0u׋0 0=p0ux șRQt 00h S50J050S2=D0t SS XZ5000X0Xh05X050h@05X05\001t-0t%FS5X0{sиSʸϡ09t )Ph##1=0=0=h00=x0t h#^h #[u 1ɉ h0=h00ƀ1҉PTXh P50050S=D0t SS(^_5000X0r[=x0u h"#\uY=0tshH#Hul0h 5050L050S4=D0t SSXZ5000X0_=0tqha#t15l0h 5050050S=D0t SSY[5000X0hZ=0t"$0 0kdPQSh{#5R/5\0y XX0Ee[^_]yy e[^_]ÍL$qUWVSQ(E11҃}50~8]9 0040)ӉMЉ]ԡ(0E1҉])؉EȉE9‰؋]1EEЉEEM]KE9t*EȉEËE]̃rAMEEE؉U܁\TtFЋ}!FEU܋0QF EURPh@05\00=H0t =D0t =D0t50S5\0 {U tU tuhȾ#XZ=0EUؿEЋEU (0{U tEC`؋Uu؍  0EU9Uuu50=00MLU9P8u+KIjH`URSPU)S$) )Q h 5050050So=D0t SS^_500h@0 `0EY[E]9]yV11ҍeY[^_]aUWVSu 0!Ut 9rt8R}t-j腪Xu h#s1rBЍe[^_]USM 0#AUY9u ЋR9uX[]USEU 01!t4^Fu(9u 9t331 É[]UWVSu} ]9WV+ZYWVqZY0,0t9ZtjSP,0 ,0M]XM ]$HX (0t}9xtju50e(0 (0UMHU M$PH e[^_]ÅtUWVS E uV8 ~&<}EEH89~kًEuC&E4`&ߋE9x8|EU!9u(EU|EUqU߉eMMG빃 [^_]US] EUR`t(t7uS /u<<+  !8]Rh}&h#UU ME@`t+tDuTɃu:< %ЃPh}&h#oUSE MUR`t't6u?Ƀu)3  Rh}&h#]USE MUR`t't2uAɃ)u+5 Rh}&h#舺]UWVSu E$ %EFlU(EFhUEEM}}~ ExE$E8NpU9r UùupE9} Etуu EFB܉)EX؋})EyEؙ}ǍW?ك9M}tu :JI)ˍD}9~} UEU~E U+EU~E U+EUE$E~CUuI[^_]UWVSu]tVֽ _uVh"j葼 `1ɉPhd@u « tGRhedAu H @u!d8tuh؅"rXZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h$r" ƹ ߋSh"V蠮 CPhC"V蒰 C Ph"V耰 CPh"Vq CPh'"Vb CC,$C,Ph:"VJ C0PhO"V; tPQK X}!uhzd@u F @RhedAu F @uuh^"jۺ 41}󫍅Pu^_@4ȋ9i9t(Ћ}1ۉ1E1ɉ [Eƀ*Ppj PEP1e[^_]UWVS4}jhPjW萍tGjPjVWVl u$U ʋMQ؍e[^_]UWVSu] 1PVZY1ɉ%= j/V_ZxrPRV)Ph#h0WBCjP赗 ‹ 19}e WPDSZY u$PVyZYyA =@uu`uÉ1ɉ PS [Xuk%=@u/h#h0V;BV菑ÉD= ji XZy.hh i à 1҉PS;ZYt-Sbj Y 1ۉ 9u 9t0P9_Zq8T8PRPS_6 s>PhFSdB yL_8Si Y h#j$W@jjWh Ãy}tWRMZt8PhF|@SA y&hF SA^_PtPY}}Wt9P̥MXZtP譥Xiutߋu0Pz_t PmYtZxS^h 룅t͎X؍e[^_]Ƀ=D0tf‰Ã=D0tÍL$qUWVSQ0EЋAEqy AEĠ0Eס0X0]؉E܍EPuuWVX UMUȉM̉E9މEsMp1Mȋ])jj`SQ/[ ǡ40U4ڃr h#迯_W!ʈEċxlEHX0!9tPRPh #u40u< =x0t h#a^h9#2[u 1ɉ h01!EPT@P}ЉWE1҉PPPTeY[^_]aÃ=D0tUWRP'Y_}UWVS EԉUMQƉ׋] 0H0ș9Ή}EE5EPWVuP0;B0u Exth.#tX0@0RPWV\ UBEuWVPuU tUB EPE܉UM9E9u9t/MC E܋UM9Mt}u ƉaE9t }tcM܋EPEEPT@PƉ׋]E9u1 ce[^_]UWVS,E @XEȍ]ܹ1juȋEp ޅtPEp[_E P@#EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0hE#ˬ,=x0t h#^Yh9#Zu 1h01)V] CSFV sC8S<e[^_]UWVSPhjjFƉRP/ÃfC9EPjjSN0;B0u UztWV2K_X5D0u  0QrRP3 E@ `0M ȐȔh P50$5050[^=D0t0PPEZY50/0Xe[^_]UWVSE XChSlEEUE EE=p0tP@P @ƉuOEXuh#1҉h0YX5D00@0RPWVqS E@ `ChSlEUE Eu h#蛩0H0ș9M}sE E>EPuuunL0;B0u Exth#PX0@0RPuuJT UBEPT@PChSls}EgUBXEU}GWEU G8W<50#uTGPWTEUTE@ U B 9t`1e[^_]UWVS8]tE"# Ey$#00}}{rT 9RPYXJ0ws$Ā&1҉Ut4Vh#=x0h#ZXt4Vh#賨=x0Fh#ZYRt4h.#kj!/t4+XZf%f=tC0ڔڐVPh^#5=x0h#HZXEPjjQJ=0;G0u Ext+Crt4ljE G0E1ɉ ‰L_XP=D0%JXF^9t(ߔߐVh#蒧E`QB9uР08BufJEf9uwh #@_uS h #/Yu(h #Zu1h0}t0ؔؐ,F_X01ɉؐؔ0{rT uDVh#ʦXZ=x0t hȯ#X^h#YsS50,XZ0t4*EEPjjujH0Z09u Extuh#1j,@E܋E=p0tP@P @u4puSQRP=Q EPƣ40X1}9}~h0X01uE)ù`1j@@PЕ_X1U9} MȉыU @ۍzEE܍Hhhs EPUEk[^1E9E~+u܍Lphs EPUE#G^EOScSZYE؉E 9}EWĉXEEԍe[^_]UWVS]KE{,uh;#h&hF h#;hEY11S04tAFVEUEPMU'Zuv vu uuAu6G9{4sEu Ee[^_]UWVS}]O,uh;#h&h` ؙt,h^#h&ha h#:U Mgu)u؍e[^_]UWVS}]O,uh;#h܀&hq ؙt7h^#h܀&hs h#\:UMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}90t5X0WVSht#Y#SWVu5X0R1e[^_]UWVS] u}90t5\0WVSh##SWVu5\01e[^_]US=0t h#趒?j5<0}[Zt!h #聒h#zZYuj'5<0sX1ۡ<09XL~$90t@Pp0h*#o" Cҋ]á<0t%Ux,tP%Y5<01<0ZË<01t z,tUu uuuRUWVu} WVWZY=p0t@X@d=D0t1s#0f`u331 ‰Ѝe^_]UWVS0tH 80 800!`t'RhW#h# "jatuhlpx1Rh#h#躼 thr#輐0 ǀdƀah P505050=D0t0PP$^_500[1111 0!PRWVjh<0h#h#ZYhr#0 ǀdh P505050=D0t0PP\_X50F^01ۡ0dJatP Ph#h# h#01ۉdƀah P50=5050&=D0t0PPZY50oX0 Rh#g؍e[^_]Ujh0&P裱 UWVS] 1LPTX\`DH0&d󥍵dh#uS} < @VhUW$htQDhdv$v tQhU#W>,jVjhdv$v W 6lQPl/SlX1e[^_]UWVS ƉUMjQRPtuh#V_XfUt+tuuh#VSol^111 tuB t@uمtr} }uWuRJtjjh#V~jjh#VjSjjjjjV pfuuh#V~uuh#VjSjjjuuV,E E܋E E EWOM1ۉ]G uuuh#V ~#1ۉESPuuRRh#V EԊWуt=t8juj1RPEUEURPVi u[]PB2EUE UM ]}uSQuщ‰ @tE9 SmjX렍e[^_]UWVSu} hjeY[u)Vh$#]XZÉEEU(,E$E U$0418%jhSPVMuhVS膆h9#Sb<RPZY@uhE#B$D%=u?$Phd@ @uhQ#S&^_$uhh#M, ((Phd@ @uh#뭋, (h#S딋Eu ǃ$$, (uO1҉MRQWVH"  ‹MtQh#SV  (,u(,EU싋$1҉MRQuuL# Ɖ׸9ЋM|RVh#StRVQuuh#SWVS @tEjjEP11ɉ @t_jjjSEtHt*jSZYt`@ P$@ t^9sVu jRPS@u7tP0* Xh#SSg 1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@l @u%h,#SXZuShK#S E]) ]US]jSYZuh#jS YZuh#SXZ11;FN|#~$u~,u;FF |F1҅8tZu"[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu+_ZNjF,uVЉ||t2@|jmURj$O8QJUR|PV tijWRT uYjuWUu!@uuZYjuPUu@v0sh#us[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h#S 1e[^_]ÍL$qUWVSQ qyAQEUy uh#S{ZY8$E܉E1EuuWVN  tuWVh#SBHEPuuuu  Ɖ׋EU tuuuh#뷋]9ً]}eY[^_]aUWVSu 1ۉ^h·%5Lp71 _X1td1SщU@&MR YZMtUBuSh'#u} D&H&  Vh·%jj1 XZ똉e[^_]US1L&@&uhC#`u܋]UWVS ]} Wh5!#S| 1D&H&E؋E!ЋM#M t:5!#;tf3#UWPS|W@&S|UҋE!U!E`uE Et;uuhQ#juV5!#;tf3#WPS6|WVS.|؍e[^_]UWVS]} tEU E U uhX#S_X S^u E@P;E sPu hg#S؋E pVSZYEtu h#S 먋EЉE܋EЉE؋E#G0EE#G4EEU E UG0W4S(_@fVSZYM#H0MM#H4Mu} u }p0x4S^@+u h#Sn Ee[^_]USP] ;u:j EP5Lp7 U:u1҅u5Lp7hO"u Ћ]UEUitstau+u PJ uPZYUg@Rh#P UE ft*u 5Lp74ZYt5Lp7h#uA US] ;u#5Lp7DY1҅uh#u%XZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h#PY[E1eRP6 $RPn[ZR@8Zfu%S5Lp73ZYQh*#P\ ֋]UWVSu }jj h5!#WVj]S yEWVuhC#}t Sh1$ZYj Xe[^_]UWVSQ]M tu ET"EF"QhK#S'M $jFVXZM uWhf#S 9jVQjjuuS U 1ɅuWh#SKVUZ‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjSA_Zth#2jS,Y^ujjjjSbEUE Eu h#SXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSZxt h#PP @9E}}EU u h #'EUjjjS@ $ufTY_u h##jPjuujjS9 uVXhH#SZ p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS1_Z@)QFHVL}$E$9EsE܉FPFTy 1;VPsUWS1ZY@UB߃}uujSu@jp juuuuS u hh#a @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9P-tE &1҉Ue[^],(h#)$h#$1RP,( RPh# h#jSm uh#XrX CRPh#s,s(h#s4s0h#$C8Ph#hxVi-Vh.#esPh@#X 1e[^]UU E$E8E U]UWVSVEUFV E܉UEUEUEUE9E EM|vuah#WE UEUEԉU؋E9EEM}6u&uuuu uuuuh#W(1FM]3M 3] t?uuuE Uà h#WEXZ맋M܋]3M3] ut.u}t#uuuuu hj#WEFE F E$F$ku}tR#}w+M &#}w M &#w &RQh#Wx1ɉNE C E$C$E;Eu6E;E u.FCstX^EUEUV#E9Eu2E9Eu*FCstX^E܋U+EUFV vE U+EURPEU }PH SK UMUMUMNU܋M+UMVN VPC^sXPtB؍e[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuu  t/E؋UWVRPR щΉE؉UMWVuu  t/EUWVRP щΉEUMEEċE܋] ؉EE] ؉E}EăxfPEЉUԸ]9ظ]A}tE9E؋E8E؋U^9uEE؋U܉EU}TWVuu EUE Et6EЋUEȉUWVRP Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}tE9EȋE̋]9uȋE|E] u?9}EEPWVuu5 ÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@Eu1EċEčeY[^_]aÍL$qUWVSQ ȋ]yIX P@EUw Uyh# %uh#urXZ~th#O_ ȉFV E؉U܋E Eu.E؋U܉GW FGFtxM؋]\MЉ]uuuu M؋])ӉM]MЋ]9]u 9M9ME}uuSQh#uEUGW )ډVFV )ډFV uFGFtxM]SQM؉]uu@  ‹M؋]t&M]uuSQM] M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U M]uh#u+GxpF)^N^ 9MEu h-#~t hQ#FV E؉U܉ȉ+EUEUE9E؋E܋U} h|#E؋U+EUEUFV ȉ+GW VE Eu FGtxM]dM]O_ ˉȉڍeY[^_]aUU Et 9Pt@]UE]UEt ‹@u]UWVSEtf1yAQ $T$D$T$ D$9E E\$ |I11҃yuEԍe[^_]UWVS@]u }(,EUEh#WV6 t(qtsu&jsEPjjS@uvE95P-th&j[^uujjjSlEЉUԃ}u}t.EЋUԃEUE Euuuh#SE$1RP,( Ɖ׃u؉}܋}9ЋU}uuuuh#SjSEZYtE̋EЋ@E Et h#fEЋ@ EjS^_u h#?jSzZYu h,#!x G EG$EjSG jS9 tu hN#S^XPH UMċM9Mu"M9Mu}u he#SY[1p GPGT<9s/jh0&V'h tV(F,9ŰM}ỦEȃ͋u}+u}9űE|uuh#4E؋U+EU9E̋M| h#U9UEUиM}9|E 9ȋU|&}tE؋U܉EUh#SXZE9E؋E܋M u}uU4}u h #SYX UMH0xh#S{XZ1}9}[uujSD@1jp juuEU+EURPS uh&#S @ r $󤋃p PF V$1FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@.Eu}U؋EhG#S_X}ffuS7Y^@,he#À}|h#SXZje[^_]UWVS]1uuuuu11h#uu 1 btENtoat%itClhN%Y1EPS &EPSEPSZY@kq`1;EE}=S0UU܋UUZt&xuPtM9Hu M9uU@օtE 9P-uEU t th&jZYWVRPuSe[^_]UWVS EЋu} jj h5!#RPj]S yEWVuh#}t Sh1$ZYj Xe[^_]UWVStƉPZt 9St[Rh#V *{ Rh#2$1s3щ¸#$1s sщ¸#WhUW$hV (Wh#htS SVuhh%VP SVh#GPh#hS Sh[#~$jmSj$G8P7Sh#\h#RG0W4 uh#AX1RPhP?P#ލe[^_]Ë -Q-y ;-| tx-J x-Uhx-PXZUWVS֋U} $,&E*#` u>h#{X ׋󫋃V6h1#=XE#e[^_])hA#X8Sh#htS Sh;#shP#E_#Em#뚋A t h1#Xh{#C SX1ۉ019u 9tCuE#! #t5!#PPh%( h#_tjmWj$8Sɽ1tttSh#Sh#hWWh<#ZY?h#Xu+u"E #VE E#e[^_]ue[^_]UWVSxhw% h#Dh#x h#)h#'xà Džp#Džp#s3x ps sx p Ct Ph#K Cs31 W{ WhUW$hPD Wh#htV*VPuhh%PCL Ph#XZ{ h0h#hVVh #Vh:# he#jj h5!#x$K x$cRPjV x$K x$cRPhZE"= "jmVj$G8PVh#h#G0W4 uWh#X[tVh #GPh#hVVhUW$ZYgRPhPPh$"yK Cs31 OC tYC 8P)s t󫋆Rh#hVVh:#1e[^_]UWVS}] u1EEEEh#VS>( t^l`~\a wT$P&ut:xuCMÃM뽃M뷍EPW EPW6ZY@uM딃M9P-th&j^_xjWZYu h#"X]t UI;]E}1WUM^t xupt9Hu 9uu@܋Ut4hw% h#h# h#h#W+ƃ E#EE#v6 uFv v u2  FtMPh# XZ N Fv6U vXZp h&"Y볉؍e[^_]UWVSD] 1}0&}E8#uhE#uu % tditHTt*PLt7olt Pwb&hN%Y1tukVS_Z@ut6PEPSB @u#tjh0&VX t E 9P-th&jZYVh EPS&e[^_]UWVu }^_]UWVS]u 1ɉMMMMMh#uV$ tfitLat%bt0lhN%/Y1txEPS~thEPStXEPS"_Z@uG1;EE}1SM}Zt xuPt9xu 9uU@܅t95P-th&jeZYuujjuSe[^_]USЋQfPfQfPQPQ P 1Ҋ\ \ Bu[]USÉIQHQH QH QH QH QH QHQHQHQ0h#RS]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk&WV uu wuD uRCu1jSk&VmV u%u vuD uًU EGue[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh#Wm 4 uEyƒtsVZYu+C xu"mt s sFYXj ZuXe[^_]UWVSE @80ƅ77Ph"u7 t 7ueCu X0u: ^t h#0p jVhp(H7 Ttg81ƅ9h(@󥍅8Ph#jPS0Ph#jPuV~ VSh#j  S[t h$j  T˅t_S zuR(,Ws胲ZY,u1(zu%B sVȬZYu+C xu"t s s>YXj ͜Zu\Xe[^_]UWVS@J9sr[^_]UWVS]u)ZuPe8E_@u h,&h#u0^uh,&h#j| sP3Ns WsBh$uw t.P舆 Eh$C$uw E tZuf EYLEPh#u= }Chs@Pu蓜 @qh#u_w XZt V Yh#uAw XZt Qۅ XMEPh#u E Mu {hE EEEM؍CU`EPu u @Muh,&h #fEftft5fu6t2C t Wh/#j }tC(UhO#C0ut3hk#j t C0sHtS4KL9sщ}t:s@shu: us@s`u% @u;4ٷ81t/sl`}t$CU[s@s`u @uEsd6CptSuZY@u s\h#s8sXu跚 @u s\hUW$te[^_]UWVSPubs Zu1iu t _tQV֣ Yt=Wx EWu u MuS譞 V辣 [^PQSu uV裣 ZS-s X؍e[^_]UPEPhqB$uZ ƒ 1tEUWVSu\Ph'#V8 t\Mfnj4Zu\VXtd$1jRVVhiSo@tt}f1RPh'#u G 1e[^_]US]uu S? @t ]]1]UWVSu us [^u 践PN Y9Es蚵?VX Ƌ}M)1Ze[^_]UWVSu us [^u PP Y;Er3?V Ƌ}M)1Ze[^_]UEPhi"u` ƒ EuݴUWVS8uEPh#V) uhF%hP&hh#Qh#Vr _ZtPO ƹ}[E]ShiV5}ĉjSl Ph#u s ƃ Sۛ Yt=EUu؅yكۉM]! EjEP XZuVh#u r V| He[^_]UWVS1Rhiu4 @t|j7RPh#hSހ>tVh#艖Vot j7RPh#hS;tSh'#LS2\ e[^_]UWVS]h#Sq Y^tVP Zth7#h@&jVh#{V ƍUܹRhiS3@u hY#j! e[^_]UWh%1󫍅hPhiR3 t|}UWVS\Ph#u uhF%hؕ&h0h#dShiu13 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVvZtÍEPhF$V uhF%h@&hh#uS1^Xu h#j CPS2| ZYu h@&h#Ph#u o uh@&h#jn Si1e[^]UVSSu] EPSV @uh&h #j1 h#Vn ZYuh%h&hh#/#Eu$C$PRS3o He[^]UVSSu] EPSV @uh &h #j Eu h5#jy h#V.n ZYuh%h &hh#袩Ph#Sn He[^]UWVS}h#$Wm [^u謯P?| pY@vh!#VZu h6#j VPh#$W@u hO#j xtdPhiWp0 thf#뮉`SX`e[^_]UWVS}h#Wm ZYurP}{ pVYXuhs#DVSh#WE@u h#j 1҉Uu]EPhiW/ @u h#j SX1e[^_]UVSÉЉʉƃ ι#u5!#QuRPSh#fe[^]UWVSu1jS,Vhxi P<@uh# UЉUPXۋUu h#j[ U]Vhxi W @uh#ڋE9E~E1}~ WhUW$轐FXZ;u} j ̏Yj SjUVSPuVZt"ÍEPu V @u Sh#j @PɆUWVS$ƉUЉh#P k [ZtPy ƹY1@]Shvi V.j Sw Ph#uk à VL HZe[^_]UWVS0]EPh"#S uhF%h&hfh#MԋU ;@uE̋UЋM]Mĉ]ȅy+كۉM̉]Ѓ]!ىΉЋU!Љ E UȉƉ׉u}j EPw XZtVh#u j Vr He[^_]UVSuV[th$Vi ZYuh%h&hh#0P?x ^fx PS+ZYu h#j PX1e[^]US]EPh(#S u &juS,ƒ 1Buhȕ&hUW$XZ]Uh1#1US]dPh-U%S% uhF%h\&hh#Md|lPhiS+ @u hh#(X1]US]dPhX%S uhF%hP&hh#أd|lPhiS>+ @u hv#X1]U1EEpPhiu+ t hf#jB 1Uh#ug ZYuh%h0&hh#7Ph#u Eh HɃ0 v+BwBÍBwBU?]UWU1ERhiuG* @u h#j 1}W|$wUWSÉЄtGjj h5!#QPj]S. Sp z5!#t#PSh#Ƌ h"¸f3#Xe[_]g_UWVSc uh&h#j jLhr-p_Z5!#t#jmhr-pZY¸#u5!#WPSh#h-辎=ho-t VW?Xjmhr-YpZY¸#u5!#SSSSSPSh\#h-t$VQ jWUEU P]UEU P]UEU P]UEU P]UE1҉To-To-1]UE1҉\o-\o-1]UE1҉do-do-1]UE1҉lo-lo-1]UE1҉Pto-to-1]US]Shr-LoYZt ¦=CЃ v؃߃Av 蠦hr-譖Z>u胦 r-1]UE1҃t@0]UUpo-t H9t@]UWVS81ۉ]܉]E䀖500EЉ]ԍEPjOZY@MЋ]u h#EU׉uȉ}̋}50ɚ;EEtJ*EUʚ;EEt$ӃMЉ]ԉ11EȉẺEЉEԍEP_[@tEЋU ЉEh$j uGEċ@C t@PYEąt݋@EtCt}tMEU9u2U9u+9u}SEZtjEP蕮 Y[=0u4]늋U9ыUjSZjunj,~EPj[NZY@UE]9u]9u9}~ 9UȋU}h{"j UWVSÉHPZtP_D 1D1V9"LY@u h &h#&RPHSƃ uh &h#j@ R1RPh#hWWVh|#贆 jVWWhiL蝆@u Wh#t Ph#iXZjVW襽Wh~iLS@tt Ph#,Y_j DpHZ@uh &h# u =`o-j:RPh#hW7?tWhA#賅W虒| j:h#hW?tWhS#mWS| tHSW?YXjVW舼Dž@WhiL uh`#XZjS#jVTW1Džd1hlWhiLDŽ @t|hXu ht#l@1dWhiL耄 @@u h#@lh#H@R =0t%oA"w&Rh# Y_HS XZ=0u0=~0u'DjHSDP jV`VV~0-{k?PL訃@uG$=~0t#Pj h%#0%X th$f3#X thA"f3#oX th#f3#MX tRPh# h%#0j_ th$f3#^ thA"f3#Y th#f3#Zj @5Xo-X%SV65po-tjHSVv e[^_]UWVS]S^t EPu S @u Wh#j u Y SwZ YY Etuh&h$j EPEEZt h$j u1EVtRUW ZYU}tRUuZYURhqB$S tFE=0tFtj=0tFu[=0tFtL=0uE=0u+Hu)}tj Xhx-vZY U6"=0tj XS̈́ uń ujvUWVS,ÉUP(^uh#@h$S[ ZYucU̹ Rh8i(S @u踜8t h$j9 jh$u uh,&h($j Eܣ00u VhE$j e[^_]UVS։P蚧VSPhW$j UWVS]U ho$SBZ ^_uh6W%h@&h2hy$趕‹0ށ؃E u %ERUsh NjURh WP$tDPEVZYUu #9ERE ËE É0X1e[^_]UVSP]U Ch$SmY ZYu ;WPg Sg VP#Ãt7EPS50ƣ0S1Fu{#U0e[^]UVSP]U h$SX ZYuh6W%h &hhy$OP4g STg VPM#Ãt7EPS50耨ƣ0S1Fu{#U0e[^]UWVSS]U h$Sxj 4xP4Z,H%(hS$x&_1ҋ0t` &xtO(9u 09t4#HɋL f3#u5!#QPhW %vx ,딅u h%Zx^j swYjmZti 119X~M%9u>uW:Ph$x h$xh$4j wF뫃 u]e[^_]-e[^_]UWVSӉϋuuO 0O Zt2tVWP6S u3{ 1ɉ [u1V{ ZV{ / Xe[^_]UVSu]}t jf NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjP6uBpW^ Y_u ] ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URP`{Ɖ׉‰ 9иr E8tْ8"uoʒ;sC| C 9s} 詒"WV2 Y^u 菒 볋K(PUE Z@tE}G _C G1e[^_]UWSËtPy X1e[_]UWVSÉUMU1}E;E t[ztMUj8 ^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(P0XC$ue[^_]UWVS1@}u k-E@} uE@ } u"PRcO [^uPRNO ZYu덅LPhi"E 0} tu 112L 17 uuA_tHh·%HPcH,ZYu Dž,%E@0tj/S)Y_0t @0`1DžTXDž\@PTP,S!bǃu.@xuP0 ՏkTtHu@xPS諎YZHu.fDžtt0u_SXDž,uTtt,h1҃0u$SZDž,T(j DP0T,D (t8t,v ,v܎"ScX%Dž,(SJX(jDž,10dr<wWr<w7 0 u0 Ј0E޹Eވ0 A$(P_,fCNj ֋$B$@tPP\^(SW S  LEHVUE [@2Ex0$,S ZYu,Sh̢&h$j @PV+W V uh̢&h#j SEpE0J uSws h̢&h#jP S`s XE}G }xG }G1e[^_]UWVSu]}t W{Zv oW YuW #NPڋE Z@tEC sF C1e[^_]UWVSU1EX1u܉u؅Cu3}Ej1ɋUE ?E1҉Pupup Y\uu}Wu Pu4EAuq }uE$EXExtHu E؋Exu[}t1}t.E</}ue[^_]UWVSQu}uEX$Cu S{0u3PE 0G YZun?-uGPRU{YZUu{(WR{YZuA{ Cu CuHPE 0G YZtPE 0G YZu^ECwH$&P.[ -w7 w7 XZ1u(7X _uCPh.$jA ȋK 11PE 2Z@tEF EFC4FCF1蟈 Ue[^_]Ujj$ZYt$&U PUPUP UPUPUjjyZYt&U PUPUP UPUWVSu] FtVuVVPX1;}t$jXt0TQ1҉FNG1 VuVVPFXFue[^_]UVSuj(jY[t2&EC1҉SCCuu SB @u SX1C؍e[^]UVSj,jhY[tDÉآ&E CEC1҉S$C$C(uuuMU @u SX1e[^]UWVSPu]1҉U1+Ei̋M ;}|1_t79r襆GM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EVm EtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S: @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps @u܃C4uu P!Z@u1]UVS]u jZt$pSuCCC]e[^]e[^]UWVShF$uB hM$uB tÅu'j`h &hT$`F VP SP Y[@8FthZ$^F1󫍅Nv󤍝tJvr󤀽uCU9 t h$j |t uh$jPn jSf PhJiu @t1 h$Xe[^_]Uh-h$XZUWVS, =0 ƅƅF1RhKiu3 @PXujPC Y_VjWhQRP%qpujP XZpVjRhVpQP$h%Wft$,h%REtZY,t $tRVRSPh$ee[^_]UjhIiup @u h$jN 1US]Dt-9t@tu0@50. X ujjS 0 u Dt-Dt-]UWVS ]UUEt ;0uK,-f|JxuEuE} tˆUPu rIZYUtC}t:=0-‰EHffUtSUBf<fuh8$E9r^hk$ E9rhO$\X1_EtE ,-WtU0 ,-fW ƒF-C+UE9~)1E؍e[^_]UWVS]u ~;0uS,-f|PxtN=0-119} fLOu0t ,@t@ޅtt SVh|$SPhȉ"b %hz7$bY19};Ph1"bGXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9s 1LuÍKكt :M؍AMPZtfP׋Me[^_]UWVSQUU} uj[Uuh#RZu h#j jPV u} ]e[^_]aUWl$1E|Ru ul}UWVS,E u:[u h&h#j6Y@uh&h#je P֌Z@u h&h$ݍF1jR so^_C xyDž@Rhi]` @uh&h$ZYq:u]S 0PjjhVPR2u+t"%t$VPh"_ rXe[^_]UWVSu FPZuU|8+u1h%j \`%1juS蛖t \vSh iR._ @u{81t{8/th$Xpe[^_]UEU =0uRP*ZYE E$^UVS] t4sVumZYtC P;UuPVZYft1e[^]Uh-h$XZUWVSSÉ։M1S>_u}uJh$j] jh$PFl uW0-DPtVh:iSf @؍e[^_]UVS]u1ɉh@uh&h$j EPh$$S uhz)EfEVh9iSƒ 1Bu h,$j e[^]UVS ]u1ɉ@uh&h#j EPhV$S t,juVN E؀8t-EPh$$S7 uy)EfEVh9iS=ƒ 1Bu h,$j e[^]UUE9@t-EMfuu 8$tURPh?$n\ ËPt<f$Pt2k$P}$Ptq$Pt "øx$ËtI'k$t?x$t2f$}$tq$t "ø$UWVSljӉʋuFEE9s]19tc  ^w@v|UShz7$W K 1UvAE9s:2UFPh1")ȉMPM UuRWj u9utD7...}e[^_]g1e[^_]UVS ]uVhiS @u h$j5 EPh$SQ uhF%h&hh$.qE߉EVhiS uEh$XE1e[^]UWVS$]uӹ!1j EPhI%S?uh&h$j` EVhiS @u h$jj 1e[^_]UVS ]EPh$S& uhF%h&hh$NpuVhiS @uh$E؉EVhiS @u h$j 1e[^]UWVSxhSh2 $u@uht&h-$jv DžDžDžDžDžSh@$_Zu?Dž1ɉDžDžDžDžjShH$ u ؉8 0-DytRx:uL҃0jWVh·%Pt;9u8tMhQ$j2 jRVjPdƒut;t 1҉Ŕ@|Phi8uƒ 1Bu hq$j e[^_]UVS0]juVh $Sо@u hh&h$V Zu Vh$jy Uf@fEލEPhiS4 @u h$jv 1e[^]Uh-h$gXZUWVS] 1}EPh8i(S @t&E1r r%1ʹ|󫍕[!RhiS @[< v Phg $jr h $4V[P\P <fDžLVhiS @t%fNth $=0t h $UXfDžLVhiS @t%fNth $=0t h $UXfDžL VhiS @t0Nf=) Ph $[U_X=0t h $DUYfDžLIVhiS9 @t0Nf=) Ph $UXZ=0t h $TX1|󫍅|Phi8S @t}u(j S$PhiS@)_h $TEEEEĉEEEԉEEEEE|Phi8S^@uhB#CTXr}uMu u uuBEH~HE0-DJtx:t~&jPh@$ uWh $S^_Eyh@$SY111Pt՘hXZGj,RDYyh@$SXh $uSY4t8h $[SXZ h#MSXj fR_PhiS= @PhiS! @jh`&P u ftePh $R[^Vf"fP Ph $R ft Ph $RZYj QXe[^_]U81EE1҉UUUUUUUUEPhi8uF @u hq$j 1UWU1Rhiu @u h$jO 1}UVS]EPh' $Sֺ uhF%hȥ&hNh$6huVhiS @u h# $j 1e[^]UWVSÉUPhUW$jQSP^Ǹ) 6 9|jPXe[^_]UWVSƍt1fDžfDžRhiV y h $j h' 1p)֍H(@!P }_9p}p' Džp h $ha<%h $h $h $h$hx $pph# $O(G(\G!PO(!W Y@0t @0EA0tI@tc@tC@tP@ tS@@tB@yA@_GlGdw19~L9}B`fWGu uw%k pfx p@tp d#z= tt= w-g [=wOf?v'k 11?1p%1=$v-- 1p-1ƍG P@ h@0Sld`VPPpphL $NG"`G!\ƃ0`*w/wNtA2FltU0W=0FQSPhw $h} $`MQl=0=< $5 $=0$YdPhUW$MXZi"d9 ʃl5!#y$lRPh"LC·%빀=0FPFPFPh $h $LF1d^1ɉll9d&j>K[S=0FFPh $WKStRTRPh $ LRPh $L l대=0FPh $KXZlF=Ptlbh $hUW$KY[=0FPh $KFPh $uK^ fdV\D $t5X\PQhW %8K\K zm"XdˉX\lT\l` $XtWlI $PtV $Ptf$Pt"PQhW %JlX zm"렊dزT<\t=PuEFu:h $hUW$;JXZ=0%FPFPh $J t#=0l5 $h $hUW$IY[=0FPh $IXZ1D dD ҃L ll\5!#lte $dRP\Q4&h $RICuh: $hUW$5I[X=0FPh $IFPh $I^V l\lD $Xt5dlPQhW %HlK zm"dNjXfld\ Td\` $tR\I $tV $tf$t"PQhW %#H\K zm"lXkT؃dPh $GZYkl=0.N=0'$&j $} $ts $ti[x $`} $Y $R $K $D $= $6 $/ $( $! $ $ $ s $ $F)`j F)hXh'e[^_]UWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh? $ XE1e[^_]UPEPhJ $u uhF%h&hh$\ME\UPEPh $u蚪 uhF%h&hh$w\MEUVSjjj" y hS $D\1ɺxBhPSk y hm $ ZuufiuSl Xe[^]UpPhiu< ulh| $詿Xl$Eu h $j2 EE1UPEPh $u被 uhF%hԥ&hAh$<[MIE@u h $j 1UPEPhQ%uI uhF%h&h4h$ZM E@u h $j蛸 11 w-USE UUXt=EEEE1҃UjURP_ 뺋]UE Puj US]SׯPhH $j^ S_0P0~ UuUE Puj贯訯j UE Puj蒯膯 Ã=0tMUEE EjjEPEPjEPƒEBuhY $XÃUSP~k jh&ri jSJi uSh~ $6jP/jZ@uSh $j^]UWVSd@u~Q1}=0tC&;Et7EE jEPjjjV:@uuSh $O 1ۉ]]]]]E}W]Sj]VSj]Ãjh $nHZYu $ $1uuuujEPj g E!"1}jh $hv#/ EPh $ h $hb$j  j\u6h$r[jjjh jWj\jVj\_1ɉ w-jEPjh u]8tih$Z+U9uU,Rh$jWj\jVj\ q Ѓu,t$h$BjSYg = w-k = w-tjWj4\jVj*\ w-SӃ  LEEEEEPPe Xe[^_]UVS]E pt&I>v \![^]USQjj]Sjjh w-裨th "ua0Zu h 5"jӳ jjSPjh w-eu‹E0]USZPh$h-Bh-h$茨Sh$h-B j5UE E ]MUWVSE u}8@D$ 1%$1D$D$ 1 %1ۋ$T$ L$ 1 ډ9t&(  9\$ tl& P&11ҍe[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t&/ $ 9L$tl& P&11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]& $09tul& EP&11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t& $9L$tl& P&11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t&9T$l&uwy|$y|$L$ ˋL$ ˉ$4$19t&9L$t$$9T$t$ P&11 [^_]Uh=u jjh@w-u21҅tPUWVS jEP Eu_X1E9}2uSPIZYt!SPIZY tG1EEe[^_]UVSQË0tRVh$EPitV5ERqZe[^]UWVSQ1:nuzouPqX1҉Uh·%Po ZYt98nuxouSPZYu}SPZYuE1V蟝Ee[^_]UTPPPh$h-<j/UWVSÉϋu ,PQi ZYu Wh$1}uHt*hOw"VZY41yG"Uu1u4hC%,P=G^_u)w"~u M }jPI ZYt1ih$Vjh$W F uU jZP,PE t% 9|\ 뭋QRSE up0 t0u1Bh$Wj Vh$*7Et!#Etu#EtyG"Et6#%&u0P,P . ZY@tjj@o^_,t#jh$SD uh$V/Y[0>w"tSh$ShL$hV40 ,Dž@h·%,P%XZ9 PW)oXZڄtVB L<-u.1j=VY^t$S@#S4Q ,t1ɉL=t0t>}uh$4_17=x0u卅$P{ Y@uNh#aXA=x0u}t2ҋ4hn%4GXZ9j 3X=x0t=Rt t6ht"X t 赘XP記=x0tj}t0$[ j[ j(J @u h$莮_w-,W3hp)%h,R2P,RL P8tV,Rh#7 ;udP8uWVWh$jN t Ǘ[P躗Y}u, Ex](Z jj M WS$WY ~)t}u2hx-,PEXZj P$Y ~j,PTZ @uhH#%X,Ѓu ƀt&qttP萞PVho"+H}t0 p00SV) Y_@uVh$謬XZ e[^_]UWVSj Ph#$1;11to&tZ&t =t0t>&F]$tf3#QPhW %E1 !ǃ 끍W#]$tf3#WPRh6$0udtj]$tf3#PhK$0v t 0hUW$ h#0XZ=t0KtSp+F=t0u=t0KtSp]$tf3#QRPhY$M0=t0hf3#hUW$.0sds`sTsPhk$0slshs\sXh$00=t0~chSjjhOw"ju.t%j S^_tSh$/ hż%QY'"tκ#PhUW$m/XZ 5!#He[^_]US] 1t-tPu'>ZYu|01=|0]UWVSEt48nuxou |0PFX1uhǾ"hX1Y,u@B uP萊_uh 5"8S[^ljxj,SZYt X1e[^_]UIPh$h-1j$UWVS]!11tE1҉Pp7P-111ɉplh$u u{ 0r=dS6EXZEE FEe[^_]UVSSPPVu ujVShl% ,@uLEtv"t"lE0覔Zv"tv"PShw"j袜 jUVS]u VS YZu Sh`w"j衜 ;/t"Shuw"q!XZu Ew"e[^]Z!e[^]UsCPhX$h-+jwUWVS]E1ɉ#11d111lhh$u u3 HuLf$M,9tQG.C|g$@&UC| C|C|C|5Lp7 CpZDžlL5Lp7CtXDžh.5Lp7CxX5Lp7Xjuh&5Lp7Tu hv"j P-TX5Lp7ecXDždC|P-P;Ut0ttSxt SxߋM |u4^uWUEhtFlt#uuxPW!Y^@uRWh6z$j" xPWYZ@tECp'xPWYZ@tǃluECpECtuE%CxdupVV@$XZK|ǃe[^_]UWVS SVdPhWu u hWdSh#%C ,@uSVhx"j2 f@tKRPh|&hSwjSh$$0jUSP]jEPSlU :9uySu hx"jo ]US]ScZt@ h"SZY]US]ShZt@ hy$SsZY]USP]jEPSءU 9t :uy Shx"j ]UVS]u VS YZu Sh`w"j ;/t"Shuw"XZu Ew"e[^]e[^]Uh $j} U>h($h9$hV$h$h$Ph$h-& jUVSQÉj EPS U:uVSh $j e[^]UWVSuEE@t"0 1VFe[^_]P_u hǾ"j VP ZYuj]e[^_]ĆUWVSQ]E10u1w-hk$u u谁 2F$@&=(0t$0뷃=$0u(0c뛁K뒺aLp7C8K t ,0hK\cPDLp7jC@K@2K&gLp7@P s4K ILp7C(KK@KEPuh@&5Lp7Nƃu hv"j: Et ,0tctKtK@tK t=(0$0 s=$0t(0c@tKt1҉,x-sc sKsC  sC sh"VL 0Y_EthN9%VLC$KXZEth/$VLC KY_Eth5$VgLC$KXZEth>$VJLC$6 0hN$%XZjP^u1RPh\$ 0hl$Y[hz$XZ1e[^]USP]jEPSōU :9uySu hx"jȃ ]US]SSOZt@ h"SZY]US]S$TZt@ hy$SsZY]USP]jEPS1U 9t :uy Shx"j= ]UVS]u VSn YZu Sh`w"j> ;/t"Shuw"XZu Ew"e[^]e[^]UWVS]fU ffCffBCffBfCffBs s}Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss誸Y^} GWss蔸Y^GWs$s 聸Y^G W$CDȉGDs,s(fY^G(W,C@ȉG@s4s0KYYG0W4CHȉGHs$&1t<16 1Ƀ 1Ƀ 1ɅtuRh~"jx 1ɋuЋ} t1M\!8"t$M tM9uM9t Suh"맋E9ƉU}7=\0tuuWVSuh9"muuWVSuh9"?9u؋E}<=\0tuuWVSuhi",uuWVSuhi"jx e[^_]g_UVS=`0tPh$h-, h$Ph$h-h-h"lXZ=`0&ttsh#h- j=\0u UPUWV=Lx-uHH׉=0t&ɉ HffJ=Lx-u f@ffB^_]UWVSƉ˃=`0t/=X0t 1}mQD00Pu PסD0RPSu5h0. 9t 0VnPWVh"&$;j"e[^_]ÅtUWRP,Y_}Ã=X0UWVSSƉˋ D0=`0tSu 0Q S׉ș։ЉEMRPSu5d0- 9t k0mPWVhH&$j$e[^_]Ã=X02W|$wUWVS#Å=0u0BB4p00 D0 ;H0L0ؙ=0;|*90_1)։ؙ5t0pؙQ Y&JtRz!9t !9t ҋ1҉ؙ=D0Q 3Xe[^_]g_W|$wUWVS,EU؉M܋ 0A Id t15x0)X=0tx050PPV x0xU tho&$!{Xx0H xU t@\M؋]ȋM؃=0tx050PP 0A Id t15x000JH,1X9M؋}ruuh&$ 0\E1ҍMQRPuu lj֋EUEȉŰϋEЉUMԁ}Tt.CЉ‰!!SʉEUԋCx1RPuuD K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05t00_\Tt0@xRPuu Ã=0tKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu_%ClRPuu Ã=0t]Su,XZ1EtttpY_DpTtF u1EާY_Fu @ߋu8_%CP0H05t0EЋUpXe[^_]g_UWVSQEӃ=01}=Lx-tBBfCUC)f UZ[^_]USÉЃt't7uFɃu0 ='Sh&$h- ]W|$wUWVSLEUȋ 0A Id t15x0yY=0tx050PP x0xU tho&$1҉U؉U܃xh&$_1E؉E0X`u؋}܉ tu}}zU tStX~KM< Ʌ0@8EU܋x0J9M؋E܃|R`뮅tGt%b 4!Ή8뗍 ?!8u{!8hvSh&$h-j Nt% tSt1\uWEah'$Í Í ? # Sh;'$h- 0$~?x0EE1uԋEЋUEUClM x0EH00EHesE@E=Lx-nKdu؋} t1RPWV" }WTU u}WT }U P}t}}}GXE1}EEċKdu؋} t1RPWV MQuuRP EыEȉEEeƉϋMUeuuRP Eȋ}EЉEeЉƉϋRPWV }f E9C0u'=0x050PP K4EDS8)‹}W S8)‰ }W$D4Ɖu}܋x0 09A8~zU tR`˃]1ɉMM]ʋ]؍ @뛋 0A Id t15x0$XE؋U܍e[^_]g_W|$wUWVS։ˋ@1`0=Lx-t@fxfDžAxd ‰|fDž y-=Lx-t{-0@40u 1ۉ,0@DJL!ȉ!؉ pZ4JdQyt@f fDžA V ‰P(,iKL04H8)$ 0ǁ\Tǁ 1A0QtAx1AA8A$1A@AD<A4=D0A|ǁǁ1҉XǁLǁP-ǃ\Tǃ1C0StCx50~4F8H GډSWRP ӋRPSQ~ ȉN8ؙ)ˉ^ <~Ntn0؋ËቅkF0 HËË048<k9}VRPhr)${ ,00@x<8@)׋@8tD11U00ӉʋKT t1҉ u1RPWVs  uDž1WV 9؉s(WV ȋƉϹ19s11ۉB,$1~ ȋʃƉ׋˃1ɉ1׉11ۃ~hH` tσ1 1Ӌ@0)H11ҋ)׉ߋ1RPWVU 1Ɖ׋ȋʋRPWV 9sv Dž19s H11WVRP KRP ȃȻ)щWVRP F 041~ H`9))HRPSQ 1ɉ ؋Fȃ1~H`F9}Sh)$G 0C`Cx1CC8<Hщ)9~)׉8<C,B,$1Ʌ~ @SL!Љ=Lx-(C|HL!ЉjjjhjC4Pj耠£0uj'P0H41󪡐0H|000H4 ډ0)ʉ0@`#PL ~ PhHx-P<(0PX$0P\401҉PTX HfǀƀfA0%ƃC4D8<KC,ș)׋C)ȋ1)׉C8HK` tƉ׋Й)׉!lj!׉11ҋ!~ ) 1҃1)׉@D04=Lx->C s(H10t ǃ^F=P0s0Kd t1RP߭ڍ%VV$h)$A 0 ؙy8PۅI4%WW$q,h)$ 0A0= @ p0l0=`0u\Tu kУl0jjjhj5l0j0£t0up09l0uh0*$v j& l01=X0LH0L09|RPhK*$1 H0L05t0 D0H&[t?t  Lș)FOu뺸2=0t?jj50S$=D0STb D0uPؙVpjV uؙ=D0VYt00Xlj=0t PRXZ0xt0\=P0~ hc*$ XDž=P0~ 0A,XÉƉ׋ǁ\TtA!A1׋AId t1RPh#jjf-ftRhht@P DžPu ftP0=X0tu1'1=01w,10;x, hx- 01҉牅8[9<}Ƌ\TuAЋ!AAA)uky4D1ҁTtYӃY19Ћ|h*$ (_01=x0x0CU C )C50$~N`Cp=Lx-u*{tFx9sCxNfKxF,H9u fSCf{CTCXȉC\OK`ȃ~:=0uCh|{lN`Cd9sh*$ %P[x00P t+)lj1ɉ1xU u@\€ x0H xU u@\€ x0H ?xU u@`¡0@`0$~%x0Bl5x0F0=Lx-~!{8x09rKd1VT~U uVT~U t PFXƋP1~FKd1111f30@8P!tx x0)D4)Љx09s?zU tR`ك 2x0B$C1ҋ9r)0H`艅 0x0BY89&zU tR`A`0$~%x0Bl5x0F0=Lx-Kd1VT~U uVT~U t PFXƋP1~FKd1111f{89rN05x0$.Nh񉍸Flx1Dž1҉)D4x0;xsxU t@` x0@$벋!ʉt:@t@;Npr1tɋ$9~‹GDž붅t$9~‹0B0;0u^=0t0s4PP |0@|00Z4Jd150000H41[0Z0 } t0؋5x0=0t50t0P5x04 0X05t0ދvxx 0\t4Tu1%Fl1%CPO붡t0p0𙋝ڋÉƉ߁TtAЋ!A1׋AId t10Y\Tt=P0]s8l0){0ƉK`Cx1񉅰69s)9st00%Cl뀡t0l09rߋ 0A01q8𙋝ڋÉƉ߁\TtAЋ!A1׋A׋1Id t1(Z~==X0j.X܋ 0𙋝ڋËƉ߁\TtAЋ!A1׋A׋Id t1(%u5!#WVRh*$R9]=P0D0P,t,=X0t h"X1j X1b~j X=X0tjtx|m_u=`0th+$v5004=Lx-0FF4+=_w h+$j5? t0X󥋅`1=0tR50蘾[^t0=T0t ǃ\8 50x\D0RP SMY=0t00r4PP蔽 0X4HdLH t1500Z;0sE=0t0r4PP8 |0@|00Z4Jd150X5l05t0\0@4P50\eY[^_]aÃUWVSu]tV> _uVh"jz= `1ɉPhd@u , tGRhedAu  @u!8tuh؅"[CXZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h$[ ƹ ߋSh"V/ CPhC"V{1 C Ph"Vi1 CPh"VZ1 CPh'"VK1 CC,$C,Ph:"V31 C0PhO"V$1 tP: X}!uhzd@u  @RhedAu  @uuh^"j; 41}󫍅PuY^_@4ȋ9R9t(Ћ}1ۉ1E1ɉ [Eƀ*PYj PEPG 1e[^_]UWVS4}jhPjWytGjPjVWV u$U ʋMQ؍e[^_]UVS]u VSl YZu Sh`w"j<: ;/t"Shuw" XZu Ew"e[^]e[^]ÅtUWRPpY_}UWVSuuuuw É֋EU)jj`RP} Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVS]MpM1}tfF^1 :^F: 1 MKMKfCCCCC s({,C8C xtuh1$j) PV}tu 0u# e[^_]UVS3t!3]b PhUW$hh@2S4jjPƃ t3)b P6h1$hh@2@2e[^]UQPȉE1$tEnPhTW$0XZUWVSÉU܍Esu{h2$ EPEPEPVEPhD2$ؠfERf Ph_2$蹠(EPEPEPhk2$蝠u1ɉ 2\-hx-uh-k22赺XZe[^_]W|$wUWSøth3h3$誝XZ582h#3$蘝502h<3$舝(3t PhR3$q_X82t?029} hc3$R[()%MMEuQQ$h3$* j A02Z13(3EE2ۃH~-2]PP$4 %RR$S2QQ$SEWW$S h-PP$Sh3$r<322!]22Ezu%ٞzu%=02\$=82$h3$e[_]g_1UjjȵXZ1=02P%U=`-u =02ujhuu82ZY9@2~@23ueUSá22xFأ222%w%r\-y1]Y]W|$wUWVS282ff2422=29=2u ;22f2f2]f21Ej]Sjj53PP yh4$[jh3jjh253ǿ y3t h'4$_EjSjj53O y hD4$jS h2j` [^242f23 s$ 2ɡ2ȉ 22s223}f2Bf224fpjh3jVP5 3Ⱦ Ã9t:y h`4$YSVh3hg4$Fh-gZ1`-82% 82 @382@822222 2u22222Av.}fE fEm]mE22 %52=2 222 2U u}fU fUm]mU}ЉEΉ߃ɚ;~ʚ;Eހ}2 2222H %؉ 22 22E22=ɚ;~ 22-ʚ;2(2rW 22 22 22 222=ɚ;~ 22-ʚ;23t ;3te[^_]g_UWVS<ÉUM3tUUEčs}uyMăA}9}fE؍t E;42uJ122u5}t43u+JEPuh4$ӕ Ѝe[^_]W|$wUWVSEU܉M7C]3MQURuh4$kt h4$ZXWh4$N3Y_t,%E %RR$Ph4$3t"uC-e[^_]g_ߑe[^_]g_US%=D3u5!#(SPhS=$h-?j+UWVSƉP ¡3_tEtPh>$E 39U|} Vh?$j tt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ 31҅w =w"=w'=w?=w W=w F=v=w=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPs^S PVh?$ StF PVh"?$蜒BhPSjPVh0?$tS^PCPVh??$Xhx-踀Xe[^]Ãt"¸g?$7tM?$tUR-ZøZ?$USљRPQhShx-ST ] -yUhx-j 膘XZáx-Px- UWVSDuhx-e[^_]ÉÉh~?$肑`&aXE1ɿ!t0\Љt }uCEtHP1DA u1tЅ}t2}uKU1ˉj.h3EPj:U1ˉuOQ VPhUW$j.h3@h3hn%|XZT5x3VPhn%YG 0=d3UWVS @<tPh?$Y[C&tRh "Ph?$^_Ph?$XZCH<$`&h5!#C Ph?$跏C@& Scssh?$艏C! &<t&<t&COS C #CPh?$JCZYPfwk$&h @$h@$ X1Zh@$h!@$h/@$hځ"_3h4@$^!h<@$؎Y PhF$ŎXZ뢍A9shC@$走 EԍsfCfhw:ffEPEPEPEPEPEPhP@$bjfEPEPEPEPEPEPEPEPEPEPEPEPEPEPhs@$F$HF$Rh-G##XZUVS$`&E׉Íu 9stMtJ@ShwF$XZe[^]UVSU %tYE uLjjEPà uU1j.0hY^ƅth3@PtYZuUuRD ZhPh3 3e[^]UUE Pjjhh3PR_B thh{%h3h 3UVSE UMYt @ȅu˅t6t1R )˅t8u3jSZYt%u %hPh3 VShF$hh3mVPRhF$hh3DσVQPRhF$hh3ˀVSQPRhF$hh3誀 3e[^]UWVS$u} KE 0~y111119Bt} |t 1M LtMw tLxw tHuGC@u?6ttxtu#2 @"@Ƅ9t(Bh1u "ω9)51u- uh %h3y[^vthF$yYEPjjhVPP~? t h{%VyXZSVhQ%hh3~3e[^_]UVSMQ3Q3يۊ@&BZ@&XÃ@.)օ~=3uC3[^]UWVS uE Eԃ=4-tL1ɉ 4-hh3['[_u(j.h3d_Zth@Ph3 3uhh %h3e F<t^<t<udEԉE FEe[^_]!Uڹ1ˍ}fEu jEP [^uԍEPmZY6e[^_]VPFPhF$hh3@}3e[^_]US]U MC<t,<t<u/MU ]]OMU ]]U؋]!S"PCPhF$hh3|3]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV _XUЅҋEtuu SVZY SPV }yE EUW$e[^_]}tEEԉE E:]#e[^_]^}EEԉEE E+"e[^_]?}UWVSXEEE EEEEEEE"1EEEE1҉UjjuVjj]Syh&A$)EuhF$͞ Xe[^_]PXu jj jjVWjSyhF$݋EEhF$耞 XE9^CU!‹M9A}tSyM9,sxEt  Cy;8-t8-PuCyPP C E1ɋEtttHP1DA uЋU؋uЅ~uE'uPsRV~uEuPjjucE#CP>h#h#hF$I{-H-$yhx-j XZx-Px- }e[^_]]UUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һF$~kMUD8-u^@PZMt$Ut:u?DX,t*DX\}uCNv t4}tEEEe[^_]UjjEPEPu u-h?uuum(USPhF$h-}Sh&G$h- }ShGG$h-|$ShUG$h-|ShtG$h-|ShG$h-|$ShG$h-|ShG$h-|ShG$h-|$j~oUVSƃ=3u[^1ɉ 3 3P337U Ru-jRZZutL9¸}9U 9zu19ZVPuWSh`O$|1҉331pt]Xpe[^_]U3 3eO$uZ"Pju uU3 3eO$ur"Pju uUVSEu835HuhhO$E PEP tT3133xhuO$E 0fZYu*=3u53h0O$q [^DžxhLjt^Xjh3V XYE t ;u&1ۉT3j5`3u 躹à uH=|3tу=T3th3S[ZYuSh|O$53Y 멉ڋE t5@35D3 H3ڍYXxt9|PV_YZu33 Vhc#yXZ9u 1҃=x3¸r" 3 3teO$jRPSVh`O$1ۉ33E =T3=3x3x31ҋtT3x3tjqXZ1ɉ T3e[^]UWVS u }t 蹗h*"vXZYuvhO$53xX uj hxO$W > r"3 3t!eO$tVWjVjjhRSxySJX 83e[^_]U帥+"}u#]U}u ݖhO$hO$hO$53W183UWVSE]uu1҅‰uTpuCE xh+"W~ZYu u0Hh#WaZYu1t/#@ u븥+"PVhO$53 We[^_]UhO$hl3u uI83U}u83=3t3E EO$]遼 ]Uh&P$h3u u83UVSE] u1=33u{+"yt ash+"VRZYtBh#VAZYu 134V^sh5P$53U 맣33노#PhVP$53U =3t53hlP$53U 53hW$t 3Y[t1҉ 383e[^]UhP$h3u u83UhP$h3u u83UhP$h 3u u83= 3t13UhP$hx3u uM83UVSE] t~ ܓ1=X3X3u=sh+"V觹ZYuX3h#V臹ZYu1X39s?L3^hsh@3 T3@3X3 A L3T3#8u-#QPRhP$53SX383e[^]áT3t8u53hP$衹 1X3ZYƋ L3+"UhQ$hh3u u83Uh&Q$h<3u u83UVSE] u duosh+"VPZYup3T3_h#V(ZYu1ɉ p3T3HVϻZy$shBQ$53R 1=p3p3T3t +" 1#T3PQh\Q$53R1=p383e[^]UEur83HuhvQ$E PEPc tЋE phQ$aYZu9=83uJ=3t53hQ$ӷ XZE phQ$xaZYu331`3USUE 83u C3Pt ]馐pYtePJ Z@u ShQ$o@=3t"h3hQ$53IQ1ɉ 83 53hQ$ XZ]]]UEt~83=HuhN$E PEP tӋE phR$``ZYu 3USSEu轏83HuhhO$E PEP访 tT3hLj E[Xjh3L XYE tE ;u1ɉ T3jju 讯à uu=T3tڋtShR$_[Zu 3E =T3u=3tx3x31ҋtT3x3tuj>XZ1ɉ T3]UEu蓎83}Ht}6hR$E PEP uhR$E PEPd t}E ph"R$^ZYu!E ph*R$^ZYu 3UWVSUU] 3E=3t5x3x31ҋE _¡T3t@T35x3ujZY1ۉT3EM9t EPXe[^_]UWVS}u <jj薗)ÉXZSn CYujjfh# à u $j/SB _ZڅtPhRW5 =p3t653SL 3HQPY^y Pj MY^ J }~j5(3h"WS67  jWS(7 ShR$83j<~PH Z9uWj腖[^WjyZYt1 hR$X83e[^_]UWVSPEEu豈83%HhR$E PEP袸 EwɋE phR$X^_t 53hR$ Y[}hR$7 Zu ]E XShR$XS\R1 t뙃}hR$ Xu ]E X ShS$PXSR1 t-U}u"E X ShS$XSQ1 |3Ce[^_]U83}t\=`3t =3u#׭=3u3E ES$ h3h4S$53G183 U83}t=3u#P=3u3E EQ$鉭 h3hJS$53G183 UEu茆83{Huh_S$E PEP耶 tӋE phS$VYZu9=83u<=3t53hnS$ XZE phS$VZYu 3UEu83{Huh_S$E PEP tӋE phS$6VYZu9=83u<=3t53hS$S XZE phS$UZYu 3UWVSu huS 9}1hE4S F 9~hh(%Su GShUW$zUY[Hu jNZ3e[^_]UEu˄83/HuhS$E PEP迴 tu uh5!#- UEu83/HuhS$E PEPs tu uhT$ UEu383[Ht}6h#E PEP uhN$E PEP t}E pphT$NT USE3u贃8323Hu hT$TYE ph#T$SXZ3]USE3PvW8323Hu h1T$SYE ph;T$SXZ3]USE3u8323Hu hHT$ZSYE phMT$GSXZ3]UE} tu覂83=|3thUT$SX#U} t}uj83Ã=|3t jjXZj`Y=|3t jjuXZj6Ujjj5UWSREEu83=uE XhZT$Ց Xu]ShS$@RSL1 e[_]UVSEu蕁0Hu ZYt\83*E pЂE[@u 53hcT$'}u 53hxT$Ex u53hT$ѧ MhNj舎Y[j_XEx t3=|3u*53hT$蕧 XZjU_4$jG[^Ph-#h@3- ZYÅt$h@3J)@$A3Sh@3 j E0]S E XPEHPEP XZ1=|3\3j^4$j蹍Y[e[^]UhT$hH3u uY83UhT$h43u u783UVS]u t~83lu%1D353hT$f D383ZYBD3@D383jvh3 u 3jvh3 e[^]USEu)1ɉ @353hT$ @383[Xu 83~}~hT$E PEP u@383j 5(3Z![ZÃ=`3tC; t(3j S9!ZYh5(3h3 C; thSh3 ]USEu&1=0303,3+"t ~E Xh+"SZYu 03h#SZYu1031ۉ,3*h%SƣZYu03,3u##=03t+"PRhT$53b>0383]U*U$=3u1Ph3u u8313UǍ@$|GWS@P =333EU313333jjheO$M qVh`O$c=3EU333(V辕Ze[^_]UWVS]u t s>hW$WԙZYt.hP%WÙZYthW$W貙Y[t뷻v[Zt3u6hW$R`4 tT3tT35T35T3hW$R04183e[^_]UWVSPU} uRUyZUuUE W$3Ee[^_]3Ë@t P衔1ɉKXW讧CZ=3ttP3hX$533e[^_]USEU 83t tt<]~r-t8Cu5!#PRj hX$53?3jrr 183]UVSu 83}t e[^] rvxXuvhW$532,Ct P蘓1҉SY3h"X$532183 e[^]US3}uq83<=3u3E E3X$]8 3h`X$A3X]USEU 3Hv3q83P=3u3E EeX$]Η 3Hu hX$nAYrhX$^AXZ3]USMU 3Avp83Y=3u3E EX$]P 3BuPhX$@XZrPhX$@ 3]UWVS @Eu} t-p83AHhV$E PEP tЋ5T3} 19~j kS3Pwi; t*Cu%whZ$53083 h@h@3P2 1ؿkS3X 9Xr0-DP@tC@3<$t<\CFC 0-K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP@3)PE 4V@ E 43߿iu6CDžؿ9}~)@3)PE 4V E 48ƃF;rT30oXu 53hcT$u!53hxT$Ք 83^X~ t=|3u 53hT$΃=3t:53h@3菔 3HQPYYy Pj 1YX J j 6R& T3P5T3V =l3t3~t-3HQPy;P| J PjP1XZh@Ph@3踫 qT3ET3E 9XCؿt G9}ce[^_]USËt P耎1XCt Pn1ɉKXCt P[1CZ]USdp;3jyX=3t>0EPh&Z$jd]Sj(~!3fJftPSRN jh3) USdjkyX=3t>DPh@Z$jd]S(~!3fJftPSR=N jh3~) UWVSƉӋ:j:WZYZuWhZZ$V蛦 :WjP|YZtj%W'YZtWhcZ$VeW C uf{P Huf{tCPh_$V3 h#V%XZe[^_]UWVS ERUS5ZEE0U;OwuCuRS1 uCEÊ u w)tu C;OvE1e[^_]UWVSË@t P&1s_stV4Y1Ct P1CZe[^_]UWVSljӋu3u<MP]wEPMQSW航jEw>yFE8 u@EuhnZ$i XZ,HEHwuE1e[^_]Å8UWVSH%Pt=0-ufTwfUtePt^ftwftO0Euf]fۃW})߉0ufWӉ)Ӄ@YA]AXZ[^_]UWVSUu u hZ$j6 ljjhZ$P uW1ɉK fCPjhZ$Wʩ uWC fCjhZ$W褩 u WC _t36vCvCF C FfC (WuhZ$ Ef: j/RUj ^ZEUu R腜8)ЉUHQM ƋMQURP# { uEuLCYj@V ZYt_{ u1҉3Mq@Pj:Ep  t@PMAYE@E@tu[uvVj]RU YZEtH:UttWuVhZ$)PERVEMV蟕u WuVhZ$tEx:u-u%p/Uj:V& YZUt>t3 3ׄtK3Gpj EPVo >tU:u PvWuVh[$/fC*C tt5P3u5T3t5!#V軚CZ{uC%{ tC%P蛚CX1e[^_]USZKJy ;J| t Y RP)XZ]UWVSP1ۉDžfDž1jhZ$P芦 jPQ^$CZY@tt8tt8uVh7[$uuDž8tj;P7 [_ÅthH[$P袊ZYtChP[$S葊Y_t>hX[$S耊_Zuh`[$[gVSh[$Dž DžsDžVÉj@P t1҉3@PΘYj:^_@P覘[H8?u1;u11ۃ/j/S ZY9u$uHsjhC%Sۡ cu)uRh31ۅ%pu'jh3u911ۃ=h3Džt*1;t%h[$SZY11u @11ɉ>t+h[$V;_Z1ɉ=3=|3t jj_XZ=3:hPW蔠 1 t1ɉd31҉d3QPZd3|3YZu u*"#Hu9d uWh[$ u Pj衾PjrY_t ;1$j/S_Zu Jx;hh%RN 1ɉ 3Pj=3u/; =83h-h[$ XZt>ut>uGt>t݃t3hSS蘞 hhC%SX hVSL $hhxO$Sa 1 tL5x31ɉ x3=@3t hhuO$ hhyY$S Wj$5x3FD3uj/V [ZtP1ɉ=@3t WjWjXZ83-1ۃcÍc؍e[^_]UWVSl<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh3 ZYu PQ^$Y[@SG^5<$!Zffu0t#;th]$SZYt h]$3t$?t?u+u =D3uhB]$\W苑Y,,D3t <,j/P _Zt@,PEZ P2YD3 t 8uthh]$c1=3=333DžtDžx=@3t0 tRPZYu33D3]$,h*"P+^_44u ,4Pt$PVY[u/tx3353=3 t14P_1҉$WVPy,Ph]$=3u=T3<T3 -,Ph]$53 33 3 u53j [^RPh]$Q]hSh3 33p8-/@dj VP% 9pd8/Pdx*u,j pPR pd83 3Gh3`$\`$d+tXH ׉dR%s^_Džh8HR2Ytxk`$dtd襁2u`$dt]kN$dth`$1Xr`$d`ujh`$ ^_p@9`$d't`$dƅu a$dutPmYV̀Zt<oZu&J3 3ha$$_t 8uh7a$ڡ3P3~ hba$^}31uQu2P7ZYu 1;33|3 3y )jPHX33339؉|1=3=31@u @u"PjYNY[㋅Pj GNXZ@tPj.N^_@tPjNY[4t4P}@t P"% Z0t8t08RX ;D3t t Pa1 X'h],t,Pa1,XtPca1_$t$PDa1ɉ$[(t(P%a1(Ze[^_]UWVSÉjhZ$P藀 jhZ$S tshZ$SI ZYDžt$jhZ$SX tS)WhCc$jup uhX$E_u?F t u8t,jhZ$S uVj11҉ZYe[^_]É؍e[^_]US1EEjh3 ZYt-=|3uEE@Ejj}Y[hjK[XhRj KXZEE;EEj:M 4ZYtw1ۉ3=3u 3EU 1oED3t%h#S ZYt;|tST_1ɉ D3[E~E@EE@E\=|3uE]ËE@tjj虺XZUWVS$} j hY$uV{ uE1ɉMMuqÉEPZD=63%h63j5d;3[_Zy h^f$_^63=3<<63<63P63P63P63P63P63Phf$Ã=|3^=3Q1҉36363=3t f63d;3tP _jj63P'd;3 y"h9d$^^ 3=3u#jXRjhP躙 @uhe$$63Ph635d;3 y%hf$(^Y5d;3 d;3xT3tjXPjh5d;3E Džh631󫍅hPR5d;3e @h0f$x=3,3=3 3t$=3=3\t63<u1ɉj j WhStPtP计 53=p3u 3WS\h~f$aÉ53~5t=|3t37h;3h#53 =|3u Iu<t=|363P63Pj63P63P63P63P63P63P63P63P63P63P63P63P63P63P63P63Pjjhf$HÃX1st 3<uBDžXjXPjj5d;3ʖ 5d;3: d;3X1=&53hd$e[^_]UWVSD}d;3=03tWPHjjPx ƃ HPj5d;3Y @-d;3EfEjEPrM]ġ3ZZ<ډEUjEPrM+M̋EZ[+Ey@Biy1QjEPV 8tx8#th)g$63EEPEP5d;3  à ty5d;3 d;3VjSg @t?}uEjEPjjS$ W5d;3Y[Quhf$V X5d;3w d;3Z1(8\8#Nh g$fY뽍e[^_]UWVSu1ɉ \;3h2j.E[_t=`3u "3+3=`3W+3 "35`3|3|33thPBUP{_ UBC3 63󥿴63 󥍺6363l;3<<l;3h;3@@h;33DD33HH3T3LLT3P3PPP3L3TTL3H3XXH3D3\\D3jh3`UPC^ j`Ph30^ jh3U썂qP^ $jqPh3^ @3U쉂@3hh3P] hPh3] $hh3UˆR] hÈSh3] ujw,\;3 t1\;3EEe[^_]e[^_]UWVSQ}j/W3 [^t#9u jhC%jWXZ/jhH%nY^y WhJg$OVnhWh 3\ !3ƀ 3. d1.F9t@BUUjh 3XZx9U0t8u-Ou53h\g$D XZ10jh 3YXy 3F<.u1F@F0볍e[^_]UWVSuh;3u/hg$. X=;3t 831Ee[^_]<fDžƅfPftjjWPŁt hg$UXhhg$5h;35h;3 l;3Ã(t hg$TX=;3t 83j3<Xt(t#fVfthWPK j]Yu=83(ujDZj1ɉ 3Dždh*"u _Z\\uu h#cN[^aDžd\fzt \@xRP7ZYxE%=tu heh$53 EЋUԣ33Jjh`63M ^_B53=3 hN$uZYthN$uZY3twC\fxu \jWVPl \@jWVPyu h]$#M_X+5353hh$  DžTeO$}tEuuhT%l H3T^``u"uhUW$*ZY뽡T3h|h$h&h+hh$i9T53s&P53tP+6XT3T53PH_P53j"^l@ujj !ZYl=3t= 3t =3y 31ۡ3`fxt `P\fyt \@S535T53 P53- uu h14#K_X8 33\PkXY@X t0`Xz33\J뭅t[pt9533|@3#,53蛾^pt3pt륋`@ @tu@o` 33<\H Xpt 3933|3 {\@ @tʸ#au h14#IXZ`@ @tjhh$IXhjXdtd\R^1\`PB1ɉ` $b[nhPjXZDžh=T3ted;3xP- Xd;3`t`P^1`j[831;33}j;Y 83h@u l@u"hPjoXZ㋅lPj ]^_d;3xP [d;3du `u)\tꋅd\RY؋`PXP 31҉3333e[^_]UWVS1043PT3t$1=3=3L33 3(<3$h`O$uZYDDu =`3uVu=3t}t}u&E 8-u}tuh1h$53X 뺋E PhZh$53? ɋDtE uPu 1ۉ8Dž<Dž@1=43uDHjh`63O ZYt=T3tzjXhjNY[hj@^_<}tWE jP[^E j/P ZY8tN8 tDE PhJg$LF[^83M E h#P_ZE 8|uuU C%t,H%%E 9u jhC%E jP^_/ jPY[n=L3t 8 uW@8 u"E hP _ZyE Phh$6=L3t 뽃=L3tE PYE D3uJutYjjjXZ39u&ju0^_3383ujPiY[=ujh`63Y ,_ZDu}u-k33 tRPhh$0 ͋E8t8PuhT% Hh*"?^44uuhUW$Y[ȃ}E h#P_ZuDž0x-15 35<3E 8|uXjj _Z@E hr"@P Y[00u E @PhR$A15 35<3Dž8=E uPY[00uE Ph#xCXZ#Dž80fzt 0@xRPL^_@tE%=t1ۉ 3<3T3h6b$h&h3hh$9L53s&H53tP,YT3L53PX?ZH53jX=3t= 3t =3y3,1,3Dt@33 t/0f{t 0IjRPQ53L53 H530fxt 0P4ft 4@,VSu u08 u33hh$A^ڃD43 3#0jjjP 11y=E Ph]$OAY[Z0Jy/0P]Zt΃ t*;533|0H уԋ0jjjP x N33,334J4P贽_ td0@ @ul0 u4J4Ph^t, VL@L Hu ,PT9ȉ*3#153蠳XPT3ډPT33띋4H 0334H PT 39533|3 {4@ @t=ʸ#a48 u33 hh$>Y݋0@ @tE PhW4#>XZjX8t80R^104P)1ɉ4 $I[Lu33y3`LPhh$536 53hi$, XZ뾋D$ u=<3uj6 _苅8=ju)[^X\Bu@j`SU^_X\lp1tE SPUG ZY@XP$J+‹E $Ph>i$53R`jh`63 ZYt$831;33}4jX Y*hj^_=T34PP[벋<@u @@u"h Z$W>ZYEt ue[^_]Z2øb#=`3t{l$Phl$53苾 -t$=`3t~ tPR2PS$2 SO%YE ]e[^_] QMZƒMuQWhl$53KSu QWhl$ދ}u#Uj PMQ; MMEPjUR rPj hX$53蹽릍e[^_]UVS 3 U3D3$t!uItJuBD3(31D3P 3-8!- u @ uD3tJt D31&D3(3 tGtBB@"u\uXu@!@B؀"@tՈButBU3 3:U3 3D3tHt D31D31(3[^]US 3@3U3 U31ɉ D3T31ۉX1T3{P5T3/XZtT3@ڋ]UVS 3=3t,SP! $^Z8tPh$53ƻ 53薦jh@h@3h -*y}uB53hl$t.=3t 3Hy Pj 菾Y[ J h;3t-fPftjP 5h;3k1h;3 1ɉ |31\3jCPZt ShEr$j, 0e[^]UWVS]h3=T3t =|3u$u 1ۉD3@3Pu7=D3uED3D3PD3@1ɉ D3=@3h53V} /thhC%V0 hh_r$V VyVhmr$XZ1pPV =3Xأ353 313 3} t1=`3P̼Xr"EEt!jjRPPh7R$Z"ҡ83-cvt;3} t1=`3PbX=353 3h*"V@3V =@3uuhr$ ^r$5@3hh@3薔 u5@31ۉ@3j h@3ZYu@3e[^_]UVSQQMq3=p3u 3=3ut953hr$ Phr$EYZuBj h;3\^Zuj UR@P讒 M te50-DN@tVu=83u=3u1ɉ 3t=p3u53h;3 3 XZz3eY[^]UWVSQ4MY=3}=83}=p3u 3=3u}53hr$ fPh s$0^_j h;3C~ZYtj.h;3.~^_th;3軥Y;3uKjhs$V u7Vhs$53.f;320h;3hTs$53;3 1}VSZtVhgs$53ߛ EPhs$V97 tEEP_uu p3u\]3gu=83u=3u1ɉ 3t+=p3u"53h;3. 3 XZE3E83eY[^_]Uuhs$j2h3?u hs$j 3UWVSP}u jjhb#jWhs$V16 ƒu&Whs$V6 ƒ uWht$V6 ƒ USjlEe[^_]Uhh3ef ZYu3UWVS`35383=p3u 3hMv#贩_uSj h;3{ZYtA8thUWS$]؍U1EEEEPSh%u} ƒ1uuz Xe[_]UWVSu] }VuSЇ u1N tut$tt$fN lS袚ZHˀ; uLUJ9uD $-y h -FY -H - t@u҅tu$ff t1҉e[^_]UVSQuh@3![á3?vPhu$ juh;u$P蔐Cƃ@3 1҉UUR@)RA3Ph -yhAu$uhKu$53IjrT319T3 U e[^]UWVSD]} S\j j VhRuWK t&hh"Rr j h"Ve H3tzW9Vt vuvvSi8 @uT迨8jjjhSvv K thh"S 聨8Sh\u$7Y[4jjS襲 ƃ u(PPh$hou$PjSg @uPPhu$fDž=3~"jP3XZuWSE @跧8$}u裧8A^PPh^$E >jP++‹Y_+y@Biy1fDžRjP跰 uY 8u=3~{8#tLVjS ƒ 1BPPh "nu讦< tQDžPPhhS? @uVD e[^_]UVS]u Sz$(jPV= t@uSh\z$tShw$ljjjVo=T3u[=L3uThh P# ǃ uj j XZuPhi"D[_g=L3t1ɍP3Sjj1ɉV t hjz$YtWb Zt hz$XT3u,u#u P諼_Shz$[^jjW ƃ u Whz$xPVgZYtWhz$@VǕ 9u9t2RPhz$=V舕 PSVh DV] jPp ZY@uShi"=T35-ShW %hRQl=v -)A5-=T3u:hh R ƃ uRh/{$ h -sc Ix{ _=T3uVk Y@u hz$ZSֺXe[^_]US?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋC1ɃL Muj RP[ F 5454h|$j ؍e[^]UWVS ÉUE9C8uqBhzu0t'Phh3M t Džh3)ȋDPS4F hY[< u5454hJ$Ph1hn))=w(SXZDžh3Phh3S 5454h$1_1ss C1C1҃u\#u~nu 44@ f,4,454K_1+4=4u8#uxnu 4M 1M I t44t]Ut @uKf 4-t41ɉ 4=,4;G ,44t1BJM pЍe[^_]U4@ t=4t/= 4t@HyPLYuԋJ54Pm XZ1UWVS|u=4uQ(48u==4t h}$j+ 4 -4w$4x-4("44tQHyPmKZt@ J54Pl 54h4h4 ÃYB4= -u 1~1PI[= 4tdh 4h 454m| t $&<49P4r<4kP5@4@4XZ=P4k 5@414154{u54s芲 Y[ =L4uuu =4z 4t54CPj V48 u4H @))Ӊ4SPV  Ij5454h4;jjh"h4j5454h4Fj5454h4\ jjh"h4Aj5454h4) 54sr 4<4@=4x-uX=d-u[h{" Zt8tP讄 d-X9TPhht@jG uVftd-d-<=d-u d-t 11<tR<@PPHt%tv$@P 1DžHP u?F;5d-r54h'%5 ^_54j$C 54j C 1.WYtKW2ǍZ;d-r54h'% ^X154Hj@,tfW^YtZPh&+_ZNjd-4t;d-r54h'%' XZ1@HЉ0,Ph?$54I,B 90uH@)< F;5d-r54h'%豮 Y^54j$-B 54j B 4@ @a¸:taPP54ho"j 4 4u45454j54*=4t54j A XZjh4g^_1ɉ 4jjh"h4rjh4,@=45454j54X*=454j @ XZ=4r4=4BHPj W13 ƅt*44)44H85454jW)=4t54j k@ Y_84444 4u45454j54^)=4t54j @ XZj9<49P4r<4kP5@49@4^_=P4k 5@4CFPOYFG=P4%=4CH@u. D4t$P9Qs@4R54PhE$j薶 54j1ɉ@9^Z"1ɉ p441҉HLC0tZ44uH 9Hu;Ptj0Whl4CP Q44pP @9u9t)HL1LH9L}jjQhl444PHσ)HLL'Hj@$YZ"L HjHWhl49Q tUAQ )HLLHj@YZ 44QNu9AuAQ 똋 4j)ȋ544PQhl4~CP 44P @@DjH+@P@Phl48 t4󥸄44l44l4t|4l4Cxt45454j54%=4t54j < XZsF uq=4u~uhh Pe F @t"5454Cp[d ;4t Cp jh"Cp3d Ht1 H4=H41H4[=4h{uhh s]e C @t5454sc ;4tshUW$j jh"sc Hփ=4ujjh5!#h4o\4󥸄44444\=44Hw{54=-t 1X4449IFTu@1*jjTPkH<9Hs B@9u[0QPVT 0uՋ@9s3<jp$(PhT4.<jjVhT4 )H*t4󥸄44T44T4td4T454h$"54@ $4 4u45454j54"=4t54j 19 [^?Cv1s L4ue[^_]U`3txt1҉P x{u@jjh5!#h4US];] ttCj1UVSQƉW1҉jEPV S >tE8tWW1:"u#C@؍e[^]USP~zYt@Uv‹EBu Sh$j踮 ]UWVS Ek<@-Ex19~BURE@u9 2u19)VD PRRkE{42@b4&t4Ƀ5|4-aX؋]#]US]E U$H&1Ƀ=k4if4 ~h4 we44k}i4_h$h}i4M7YZi4t=i4t h &Z(j4 $5k4[`X؋]Q]Uh襷t41U14jO1U14jOc1Uhh$h`|4 E Uhh$h`|4躨 E Uhh $h`|4蓨 E Uhh$h`|4l E UE.tgzEEPjjp׺ UE.tgzEEPjjo贺 UE.tgzEEPjjf葺 UE 0^Ph$jjcpUE.tgzEEPjjhg UE jUE jUE jԨUE j躨臮UoU ]U輬U ]U衫U ]UaU ]Uj7`U Uj!`U Uj `U U踾U ]U |4,P1RP(U |4,P@1RP(U |4,jh(U |4,jh@u(Ujjְ1Ujjư1Ujj趰1Ujj覰14,Uh$t_ Uh-$`_ 1Uh;$O_ U@1]U4o4jo1U跱1]Uj.1UY21]U01]U,1]UVSu] hE#C Zwt @t2E0f~ufFsHPh\!%h"e[^]Ee[^]#UEU ttu(8o4u4 }4]]UEU ttu(v4 @`4  }4]X]UVSE 0ڸuhX$3\ hX$)\ XZjShX$h jShX$[ 1e[^]U{4={4uhX$[ hX$[ XZ%jh{4hX$ jh{4hX$ 1Uj4&=j4uhX$t[ hX$j[ XZ%jhj4hX$ jhj4hX$ 1Uzs4=zs4uhX$[ hX$ [ XZ%jhzs4hX$D jhzs4hX$3 1Uh$hy4Z0ZYuz4dOhhz4h5!#h$1Uh$h}i4 0ZYui4dhhi4h5!#h:$1Uh$h]r4/ZYu{r4dhh{r4h5!#h#1U5 |4Zujj5 |4 US] |4)thkj`XZ0ƀxj3Pjj35 |4S1 ]UE ]UE ]UE 1҉]UE ]UWVS É։M}}} }PfуP19~Pfz fSC9uh$QuR s"1h(%QuR CuDSu0Kx9tF( Fat~UCuBEs8})CuS փ9~Of{ufKf9|A)fKsfuu)K9M|9~fs)y1fssf9u|MS9~09},CPuAERuFYXMCu9}ys(unXZ1C9uf{thP$uQsECujjss~ uC}S)Psĩs迃e[^_]UE ]UE 1҉P]UE @]UE @]UE ]UE 1҉]UE ]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE @]"U14j'B1U14jB1Ud4 11]U@c4 1]Uu41]U@b41]Uh腩t41U@b41]UhTt41U@c4 ~1]Uu4c1]Ud4 H1]Uu4-1]Ud4 1]U@c4 1]Uu4q1]U}41]Uv4 1]U@`4 1]U8o4ep1]UE uU]US] |4)thkjOXZ*ƀxj3Pjj35 |4]UWVS ]u t/{u)P>vPK t6vWYC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>PvxC ZtsP^Is  1C sYs 1CZY]UWVSP@-1AƉE1U9}HQG t5fu.O)ljPD PRkVjj5-7.$jj5-7Λ5-7u5-7,Y=5,-DBxsqh>tadt\<-u(=tK=tB-wH=Rt/=Su8t4+=4E9s$ X>t 4|h-j XZC SCf.S K)y1fK)y1fCYCfEECЍP9UK fM)y1s9~fSUʋMM9EL8fKsnXxufufCVt%z `~x~Ha (aS9USB CfC> =S=V>Yv10-DB'h-j Vs smC Zt sP>_XsNYtmF t!u S_Zt Cx~fF ft\uMsqmC ^tsPY>s 1ɉK sNs1C4XZu W_XF u|s mC Yt sP=XZsMXCt2Po1s_$uCD0tPoC1҉T0YEC9E|ӋC4tu S_XsM1ɉKC ^t9P:1C Z+u)u1Mu5-7Wle[^_]UU4U fP]UU1x94~4]UWVSP.5449=  MRPkY_Mu1146444uj 4X1]US]w>`-t-t)94r!DPe> Zt;4s `--؋]U54b144ZU54XU54!XUS]uTu PnSPjQ]US]u+u P~nSPj(]UE Puj UGuPhUW$ UuPhUW$ US ]uuPmSuuu jPQ$]Uh5!#uuu uUWVS}5454XZun},u4u(PmWPjj7 ǃE}t'E8tE$9}u Y|EE$|9}AE6}Et)~%E8tPA ZU$D9EeE} u)@E }y$uw[Ej PVZYtE@M}})ȻEE9~)Ήuu uWQM54-ÃMu$u uWQhɇ$54[M11M DS`/XMtV5-70ZYMM54蕂PSl54PSjjS_$SeE @PE@PWMQ54,P,S; P54 SpP54u#u(PvkU,Ru$u uuP$t6S^XtSV/V S?WPmSge[^_]Uh5!#u$u uuuuu u/$US]uuPjSuuu jP+$]Uh5!#uuu uUS]u1uPjSuuu jP$]Uh5!#uuu uUS]uu P4jSPj]Uh5!#uXZUS5454؋]Uj US]Sv h"ˆ Pe sl =$`4t7S螈Ph%5$`4a 5$`445$`41$`4=n4t8S^Ph%5n4! 5n45n41ɉ n4=4uh-h%d XZ]UWVS h*"P1 _Zuoh~RjP觌Ph#h- SZ_ jr h-#SA _Z؉Ph#Y[&tCVhS uW$W腍 t ;u뵋Ct{ tዅh-#R ZY€:=uZh-#S ZYh%SDz ZYWSA{ ;V3Xe[^_]UEPE 4UWVS 1ɉJ P` ^Nv Zp j h%V| uՃ{ uC W hC%W. VW. WujƋ;7P yC9C u=CPW Z_ZuS YaCPsY_ZtۉC{ CPGC VY^e[^_]Ã=n4u U塄t4t uPz XZj Uh" YtP裀 Zt hC%蔀 YhjhQ~YZ hZjXUWVS 1ɉM܍}14o4j1j蜇[_ ]߉jjPN =4o4u:SZxEPj b_X}cjhy[^1=4o4CX^j |4PgZY~>jh6j |4PgyjhY^=l4;SZujh_XS^u |41ɉ$HuWc^ |4PhUW$jXj_ |4)t]SVZ4}EEjPFV^XEE119EtMԋ 1҅t9t; tB F@܋Ekl9tH41҅t9t; tB Fl19t!4EP_ZYu S&ZYG19tPZtG}WfX1;Us=klE@0 t.Hdt'yt!U؋ Ph q1p8p4kUB19t4UW:ZYmUBSY_S}Z^u`S[Ohj]jYju8j]SZYu'S֌SiS jj^֍EPݛXe[^_]UWVShPVu hh%Vv hVWu $hh)%Wav VNu1EW=Zt/SSSSSSSSSSSh"h4jj*Y[ WVSXZ뷍e[^_]UVShPVu hh%Vu hVSt $hh)%Su St VSXZe[^]UWVS}11u܉54o4jj._ZyjVP7J e] |4$*u u^)uYjhb Y[,u>tPZt |4$PX |4$S|^_EScSDZYS<^_%*%S^5-77Yjj5-7%5-7nS5-7YEPj }tChj_jZju,jSZYu%*%̉SXe[^_]UWVS}11Eܣ4o4cjj]ZYxjSPhH xpu |4*u$tPV_XEV\[u4EPj ZY}t!hj`jju VXe[^_]UWVS1HH;E E8u EH1LEL0t < tLEL8PdY$}1ۉ889E S;Z9$PuSd O]1<%rA <%t)0-< u"DB@CC8uj PPS' P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< u0-DP@tC8u$C<E X1lSVR pY@ltJG9r7tuvQxFE 1ɉ^dWQ CE XZtNp1F1}uSS1 Xu5$`4t,Rh@&h%P> }tS ZSe[^_]o UWVS0u 1EEEPVEP ] 1EԉE܅unVh%E܍t0SE)Phȉ"V h%S ƒE9E؀8'uE؋E؀x*h(%uE ^_]EԊp<'uMCj'S^_E؃}u SY؉E؋Eԍ4VuAE_ZOSh%jT j 벍Jg<%u<@T)IB*E6j/Vu ZYDžuVG EXuVG E̍GE/X}u_HEu\ M܋}ԍYtqUĀx .tx uuW uˋU;2tEԋEԍRUu@EZYUWVE)Ph%E܍DPW y;2tVCXun: XoE܋M1ۉo]Shht@jQ f}ufEf}ufEPEt|e s+-7EjP5-7k5-7E6Et55-7!@j5-7K5-7~F-7EڋEEEfmEPuuًU܍Edh -L tE@ Eu ڋEE]^SESXZ;-7hPjjtS9-7ut h"XDu E_E@;-7u5-7趼j5-7)gDuAY]܃Ct P@Zu@XtEtV Ne[^_]UVShV [ZuYtPEj.VnZYÅuhVh4F] 'hVh4.] hCSh4] e[^]UWVS֍y9sjʅta}t7E t/t,0-DHuUQMuZYMUtC)؃~Qh%PS F1E ؍e[^_]UWVSƉUMjjj<à @t5$1UVjh4VF\ VuS Sd ؍e[^_]USPh4h%EPjh"u [Xh"j ZYttjh%S u؃h'%S[ ZYuh1%SJ ZYujh<%S t؊t t@hSh@4l[ u>X]UVSh4$4$h4h 4&[ =4tR)~4.u4Ph4gBZYt+hhH%h 4[ hh4h 4[  4e[^]UWVS1ɺ!idu$xtx jPh4yZ 1ɺ%idu$xtx跙 jPh`4?Z jjjà < 1jh4VZ Vh8i(SS! ugL8PhPh`4Y $8PXt*hVh`4mZ hSh`4]Z ·%Íe[^_]ÍL$qUWVSQ-P4T[hd%(Pj y,$`4t Ph%JA ^_h-h%9A jI h3Ƌ([1ۋ(?RXYX9h$WW ZYPWV| h$WW |0-LDžX -XtMQD$HDQVE uHLDAEXhViPX C (uV;W;XZ0iƄV:W:^_ujrjoY[ PDž$Hjj$V(Wh%: @u"Dž$ jjVWh%k: @u/ ;Psh%jP|YZt,뱸 ;x|s:h %jPP_Zu(hre^t4DžT jS5XZYt5t4zXDžT 9tf@ @ &+hujjjjjjjjjSXjuRL411PDžhjt`hPLϿh uLX#9_X 4hiPh4U jhF%h4t(jhB%h4 B%F%1DžPh" %j@$W jjPpPWY8 $@t puh4X&h4hW %h-jct8DžpjpPjj$V7 @tVh4 %e^[^1=4s(u=4lu 40-DJuPhC% ZYt;rPhC% ^X1hH$P&Y[hH$P_ZÅu 1DžPkjv<$1󫍽p!󪍍pi\^@u 1ۉ$Nhh9 %tVZYthh`4h`4jf=`4thh`4h`4hhZ"h% %0 Ãt{PhR %jh\hz %S]\h~ %SR\h{ %SG\$h %S9\h`4h %S)\=`4th`4h %S \ h %S[^_h %S[h %S[Sh %j[h4h %h(h4h %h$S S.h %h`4ZYh> %h`4^_hG %h`4Y[h8$h`4_Zh"h`4[^h(%h`4ZY=`4h`4h4hN %jtnh4hi %$Pj8~ $X$4_hh`4h`4j~-hJ%h`4`41ɉ @4hh %S[^h"_Zh4h %h %hDÃ3P @4h %\Pj_ ~h\h`4P \3j h`4襴 thX %\Pj ~h\h`|4\P \r3j h`|4R t=`|4t @4h %\Vj ~h\h4O \3_=4u8hb %Vjh ~h\h4O \2Yj h4譳_Zt=4t @4hh4vY^u =4u @4111hP$V2O hh4h4jxhh4h4jw,PV^Zt%@4Pu*jh4h4jytjh4h4jzetih4T Y=`4u=w jh %"P?w jh %-wjh %h`4[N jh`4h`4j{hh`4h`4j}@4u:1llPj豷XZluhh`|4h`|4j|VDžH`4=`4u DžH8$DžD`4=`4u DžD8$4=4u8$4=4u8$`4=`4uJ%`|4=`|4u8$HDVQRh4Ph4h4h"hV,=`4u DžH8$`4=`4u8$4=4u8$`4=`4uJ%`|4=`|4u8$HVQRh4Ph4h4h"h(jjjXr T%x PX@4RhUW$h hZ^L,XX/h %jktjK4Y=`|4hr"h" % XZu>=$`4th5$`4P3 hh-P3 j h3 %jTpWE W WPhP %hm %VT =4th4h %VlT =`|4th`|4h %VPT h %jATj\V%=4sh4h4h4h %j5h %h`4 hh`4h`4jjFj jh$_ZExN1jSEp(7 SuVSuVt~tg`PRQ^[^tEPPRZYtU6L8t,B8u"E@t$RP]^_uhl%EP%Y[tEXt p$l(h,`d04t:$VSa]_Zt'EPV4Ph%hSZ \EpFjh%ZY@mfh%h!%S~&Vh0%Wr&Wh<%S$W豸Ph}DS?S葸} ?PhM% t0?u'hZ%Î[_thm%P貎ZYu"XRhp%P$ tjj h5!#,4,0RPj$W S:0- tHLDJ@tSPWVhw%hFP迱 w 41󫍝DžƅDž4DžDžShQVjZ 4Džf=t#fyf4f=NE1f=FX!щ11Ҋ44t'w8X$'wX$$(uJ1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VY^ ?j!jAj.jj h5!#,4,0RPj#R (PW#RVh%hSD Ijj h5!#,4,0RPj$W WVh1$hS 0E@8@}~P# $uJ< uuƄ$jj h5!#,4,0RPjW SWVh%hFP` 4be[^_]UVSPjjuVjjh&@tbuK XtSjjVSjh&^@u SY2h(%SZYt PuU ^Zu S[ h(%j1e[^]U EEE EEhEPOZYtEU 1ɉMEUhEP%ZYtE1UWVS`NjEA w1h%wU ^ZuhC%w RZYth &3@[^G,Suh &3ZYt\tBJ@u xt@wt4 |4$t)tVP҉[Xt |4$1ҍ1ɉ9 |4PSdYZtXP,40Sƒt/t#VRЉXZu\RY8pu`$uVP҉XZtً$9jjjjhSQRPx jjjjhSQRPx h~.%Pʥ h |4PPP. hق"V蟥 h |4PV+. W(R[XT`=a9lhGPP- h_SV- Ah~.%S hwS- hق"S hwS- (uYh%Vä hVR- hwSn, Ph·%Sa à ƅG1ɋÅthyG"SҹZYu!Ph·%ja à uh#S蠹ZYthu#S菹ZYthH$S~ZYthT%SmZYthh"S\ZYtt hh% hh·%VQ, hSVB, ƅGw PV à {whUW$jj9Z؍e[^_]UE1҉UMU ]UEEMU ]UWVSQ]} E10$hmj6S=u E%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVS E 1ɉ1D󫍕D1҃=4o45-7萈Nh - 5-794o4 Iuujj_AXZ1Ҁt,DžfDžDž&+Dž=v Dž1ۉ11119tD5fDŽ5DŽ5&+H5=fDŽ=DŽ=&+BC8[ty1t1DŽZfDŽDŽ&+DŽBt1DŽXfDŽDŽ&+DŽBhjjjjjjjjjRPj谛Ã4uDžhuhUW$jJDžPS!tuiu5hjjjjjjjjjPj$ƃ4t@DžPV趐ZY^Hy V֛XS͛_u?t6hhPh´-&  |4-Džc=4o4yu4o4Dž<1ۉ4o49i8511ɉ9=4o4t9i85t4t(~SW譳YZoڋ`d4 |4ƀy1҉LPTXjSP% hCP |4"P% jSh8o4% 5 |4,, 0$4(804$ u1҉DHPWHDFP$ |4()l,, 0$4(804 uȉ1DH$=4o4 pH DH9jj h5!#RPjV jj h5!# |4$P@ RPjP $`48t$ |4VHDPh%R  |4$pvơ |4$0`RRVP |4Pjj:5Dž1ɉ$Pj行^_u65 |4h_u1Z%$P1$Xu@P4o4P5 |4 PA^ |4$JZDH-1ۉ,048DHƂ( |448<=4o45`d4g_t4Y`d4tu t4h>£`d4a1X@KyuƆy$tP,40WD$͋e[^_]UMw1vB ]UWVSDž1 |4*)Ph%hS l%t+hf/^Sh%h訽 jubhC% |4Ph12%hS襝 hC%ShZ%ǃ((hC%ShjlE0p"|11ۉR YZtsE;klEX{41ɉ Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CL_cLuПXZ=4o4CLS9SRV茍ǃSRjj\ 1jjB6u$&v=IC`,tPh%hV臛 Vh%P葾 C`,tPh%hVL CXtPh%jW. WVC\tPh%jW WVSTz"t$t#VPh%P CH@l%T%GCX,tS\tPh%hV茚 Vh%P薽 %p%h%Ps XZ#%v%h)%PQ _X5%~%h=%P/ Y^I%%A%{Tu)%PP XZM%%d1]l%c%NKPQhT%hcǃ-1ɍPY1e[^_]á |4*;UWVS ƅh%Nhr"hݭ#聊谇Ph%j$=$`4t" |4X芇SPh%5$`4趝 u6hx$`4Zt Ph%l ^_jj 3Y[h%W*$ |4[^1҉D)kSPGBZY;PdV P,P Vh5%W#TP,PA$T\L1PL9Phl"HPZYHuuRSb VP,TXhh1TRjPZ*Pn(P V^P1ShL%W" PAVYkDlEXC uDED;rC,u{Pu C0u tCLtċC4jjjjhVs8PRx 1҉LtL{tCH5!#DžHN%L#CP w$&=11DžPt $L#"DžP%uL# DžPl%hC%HEZY҃5!#uhLP\ S%PLhj%Sy؃RPh%W8!RPh%h%諄X11DžP5%11DžP#%<@hC%H胥ZY@v ExtSx u^~1;s}O19t }?;tBx(u PYFËEx u=Z&1ۋ;sx(u PXC1ۉ؍e[^_]UWVSu1ۀ~ tB~9s*ًx(u1;tB9uPXC͉Me[^_]e[^_]UWVSQ8ME111ۋE;Xs-E؋MMQrPEPL tu}CˉeY[^_]UEPE P0]UWVS}EjjjjhSuPRx u1=jjjjhVu WPx tVSh%he[^_]UE8b]UE,4Ƃ ,4*4fP*4fP1]UEPE ]UE E EE]ۗUS],4)PCC0 ,4R C*4C*41C1]UWVSÉM1u1sNуtX`44tJ}s<0u%1Ƀs1t0uAqtG,J EE띃}tB 3BB3EEZY[^_]UWVS1󫍵HEPE jhjjh-jh544jj jPSj|Ã8VPlrS}1e[^_]UWVS<Ɖ׉1E1;S sMQRUSPL <]UBjlu5ZY1҅E1EEE;C M9MMQuSPL k}lE̋UЉQE܅t8tjPQ HL >_4EG8EċUȉGh~jh%*hVh$V5m4hx MjW5m4h&h&hSjW5m4I(SNZt PSV MVlVjh5m45m45m4jjh%蕧Ã(xj VPS]e[^_]UWVS։ϋ1׋B˃1t.0uKB1t"`44 `44ȍYu1[^_]U1ҋE ]U1ɺE ]UWVS ]ju ^_jdu h%%P u h12%W{ 19tNi sQWV uΊa<w ~[BjjP:ǃ :1ɉPhd@W u u WܦZ`RhedAWdW輦`9< RFaPu h%%W) jjWSǃF s9"hh"4W@u W˥Xjh0%h"4D u܁="4usjOh#4Pcƅ_ OusƄWTu h_&%s* CRPh1$P $1u2jau h_&%s CPPv CtC @C wF-1e[^_]UWVSEEuu(&T& @&*41&ƃ`44@&u1`44@9u44j@{44j4{44j({44j{44j{ƣ44=44W茉Ë44$Uy9s}Ë44RU^Z9s}Ë44RUEY9s}V5Z9rVh5!#h%jjz 44EEe[^_]tU|EPuNXY1uE%;E Uh@uÀ=o4tuUho4h6%j5 t1Tu4hd4hR%hp)%hht45z h@c4hR%hp)%hhk4z (ht4sZ1Uhu.UQ *4 *4u0EEE jjEPh*4jEP*4*4USh$TzhJzjjJJ hp$hhp$hh[%j S SXZ]UVSP]u EPVEPݛ E u Vho%j SSPh%jƘue[^]UPEEPjeEZYtMu4DWgh@b4Php)%hht4x 8gh@b4Php)%hhk4x (1US 8PhC%q [X1u?9t3h0!"SpZY¸th$SXZY]U ,4Sh ,45,4h%hh+4jo jh+4h0"S (fF-~PeXYtSuPSgXZ1e[^_]UjjAXZE< UEEEEPj[EUEEEEPjZEUS]0SnEpFnEEEE1EEPjZE]US@-{/ttPu~ZYuC۰]UuZ¸@d4uu4UWVS hٴ%EPh Y[$5!#EEPn]SuhW %hBnEPWYEhn45 `4h:%jn¸uu4u>ZE\URuh@b4PVSuhX%j"¸$KEtVSf V%zà E)ËE9th%h&h h%葃Ee[^_]UWVS EUˋujQEY_tG UR#kuSPQÃtPESXZEEe[^_]e[^_]USj$uQZYtD1ۉ]XEPjhjjj EPS荶U Vt;M rj$S뱋]UEPM UXUEPM UƳXUWVS 1҉<P&jƅPh%V t#hjh%h%j %!hjh%h%j )%Ph}4d Wj&V  Hvw=4uj輒_1-Dž-Džjhh$jPj(Uu1 h}4h-Wݢ 5!#=-u.h}-h$HyZY5!#u=-u%WVRh4%h谈VSc =4uj̑XDžjhh$0iWj'T-=v4+=@`4=}4hM%Wc W h}4Whp)%S Wh@`4hv4ha%jڇ$VSh' %jWhb %j讇WE VSb Y^DžWj)SXZX=8o4tZ=u4tQ=}4tHhM%W7b W h}4Whp)%S Wh8o4hu4h{%2;e[^_]USڸstjSn ZYuSh%jʆ ]US13tjSn ZYuSh%j芆 ]USS1$tsf1EEPj%REZYtt`Huȃul"hH%fX t&jJ hH%fYXKuh%jTXZ1]Ã=!4uiU!4 "I`}4%:4%+d}4#4[5% }4r "4]USE] tP7fYSjQxeXZm4E]UWVS18Z^1Dž@DžDDž<jjZuWU2ЉXt0tp}4haujPjP_SV tl}4uQX} tExuh%j老Y_}tuSh"%heǃShK%hNǃ V VXZt-tt}4ShUW$hajj@=u4t=t4tSho%j E@`44t x}4e[^_]UVS]u Stt uhu%OXu%C%2u%jjPVSe[^]UWVShhR%]n4_Zt Ph%& [^h}411۸@-P/t 8t`44u uA؄t h}4Dž@-{5t}4/z;i`44\l}4u1uSZYH0l}45t}4j5-7`5-7@5-7=3|}4x}4P5h}4h%ja_1u4Pj wKtu`44|}4uf|}4ƅ1N1tσ0u@/u(Ht!ȿ1`44uƇ`44Bƅ뼀t/|}4'tju ^_`44tx}4h}4u9uh_ju 0VR5l}45|}45p}4Ph%h^ jjY[}u%l44h%j}XZo44tkh%h}^_Hu%h,^jY[th%j}XZh5%j}ha%jw}l44l44hC%LRP urh}%eLxRP uT|9u;xt8h%h%.Q^_th%j|h%h%MҴ\[Oth%jT|Y[ju XZ1e[^_]UWVS-{t0u1#W3(PYZtWhUW$h\ ك1ujhXZe[^_]UWVS1h%$KPhUW$P ytQPXHh%JPhUW$P~ xh%JPhUW$P~ y6륋tP:XuhUW$h3[jj跪_xP heO$` à t航^ySRhr"PNXZ1ɉu|SRW貃uhUW$h3)[jjBRh-#Wqz ZYuh$uj t*WhUW$V$ ShWU u<=uDžSQVQ_XtqA[^u*ZYtCh0Zj^_u2Y[tjh2.XZ1 jh3ިG<1؍e[^_]UWS]S 1E CM [_]"Uu uUWVSSu] V 1EStitcklЉE1}9z4u@lM9ut@FjlP,‰FXYt*1}9{4ukl4 @lM9uܰ1e[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF;s rEtEȋỦEUEЋUԉEU؍e[^]UWVS]u 1V,ZtƍCڍe[^_]US]s Os$GXZCE]6UWVS]1;3s8klCxdF@0 ttW X9sklS9zduBd@1;3s>klCx4uFtWXF 9sklS9z4uB4@s裼XCEe[^_]鐼UVSjhPju(t)uu PX @ut0SPt0Z1 S>Xe[^]UWS] 1Sh|duw t#S;S t%iSR3莸ZYt3ֻX1e[_]Uu hzd@u)UVSujhPjVNt(ju jPV+S~y s01e[^]Uu hedAuUU EHJ Ju B%Ep%8e[^_]UWVSXu} ]=T4hKT4P ZZY9T4}T4hcKT4PYZY9T4}T4h?KT4PYZY9T4}T4hKT4PYZY9T4}T4hJT4P{YZY9T4}T4jGJT4PZYZY9T4}T4jHJT4P9YZY9T4}T4jIJT4PYZY9T4}T4jJsJT4PXZY9T4}T4hOJT4PXZY9T4}T4h+JT4PXZY9T4}T4hJT4PXZY9T4}T41ҋ;Q$s+k UA(0IPYXZY9T4U}T4BʃT4F@ u3{4g@ =dmY=N=p8>P dmpEMt0t(t h5!#5T4h`%v苙tstZ~ tS4C8u%uh u hH_hPRY[P5T45l40o41RPssiRP5T4%5l40o41RPs$s iRP5T45T4ho%v裘=5l4C S$CS 0o41SQRPAiRP5T4몋P ]uC( PGP5T4]u CH@L؃PGP5T4]uCH@LPGP5T4a{uCHpX5T4{uCHp\5T45T4h}%+oCHP`u&h#GP5T45T4hf%vsOEERh)%jPHG hFURjPà P5T45T4hf%v(S軬kfx5T45T4h%vCH@Hth%vݖXZCH@Hth%vŖY_CH@Hth%v譖XZCH@Hth%v蕖Y_CH@Hth%v}XZCH@H th%veY_CH@H@th%vMXZCH@HE %FEe[^_]%fnu%CHP5T45T4hf%vI+{jPMQKQWsPRdk B(0`EMQP5T4hf%v貕0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4I8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhH SPXZ1e[^]UWVSu jFHP]S jSSjjjjj KH0-E܃,11t]DS@uu@tA^Ht҈Uth#WITZYUu CcL'/t C/jWjWSi FHHL1e[^_]UVS u vDh)%j ]SC j SSjjjjhG0SFDVHB`1e[^]UWVS jj%趤[^9hBC ^hBCC^hBC C,^ E1҅tuB &tME4}GF ^u/UDEjh譌MEZYU}B}$w"uuh@BF ^X}$th%h&hh%AZjjjjh&^hjj jjj%SjM8ƃ4xu Pg.V9Sاe[^_]UWVSQE @4uE x8u-u uxXZttt =t ujj ^_x 1҉j4&U茋G `UBXYu؍{shAh AChAC h@ǃzojjjjh_hjjjjj SjM7ƃDxu P3-Vs8S褦1e[^_]UWVS] ;G(S119tuklKI0΃@jj h5!#GOOgRPj!W c jj h5!# A1҉SQыcRPj'Pb 8uth?jPPV E@ tP?jPPVZ 5!#u h?Xp?0p?'QWMQVRPpjjAl4,jB=?SPh1$j -P}? l4jC?SPh1$j :P[? l40j->SPh1$j GP6? jD>h> EMYÃsU4'MZ£U4~ް-T1~CVƄ5T -߉TPh %jPhU4> j.6>hU4P5U45U4GP:P-PhF%hhU4D> Dh$CXe[^_]UWVS] |4$DV(Y_TV$ C8@@8 QPVRL YB r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhfhajj7jjjjF)ƃ4PV0V)E)PB89B4<藓ZPufLW WPF8PP8 WRPQLP $A!%SZYu,Z4]U E]UWVS41ɉMԉM؉Mܡ |4f([ |4$u|jjjPkPÃu1 |4jjHDjjPtϋ |4$KC19};DH} DH |4$}ЃEȃ=(Z4uajj]Sjjh-py1ub(Z4Zuh-hC!%Mp ^_jjSPjh-o1ۉ](Z4u9}MkT UWuZYÅt FuMŨup |4840h%hJEPEPEPuCxtuuuh%h>150Z4EPEPEPuIC~(Z4wL3Mh/hY CSEȉUjheRP Pusss shT!%h(hMĉ 0Z4h0Z4j,F 0Z4u/EEԋEE؋EE܅t+EPEPEPu,APUԋPU؋@ Eܡ |4$tuuuR |4,jhP |4$tIytCf(u9PH[Ht' |4$P |41҉$Yhh^X]9_~GL (Z4AEȾe1Puqqq qShR!%hEX$뱍EPj-EZYD(Z4D0Z4se[^_]雃UWVS5,Z4t/uujP6 SgthjbXZe[^_]UVSE X(uNpƋ0VPsjhSà uhjj ؍e[^]ðUE1Ҁ=,Z4t]]UE} t=,Z4t[1]U čha!% hm!%j!EjjEPEPjh-k$@tEU th!%j XZøøUWVS,uEE1(o4,o4uFVEUFVEUURURVЃ tԋ 0Z4EUA |4;\`|.}t1hjq[_uCP@^N t9Ӊ}ډȉ(o4,o4 (o4 ,o4EEЋEE̋E E11}E,E1ɉMԊ MˀuMJ}uE9tEԋMu}t>MJ}u29Mu-*}tMJ}u 9Mu }ˀuGE }$vE0EDr%=uu r% = uuS% = t;}yhjΏYZ|tT0Z4t&@t 9t90Z4t@u%}*h7j袏YZ-OOBOu5(O~% E tSE (!%~ v$ t!%~ v t "%"% E uW!%E fUu)8t$EU |4;\`|ˀ}t4U uWNE (}uƒ ҅u uuth hhXjeZuWhUW$h!"%V艎e[^_]UWS0]}ȹ 1E1EEE =,Z4ujjS@ jP4E܍EPjS@e[_]UWVSM 1 |4f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuh/"%j]UWVS4}=,Z4PklUVE 0G^ZYE UlVSClPH11CC,C0CLCPCT |4$F( t1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC}}w1] 1ۉMԉ]M]x(Ã}t*3M 3] uM ]M]U9uU9u y;u U| 9u܋U}U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á4"UWVSLEԉUȉM]E EUE}ԋwu}9UM}։lj]19؋]| E1ɉM;EE}HuuWV  t4EUuuWV );uE}u}]ԋEUCSEU1҉ŰEUEU]9]E9ƉMEEEU)EUEE1EЋM9M#} E؀x @11ӉM܉]3M 3]$M]] ]9u܋]9ƉE9ƉUE9EEM܋]Ή߸;EE#EUuuWV& );uE}u}E9Ɖ]w)]9؉ы]}EUEЃEE9EE]|Eȉ0xEUAQ EE̋EU׸;EE3u}uuWVk );uE u}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]USQMAQRPRPjjjjU} IuEU11ҍeY[]UE]US]sh&%j ]]PUWVS]} j/W> ZYƃti)PCDPW$ ƒuNV`~EJ9s4t'19ty u9t@e[^_]Uju EDPXUEvPEDPu l UVS]=ȃ4u ȃ4K$9C |`5ȃ49s sUjjjjRPRPU t39r,1tu{(u t @9|1e[^]UWVSU}119y u 9;] u}t uz(tt}h~[nЃu"9uǂǂ1J Z$1ɉƀJ C@]t&%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVSZ41ۃ<`&t9jS2FFXZSF w&ӉӉƃ"ue[^]Ã=Z4uUZ4]øZ4UWVSUu}E EE9E sX11ۀy u9t 9] tC9] r8@9E}tMa}w}uWrVi 0}t.1HR}t PRhZ&%PRh_&%WV R}t PRh%%PRh*%ԍe[^_]US]uhmG%hP&hhd&%suLX]]hLUWVSÃ=Z4ujZ4u1hujjhjjjAjjjRVh襼E4URPHu膽V+}51Dž<Dž@;us<`RVSPL t$hl`d<@FjH&4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV)׉<@8ڋE"C t @]fCEf@ DP:Xe[^_]UWVSEMt]X$[ EXUjS%EZYtI-Ut#E@$19tD BMNju1ۋE Ee[^_]UWVS] Ep+s8k H(L9tWIw\hWKQVs4RPdhWWjjjj@(48WVs4PRp Vs4RPh 1e[^_]UWVS0] K4Uus 0RQPVL Utss ssuu3輥C S1e[^_]UWVS0] K4Uus 0RQPVL Utss3CSuuPR|EU+CS;C {}C S1e[^_]UWVSDÉUEE1uu11;{ sGMQWSPL t2EԨt+M؃9u#F}y tEċUȉEUE̋UЉEUG봅u*}pƋ0VPjhKNtY}yS}ttURURSЃ u1pƋ0VPjhVSRYt }WSЉXZe[^_]UWVSPuIh=1҉UU:ÍU.WVhW %jjjMQR9|ڃRjjh(%1e[^_]UWVSl}1E EEURj-1[_|ËEPRHEU |4PLEUYE9ƋE|EEE 1}EjP4E̋MEjjuuuu0o41ҋ}9=0o4׋u}EURPjEPQEƒ01EUEUEUEUhjjhhhj6jjjuSj{ƃ4u S$ZkEPVVQS$}u#EMQ]SP @u uXUEEP tB]fCe[^_]UVSR] 1ɉMS4t&uVRP u uXfC<1e[^]UWVS] E@fHPR0_usCthpWm@ ƅhWWjjjjp t%RWP@ZYuX붉Ɖse[^_]UWVSLu}1E EVUEURj-CY[tUÍ}UE;P s WRPQL hjjhhhj6jjjuSjj4uS"ZwURPEEP7Sh"}u*UE;P s]SWRPu uX1}t UnEx fFe[^_]UWVST]SSPHEU |4PLEUZY1}9M|EE1E}u{3jjuuuukMeRPjEPS,HEUEĉUȃ}uuujP8E؃ jURS @tQEM;M qku0}u jjuuuuuujURSЃ,Hu1~Uع1EUEĉUȋEUẺUЋz!EjR4E؋juVStVPSRLƃ txtjuuSe[^_]UWVS|] |4tf(ttuh(%hH&hh(%0xF54o4t\UP^4hjjhhrhRjFjjjuPh`]4肰ƃ45P^4Y20艹Ep||7oxwajj h5!#jh0jUR#,jj h5!#jhjMQMQURW|xu |4PjhqN@h$ |4$0ظE |4$pEEEEEU׉ u11MQMQSЃ UtEfEEEĹf@ @ #@f@@4=̃4w@ f@*@,EhujjjjjjjjjQRh蹮ǃ4t P苮@,BEPWKW苯Et11!UMQWSPL UuG;{ r"E EtEuEȅtօt1hIjHY_u$`4zPh)%-" S3ZujhQ_XO:jS[^JsjhsO |4@u ǀ@>U1]1EEPVXZ}y1Q1҉u1Hùxt%| q1@ 4S-|GEE;xrB;Us E11ۃ}t E;]sP,C_PYV觭5P^4XZ}e[^_]UWVS0EDž}uEl̃4jS ZYt jS^_uDY15jS_Zu[^ƅ1;̃4Ѓ4} tE 9[uE(u)tMQRYu';s{Љ E, UHD9Ɖ}djj h5!# WVjWhpƃ 3WVPhI)%V5 V[ ƅ3诳P[ XZ00@ V_w%tDž111=uhnjj h5!#E,}H,DRPjVE$ho觲RjPESY Ɖ<$T2 ‰$SP` S[Xf SC $f <$S" WV9r$hT)%h&hh(%uձZ1hjjjjjjjjjP|Ã4tPS_X19s <19t4U@YڅttV8Z,! tSѨXe[^_]UWVSljfDžv/ƅujhH%Y^yhhH%S3 y蝟t&蔟8t芟WPhp)%hSٰ hWSR3 =Džp!j/S"h _Zt-xv9tH9s8/t@Q): YyߍxPWDYZ%=puT>hQW iƄ/u%蔞QPhW %hSݯ %hQSS2 =@uW^9 ZuhWP2 =hSS Y_1Ҁ;/u 1Ҁ{‰hS聽p<$mZlhЃpDl=w4uhhC%SN2 =whWS82 =v ?V _y VgYV ZVNX1e[^_]USÍEPSBYZx7Et.jS/XZxj `PS t SY1$S`Z=vf u]UWVSEUP ^ƃ}t11ɉMV+ Zt{fx vX jh*%S+ uSuhp)%EP @u hi[#f) 3Et}tESWuhg)%j+u[zV XEEe[^_]Ujh*Gj UWVS hv)%11tY+ڸ)%xuڸ)%wu#WSS@XZuWS?@Y^1yah)%觛hPS/ WS@1u h)%聛PSh)%j,Sh)%j7hS@h)%ShPP. WP,@u'h)%S蹚PPh)%jh)%hPSX. Sh %jtPh)%h)%jjuhw)%SDhPW. h)%S'PWh)%j-,h)%S hPW- h)%SPWh)%j,hw)%SؙPh)%jMh%S赙Ph)%j*h)%hPWX- h)%S|PWh)%j(hv)%贙hPW- hw)%SByth *%S# Ph)%j' h *%YhPW, h *%Sp14`-Php)%hW vtpWh)%jC utjh+*DXZte[^_]UET^4fP]USE@k `&t!`&ShWE 0ͪCX^4 ]UWVShƍPhW@j荪@1jh*%_ZRhW@PD 11!tVk `&`&u Dž"BVPʸZYu=T^4DŽS GjjjjhA jjjjjj!Sh˞Ã4tjPS`S蠟Xe[^_]U詖X^4tPPRRRh*%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡ0o41RPSQJRPh#j]SL ]Сl4EԃЃ7P٦URjP:jPPh`^4) S  e[^_]UWVSĀE@kl} GNjE @u FuG u G08uw0WEU1EEPj ĒXZ}E MQw8P uEP^G81ۉ]E ];Xwk]lE X{8tIC] su19Mtklu ^c0AO0u uu ]u]u tu9]}UEG0uW+EUu FV}t ]U]EUWE <1e[^_]UWVSd} E@9E Ek] lEpF0t0 tfA A B}lj@&fG G5GG G,G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{`S(xE+C$PR)XZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQP覬YZuk{8ueEC8EC4FV SVCEpxP@EU(o4,o419| EU)AQ1&Wv @u1]{]4VNUMEP$@ EU]9]s#kElx8uyP@P b]9]r,1]9؋]|ZEM]+HX M]11~8u(V] ]9E]|V1]9؋]}yV9E]}jM9MsWM]+EUuuSQUUMNk]lUMʋUeʉT EUVEM]+HX M]11ҋ]9]sV]9]s kul7T7]9]s kulD7T7 M])ӉM]19Mt1E9t$E9t8uW t G0u)EUAlʋ}9}}y{&к 9ʺsbkEl}GËSEUu}+u}uuWVH)9uE}u}u}EU)SE};xM] uuSQSы}ϋUʉӉ]u9ދ}|}9׋u}ȋU}MOQ)EUE@EE}EpxPEU19]EUC<S@9Ɖ|]C0EU9ƉE@9Erk9EkElU‰UM]) Z19ʉ|EXH 9|1ɋEHE0xP0tqP0EH0bEUӋEU)uuSQыU2zk]lu΋Uʋ}TE0xEPuFV e[^_]UWVS@PEU 80%W S0pƃ 1z t 31묃u1돃ty  ?VI$$@c)((A6,,B 1ɉ Ph#jSPW jSSjjjjW*[0St ZSe Xe[^_]UWVS(]}h#uVQ _4XYu81ɉU&MVP eZYU9‹M}ƒ$uӃ_4} E $&h4?V Wtjj"V_h5ku20o41RP 0wRPh#jEP2V h6&tjjUYh7u)tjjUZPhUW$jEPU h8t"u h#jEPU h9t"u$h#jEPkU h:bt"u(h#jEP9U h;0t"u,h#jEPU h<TVP_4PhY%se[^_]UWVSX1ɉt @@_4t4t=$txuP1$Xytƃyjh}/%裬_X=4ԏ4|uÐ Dž81ԏ4ktƒ8B1;8 8.T8 RPhp)%hWS 5t41҅t8t%FWPcZYu Ɔyԋą`d4ƀy1LPTXƀ);ԏ4ǀ,ǀ<jWP hW`d4"P =t4u/`d41҉t4h`d4aljY t_t4tByu/t49ut4ы9u􋐀뺃G5t44@k<Љǹ1󫋅PB qsC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB q$CsC C8RPL u;H ruكtЋSO_Wk<<󫋅PB qCsC C8b]1fD @9s=d}4t1&󥍅Pg^&󥍅P6[=4tcDž DžDž؏41҉0&󥍅PY=`}4t1D&󥍅PX1B eTB n_4yFHfGe[^_]UU J E]UWVS0EЉUĉ1ۋ9}qGE̋GE11ҋũ<tw9tMBu9uSuhAV%jEP{M 5t4tFURP]YZtEЉChjXZe[^_]UWVSL4ppp h/%V# h/%V_X1L4k,<PXR0PRE GPZYtcOTt[8jjjjhRQPWxL4؋QP :jjjjjPqTRPx Ph#VJ 0)h/%V)_X1L4k,<PXQ0PRD GPZYtcOTt[8jjjjhRQPWxL4؋QP :jjjjjPqTRPx Ph#V^ 0)L4p$p pph/%V*h0%V h %jV@ j%9L4tPh0%hi uqL4tDVPh00%hhuKL4thE0%hh u,L4thX0%hh u L4DpC1e[^_]1US]1{u4{ t; |1C4dv"{x[]Ã=48UWVS`1Dž114P~Y5t471ɉ$;H QPRL t tt߀8tPRbB RU /thC%Rh~XZ4 QR+ ZY9st6t-QoUZ]UY99}tt$;H s41VTD 4$Vhp)%hPvF 545!#t)"PPA XZt4PtYVfPh)%he488  RPVhq0%he$tt;,($ PRPh0%hbe$!PRPh0%h?eu&4@40|81e[^_]1US]1{u&{@u1C4s" {x[]UWVS_4t4xtt$u ƃxaPYt0$xtEjjjRt1PZu#$`4tSh0%P5I pÅt$`4tSh1%1=d}4'p4P_p4p hV"S K8u8=`}4tyjhg#CPM ƒu]K0L4Cxt79Hu211Ƀ|Pt |XtFB,@uVRp$h1%p9ue[^_]UWVS8E$C } yB11E$;X bMQSPRL tEuuSuƃ C19E +=d}4p41Ƀt7t3:t(}9z@u } 9zDu}1r@B AHă=`}4E L41tT}tNEQP1}t,;u(} 9zu}k,1ۉ\Px@,0u @,0uFp맃=4E ԏ41@8=uFtC}t=9Q<1t%]9u] 9Z$uɃ}t k81҉T<@8=u1e[^_]US`d4; |4tt4t3t49ut4ы9u􉙀[]UVS0]u$MQu PRL t>41:uJ Jt @ =u_k 4]ȋủ44BMȋu1k 94u94u94t Bu1҉444e[^]UVSMU194u4r94u;t = u1[^]UWVSGDžt41|?1$%$;p WVPRL } t} t!} tWVS jVSSx k|<$tjjjjjtVRPx|ǹx󫋅tfDŽDŽ&+| Fhujjjjjj |}@Pjj|Ph/Ã4u1}?PS%S0 |9ṣ_4k<}Ee[^_]US<] EjP_4ZxD1k8|<u$MȉHhNhT>jRjKjjj@PVh&ƃ4u _4w1=_4*SVVD' =_4uL |4$t>t4t5xt$h`G0jY^tjjXZǃ=_4؍e[^_]UB=4tuh2%jPO UVSuu1r$ugjjjVyÃtjjHDjjFPt$ |4KS;DH} DHe[^]UEx8th؍#h&hm h2%ZF@UWVSQ} E@E19u~aEX=su8u?G8.=ru8u/Gx=muWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$輖$zuubPrYtWWZtNjE@ u WV_XWPV. tjVSE@ t VPZYVXjjSƃx_4 e[^_]UWVS] uUYP}Ĺ 1󫃽PuPZt苅P$V_xt2jjjVǃtVYt P$VPHHLd 1Zw j&RjP8x u0h؍#h&h h2%CR1t4Q,1t9E t @11tt:[]UVSQMp@19|hc3%h&hh2%(09ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s6SrY;C K$}%jjjjRPRPU Ɖe[^]Ã=_4uUhђfXUS]=_4u1;_4s k<_4[]Ã=_4uU_4]á_4UWVSSÃ=_4ut=;t6_45_419t$USF PX'ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}hx3%R'ZYuj juZC,S0h3%V&Y_uj juZC4S8h3%V&_Zu0j(u Y^ƅj)P _ZFh3%V&ZYuEh3%Va&Y_u j(uh3%VF&_Zuj`u@S肘 Oh3%V"&Y^u>hf3#EP) XZt(&>ttVP%YZuG C<e[^_]USPQRh3%EPj3~-h"uMEjh&P$t2uz[1Eh-#EP XY:tjME+[h"jLEZYuuzX]UWVS1jhPjEp:^ÍPhd@S  @S\=EP,[1Dž Džƅ ƅ tfÃuCt=ut2Ѓ  uuЃ A떋Ex@uS@4tPh3%P葕 ƅEpPh3%j3t1EE@@Ep0Et(pv0v,h3%j\3V1y1ɉH0X,t(Eps8s4s0s,h4%j 3vE@61C,S0Vщ‹VZ*H{09L;C, P{89T;C4 PCPW ^_;t' Ps0s,h"4%jB2s@\PV"ZYt$Vs0s,h<4%j2q{XZƅ11ɉh"j>^Z{ƅ1h-#P XZ>tރuJtjaYj jVyJ t*t t/j jV1JKj jVJ u7thh(%P hVP   h_#VZYuDG8PW<G4&hm#VRZYu)+hP#VZYu)j h&V t򉕨hje^Xۋu0 jY19ȋWi[j`RC@P贆 C,S0C4S8 u+t)CQ RPYZuƅu_, G 1E u" G1ɉOOO_O _$UWG@jhRjPLƋ_,tjP4tKRPPs0s,V0t'8t"P艪 PXZ@8u ǃC4S8)G W$q1ɉSh|dV iRy_ZugYSh|dVt u܋1;s̋G,tpH,9H0u0;u"H49H8u;t밉jSP BuV4*Z1e[^_]UP}4t 1=4]USÉIQHQH QH QH QH QH QHQHQHQ0h#RS ]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk&W uu wu uRCu1jSk&V諔 u%u vuւ uًU EGue[^_]UWVSu] t>u1}WEPEPEPEPEPEPEPEPEPEPEPh#V4 u}w1M9Mt ]K1ߋH X$9} 1҉P P$ )H X$EE}Uz=tVwAtLw"Q w=RX<Á@1HøUWVS։M11ۉ9uuRjSP07Gуt `d1ɉMMu]썜SjuRVPEЃc}t09tGE}t"MM슌 MtMuʋ0tt9tGEC01e[^_]UU 1tEMh]UEUUqU ]UMEPЃ< u1tE0]UE1҉UU ]U EEEEEEEP}U EXUWVS]xu,P4x1p3?J} @0P4x1p3?J} P PH1ҋuVi13k?] 319[^_]UWVS u]}1u܉]EPU sZu tX5%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EEPEPEPMȋUEaE )EЙ]u)։]u]uEEEPEPEPMԋUE Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋuԉMʋEeƉωؙMʋEE)׉ t/E Et'EPWVuuFEE Eu}tE}}5E؋EؙRPuuAEU |4DH~1ERPWVuuRPEE]ÉUӉыUe9E1EPEPEPMȉEp xKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9ZXeY[^_]aUE]UWVSQME܋A1҉UE؋E܃0EE1Ɋ t.}uÃt&<t" ,1ۅu9ut@u0Eu1ƒ< PWEpWMUE{11҅xE1ҍeY[^_]UWVS,U$}(E,u01ۉ]]]]]]1ɋ]9ً]| E1ɉM܋]]19U}U19E}E1EEU ẺUЋEHXE;E9ME0juQuMU]M MȉE@E1;EE }H1u}u uWV)׉;u} M}EE)9s U)‰U1҉UM1ۋE1ҋ};}}܃}uu VN^ Eډƹ19 Ee[^_]UVSEP$9p |$1jjjjSQSQjURP>,1҉Ѝe[^]UWVSuMU ];k _(u/ȄtaB 19t Bu,1u.R E@M,9du 1dd[^_]UEUUUUUUEUUURU UEUUE1҉UP0UURsU UEUUEUUP0UUR(U ZUE1]US]MEE k B(u#1tAƒ<!Ѓ;ukE U1uQЃ<![]UEUUE1҉UUURU UWVSÉ΃8t2$41jVRs $Rh{dЀ3 jhPjR:@ue[^_]UEP0RPNUWVS]E EC0E1xp@u |4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@u}WuSZ yуtu G{0Ea;hh ZYohS9ZYa }U׍e[^_]UWVSEX01҉U1Eߊt]}tttR<tNwtw A,<vy _4CFU,U9u _4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU P 1]UWVSUE}u NtGtRutG_tvpS_ GPh)%vS# FD64t(vtvPSrj e[^_]USR] =_4uj EPu ƒ =w uE8tt h7X1kD44u]U U1vEEUEPU E7ZÅt*UVS14LFZuSLXe[^]UWVSQu>xp19|h@6%h&hxh6% ]9|@89@|ue[^_]UWVS0uU= |4]ډ@E =~Mȉ\1ɉ`Uډ@8;FF| FP1RPz~ tjURjVPL tWEċUȉḾ1 u@dž9|Ӄ!lj! t9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E E thK5%h&hh6% hj"F^_&uc CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RPK@ǃEPu9^_t!ẺEЉEԉEȉC1҉ ؍e[^_]US]=_4uF1Ҹ;_4s)=w9t kD4B1=w kD4[]Ã=4u ^4UWVSƉ $41󫋅 EU RPVh=3%h4P# E jhPjVm,xShydPI @u V X1V jSuWe e[^_]UWVSlu] E EE$EEPSV EP߷ډzXE8t%E8hX6%h|&h h6% 1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}t }t#1A}tPh12%%uPu d "}tPht.%Ph%uu[ ؍e[^_]UWVS8Ɖ˹1jhPjVz*1ɉDž11؉1u51 RPhSz =|=ZbƋ!!Љ u9tEXH!ƹnEXfUtƒ<<„t <uh[0101ff=Ut f=u(Ћ,D1ɉNu1󫋽~wRXu[tO ttGEt%,MPP,1RW P腅 Pشx rt6t%F,dDž $t tW9,sAu1hji>^Zt1ɉF1*1҉X1u1fǃUe[^_]UVS0E E thK5%h&hh6%V hj=^Xu1E u CEUY~11ɉKKCSǃ?ǃjh>RP@ECǃ1҉K0SUE^@uSAhރ{ u_C$9S }NURjSPL t;M܅t44t,41@=tD9u=uSXe[^]UWVSSMӅtY0uƀ1҉8,0)߅uU,)ƀX[^_]UWVSP}U] J3ȃ<tu&`t$[ch\XQ1EEJE,K1CB C 1CtqE1ƀEDtP?1҉TY}`t01`1ɉEǃ<t}tAu1ɉM1EE9`uƀ1҉vN09MuCt:j6%29Mt΋0ukE00,09u/1O0t0uu 10M`0 e[^_]UWVS,É11@jhRPS#"yPhd@ @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< 󥋅EE 1h1󫋅,t20t"uh؍#h&hh6%  u/ƁƁƁƁƁƁ} }t~1É1uvB? ڈD>1É1uvB? ڈ49 fDžU1 uAWVhPx30J12XuWV%)׋1҉!!Sb9uE9u=H!؍SS:ș[9-9!X؍e[^_]UWVS]Euh6%h&h .1uEE}lj1Ʌuh%h&hh6%? s{u}Ɖ 9uE}QRuu K0S[Puu e[^_]UWVSÉЋ{1Ҿ44tBt D9u3{u}s{ u}u}u}v}t t4M1;})ωxMH PC u hk"kE UP XZ܍e[^_]UWVSE }Ĺ }Put&4u{}1ɉt4t_41 h6%h&hh6% D9t Gu]u1ۉ]]]]E1u)E6%}vuuE}t8tރtu݋M\Z]1ɉMZ1]u뼋u^0]M Mt3] ]tu$}rEdu uXM]M9M]uUMUMUMM9M]uP @x|EUx|EUE9}}}EE`ut.1EUEUE9EE}}ދ0Ή1}9}}U|s1EUEU,Mp1t1ptM9ȉЋM|/9t+E9EE|}E1hj1EZYEfǀUƀEEE1҉RPtpu9uu|H1+EUẺUЋE,ujPE}܃ t"49ttPt5Wgw 4Y_E0Z}w1u}RPWV )׉E9Ɖ}ME,}ȋ})1ҋu}׉u}uĉ}ȋx|9E}}EU+EUẺUЋEujPE}܃ t"4t9tP4Wv 4XZ0}9ugucE,9EE}Ohj/Y_uEct4}},fǀUƀ0Ë0}00UMыE`E]}v& }v}b}X]puu;u}ʉUHX M]EEjREpRMUEEE1ҋ]9]ЋuEEM1ۉMĉ]ȉ$tuNEEE1҉UH1ډƉuuRP)׉}9ǃ}U1UĉEȋEċUȉEUEU1ҋM]M]9ȉ} +EUẺUЋEp0\EX}T>uuuE}܃ t3UŒED4Ut9tP82W+t }UD4_XE\FhqjjP 1}?t;_uE@EuՋE1EE1ҊG9Bt<utE0E}tbExt99BEXEtكt&t!9B1ɉME}tX̋E돃E9\=,ujSE6}܃ 49P0Wr 4XZЍe[^_]UWVSL]E EEEuC,t)uC0EMċUw-:PX{,BC0EMċUHu1uĹ 1jjjj1RP1ҋ};}}EURPjEPS,tEUEĉUȋEUẺUE؄4jVSUE uaduVh`&suuuus&C,u*E̋U19}'SjRPuus &C, X({,tˋC,tPC,e[^_]UWVSdE}Ĺ u^0]H441@=D9u€t 1ۉ]1}t ߃tu‹};} uE@uǃt"9t}h?]QEEM1H1EUȉƉSQRP)׉u9}1UĉE11҉uts;E @˃tuZ}`tMt;E ti@EMt˃tt9E tA@E}uы0Bp}t E7%E}U1ɉMEċUȉEU1u9E8ƒt<E`EUEUЉEUMEu49MEEE}tIMtƒt6<t2,AE1҉UI1M]‹E9‹EU}0n]уtt@uh؍#h&hT:u09EE}}h}[UUűEЉEuEEE,EE] E9sEjQEpuMUy}$Ed7%]]1ɉM1҉]ĉUȋE19u֋M}ẺUЋEuuWME]E EE t];u ǀ]܅t'EDt9tP*Sl DXZEt uDEt ]TE9u/Eu;hqjjPq E̋UЉEU1҉}ttBuh؍#h&hl8EM]M]։u1}9΋}})щ h6% E}uEgEe[^_]UWVS]uh2%h &hk h6% Es0h9tSME M9u㋶0u͋EtP?^C,t PY`11d)FZus(X]e[^_](UWVS}G,t PXjhPjwl Ãt7WjR4$YXtRVS,Vz(S}ZWXe[^_]UWVS\E0h^_E0h#jP]Sx jPSSj S Ǎ@^>w̋E0h#jP]SD jPSSj So ƍ@[=wʡ |4EHDEU}~ E1ɉMRWuuSVRPމؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ |404}81HDEU}~ E1E}u?9}/jh>uu=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ] |4480h%ht}WuVEPS$xuuuh%hqWVEPS>tuuuSЃS,e[^_]Ujj jg j PUSL P $5!#PShV8%h-T j@ U=-u y-4fPftPNZ9-UWVEE왉U1E}ujEPjE e^_]U0E E1EԉE؉E܉EEEPEPu ƒ xEÍL$qUWVSQ@@u5jh4cR 44󥡨4444XZjP,R 4444+44_X49}944s74󥋅441=4uh(jjE(t!j$jjV =4u`h"P 4Y[tPhUW$hP x4419߭y%ݝ݅ %߭ٽf f٭۝٭y1d~dVho$)P=PP Nj4~-4t P` Z)Å~:ùdh5!#)Sh`&Pho$)P=P ǃ119ʉst @u4H&SQhp$)P=P茻 +44+ 4y @B%ڽ߭ 4419ظw ȉ߭%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4H&%11d PVShp$)PP 449lj44)ލ 9lj݅99Ћ}h6p$VQ à +44߭߭ٽf f٭۝٭?~~h)p$rtPh"VQu Ãh(%VQb à <ЙRPhCp$)PP) Ãuh")PP à 4fPftSVP7 eY[^_]aUS j X]UWVSPu ]Ett v9s 71;uuߋuE9s$;ut:GFFPhGH%jWP ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=0-DWtDOt uxu 1!tjjEP6  FCE덉뉉؍e[^_]UWVSujulZYt&Vu PW19u 7؍e[^_]UVSu huà @tuuSS؍e[^]U|EPuI ZYtM EUQ1UWVSEE 0Vj Sw DžuVjSe ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U <v }D&7Ep Vo YƒwCljt)1E@EȉC,ub Ex txj(Zu h&M3XYǃ,f@S(P1.1;,s$k(рyus1(D@.u e[^_]UWVSSƉM׋ttU9t7{ t1 ufujuPC< t[뼃 S Vh@:%~2 e[^_]UVSÃHt1HL~tU HXPF 1LXPt1PT~t PYP 1TZ`t1`d~t `XP 1dXt/tV1I,X 1҉Yt/tVH,X` 1Xt/tVH,X' 1Xht/ltVH,lYh 1hZe[^]UVSTjjjVmD@PjVj48@t@сt t t48SVQkXZe[^]US]E ftPh&h:%/ jP t(@t H h&/YE u1҉U E].(Sh?jPe#@uE &E,:%]I/]US]E ftPh&h:%7/ j|P t@ v|y n 7`x |ZxYZt>1҉Shj"@u;E &E,:%]x.h&n.XE E]']UVSĀptQPhhxVj@u h&.XV Shk:%- e[^]USË4%uXh:%S諔XZ{PtS0Ytp%tSLt:%Ju+#PS`XZ]UWVSÉ׉΃t t%:%t1PSۮS]jS|Au:%tґ#PSXZe[^_]UWVSÉ֋8 Ph:%,1ɺhXZu:%VS诓Sjj$1ɉK 4%ujL%XZe[^_]UWVSUM8tt^@@tR{ tGu}  t1҉CXZ[^_]USÃlt1u?hvPplPh:%+RPXZlu]Ãx tkUSË%u6S_% Y u=uSmZ S.YuSX]US]SaYuj#XZIpQpcvPh:% +j#ShLjdj"]UVS]E ftPh&h:%* |)RxP uh&k*X;|t xD8t|x苐hx-E H 1tf -yhx-j j Y^x-Px- Sh?j@uDE &E,:%e[^])jXZu Ee[^])"e[^]UVSjh%ZYuh%hj|#)[^"VP5(ZY@u Vh:%(ZYSMXe[^]UWVSPu~ % tVXtpE&%Et%`u VYE%@u$t+`u#V,Zu}V,Xt%e[^_]UWVSE48ځ` u %t8tf% tW*Yt ߉%@ tWl+Zt 翉%` t떁1u ځ u@\e[^_]US];(%P6(jjb&jjY&4]UVSS]4@tp%@uft0t0VY%t1҃w`&R Vh:%&SvSZ%tw4`&Vh:%W&[^8%th;%e&jN Shj4u^%@tTS,-1ɉMjEP,@u h$&"&Z,Cǃ,Xe[^]UVS]h{"&48с^t:t0t~ u h:%V莌YXvj\XZe[^] @48]e[^]6UWVSD]u Ctt,PCQPhj@EP藖@uh &E%EYE{ VEPW3buVWh(;%$ {EtSj@VCxP VWh:;%$3'`U D@RWP_Cx3_UXZe[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3^UM   t*;xMu;0tQhR;%#11҉[Y^{ tHEU  Ѓ t3 Z@uh&#Xe[^_]UWV։ϋD@WVXZe^_]UWVS]%t S &_u Sh{;%"Y[ % ڋFEj EPju{ }PWh;%"M1҉1;,sYk(jQMuP, Mt5j EPjQ?PMAPuh;%#" MQ~G럋 S3Z@uC Ph;%*"Y_ t{ uS\2%ZtSdX{ tSQ_t>{ u8u %҃RS虡ZY@uC Ph;%!Y_t { uSZt]e[^_]e[^_]UWVS(]} uS$ESẺ{Ls$S$ ({ }u }s uJS貣Yt?Vh;% SSdSǤj3ooE ;%]e[^_]酇Vh<%f h:%So11҉ 9C$u/S#Z@% 8E&e[^_]G jjSn"SH#@u躳 8t h& _1EE A]e[^_]2"}{ tC uPh<%Ph4<%Y^{PtRStCQEЍ}ԉƉщUS苢CtZU9uPEPuY) t{ t911҉{ t411ɉh+#S3SGES6]e[^_]e[^_]US]C Pt$ZYts$sLP ]]n UWVS];1{Ly)tC$tjjS 14%tutEC$u?tS!Y@u h&xZjjAS @u h&]X]e[^_]US]C][]3UWVS ׉΋U K 9}!E4UQM诣 YZMUtB;u t9{ ;u u{ t|EUhI<%SvjjM%tuuS %tS貞ZSKSX+9t'C jjM$S [e[^_]UWVSS] 84%@tjE1҃ t6HjEP,s @hD&h":%_tm>hn%h<%he<%@t+XRDAtxUhU<%h^<%he<% UhU<%hu<%he<% 1Uh}<%h<%he<%p 11h<%h<%he<%Kt [h<%h<%he<%<J@ulh<%?Y_jjj衹 KPh<%3<4u544%u dW4XZe[^_]USS]E uPh&h:% jEP,謷 uh&j4YuZ8t$h&h<%vj,,\ǃ, _w$jPh&h=%j6U8tu h:=%mYuSRXZ]US]E U{ u)C щ‰ { t][]~[]UWVS ]]} utSEtXZu ڬ w{ tC PhO=%f=%^_CStP }tQSSh[1pEPjEPu Euh&YASuxXZu= ~ WEtKYXt3{ tC Pho=%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh=%11ɉtY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu ؍e[^_]UWVS]DžPPhh D @uhl&h=%)1XZh=%%Y^1hPF1׃ u Vh=%XZuL 87tB 8 tt Vh=%^_\XPS+ǃuhl&r[ttlHp VW ZYu VjS ϋFVt=PVF PtZYt%VhHjj 7u7W1FtPV2VP~ t11ɉ3Vh6WtPtStPS| e[^_]US]E ftPh(&h:%a SӡZ@uDǨ 87u ]]豨 8 t觨 8Vt蝨 8tE(&]]UWVSD}U uMtNˉUMPV ZYUtOMv_B 7 }E X&Eo"e[^_]G(1f9u2W>G(1f9uW>uxG(f9t& tʉUQPG Ph=%UfW(W>8uHUPVG*P  Utn uG>j u G>T tGj%qj%O _>t G*ˉe[^_]UWVS,}E EЋEE܋EE؋hi>%S ^ZuEE s>%+hz>%S֘ ZYu,EЋ@0S辖 ^@E] EЉEe[^_]h>%S虘 ZYEh>%S聘 [^u EЃHo1E9}E4V Y\FS3EZE1ҋE9}?E؋ UQM Ɖ$MQu] )KEƍ@E UB 뺋E@uh>%uI1P-E 1E111EEM̍EPh&h>%uuMtvkt@(NtT4tW6uE븃UuM@몃ptxtnu딃M뎁M녁MyoEcP-E%@4@E܉E1E11ut0tX~ tMڍN U9U~!E4UQM贖 ZYtUBM9]uuVju EvjEPEp 萬 uot0tR~ uvڍN U9U~!E4UQM2 ZYtUBM9]uuVuQu @u414E@t轣 UE%  9]u%}uUMhjQt8EE̅x ލW u9u~E4RUR ZYt FUEЉUԋEU E Uԃ}t}t}u}tM 1҉EЋUԉ/tP9]u>t9[E4tY[tEX]9][tSu؋M܉^XZ9e[^_]UWVS] U1{>tNf}fC(ffGfJuj ȋuFZK>s*S>+Ee[^_]UWVSu} lhfF%hPVqà t1=whlehfF%hhzF% <5 8thfF%hUW$ XZhh[u h&r huPY1l>u?G PhF%( tXZ{>u[C PhF% XZ1hDPWhohnRPhnRw =nwHƄn ƄoPRhhfF%V׆@u-h&hF%~ YXhtjWhà phthF%/ Xϋpe[^_]á4tU4P4U4]UE@]UWVS]u }uh G%h&hG}t}uh\G%h&hHh.G% tu 4 "t 9ptIC ujYuTHtAJHt6BXCpf@up MH1҉PfxCM1 K뽉Cȍe[^_]UEM uh G%h&hh.G%= u y t 9Jt] BH@MUWVSM Ep}y1yy9s)}_+Yy tʚ;1Ƀ}t}[^_]UWVS$Ǎ]SjG EPGPShEUЋG uʚ;)U܃tHPU1ɉM؋]9ڋ]]s 1҉P1 ])ډPX )9s tJPMىH 봃ue[^_]UWVSU} uh G%h&huhyG%h&hh.G%褖 }ʚ;vhG%h&h܉É΋P t9zuM9Ju JuK$݋S(tJtHK,JjYtcUUrEB zEBEBC t&H9r 9ux 9}sHJP1C$BS$1e[^_]UWVS]U Eu}xx xʚ;v [^_]É}u M[^_]USEU M]]]] 1ۉ][]nUVS]u E1MMMM i@BU[^]4UWVSUuuh G%h&h|h.G% B 1ۅtI} t} 9xu5}9xu-t9pu$xtyz$x18z,xB,C볉؍e[^_]UEuh G%h&hh.G%q U PH@LUEuh G%h&hh.G%B @L11UEuh G%h&hh.G% U P0UP4UP8UP<1UWVS(]}1EO1E@uh G%h&hYh.G%贓 1҉ỦUЉUԉU1;s4s,C0 I>v ԙ  DFu EPjJ @u11EEEE1;s4sjEPC04y @tF1e[^_]USjPj[ZtÍ@Pj6C ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tg>U t9FuV9u@uEFtB.NtH C1҉KNt R1KXVXs@1s@sDCMYC t6HtJKHPڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]gUWVS]uCh G%h&hh.G%e 4t,4H44C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t0zLu%1t]UWVS\u~>u d VvR 7EEEE1]Mu EMQUE UJHOuԊEEjPS PF PhG%F>PSV}(u V*N>׉e[^_]USEtS1jS[ ]UE t E]f ]USEtSS[XZ]UVSEu Ʊ9tt ut1t 1@1[^]UWVS}] ?jWS[ s jWVC wmj:VCW ZYDžt?EPjhjjj jGPDm C8 }t菎 UC8jVCP0- Z DJu <:tFu}Wjhjjj EPVl C0E t/it.u#Wjhjjj j@Pl C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WP ZYt[u{y 1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPjURWPVsu ju`(C*WtE4%@u1t(SsZ@uhLH%AS SwC@SvfCDCCHSu @t CPCHC pS_uCL1s@CX_XnƅRe[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[e ؃4[^_] US]SvqZ@u:jhj @tjhj @؋]UVS t=΁u$B Ƅ Ӄt ӁtӃuӃ uӁu [^]UWVSljQu ZuhX&LÉEhf3#EPV ZYtfPB XuhX&S2[_LUj@PV UuhX&SUR q7SXe[^_]UWVSSƉϋ]jhXH%RUt UuA}H} L @ð`jh\H%R.t u>MP} Tð0M@} DKS0CPp}7uMU E$e[^_]UWVS EӅt΀9uE1҉1j/QJ Y_DžuuV _ZumVhcH%2@EEPjj jjj jud` }tuhzH%2Y[:t SP[ZuuV腀 ZYt/1tE0Xe[^_]UWVSÉUQMiq YM<9"u"OAIQMjϫXZMt3t 9us 7QS蘫Y[1҉U}u9tEtCE9KEp9ush4#S&k ZYudžEPjjjjjjSK }Sh I%ZJEPjhjjjjSAW F }Sh*I%8%EPEPEPEPQEPEPEPMԉډ 8%CEPEPEPEPQEPEPEPMԉډ jSuuuuuQt ShFI%fjSuuuuuQujSuuuuuxQ볁111otq;tlj/S? Y_M̅tU@j/P? _ZDžUuًE#ًE/*O1t1ۉEEEUEPjjjjjjSۣ }}ShYI% )‰U썄jYu hvI%R9  T uhI%oj,SR> _ZDžtxu ShI%V9u:K j@Yu h" t%Ɔ EPjhjjjjSS E, }t hI%_ )‰UčEPSt _ZHUu-t 7L U䉔) jWY ]̈ T <4t{4u  ;6t{6u @C빅EPjjjjjjS }!ShI% ~LHL+j,S< _Zt Sc P U$UwYUSh J%RP7U 1ɉWкY}Eu Ƈh5hN%S%e ^Zu ƇhhJ%Se ZYu ƇhhX.$Sd Y^u ƇhSj\E^ZPlӶEZYuhl&^lSPpY[{u Ɔ 1kh"S[d _Zu Ɔ Nh%S>d ZYu Ɔ  1hJ%S!d Y_th$J%Sd _Zu Ɔ Sh,J%pt$ jٺ@[u hCJ%1 EEEU | m^O@8%'EPEPEPEPQEPEPEPMԉډ jSuuuuuJjSuuuuuJjSu8%EPEPEPEPQEPEPEPMԉډ jSuuuuuJLjSuuuuuI*jSuuuuuIjSu,^j=SA8 ZYu hLJ%@Ej hgJ%S` up}u11҃uM#EEEUIj hsJ%Sw` u}u:1ۉjhJ%SJ` u0}u 1ɉM1jhJ%S` t@jhJ%S_ t,jhJ%S_ tjhJ%S_ }u'jP%XZWEEąuhJ%OE@MEM̍UE@u E "M1ҍE@tE WB#XEPRU,2EPU̍BP2EPU̍B8P 2WURP%$1ɉjhJ%S^ }u'jP$Y[BM1ҍE@EW{"Z61ɉMURPEb1URE̍PRR1EPE̍P8RB1WEPPH$$1ɉjhJ%S] tjhJ%S] uB}EPjjjjDjju辙 }`uhJ%j hJ%S] }uߋEj/uo4 _ZDžtSuj~ Hu_Suj~ HuOƆEPjhjjjjGP }t uhJ%uhK%11Ƀ}^ٍUE`j/S3 Y[uEjPJ JM JM ٍUEsj/S3 _ZuEj P  J M J M \ETPT'E߉EEUEEEU  %EEEU Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ Ɓ DžtG1ҍEj@P   JM ^Åu  8%t EPEPEPEPQEPEPEPMԉډ jSƐVuuuuA" g 8Sh3K% q $eSX $Y[ hl&> 4%tu hK%fF@u Sh\K%  s d X @I : + uhlK%V EEẺUЋ4%t%E̋UЉ1tt hK%E̋UЀPt @_t1j/S. _ZDžtGڍEY@uShK% 1,E̊EE19M k(Pu*t,Uf9Pu#U8uU8PuU8Pu U8P A밁  K  @ED1HEL PETXE\EċE18E1҉uZ }tEHM Eą hK% EH$MH(MąuhK%}tdƅu Sh L%r EPjjjjjjS, }t ShL%C FÅtMh-L%k1uLƅtFj:S, ZYt8URjhjjjj@P踑E 1}̃}t'hG1EMċ 9sM9 t>{t8@,9tt(MMċJ]ĉ k,1CC C$C(S_YE{ECs Cǃ}t uEO ZEủ)1 E}t5E- }t }EEHh@M%`" SX^ud}ShZM%@dMA2Džt @he%SP ZYUĉMȅt"he%SO ZYth%SO ZYuEċU ẺUE%E̋EȉEЋE̋UЉhM%SO ZYu\u hvM%30uQWjvo HRhM%PQWjJo Hu؉߅ h%WO Y[thM%WN _Z@   jٺ[u hM% nbV@JEPjjjjjjSw }ShM%tzEPjjjjjjS? }ShM%QtEEPjjjjjjS  }ShM%PYuh N%XZjE@P( i(,P,k4EfFFE̅tHEEFEFEFF}u!1}F1uFj/W6# Y[Åt/uWjl HtJWhK%1}_X/uWjl HtWhK%}̉XZuf~jCEPjjxjjjjS螇F }CShJ%FY[-e[^_]UWVSEu} EEEE1ۉE싀&tM܉UVPK ZYUMtCnuFE샸&uu u EY#DEEEE} &EEe[^_]E8%uu EFI%e[^_]e[^_]UWVS]}1P-} t]%E苃%`E?EPh&RuutAjj5Lp7PًU E=ƒu$E8E%>%t>%뢺} t*%Ƌ䟉 u }쉳UaUЍe[^_]UWVSQEE] 1 t 8t R褟ZP蛟X1t 8t RyXPpXEtu7jVu| F;$0@%8tjjVt txTuxTjP僻DtVr,DX@ڞHXLtVE,LH讞P_TtV,TP肞XY\tV,\XV(KXZ]e[^_]:e[^_]UWVS0uhdj赙ZYuh|&X9Áǀǀǀǀǀ@ `h8&P48Y_tt %t 4 4up4@4jjj? tP%` 4 4Xjjj tP_ 4 4!D_ 4 4ЃhF+P Pr =v1 1ɉ} !8%j,j@_Zu h&!Y ǃDj,jʗH_Zu h&Y ǃLj,j螗P_Zu h&Y ǃThh&W裸 =vh&h,N%XZPPZYh-#P' Y_t u-PP1҉xWC ZD9t t ux\tH@ߋ@D1@DHLPT1HLPTXh\l1X\hP0VA9u0h&ho" ut=w@ƄS0V!91 1} 11PP}YZh-#P% ZYt u t:RA YD9t֊ t uʀx\tH@߅tC%䟉1h8$6C YZ} uj`@Pd5 u>ju Pf d`7 Zuh&_G`hI%B ZYu;}uPiB Y_$h#?B YZuA}uPB _ZutDž}tuhHN%A ZYtOPPًU mDžY1ɉLu}tSV=O XZ1+u؍e[^_]UE E9r9]UU19U t]UWVSǃEE1fUfQMbZUu8؋Msۍ;ƸE9EsOƋE)Ɖr=89s "@G19r)SEЉ‹E9s )։1e[^_]UWVSSU uJTuhP%h&h~TuhQ%h&hhP%G YLGL9t)cCu)U QM<W<ZY8ËMU t u7F|B|u t  tAH+GHu9r9e[^_]UVSjjV6à tSVS ۍe[^]UWVS8}1}عEX}ى‰+E pE؉U EPW_ZuUBtt U Btu VSZYe[^_]UE UU E]rUS]hH&Pxh&ØSg]US]S$ Y1t S Z]UWVSuh R%h&hhP%E Ɖ׉j<|QS" CPqtS8jhP%B jjSǃ t:jWSƃ }tG9Et G99EuWS W* e[^_]US]t"jjS tu S@T06 ]US] UHSuZY9tS7H X1ۉ؋]UE PTuhQ%h&hhP%A 2PuUWVSSEuhR%h&h;hP%A ӉϋBTx t*tSu迿YXu-4STZt׍CPF^t1sCT9FTuwFt ;CtulSV* ZYu_FttCttC8PF8P ZYt>CPFPZYu+֋CT@$uFx9CxuR%ٺ%tR%Fts5cٺ%tR%vSj7Y[@uF 8uw롨tCtt&Sj6_Z@touF 8t h%R%زYVj6_Z@u!SF 8th4R%趲Sj6 Sj6ZY@u%F 8thCR%舲X1VuXVu ؍e[^_]UWVSP}tDjjSƃ t)jVSE 9~TuVSV uӍe[^_]UVS E uh R%h&hPTuhQ%h&hhP%? 2uhRR%h&h߃}uFƈPVIXZt1SVruhjR%j uV& ىSne[^]UWVS8uh(&]SͼhH&EP迼hH&}W豼u WV[8$th&hyR%_X14SVZYujEPjEPe[^_]SVZYt1xjjS,à jSEPECT x t8hS_tC8PsTt<ZY@u hR%AXS;U t0C9t ;E SEPY_ CT8ESP衻XZC|twG|tڍEjuEGT9CTuG8PC8PZYuЀ{Yu Cx9GxuCXPGXPZYuWubW <Et(SPZYt`HT9KTu 8PC8PY_ 1ɉt8SEPSEP9tB h&SXZ]PV(;_@uvB 8Vt hR%ٮ[jjWHà jSW2EC S9;U tSWlSEP*u~CTt 48%u=t=ٺR%{Sj2ZY@uA 8tA 8t h&XSY]';E ASV輼SW9tSA h&赭SXZjjuV à uUWVSSljӉMЙ1Ʌxtؙ)ѸFE)عy11X[^_]UEuhR%h&j;hR%X: Ptt @ /1UEuhR%h&jQhR%: Ptt <@ /1UUuhR%h&j}hR%9 Jttt8? /1)z 1zuz uzu 1zUEuhR%h&hhR%\9 Pttt-? / xjh&P蝵 1UUuhR%h&hhR%8 B<t<tt>)? /1z'1zuz uzu 1z1U幀U E]UWVSu] }uh%hx&h{uhR%hx&h|hR%Q8 Fu#<u;FuFPhF$WSS @u612WSPFDPhÃVWSPFPU Ã؍e[^_]UWVS}] uhR%hp&huhR%hp&hhR%7 GS8t)R78s<t<t1&vvRS Q躳 e[^_]UWVS(uuhR%h&h$FE<t<FVU1TF1 G!)JO9t< B@t8t}19sF8}Єɹy$At}!u}@]9s 8t1s< /^1ۀ=4uV}ع1E׈E4S}W=WV&thS%h&h'hR%5 4؍e[^_]UVS]C<t<t< /g S؉U Y=4t154S6Z;E th S%h&hnhR%Q5 4Ǎe[^]UEU uhR%hd&huh.%hd&hhR%5 fPUWVEu uhR%hX&huh.%hX&hhR%4 fe^_]US&tPh:S% XZ]UWVSD1}]S4Z@j0S51uuuu}WS51;5@&s/D&H>v e:  DF1;58&s/<&H>v ,:  DFWS?5: 1҉u uSjE0EP ƃ S64YEt 9 0e[^_]UVSuEPu V$ uVj ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWhBS%Vu 1Íe[^_]UWVSU} u19s$@u9s8uhHS%h<&hC؀xthS%h<&hh\S%2 u1X9s%UjKQP t؋UGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`P蘁XZ- `S X4%@t _t^Fhv#YuS%PhS%S @ PhS%S @uWhS%S @dlhhS%W) YZu@htDžphxDjVYZuGDžphS%WB) YZW2' Z|6hS%W) ZYuDžph:%W( ZYh+#W( ZYh:%W( ZYh;%W( ZYhr"W( ZYhf=%W( ZYuh:%W}( ZYpDžp Džp_t@F PhS%SY @pL&tPhS%S2 @84t pNdX؍#tT%Rh T%S @VL%t e$Ju1<%PhT%S @ZvHh'T%S @BFPPh3T%Sq @(v$hAT%SY @VʨPhLT%S=@~Pt?vtFQPhhtR@ttRhUT%S @~xu=4%@J1h(&tPztXY#FxPh_T%S @uRz u RuARToX,QXtPZYX9TthjT%S ZY@jjtPԮƒ ttqXjjP赮 X9u-BTX PhUW$S` @XjR뛉Xh(%hUW$S5 @Xu^jPSj{ @Dh:%W\% ZYu-dXT%؍#hS%W% ZYh:%W % ZYh+#W$ ZYhr"W$ ZYh:%W$ ZYth;%W$ Y_twpulelxOpu VZ;puh/hxDpjVpY_؍#T%؍#Ph{T%S9 @WhT%S# @V2uZ%u6u_%u*PhT%S @ut:u%uȞ@t>(WtY%uPhT%S @ubhT%S_Z@Npubll@lq PVh)%ST@d)%h@pt!pNVh^%S 1huvh@Lt㋍hqPPVh)%SN"@urpt)ptptVS,ZYpujlt l@u1d lqPVh^%SS@d^%QNppuA 8tV _yhpHpDVh^%S\!@WpCPhUW$S @tXd 0uS SY^u h0&蜛Z#_tFP`P u,h0&lX_Džp؍e[^_]UVSË2;tPSd e[^]UWVSQ} utu=GL:%t +#Htr"}tE1@ۅt"a1ۃuZ xut@xt:HHu 1HH}tE-@uCt WhZt!CE}tS%EE@t]jW[^t WYuu"Ep}tS%Eƃuًt 8u1W Zt^}t8EgÃuˉ؍e[^_]UVS]u tPހ~t9- :jhT%SO uS2 S \ZY9rhx-f X1e[^]UWVSEE} u |Uƃuh&Y[jhT%W uu Ee[^_]E1҉UWPE PhT%EPFƃuuh&ho"a jEPV6 @u + 8th&hH#&1ɉM^_Euƒut%hxD%hU%WVo `PPShs>%hxD%hU%WVE u.P9r)ǍGPCP$ZYtۍP9r:)e[^_]UWVS EP華 EE[tF  >SP ZY} -];уM I+ѻ}hf3#EP ZY;tjh\H%S ujhXH%S uu1;}1u1;} uJul% [EPjjjjjjS^R }tG,9uSv  ZYEPjjjjjjSR }u9G,nFul}$ d!ukX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9!1E؉EErE,@x k# VuQ9uuT# "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms " 7뎉ߋM_.MIE)M܋E9,}v" M}}9]ttC }Ut;]tC } t}E[^_]UWVS u }EEE]1EE9EEEPs2&&Csy7Ku-y)‹ 0-DAt/rumr^s ‹ 0-DA@t! t\tFx+B 0-DAt/t U4! Uu=k ! t#w ! 7f\\Ev\0C0C0SEttNCEqt(tsExu EE [^_]UWVSÉ׉U.ƍPSrYZ@WhUW$S @}uSj=* _Z@u$p h"S @u@ s=Vu hV}^P~n sVu SA> _ s Vu SF=  uE V* t.Vu PhV@VhUW$S?sh#S,ZYsE1D0t<0u FuM )tSP Y_@u|u } 9K;} u@tPh)%Sj ^Z@u3tPh#S @G루tffPh)%t&ffPh#S @c t Ph)%@tPh#S t%7PhUW$Sx @sWj.VWj4 tcVhUW$S< @tQ?tGV%EP @u1ɉMQRhBS%EPp ރ}s1;{ U؉E@uW63h&uhFV%(}u/}u F OW63h&uhrV%膇0FuDv s  YZuuuPUEf@uW63h&uhV%!UU)UG,B{(}{$1;s(sUEk,D t'EPjjjEPjűEЋEt1҉PF‹M9tCB,E;S(rEE)E؍EPuuЍEPEPEPűEЉǃt:s$1F t Mu뮉UPWuQuuuu UuQa h&$Xe[^_]UWVS]1ɉK{1;s s WF,Z{$1;s(s WF,Xe[^_]UE UMMU E]DUSE UM]]MU E[]DUE UU E]DUE E]"J UVShVu$D =tu11ƄVjkCXZtSWU YtVPLCXZ؍e[^]UWVSÉЍ4 1ɉt19rv -}tJz}1҉A u1[^_]UWVuhV%h'hօuhV%h'hhV%  xuxuP uf@ e^_]UWVS É։ Et A@E}xE)ȉE9|s'UWt[ZYtnt|UzuvRUY^U苃xt lj}t21MExzt1 jRՎXZȍe[^_]UWVSu  É֊B<t<<BfBt&U׉DRtĈY^Rt:S>uUWVC*P舌 U[҃VSYm_Zu VSm[^tRXZR YtPt~rVS荌_Zu VSZYtX /1  ؍e[^_]UWVS(E̋A tӉ΀ytu xVx}WY@$1FCt}ЉF tCUfCF t#UԀzu ztK|@FtC8F t CXUF0CxFftPEtZ_ZF tU tUԋECTt14~t  h%EtņCTZYuՃe[^_]UWVS8t. F1Dž@jB UPPavfDž ˉhPhiUp UJ>r*hPhip ,؍e[^_]UVS1ƅ@ CtDžC8P^CPƋƒYu9)Zu)CT@fCXP5_u tt uC| t Cxt(1ɉ,uCT1fDž @fp׉މ;tHH tut󥃅 TupVXZtHHt'CstHHt󥃅  t'CXsXtHH)fSP @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP&X@OHuWiSY1CPWPXZ$jjVSjLPW@u 8 넋H؉@D@9DDx9@sS DD9@r׉F u]dERuGu:Xu h'gwX?$RuSU ^_u1XZ]]V@UVSË%tJC><vBD&FTttT9t0t&NT9JTuu < 뻋@À{>v P ShW%>c e[^]UWVSÉ։h,j9ZYt:PǀcScufǀ,1e[^_]UWVS0ÉRi^@u PhX%XbY[.Gw*hH PhX%)b %th, Pj8XZt@dtVWv<u?(9x u1Wt cScuGhu @F @(GH>A<wO*󤋅% t&x utmtdf@ tStJSjQjPSV9Ѻrf‹fP@TȋG,CD7LJcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$tQ~DcScuHu ~<u|t2<t&)ڃ*f@6Vt4L7Pu"uJƃv9C,m@1;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃f9 ffC tHGY u<)9dCM A 󤋵 \ tC)9C= A󤋵 \tIt @W uD@Wt"@W uv tD)9UC< A 󤋽 \ttRC4%u+@t@Zu)؃fPhPƃ tt)߅tPjVPYY9qQS  C{fCWVY^g0Q COt/t+V Z@)9 CKt tRG%t4@^u()؃ftC uO t>P)9rNC A 󤋵 \C))=+w/D@ PhaX%EXE3 e[^_]UVS~\jhxPF\ uFo 8u!5L-hzX%WY[ Sh'ho"W 1ShjpK@uh'h,:%sWXZ1e[^]UWVSE}uhX%h'hhX% Ӊ΋S IuN EEE싐%tZt Cts mjSu@ u3@C CXJP S@p@P& Z J(H J>r*󤋅uK%t9 t/hQQ@PPPB PhX%8B>u1DhQPB*PP RhX%Rh '.SXe[^_]UWVS$Ɖ1iu1hX%Rf.-Xfth$SPà 1GiPV RhY%ARh$SP6Ãu 8t8iW Vho"uR!w h' VhY%hR 1`64%@u"j5S,Y^@uƅS$Zu h'QX뢍lj󤋅e[^_]UWVSS]Sj8^_t]u1ƀ8tCP<$Ztlje[^_]UWVS$ϋEE Eh1Y%R ZYu}]ƅP $#Xۋuh4'PYuQVhRSV+<@t-PPm XZuE4'e[^_]P1j6j4a@uƅw x, "j@,Ph@hW9uMWPh "6WPh "SVhFY%N$v "t$u)PWVhYY%`N(蹆PWSVh6Y%6N ]e[^_]F*UWVS] 'tPh0# XZE1E;s31;Et k, 9t@v 6hfY% PV脹G,1;uts 3hfY%a PS^F,܍e[^_]UWVSEvpE E] P1}tEu軅SPhQ%u @tBE^P蘅Phn%ur @t E9sT;] us< v! Juj ZY@u؍CT9UbW "ujn ZY@te[^_]UWVS]u }~EHt t4PWhV)@uxVhUW$S Ut" QSj ZY@tǃ7PhUW$S[ @tE)uSj [^@us 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hpuԋ@E܋E E@_tE@o^'EPjyMԋU܋E 5^XtE5!#,EPhMԋU܋E Y[EnY%EU1҉Uw|MUu fX1E}UċM1uGEEPSsEPCPfEPC8PYSu谖 tEE99w< v YЍBEȉD9EM "1E )уȉEU@t~TCtE@Tt 1ɉMEPj!MԋU܋E XZt؋Euэ<1E9ECEtu !Xu EEU9t M;At;A u1EEIʸy,%=tс1utȉE@uFtEPVԡEPFPǡEPF8P躡Vu ]E@PEPjMԋU܋E Y^u1҉UU9u XEEPW-EPGP EPG8PWuj ]뤋E؋E%u3E @hu$uЋE PhrY%PHE؁ Ee[^_]UWVS(}ƅj4uM{Y[@uƅEXuX uExlSPu hY%u@ujuMH^Z@t'a1Pu hY%u訡@u-S1P-Pu hY%u}@ujuMZY@t,E#pV~Pu hY%u8@@ ؉P~Pu hY%u@ut Ex,u@GhElPhhS>Su hY%u贠$@ut 1;j@E,Ph@hSSu hZ%ud$@up;s VeC,X鋇@1ۋ;Ds Vu,Vdt%F$;BuFhuPwuPSh&[%?v$wuPSh&[%?E苀4E%t*FHS%hS%WЦjE8~HuJFt.Fhu(VJ9Hu~<t>t FHa%FHC[%>u FHJ[%FHQ[%~0uF8F4bWhv4jE77Whyv8jE7(Whv0jE7v8v4ShW[%>$E䋀~@uH%u>ViRUSh[%>vvhUR7 @Uu Rh[%>Y[^hE䋀t=W[2Zu[E苀8E%t]h;%F>jE,7 >vHW<7juWt(tFdFhӉe[^_]g_e[^_]g_UWVSPuE EtuVjj 6(tl%ub  CiP61V}@ t;{t5{<t/s$tPF Ph[%C=1ɺVjj51s p1C Cs`CCCC 1CCECHt V0Y1ɉKdChuṾXZs1CC C$Zue[^_]^e[^_]W|$wUWVStEUM]EEu\PK?_EPT%[%u'Ht :tRQE Ph[%;1ۉ]EPLt @v@}GLih Eu>ZYEE1}m5%EPT%[%u'Ht :tSS$RQE Ph[%;MUEE@iEEE@ht 1ɉMExdtj$PuP% t؋E@$EtˋE@EPWS u{4%t ShH]%5[^jWS t jP&ZYF MmFuWS uho]%h\'h hX%  FdH PF )Ft'N V$vX]e[^_]e[^_]ËJh1ɺBUWVSËN t9At E9F$E;2UlPC Phz]%4FiP3EUu~@u kUjRS EtjPn%XZESjjv,E%tBFH:%h:%S48%Y^ u-j,XZShjj+Ee[^_]UWVS(Ë4%Sjj+V BuB EjEPS u2N }vuu܍EPEPWS%BPt3t P)#ujP Sh]%2SAXe[^_]UVSËu<wPh*PBP45 uhx  X\`\u TT1ҋTX#DT9 tj`9r7TbPh Ph_% \X`#D`9  `T9`rj5dohYZ@u ƅo4\`%th Ph^%)XZn o`< uBHvWdVh^%WdVh^%`  uWdVh^%uWdVh^%1CLDžXXX\Dpt;jXdhZYtWdVh_%.XXuDžX`m\@6@t:j6dth-ZY@uWdVh _%WdVh1Y%!dhƃ tPh Ph_%e(V; h4%u$h_%hCiPh0謢hhsPjhCPu CP+WdVh_%;C@FC$CD1C<wPC*PEP) u%C PF PhQ`%euMU[뚍e[^_]UWVS8EE] }uPYt99s&}E EE P'Et`%e[^_]|)WPSGW nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉgfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMк EUfҋEftuUPE Ph`%#(fEfu)T3EPE Xe[^_]UWVS$}E ^\ftPh'h:% cCubh$RS u#>t=G Ph'ho"_WsPRWt^\ue[^_]UWVSE 0xjPuq* uE$'e[^_]ËOwvMTPw Sh`%<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhh'h:% t @`jVPv u hh'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuVXt,swsos g \SVtttt:uj@苃t$Pǃ tPǃY1Ze[^]W|$wUWVS tu}P.YUK>vuu{(Ofu  tu%ue[^_]g_h ƉE1Em5%RR$C Ph`%She VjN(e[^_]g_UVS]She jVt~ht j3gXZe[^]UWVS E} wLBuB9{d4G PuF Ph`%yVR1Cdh:%V|V GunC t{@;GusPOPF Pha%%t VX9tSH[SdXX떀{tjSu à uhSpd_tߍC8EP_d^ujju rƃ t9tEuVBfZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EE\E@$tLu>E@hu5jZt9^duFh1Fd뮉e[^_]UVPuu,jy^uEhP' YE1҉@uUWVS]} SE^uh@' %t Et09Pt jPoXZjWSk ƅu&j4Xt^FFF`EF EFE0pE7`DN }WPhQ%jQMR E0=D #C$Mt1"PWQ Sh/b%@ Vj豕@u,) 8th@'hNb% Y[FtVZ1Ft1E@F0Epe[^_]UWVSQ]tdue%u=t-htGdt jPXZj3ZY^wHSr j3vZXZ1GdEw$jVS t'W(9P uW,9Pu PC Ph`b%! 5w8w0G,PG(PVSu 8t둋AhAdjVSh ƅu Shb%K ]}tEW$9Pt jP(YXwdGhj3YXZ?uwHSq3 e[^_]UEt tH]UWVS]E EEU}uM MM$MM(Mutu |RP*EZYhPaXuݝ KUjWuR Ã}Ut} tuMUj4XۋUuE0'e[^_] ECCC 1ɉK BCZ;C t/C 67AVPhQ%jC P }t EC1CECcHwnEE] Ee[^_]CtNt;C uCECKtHJSHwuSjà ]e[^_]e[^_]UWVSut=t7;Ct+& PjCPC PSF PtjR$ōe[^_]USEt6t,ttHJHPX]]y]UWU@Euu* Y_}UWVSQƉ uXӸH'ljU@'9r 9EsҸX'ljUP'~9M9 uZ[^_]UWVShPLufJ}xv #htAEH@‹EEhЍHdfhdZhb%hPh藁Ëh | 8th'hb%XZh?w8j@Zh_uh'^Lhǀ@h @uhShS =wPƄ ƄPPhhb%hT@u$h'hb%h1҉Y[hCjydwZXETE`\fu `\\@)ЉD 7RP*RuM UuU]UWSU v迕 11}}u1'M[_]UWVSUt΀yv b u1y tËAdr@t$tt @$u@hb%uX؋U-ÅtF PSYFP}WWCPYFd@t KthX( u} WC8P}Y_XC9@VCXPhYZY؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PV"LXZ?1e[^_]UWVSQEp1҃t<t 19sDB]۹yAt}u1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}EEEHfw EHfv蔓 Ef9EEEM) u k@w ¸ w w w ?w xK9~% "}u1EEf}tdf}@~9f}? t1҉EUE) t1$t@E) t1u}11ErEUEa ׋UM U MEREC1[^_]UWVS}E uuGd((*1ۃ t%jPG@P  ut #wdۉ؍e[^_]UWVSu }WVuw)WVu(pttSHIH9JHs؍e[^_]UVS]CtPV SjjV]e[^]UWVSuFhPF Ph.c%,Vj@u3 81t)ߐ 8tՐ 8tː 8t h'.XF@t>jVC@P ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjSu'ƒ ujjS0n ]UWVS} uEtMtGu{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVSu 1ۉ]]]EdߋGdEuu;tGu}묋WtSWuJMQ1ɉ uHJt6GuCu;W_IuWYUOuUJOUjW@R06 t)G9Au!%uFEPQXZ8MWG E1҉UE܃YtMuW Xe[^_]UWVS} Et0t[uvtCPEP_ZY@t/C@3#Eu%CD3G#EuCH3G#EuCL3G #Eu붉e[^_]UVSEt0t.ttju CPP t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j|Zuh'YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZfECCdUSǃt_{ u Pu uƍS@ C t@sdKQPuR@u{ s{ u @t{ u j.EPC G{@u RURY^@s@t~{ 1UĊ  L @uj.EPC@Pj tJSRPhQ%j.ChPxh jC@Pu t @`C`KdK`C`uKd h'SXZ1ۉ؍e[^_]UWVS EEE EEU}uM M܋M$MM(M؅uE苀t2RP EY[EujZEԋEt?jWC@P u(EC`}}StP뽃}}WSjVWueP|@u 1C$C {4s(EC`1E@CEX}CPt Nju h(CdEt CdtS` ttSX{@t4E胠4uSuu!uSuu}uLSYMCAe[^_]UUjPR 1t!hRu hd%uItUE1҅t%tHd((uH`ۉ]UVS]u!uu1҃jPS, t8Hu@`tFP^jRPStk1ɉJHB1Hd@ @$ǀR9jPj3w=uhS%SUXZЍe[^]UWVS]C$t1jjSP u苃%uuS^u묉%u^f{(uGC>Pu<{*Vh('W tVh 'W u 臁 w VEuU1Ejj@VSHƃ@$@ 1ɉMH P@%t<u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLV\ V8FHtVB FHE88V" 1ZMjG@PRU3 U܋Mt?uRG`t%tEGhPG Phd%VC sj.FhPRj 1E@F0EpjV@e[^_]UWVS]} FtHtJN HPZڅt0jjjVtEE Ee[^_]9jjjVVd1SjjX$e[^_]US]-XE]UWVSQEvp~ E 81ۅEjG@PE@Pf tGd(1E@`G`}u!GdtGhPuG Ph5d%IG` ttGd uCtWZOd }u/GdOdt OtHU JOWX}3u1ۉ؍e[^_]UWVSQu E@EhE@PE Pu[ǀfU@4uUr4{(s41ҋECEH$Q+B9sȉC$}O : v: K vu9F s| SEZ11BCZ؍e[^_]UVSÉփhPC PhSd%zVSt VPZY h'Xe[^]US ]Sj(&ڋEXZ]UWVS Et_uVj%XZ؅tt8;Cdt, PjCPPCP@SF PtjR $če[^_]UWVSEttBu[0tFd%=u1҉vt Pu 0Y_6ϋEu@EtE #1B*Et E @ tt^tTCƅtDGPEPh9WRV =EPFP_t @ FUMvj±ZYUt0Mt&@}wFH r*NjM;jC 1CUe[^_]W|$wUWVS %ue[^_]g_hL ƉE1Em5%RR$C Phe%ShaVj(e[^_]g_UU t,t9PuƀRh[hjjUUу1t3wt-tRh'he% UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`PEF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS<1ۉ]]]E1u1EEE9CEׄCdKTMЅtYURQP藘 t t0u5CPE Phf%1ɉKd EEt9sEsxF URV4RP% t tlVdtRNh3S%t$QPF Ph+f%aVja@uj 81tj 8t h'KZ1F$F fdEt9sE6NEtXMPF$Pvu t t1F0PC Ph=f% NtHVujuPECPEЋCL }ffMM9Msj KMɉMM̃щu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u%}uƃEă}v1ɺ1]/tuhdWjEH}t?E PhRf%HEESjE0#hS%u<e[^_]UUt&t9PutƀU]\]UWVS}u1-0t9~t6^xtuu S0 u؍e[^_]UVSEu1(0t^xtuu S u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EEP 1ZYtU9pu 1ɺPGEttu4@t$Plqǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`u @tײy1҉[]UWVS@EPjE _X1EE 9CEuh}f%j uVG CPVhf%u+ @ursXsTVhf%u+@tuuVhf%u+@tCtPVhf%u+@tC`PC`^E'+"uE5!#fC"t 5!#Au6$" u5!#a#@u5!#5!#y,]#uRWVQuVhf%u+ @&sdVhf%u+@ C1C;s WJF,Z拀H1C;Ls WJF,XCPECLE}EfE9Es1d SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQh ZPB PEPu2XG UU)U-sx1t8Fd%u'~ t!GFhPWEPhf%u)@6ċ<e[^_]UVSu Ft%tF9CuuVCxPusݍe[^]UVS]Sjjf1҅t#09XuƀلtKj3%Y^u=t hS%S5XZe[^]UWVS] 31<t0h>h%xNj 󥊅zp 0hli%%11Ҁ+u8B,CdtG{$tA1ɉڋ8u.ڋ8ChP0hi%Z1s$ )t1ɉEP8Q )xdu+81҉EP8V2H4818EP8V2p*v>xdu"t0hi%ֿ *?)t49$8xdt⋅4t4^u0hi%eY[+(뗋4t=4O8xPc4j40 8Y4jj48jj4 Z8@`y *t[j@t/*tJj4>^_@u80hj%耾Y[$*0hj%XZ4e[^_]UWVSp]U Dž 11DžDžDž0ftRh`'h:%趽 jWV;Z u h`'|YWSXZe[^_]US]jjS u"C PhZj%μShbS]É]]xUWVSPu} UUjWC P Utۀ8j%u %UPCPC Phj%OCjV UuDt&9tH9Kut倸u܃xdtCEe[^_]e[^_]US]Shbj7Shaj" Sh_j ]ú@ 'Jt f9tUWVSEU MftEv0f9sO 1&f9u}tMf9)N [^_]UWVSEu} tRU w N 'fɋ] ] +39sN "1?fҋu1҉]19tu692uA,t[^_]UWVS8EċEȸɁuѸURj uQЉƃuEfǀ<M GfEfwEă Phj%WY[f>ff}fuEfǀ<M 1҉1ЉЃEu.Ef}w 'Phj%j ]SO/ 1:BUP_XۋUuhd'賹XߋMDڸuf}f9<t >Mčq RVhj%PeS联Ef]f<L 18f}uVhj%Ƹ}ȃlh(Y[Eċ4%tj貱XZE΍e[^_]UWVSSƋ1;,k(f{u{u4{u.{ t&{u&{ u {u{ue{u{tYCUhPCPVUt1ǀަ Kf1ɉHGEe[^_]UWVShEwK EdEEEE@|tXdÀuXdBEAE1ɉMM}qEf9UrZ9]s#K E Phk%職XZ0u<}])Ӎ{}ff}ftftfu f9s#J E Phk%_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSPs UtGF΅uE4%@u+j EPjEPCtPE Ph3k%f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPsuSVPE PhTk%(g1ủuEEPM1ҋEJE[tE2Eƀ>#f}uEȅWeEEEPjuWƃUЍ M))Ufw#I E Phxk%tZYEܹEȉEUʉU9s'H uuE Phk%qEX|ۍEjPSs uCduCdcd{4u EC$U9S tKdS C E}}uuE Phk%g f}t2}O`MQ9rG`E̅tMqduV9rAdE}E؉E};aV}9GhUGhMjhPu~ǀަEfEĉ{(u 1ECEEe[^_]UWVSljUMu w@ Phk%F 1҉u1ɋUYtF E1ɉKhKdK`ǃu uVjXZƃ>VuMUZYuC;u}tG Phl%[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[]E 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύK G=DQwWF(1RPQh!l%蕱~(WQh;l% EPjSuuAtBf}u;8σ G=DQwWF,1RPShUl%;~,WShol%諱 e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@l%}tQuЋE؃ Phl%u18ujjE؋ EPjN$'8u ǃ8l%EPj s@s<Qtf}uʁXsXS`1CdChǃJ8u ǃ8l%8u ǃ8l%8u ǃ8l%8u ǃ8l%{`tts|C`t}t8sLCDCLCHCPCFd rFV t#tFhPF Phi%般 1F$upFhPF Ph$m%葬 Vd s"1F$F VjjF٤-NtHN rVXV蓮YHE؍p C`;u PVh>m%MuVhXm%,KdSh tRQPVhpm%u/)uVhm%u RVh\%ujE0XZ}uA}t;WVh[%hsHsDhWE0& @u Wh[%诫_XE؋_|tACdƒ t ujC@Ps? tKd Cd uVhm%h8u E0 E؋4u$}؋t%uj謣Y[XZ믍e[^_]g_W|$wUWVS,(h1Džh#fDžBDž<"#K8Qff@98tB9rIpr@uHtHu f$8,nt104tj g0\ZYHu" t\10fDž$H8% t#j@wP?(| @p|1(Hx@1NjDC buy(u4tƅ,18$|Dp<@D&v P PhW% DP4BnFDFLVHVP1ɉNDNHt h:%SXZP3c SjjMw0%t11҉SY2~Dt hl%SPXZu ShWo%M1ZYe[^]US]?S Rho%P* ؋]US]C Pho%XZ؋]US]?S Rho%PŐ ؋][US]Sh8jƉC Php%蟑؋]US]?S Rhp%PJShje1҉؋]UWVSƋu5hX%苐f.-XfthWP- 8PV RhY%EhWP6 Z4%@"PPR @ {TWjj褁 u +)CTSXWjKZY@KhtD1+9}F Ph]%Y_DsDjbCD_Zu h'UY#Nj󤋅CH_1҉tjhj|P蠗P6~ sDj1CDCH e[^_]UWVS] E1E;s31;Et k,9 t@v 6hEp%I PVFG,1;uts 3hEp%# PS F,܍e[^_]UE@|tPd(t1]USEu1X|tuu Sp u؋]UVSEt0t-uvX|tuu S( u1ۉ؍e[^]1UWVS} 7G@4j.DSFPjN8 4wShMp%`)}tE@<"jWu胚< u h'iG8@Pj48PNj<% tj<01ɉ,0,;(⋍(tx}HlaDP< Phq%<;8BPj48ƅ0tfBu0S@tWC<8uOBQjRPDt8fBu.08r$PDP< Phq%648sunu StHuZ%uGjSƬY^u9ϋt# w~tn0ueeu1t1%thDjVYZ@(@,1҉P|P|10fǀ<fǀ?SjhPsjjS襂u"C Phs%]~Sh[S詉FSX:Ѝe[^]UEtQw]UM E]UWVS É։M苐t 48UMtSjjPMv u EU S蛀Zt~8 1pp@1x xx$3@u Sh'ho"h}:SY(h9s%SXZP3YXt jjV|P蛅t j3XZwLXGDGLWHWP1҉WDWHYt=t8E%Uu=t}uE3s%uSrZYwLWw4WwPhs% YX؃t w t u F17tA9MuuUM7Ph(%7 XZUM΃`Ѝe[^_]Uh-hs%oWj 44t9W|$wUWVS41B41X-% 6f 6 s f4.s f4P s1f4f P4f 446 1s44 ut/44 44 4f41=p-Of44ff4f4=4tjV; Eȣ4Eȣ4ZYp-X44684U1E4]5<4@4jh4456ƃ x9u h>n%f XVS54ht%  6Hujhl-j 44󥸄44 4u4󥺜445\-=`-u؉}mrqd-E؉ 44 44E44=ɚ;~ 44-ʚ;444 %we[^_]g_UWVS4ƉU)'ht% Y>^ ht% FfVRVRPWSPh u% j.]SFPj uj.h"Sk Sh,u%q j.SFPj uj.h"Sk SN F^(ZU)ڃ<,wJ<w1tR<CSPSPhlu%<+hDu%"<:tI<u% ^ICPPhKu% CSPSPhu%Z 'Phu%J ZYӋM9h"7 Xe[^_]UWVS@<WPPhu% 1ۍEPEPEPSWVoÃtjE<t!<tG<T@8Phy%P $ '<uT@<w*$ 'h9y%BhQy%;hzy%4h9$-h9$&Phy%,T@t <uhW<$hy%^ Phy% Y[THLhz%Z T@Z<t%w uh&z%<uhaz%h8z%) _hLz%Phz% [^T@8Phz% THmhz%hz%hz%hz%hz%hre%hz%h{%vh{%lh-{%j.STPj uj.h"ST Sh6{%= j.STPjU uj.h"SQT ShF{%hV{% hf3# T@f8fZYfw2$ 'hm{%h~{%h{%h{%hx%h{%}9Huh{%nh{%h{%v S1ɋHU t Sh1$h{%&uj.VSjS h{% [h{% hf3# T@fHfZYfw-$ 'hxx%!hm{%h~{%h{% h{%hx% X!6t-T@<m4 'h"Ph =$p ^_ 6 !6uhx-豿 [g v狝t݃{)!C2t!#t1 h{%3th|% C Yh|% C HC SRRPC Ph+|% HKǃxPhP|% XZ h^|% XCPhq|%o Y^19~gVHLYZuVhz|%J XZCj.RPja uj.h"RWQ PVh|% F땋L 9؋44t9~"6 4t494 =4P UWVS]u#P6tP3^1ۉP6T6S/ T6@$ +P6Yu U1҉L650-t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSUtWB<:u1<2E 028uFut<@t*}:u<:t"u}:t;EuݍG1ɀ@t1ɉ[^_]UE-]USE] u:À|u%u@C8t9EsHt:t @|u1[]UWVS4}!}u[=P6tQu Wn[^u<5T6Pi)YtHWPD3XZh5)^1u? Dž)Etw}xjjju !jh@PZE xDž1ɉ1ދ9rqhQuƒ ?tuZ 0S0 0HЀ u%V1It 1:u4:ut75Dž\t&Dž t t11҉V9r)ډ)ށVSj,ZYu"S/^u[Ɖ‰,1i<#au SZYNFS;/XDž-K1j=hݴ%S Ɗt F:uFHX)ىMQRPu[Ë tK}t uXWt.^tCu F:^DžBDžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QWU*ZYu:W-Xt uXx- _<ljljƉlj )PVQ SR͉ ,Ymt u^)؍P9s&PS:)ZYuS, XË Dže[^_]UPjujM UEUH6tP 1҉H6Y1@6L6D61UWVS1=@6uE @6=H6uYh$@60` H6^_u=`P5H6Y[t?Duz1=D6P6t=L6uL6H6u@ @uP 1H6@6P@6@Zu 1Uh$PAڋ 0-f\Yf:u#t =D6t|0\LD6E|0\u D6N1ɍt:uf:Y\tAߍP5H6zY^u'H6tB @R% 1H6ZD돁NJ|Äu :t@PFjWjM EÍ@ wCe[^_]UVS]u uu ][^]UWVSj=u uj Pjd ^Edu! l4uEdUz}<:<^uFC<:{Mu])CdPV%ZYuV([{<\ůCt}<:tyHЀw1GOD9t0v뛍{1e[^_]UPEPhh7h7uƒ1uEUWVS} uHu7uuW1ɋUà =7u u1Ɖ>1e[^_]UPEPhh7h7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ`&#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס|7EС<7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSPU} u]RU $URjW $WjV $Vj$Sm ZE] Ee[^_]sUVS@ÉjjjQjRPx tN9tLtHVPJ ZY@u: j@]S0!;v h"Sh%P-=7t2 1e[^]UWVSSÃ=$7tO1t L7<!jĮơL7!P7)Y9sRU裮$7Z9Uu)@uÅu,x7!1ɉ1ƅtÉ5 771e[^_]USX? 797r 7É 7 4t1[]À=7UVSh5!#h5!#h5!#h%-h5!#h"hZm"h0%-- fC"=7t"%=7t%Z"=7tP"QRPh<%Ӌ5-s$=7t %#=7t%i"=7tXs" %=7t%SQRP֋-U㡀7h5!#h"PhU%Ӌ- Uh5!#h"Ph\%Ӌ-UX7ih5!#h"Phk%Ӌ- U\7Ah5!#h"Phz%Ӌ-UP7h5!#h5!#Ph%Ӌ- U㡈-h5!#hκ#Ph%h5!#h5!#h5!#h%- e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVSSh7l7d7k(0hp '@PI1ۉ^,|7~0XY1;l7s6U1h` 'GPHKGU C(XYk(|0h7l79subC[^]á7uÀ=7>UWVS} 0DžDžDžjjPh7jSu@u 7k |7Px71 @Ht7hSh%X tƄ181ƅGh%<Xt uʊt͍B<9;$` '7R7F7:7.7"7-t7B9H-@-77-H-t7J9@--H-t7J9~}@-u7l7c7Z7Q7H7?767-ƅ h"Rh%P-C7n3 0=7t h6 Y-9-}-=-‰\7 |7 p7s5l7h7t7)I d7X7H T7tH `7 -P7XL7 H7Ɖ5D75@7#x7tA @75@7)<7=7t*1҉j Ph 5" h 'h,7Cj(7$7 7h 'h7C1177}ã7u&7 1t71e[^_]1À=7u1á7u 7UWVS@É;(7; 7j3¡ 7_9u739u0PY; 7u;$7)$7 7jVS2 19Z;P P7PPh7C=P7XZVS@ Y_@u:Y j@}W00 h"Wh%P-=7t蝜 95P7u"tX P7PPh7^CXZe[^_]UWVSEЉʋL7!Ë t7)){ MA L>D=7tMjRP1 M95@7sxu@)lj|| >;D7Fs"J| u| | DT>| T 9Ss$EExSW~DED CSWyB;sss{uISC PODXZ=7uE@,t P7EX,P7؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC t7‰ى[^_]UWVS¡L7!9t> t7)su܋tu 9t)D @!u܋D UEPh,71@@ZYe[^_]UWVSQӋL7!‹ t7)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS$E܋L7!9_C E؋ t7E)puЋ|7Uׅu9u)Ӌs V}t Z}܉E)+F$Iu*w  'w) 'wT '1;SsS |C@C;Fu ;u1ɉHt SFPAXZN]H9t9sxt PFP?Y_SV?XZ{EЋT }t Z}܉ыU܋E؍e[^_](E܉EEPh,7$>Ph,7OA=7t KZ{ SC 77e[^_]UWVS9P7tP79kjjh7@ǃ t؋_ jWh7j@EWh7@7=7;(7r; 7rw1ɉ Åuj}먋 H71ÅuP=$7@u1jDNjL7!‰)[9tP$$7Y9uō3 7t]EPh78=XZt>G 9r7 39s0jWh7?EWh7?7=7}뾉؍e[^_]UWVSÉU t7EC1t}9xts@ƋuzơD7EF}}1U9sK)K)21ɺCPY^y)VxK)]K)1ɺACPV*MKZ{uoEA)VHXK)P؍e[^_]}O}M&؍e[^_]5e[^_]UWVSSlj1=-H9s?MjB,@Pr(1 Mu e[^_]C(S,z{,f P{<t[F,-01=-H9s (-29se[^_]UWVSfU0P9s'H9r f8f;}ux]u)E-HuVQM t uMQ覕 ZU9ufG}uf 1e[^_]UVSË@9r{uC7C7KP9s+9s'8[u"x.u. K9r !f3r9s:.u z]u{uC7C7[^]èu'B 0-fAf'f` ЃðUS1u4@#'蔖 ZYuCC u1]UUE ft҉U<#']1]UWVS É1=-H9s33C8C,E,-E(-E1E9t*C(p{<t@}f;t5}f;t,Ff9{419ts04f;|f;V~ @1 1{8C pPWZYuF;s$rC8e[^_]UWVS Ë0F;CsGjh%V蚔 u 1ɺjh%V} u1ɺmS j@B@Pr @. u ؍e[^_](K A QrqЉE1}C @t E@<S9s8^u @E@89]u @]-@-9H:9<]<-3K0-9)BC9S9{uC7C7S9]p9rD-tN[@3K9ȉu,M؋U먀=Vʀ-ux]Z {uC7C7{uC7C78Dz@U׉DRO^fE11=-H9}"uQMBZYMt UGjE@$E@PEp + u j}G W$JO$f4PY{uC7C7EH9G8:>x]49r{uC7C7<]t<-u{uC7C7=ȋUC9r{uC7C7S9sH9s8=ux]u {C~8-P9x]x-t  -f9=-f9~0{uC 7C7f9UG1=-H9|f9jE@4E@PEp0) u MA0Q4f8fpBQ4EV~{uC 7C71E, U%Gu48-u@-U;Cr{uC P8]u 7C7{ Ex8tC @tEH-E11}tf~)f=t#M9tFfE@fNt/Ex,x4uzx$utx<un@(ffEf=t^U܉zC P U܋pEp(Ep0tEp i1}U܍D2 9Eu'C HC M+H 0؍e[^_]Fe[^_]UWVS$@ @tbF 0-f tNt ,- t< (-ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]UWVS]CE q39\t[p;sr{uC7C7Bׁ)>t~+90y<1ɺE {*.MC @+1ɺ(1ɺ4~t6BЉE8NdBM@a C @Dz({PUCxMu*@uC 7C7{ 7щ3S9ryn3S9Y>*ubF3CHE)PHAKE)PCHE)PXKE)``[^F9>\~{3ƋK9sI:,uDz;9s6J0-DJt%9~{uC 7C7PU:SY9s"H9s8\ux}uDH9r 9r 8\ux}u{uC 7C7 1($S B@pr@ wML(h/S9s#H9s 8\ux)t)\ wCDLpS9s(H9s!8\ux)up39Zx*{uC7C72SUEECE^ ]k3US9֋My*CU z5{NGe[^_]UWVS]x;s?SB< $#'^[m\p{|;{r{uC7C7S B@xz@ wt(hw;Cs8)t~)p wCDLp@;Cr{uC P8)u7C7 1E1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ]};US|1ɺ(N`g;{r{uC7C7Pu1ɺ1ɺ!Cxu{'{9Jր?u#@}{C {P9sx 0-Dyu@<,t<{uC C77}{uC 7}~{u9C 0@}t{tE7C7+uN+ue7C7-7C7C 7C7+tv *t?{CH)VH$K)PrCH)VXK)`L_X5CH)VHK)P^CH)VxK)K)o1ɺCPO^MNj;SsE:,u@BJ0-DJt%9~{uC 7C7PSY9s8}u @48}t#@9r{uC 7C7 {9s9r։v!?t{u#P9sP0-DPt o1e[^_]UWVS} U0E tEp9) W [jLYt3SUUw$@@EjP|1҉UYZuSX ]lp1tEEU1}Eu53%Džh%1911h1xEEMU싅hE1C CE$C1C C$C(C,C01҉S4S8S qAG9r 9Y0-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ0-DJ<_0-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,0-DJu _9wu G9w NDJ_9< u AЋ 0-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hj%NC0Y(9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV- uE @MC9uEƉ]]uuu uMrE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMQƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB ;E!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS4ljUMȋEEЊEЈE׋G(E؋G0EܸMjPh{PM UE}tEfEE9G t9GuGt E@fEM E1uE9GtfEE fE1ۉ]̋M9Mu }tEEf} u@uIf}t6f} up`@(E}Qf}tP0-1Gu@$E~1ɉM1f} u @uDf}t*f}tr1w@(E}{Gt f}tByf~u"| f}G1҉U}@(E1f}u1GuEf}t}u?f~gGuE1}uf~@}u f~u7tÉEVuuuM UEMuf~u;11ۡ0-f}UfMQPf_tIf}tAf}uf})E@0-Buf}_uڻzf}0-EDBu#f}_uff}thf}u4fzXf}tLf}ufztBf}E@Buf}_ufztf}u;rfzu"yVuSuM UEf}tAf}tY 0-E@Af}_ fE@Af}_ 8uY8E0-DBuf}_f}u7E0-DBu&f}_tVuhwuM UEUąUt }udU܋E9UtxM9MtpEU9UtNM9MtFЀ}tEVPEPuM UEuuEfEEGE@}t)EG1EEf} 0-1Ee[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUEju uM‰9EtMIFEEjSVMU tUU9tESVMUjuVULEju uM‰59EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y0-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ0-DJ<_0-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,0-DJu _9wu G9w NDJ_9< u AЋ 0-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hj%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PVp uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0He=XSw =H=PM=@=`=h=wF=w=xU=o==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEfflEffEff}yPTfEff<@-/f}$(f}UEMA k MM)ʍ M ыEEHM)ȉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tT0-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U‹}}f}}t4EC1E>t$E@Ef} 0-fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUwEju uM‰`9EtMIFEEjSVMU: tUU9tESVMUjuVUEju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tT0-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U?‹uuf}}t4EC1E>t$E@Ef} 0-fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVU|Eju uM‰e9EtMIFEEjSVMU? tUU9tESVMUjuVU Eju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y0-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ0-DJ<_0-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,0-DJu _9wu G9w NDJ_9< u AЋ 0-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hj%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV[ uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=-lt1ۉ]tMEAEWH YE}M9M) N,F4EF8EtwF6 Uu;EYt'BE.gD$$5 ME멍gD$$U5 U2D$$U5 Ut gD$$U5 ULM$t['PgD$$U<5 UD$$U5 Ut gD$$U5 UEt't&t&t&tr&j1[^_]ÅtQ&It7&,gD$$4 ygD$$3 ZfffffffUWVS ΃ Ó}UE DExw@<zA /19ĸ [^_]ÉUD$ED$$蓥EDžDžDžDžjDžUDžDžDž >}׉ƍWOt%%"F9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$!U6DžDžDžDžDžUE@fE@fMIL$D$ D$D$$ t$ D$D$ 4$ EDžDžDžUE@MIMI Ɖ ȉ } Dž UE$HD$D$Ɖ$蜢D$:4$ Ut p9EDžDžDžDžZ DžE@fEEDžDžkzR%KwҋD=V9s%u9sF?V?4 r9i_oJgNN9sVu鋽D$ S~D$D$$d V9sNu鋽E@D$ D$D$$ ^V9sNu鋽*N9sVu鋽gNN9sVugNN9sVu=Exi @t>ዕt9gNN9sVugNN9sVu ygNV9sFu鋽Dž6pSgNV9sFu1fTA D$(A D$$AD$ AD$AD$AD$AD$D$ D$D$ $ ȄLN9sVu鋽AD$AD$AD$D$ D$D$ $W lBD$D$hBD$D$ 멋AD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ $D$D$ $O dAD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ D$D$ $ N9sVu鋽N9sVu鋽}nȉN9sVu(@D$ D$D$ $ N9sVuA D$A D$AD$ gD$D$$ {V9sNu7@D$ D$D$ $ N9sVuD$ D$D$ $6 N9sVuZD$D$D$D$ D$T$U$;"N9sVuEDžDžDžD$D$ D$D$ D$L$U$tN9sVu*})mUE@D$ gD$D$$ EDžDžDžDž DžUyzUWVSt^t #U11 rEEEEEEEEEH>U DEED$ED$$P:U}ĉ|$T$E$0 ƃtdE$/ ƃt'D$ED$$91҃ډJ1 MD$|$E$-0 )1 M1 8D$ED$$90 8t[^_]0 UWVSP r ñDž/devDž/XtyDžyXXD$h$S:t-ƍD$D$FtH4$ 4$;D$D$ D$D$y$nS@Džgpt0ƅpD$D$<$s9ƅtȖL$D$<$=uD$<$=tg$9nC./ P [^_]/ 8u)΃wΉ<$:uD$D$<$8`S9EE ut|$E$ Ut#ED$D$ $葳EtED$D$gt $m 1P [^_][DžUVSp |ED$ED$ E D$ED$E$tK ƃt?uE$L8E$c8[^]ËEUE$%8[^]þ[^]UVS o E|(y ;L D$D$($8 t@L $,^ ǃL ($7ǃ(ƃL 1 [^], 0ǃL ($[7ǃ(ƃL t, 0ǃL ($ 7ǃ(ƃL d, UWVS<dn ){uD$/4$ D$@4$5ƃ%D$T$$a5+ 4$j6Ƅ=D$D$D$D$ D$D$ D$$ tVuw: ul<[^_]ÀL uM) Ɖt$ XD$ hD$D$4$ =* ?L * UVSl éyu, 3D$/4$ "(t$L $ 蓴 L D$D$($X BD$ D$D$($p !ЃL D$D$($}1[^]Y(RD$D$%@4$b3(D$t$L $ ( Ɖt$ XD$ hD$D$4$% =0) ?)$! tƃ, Y) 8#t( 0z( 04$ƃt( UE$]fffUWVS j vwE@ E։υEE y ]]U ] }ED$D$ $D$s&ЉM;MM }$UM T$L$ U$D$=&ЉM9ureMϋE eƉϋ]ڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEE9EE }E2MϋE evUWVSP4i uD$T$|$$|$D$$D$,H*)R)L$L$|$}<$teEU +D$T$D$T$ \$,K)v)D$T$)iD$T$ e[^_]øUWVS8Oh u}܉E؉Uȋ0-8}tGC@%-Z+]E[t_E@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }KtO0)Ӊʸ9иbv-t9+E]܃}thEȉE̅um 8[^_]E@ta(uk1f)uAÃPt((uރEPXEȉ 8[^_]18[^_]Éc}ȉk}ȉ^}}Љ}9s]tSÃPuހ.tEȉEt,},-UЋuԍLDFt uf}am}a.m.f}pmR}p.m.1EЉ$]\ 1E܍ h'D$D$EЉ$]] t#tWuՉD$EЉ$] u݋FV }؉WF2}S1}؉}+E܍,}̉hD$EЉ$] tu}܍0#D$EЉ$l K,"hD$EЉ$]F Hu݋E܍L}ȉ+hD$EЉ$] u݋}Љ<$] |?sE܍LD$EЉ$] uE}u8}DGt.E܍D$EЉ$] u1ۋEЉ t.u}.E}Q} auD$EЉ$] usu̅u#D$EЉ$] uݸUWVSb YoƋ'<'wwEVN)щȉMEED$$[dt_FMȉFD$F$6dt:F]؉F>FDF 1[^_]ÿ'E {UWVSa džnD$\D$`D$dD$hL$tL$D11rD$DD$xD$|$$1D$TD$PKD$LD$T>,M\$XD$Xtt$T=qw 9?D$Lt$Xtt$T=qw 9?tD|$P\$XL$HD$TD$dU ID$Tb\$XL$HrEOT$X)Ћ$‹RD$\T$`F3W>D$|t$xt$X$1?\$H\$PD$Ptqwt$H<g9D$XrD$TD$X$9e$$*eD$Te[^_]D$\D$`CE@$@@(L$XD$|)ЉD$|$)щ$P0lPT$|@A$D$\T$`AQ T$TeD$T!,M\$XL$XD$|)ЉD$|$)ى$PiKtсqw 9?lN;$rD$DD$|PT$|X$A$D$\T$`AQ ND$T\$XL$HƉL$HD$|;$rD$DaD$|EPT$|X$P$T$dL$hPH ND$PtD$PD$T$L$HYЋAԉD$81\$(9ډËT$8QˋIL$0;T$@9щ‹L$0ً[I<9qUD$(B$L$HAQD$ D$<Y $\$щ‹EL$XD$|)ЉD$|L$H)ى$PE@ $T$HJZ@U@pHhXl둋$L$HAQD$ D$KE^D$xD$XD$T݉D$xD$XD$TD$dU DD$TD$xD$XD$Tt$P\$Xt $D$|;$rL$PD$DL$PYD$XED$|PT$|t$Xp$B$\$dt$hZr D$XND$Pa,MD$H&E@ $D$H$D$HD$\ E@$D$HE@$D$HvE@($D$H_E@$@($D$HDE@$$D$H-E@ D$8_$D$HX4""""9ȸ"""3ȉ)L$8 I] ApAhQl5$D$H@MQ m$($,$u@yރ1D9$($,DŽ$\$P $D$$0$$L$$\$($ \$$D$,$$L$D$DŽ$DŽ$DŽ$DŽ$DŽ$$\$,$à $  .D$ t$$|$(5 D$ t DŽ$L$$$$\$PD$TT$XL$$D$L;$o ;$b D$D;$Q D$<9$@ D$,;$/ D$;$ t$T|$X! $D$DD$D a$4D$P?D$L%w\$Tt$XD$\D$\ t$D9%Gtԋt$PV WL$T\$XL$l\$pӉD$DŽ$DŽ$DŽ$D$T@D$<CEPt`E%} tcEL%u1Ɓu u%9tJtÁuσ9uȃ[^_]ËEjȃ[^_]ÁUVS5 But+1tut Xuۉ[^]UWVS5 YB] Pt+Lt 1ρu %uVuہ1҉ [^_]! [^_]UWVS %5 AEuFt7>t ] 1uUT$$]>tFuɿ [^_]UWVS4 ÈAt:>t M1uU T$$F>tFu̿[^_]UWVS\4 !APt:L>t M1uU T$$=tFu̿[^_]UWVS 3 ú@E $R{ ƋE%EEgUuUT$$ …PLU>t M1uUT$$#=t1FűuUEEu54$8E [^_]ËUt }1]uЋu9t!$U D$UT$4$) E0E렃}tE1҉UWVS2 Â?u Ex}u 4t+D$4$ME D$E$P D$ED$4$ QNjE8tB 8"tnx(P uOt$ E D$rD$$҉[^_] 8"u썇v£(뱋P t[^_]ÍvҋE D$rD$$FUVS61 =uF$6F $64$6[^]UWVS0 ÿ=E 1t 8u$-E]M $)x NjExlD$4$1MA XEU PMgEED$<$Dž?nED$=<$螶 HE u M D$<$9uM+E UR V tMV}9~t!Љ1OMV}9~u oSEK1ɋE gP t&}G$4<$41ɉME[^_]É|$QD$$D$4̉<$4E$4뷐UWVS8/ ;u D$rD$4$SuD$:4$+ DžD$ D$4$ShF$ $h+D$$輏D$D$|$ D$D$Q4$68$*AD$D$|$ D$D$4$7|$$ƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $I  $D$$ |$$?ƅOD$E D$ ED$D$$$D$E$vPtD$$}$1$1- 8[^_]À>/uEt$D$<$ t'D$<$^ 8E D$t$E$'N}8[^_]ËE D$bD$E$ME D$D$D$ ED$D$Q$|5BE D$t$E$cNg E D$rD$E$eMDž1D$ sD$E D$E$Dž1` E D$rD$E$L10$j t$ 'D$E D$E$'<$1sD$E$-D$/4$h E D$D$E$ALDžDžk E D$W E D$WUS() R6EEED$D$ED$ ED$D$E$Y3x E([]øUS(!) 5EE>ED$D$ED$ ED$D$E$2x E([]øUS(( z5D$ D$$?D$D$D$D$D$ D$D$D$D$ ${2x D$([]øUS<( 5ED$D$ ED$ED$/s$Y-x E[]øUS' è4E$iU' 4U<t <]ÍL<]UWVS' U4}|$E D$E$I9s [^_]> ?|$ t$D$$<[^_]UWVS' 3}|$E D$E$!J9s [^_] ?|$ t$D$$<[^_]US & u3E$ n t []ÉEAsT$$<EUS j& /3E D$E$m t []ÉEAsT$$<EUVS& 2u4$"t[^]ÅtEt$TsT$$<EUWVS% Ð2u} |$4$&t[^_]ÅttE|$ t$@T$$<EUVSk% 02u t$E$o't[^]ÅtEt$nsT$$<EUWVS% 1}|$E D$E$K u[^_]É 0|$ E D$hD$$<[^_]UVS$ m1uE D$4$t[^]ÉEt$sT$$<E[^]USQ$ 1ED$E D$E$uEsT$$<E[]US# 0ED$E D$E$duEsT$$<E[]UWVS$# n0D$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]* L$ EUD$T$EUD$T$E D$ ED$D$$<$[^_]UWVS$" ì/D$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]h L$ EUD$T$EUD$T$E D$ ED$D$$<$[^_]U'" .U!QፀL]Í]ÍS]Í]Í]Í,#]Í]ÍS]Í]Í]ÍA]Í]ÍM]Íۤ]Í]ÍS]Íu]ÍS]ÍY]Í]Í]Í]ÍF]Í<]Í]Í]Í]Í/]Íx]Í]Í]Í]Í]Í]ÍA]ffffUWVSP X$Hp)9s L H 9r,P 9s P P P$@(@,[^_]Ë #p VpUWVS| A-ƉUx HEU D$ T$ED$9s)L$><$ ~F [^_]D$$ۋP Hx,tP(9s ,P P 9s 

S S KC S$T$ʉs[^]UWVSTh 1,E}>11L܃r׋EEċE EȋEUEЉUԋEE؍WỦ< <<] E;EriEE؅eEU9s UEUȃE9sv ED#UȅtEDgET[^_]ËU#EE%ju}ču܋EU$T$?uẼƉE wt ~ 1ҋM!E! tE̍PUP v)E;Es MĈEEU̍JMR wډuuUtE;Es U>EE1ۋE؅EyUE9U9v UD#Eȃv UDEȅUDwMaEEEE}ωu΀FE:j=*}_]̋MEU$T$ڋ}i]EE߉]̃{u]bO?_]̋EЋU t1҃EE̍PUt'E;Es MĈEEU̍JMu܉E}ESfO?~w<@p]fEЋU t1҉EU<@t$ t1!E!UGE̋EFE̍PUE]Ȅt&9s MĈE]ȃEU̍JMu9s U=EEEU$T$U]}EEf@E%#jxE%#joEUE_]̀}FGG9U}1 CEt'E;Es MĈEEU̍JMu܉E }EEEv_]̀}fGU}1 HE;Es U=E]̃EQpEЋU t1҉EU<@GE̋E"0]̉EUD$EUD$ T$ED$E D$E$p]fffUVS ×%uED$ ED$E D$4$5D$ED$4$U[^]UWVS4 G%UEzlj(aED$/<$螞 t<|$a7D$ED$ ED$ED$4$/4[^_]ËE AE|$ED$bED$ӇD$ED$ ED$ED$4$u 8upED$ |$ED$ED$sD$ED$ ED$ED$4$|M/ 8u 6EL 8t ED$|$kD$ED$ ED$ED$4$  US Ì#EU M]]] ]][] USEU M]]]] ]][]fffUWVSt^ ##D$L$<$8t$#D$<$m1 Dt$D$$mũED$ sD$D$$Yrt UWVS ö D$ED$$t{NjE88/tbD$/4$j…tL)JBU=wsG|wdD$}|$M$u Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVS ë}UtlƍxD$4$F tD%=`u'6$U tĄ[^_]V O1Ą[^_]< 1UWVS? }U)tlƍxD$4$qE tD%= u'A$U tĄ[^_] O1Ą[^_] 1US( bEEED$D$ED$ ED$D$E$ix E([]øUEM tP8u ߉P81]à ]UWVS  }tc$fUT$U T$$ ƅt/tV$/ uDt$D$<$MƉ [^_]ÍD$$u [^_]U G U T$UT$-7$]U EtUT$U T$$]ø]US  íE D$E$`=u$ED$ED$-7$ []øUVS  YuED$E D$4$x=uED$ED$4$H [^]øUWVSL? E uUŰPUЋPUԋH M؋HM܋HMHMHMH M@$EЅ$EPU@E)99}W~E}ủuĉMEU1NjEĉD$ t$EȉD$E$qE9}u֋UȋED$T$E$J<E$e1L[^_]` 7Eԋ U2bL[^_]UVS4 ùuЉt$E $^ED$t$E$y4[^]U yU T$UT$-7$D]UWVS DuEE}ED$E D$4$Z;t}EE u[^_][^_]UWVS4 -78ủt$E$聣E D$t$<$4[^_]UWVS ÛEE}-70E D$ED$4$:t}EE u[^_]?[^_]UWVS4q 6uED$E D$4$U:t%}̉|$E$轢ED$|$4$4[^_]UWVS4 -70E D$ED$4$9t%}̉|$E$YED$|$4$w4[^_]UWVSH sMU }Aq)9y}ȋ:}̋z}Ћz}ĉ}ԋz }؋z}܋z}z}z}z }R$UUątj~;ƍỦUĉEuƉϋEĉD$ EȉD$t$<$!nE9u܋EUȉT$D$ $M8M $1H[^_]` 7}ԋ Uy'H[^_]UVS4 YuЉt$E $ED$t$E$4[^]U P U T$UT$-7$u]UWVS uEE}ED$E D$4$7t}EE u[^_][^_]UWVS4 Ä-78ủt$E$!E D$t$<$4[^_]UWVSv ;EE}-70E D$ED$4$L7t}EE u[^_]p[^_]UWVS4 uED$E D$4$6t%}̉|$E$]ED$|$4$ 4[^_]UWVS4 w-70E D$ED$4$6t%}̉|$E$ED$|$4$4[^_]UVS O EM thP8t P8-7@:t1 [^]ÁP8?D$D$37@<$GH8붸 [^]UEt @:]ø]UVS  i-7t^D- -T$XT$$3-7tE$\1-7$S$-7 [^]Í$2u뎍s$P$蝞fffUWVS0 öuzE$z~}UU}} M߉ME؉4$#aƒ  UFD$ D$FD$4$蟉U9UX9UF?M0- DQEmML$D$4$34$W`ƒ4S;} E8E}E;} tu}MMD$ FD$FD$4$fD$ FD$FD$4$fMAE9N~D$FD$4$!3mFM9ED$FD$4$2EE9;} tɀ}TUD$ ED$FD$4$fEHU9ЋUE9F M10[^_];} D$ uTED$FD$4$eED$FD$4$12xD$ D$FD$4$eeFD$FD$4$GeD$ FD$FD$4$&eFD$FD$4$1}tE9} uD$ FD$FD$4$dFD$FD$4$j1D$ ML$D$4$dFE[^_]UWVS0  E}GDEE-798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$] fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]虁MEE9G~0W,10[^_]Ã]1^E:<$]?}1U  -7$]UVS æ -7p t4$u N8@[^]ø[^]UVS a ut4$nu N8@[^]ø[^]US$` % E UD$ D$D$D$T$T$ D$D$E$$[]US$ E UD$ D$D$D$T$T$ D$D$E$$[]fffffUWVS c } uUE%tUG$&Ul ` 7tUF$U/ ` 7tBU$U ` 7,048<@DHLPEtE@$R ` 7  $(EtE@$ ` 7TX\`dhlptxE tE @$w ` 7|UUUUUUUUE}$tE$@$X ` 7U UUUUU U$U(Uċ,Eȋu(tE(@$9 ` 7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉ`T|t ʉt ʉ\|Mt ʉt ʉXUUt%  TŰE@|E@hDž$&' E@,8@1fN9 4>ff~~ tωv$uE@,8@4F uf~n$O HG 9u͋940f|0yW}$G,@fD00f|0y.GDfJT$G|$uĴ[^_]Ë$#E@,8R|)4xLlx9kf+fdG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YUR, rfVAtωp$HN HF 9u͋tp9dl9h0\d$xy DžxEP$ty DžtEL$y DžEԉH$ry Dž4$Jy Džx|Ƌ)΋)ȉlp9`l9E@,H1҉tvf~94>ff~~ t‰ljv$9u}O, I4F uf~0r$;4O HG 9u͋9 Ƌ9p9pDžAlxE@,8@xM8MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bff~~ t‰׉v$u}O, 9I4F uf~k$b O HG 9uϋ9 p|9|)ȉ9xE@,@u0F,@‹NHJfB91ЉNDfHD$F|$YuX-7}9Gx E@,@1fF9x4dff`FF tƉv$uE@,@4F vxfFXl)\N HF 9<$u,9|?EH,|f+f49@)fT094‰PЋLf`\Pp tv$HuEH,@D gE@,pfFE^*LN HF 9-$&utE@,8@1fF9t4PffXFF tƉv$uE@,@4F otfFMh&LN HF 9;$u9|EH,|f+fD9@f+f|094xH8f`Txx tljv$uEH,@D8 KE@,pfFEЉM,LԉN HF 9Nj$u3-7}9GG800D$E$/f1UWVS|> Uu}} ` 7M  M` 7 ` 7  $( Q` 7,048<@DHLP ,,}` 7TX\`dhlptxE% TT} V` 7|UUUUUUUUEE % ||}$` 7M MMMMM M$M(Mċ,UȋU$ UU}(` 7]̋]Ћ]ԋ]؋]܋]]䋙]苙]싉MM( M̍M̉L$ T$D$|$t$D$ D$D$E$|[^_]ÍD$E $tUD$$t1D$4$t,t$<$ct}-T|$E$Dt} |D$E $t}$UT$E$$s}(EM̉L$E($syU$ U$T$ U T$UT$UT$UT$UT$ U T$UT$-7$w]U$ |U$T$ U T$UT$UT$UT$UT$ U T$UT$-7$]USi "E-7t0ÁtZD@.7tu8.7 %BH[]US UE t0ÁtZD@.7tu8.7 %BH[]UWVS Eu] %tFDU@.7^HFE~TFU1~_V,@M}@t~D8x ߉xf@9uڋ}9}uD$4$]]1[^_]Ã9}uf8.7 Y[^_]U UT$-7$]UVS bEt=PHӁ@.76u @D [^]Éց8.7;1uڸ[^]UWVS<< U Etzu<[^_]ËB$E@DE̋E@HEfEE@LfEEẺED$E@|$dEx|U B$lU BMADBEȃvgDE9tKuU M$Q8@MąɋU  AxDE9uU <$U %@.71t MAHALQDUEfEfEE}}ȉ|$A|$[|$E$1ҋEH~]E@,<1E@~=U E9p~*W DtL$Eȉ$E9p֋UăE9PD$E$ [<[^_]ËMA|tBf8.7 U $@EH|U U UT$-7$_]UWVS \}-70t=Gt6G$$&|$4$D$4$(Z1[^_]ø[^_]UWVS* u} t=Gt6G$&|$4$D$4$Y1[^_]ø[^_]UVS ËEM tlPHց1@.76u7PDQAP|tA\Rtu1[^]Éց8.7;3u뭸[^]U2 UT$-7$J] ǀT UWVS8 øu-7E8@-…2-7E̋2-7E؋2-7EЋ2-7EG -7EG$-7E܋GT-7EȋGX-7EԋG\-7EG`-7Gl-7EGm-7EGnE0Ћ2E̋2E؋2EЋ2EV EV$E܋VTEȋVXEԋV\EV`FlNmEĈVnE4$"F-71ҋ2‰T$$V -7V-74$4$ 8[^_]-7E-7E-7E-7E-7E-7E-7E-7E-7E-7-7E-7EUWVS Ë}D$4$ƅEdž3E Fdž2dž2dž2dž2dž2T 3ǃT džh2džl2F`fFddž2dž3F FFFdž3dž3dž3 $3dž34$6t$<$}o2PJpdž2D$D$D$D$ D$D$4$TFD$D$D$D$ D$D$4$F4$a4$譏D$D$D$D$ D$D$4$謡F tjD$$4$$4$t4$4$6HH-7t 3t4$#4$A[^_]Ë2t$fd2$g29tDžu拆3$E4$=1[^_]ËRhD맍$rDžUWVS L}2t$c2$ig29tƅu拇2$g"<$a3$3$-798t<${[^_]<$e[^_]UWVS ßul +9uǃ >ǃ <ǃ  ^ǃ$ vǃ, #ǃ :ǃ 'ǃ #ǃ  #ǃ #ǃ0 -ǃ( -ǃ8 _ǃL |ǃd oǃ, -ǃ4 -ǃP <ǃT >ǃX *ǃ\ !ǃ` f2E@tgt.Ex tAu[^_]ËE싀t(VT$?T$ D$D$E$ 1l Tp=u[^_]US9 M1Tpl =u[]UWVS, l EƍME$+FF(9u݋uD$$98CuxuAD$$$3,T$$/ǃ, !ǃ +ǃT !ǃ ,ǃ| !ǃ  -ǃ !ǃ$ .ǃ %ǃ, 0ǃt %ǃ `ǃ %ǃ aǃd ǃ fǃ ǃ gǃ %ǃ  hǃ &ǃ iǃ %ǃ jǃ, %ǃ kǃT %ǃ lǃ| %ǃ  mǃ <%ǃ$ nǃ %ǃ0 qǃ #ǃ( oǃl #ǃ8 sǃ %ǃ< tǃ $%ǃ@ uǃ 4%ǃD vǃ ,%ǃH wǃ4 %ǃL xǃ$ ǃd ~ǃ #ǃ, pǃD #ǃ4 rǃ\ d"ǃP yǃ e"ǃT zǃ ǃX {ǃ `"ǃ\ |ǃ ǃ` }E2xUl U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$?L$ D$T$$Epl }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$>, $<T $^| $v $# $: $'d $# $#q $#_ $-M $-; $_)l $|4 $o$ $p $rD $y\ $z ${ $| $} UUS0 l ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0 ÆEU܉M-772EE4El fEE$ƒ=4M4%y 4 44fǃl EDPf~M䋑f8>@El fWfcftf.MlU܅-7Q)ʉ$1E$ƒE@ @M M4 /UfB 49}} 4% 44;4yfl €"7f1҉Ѓ0[^_]ËE44%y 4EDPfl y4D$ D$D$$F 4449)‹4L$ T$U؋MȉD$E$4;4U}dž4…fl 4xp4fǃl +E$/t3E$=Ec0U$)4fǃl E܅U 0tE@ U؋4 E44B%y 44D$ D$E‰T$E$y4%y 4 494114M%y 4;4$fǃl Mԋ4D$ T$U؋ED$E$U؋M ~4y 4 49411x 4Wy 4 494"7ffl @}AEE܅U$D-E$ƒUE@ @MM MtU-oE@ U؋4  UfB 9 4)fǃl &E܅{-7Q)NUj 4}} 4Hx6 44m4%x4|뿃ߋ 4}} 4%y  44;E@ }fG Ef`  -D$ D$!D$,$G $WdUN Efǂl ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSX ÷u-7MV8у$33@-EEt-7E(V8t@N<)tE11iE}uDX[^_]ËFv3@-7D$-7$#ǀ3E AX[^_]EE] (.t&KEEED$D$ F@D$EĉD$Ủ$UuQUT$4$ M)v4$ 33} @-!EED$D$ F@D$EĉD$}̉<$P|$4$& E1EE$E%V88uF @t'z 8t!F }fG %E g3t&-7D$-7$M1҉3E@ Uջ UT$-7$]UWVS 諻 pu}ED$E D$4$t} u [^_]r [^_]UWVS W u-78E D$ED$<$3tu } [^_] [^_]US E$ []fffffUWVS Ѻ ÖƉ$h $袷…t"ׄtN<$tȃuЃ [^_]ÀF$@ Ut p@뮃$<UVS< ƍD$4$#j sD$4$ j 4$g vlte110B<1ɀ;Pt0tD~ȃu9mt(B< v-1ɀ;Pu1[^]ø[^]É묀;tD01ɀ ɉ떀>uF[uVmtÃt0ZcWKUWVS0 Uu :uH2tU$9LUF@fu2ML$ MD$T$<$S2MEPJ(N$JN 3\s$,JD$D$$XFTs$D$D$$'FXV ~$-79-7NT´-7 °-72P3B0ozpdH12džp2E苂E싂TEtU܉Udžp2ELɉME*EEUwD$Eԉ$U:E܋U؉$@Mԉ $5E܅t2džx2EtEJdžx2dž|2UtE.dž|2E؃0[^_]ËHt1@@Dǀ@l@hǀǀǀ<HHpF$B(KE`U܋ED$<$e U|E>U܋ED$<$pe Uu p2EU܋ED$<$Be Up22@@ ,F@f`L$ D$cD$<$2E41E$D$E$d u džx2EED$E$od u x2|$E$Jd x2Et ED$E$d u dž|2EtD$E$c u |2|$E$c r|2c~ LSMt|$E$gc u x2dž|2EEdžt2džx2dž|2džp2MzEdžt2džx2dž|2EbtW|$E$b uDx2dž|2džt2džx2$dž|2EEdžt2džx2dž|2E&U -7D$E$]USñ ÈE¸-7H$ ¼-7H ´-7HT °-7HX ¢-7Hl -72 p2| t2x x2t |2p 2$QC[]U$ M-7tJX-71]ø]fffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS L }ƉDHfx 4 [^_]Ëf=tnfDN4f>tM$]׬QPf9uǀFF [^_]ËEFf\Nu]ED$$]虱MME$ ]CUMtbf@f@@ f@@f@@]\]X ]]UU9uU]p$$eF] -D$ D$D$P$5 $)F]$迷$ FUWVS g ,Ɖ׉M$S\ ttLMt5$LVp9uϋ}E$TF [^_]É}UWVSí Eu^9t)fxf8u@$9u׋~1$]ڲ9> $]²4$躲[^_]UWVS X9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS褬 i}fǃ $rPf9uǀ2ǃ ǃ ǃ lR2@tL$Y =w4D$T$$N2D9u[^_]Í$Ӵ$ CUS 腫 BE E-7t+2UT$$UPE []ø []U UM ~*-7t2t 1]É1]UWVS ժ Ú-7te3339}}<31 [^_]à D$$蜬‹t!3333뱸빋33D$BD$$v 33]\33o'U ĶE-7t%2UT$$1ɋUE]ø]U譩 vM-7tJT-71]ø]UWVSy >}<$荺ƃuOG @tI8g 8u?-73t--7D$-7$yqǀ3[^_]UWVS ÿEU-72E EE$3= %y   fǃ LNfu f9q fmffjMUU$ E$mE@ @ME@ M  %y   LNf   yt鋓  9f y [^_]ËE$At3E$8=DEMR [^_]ÃUfB   9| <  9f [^_]Ë %y  ; fǃ Eu-E$E@ @aσufF -7Q)=  Ef` [^_]ÿ -D$ D$ D$$, $=UWVS$x =u-7M~V8у$?p33@-M MEt-7BEF8V<F11‹FUS ҂ ×E U€37RtI|t7?T$D$$x-7ǀ3@$ 1 []Ëxt?T$D$$/-7ǀ3@$ 뵸 []UWVS ΎE-72tt_ [^_]37@tǂ2?T$D$$@$  [^_]37@@ttǂ237@jǂ2U/ -72$]ffUS]E  }t J;}R ;~1[]ÃUWVSɀ Î}tG8 uZ@u[^_]ËtG~W,EO(G\p;}@ ;~E9uՋu뭉<$VG8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtTx^F9}WҐxR)9H t7~,}߉ˋF(D$NQT$$U191[^_]É봸USEt"H~X,19t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًUI9u1[^_]øUWVS}] UuG9)9UtYW,G(tX] UG(uU r9|_9}G(r 9 _9}"E E9E |1[^_]D$OL$$bE9oƉ\UED$ PT$D$$]UWVS}G~CW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]t]{tVO~Ww,19tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]UWVSĀ{ mR433x,}396F8 ,4};~E<E1uuuuủuƉMD>EED$D$ M3@@D$ED$E$OV,UD>UЉ$bUЋM;4ED$ EF,D$D$3$bED>$EENjE94~WD>D$E$$BE!эP$U( D$UT$ ED$D$4$;EE[^_]F,D$D$E3$EV2MD$ T$FD$4$D$M2$ҸEE[^_]ErUWVS8]y "ƉU̍R4EԉuЋ4M8<$&' ƀ?tqE4EEEEE'E$要M9ErIUU)ր?Et7E܉D$ t$|$E؉$Ey8[^_]EEEԋ@tCuҋEԍPMulEEЀ4uŨ8[^_]}E)9ǃEԍPtt$D$ $U> U)uMtMȉ׋uԋ6sRtftE‹u)uEmut$D$ $U UIuE)muuzEfUWVS,cw (EօE93}ʅD0-?@tDG@uM$U$ MɋUM4M׍MMu܉ƉUE$*}Ut7)ր?t.ED$ t$|$E$t}Eyĸ,[^_]Ëu܋U)׉|$$…tٍNDvu4]Xʉ1,[^_]ø1ɍA1USv ւEw"DD$$=3[]øUSu Ó-7t3tUT$$\[]øUS u O-7t&3tU T$UT$$( []øUS?u -7t3tUT$$[]øUS t -7t&3tU T$UT$$ []øUSt u-7t3tUT$$\[]øUSlt 1U -7t*3t ML$ T$UT$$<[]øUVSt ݀-70toƆ43u'3tU$}3${[^]Ë2Ppt%T$$ D$2$[^]øUS s IU-7t$3tD$T$$ []øU7s U-7t~;3TR4]1]USr ÿ-7t3t$U[]øUSr Â-7t"3t$Ut DY[]øUWVS tr 9-70Ɔ43uj33~BE14u_uE;3|Ճ}tO3$y [^_]Ë2Ptt&T$$D$2$ [^_]øUq _~U-7MMM ] USoq 4~-7t3t$Y[]øUWVS 0q }-70E E4ED$ D$MML$$xtiP$UmDžtUU UED$ UT$ML$<$Vxt&E$U%Ɖ<$v [^_]þUShp -}Et3t$gS[]øUWVS.p |u3t$"3~#14$fu;3|ߋ4$MuD3ǃDdž3D$0$p4t`2PtD@@X~:Ɔ3$G/2@PX3@$41[^_]Ɔ3UWVSo {u3t$3~#14$Kt93ߋ4$2t[^_]UWVS]r3Y3KE ~443 u} })u}}11]]9t0z9u}9u]1~39114uu;3|ى[^_]B,B\4u u )lj<)} t7ƉL|G1[^_]ÿUVSm yutNFX32@@T%D$4$ E D$FX$1[^]øUWVS l pyEExD$D$<$Wuƅt,)‹M tEt|Etuu)1 [^_]ËE tmEtYutREM@.7 u)1MfT$|$E $tE 01f%и [^_]øzUWVSk ÃxEEuE $tƒw]}E(1M149rEtfEt1[^_]ÉEE $s,} E9tl$stEHE 103EE1MM9rMEtfEtЪW‹EHE 1uu1U7U9rUEtfEtE%}@.7t]ft  ؉EP1u 9r[^_]ÉE'[EGfmHfmBЪEfmEH>UVSi 9vUE ӁttH@[^]Í ` 7ʋ JHJHJ H JHJHJHJHJ H R$P$ [^]UWVSh èuutv4$}uVȉ‹9u F0$nF,$n-79pt]9p tJ9pt2t$$m4$m1[^_]@u@ 9pu@9p uUF4$m>9UtU?$9Uu~X24H90t…#ȋH90utJ$5m2UWVSg jtlj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVSe ÁrƉ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u=uAuIu 1[^_]37@@8tf@ۃf@t4$t4$뭸[^_]USud >qMU -7t%t X@t @@f%f1[]ø[]U)d pU-7M u]]]Uc pU-7M u]]UVSc ˜pE -72Uu0ÁE% úډ1[^]ø[^]USuc >pU-7M u8tHX2H@H@[[8u1[] ʉP@[]Uc o-7U]QUb o-7U]UVSb Þo-70tFFX2@Ttf@4$4$37@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]g]UEU Mu]3]USEUu2U Á ӺEڋE1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]_UVSa mutFFX2@Ttf@4$4$37@@8tf@U 1[^]` vm37PT1 t t t@t̀t(t t8t ttLt 1_ l37PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS ^ ×ku4$ D$t$-7$) [^]UVS ^ Zku 4$ D$t$E$ [^]UWVS \^ !kuE -7:x1u 9t <uЉD$t$<$ [^_]É4$ UWVS ] j}-70E D$ED$4$׋t<$ D$|$4$7 [^_]UWVS ] fju}ED$E D$4$肋t<$s D$|$4$ [^_]UWVSL] j}u-7E D$ED$$U"t/Ux0u 9t<uƉt$|$$k [^_]ÉU<$ ƋUt$|$$C UWVS \ xi}uED$E D$E$葊t1x5u 9t <fuƉt$|$E$ [^_]É<$I UVS 9\ hu Ex2u 9t<uЉD$t$E$~ [^]É4$ fffffffUWVSD[ Öh}EUċEG,4@4E@U }` jE EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$譾uD[^_]à E1D[^_]É$c&EEFEȅZE@$rcEyEGM+M9E O(U @9~F t$fF E@ffO@E % ЩOH ȉFEfFE@EȃvA}$VMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$fG UMȋE@A%GGfGfwu}G9uOT9 pO(LE @ 9}Gpt$ EĉD$ED$<$9EEGT9tBuW,u P GG(<$FEP1Ʌt=Uȉ}${UkMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$a&A!E$`BE u E;GTuO,u u6uč @4E;GTQG8 |<$w<$ EE uUčJ‰Uĉy19zuĉ)UBHFBLfFMEy19@E0B,4v4BDfFt$B|U$bu 4M+EOT9E M MO(ʋH93OU9U+GHFGLfFfFUO9UGDt$G|$au3  GHhUMʉUȋu6O, 4I49~X}uEFDfG|$F|$aFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 E 8W9)ʍBE G8  -78u E<$\GG8 <$BEuĉ׉EċE MO(@9E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM E<$0EG8 <$}YmUWVS T `8uE0E,EP@,Dt@ 1H4J W37@t 1J V37@t 1UWVS(I VEUE u@.79}t-79zH}z}JP9krT9`N)9c\]u܍D;9u׋WE1MfFM9yA,U[4ADEFFfFt$A|M$]aTu([^_]؉9BT9H)9)Ɖu9EMAIB[ωރtftEEE}9B,}4!}#zuŋJ)9q)؉E9E]u=[BI߉΃sEtftzmEm9FB,M4!]؋#zu띉ϋMG9 u9|-׋GD$ D$t$<$]U9w~׉BtU$]U$]1([^_]ÉJ)9>70RM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]Qu`E9EuM܉r9M׋GD$ D$t$<$]9uuE7fP 1fUmE 6RUT$-7$j]UWVSE89tZ@EOE)w~>EP,G(UW,΋M4}y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS( D P}GDE-798 GH%EWUOMG,E܍40UunыpG9UfFE9svffEF%M ȉFt$G|$Nu¸([^_]ËOU9~VUEEGGE܋D01E_GD$ ED$ED$<$%<$ 1([^_]EUB O-7$]USB fOE] , *t&tL A, P 1[]øUWVSu} ^(1Ʌ~&1 ~у9tT,y)у9u[^_]UWVS0 B NE,E-7E, L E1-7EED$D$D$D$ D$T$UE$t!UB UUB(ɋU~CUMT$$Vt=9, ~#tyڅlE)e)Uǃ, 10[^_]UWVS@ M}W$G(E~w1U9w(~hD,tO L$y؉D$D0$tuED,yD$UЉD$D0$ tD,E9w(E[^_]EyUWVSI@ M}G(~"1D0$9D0$=#9w([^_]UWVS @ Lu, 1~019t% 9P uDŽL 9uۉ[^_]ffffUWVS ? fL]ƉE׉UM$2L]EPt MA +B A(EEuFF]^]^FT4$]j 1ۋNv]uF,MzF.1ɉU܉fGU9VUGfGFD$]EG |$F|$3Ju [^_]ËEED$E@,$]@tыuF,U)D$F0$]\@tF0V]K +J K( <K,[+ZR,UʉUrprpP 9MuԋEU܋zUED$<$]KUBEE9FEP1 [^_]ËVE}ǍD$uF4$]i?ÅF4F0V, M܉ً]Ӊ]u܉HXXXX @x9UuҋE];9NG EOsC9~ HOCU4 9C~FO$w CC 9~ pw C Ѝ197~5U?9u1E)EEE1)ùUWVS-< HE]SCJr9~ FCr΋M 9~B1)΅K zB 9~ HK B U9 }B}M :u 1)ȍ<?E C EC$E-791[^_]C:}-7-79-79-79S9M 9u M S E-789E9EE)Dž#E-7tS} x }x$}u UM su 9+E-78;}~}낸[^_]É1)ƅ.$1NC E1'CM 1U9 §FE~M ~-79B$t ]1]ËE 9B ]UWVS 9 bFUE -7Ex$9}h-7P H4 9unfH$p <19} JBzo-7P H4 9u80H$p <19}  0%D$E$hu)-7P H< 9H$p <19} E}x$} x ¸-7}:¼-7} :2u #vt@:u$wvuE$؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )9)UWVS7 aDE-7ǁ3~^U ~W;A$t^U T$$D$-7$t [^_]ËE D$$t$1[^_]ËQ 9U u1UWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVSu6 :C}M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$|$4${D$<$茸1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8u ⿉P81]Ã@]UWVS 65 AE} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]7BFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HR$x9tC9uՋMQ ztɋQuut duH8 uX8UWVS(3 @EUMQI$0ƅ1ǀǀǀE܉$0EF,D$E$4ljF0MF4EFXFF]^EF^ F$EFE F F8F}É׉΋@Uu;ES ;U MMC9ME S9E-7UT$ D$U T$U$UtSCDADCHAHy q$ YQ0q1~9uL$M$TMȃ[^_]1ɉȃ[^_]ËS S+U 2MS+U :MUSE] MEP UU PUU[]USE] MEP UU PUU[]pUSEU ME]] ]][]IUWVS$/ <E}Uu eiE E Eu,uED$ D$T$<$UEYDž$ ]6GD@.7t 8.7 GH?G(GE G EG$M1UEE}E@,]8~xfHf@uEfx~SE@uJUR#h2u@.78}}$J t$JutE1[^_]f~E@t܉-7fy~ӋUBvuGfd묅t}$:J {뎁T$-7$G}$J G_UEPT$ PT$P T$P$11f]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]뭉U델[^_]UWVS r(-7@@Mtƀ37J y?ED$D$ƀ37@$6[B@d"7#B@t2ED$D$@$ZB@h"7#B@~@.7t $hD[^_]uW~udtƀ37?Et?D$D$BL$jZ`@ƀ37?E*ƀ37?EED$D$@T$ZB@l"7#B@&ED$D$@L$Y`@@.7[^_]UWVS dž&}ƉӉ$N,4;]u;} t;E"D$E D$ ED$|$$]6[^_]uUWVS6 %E-7Eԋ3 ]-7]ZJx< XHUE@8@u B8@B B@ ]Ɓ?t$D$37E@@D$XEԋ@@HT D$u4$]Hf8E@PhtfEԋsEHȅuvϋE-7EP,11M~9z_{}~r}41҉9} L$M4$]MuՋE̋K,SB9E}E@@%ƋE}9})EU*Ct}EU9/EEPB%9uUEuE}ċE)DžyE9U)E9EEE}ӉʋuEEȋEMȉEЉ]u]9]1MEȉE܋ZE@,}܋xB,p1҉]M؉M9}L$M4$]TuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9Ex$EaE̋K,E؋mEăpSBE܋]؋}̋7N,"XV9EM$^E@8MEԋP]CD$CE$]CD$C$ESPSPU܉EE$]t,M؋E̋E}Љ9}9}r}h}ӋBM E]ȉ]ȋ}MӋBy9nE܋U9~EċEBDM9 tS BDt$B|$]gFfFEBLfF9uE̋sE; _C1ɍ UL$D$ <$]U€w֍V)‰։L$D$<$]S‰EЋE̋@  EȉE]9~]E])؉E؋UĉЋ])؃EEH,E9p]]]E])؋UЋUЉ֙Ӊ]1uu܉1M9| M9]9]9]E؅& 9]܋KȋŰrU9Sf E䍐 E̋@=vuEEE܋Hىωָ   tftEE =wEဃ)ȋ]܋Kωփ~ tftE܋]ЉXE̋BD$ D$ED$$]蚇EIeWdIt$D$$]D-d]Ɓ?t$D$$CMčGED$D$ E؉D$|$$]M U܉ MDD$)ȉD$ ]؉\$EȉD$$] EE@T]?L$MD$$CU܉E܋ML$D$E@$BE܉؉}܃}EUqd^]̋R, ]9]uE]E@,E]EE9E|EH,EE}؅EX]@E܋}ȋE)NjE@X0ppuCpM}UčJŰ;JSHFEĉD$ML$$](dƁ?t$D$$AD$D$ D$M܉L$U$t$D$U@@p$6AD$D$ EĉD$D$$U@|$$xct$1|$$@E̋@D$D$}@@0$]9ct$D$$@D$D$ D$D$Eĉ$&t$D$@@p$O@D$E܉D$ ED$D$$t uD$1D$ ED$E܉D$E$]1Ɓ?U؉t$D$E@$]?U؃9uHvtHT1҉Ut$D$E@H$];?U9uUD$1ۉ\$ EĉD$E܉D$E$]|$E@$waƁ?t$D$$>E)ED$D$ D$D$E$]TE@|$$at$D$$c>D$E܉D$ ED$D$E؉$] H } D$1D$ EĉD$E܉D$E$]1Ɓ?U؉t$D$E@H$]=U؃9u" 1E@Ut$D$$]}=U9u ppu;t#t}učNŰ;JXLJEĉD$ED$$]_Ɓ?t$D$$<D$D$ D$M܉L$M $tt$D$U@@p$<D$D$ ED$D$$*U@]؉\$$]^t$1|$$5<E̋@D$D$}@@0$]^t$D$$;D$D$ D$D$EYučD>ED$D$ D$E܉D$E$]TE@t ]̋ ;qtE؉D$$]]Ɓ?t$D$$C;D$D$ ED$D$EЉ$]E@E؉D$$]?T$D$$:D$E܉D$ ED$D$E$]SEƁ?Ủt$D$E@$]c:Ũut$D$E@L$]):u 3EƁ?t$D$E@$]9uL> E̋];X- iEƁ?Ủt$D$E@L$]y9Ũu)D$D$ ED$E܉D$E$]|$E@9E؋]9Efuucfr 1t`u 9}tQpt$$]uE䍐 E܋HcfwZ]䍓 T$Uu܋F$NU 1ɋE䍸 E䋀 EE܉E9EBEEUWVS DZ]-719X‰PtAC:uf11ɋCD$ CD$C D$C$KtB[^_]5C9u-7 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]U -7$]UWVS u] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$t[^_]FF9u-7 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVS> ut$;#vu[^]UWVS }GDE-798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$wD$D$<$"1EU -7$]UEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVSZ U} w to1t6~RutF$u1[^_]ÉU$t8U F@RuDžtÉv$1҉EM׋q tMv$suME9xԋEM9A [^_]US] t.UӋE ȉt %1ȃ9u[]ËE[]UWVS]} 111 ȉt %1ȃu1Lȉt %1ȃuڋK t4u14Ɓt %1uۋIuҋu9h[^_]1[^_]US ÈE, t$D$  $膹x)0 1[]É$1[]øUWVS0g ,U, 0 @ E싃< Eǀ37HApEЅ-7EE䋳8 utayFEԋE%Ey E܋EԋuƋUE99ЅyBU)u܋UE)‰U.E9EEEƋEU)ЉE9gFEԉu܋4 u)y ‹u)֋Uu9Guԅ+^Ƹ-7uu܍t9B~ Eԅ3lD$D$ $/ǃ@ EЋ< EE1ҋ8 EMM܀}EEơ-7>< ;4 ЋM)ȉEԋHAEЅzEEE9E| E9AlT$D$EЉ$$/@P#< ǃ@ ;4 ^J  U-7UflT$D$$.0 >u Eu@@l8 < ;4 J< Alu, (D$ E$C…y0 )Љ0 p, t}쉻@ }艻< 0[^_]Ë=-7EEU싃8 EMM܀})y uyFȉEơ-7> -7ЋM)ȉEԋHAEЅ < ;4 }xM9M M9M, D$  $)0 ǃ@ < ;4 t@ 8 E܋E9  El"t$D$$,@ ;8 ~a0 p@ @@xu, XD$E$\y)0 @ ;8 < l<< t$D$@$,0 < ;4 @ u؀>8 u)ʃ-7E䍃  EԍlEfșƍry )ƋE9@M؉L$D$$V+@ 8 EE0u9~1$ 0 ]$uXE܉E< ;4 < -7u܋R,r@lE؍  E0, 0 0 u@ R98 E܋EP,< 4v4F‰EEu@M؉L$D$$*@ 0 yu9lD$D$EЉ$)ǃ< ǃ@ UNE;H@uRFuLf~-$@ D$< D$F $?V0 f=@ @$ @ 0 , tD$ Eԉ$…y0 )Љ0 덋@llT$D$$(< < E94 EЉEԉu($ \], t'D$ Eԉ$Ty)0 $ ǃ0 , D$  $y)0 0 E)ȃ9u@lD$D$$'@ 98   El"t$D$$^'@ ;8 ~b@ @@xuɋ, t5D$E$y)0 $ f0$U됉Ƌ< , t*D$  $躮y)0 $ 1ҋ8 EUWVS TE苃8 -7M19|4 8 @ < 94 -7Eǀ3794 9-7E?E)$ JEu ǃ@ E98.@@ltˋM t‹UT$D$$%뵉4 < PBh9}d8 T$t$$GƅtDE;@ t4$X U ?D$D$4$%uU14 < 8 @ [^_]Ë8 -7Eu@@h9ME4M䉋8 E;0 GE< @ ǀ37p >u~x-7UƁ?t$D$$I$mtGUt @@tut$D$$$@@lu$ gmu< ǃ@ -7E4 9P))Ή4 < $ 둋4 xǃ8 U QU8 U4 U @ U< 11]UL U8 U4 U @ U< E1]ffffffUWVS %-72-7E-7]19u9uV~sF,E1҉MEF~PCH1U 9F~59uuS9~S 9}͉9FˋU9VMIg[^_]Ë]S~Cs,~DUMڋXCӉu΁9u9uu9utɃ9u x37BH8~NHD~GBlthtËuu拐tt 1B  37@ xUWVS( ƉEY37EBH8ˁ:uƬ-7u@D*= }ƨ-7LJD -7Y\A`fAdBt%]?D$D$ $N EBt8]?D$D$ $ -7p2!P@EBlhzǁl2ǁh2BxT2@@Tƒth2t h2t h2t h2 t h2 @t h2@t h2t h2EHA\$fǁrǁt"fǁ~ǁfǁǁfǁǁfǁǁfǁǁtmfǁǁtLtfǁǁ~/Rrff@f@@ 9uǁp"ǁt"~&p"p"ff@@9u}苇D %ȋTp"Xt"LJL LJH 2-7E-7E E9tE9tE苘D ZHB~UJr,EEU܉}؉ϋ~HQE% ؉9u9uuҋU܋}D$$]_j1([^_]øE-7ȋtǁl2w-7Ћtǁl2Ntttǁl2)UWVS ËEU MfUfMf]Ǩ-7;7Lftv-7949)-7l2tot"уt>]f9p"t"]fp"]fr" 1[^_]Ét"ufp"ufr"fMfvt]fufEftwft8fXfEMfCfE8fufEfEfE}f9r"*t"BfEfE'UVS= EM ]f-7;B`N4f1Dfl2t1[^]ftf/ftTfufft9#ft*fuffuffufffff릸yUWVS$W U} uEEEƉEljEf-7;B\ @ frftufv37 I ytX2RtE}|$}|$ ut$D$$-;?T$D$$1$[^_]øU CEfx?-7;B\}1@rU f tUf vEf1]ø]! -7ǀTǀX-7 t%D ǂp"ǂt"L u1U勀D %1]UWVS f}M -7l2t^fTfVǀX-7 t)D fp"fr"ǂt"L ug1[^_]f3fthfufto'ftVfmcfuؾfLBD %1[^_]þ뜻닻~ G-7h2UVS a &-7l2tu?€37Rt*?D$D$$p"7M!A@f@d [^]UWVS îH t-7} 3x@tOu f-7f9pdt6l2t*-7fpdQ@E % ЉA@[^_]΍N} f_f|S-7UL$2@$7?L$D$$UUULf`L$2@t΍N} ff|-7UL$2@l$ 7?L$D$$bUUULfL$2@h$6?L$D$$UU-7$UM fxGU-7$sUM f -7f@dUWVS eU-7pFFy ;F|# tH4$b [^_]Ét$${UWVS; Uu FFy ;F|# tH4$b [^_]Ét$$zUWVS ã-7x|$E$Ɖ<$6b [^_]UWVS a} |$E$^Ɖ<$a [^_]UWVSa *U-7tJ } xCH9M ;X9}4xp,9"49M uM HP1[^_]Ë#ָ[^_]UWVSEM UtK xEpu9|;p9~4Xx,9"<79Uu7PH1[^_]Ë4&ָ[^_]UWVS Uztzr BEuNjEBw u)]ZڋOM)ʉ x=_]93O9},_w,9~ ! ΋M9u3GWGu [^_]fUWVS@ E}E E EE E @$]QÅxyGEGE؋E @ G]% upE-7E_E))9@L$ED$<$]؃@[^_]û놃 uG1뼸@[^_]ËG,U؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9r)UԋAFAFA F AF9sڋMA E @EȉE E%AfYE HvJM܉]ĉ}}$]M \_ XG E9u͋]ċ}EԃUt1Mٍr}}ȉ8)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]Q<$vM1 EGy1G1 <$] E9GT G8  <$]T1E D$<$]v1 UԋUЉE  E9:]ȉMĉ:BD|$B|U$]-UBHGfG9}s*w tUv$]uUG 뜉]ȋMĉU- UT$-7$&]UWVS  u}ED$E D$4$t} u [^_] [^_]UWVS tu-78E D$ED$<$tu } [^_] [^_]ffUWVS|M E}}M E $]EQw$]E1EHMGEȋGEEċE @M qMMM-7M t[E2 $ ]4ÅyEEę)EEĉEċt& uE9GTu G8 )EȋuڋwGEM)ȃM9EEċGEȋE ]EM-7MU rUUEM  / m$ ]EDžyE]ĉؙ)Mˉ]ME Et MuM} EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9ZU@t)G$fE9r)UGFGFG F GF9sڋEȋUUċu}ỦUUĉU]ȉ]UUuEȋ^,EEEF@ED$ED$ED$ ED$ED$4$]&mmuE]4EȋQT$ UT$D$ $M]LE 8 MQA(TE@ 9}E <U1UĉU uKEEEEE E E$]yVMmEEMmEąy1EămyEF$]y)EE9EbEWMFE EĉE_$]DymEHU8mEąy1EċF$]y)E<9e}U&FHGGfGfG9}FD|$F|$]luE$]6|[^_]ËyQUEĉAEȉA $]{MyUQE9ATtNEȃE u{}ω4$]<$qE1|[^_]E $]xyMEu붋E$]x=U U T$UT$-7$q]UWVS ÃuEE}ED$E D$4$t}EE u[^_][^_]U D$E D$E$]U 9 D$UT$-7$]UWVS  u}ED$E D$4$tE} u [^_]h [^_]UWVS qEE}-70E D$ED$4$t}EE u[^_][^_]UWVS G u-78E D$ED$<$#tEu } [^_] [^_]fffUWVS ƦÉUM0-ljEDWp1҉]]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}‰ DOu냉1sUWVS( ìEUM؋ufUވM݋U 1ɋU EEԋ}0-Et$$UEx}P$u܀G$H Ut}EMU E1‹E Et~MލAf qC$WЙDžNE݉Et$E$Uu0Eu1([^_]À}. G}ԅ~Mȃf wC$WDž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVS kUE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ et$D$$E[^]ûu111[^]U P R D$ ED$E D$E$]U輿 P R D$ eD$D$E$]UWVS} 6Nj2FEF<\<^t{Ѝ\0-r7%Ӎru<: <&~Hپ!J'JP'EE[^_]ÍFFZ%P0- QuJ{E< v^]v.F<0-]1DsD]}MMލ[{D~Dyuu}M؍\u2<\u7{ESȍэf  ΍ f )ʃ0Qfv)f )ڍ)Ѓ0P}E[^_]ÍJ{P]1TQu<.tt]<*yMl1nVU}uf%p}O0J%}d J]܈ZQUdEVU}f%p}O0JJMf%ctEF =8}Ef%pPU}W0PUEtEHM%+%c֋EE&VU%p0%Bp0%{B2}%*fB %-}O0JJUECVU%p0%B{10}B%/%{B 16}%B*%p0B%{10B}%m%B+}O0JJUE'UB\E%p0%@p0%?}W0PPEUMU܉ȉMbËE%>%tEU܋EFt E%+%;E֋EEL1<1JfKMC|D7<\F=]EPU\EUVS5 ƀ37t\ t~9t $sK\ EED$D$E $`uI\ tG@t  D.7 X @xT [^]É댋E[^]É\ @uUWVS(j /UEtBEE37E}<$/e UT$ D$D$<$u蹵N)) _U܉e)‹M) _UѸg4 )3lD$<$f EtTH tCp$1҉}܉ 9t-~fuUE܉D$$]f UuF([^_]1([^_]ËP 3l([^_]UWVS( UEtBEE37E܋u4$c UT$ D$D$4$襐}kLЍB)^UeЍBM)^UѸ>Љ)<;kD$4$Je E܋tRH t>x$1҉u܉ 9t(nuME܉D$$ e MuՋGy([^_]Ë;k@x([^_]UWVS(Ǵ ÌUEtBEE37E܋pu4$b UT$ D$D$4$Q}-?L) RЍ)ЍlXGEeE)  IȍE) GE*SRЍ)<;l_D$4$c E܋;p_AQ tJy$E܉u9t(~suED$${c uދF E܃9u؋E܅tЉ)EkD$<$^ -VUE}<$\ UĉT$ D$D$<$肉Mĸ-?L) @)ЍlXAE-?LeȋE) @E)AM*SRЍ)l_UD$<$^ Ute}tu}cu }uFEE3l$z<EEk$J=p_$0>렃}u E$1҉UffffffUWVSQ E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUj Uƍp@Hπw09}맋E D똉Uj UUWVS芬 K48,.օR@08G4<11$rD$ \$4$01󫋅0t=1(}J90t <u 90u狵(P)1~u,H]Y8^4~!%u~V%8H4X0@,q9r0t$$4I8C,s0K40u4` 8$4ȧ8` @0@4$4蔧8G,_G0Gƅ`%40- Dž,Dž$Dž(Dža`0:~LJwDɋ4nXKJw! .ʋ DNt{,4ʍ\qЉ,'~>aDž,>~`B<=w^4nW0)?(t9,> z$t-.(M,Dž,Dž(hDž$YilP[J߸ V8uo'dwEOI PDEG/8W,G4G,[^_]É,] CEP0 ]P,&Vҋ4xoE EP(, B08H4X0@,T9BtD(\$ `T$0\$ȉ$4Gt8C412<'urR1҉,,0O0PD]PEEP08P4H0@,Z9PJ8K40U{UJP,0$4.T 0,OPDŽPUw}7D$$>D$t$$-‰E$20UtYEE[^_]Í$WƅSE1ҋEEut$ D$$腱M$-@ x Utb}ut$1tD$$IEJ\ D$$($'5 Ex t;MEt$FtD$$ݰ D$$ǰED$D$ht@E$< tEftUft IA(Q\uEt E1|$t!D$D$$RB($tD$D$$RB끃}, D$$#tD$$ͯUVSw <EtD$ E D$ED$E$ƋEt$Q,[^]fffffffUWVS ֦ƉEωD$$I tB4$G ƀ?u1)9tXzzt"D$|<$ …uۉ<$G 9t 1[^_]Ét$ED$<$[^_]ÉUt$ED$<$xUu[^_]UWVS U uEUt E<t]V  [^_]É΋Ex %1ji˃1҉9rExtftEx(1}fWVu~9Vt"VT$<$](ljFVEptft]CPSD  Ћ]XgËuVf;h{CftMWҍTRӉEf}]}^ Qu F 8vE9uڋE}f8Pf]s} H u yf}uHD$$%]ۗ]C ExD$$!]託‹EPn!f8t;Pft2]{u0 ftXHt݉f8pxE;x T@$`|$D$$] & Ex E@$E11MȍV HnsffvrRPMu v@@1҉P 9rjD$$]e]C(11ɍ&mC}G G$t$]{G$uyf fE@$$]Ex D$<$]裕]C$f$ffs@sU@@Jru9U@}t*JrHUznnJrfM6fy'bUWVS,襓 jE׉MT$ \tD$D$ E$73=v(FQ ;Q 8,[^_]D$E$jƅtʋE$A UU܉T$}|$ D$ED$4$FltJUMt@:tOE$Eǃu(EPEǃu E䉃l 14$7m,[^_]ËE܉D$ |$BD$4$*ku΋MUD$|$E$觴E=D$E$iƅUWVS։Dž)t Pv9s:ut<:t׃u)u͋[^_]ËrtftƄE$txDžiDžUWVS , ǃl dt$Ѽ8/u$U… ${vt$蔼t!4$‹ [^_]Í$at,D$ tD$D$<$/04$t [^_]Ínt$TI/@$wlj($<$XuDžD$$Nj$OmtQ<$)4$‹4$|$$)t4$$j<$tmtl 눍ctl wUWVS詎 nEEE EUUD$$rtƋM‹E1lj4$ٓtKMUEt81ED$E$1> t' uMȃ[^_]ùȃ[^_]ÍHPEEE[^_]USӍ ØK Eu[]ÍED$E $9+[]UWVS֋N ufS[^_]Ë~Of JN fJy8VӋ6s!uu [^_]äftuutYyZfUVS éƋ$GF$t8t\tɀ^tăt8uH[^_]ùx1[^_]ÉdUWVSU uNE|F9sXtd|$$EtH~NU fFF}t<]fFFF [^_]Ëu1[^_]É<$렋}<FUWVS<譂 rE@ EE@ 0t$$sM4$E@E܋uFX1tftE$詇u}D$|<$ HM|$E@ $E$/ xDMED$E@$M;UBNju`P0@|$E@ $k$Ep/ Ǎ@ED>D$E@$mUu$跆EE<[^_]ËMAOMփEtfEtǤ$oE܉$dEP p,@ @(@$@,׃ EtU?Wx0My ɍL L$ T$D$E$$t8}uWfUE$襅Ep@@LEMA@AHADALudfx= 111D$ T$L$t$D$ED$ ED$D$E$tam7GED7Mnts{HP|1뉃}t>px111rx@11buE4$螄E<[^_]px1113u܉4$v֨u8uDMUUu$wEU r}fm몍u$8E0GU7UWVSs~ 8UJEtB9swt$U$\Ut]rJ] fBB ]fBxzE:us:u.u'EBB [^_]Ëu1[^_]äftu%u0tۉ4$zU]EfUWVSh} -uVzF9sHtT|$$\t8~VM f FHNMLF [^_]Ëu1[^_]É<$yUWVSX| ED$,E$} D$|$]_xD$|4$] PU4$]n* = t<$W* = E$]>* = D$$P].}ÉE܅F@ t$$<Et E 2t E D$,E$qEN EEE0-E̋EE u<.tjDy@u붋}]5 D$ED$4$]赖ËE8g E E܃x f_EĉUED$ EԉD$E썈uL$E $@EċUڍwEJЀv)ύ)ȍLD$4$p u [^_]ÿUZo |E=w l]1]UWVS $o {u4$ UT$ D$D$4$I}-?L) RЍ)ЍlGEeE)  IȍE) GE*S)ύɍlD$4$^ u [^_]ÿUWVS4:n zufF(}ȉ|$$ t4[^_]É<$C1t9,ufV(4[^_]UWVSm Üzu  F.7fV ED.7 4$@V(EfD$FD$ $U诏=UwDE |)ʉM싆t7T$UD$E$nU9sUJM|M))‹FtIT$UD$u4$0U9r4[^_]1$D.7[^_]ËUыU|UVSl RyutgF$qF$qF$qF $qF$$qF,$q4$q9 t 1[^]ǃ l x @l ¾x @tÍAfffffffUWVSk Æxlj$U D$$ & Et$UT$lpU$19UuED$$ r& 1[^_]ÉUED$$ R& $3UD$3UD( UWVSdj ëw8EE1EEƍEE> tqE9D$t$U$1Utˋ$2p$2UDŽp/( 5Euu ;t1< tHv0FIU$2p$1UDŽpUWVS<Ci v8U11ɍˌt6u& E+<ȁ<[^_]Ãpu@W@0ƃ:uVƅ/lFul$9$ґ  Ή$k0D$Y0D$D$ D$D$o4$k{qD$@|$/$蔉:tRP:uVpƅz빉1$L/Ή$[2Ή$*/D$/$ /D$2ω$.D$.b$:e$/u$ƅD$/4$U/tY1ɉL$T$/T$T$ L$D$4$tt$uD$$ {B1҉T$T$ L$D$4$/빉ouvFUWVS \e !ru}D$:4$t!D$bT$$` t|$E D$4$, [^_]ËU t考 [^_]UVS d ÞquD$:4$!t!D$bT$$ tE D$4$=  [^]Ud BqEwpt ]1]Ì]UWVSh9d pEu 8MU1ҍxlUpED$ vD$D$@U$UUƒE9~ЉEΉ )t$|$ʉUM$*MUӉϋʉU$+uD$+UD! !}|$t$$X*uU+u h[^_]ËEvUWVS`b ÒoEM 8U1ҍplUpMED$ vD$D$@U$U.UD$$ Z EED$ML$ED$A(;EUT$$ u@" f!^ut$L$$'U+uW`[^_] U$5*ED$&*UEDm UWVS`ka 0nEU8L$\1ɍpwbptNT$E UD$ T$vD$D$@T$$T$T$1t>$uT$ U MT$L$$ L$\+u`[^_]øGUWVS ` cmExw|lMpt_ƃtAkƍU$(ED$(UED [^_]Ãu$(Ɖ [^_]UWVSp_ Ǵl}EU 8uM1ɋ]p3lMpmQm8@E~Eߺ81xEM}E )|$t$ʉUM$]M&MUЉ΋ʉU$]P'}D$A'UD !\$T$$]]U+p[^_]ê0f%.t&CD$D$ ]#D$D$@}<$Gj뉉f>~$E~LSC9u1Uf~7g] ];US] YjEPw*ptV -[]Ãӌu$([]US?] jEPw*pt -[]ÃӌuU T$$[]UVS \ çiuD$:4$*t!D$bT$$ tE D$4$ [^]k - [^]UVS j\ /iuD$:4$t!D$bT$$q tE D$D$4$# [^]ËE D$D$4$ [^]US [ éhEMPw*pt - []ÃӌuL$U T$$# []US[ FhUBwpt1[]ÃÌu$[]UVS 9[ guD$:4$t!D$bT$$@ tE D$4$͎ [^] - [^]fffffffUWVSZ vg}E1E xt=1}t ƒu@u[^_]UWVSĀ:Z f}E|8xƋE  1@ E0 E|1E]EH Eƒx  EB A ǁE9uʋE%u, 0 < EpxEPMHx }1E]uJ˃4x MN K u9uʋ]uE%BzBE9yxE+?1[^_]ËU 1ۍU @t?ELt鸓$I )9uu1믋}@ E1ۍLE0 EEEu1}}}8KtDAuEƃ@E}t,ى%I$))9D E9u }u _]uE^@],1҃DD [ u̓E9uE, a:!@t$EDu۸@u܋} Ƈ ,E}8L8 0u} ] ]E M }~Et M  ЋU 1ҋMDŽ  r1ɉ]] u]U1 L ȉу9uMՉʉ EMU1 L ȃ9uMՉʉ MEE@ttM Љʃ Љ Ѝ Љ ЋU‹ELt 1itEUEEt @FEǀ  ]0UWVSXT LauE EM8ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE, EEEƃ4x  EF A Eu1E1EE܉}ԉEEƃ4x  NjF A E؃uĉ}EEHE, EEˉuEE܋E؋uu؉EEuuEE]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ ]3 ]3 ]3 3 3! 3" ]3# 1EEԋ$ ]3% ]3& ]3' 3( 3) 3* ]3+ 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u u3 u1E䋼$ u3% E1ljE3 3& 3 3' 3 3( 3! 3) 3" 3* 3# E3+ }m1]E%MɁ ȉEE%MɁ ȉE1E1 EEE0Ãx  NjC A EuċE8upuE+u!1X[^_]ËME 4UWVSPTP ]E̋uM M8EЉNjE19$}܍]]ȉ9u<$…E<_t:t< t<:tMAE̍$v}ЋU+ZP[^_]ÉUĉ}؋}1D$ D$E؉D$$u+EҀ09uE؉$tEԀ8*sx0iE̍'vdEEEEEyD$ D$$<$]g9tD$ )D$|$E؉$Bf}2ae}sha1f}1 }argo}argo}argo}n2d}M̈ _ȍ  MEE Ȁ`QŃ?}<9E ЉEE9uËUċEEԃEM̍ MEM̍M/^Ń?}t}<9U}Ĉ  ڃM4`À@~^뿍^҃?뷀@~Q>Q҃?3}EԉD$4$p< .t&U<:MMEM̍ MME&}n2idN}DEԉD$4$대}EԉD$4$ nEËED$ T$EȉD$}̍ $,EfM ȃ?9K?9K ?9K8EfM ȃ?9K?9K ?9K8CEf?9K ?9K 8CC EEԉD$4$I2}n2i]UWVSIK XE8EEXUэuuUS1r 9uZ9MuߋU$U+u[^_]Ë]~UWVS,J WE؋U8ENjE1Z}uU܍S1MJ 9uMZ9uڋU܉U} D$ D$|$<$uEUZ8uECу9uF9t܋E}U+u,[^_]ø]蝐UWVSDI VU uU8‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$S @D$$ t@D $9sÁ t׉D$@BD$ <$L$ $?293?!~9.?J9)1?߲9%?+59#?x}9#DžTDžJD$$KD$$K(D$$HP489ȉ )ڋ09<} D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$n$D$$AtD(,481։ 1 <90Dž|Dž@mDž ^DžODž@Dž1RUWVSE kREu 8‹E1D$D$H $TyDžDž4$襌8$u ~vt$4$Ɖ$DžD$$8vu[x=uUT$$ D$$p DžDžDž DžDžg|$4$3ptjtmt2$9I1U+LĬ[^_]ÍT$$x*tT$$y6OT$$xۋ%t$6v$uDž!t$>v$DžID$$ƉDžDž|Dž[<Hv2BIڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/Ӄ? ЃA! = ЅiD$$?t*D$ a7D$D$p$$PF 4$|$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$sD$D$4$sD$D$|4$sD$D$p$s$%D$FvD$ -$UVSM? Luv$sD‰)Ѓ[^]øh`UWVS4? KÉED$Zvut$u 4$"u3D$ ED$$EE8$E $]Ch`)‰UE E h`9tt$u+E E܋E$]RNjED$ut$u t$u܉t$ avD$D$bJ E$J t$|$ ML$D$E$_}v/lj|$t$ ED$D$<$/9]uىE D$E܉D$ED$ED$ ]荃jvD$D$b}<$=U^D$O O ȉD$$9EPU9uD$]J J  J ȉD$$EPU@D$D$4$pE4[^_]14[^_]EWfffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSƉEfM䍾}܁H1۹1҉}f;]ǃ? u}19uEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uu9Muƃ[^_]ÉǻLUWVS98 D9ɍL  dH USHlf`TEPƋ@D1\f;`6 uދ\19u111ۍhXdLD1` Ѐtfu Ѐu拕`1Љd1f< Ȁu1hXLTdPhxP9GTP0`DP1\f? uዽ\1Љd1fH Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@D98uԋX1ɉ`T1f|=؃ u9uѻ@TXO9uu⋽`E؉`]BbJ9uߋHfǂK $2?ƂK aHK ƄK $,T$ uvT$D$$7D4$`D$HD$T$c14U+u{[^_]Íxƅ??tOlEȉDRHuUWVS / ;u(} 8E14$$?$u 1H$9u勅)ȉx  @4$+$D$(|$4$D$|vD$4$kT$|$4$O}<$$D$(L$<$(T$T$<$ $D$(L$<$|$0, $ $lj~T$,D$4$Dž0Dž4Dž8Dž<$,D$4$Wt&D$uڋ(D$4$1uڋfǃ,L $1ƃ.L $ D$D$/L $ OD$x~vD$ B$Ot$,$1s$D$(D$<$ ɋ D$,D$<$d|$,$B<$ʉ)Ѹ%I$))Љ)‰ :D$,D$<$ ɋuo$D$(D$<$9$D$(D$<$ D$D$<$Z $D$(D$<$3p D$D$<$  ?,L  L D$06 < ȉD$$ L  L D$17 = ȉD$$= L  L D$28 > ȉD$$ L  L D$39 ? ȉD$$ L  L D$4: 5 ȉD$$w L  L D$;T$$M L P L @D$D$,$&]E+[^_]À$')MDž0Dž4Dž8Dž<Dž Dž Dž(oUWVSx( A5MMUu8ƋE1@Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\E[1ۍT009u$ND$@|$<$豣E D$D$<$蘣|$$¥<$D$@t$<$jD$t$<$P|$4$耥E+[^_]Éu4$莢UT$L$4$t$4$Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TkfUWVSq$ 61utJD$ED$4$'NjE9t.8u)8"tE 81[^_]Ãu1UVS $ 0EU ]~Í у? H9u[^]UVS# 0EU ]~Íу? H9u[^]ffffffUWVS8q# 60ƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$t8[^_]É<$5uEĉ|$4$Eă8[^_]U" /Et t&t1]ËM t6v]ËE tv]ËE tv]Í-v]Í>v]Í6v]UWVSZ" /u} 4$9uw[^_][^_]UWVSd" .u}$}(E($EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$a…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$ <$&UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$)8UtE(D$}<$} E0D$E,$k <$%jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVS [*u4$xu1҉[^][^]UVS^ #*u4$@u[^][^]UVS# )u4$u[^]}[^]UWVS ì)}u <$ …uA}wLU>…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSXf +)M $NƉEE$)ljE4$ƉEE EEEED$ML$}<$1t.1EM $W!M $L!4$D!EX[^_]ËuE$EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVS ù'}u <$ …u8T…u+t"11U2 у9uUɃy Ѓ[^_]úUWVS H'}u <$b …u=…u+t"11U2 у9uUɃy Ѓ[^_]úUWVS  &}u <$ …u=h…u+t"11U2 у9uUɃy Ѓ[^_]úU b&E##+Pፂv]Í-$]Í4 ]Íl ]Ív]Íx]Í2x]ÍEx]ÍVx]Í ]Í8 ]Íl ]Íx]Í ]Í ]Í ]Í ]Ív]Ív]Ív]Íw]Íw]Í%w]ÍBw]Í^w]Írw]Íw]Íw]Íw]Íw]Íw]Íw]Í ]Íhx]Íxx]Íx]Íx]UWVS G %EwrE$c5NjE $V5ƋE$I5E|7E$ 5EU׋E$4ƋE$ 5 [^_]Ãu$tffffUS  X$U T$D$U$sK []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVS]u 1ɋ΋T11Tu[^]UVSw <#u Ee…t5҅u.URу+?҃/ [^]UWVS É։ϋMER)Ѓt$9uuE [^_]ÃEE9sDE11փE? كCwʋE9EuljUt)?UZsEE9rEE [^_]UWVSEUEEEEM4u}Ov(}W];;}}UM0~^z) ҍ^!ڻZ) ! ڍ~л9) Ӄ! ˃+Ӄ>΃/փ? ҃A! ځ}w ҅Uu}M[^_]1[^_]UWVSE0 wG׉1w7  r-у0 v9t}0t ؃[^_]Ã9t1ۉ؃[^_]UWVS J u} FEFED$E$O?$ug$ED$EUT$<$/u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=u}tUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSXy >}EE8UE1D$E$wƋẺ$-E+} f$OME Eĉ4$U9PMMȃ/MU)ƒ$v=yM}BEŰB8D$AYUĉT$ D$D$u҉uȉ4$J4$n‹E9\BPBMыE)Ѓ+$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$I4$9M@}uȃoMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$H4$\‹E9JBacMыE)Ѓ,p=yM}EŰB0D$UĉT$ D$D$uȉ4$mH4$Փ‹E9BEЋM)уf$xqE̋H@$i)ƉZf$E̋0QG}̋O $N1}E+/EX[^_]Ë}ȤA}f}ȃ0f0ft&"ffvE}}qM^rEM)M(W}ȃ}f}ȃE҈AyuӉfE҈AyuӉfE҈AyuӉ fE҈AyuӉ$fE)UMR)уtu]UVSU ṽщcw[^]ffffUWVS @|$`Ѝ$$X03ps$X$\2z9uً$XA$\A$`A $dA$hA$lA$pA$tA $xA$$|A($A,$A0$A4$A8$A<$A@QD5т歁RQ$$AHQL5l>+h$$APQT5kAكD$ T$$AXQ\5y!~[D$pT$t$X$\D$PT$T$x$|$`$dD$@T$D$$$$$h$lD$(T$,$$D$xT$|$p$tD$T$$$D$hT$lD$`T$D$06_D$4:OD$8+D$ $D$PT$T$X$\D$pT$t$$D$8T$<$$$$$$D$@T$D$`$d$$$$D$0T$4$$D$xT$|$$D$(T$,$h$l$$$$D$HT$L$$D$hT$l$$D$T$$p$tD$ T$$$$D$XT$\$$$x$|ȍ$$X3J3Z3 3ZX9ue[^_]UWVS]u {@1ɼCg jC;ʄC gC+Crn+C,hC0kAC4كC8y!~C<[ڍ~@M]u 01pq]u11r9u]u 1[^_]êCf8fUWVSLs 8uE 8U1҅P?EEEEEEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$tFXF\FPFT UWVS]Es8U -ST SP!<}J`)ЉE< u zeSC@SDC@SD1EU19EsH{LS`#ǃE}} =%M ȉEC@SDEUC@SD1U9иEs11sH{LʉMM逋E)=w}U `< u s,uu1[^_]äftuauit11t&fuUu<oҹ`^PffE pE땸+UWVS lj(UE u8, M1ɅH?fM?W0E1Dž2Dž6Dž:Dž>0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$$&$p 1߃}rMEuQEuHD$\$$$D$$(e1,U+[^_]äfEtD$$$($tBXB\BPBTD$$D$$$Ǽ$t맋(`UWVS\ yML$} 8D$‹D$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$T΋9EAT AP1F@VDF@VD1FHVL%t$FPFT)ȍT`D$D$$^V`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$~n!D$0 n"D$0 wn!D$06 Yn"D$0;n!D$0f n!D$0Hm!D$0* m!D$0 6m!D$06@ m!D$0Im!D$0 im"D$0qKm!D$0v, -m!D$0Xam"D$0:bl!D$0l!D$0|l!D$0gl!D$0Nyl"D$0[l!D$0=l!D$0h6l!D$0Jl!D$0,k!D$0k!D$0k!D$0,k!D$0mkk!D$0Mk"D$0x /k!D$0Zk!D$0?EEEpD$D$$]}}GU܉B0G??E VEX}E؉mE؋E@N?EX څ}wOE ]UԋuM؉]]BƃvUԋU]uM؋]EȋM)ȋuFMA :E@O?EЉEEE_ E}M̍}WPGX WTG\GG?} mmEԋE@H?}uЁxE܋UĉP pUԉxuUVߋuԃItftE@t E@ \ )UUԋEHDM)щHDE@uFDF:?9EP UR$tB1ҋ}G9?E@;}W$tB}GDG;?}wCE@Uԋ]uMBƃvUԉ]uM؋}EG< }E̍%XU܉BE@Q?UBD?mmEԃ} wCEUԋ]uMBƃ vUԉ]uM؋}]SdCh s`}mw ) }E̍ U܉BE@Q?Uԉ]uM؋}uȋE)} 老B??or]ԉu}벋Et1] 9uE|0C$tH$MtKD;H(s ACDEuEP)uuԉ E@??E21] 9uEE|0C$tHMtKD;H s ACDEuEP )uuԉiUԉ]uMUԉ]uM؋}uȋE)}ԉ]u}W4])Ëw89)W,ƋEPD9sȋ}9s)E)‹]SD}9u}ċEPD @E@R?E&А{9UsBE]ԋu}MCǃ9r]ԉu}MظЋ}!]CDCD})U:f*EEE@P?uȋE)EJ c M)ȋ]]]MYl]ftYt]9]U}E؋UMyQ?x ft }E̍ U܉BAQ?EE1UċuЅ2 E}GDuGH?Uu ЉEE!ȉp@U9Us|E5]ԋuU؉}}xCǃE!MMȋMMHfM@M9r]]؉uu}U؋Um})}؋M}v]ԉu}EǀXPHX׋E!Hp9Es_UԋM؉}؉]]ZBE}E!u4E~v9rĉUU]M؉]m)E؋]艃sD 3Eǀ@??Mu)ƋE@D9E@#E@ u}UU1Ez@ t$EԉD$UB$]#cUB)uuԅ=REǀXPHX׋E!Hp9EMUԉ]E@`E@ 9t$EԉD$UB$]ybUB)uuԅR"EpHXL@K?9]sB}^Uԋu}MBǃ9rUԉu}MظЋU!Ћ}GHU)]m)E؋U艂rDE@M?U4}wC}]ԋu}MCǃv]ԉu}M؋Et }@$t@0NEB))9E}E̍%XU܉BE@Q?}/]ԉU-}E̍c{EPD@B?} EEUԉu@}E̍6|]܉CE@Q?QqItDUЋ])ڋ]ډD$T$ $]̅`EHU܉J0X xEpEu99E̍|U܉BE@Q?EЉEE}U̍{M܉QUBQ?mmE9s55]ԉƉȉs9r]ԉȋ]M)؃1u]M؃w-E̍Y&]fDSt9uE@lu荆4FpFPFXD$FXD$FpD$ D$FtD$$]n}{]܉CFQ?]ԉu}UT$UEԉD$}G$]F^GUzU}E؋}uȋE)BEԉu]?EED$ED$}G$]]G7}E̍|{]܉CE@Q?} ։uU! yf}q<9}swU}]]؉EEIPUuU!Muu4NfMvM9rEԉ}ω]؋E]M)ȉ])E؋M艹EAD<"E@l@E?1EPL@I?]K9s5\]ԉƉȉs9r]ԉȋ])؋MF]tKrM}uMEE@G?} }uȋE)EEP$t EEt E@ E@6?EEfvPjEfED$ED$}G$]c[GGEE}UUԋuȋE)EE>Eԉ}]>@ WlaE@l@F?1E܋UĉP UЉPUԉUPEUPuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS | à}u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$q\ML$M L$$[\9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS${ Eԋuu8E܉NjEEFE~@@}S?}GS?wH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃUEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]fffUWVSs E}Mx11 rtE xfDU9uEExfG0UofxZUWVS4d Ƕq}̉ÉEЋ@,E܋{t-Ek@^S,s@JBBF|FlF\FtdžFxF`FhFH [^_]US]t+S t$C$tuSzu M J[]ø[]UWVS]} ut:S t3C$t,u!tSRt S[^_]ø[^_]UWVSI VE]S C$fu{{} G9rrU )9~։U #Ef 󉟼<$]?}U )uU E [^_]E E [^_]E US]tDS t=C$t6…u)CM MMMH|[]ú[]UWVS}] DЉ ЉECEtƉ ƉugWBteJ0zPt9r[^_]Ãu߉ MʉЃ[^_]ËE9rX[^_]ËztfGtiGOt )|uO$t )|uO,]U뤃zl =uR+UWVS4|G ETE܋EE؅Y} OE@EEP &PE@=u~uN(] ^(v=* EPA@qE@ EM$  @M L$M $MPct'} fN}  E;EXu E@(E؃4[^_]ËE` -@MAEЃ} n] ۍ ~ 9=EHE@Extu nx} WEPEH0uFXFu ^EH0VFX^,EH2VFX^ EH3VFX^ EHVFX^ EHVFX^,EH VFX^ EH VFX^ EMA~؉AE@Ee]C0E _E@lt B))ЃuNVZ^$NVZ^Fl6D$D$$] $MA0]CqCE@9ZD$D$$]MA0uVFHNVFHNVFHNVGB,JA:Zȋr$}_OqwЈ GHWGX_ GHWGX_,GHWGX_ GHWGX_    uNFX^FH VFX^ Vzt*JVFX^ FHVFX^,VZ, E@ @E=}  VFHNVFHNVFHNVFHNVFHN   uNFX^VFHNFqE|~@FEtsIk[M gE@@, E7EXۋE@I} ?E` -@MAEEPJ]{}s B)E[ ]9kUotftB BJI,t 9E EB UEUBGMu)M]z }JIr 9EE])ZE߉΃tSEi uE@0NVZ^NVZ^EP0NFX^4NFX^tM)ȉD$BȉUԉD$E@0$]MA0UE]ڋE}x΃Ntft]MKKSB,E@ E@IBuN&ZV z~ ^x~t4FV9F uՋz,t9EFnV1묋EPZ,t @9E@ E@[J$ uN*Z$V z~ ^x~FV9F uыR,t9ruEFV1묋MAhE D$E$0Pb)ȉD$NL$E@0$]MA0)ȉD$NL$E@0$]MA0b W]C@,C9CgB,MAgtsE@P]9S sECMI0uVX^ EH0VFX^,D$D$$]+MA0uFqEFjfmEK1ϋGtG`W8GlZZZfGtGtOlQWl9p_t^M }Eǀ} (M7A\Yl])…A8D$ T$D$u4$]3FlF\M@G\)…x9G8t$ T$D$<$]O3GlG\ P1ƋEPu^VFX^ EP0NFX^4NFX^E(E}E(G`GlO8MtMLU:QMZZZfotGl9_tS_t=E qG`GlO8M;9MhE)L$CD$E@0$]MA0V7D$ D$D$E$]U.} HEEP~@B)ȉD$uNL$E@0$]2MA0V<)ȉD$uNL$E@0$]MA0F@,L:Q1:Q(U썔UЉ}]]׋UI:Y:Y:Y:Y:Y:Y:9~:Yt}]ԉUU)сO`9_`ٍAZZZMff G`)GtGlG`9xG\Wl)…G8D$ T$D$<$]]/GlG\@E<EuFD$FD$E@0$]MA0VK1FEǀ} `MA\qlu)…A8D$ T$D$u4$]`.FlF\pEPE$],5'uFDVLfDPTT$D$$]Nt[FlF\dž>ɀ @\Yl])…A8D$ T$D$u4$]x-FlF\4@u FE@@\Yl])…x?A8D$ T$D$u4$]-FlF\1n1N1w1fEP}]ԉU}]ԉUt}]ԉUc}]ԉUR}]ԉUA}]ԉU0}]ԉUUWVS4 @} EJEqEp3 Y}OE@ M苔M9~(uaE9tF}LDDF|EE[^_]D$E$E@FtFl9F\EXYtYVDFLfDBDD$D$$dž   9TE,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS 1 |>EuE EM}EEEEE U$o81f8]vEFF ^$}uEEG} }UD$D$F($V ÅUF0@*P@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]A|A13u3 eE;F$EF F( [^_]øCE` -@F4$}U ED$ED$D$D$D$ D$E D$E$]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@ CL{DMqD-{uvuju^CMQ+QS $ | 0 E[^_]älfb.t&ft.t&`fV&ft&fu5AfY{8f3f+0f(-f%*$ E1E%^* '7UWVS8D*  7EȋM }׃}TuĉU 2A3؃u߉߉UθEEEE]ȍỦuEʋ1E؋u3ruԋM3JMЋ}3z }}3z}܃<EEEEE܋EU U҉3tRET  }9`U릋}>X8Xr‰]f9]s‹EƋE܉D [^_]ËEX8Xrf}U냉E܉D [^_]UWVSLÉ֋EЋJ9}A EǃPǃT=1E1M̉ыU"P\ ƄXE9tf<ufD9uM̃YẺMM}ȉuK}11҃P\ fƄXU)‹}}t T7)t4}뤉MMuEFM̉uȋuЉuM̋uȋPM}̉uu9B3XEfpfq~` UЉv}` UămẺP` ` }Љ6` MȋTMEUĉX MTMȉT Ѝ UȍUffXEX8*%MuET` Eȋ}P FE̋AEAEAEč< 1mu1 9r EЋ}fD}<ET PEE]<)ދ]4 ]EtD9}7]Ѝ DD]9}EfA9u|‹]fC< ]9{11uK: fNuExBuЍ|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]ȋ}tEčPUȍ4C: fEȉC< ftfC< fK< f< Uą$=uS< }ȅt>uă\ 9M|uЍ<L9t)fWmuȋuĉ뤋MċEcȪf1E*ȪfUWVS ERfDHDE1E69t*9}tuf| 1]9Mt>9|9}6}f| tK9U19Muƒ [^_]Åt49]t Ef| Ef u1]z E$f u$1ENf t1E*]1UWVS BE%Z]\ ]1һ}܉fMMc9t|~ | Uf UU)9fGHOOGPWW )UUDu  ډU ʹ)9fGHOOGPWW )ڍL0~E fOWZ_WGX_ )fEu99E1EM9MUUUUVU9D$U:^NjFD$U$0tE 8Q [^_]1 [^_]UWVS M  }GtUD$U]ƋGD$U$0t+4$P=yarauE 0ܺ [^_]É4$r1 [^_]UWVS Õ }GtUD$UW]ƋGD$U$0t+4$Ӥ=tciduE 0_ [^_]É4$1 [^_]UWVSS  ED$E D$E$UtSEt4}D<$\ƋED$<$/tE01[^_]ѹ[^_]蹹[^_]UVS Åut$E D$E$œt.yaraUFƅu [^][0[^]K0[^]UVSQ ut$E D$E$St.tcidUƅu [^]0[^]ܸ0[^]UEU E MMM] UEU E tcidMMM]UVS iE D$E$vƉ$Ǣ=tciduE0[^]1[^]UVST E D$E$EvƉ$w=loobt 1[^]É4$ŊU[^]UWVS E$ډt,ƉD$E D$E$vlj4$M [^_]1 [^_]US fE D$E$uUT$$dA[]USh -E D$E$YuUT$$A[]US/ E D$E$ uUT$$A[]US ûE D$E$tUT$$)B[]US ÂE D$E$tUT$$WB[]US IE D$E$utUT$$`B[]USK E D$E$8t,ƉD$E D$E$`olj4$( [^_]1 [^_]UWVS z ?E$D$7t,ƉD$E D$E$nlj4$ŗ [^_]1 [^_]UWVS  E$D$y7t,ƉD$E D$E$nlj4$c [^_]1 [^_]UWVS zEU$T$7t,ƉD$E D$E$9nlj4$ [^_]1 [^_]UWVS S E$D$6t,ƉD$E D$E$mlj4$蝖 [^_]1 [^_]UWVS ôE$D$6t,ƉD$E D$E$qmlj4$9 [^_]1 [^_]UWVS PE$D$66t,ƉD$E D$E$mlj4$֕ [^_]1 [^_]UWVS ( E$D$5t,ƉD$E D$E$llj4$s [^_]1 [^_]UWVS ÊEU$T$q5t,ƉD$E D$E$Illj4$ [^_]1 [^_]UWVS c (E$D$5t,ƉD$E D$E$klj4$讔 [^_]1 [^_]UWVS E$D$4t,ƉD$E D$E$klj4$J [^_]1 [^_]UWVS aE$D$F4t,ƉD$E D$E$klj4$ [^_]1 [^_]UWVS 8 E$D$3t,ƉD$E D$E$jlj4$胓 [^_]1 [^_]UWVS ÚEU$T$3t,ƉD$E D$E$Yjlj4$! [^_]1 [^_]UVSt 9E D$E$eiƉ$藕=gntst 1[^]É4$'tU[^]UWVS  E$'%t,ƉD$E D$E$ilj4$j [^_]1 [^_]UWVS ÁE$$t,ƉD$E D$E$Gilj4$ [^_]1 [^_]UVSb 'E D$E$ShƉ$腔=atadt 1[^]É4$vtUEt 4$vM[^]UWVS öED$E$tt,ƉD$E D$E$uhlj4$= [^_]1 [^_]UWVS TED$E$4ut,ƉD$E D$E$hlj4$ې [^_]1 [^_]UWVS- E D$E$gƉ$P=gntst 1[^_]É4$$P$UDžtڋUT$D$4$$t U:[^_]É<$'UVS hE D$E$fƉ$ƒ=gntst 1[^]É4$A$tU[^]UWVS F E$V"t,ƉD$E D$E$flj4$虏 [^_]1 [^_]UWVS ðE$$"t,ƉD$E D$E$vflj4$> [^_]1 [^_]UWVS Uut*t$E D$E$%flj4$ [^_]1 [^_]UVS@ E D$E$ʉƉ$c=loobt 1[^]É4$yU[^]UWVS ìE$xt,ƉD$E D$E$lj4$9 [^_]1 [^_]UWVS PE $jxt%ƉD$E$蟊lj4$[^_]1[^_]US8 E D$E$ˆUT$$/[]US E D$E$艈UT$$F0[]US ËE D$E$PUT$$0[]US RE D$E$UT$$0[]UST E D$E$އUT$$0[]US E D$E$襇UT$$0[]US çE D$E$lUT$$%1[]US nE D$E$3UT$$p1[]USp 5E D$E$UT$$1[]US7 E D$E$UT$$1[]US E D$E$舆UT$$1[]US ÊE D$E$OUT$$1[]US QE D$E$UT$$ 2[]USS E D$E$݅UT$$ 2[]US E D$E$褅UT$$2[]US æE D$E$kUT$$2[]US mE D$E$2UT$$2[]USo 4E D$E$UT$$$2[]US6 E D$E$UT$$12[]US E D$E$臄UT$$22[]UWVS ÇE$D$#)t,ƉD$E D$E$lj4$ [^_]1 [^_]UWVS_ $E $D$(t%ƉD$E$llj4$豈[^_]1[^_]UWVS  E$D$d(t,ƉD$E D$E$lj4$N [^_]1 [^_]UWVS eE $D$(t%ƉD$E$譄lj4$[^_]1[^_]UWVS D E$D$'t,ƉD$E D$E$Clj4$萇 [^_]1 [^_]UWVS çE $D$D't%ƉD$E$lj4$5[^_]1[^_]UWVS LE$D$&t,ƉD$E D$E$膂lj4$ӆ [^_]1 [^_]UWVS% E $D$&t%ƉD$E$3lj4$x[^_]1[^_]UWVS ÏEU$T$,&t,ƉD$E D$E$Ɂlj4$ [^_]1 [^_]UWVSh -E U$T$%t%ƉD$E$vlj4$軅[^_]1[^_]UWVS E$D$o%t,ƉD$E D$E$ lj4$Y [^_]1 [^_]UWVS pE $D$ %t%ƉD$E$蹁lj4$[^_]1[^_]UWVS P E$D$$t,ƉD$E D$E$Nlj4$蛄 [^_]1 [^_]UWVS òE $D$N$t%ƉD$E$lj4$?[^_]1[^_]UWVS VE$D$#t,ƉD$E D$E$lj4$܃ [^_]1 [^_]UWVS. E $D$#t%ƉD$E$;lj4$考[^_]1[^_]UWVS ×E$D$4#t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVSp 5E $D$"t%ƉD$E$~lj4$Â[^_]1[^_]UWVS  EU$T$w"t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVS xE U$T$"t%ƉD$E$~lj4$[^_]1[^_]UWVS X E$D$"t,ƉD$E D$E$U}lj4$袁 [^_]1 [^_]UWVS ùE $D$!t%ƉD$E$~lj4$E[^_]1[^_]UWVS \E$D$A!t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVS3 E $D$ t%ƉD$E$?}lj4$脀[^_]1[^_]UWVS ÛE$D$ t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVSs 8E $D$ t%ƉD$E$|lj4$[^_]1[^_]UWVS  E$D$t,ƉD$E D$E${lj4$b [^_]1 [^_]UWVS yE $D$_t%ƉD$E${lj4$[^_]1[^_]UWVS X EU$T$t,ƉD$E D$E$Wzlj4$~ [^_]1 [^_]UWVS ûE U$T$t%ƉD$E${lj4$I~[^_]1[^_]UWVS `E$D$Ft,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS8 E $D$t%ƉD$E$Ezlj4$}[^_]1[^_]UWVS áE$D$t,ƉD$E D$E$xlj4$&} [^_]1 [^_]UWVSx =E $D$"t%ƉD$E$ylj4$|[^_]1[^_]UWVS  E$D$t,ƉD$E D$E$xlj4$e| [^_]1 [^_]UWVS |E $D$at%ƉD$E$xlj4$|[^_]1[^_]UWVS Z E$D$t,ƉD$E D$E$Xwlj4${ [^_]1 [^_]UWVS üE $D$t%ƉD$E$xlj4$I{[^_]1[^_]UWVS `EU$T$Gt,ƉD$E D$E$vlj4$z [^_]1 [^_]UWVS9 E U$T$t%ƉD$E$Gwlj4$z[^_]1[^_]UVS äE D$E$iuƉ$}=gntst 1[^]É4$}tU[^]UWVS GE$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS' E $7 t%ƉD$E$FtAD$$UaU [^_]H4$l [^_]1 [^_]ÍAUWVS ~utJ 9u@~ G$…t,Ft/D$$U`U [^_]1 [^_]ÍAUP Et 9t1]Ë@ ]U, Et 9uP@tt ]1҉]ÍA]US áEt 9t1[]ËU tH Q9Ur@tD$E $`[]ÍAU ?Et 9t1]Ë@]UWVSG }t; 9u1G $ƅtGt"D$4$_[^_]1[^_]ÍAU ¨Et 9u @t]1]ÍA]UWVS mut 9t 1[^_]ËU tM 9uFtA F EP$UHDžtŋE HɋUtOFt@L$D$ cD$T$<$cF~}~ t$sA븍AUWVS éut 9t 1[^_]ËE FtE $qF EH $M…tFMtI} |$D$ cD$L$$U&cFUV}~ t$oA믍Y}D$ `D$D$;4 $zUS Et 9t1[]ËM tM 9uL$$)mUS zEt 9t1[]Ë@tU T$$r[]ÍAUSa &Et 9t1[]Ë@tU T$$-r[]ÍAUS EU tG 9u=t99 u5Rt@tT$$q[]ÍA@uፃAٸfUS hEt. 9u$@tU T$$wq[]ÍAfUWVS S u~(Ft  [^_]D$ED$ D$D$4$1tȋUBU$ܽDžtFD$ED$ UT$|$4$t}M9Muu>uyF8"udF1M Z$ sƅt' D$4$eFF FE 0 [^_]É<$D$,fD$4$ctՋMofffUVSUE 9t4J2Ht"JZxPx3H3X1 [^]1[^]ø[^]US跿 |(5D$$L $蠍[]USy >L $z[]UWVS4Q M EpAQAtpl}D$ T$L$D$ uԉ4$^D$|$E$ipt2t$E$5mt|$E$^q4[^_]Í14[^_]ÉD$ T$9D$D$ uԉ4$D^y D$ D$D$ $uUVSA E 0t$L $\4$1[^]US D$L $ƋLD$L $1[]UWVS载 Âlj։M{ML$ED$G$YWVEU9ErfEG[^_]-{8"u1UWVS4 lj։M{ML$ED$G$˥V!ЃtNEG[^_]z8"u1UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVSP ƍ(5D$$XL <$7t$L E$ t $E4a<$ UЃ[^_]ÉE<$$ 辸Ut֍lD$ $M`MAFAFA<$證t$E$Mt+$E`<$脉M $UЃ[^_]ÉL$ME$M9uE<$HUЃ[^_]Ís}D$ (D$D$M $rUVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVSݹ âutl9u4$^[^]1[^]UE@]UWVS蚹 WEt l9t1[^_]@t9H@1һ9ˉr|9[^_]ËP@Ӂw?Ӂ19ωr-9[^_]ø@[ QUʸ ‡Et l9t11]ËP@]U蝸 ZEt l9t11]ËP@]Up -Et l9t11]ËP@]UC Et l9t11]ËP@]UVS Et l9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVS荷 JEt l9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS Et l9t1[]ËHX@uȉwދE []ËHP9ȸsUS襶 bEt l9t1[]ËHX@uȉwދE []ËHP9ȸsU? Et l9t1]ËHP@txE P]US ¹Et l9t1[]ËHX@uȉwދE []ËHP9ȸsUVS葵 NEt l9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVS Et l9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS茴 IEt l9t1[]ËHX@uȉwދE []ËHP9ȸsU& Et l9t1]ËHP@txE P]U ¡Et l9t1]ËPH9иrE ]U蟳 \Et l9t1]ËPH9иrE f]UY Et l9t1]ËHPwE ]U ܿEt l9t1]ËHPwE ]U ¢Et l9t1]ËHP@uxE P]U裲 `Et l9t1]ËHPwE ]Ui &Et l9t1]ËPH9иrE ]U$ Et l9t1]ËPH9иrE f]Uޱ ›Et l9t1]ËHPwE ]U褱 aEt l9t1]ËHP@uxE P]USV Et l9t1[]ËM tM 9uL$$[U ؽEt l9t1]@tHxUxU M3P3H ]Uϰ ŒEt l9t1]@tHxUxU M3P3H ]US肰 ?Et l9t1[]ËHX@u xExȉ3E 3U []US4 Et l9t1[]ËHX@u xExȉ3E 3U []UWVSݯ Ǟ]1ɍuEEESt [^_]À{(uSU-tn+ti0u UzxtmMMti;t D$oD$$~tU [^_]ù RAu_Uu>fUWVSPή Ó<$evH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$)fuP[^_]Ét$D$$_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$GeuP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPw W ӍPЀ w 0 1UWVS<Q 4$}cB BBB$BBB(B8O)Bf^.t{BDžT$T$4$Є\?D$D$ D$|$4$D$D$ D$|$4$Jcut)B wB8|<[^_]ÿ"[upBxSxauZxluTxsuNxeuHxBJB(zJxru"xuuxeux̃+)D$D$ |$D$4$D$D$ D$D$4$bu1<[^_]ÍHJx"t%QlHcBB(Qуzc<$N1USEJv[]ÉuUS úE ;Et1 []ÉD$ED$E$ []UWVS谨 u]u}E E $V‹FUJv<F H!uix-x-PVHt|B-ttlB-u<-uz>tBFv1RU/}u*}~,Fǀ  *fu1[^_]À/t>t t  ủ)N] t9uʉT$D$E $]bu?/ F(<>tt uHvf~ t{ lqG u\.x$E]}}D$ D$D$( $!^ t=u)Vx"xPV HЀ"u c"tXuEF(>FFF F$GFV1u)щN$x><UWVS0¥ EEu }8X1t9s]<<{<&uKatAlt,gt{qu({uu"{ou{tu{;u"례{tt;10[^_]Kmpu{ouހ{su؀{;u҃'`{;u<M{tu{;u>4EMMt<".E<\tdMt&ȋM)]9t 9rD]6U멀{p'{;CEt)<>tuE$p(r EpD$}t$$t}(u GtXtA1(u~u EpENjE$e[^_]Á8versuxsionuE tE E D$E D$}<$t}DžmD$t$E$z<$D1k~WIUD$E$m]UWVS) $Xlp$thD$D$E$zfp0xD$p$c8$MЋEԉhl!tW91!ȉh! D$D$p|$D$ D$T$p$Ƌt0<$fplD$T$4$KkE D$4$NjtPD$T$p4$kpT$4$-t$Ĭ[^_]ËlЉhdD$D$p|$D$ D$D$$Ƌt0<$ehD$T$p4$ajD$D$D$D$ D$lD$p$vptdtAT$4$t$1p$dt$ޡ1UD$E$]fffUE 9E]UWVS ƅtBD$$Et E$@ӘDžMu% $K1\$@貘DžtED$<$@D$G$?kEG,w0G4G8G<[^_]US` %L $ai[]US: 3XD$ $DlL $#i[]US D$L $hD$M $1[]US贚 yED$E $J[]US臚 LED$E $jJ[]USW E$(jE $j[]UWVS(! UM܋p4@,EEGEt@E<E t}D$ ,D$D$ $KUWVS uFt09u&x<$cƉ<$c[^_]Í D$ D$D$ $RKUWVS訓 mƄt1fƅtptC[^_]ÉUx<$Uc1ɋU5ƅtpt<$4c[^_]ÍD$ D$D$ $JUS ԟE xt"D$ D$E$C[]Í}D$ @D$D$  $PJUS訒 mUB4tB4R,…t8$ 8[]Í~D$ D$D$ $I}D$ D$D$ $IUWVS4 ݞUM@8t 14[^_]ÉƉ׍@E$aMt9pE}<$6Ex4$C7E$a4[^_]Í3XD$ $bL ljE؉$_UT$M Mԉ $\E܅$6<$V_V09V4E$`6N4F,E؋U<}Nj2UЉMԃD$E$@MԋU|A)D$|$E؍D$EF,}܉8MHF4F<E؉$^E${>E܃,}<}ܜ$4EMD$ $I5}|$MA$*EU܉PU؉$^|$}ԉ<$E܅$5U؉$]E@,vF~D$ hD$D$\ $FD$ (D$D$ $EUWVS@ }Gp4$^Gt'9uG@u1<$\0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PUUE܉4$<E܅UT$ D$4$3~D$4$<4$<U܋T$4$P tEO49H1gEq<$@[D$4$>Ɖ0[^_]Ë}4$(<E$5mD$4$v9n}э D$ D$D$ $uB}E$l5n 4$;EԉD$4$J= ~D$ D$D$ $BUVSj /E 0t$M $F,v Ƌ@$F8,uUB딍@D$ D$D$  $>1UE]UWVSӆ ØU9z<$VUB4pEthUJ4tR1}Ǎ ΉMr,Uv$E+4$+EMH,EqUJ49r}uN4B8F8<$ VE[^_]EE[^_]U ĒEt9u$t`8]1]UWVS Åu~<$UF8uF8<$|U[^_]UWVS聅 Fut 9t 1[^_]Í~<$8Uv4<$-U[^_]UWVS0 ut 9t 1[^_]Í~<$TE 9F0r<$T[^_]ɉUWVSȄ Íu~<$TƉ<$T[^_]UWVS苄 Puth9u^F4$_"EFE$=TF4tD1;~4s8F,D$E$k&uߋE$TE$)E E$SE[^_]UWVS îutB9Uu5~<$SU9u/U Ɖ<$S[^_]1[^_]1US荃 FEU t$9ut9 u 1[]1[]UVS; Eu Mt 9t 1[^]ËP49P0r [^]@D$ D$D$  $r:UVSɂ ÎEU ut 9t 1[^]Åt9 uH49H0r [^]W@D$ D$D$  $9UWVS,E ut 9t,[^_]Í~<$RF8t<$Q,[^_]ÍMU tߋUUUHMN4MtpM9MV,U܋MM9UM)L$M܋U؍TT$$n4F<E$'E$&T~D$ PD$D$u $8a~D$ PD$D$v $8t~D$ PD$D$w $8US §EM t 9t[]Åt9uM E[]TUS蛀 `Et 9t1[]ËM tM 9uL$$*U` Et9u]1]U8 Et9u]1]US ɌEt 9t1[]ËM tM 9uL$$1*US ÂD$E$4[]UWVS  U}U uFt  [^_]ÉU15t~(Ut [^_]ÉUE$!|MUt E [^_] $$US ŋD$E$[]US ~ ØD$E D$E$:5 []US~ fD$E$L[]ÐUWVS q~ 6ExU(E P $D$L|$E$/E p@ E4E}pM9D$E$C+E}D$E$!+ED$E$+trmEV0MM<NʈUV?UMD$E$*.1 [^_]ÍLD$E$0 [^_]Í D$ TD$D$sX${4}EE}FU}><<E]E tE $[^_]Ãt}E9E)>E1}E9E)><<Nkr<[u1R}GEt"E9E7E)ȉ >}> ~D$ D$D$eX$!0=2ƤD$ D$D$,X$/UWVS )x $u,D$$UUBB BE u Ѓ [^_]ËE $tUtJNju} s5E u%E uBE B Ѓ [^_]äBE B fE tM $1UWVS Yw u} tEt=$%tt%,T$$EAE@px [^_]11UWVSv ÷uE u@1$sDžt,D$<$GwE G [^_]ËE ${stDǃ} s E uE u뛤ƐfE tM E tE o1UWVS 5v u} tEt=$st%,T$$EE@px [^_]11UVSu ÔutG,9u=Fu!F D$F$tH[^]É4$[^]1Uwu 4Et ,9t1]Ë@ ]UOu Et,9u@]1]UWV%u Et ,9t1^_]ËU tP 9Urptt} suuɤfuufUWVS}t BEtH,9u>P pt0t{$U9qt!NjUs*ut[^_]Åu!1[^_]ftt鍃D$ DD$D$X$y+D$ DD$D$X$O+Us pEt,9u@]1]USs DEt ,9t1[]ËM tM 9uL$$US 8s Et ,9t1 []ËM9H uU tL$M L$@$ []UWVS r àu>t=~(u7Ft=D$ T$VT$$t F$ [^_]ËFD$U$11tՋ}O $M@oEtFVT$U$MUK9}D$D$4$I$nƅ,D$4$FEF~ E 0%/D$ED$F $jljEt\UF$F 9:" ~D$ ,D$D$X$(E$v [^_]/8"uE$v$mƅtEE$[v1 1Up ™}Et l9t1]ËM tM 9u9]UVSp Y}lt$4M $ƃ<&D$4$Xu1<\\D$\4$-tӉT$4$tŃtaD$$Buύ T$ T$D$# $Pt][^_]UVSMM Z]u {u3vut&D$$}t,u[^]D$<$Su 1[^]D$/$6t6u Ht>D$$u뼍 T$ T$D$D $E >][^]UWVS\L %Y]u {uZ~uvDD$$t4u~ tku btXD$$Yu1[^_]D$<$;t6utwD$$u븋vt%u tD$$u댸[^_]Í T$ dT$D$c $D$/$;E >][^_]zUWVS K WUEx } $Gƅ$GtzFFF E Ft.ED$4$ׄu`$O14$O [^_]Í<D$4$u뵉4$O1 [^_]D$ 4$ztFu2D$4$kD$ 4$ESD$4$-;>@D$D$4$-D$ 4$Ex UWVS kI 0VED$E$5t>Ɖ$FE U4$NU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVSH VUutFwyM MJ]ZMJ [^]$Et|] X]XMH ]X뼍D$ D$D$Ap$qD$ D$D$Bp$G1fUWVSG [TUu }t`t`tAtA}tA uutA} $L[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍D$ D$D$Zp$5UWVSED$] u}څu59D$}t }GȋT$[^_]9sut E|$8XD$1σL$uT9r9ڋD$)]t}W뗉u 11҉ËD$\$Z D$)‰$ L$t$ ؉։L$T$ ދT$L$T$ÉӉd$ D$T$9rFt>Et(D$+D$\$ $|$ }_D$9D$sq+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )D$T$‹D$ ‰T$D$ L$L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1MD$9sFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$uy9r9,)|$ȉ뙅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ ЉD$T$\$\$ L$4$Ét$Ӊd$ƉT$9rDp7u1[]$C1[]US1 ä>Dp7u1[]$ 1[]US1 j>Dp7u1[]$1[]USk1 0>Dp7u1[]$1[]US11 =Dp7u1[]$[1[]US0 ü=Dp7u1[]$!1[]US0 Â=Dp7u1[]$1[]US0 H=Dp7u1[]$1[]USI0 =Dp7u1[]$s1[]US0 <Dp7u1[]$91[]US/ Ý<LP ?jITM  @tM:u DŽTM с?x"LP ] LM \U1[]ÃӅ~TM 1  9~:u뙸#[]U:/ ;E@M LM 1]U/ ;E@LM ]U. ¸;E@DŽPM 1]US]Cu U C1[]US . t;Dp7u#ED$E D$E$u []$I []øUSO. ;uS[]US5. :Dp7u -[]$\-[]US- ú:$zUS- Ü:Dp7u1[]$1[]UE 9E]1UVS- M:ut$E EED$D$vt4$~[^]ÍD$ 0D$D$;\$UVS- 9ut/ED$D$wt@4$x@Eu[^]ÍD$ ) ‰L$D$$菴yX1 [^_]ÉM4$vSM랹čoD$ D$D$>$넍UWVS# ñ0Eh+l}ptDžxAEEEEEE|(D$ut$$;]E$D$t$$Dž<Dž@DžDDž8H|$8D$$dDž\Dž`Džd1|X}t Xuĉ4$_XD$4$|$4$D$04$5U<8D$hD$t$ D$D$0$"G,&V4$G,48D$t$0$tD$(D$$D$$D$$pD$|$$4[^_]D$$[^_]Dž4c ,Dž4GD$(D$$yD$(D$$D$$D$$UWVS@ `-t$0D$T$L$4D$4t "|$GD$8UT$$\$0uL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$rD$L$8D$9\$0&"D$8D$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$D$L$8D$9\$0M"D$8D$D$=u4$w7)EE8EE1҉MԉU*}D9FEE>tHED$|$M $޴uى<$蒳}9EuEEE>uMԋU܅{UWENjp,T-t$E8:tED$ED$$XGxTp70E<-<+<::gB9FB 9F <;uEz8;EAXT-0tE8:tD$W$袞Tp7WE<-QEx:T?Fw E؉Gw t01]E8[^_]ËMԋUEE$ȱEMt$ T$UD$_<$EUMt$ D$D$<$>u4L$ Mt$D$`<${EM:L$ t$D$<$O3D$ D$D$a$  <:z5E*E!w P]ẼuE MЋM؉u\[^_]Írd`P :u>u\`t E8:?부xt\Ad됋\>uTx:tL\9MAdE8:`t*|$ D$h1XP Ad\[^_]ÍD$ D$D$R0$貵uD$ D$D$S0$}臹|$ D$D$ -$芡E 4=:dUVSÄ utD$ D$4$[^]ÍRD$ D$D$/$ѴUVSW utD$4$fe[^]ÍҀD$ D$D$/$qffffUSøE$W1[]UWVSÑEtut4E@D$Ex E@t$9r0E@ 1҃[^_]ÉuU 9E׋EP @D$E@t$9s뿋E@D$M);u ED$1E U9Nj]C E@t$9ANE E D$ D$D$$5׋EP @D$0E UdOeD$ D$D$$űTUWVSUB EEEu1u}u}9}EE}B269rz])9ErEË}u sHu(u J J ZR9r [^_]ÉftEË}u rucuk량UGD$4$Hƅt[UB)ǍD|$D$$'U0MJB E4Xf넃BUWVSzu} D$$$[…0x@@ D$D$ D$D$4$Ut [^]1[^]ÍD$ D$D$0D$̭USVED$ D$ E D$E$8[]UWVSuttE D$4$~7肍F0u D$4$胍[^_]tIF0uҿ0F0뻍0D$ D$D$/h$ج]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVSÈE0x$"tu[^_]1[^_]UWVSK} tE}2tGfp f@UPx$MH,UP(UPDUP [^_]þEu1UWVS }u$‹EE Bzr EBtYtpE tZE EU<1UtnMfH f@PM H$x,p(@DjP [^_]ÍE뭋M tE E딉UU$1 [^_]UWVS UE trB0~4r,txM q J$tE D$ E 0xt$|$$Q[^_]ÉUD$ D$D$<$軩UY0D$ D$D$;$艩U US ED$E D$E$ []USáED$ ED$E D$E$j[]UVShuf~ D$4$F0tN@9t $F0ǀǀ FFF t1FD$4$ψ1[^]ËFߍ0D$ D$D$<$KL軭 UWVSÃEU tdP0~4p,t} r H$t} Lj $>M Q!Ѓ[^_]ÉET$ T$D$9$}Eg0T$ T$D$8$KE.UWVSÒutFD$4$;nx$P8D$4$D[^_]É4$Oڍ0D$ D$D$7$踦US BED$E D$E$9 []USED$ ED$E D$E$7[]UWVS,ÜEt8uj}ԉ&;h#$薛FFF )t$|$$d,[^_]ÉEԉ$QE؍EEu}w 끋luUEx9h#]Ël]Í ]UWVSTÕUE }}8}M1ɉցE- tM9utID$2@D$u4$4$OPEu2}E+ЃT[^_]Àu3p4$PEtΉUED$t$E$JU밉t$ D$D$2u4$蚋4$̙PxU@E 7t"ED$G$胛ut$ 눺Ƥ}U|D$ (D$D$X$蒣UE4T$ (T$D$X$]uE7M,E|T$ (T$D$X$E=1fUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVScut;F)F3E uF F[^]1[^]ÍD$ TD$D$Y$蔡UWVSu} Uts~F<FF DWPWPW P F F 1[^_]ÍD$ @D$D$v$ԠU`U:D$ @D$D$w$蜠U+UVSut~u@~w:E [^]ÍD$ (D$D$$/뺸UVSvut~uAF u9<.w5[^]ÍD$ D$D$$ǟ빸UWVSH }u t5u%G u<.w~9|D7[^_]1[^_]ÍD$ D$D$$AUWVSÎu} t*~uPF uH<.wDx>9؃[^_]ÍD$ D$D$$͞몸UEu E D]1]UWVS4}utQEu@D69E r4E D$D$<$v6GfGG[^_]1[^_]ÍD$ D$D$.$UWVS^u} t;~uaVL\WQWQW Q F1[^_]ÍD$ D$D$M$茝뙸UWVS4 ƉEԋE} 8uЋU1҅x'PރT$D$<$]FGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍT$ T$D$h$WE܅E܋]ԍƃT$ T$D$i$Em]5*UVSRut~uEFu=:Fr6[^]ÍD$ D$D$$蟛뵸UWVS u} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍD$ D$D$$ffffffUWVSVƉׅt18u9s1[^_]ÍF9rFލ҃D$ D$D$0$萚=uUWVS t ljփu [^_]Rw%FGT$D$<$q[^_]ÉUރD$ D$D$0$UUS{@E x[]ÉET$ T$D$T0$蜙E[]UWVSu} Et,tYPσF)F 71[^_]ÍT$ T$D$b0$EuET$ T$D$c0$ErUWVS_(Eu}UxE ;Eà EME9؋M)1L!ȉ)1׉E8E 8t@‰ߋu s}tftËM؋})p)ƉnE0)F=^EX E[^_]EE[^_]ø‰ߋu rbEX]荃D$ D$D$0$?ÍD$ D$D$0$W]荃PD$ D$D$0$ܖf;{PUWVS6EuM}~ 9)1UD!ЉEUE)‹E1UU ˉM] E )P)‰U|U)G=Mw]_^ ȃ[^_]1ɉȃ[^_]Í^^ÍD$ D$D$0$茕MM]荃PD$ D$D$0$TMkUWVSÛu} tt~)F1V J 9\ t+9sw[^_]ÍFፃ+D$ D$D$0$舔]D$ D$D$0$Y*UWVSÖE} ux)ubHQσwWvPH Y 9r>\ tHډt'9s89t9t!P9r P9sݸ[^_]ú߉1[^_]ÉE+T$ |T$D$X0$XE6T$ |T$D$W0$&EUUE ttuB]ø]UWVS xAEEEM<v}wwٸu [^_]9]rE}t81ɅU t9u rEtuutit9A=QMVVD$D$$]iMEEFE 0 [^_])Ӊމq̉M]썃tD$ hD$D$0$轑M9ME]썓T$ hT$D$0$肑ME.UWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉t 뭃먋E[^_]UWVS] U}EEt6u1]t7U9s tCB9rr9s[^_]ËEP8Mt9s܉ uM1+E[^_]UWVS] UЋ}uރstft[^_]uuBfUSOD$D$ED$ ED$E D$E$:[]ffUWVSPƉЉ8U1҅SƅD$D$D$D$ T$D$4$5t1U+4P[^_]Í1ɉ  rFDžDžD$ T$ƤD$<$ eutjƅD$D$D$D$ t$GD$G$5ut$$軄tu<$1b $b9T$ T$D$G$輌rUWVST3Ɖ8E1 ƃP ƅD$D$D$D$ P D$|$4$4D$D$D$D$ L$|$4$3;DžDžDžDžDžVDžDžDžT$ D$ƤD$$btjƅD$D$D$D$ t$GD$G$2ut$$膂thuGtLD$ D$D$$$_1U+uXT[^_]Ë묋$_ʍ9D$ (D$D$G$AjUWVSÃϋEE uE8E1 JD$D$ D$D$<$蔶=/D$ D$D$$2t6D$ D$D$$rk*$D$$D$$o$詘D$=$[;$u$g)y$X$4t$D$D$$AU+Ą[^_]Íd @$*%=D$ $uD$<$~!D$/$&Pt:D$D$$i'oD$D$D$D$ D$T$$ D$D$$$蝊@D$D$$$l$ D$Մ$T$4nD$ D$D$yG$ |D$ D$D$zG$诅D$ D$D${G$wD$ D$D$|G$?@$8u D$/$#D$t$ +T$D$$4$D$D$D$D$D$ D$T$$D$D$D$D$D$ 뭋|$D$$f-D$$&эD$̄$ D$ބ$$͇UWVS+EhU8E1pl 1} t2} 躈/E+Ĝ[^_]ƅpt BtE qD$D$E $DžxfDžrlD$<$rfhkƅptBxB |BEBEil D$ \D$D$ G$Bl謇l<$;藇l>U D$E D$E$G]UVSr7utD$D$4$[^]Í D$ pD$D$G$脁UWVS ljEE Et8|E1;DžDžDžDžxD$D$$詎VDžDžDž -D$FD$$DžD$D$<$辏FD$FD$<$`<$T80F8=f~4$Dž,8#tf%$v D$xD$$J|E+Ĝ[^_]Ã$`똋F?UƅD$D$D$D$ |$FD$F$v&|$2$vƅD$D$D$D$ |$FD$F$&u!|$ND$$EjD$[D$<$D$[D$<$A>$uD$ @D$D$ -$i8tD$FD$$DžD$$ D$ D$D$4$\d4$rD$t$<$蕊Ƌ$er9fDžfDžD$D$$荋D$L$$jƋ$:t0<<4$qD$t$<$茉4$^qD$t$<$k4$=qD$t$<$JD$D$<$pD$xD$$\D$D$D$D$ D$D$ $"u(4$莠=4$=L$\D$AD$<$bDžD$ D$D$G$dzCnD$ D$D$G$,z|D$ D$D$G$yD$ D$D$G$yD$ D$D$G$y~\$$m<$e!D$t$$ tD$t$<$tƋtt$뉍$ $ڈhD$a7$뛍$$rZt$UWVSløuEEEEEEEE8E1MGUqEE fD$ 5D$D$ UЉ$U4_EEEEEEM MEEML$ D$UT$$O=EPt%D$T$T $U9UEML$ML$M $MƋE$ELE+l[^_]ÍnD$ |D$D$G$vM|D$ |D$D$G$vUD$ |D$D$G$tvEeD$ |D$D$G$?v6$3KD$D${$X>UD$ED$ED$ED$ ED$E D$E$f]UWVSlUuEEEEEEEE8E1xMUEE fD$ 5D$D$ UЉ$U\EEEEEEM MEEML$ D$UT$$xLE@t"D$D$U $UU3D$$ttM 9HtCED$ED$E$MEƋE$IE+9l[^_]Íu$D$ ED$ED$E$ME 멍nD$ D$D$iG$sM^|D$ D$D$jG$sU4D$ D$D$kG${sE D$ D$D$lG$Fs$:HD$D${$ UEUD$ED$ED$ED$ ED$E D$E$ ]UWVSYl}dE TEPEX8@E1D$pD$yPXDžHDžLphl0-`,-\dD$ D$D$h$lsSD$ h4$l?:p< `\?.< t.dЍLDSt< B< u< t< t< u< t< tuh9>uPp<+<-iq<@pHLDD$ D$LD$r$lo؉DžH<+tj<--t$X$lgPH;v31@U+%[^_]ÉFg<@qs<@PHLDL$ D$D$r$lzDžHhUTd [4$lL uCF)<@t$X$lf DD$ XD$D$4$l诘tthKqUTqUT؉DD$ XD$D$4$lADžHDžL1bUT%LUT LƅplD$ 8D$D$G$qm0lD$ 8D$D$G$|[^_]1䍃ʆD$ HD$D$N$W UWVSt1EUU8M1ɅtBE}<$WM L$ED$<$XED$<$U+u:t[^_]ÉE؆L$ <L$D$h $ WE3US茞QE D$E$[]USb'E D$E$[]UVS7D$D$W 4$bD$ t$ED$$3s[^]UEȅyt ]%]]UWVS0誝sE؋}u 8EԉËE1tstX|$}܉<$]1| F TFuF(}ԋE+uS0[^_]$)] ƅuՋ]؍D$ D$D$F4$RU[]xUWVS̜ÑEE EEu}8U1ҍ $D$@$d \19ȋ})׉ 9}PD$T$$Cc~3D$T$ $19|v(|Y0$ dgY0t 14RY0$c=Y0D$ $U+uw[^_]D$ D$L$$F<$pc1몍D$$4tыptvSUD$D$D$D$ E D$E$]UWVSxn3EUU8M1ɅtBE}<$M L$ED$<$/ED$<$_U+u:x[^_]ÉE؆L$ pL$D$4 $GREpfffUWVS躙 ]4u 8$ËE14ENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ |]Ћ~$x}ԋ^(p]؋~,l}܋^0`]^4\]~8X}vh}l1u1u1lj]11ωtdn߉Љp}1U1׋|1ljh11ljpu2n׉l}1u1x1Ɖω`11߉lhnlj}u1u1t1lj`11׉hnωU}u1U1׋p1ljߋu11ljd`2n}U1׋U1׋l1lj}11ω`n߉M}U1׋|1ϋh1ljNjU11\Un׉u}M1ϋx1ϋd1lj}uM11ߋMXnlj}M1ϋt1ϋ`1lj}11׉T1nω֋}U1׋p1׋\1lj߉u11ljPu2nE}U1׋l1NjX1lj}U11ωLn߉M}U1׋h1NjT1ljMϋU11HUn׉u|1Ƌd1ƋP1Ɖu11މDnƉًux1މ`1L1ÉމM11Ӊ@Mnى|t1ً\1ًH1M щˋM!ˉ! ً];ܼىxp1X1D1M !׉! M}MܼMωutl1T1@1Ɖuu !! }ܼ։׋ph1ڋP1ڋ]1‰U ӋU!Ӊ! ڋ]ܼЉˋld1ȋL1ȋM1E !! ȉEEMܼEuh`1H1u1MM !! u>ܼΉ׋d\1D1u1‰U ֋U!։! uܼӉƋ`X1؋@1؋]1E !! ؉EE]ܼEÉM\T1ً]1ً]1MM !! ً];ܼˉىXP1ڋ]1ڋ]1‰U ӋU!Ӊ! ڋ]3ܼӉƋTL1؋]1؋]1E !! ؉|E]ܼ|ÉtPH1ً]1ً]1Mt !! ً];ܼˉىLD1ڋ]1ڋ]1‰| Ӌt!Ӊ! ڋ|3ܼӉƋH@1؋]1؋]1x !! ؉pxtܼpÉlD]1ً]1ً]1tl !! ًt;ܼˉى@]1ڋ]1ڋ|1‰p Ӌl!Ӊ! ڋp3ܼӉƋE]1؋]1؋x1E !! ؉hElܼhÉlM]1ً]1ًt1Ml !! ً];ܼˉ]}1}1p1lj} ׋l!߉! }7ܼމu}1}1}1Ɖu Ɖ!׉! hul>ܼhhl}u1|1u1Ɖ11߉ubhUu1x1u1‰֋l11ʉub‰Uu1t1u1‰։ډh11ulbщMu1p1u1΋h11ubˉlEu1M1ȋM1l11ЉMh1bƉ֋UM1ʋM1ʋM1‰ыl11ډM9bU|1ʋM1ʋM1‰щd11‰hlbӉEEx1ȋM1ȋM1ld؋M11lM1b|t1ȋM1ȋM1E11Љ|bӋxp1ʋM1ʋh1‰щl11x]bډtM1ʋM1ʋM1‰ыl11‰t9b׉ :dpM1ȋU1Ћ|1‰11؉pl bȋd]EU1ЋU1Ћx1‰1؋d1؉l2bƉuU1֋U1֋t1Ɖu11ΉU:bM}U1׋h1׋p1ljىߋ]11ljU]b߉EU1ЋU1Ћl1‹E11U bЉEu1|1u1ƉM11؉uMbȉEu1x1u1bʋE11UEu1t1Ћu1ubʉ؋U11EU1Ћp1ЋU1<bËE11؉Ћ402މC(lj{8 F ,EF$E+u~[^_]Ë D$ D$D$\$.<4< D$ D$D$\$; UVSk0ut7#EgFFܺF vT2FFF[^]Í D$ D$D$\$e;UWVSòE[U Pu щHs H?J]Ӄ?@)Ӊ]<u EEu|UHL$$EU);MEƋ} T$4$dڃ@;Ur)]] U<u sRtft[^_]äfEuMEC] }|:}h T$ T$D$\$9EU xE؆T$ T$D$\$9ECfm2u KM &fUWVS(譀vE}u 8EËE11U1ۃÉу\u݉UD$]䍃$D$4$>F%=Ut,D$\$4$F%=u݋UD$T$4$t!1уu}E+uo([^_]Ë]䍃D$ D$D$\$7]䍃 D$ D$D$\$7]UWVS0/E؋}u 8EԉËE1tstX|$}܉<$]1 F TFuF(}ԋE+uS0[^_]$)]{ƅuՋ]؍D$ D$D$F$6[]UWVSQ~EE EEu}8U1ҍ $D$@$E \19ȋ})׉ 9}PD$T$$D~3D$T$ $k19|v;0$E:0t 14:0$fE:0D$ $U+uw[^_]D$ D$L$$$D1몍D$$ tыptvUD$D$D$D$ E D$E$]UWVSx{øEUU8M1ɅtBE}<$vM L$ED$<$ED$<$_U+u:x[^_]ÉE؆L$ L$D$ $3EfffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8puX]H MPUHMX]HMX ]P$UH(Mp,uX0]H4MP8|@yZ<3 h Ӊ 1Ή\uh3n\  1Ӊh]nh  h׉ ؋h1|9n ׉ 1}:nh \ 1ڋ}h;n ҉ 1Njxn \ P҉։h 1΋}\;n <P hӉ\ 1Ӌu0nˋh Nj\ 1u1nЋ\ \1u2n 1ڋt7n \ h҉׉ 1Nju\0n ҉ 1΋Unhމ \1ӋUhn  h ҉Ћh 1Un\ h 1Unh 1!1‰hUܼh  ωh1!1ω}>ܼ<2  h1!΋h1֋UܼƋh 1\!1Uܼ h1!1tܼ\ 1!1ًUܼh 1!1‰\Uܼ\  1׉h!1ω}>ܼ<0 1!1֋Eܼ h 1!1h]ܼh 1!1hEܼh 1!1ىhx ܼh h1ˉڋh!1‹|ܼ 1Ӊ!1ȉËEܼ3h 1É!1։\uh3ܼ\ 1!1Éh]ܼh  1߉h}9NSh  h։ 1t2NS ։ 1ʋu0NSh4h ։ ʋh1u0NS  ֋h ։\1ƋUNS>h Ћ\ 1؋UNSȋ\ \׉ 1‹}9NS 2 h׉ 1ʋ}>NS \ډ ׉ 1Ћ|;NShlj ׉ Љ\1؋}h;NS  Ӌ\ 1Ë}>NS ˋ\ Ɖh1u1NS4  Ӊًh 1]NS h PӉ 1ʋ]NS< @։ ʉL1x0NSPӉH pm h T։\ 1׋]h>pmNjT \Ӊ 1]>pmы\ 1؉hE>pmh‰ 0 1hE>pmh 1Ήh|3>pmhh ։h 1Ӌu7>pm h 1Nju1>pm׋h 1hM >pmh  1ډhU>pmh  1hE>pmh 1Ήhu3>pmh \҉ \1ӋU>pm  h 1Njt>pm \ ׉ 1U>pmh \׉ 1ڋ}8>pm\ 1!1hEvmzh 1!1Ήhu3vmzh 1!1Ӊh]vmzh 1ljh!1Nj]vmz  h1!1]vmzh h1߉!1ڋ}8vmzh h1!1xvmz؋h Ήщ\1!Ƌ\1΋t vmz 1щ!1ӋMvmz\ h1!1NjM\vmz  1!1M vmz  h \1!1ڋ}h8vmz \ 1!1hEvmzh  1!1Ήhu3vmzh 1!1Ӊh]vmzh 1!1ljh|9vmzh 11hMʋh 1ډM1ʋx M1ωx1׋U ߋM x1ʉ1U Ƌx ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11EE 11؉E|ME 1M1ȋt U11‹M UM 1ʉ׋U1׋U U L ׋XUzp4 <UrU1ЋU1Ћu l@؋uF ЋL ȋH1P]NSdыUȋUBU `HEĸ[^_]UWVSE}O_M]ʃ?@)Ӎ41u}Mqy9rdun?v91۾@ω؋]E D$<$Ov@9s]ËE19s-)] }|u s~tft[^_]19rӃ[^_]Ë}}]}|u skEu[EuREUED$E$U)֋E9r{}؋]HuVu=ffEtuVu$ [1Í&T$D$ Zbj rz $RPS[NjjRj# [Xt@US `]%jED$E D$E$誂 []US/]iD$ D$ED$$G#[]US\ùiD$ E D$ED$$[]US\iD$ E D$ED$$[]UWVS,~\CiuEEED$D$}|$ t$D$EE$?fEE ED$D$|$ D$D$E$e~EEED$D$|$ D$D$E$e/EEED$D$|$ T$UD$E$OeUEt2E <wE)Ѓ9uEEED$D$|$ t$D$E$d؃,[^_]v8 u>ƆUUoD$ LD$D$<&$fffffUWVS.Zf} 8E1}D$D$HtHE$t=ED$D$<$$|;Es1U+[^_]ø"㍅D$E$ktt@D$E$1u[ED$bD$<${;EsED$|$ H%D$`d$T$UID$ TD$D$B$S|UWVS XǘeD$,W \$E$qƉ؅u [^_]É{01UWVSpXJeU,[ ut$$,[ @B1E}E1uNjU:ME1uEHt$$xx,[ @B1Ƌ}E1NjExME1EH D$E$Qu(,[ ]ٸ@B1E1؃p[^_]øp[^_]$'謣,[ 8D$ `D$D$HD$UWVS#WcD$7sD$E$|uE-@t&tD$E$u܉[^_]D$bD$E${t 1[^_]ËEpD$D$4${E@<-u?EP0-DPtEPD$ ED$$U7uMU9p9g^My+th)ƍF߃1BD$+D$4$zE@t<+ !M?!UUBbE?w-t u]Ë u@u1]UFUaEP>w -]1]UWVS( Uau}܉|$D$4$xINE uG>wl8EظE! EED$|$4$~([^_]Ã>w28EظE EH;UWVSBTauD$ toD$D$l[ <$y)L[ -t@L[ [^_]ÍU T$ t$)‰T$$H뵍a7D$D$l[ <$dffffffUWVSSF`ƉЉυV=vlot ufus  E ] ^}+}-}=uFЃ[^_]Ã+t-uuXE #EFЃ[^_]ÃXtguy-t~F+։} RF F+֍R먉} 룉UfT$ T$D$t$ EFlFaUWVS-R^u ] EEEE}|$EԉD$$$v$EvD$|$$E5D$D$Ẻ$vMẺE0EU0-DPuHщMEE1E($UM$M~9E~L$$d‹MfffffUWVSP=fJEu}b]DE E AEEEDE{~ 0jM_U tEExGz;EGEkMddeEUMEEE EE܋E$] 8MԍD9E 0>EUM]L$\$ $T$] 9tu׉EUM]ىeщٸ9и| E AED$ExD$E܉D$ˉу2΁ȉ%ƉƸQ)1ʉ)i)\i(\ø)\ƋE؉E]ʋUʉD$ T$]‡D$E D$E$9} |P[^_]ÍnEEEE`EEAE$UԍD9E ỦUMED$ |$}܉|$E})lj|$D$EЉT$ ]͇D$E D$E$1ÍD$ |D$D$8L$er]D$ |D$D$9L$0@zfffffUWVS87fDlj։MEuEE9r[ff=?txf=[f=*t!f9tc]9ttg9s>18[^_]Ãf~*t{uE9sfu!f=?tf=[t]]uuf=?uS`EuLCEFfEf=!E؍FEf}!&f}]AE܉EFE1]ԉ}ЋE܋}]f9uxf]t(fx-uf9r f9Prxf]u؋]ԉ}}ЋE9Su]oD$ D$D$ڇ$5AD$ D$D$ڇ$ED$ D$D$ڇ$FEvfuf]SƋ]UWVS"5Au} ttFD$$[4[^_]ÍUD$ D$D$Dڇ$4uD$ D$D$Eڇ$UWS4TAׅtkt/tPWu 1[_]Ãu[_]ÉMET$ T$D$qڇ$ME뙉MERT$ T$D$pڇ$PMEZUWVS3Ñ@8U1҅tWF @D$$tV$U+[^_]1g㉅'T$ T$D$Eڇ$nT$ T$D$Cڇ$K/cdyUWVS$2À?]E։M5_VЍEF t =F}|$$]w4DžF\~MfyuE)E $M]/ÅM‹EiFJ‰F u $[^_]Ë}E=v]ԉUE$].DžUt߅FT$D$<$]'D$ D$D$ڇ$]썃'D$ D$D$ڇ$vo$]s6FVNUWVS0Ö=ljdhlE`E XuEpEP8<E1h`XphfX9r9f>*uf~*u1f~*@DFH9`PD$pD$ HD$XD$`$lhdDž|hfDžDdf8$pD$)D$<$Qp@ @<$P TTp@ @0Lt4l8\T$LЅpQ tPNy~ x .5 h\9lHfOfuት\9lD@u5p4d*4|%=H`h#W89sfG/fPD$pD$\$ld=hfDžHDž@DžDdf8tpdHu|%=@1P(X|%=@B9pp/%`BX븋`D$ D$D$Sڇ$M`:k`v1҉p/!UWVSDo$018ƋE1Hf~uQ@ *΍f}f/sP9uݸz0fd"f*ffʃft@f?f[uZx!#qf92f[ʉfuffP u:!N f?ʃDW Ӏ_ Y9t fx*f*ʉك |$|$<$U+D[^_]ÍJfzuf[Qr f2f]u답f[!Vf]tI։ύOf%ff-uFf]fG-Of%fG^Vf]uH Af]N9D$D$ D$D$$P f 9 9sVfPfu9t.P9fx*P9fx*ʉW 9B  T$ D$)L$pP$薞f[!ʃoV- 0!$K…DD$D$ D$D$$Y@xf@!EfH9'?'|$ D$D$ڇ4$R|$ D$D$4$4jMeUWVSi+Ɖ׉MG tMA PQ f>{tBEEft>f{uED$E$quۋE[^_]f~}uf~uM[^_]'D$ D$D$ڇ$IMUWVS0~*)9YË)ډσˉHPftDΉ1ۉff}tYFftf[tWf{uFfuM `E10[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1=f[uSf]fً9CS{f{f,uvu91ҋLf fuM }1uLfAf}=s-%qQf]tyىC)D‹΃tfFT$ |$D$ڇ4$ ɋ'T$ |$D$4$'T$ T$D$ڇ$u=$SًfvSdfPUWVS(Ë&u} UDžDžDžDžuBB EBB]uR} UfP9~ʅ\uVtM@ɃfH9Nuft ([^_]É\@x'([^_]B&} U맍YD$ D$D$ڇ$U} UhUWVS7$EtXEPtF@ E$/ǃc []UWVS8 }u #D$$D$D$D$$D$ T$(T$T$D$4$t6t$ T$w3D$41 1ۉL$\$l$ǃ\$ 9r؉e[^_]D$ ÍD$ <D$D$F$D$$D$D$D$$D$ T$(T$T$D$4$t@D$ T$AD$ <D$D$E$1ffffffUWVS F$>3tƀ8u^AUD$L$ D$D$c 4$UE tE 8 [^_]D$ ED$4$ &xT}untHuG<&wHt$Ј$D$$t$$ՠc WuA@9|w뵍8=9,@뽍!?ЉED$ $@EEUD$ $MEbffffUWVS fljD$\t$<$Jt8t [^_]UWVS8a&8E11҉g rc g D$ D$D$$g L$$cytzg t8#tg g g g D$D$ $藞-g 8#`g Qg t8xuxxu xg 8sxwx|Lg <$g $g U+[8[^_]ǃg ǃg t)$0g lt$g D$g D$4$:%g Dž<$詰u؋t΍ 7tt$$ouታg >x~x~6%1g HT$$t&HUVSòg tftKg [^]ǃg D$4$貦g ut$s$.1[^]UWVSr7uǃg g t0$ɟt$g $2tHu1v>D$<$g uΉ|$s$1g [^_]ÍoD$ D$D$%$GUWVS_ uǃg g t-$t$g $ZtEu1>D$<$=g uщ|$s$1g [^_]ÍoD$ D$D$%$@JUVSË ǃg g t$([^]ÍD$4$荤g u҉t$s$ 1UST g t$荖ǃg []ffffffUWVSL ]ԉljUĉM؅uą]1E0-EEu؃EĉEGET]DCtE,- ?*WЍL]DS<*E,-}<* tЍ\]]DStڋEЀ*Ҁ[i\U؃B] ȍ{}}\\ ]]DKtE,-M9L[^_]À?*vG[\U؃]]Oh}눋}].@렋]у]}ы]]}L[^_]Ë] ȃ]_]_]|}܋}D_]}E,-M‹u}[}]ԍCD$ D$D$|$nYD$ D$D${$?},-};EӋ}E//E/(EEE,-EE؃E}}tÍLUDBt EE$ME/uEtveu؉D$/E$]>~gEEÄ[^]UWVS÷}u D$<$զt*lD$<$迦u t1[^_]ÅtwUWVS8w<8‹E1D$ D$ED$E$E…uZDžDž$x$jE+0Ё8[^_]É$ T$ D$ED$E$Fƒ$dnEDžDž9~&t$$1t$|$ D$ML$U$ƃD$|$ D$ED$E $9D89trtftƄD$D$ D$ED$E$ƃɱ1҃8-DžDž1DžD:1UWVS@MUE 8ƋE1D$ D$ED$$Q…uZDžDž$z$lE+<Ё@[^_]É$T$ D$ED$$%ƒ$cwBDžDž9~&t$$0t$|$ D$ML$$ƃD$|$ D$ED$$9D89trtftƄD$D$ D$ED$$ƃ迮1҃8-DžDž1Dž:71vUWVS@~CUE 8ƋE1D$ D$ED$$Q…uZDžDž$p$bE+<Ё@[^_]É$T$ D$ED$$ƒ$YwBDžDž9~&t$$&t$|$ D$ML$$ƃD$|$ D$ED$$9D89trtftƄD$D$ D$ED$$ƃ赫1҃8-DžDž1Dž041vUWVS w<}"D$E D$<$utuFtf [^_]UWVS }"D$E D$<$Sututf [^_]UWVS |}"D$E D$<$ututf [^_]US Y<8D$E D$E$v []UWVS!}U 8E1EteMyu )čD$UPtMP}y:u}D$<$'}U+ue[^_]ø+2UWVSGEEM 8E1EtgEǺu )ԍT$ MJtJx9uD$T$E$XxU+ue[^_]úE1USâED$ ED$E D$E$ϲUS pED$E D$E$BUS EED$E D$E$kBfUWVSQƉUtb}u +t"D$4$uM)[^_]0-DPu 1[^_]É4$[^_]ÍD$ D$D$$oUnEt8t س1]ø]UWVS\x=u8EE1*t$سD$Ẻ$"i h }e1󫍃h EЋM̍#h |t:tEЃ9s EЄu$h t$RD$Ẻ$;oFD$tD$Ẻ$oEЉED$D$Ẻ$ox,uЍBTD$4$sdh 4$D$:D$Ẻ$Ztdh EԉEȉD$/D$Ẻ$sZEԉ4h EȉD$[D$Ẻ$st EԉEԉ`h EȉD$/rD$Ẻ$qEԉh EȉD$PD$Ẻ$SqEԉh fEpxEfEbxEfEfxEfEoxEfEtxEE`ah E؉EEEčEEEt}4$ďT9u f9t]:/t9r 9֍vtJ:/u9u .t&8:/u9r)vi 9u(Ƅi [^_]Éր>/t>)i ǃstftƄi [^_]Éڍ#ffffUWVSöE$}|L0-DB,-fkfbfg@_D$ ED$E$*zEUE8E9t8u|8"tQ]ڋEƍ EʋM Q1[^_]fmuAxn1bM]9ȸs 蠝[^_]þUSZD$ E$蝧[]fffUWVSa&}tz?tu<$HD9u p9ti8/t9t`sc~/t9u)=vm ׃rtftƄm Ѓ[^_]ø)€8/t Ƹ봸#US<kEEEEEEEED$ẺD$$tEMt<[]ø<[]fffffUWVS !7ƅt $茚UtE t [^_]Í#$8E uD$D$!$CǃtD$$D$<$D$<$~<$ߥzpUSCEt=tU T$؉$[]UVSýutE D$D$4$u[^]ÍD$ 4D$D$1 $ fT$D$Ít&T$D$.&&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  .&&T$D$L$  .&&.&&D$ffff̀rS[[Ḯ̀rS[[ḭ̀rS[[̀ffff̀ffff/̀ffff^̀rS[Ä[̀rS[d[Ḥ̀rS[D[<̀rS[$[̀rS[[ḇ̀rS[[̀rS[[ḓ̀rS[ä[̀rS[Ä[`̀rS[d[R̀rS[D[2̀rS[$[ḩ̀rS[[P̀rS[[ḷ̀rS[[Ḷ̀rS[ä[ḉ̀rS[Ä[̀rS[d[Ḛ̀rS[D[̀rS[$[Ḩ̀rS[[1̀rS[[Ḍ̀rS[[òrS[ä[ìrS[Ä[l̀rS[d[t̀rS[D[s̀rS[$[r̀rS[[p̀rS[[j̀rS[[m̀rS[ä[̀rS[Ä[Z̀rS[d[ ̀rS[D[S[.[.&f*̀r׋L$Q1fffffỲrJ!QۓUWVS q q D$$q q +q q s$uu[^_]ä[^_]ft뻋q Pq D$D$D$D$ D$ D$$6q 31q D$$LD$$ $qGf?USrq E)9q t$[]à T$$[]USe*D$$q u !$k[]fffffffUSúQ)‰э)y )ȍ BЅyBut*$I )Ѝ)‰)[]i)\P ףwƒUWVS ÉUB< we΋EE11u v4B< w-ύLzЋuU<9EsNju9r9MrE؃ [^_]1 [^_]UWVSñEU1U9} t?E $M迀ƉD$ED$M $uˋE8E[^_]ËUt E1UWVS$o0Ɖ8E160-ʄt/}9tBt DK@t⋍t0DCu1U+u]$[^_]É $<`Džtҋ0F D$<$_F$F(<$_`떋UWVSXD E؋}E }x EEEE]0-]wu8EX]E]܋DJ@u.<%uEUMYC}Ѝ~}E@}GEЅ>MUЅM E؍~E -D$ ED$T$<$ƉEMEU$c1ɉpƉEE M]ȅt)ExQ)؍)MEH}eMEoMMЅGEP$1ɉƉEM =MEU$nƉEE}GEЅMMU$5xƉEMwu?%}ЅMEU$ ,ƉEE}GEtYMUЅKEP$ ƉEEx @uMEЅM E؍uuЅETMEЅE؍lM$=1ɋU[ƉEEMEP$1ɉ.ƉEE gMU$ƉEM踓$I )؍))ыEHEMPЀ E MEEЅMU$c1ɉoƉEEȅmEHQ)ȍEE}GMEP$;1MEP$ EEЃ} uG' MEP$1ɉƉEEUMuDBuMU$c1ɉwƉEMEMpMElU$'1ɉ5ƉEE-l}G}eMvMEMEЅ7E؍4=%]ЅE ,}tz]ԋEpE@El‹}̉)ЍH$I )Ѝ))ыUčD)֍D)}G؃Eԃك}}}Gw}Dy@&V؃DY@u] utU܋DB@UЃ@)FUDBb3v%ME)EERUЃAD$1$E؍ډ[t"UB M)i]D$1<$EDŽ-ډM]K U8cUܿ -D$ ED$E D$E$b]UWVSD覿kEu q 9PMP lM܋HP UPUPUElS *DT$$ML$ ML$ML$ML$M܉L$ML$ D$|$4$^9D[^_]ÍMP MMIH??? F??? F?? ?F ?:??F:?? F????fF =|늍d9gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ D$|$4$]9{T1D[^_]U趽q D$E$]US8落UEЉD$E D$E$LtUT$$8[]US4LEЉD$E$LtU T$$m4[]USE$CLtq T$$4[]fUWVS@ѼÖUE u8M1ɃtHMċNMȋNM̋N MЋNMԋNM؋NM܋NMN MN$MN(MMuăt,tSt9$zU+@[^_]Ét$D$t,$1]׉t$D$t,$]t$D$t,$]뫉E UL$ L$D$; $tE UL$ L$D$: $sE UfffffffUWVSQu} tQt!1t  9t)ʉЃ[^_]ÍD$ D$D$8$Zs볍D$ D$D$7$.sUWVS趺{MU Etx $MhxMMEpEt';Uu"|$t$F$V9UtމuE tH9uMtFE]ȃ[^_]E千ɉD$ D$D$I$Dr=D$ D$D$H$rUWVS 螹_uU Mt;A t+ ÃutF\$D$$mI [^_]fUWVS 1MtU D$E$ED$}|$E$0ƃE $fEL<80t6Eu1 [^_]ÉL$M$UdUM $…tU $fUMȉ׋usYtftE|=Eu stf`Z뉋E|떍oD$ D$D$C$oU b׉D$ D$D$D$oD$E$uf5Ef,zE UVS ÅE UtuD$E$赸 [^]ÉT$D$E$Hƅu E [^]ÃTt Gt01EtB[^_]ÍD$ D$D$M$;f?et[^_]Ft$V tQFtB1ɉωMT:0$V T:($V D: $۲M;NV r$ŲF,t$趲F4t -$袲F8t$蓲4$苲[^_]ÍD$ D$D$K$LeUVSҬ×4$z,r D$E$s4$z[^]UVS荬R4$z,r $s4$xz[^]UWVSN<$Oz,r D$$JxƉ<$0z[^_]UWVSȸuED$@$iED$E $qj…t?t$U$[Ut'zu Ńtt$$[uUEHutU$BEUЃ[^_]ÍoD$ D$D$<$c7UVS4$ylr D$E$h4$y[^]UVSתÜ4$xlr $h4$x[^]UWVS蘪]<$xlr D$$iƉ<$zx[^_]ffffffUWVS0AUz0-E܍uu<0 1E1M؋MLYtyu 8<|EuȋM؋uԍE99)11 ؃9ruu\M؋uu9tzwr<.uUy<0BÃ߀Xt\E f)Ǎ|uԄAEDX@30[^_]B!D$ D$D$F$`UTuԍE9t11UWVS a&dD$D$ -<$LE tED$E D$<$mD$$ FE$?USïeUT$ U T$D$E$oUWVS 豧vUEtaEEt88 [^_]à "EE ,獃JD$ H D$D$,$v_p!D$ H D$D$,$G_:}}43k } ;cl uuEU}#Ћu0u9dtt4}t>}9tȋEE T0-EE } =Y n}E vU 0-DPueE 7}} Ј3E T0-&E 0}E E}E } ;U 0-DPEE DЍPE}} #}}E1EEu } \Et } %Et } &Et } =uE E 0<EuЈEE} ?U  Ћ}E} } U 0-DP[u VɨEE IEE 0<}Ј@E nwtlEE T0-ME 0u Ј} -} ^E0-u DpuE EE 0uE[EMEEXE+E E6E E"E EE EE EE EEEEEE\EEEcEUdugs 1cduYE 0E E PH,-WEUE,-WE EE1FEzElE ^UWVS,Π‹u }EEqE/O]}}؍}}܉MEމU)ߋED$ E؉D$ED$E܉$Uw{( GAM ǃEE@uUD$ E؉D$D$E܉$/U+E,[^_]ÍƤD$ < D$D$,$ӉUXUs]9EC6D$ < D$D$,$ӉUWU6D$ < D$D$,$ӉUoWUXEE؍EE\QFtM ƃUED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$s]UWVS5ur />3)Ѝ)Ѝ:~ 9w$&r um0"U$Ѓr $U4$Ѕt?w$WD$ D$$UֿUЃ[^_]É4$$uw$Wt$ AYD$D$ $U=E Ut1҉Ѓ[^_]Ër t;U$(NjU4$$CЃ[^_]Ë0ǃr 뫋U tuW3ǃr $r ^D$$=苝r Jǃr 1+1UWVS:ur ))Љ):~ 9w$&r um@"U$Ѓr 4U4$Ѕt?w$WD$ D$$UڽUЃ[^_]É4$4uw$Wt$ AYD$D$ $U ;E Ut1҉Ѓ[^_]Ër t;U$(NjU4$4CЃ[^_]Ë@ǃr 뫋U tuW3ǃr 4r ^D$$菛r Iǃr 1+1UWVS>}E$#HDžr fE|81ɃP9u/>3)Ѝ)<7ɉM~=~}|$E$IMAF$U 1[^_]Ër VD$ ED$$譻E$(@F$맋r u0$Ѓr $(ƉuE$(@Or a0t $Ѓr @~0u㋳r uED$$=虙Ɖr lǃr ǃr IUWVS?}E$$FDžr gE|81ɃP9u𸿿)))<7ɉM~=~}|$E$GMAF$U 1[^_]Ër VD$ ED$$譹E$8@F$맋r u@$Ѓr $(ƉuE$8@Or a@t $Ѓr @~@u㋳r uED$$虗Ɖr kǃr ǃr IUWVS?UE,tЋr t'Ǎt$l9uǃr ǃr r t'Ǎt$19uǃr ǃr ǃr E0E ,E(E$1[^_]øUWVSTUE<tЋr t'Ǎt$聚9uǃr ǃr r t'Ǎt$F9uǃr ǃr ǃr E@E <E8E41[^_]øffffUWVSZ#pUE DžXE/tBD$E $p,E $Auv E t E tDž`Dždxhً]/]=Ut Ѓ/u.t+M L +Mkt/l+]utftl+EthD$E $p)%=l /=@_Ot/t?+Mu~.׉ڋt9E щ`p\`d 5lD$D$E $p-YDž`&$`p?D=`=A߉փsetftdl /tf\`Ut9E etE Ĩ[^_]Étzu \`l5pN?t9E tX$p.1nىf t~uf.륃8/utщ$p5E tE XfE pME /t/tpMpMwM?paM>OM1UWVSR}E ttrD$<$3'xX[^_]Et$<$}#DžMtAt$$&ymt L8"tƉ<$K1[^_]L1fffffUWVS衎f}<$<r $cr ǃr 7ty0-E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEuE1[^_]Ër t$3ǃr ǃr K yEUWVS肍Gu} u <:tu1[^_]8ut$8tu<@t΃}:t& u}:t;UuF~@t[^_]Ät<:u[^_]ÍD$ D$D$$#EYD$ D$D$$DU{DUD]UWVSa&u} tb 8u$ u|:9ƍt&s :t|tu[^_]ÍoD$ D$D$$%DoD$ D$D$$C:1UWVSlv7ƉE 8E10}!H Mu0r t |$$p$談Dž DžUD$ ϏD$D$4$*D$D$ D$D$@4$%D$D$@$QE8DžDž1ҋ9slxȀ %:Dž\1҃ t t DžN9 ΋9rD$D$E$P5xȀ Mp@<#D$$2ߍFDkDžD$=D$<$… <:Duz)ED$T$E$EƋt'p<:tu))|:t:Ћ)ȉ)9 )؉D$\$ $MT$t$<$7$Qy?@E<$Dž:΍N9))t$$10r1eN1nCȋ)Љ)Ћ))ӉL$$聇ÉNjÉC:{DžtE$oM)P9rg8E+~l[^_]D$ D$D$E$%DžD$<$rxr $Njhr D$<$D77DlNj4A0<$A0Dž$D$ D$D$$;D$ D$D$ $X;oD$ D$D$ $;E$KE$KƉ<$؇6$<0D$ \$|$4$V tBt(PuADž4$VDžDž$/H $r~DžL$T$$4$V18XoD$ D$D$$W9<$KtE$ <$ t> 4$VX> $̅u!$诅냋E$HUVS ҌEM ut.t^UD$t$$P[^]ÍT$ T$D$$ 8M EuM ET$ T$D$$7M ElM EoT$ T$D$$7M E1US؋r t$Lǃr ǃr ǃr ǃr 1[]UWVS0~ME 8ƋE1Dž]r r 0-r tr uD$r $;D0Dq@:#r ux|\u ǃr ׍:\tWut$r $:lDҀ|\tǃr ǃr r $<#Ƌr u$8ǃr r Pr @&L$$!r dǃr ǃr ǃr f:wu<:tAt<|uD$t$$ƍ@E+0[^_]Ër $"uhr $ǃr +r r 0D$r $t r 5r t$ǃr ǃr ǃr ǃr D$ D$D$$N3tD$ D$D$$37ǃr ǃr ǃr ǃr $ǃr UWVSHz u} tPtzr t$sǃr ǃr ǃr ǃr } u[^_]D$ D$D$$&2uD$ D$D$$1WUWVS$yyBEu} (TED$=|$4$ƅl$d]vDž<:9}d]V<\ֈmt>}<:tkOML<^uF<:mu‹M])ىύAdD$$]zljEEd<:u]WF<:XЀvP2MҋM FE1]MVD9ut 0v]M :]U})rtT$<$]yEEM$[^_]Ë]뽸 y]䍃RD$ t D$D$$/ÍD$ t D$D$${/]䍃D$ t D$D$$F/z1*E$]'|<$]|]u4 UWVSyvBEu} uE0D$=|$4$Dž$d]sƅ<:d <:tCZtsu)Cd]D$4$]wUn‰ƹd<:uЉƍX)Ӎst4\$$U]wU@Љ)ӍsűE[^_]Ë]썃D$ h D$D$#$-E]썃RD$ h D$D$$$_-ÍD$ h D$D$"$.-Z]썃ՏD$ h D$D$`$,)D$4$]vt-M14$]y։4$]y]2 UWVSt}E uD$#D$<$R80tN 1G<w/G9~ƒ9G< w91[^_]ÍG<wG@tftƄ/ DžDž)S$O9>:hf . 81Ƀ4uA )čD$pxr󥋵t$D$$7D$D$$5|$t$$5D$D$$z5oD$ 8D$D$EL$'udurP)1)rBvBDžqfzU un>{<8D$E D$E$]UWVSDn {}U 8E1EtqMyu )čD$UPtMP}y:u}<8T$D$<$6U+ue[^_]øBffffUSmXzD$$Dv D$ $uLv []UWVSHAmzu} }ԋEE8EЉE1D$L$*>v u}MfMUT$U܉T$ D$ UT$$FuM vU܋9Eo} uv t%9v t1uЋE+H[^_]Á} u v uD$D$ $\E؅tDEċE؉$`KfxHuPPM3J$z 1 uԋM3JʀuNjPD$EĉD$$UDžuED$UȃT$Ẻ$;EsE؉$^ % ЉD$&D$ M6D$ED$Ẻ$ ;E1B9EBf9EwB U؍yM|$D$Eȉ$lEċMQUUȍD 9E89}r5M̉ωփs1tft1HE؉$]3")UuuB r EfUSKjwD$r \$ ED$EU $T$u؃[]1[]ffffffUVS…D$LT$8D$h$KZ9T$8T$4T$dNL$84j|$t  D$hD$D$tD$ L$8L$$t$D$<$YT$4D$<D$hD$$ ZM T$8T$`l$LL$P^D$<1D$dP5D$d|$PD$<D$\L$(<$;nD$LL$(9YT$@JL$P2t$l.L$diPVT$l|$Lt$Lt$d5T$l nHJL$lCFĉ4$tt$LT$l9-)D$\D$PD$@UL$8<$OL$8ΉL$8sL$(<$,L$(u D$L9LD$\6T$@r:|$l|$P|$Lt$Lt$dT$hT$$u7nPD$lHL$ltF~뾉4$t|$Pt$LD$lD$l)D$@T$<D$@D$,1 D$4D$tD$0}D$<1|$h|$$Vt |$D$<$yVtT$PT$`l$LD$8uD$<D$,D$d1@|$LD$h$V9L$dVT$P4i|$t t$4D$hD$D$0D$ T$PT$$t$D$<$U(vt D$<D$dt$P@WD$d$7|$,%L$8D$<D$\D$@T$<D$@1 D$4D$tD$0D$h$U9|$dV4o|$t t$4D$hD$D$0D$ T$T$P$D$D$<$uTT$PtvuHT$`l$LD$8uD$<D$<D$d1H~1T$LL|$8T$\-u3D$d֋x'D$d$ttNjD$dfH @dT$`l$Lt$8t덋T$<΍yGNL$dAD$<AO9|$LlQ:|$8IL$PL$PT$pT$FS}D$<$ED$ ED$E D$<$)D$<$[^_]UWVSEãR}D$<$PED$ E D$ -D$<$D$<$G[^_]fffffUWVS qE6RU L}`7D$$U U z0u LJB usxfB EEJw9hJ@U 9{<6}|$$FEU 0ulj΃}EEJ0u1uqH MHBD$$ E [^_]ÉU #U fb ߋrEt9spE94J(KE$ t:t4@t-UT$ U T$UT$V$Љƅu;E[^]ÍD$ \D$D$8, $N@0E[^]U =J -D$E D$E$2]UVS=VJE$ tAt;@$t4UT$UT$ U T$UT$V$Љƅu;E[^]ÍT D$ DD$D$p, $u@$0E[^]U<I -D$ ED$E D$E$$]UVS<vIE$ tAt;@(t4UT$UT$ U T$UT$V$Љƅu;E[^]Í D$ ,D$D$y, $@(0E[^]U<H -D$ ED$E D$E$$]UVS;ÖHE$ tAt;@4t4UT$UT$ U T$UT$V$Љƅu;E[^]Í D$ D$D$, $@4#0E[^]U&;G -D$ ED$E D$E$$]UWVS(:õGuEqVt M>$ I}|$T$UD$ D$D$@$ыU'$ tLtF@Ht?|$T$UT$UT$ U T$ML$4$ЉƅuGE([^_]Í}몉U썃P!D$ D$D$, $?@HU0E([^_]Ë$ 1ҍ}QUE썋$!L$ L$D$J, $EIU[T$ T$D$} $E]fD$ D$D$[ $qUU8E -D$ED$ED$ ED$E D$E$]UVS8rEE$ t:t4@8t-UT$ U T$UT$V$Љƅu;E[^]Í!D$ D$D$, $@80E[^]U 8D -D$E D$E$2]UWVS7ßDKD$D$ -<$QEt8ED$ED$<$?|$ D$D$$跾E $DD$xD$$E$US07CD$ ED$E D$E$J[]ffUWVS86CÉEċ}u t$E$5Eȅuu}EEEE̍Eԉ t1 E U]M!ىˋuM! u t뷋]u!M܉!щME܋UM t1҉EԉU؉ƋM̅t_Mx+Mw&EEԍHwq{E@N4$]ƉʋEE8E1x}} EuD$$ 2^ D$<$1e xDžE %@  1)ttu䋅D$ v D$T$<$6x9 tvu1ɸ)u)lj9usu$yD$$r0p 1󫋅Et# 9uE t *H uE t 'H uE t E t E t E t "E @u \E HE <2 !L$ L$ U T$KL$$ׅu͋$+3$3$3$3E+DĔ[^_]Dž:D$ D$D$$D$<$.UDžpD$ D$D$$LEj1UD$ D$D$$%!D$ D$D$$$Q4X 1󫋝8Dž-t0)؋t9D$t$$29.9Ëϋtft6tt$/$/$/9&!Ɖx!։|x| t1ҋ9ҐD$ D$D$$ $e0…t01DžDž1 t1 !! u e눋 09Ћ!ȋ!ȉ t1ҋ1D$ D$D$$%/<$0t 01s^!D$ D$D$$MD$ D$D$$ "p fEqX#111҉mldUVS$&2EE8EE EEEMED$ UT$UT$$1!xEU+u [^]1BlUWVS%^2EE8EEEEEMU ED$ }|$}|$$xEU+u [^_]1kUVS%1u t44$ D$ UT$UT$$1ҍE=[^]1UVS$Ð1ut54$U D$ ML$ML$$E[^]1UD$ ED$ED$E$M 1ҍE]UU D$ ED$ED$E$ME|]UU E D$ ED$ED$E$MEI]UVS#ã0EE8EE EEEMED$ AT$UT$$1xEU+u [^]1 jUWVSb#'0EE8EEEEEMU ED$ A|$}|$$kxEU+u [^_]1iUVS"ê/u t74$D$ AT$UT$$1ҍE[^]1UVS"U/ut84$|U D$ AL$ML$$E[^]1UWVS9".}u t74$D$ AT$UT$$1҉N[^_]1U!.D$ AD$ED$E$M 1ҍE]U!b.U D$ AD$ED$E$ME]UX!!.U ML$ AD$ED$E$ME]US !-EEEEED$E$E []UWVS$ Ú-DžE = tIƍD$D$ t$|$$%tyDž 9AD$E$uƋI} t9rcJ8 uv9t<$&%$Džf9t4$$Ё$[^_]ÉUE D$E$K]ffffffUWVS+ƉЅtK Љ Љ Љ Љ Ѝx|$F$ tBF~1[^_]ÉU`T$ XT$D$y$E냸UWVSq6+ƅ9N rn~PRuF$D$ D$L$M<$褜^M΃ډE:BGuETB[^_]ÉUy(MED$|$F$DMҋMUu~ LЃ[^_]ÉMU`D$ @D$D$$MUMD$ @D$D$$M9N r~y(MED$|$F$CUMu~ 1UWVSÄ)ƉυZF(JJrPf~Jtt$ $ uKLPthF%=@=\=DĔ[^_]Ott8t$tB$Ot9z |1tft Ĕ[^_]fx t~B8z<~ ^z0Z4FB@zT.IBpDp@PDH41ًP01 uH<1t3P8 uҋpx9t<|1tftFĔ[^_] nĔ[^_]ÉtUD$ LD$D$$tt`D$ LD$D$$tkzUtBT%=.8t f{f{UWVSf&E։ʅE@(tvBXU$YU@PxTZrtftP,}WP@ @J@ @@[^_]ÍU$txTULYHP놉M썃`D$ 4D$D$$U"U썃oD$ 4D$D$$U1]UWVSY%ljօxlxD$$tE3G4U3W0 u|3G}F)uGHf fű~t$S u} EHDu@8/tF(t`F[^_]ÉUD$D$@)$ǃUtq#F<$b<$ufF몋E@[^_]ÁN(i`D$ D$D$1$oF1p1UWVSßutpDp7u4E4$u(4$ E$[^_]ËF$$뿋F$$F$$F$$뵍$D$ D$D$B "$蛻aUS  -D$ D$D$E D$E$l$]]US àED$ D$D$E D$E$l$]]UWVS8`Ɖ׉t,MN=U= =T$E؉D$E܉D$ L$|$4$[R=ƒu܍M؁ ʨtUEԃ8[^_]1EEkEhEEMdҺ뱺몋U른s"كؽ8[^_]1Um6 -U E]UMU E]ffff̀rS[ [̀rS[ [ ̀rS[ô [USØ EM u Et9u[]1[]UWVSZ u} ttB|$4$v[^_]ÍD$ D$D$BT"$諸uD$ D$D$CT"$}UWVS u} ttB|$4$[^_]ÍD$ D$D$BT"$uD$ D$D$CT"$UWVS@7 t$0D$T$L$4D$4t "|$GD$8UT$$\$0踪uL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0藹D$$T$ D$(T$,D$T$ $D$ID$L$8D$9\$0"D$8D$E $]D$@E$,E EUP ]P]썃ՏD$ D$D$"$被uu1]uUWVS}G $_wt6$LuG[^_]UWVS{u} t"tL D$ $荢[^_]Í1D$ D$D$:"$ªu@fFE܋UVtfNȃ8[^]FfF1E@EÿE?EEURҸFfFFfFs1]fffffff̀rS[Ô[UE]UWVS$mE։ME}E؉Eut[E9UsH߉։]EƋE D$\$4$U~" HS9uE)9ur‹]ڃmu$[^_]Í|=D$ 4D$D$r"$KEQD$ 4D$D$s"$"UWVSX`Eu U E } XE EE̋EƉE$]1Eȅ EE MȍANjEȉEԃ)֋]ދuމu؋ED$E$M#EȍDMԉED$EED$E$U1ɅM9uREEEȉEEEE؉E܉}ЋEM4u}؉9_u E9s#ED$ED$4$U9Etщuă9UM]+uED$T$U4$U}9NjUt +EMC1ˉUE‹E9rU]}M9MrED$ED$+E$UEEE‹E+EMȉEuM9M}ЋE9 EEE]ԋ}čGU9Eщ}U܉EA‹M)ʋ}č M9xȋU)Ћ}lj}ԋE9E9EM]ED$}|$]$U}]UEE؅:U!ED$\$<$UU9~ ]E9rՋE9M̅pU܋E 9r}G9D)EE܋M܋E}89uM܉E}9}M9M M]E̅uU܋E}Ћ029r}GU9CЃ)E܋}EԉE9DEԉEGED$E$MEEԉEȉEċEEȋE9EEĉ$]1X[^_]Éˋ}M 9sWEƉ}Q+ME }uڋEE‰]MĉEE HZ9Eu]M9r}M8E}ljMĉ]XJM9uˉM]9sMˋUMUuދM9U]3]M9ËED$\$<$UM9Ӊދ]19ME9Ms?}u}9us'<3ED$|$E$UU9~؉9urً}uE9Zu̅U܋E 9rUB9)ӍCEE܋M܋EU‹9uM܉E}9}[M]U9UU̅U܋E}ԋ029rUB}9G)XUE:}܋u9rUB9)]E؉ËuEߤ9uu]]Uމ+]9UED$\$<$UU9ЋUlM9se}؉ߋ]M ֍E9}s8)1ÍED$T$UE؉$UM9ȋU‰9}rȉ}EE%}܋u9r}G9r))]E؉ËuEߤ9uu]]Ҹ}܋uEԤ9r}GU9s/}܋uEФ9r}GU9rщ)EMċU9EȋMĉMȉEU9UrEЉE}ЋEMԉE؋MuuEU)ЉEĉڋE]XJ9u]uE}9EŃ}tuED$}ȉ|$Eĉ$]H}!]D$ DD$D$&"$z]GD$ DD$D$'"$HÍD$ LD$D$x"$E*]D$ LD$D$y"$ߝ]LNUMUT$|D$ ED$E D$E$y]fffffffUWVS EuNt4~^ȉMtH1ًP1 uN9H u [^_]ËMM$]t"N^HXVP MF [^_]ÃUWVSp5uDp7uu[^_]=F$$V4$*NjF$$A[^_]UWVS}E wuq6tk9uFNW9V uW1ʉUW1 UtGD$ D$L$$GWG1D$<$StG9F [^_]Í$T$ \T$D$i#$輛E LffffffUWVS1u8F}9FiF FD$ D$D$$$FVFD$F D$$FtotfxWFvthV uAzN)91FJ u M ]z u F MЃ[^_];1})81F u1UWVS(}Dp7t2G$$D$<$ƋG$$[^_]D$<$Ɖ[^_]UWVS |莟E脟Dp70E@$$蓯D$E$,ƅ@ ‹} >HE@$$(tlEM 1 [^_]D$E$ƅt[P } uuuF脞uy}8눋E@$$藮_uJT}8E Y=If뱤&fvft  [^_]E xDE xfffffff̀rS[t[ḃ̀rS[T[UWVS$q6utoEEE E-8D$D$ED$ t$D$E$3ƃt 1$[^_]8 uۜ8ፃoD$ pD$D$< #$3bfffUWVS0vƉE̋]E 8U1xu2  t8u)؋U+0[^_]Í}1 r}̍]ȉT=Ѓu]t; t\="t]y$]Ջk1d]̍U$fffffUWVSf}U utrt<Ѕt .t&HOtuxu)Ѓ[^_]ÉU 6D$ D$D$=H#$艕U 뒍6D$ D$D$<H#$ZU \fffffUWVSÖM} UthtN49t8u)Ή)t3ttu)[^_]1<$[Ɖ[^_]ÉUM6D$ D$D$A#$膔UM]6D$ D$D$@#$QUM$US×Ey |b(9~)ML$$-D$E $1[]ÉD$ UD$ED$E $薘1[]UVS]"Ey |b(;}.D$@$-D$ w 4$r[^]ÉD$ UD$D$@ w 4$[^]UWVSâu} taEtH,-EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]ÍD$ D$D$?#$誒uD$ D$D$@#$xFffffffK̀rS[ô[UVSÚuLimNA90%[^]ËTPH9rLTP[^]9r싋LUWVSY}L^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓TP419|[^_]Ë]싃TPu޾ UVS@,4$AuLU4$$[^]ËE4$ [^]UWVSè} LEq,E$ʥL@}j}wMǃǃǃGLHEG1E$]E[^_]Ã}?vB}<6LP)ȉЉA[WLЉU艃HEPPU)ЉB}҃?}Ƀ}Ɓ}tfD$ D$D$Y$$蓎`E$0EUWVS LEEẺEыE)ȉE䍃,E$ǣɋUL@EHLt)̋EʉP1THE$UT$D$E $;Es17[^_]"썃oD$ D$D$V8$$<N謐UE U9r 9]ø]UU E9r 9]ø]UWVSp5Lw Lw uLw <8E1ɍt-ωD$4$&t Lw PEu׉MD$D$4$ MtMljMuD$|$E$ Lw 8Ftt$E$ 4$uMETw 9t$$ǃTw ǃPw [^_]ÉPw TD$D$$aa[^_]UWVS*u} t%>D$4$Itt=t1[^_]À=t[^_]UWVSÕut4t$<$ƅtD$<$ 4$ [^_]ÍxD$ D$D$\$$͈UWVSU}G$-ƅtx @D$$f[^_]UVSut/t$$tU 9P [^]1[^]ÍxD$ D$D$\$$ UWVS WU<8E8s7i1}ƉUE D$ED$<$~u E <=,ED$<$Åt:<=t4D$D$<$xU <8D [^_]1 [^_]UVSi.l$:u [^]É 01[^]UVS&l$u [^]É݉01[^]UVSèl$贛u [^]É蚉01[^]UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu#B[^_]ÃHPtJ ȃB[^_]UWVSӉ΋t B SuUtBu{QtBunQu Q9tW[u믉 St2tAu(t@uAt@uSI[^_]ËtBuBB[^_]uUEU P@@ ]UWVSEpVUu 3t)+~E D$|$F $EЅu׉[^_]1[^_]UWVSExOtX1҉UM~]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSExOtX1҉UMy]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSEpEFM ]M19MƃU;\tkCEZE [^_]UE [^_]L돋 u{Etu>E닉Lt9ur 눋}bM υtIMyED1uLC yvyEE)fffffffUWVS!ƍt$<$Bu[^_]D$ FD$t$<$L[^_]ÍD$ D$D$X$$g떍D$ D$D$W$$fcUWVSh-}u tt$<$u 1[^_]ÍF D$<$ftF t6u$FD$<$苚tăt$<$x뵸[^_]ËFE }F[^_]}D$ |D$D$x$$fRD$ |D$D$w$$eUWVSe*u} t tJD$|$4$_[^_]ÍD$ D$D$g$$seuD$ D$D$h$$EeUWVSͬÒ}u tet$<$,u 1[^_]ÍFD$<$˟t~uD$D$ F D$t$<$'뵍D$ XD$D$$$dqD$ XD$D$$$ddBUWVSî}u FFt 1[^_]Ét$<$&tFD$<$ϞtӍFD$<$tF D$<$tt$<$ڗ랍D$ HD$D$$$cVD$ HD$D$$$ac'UWVSë}u  GtNu$G tWt)FF[^_]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ ,L$D$$bE GFG F[^_]ÍD$ 8D$D$$$$-bL$ M썃8D$D$%$$UaGUM6G EL$ L$D$ $aE   FFufffìrS[ô[v̀rS[Ô[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVS!u} Mt}t]MF9tDJuMtL} XU tz9ut@[^_]É11fu1[^_]1MD$ D$D$;$$_MNɉD$ D$D$:$$_MfUWVS(ӳƉЉ8U1҅D$ |$D$${z<$T@9EED$|$$Fu1U+6([^_]E @NteulN u`L$$ $SHN tD$ 5D$D$ $XE4t9u΃tft%D0 oT$ 0T$D$%$_]2T$ 0T$D$%$$]FD$ 5D$D$ $>Du-uFfUWVSɰƉЉU 8M1Ʌt=~t3 E+ȁĈ[^_]ù۹Dž9FfXtvEtoEfD$ 5D$D$<$B<$Q9E]ED$|$$-Vu5F~uN uF=tu ~tMEEhED$ t$|$$rw4$"P9E}ED$t$$M1@FȉC:9DžM9FF ftV ffuu҉T$D$ )D$ȉM)D$4$=Mx 9=EtEȃiviD$t$E$ڿ1T D8D$ 5D$L$M܋E$=M܅x9E4FD$ 8뻋EYQEE@DEԋ}1AE؍@E܍xEЋE؉M؉u E8EЉT$D$ E܉D$t$ $M[<MH9@)ƃu1q҉Ű}UT1AE؍@E܍xEЋE؉M؉u ET8EЉT$D$ E܉D$t$ $M;9M)ƃ9}u1MFD$ 5D$D$}<$s;<$IM9L$|$E܉$ԽMUU܉D$ D$ȉM)D$$;M}9nD$T$ D$L$M܋E$:MUWVS@ûlj΋E8EG uY$ato|$$bt9wuҋtD$G $kJu1ffh$tOEtPD$ ED$4$O'PPuEt8u x[^]ø[^]ÍUD$ <D$D$X%$JqUWVS(˞ƅt Ftt 1([^_]ËFy ([^_]Ãu ӉM܉ЉUUMxy=fuVfǃ  f|M܉UHD$ HD$D$X%$IM܋U0u?FtTtG1M}|$ }|$D$$*B0@MQVd5<볍3UWVS诐tƉׅt4tdvu 1[^_]É $GuMGT$ $T$D$X%$HMuMHT$ $T$D$X%$tHMlMRT$ $T$D$X%$$胁…(88,,D$|$B$触8 ,&Lt!9 ft LL1.Bvq'tlH$9}NjE $,}$]~|$t$D$ D$ %D$D$$%l81H L)Pd8pT4 DH8@@11HrLXDž\Dž`HTtDžxDž|$@(4)L$谇P#LP3者1.} 1-D$|$ 8D$PD$<$ƅ@@ u<$0Ѕ8Ɖ<$}/P9,| rGL"fǃ DfGljfWtuˋW҉NKE+&[^_]Í\\0DD$$jZ(FF FFFFL 9u8΍ Gt‹@u iDD$$t!H󥋅DD$D$ D$D$$%Z81Lx $薄臂15M(18<pf1f14DD$$SW 8FNN uuD4$,DD8D$ D$D$X%$"6_D$ D$D$X%$5 NnD$ D$D$X%$5($GD$ D$D$X%$5D4$ +DD8,D$|$D<$"8ЉD1_ <$}w1#Lu .8t189 u拽,t t҉11UWVSp|܈Ɖ8NjE1>$xB$x11 rFFtGGFUF19~1ɀ.уu9`d9@ HDPDDžDžDžDž<$Q88=}3G u$1ҋ~`{Y}$O$A1xƋND$F D$F$Ƌ@ut2OD$G D$G$tF$~$~U+p[^_]Ë넅tJPd9\.$1ҋD$ D$D$$qu~d,@}뎃1@<tE12Dž$1ҋ. {u@ z81.늍oD$ D$D$ X%$/$1ҋg{z@u6mGzHDPDE$|y1jUWVShv-EhpPt%={4DžthE11҉ rMd11҉`d r`VtA<$q49y.yt[^_]ËhMEEdUMEE$1u`11 rU؅tkhd<$3hE[^_]ËhMEE뀋hMEEd<$c3ЉddiX2\P}`1}dX  rOTdDpP|HXLƋX9H`D$ PD$D$L$%hL$P T$ D$HD$l$6xWE11҉ rlUEE!$\X;l$x9T#X\dwc\$1U`U؉h<$1h(‹d뎋DA‹@uDn> t1҃me9Gh9wGw9uhtQl$|dL 9u`q@D$%l$h[l$至…hl)D$L$4$|XdX`phHP HLT v~u~hxa G<FEu11 rE@t`EEEE<$8ML$ML$D$ |$D$E$~twEЅUp[^_]É<$MML$UUT$D$ |$D$E$$t?E$]_p[^_]ËUEtFE$\gMEԋAE܋A EAEAEAEAEEUԋEg{EЉƋ@uj~ZUWVS\ V÷c8NjE1 D$ D$ D$ $jƅ8#3D$4$D$4$xDž< < D$4$cxt$$yt띋AAA AAAADžD$ D$D$4$ ~#|$$u@D$T$1ҋE+Ё\ [^_]Ët։։vt.ttދ$닉GD$ D$D$ X%$a 3oD$ D$D$ X%$& IUWVS4Se`EȋE0xU11  rŰ]ȍD$T$mEЋ]̍EЉẺEEtCË@uE)uEЅt $]gEU4[^_]UVSRó_uD$F $StP PH p[^]UWVS@Rg_ljE8EG ut$t$$tӋD$$tD$F $ue$@=wI$‰@=wЋЉ==1U+@[^_]Ë~D$<$Dtu狵1DžЍtftȍtftD$D$ GD$D$@$)9OtD9AD$D$G$!t<0L9_YB 9@3t9'9uۉD$D$ $藃ut$ D$D$$+u9u [u3fvfvBfUWVSNÂ[}utHt$F $E $UF t[^_]ÉE4$zE[^_]ÍoD$ D$D$&$fffffUVSÉ1   lLLLL9r[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVS7GSut0FF#EgFFܺF vT2[^]Í D$ $D$D$ '$8UWVSFÅSEWU P?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPE=E);UEމE} ]7E@9rE)uu U<u sPtft[^_]äft.t&N] u]tug T$ T$D$ '$EU |EȓT$ T$D$ '$[EGf2u S'fUWVS$DQQEE} 8E1WEEG?78)‰T$LD$<$ND$ED$<$7EX1tftE+$[^_]úx)rD$ D$D$ '$ D$ D$D$ '$WZfP轉UWVS$CO}Ћ]E E8EƋE130-8}DGt`EE؉<01E 1҉M܉MLAt;}t^}׍T3y1]E+$[^_]Ã}u-t( fɃa) 3믍NȀw볋M܉<.u9twQ3ЋEDP{<0#s߀XtXEE1҉3)AtstEt)Eԅʉ s1EE EM M 뗁EM tEF]Ds@9o]xU ED$E$u ]ËE]f ̀rS[dM[UWVS0@FMuE 8M̋U1xu1 t8t)űU+u0[^_]ÍMЉM11ɉEċEȉ rEčۃTЃut( tۃ\"u|1w@UWVS?YL}E 4UE08E1;q,hEED$E$ D$h8$ hǀPǀTǀXDžDB$;8H"Dž@DžL0D$ ,T$4D$8$ƒ8B4D$H$j@4E+Ё[^_]É,RD$ D$D$<T'$^,,+D$ D$D$=T'$ ,THt$Cr BUl=5JUT$ U T$ -D$E$]UED$ ED$E D$E$y]U =IUT$ U T$ -D$E$B]UWVS$<ÚIu4$uE荓UEEEEED$ -xX<$ E؉D$<$D$<$ $[^_]UWVS=<IEX8TE1D$D$$ƍ`$1D$XD$$P^PT$D$i4$4$t'pTU+İ[^_]\$V\t~։P6tN~ tu틅XD$F$"uԋPGX$XcP$1A$]UVS:zGuF tF 1[^]ËF0$@F0F($?F(F,F$?FFN D$ӓ$FtF 뇍D$$t F ^YUVS9îFuF uu,F [^]ËF$WFF F tԋ$F F [^]UVSy9>FuF uetaF0$>F0F u9D$D$ D$D$$gF0[^]Ë$f 뷸US] $)1U C []UVS8ÐEu4$F$$>FFF0$ >F0F($=F(F,[^]UWVSa8&EE@0}  ML$$Ԭop< t< t򍃖D$4$褬?x4$fM Ay EpE pED$<$[tbP1tJ< t`< t\E@H9tTE xFE7ED$$tgPuuE @4E [^_]Ã됉U }OD$G$<9DžUtBExE xzt7@ D$$ 7ƋEp0E$01jUWVS$6lCEuUE@ u*x(9P,ӃCtftEp(ff} GуbF9SNO F|>L)/9!A)‰UtEHE HU1EE.E HFD)ЍtEx9EEPB9uҋEPU@E]?ED$UT$E܉$ \MuTMEHE Hb@ ]D$D$ E$[]0E$E@$.:E@@@0$:E@0@($9E@(@,T01$[^_]ÉT$<$]s6DžqEx(UP,ӃuCu*E $[^_]ËEH!fZUVS3Ó@u F tcu.tR4$(tEED$4$+tE[^]èu?V$ED$ ED$T$F$ t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$b[^]ÐUWVSh2?E̋UD$D$}Љ|$ D$D$]̍4$<vEЉ$/cD$D$|$ D$ED$4$D$D$$茹9ԋD$ D$D$=$10-D>DBu.L$$u9ċ+$b!D$D$$ǸZUWVS EĉED$ED$E $b&D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,yaD$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,aẺEEfEEEfEEEfEEEfEEE`t2 u&FlUopU x;uED$|$ @-D$'D$E$E`t jED$$;E`FED$ D$D$ה$8D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,_(D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,"_D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,R^rD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]ND$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\*E`Yl‹w puED$ t$D$E$l‹w p8uED$ t$ t$E$訲kWZ PH8uED$ T$t$E$ekWu Wz?uED$ T$t$E$'E`t tED$$ ED$$1ɋuEED$$ EED$$@EbED$$EEEf Ef Ef EĈ[^_]Í T$D$ D$D$<$.o D$D$ D$D$$UnU D$D$ D$D$4$n D$D$ D$D$$UnUP D$D$ D$D$4$NnK$D$”D$E$4Ĉ[^_]ËED$ D$D$$詒ED$ D$D$$ED$ D$D$$UED$ D$D$$+ED$ D$D$$dED$ D$D$$בED$ D$D$$譑@ED$ D$D$$胑ED$$ IUWVS$ uE }8U1D$L$ t$U‰T$$ xVD$t# $U+u#$[^_]$."1OUED$ D$E D$E$]UWVS! }ED$|$ ED$ED$E $ x8Ɖ<$uH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$bE8E1D$|$ D$E D$E$&…tD$<$E+u Ё$[^_]NUWVS }u Gu 4 Gt*D$4$趞uUt E[^_]ËEtE[^_]UWVS^uZe~M u ( ~t9uUt E[^_]Í L$D$ D$D$<$iEtËE[^_]UWVSu} dVu + Vt!9>uMt Ev[^_]Í|$D$ D$D$4$#iEtËE[^_]UVSk0u,d\l Bt ;2u[^]Ét$D$ D$D$ $hv [^]Ét$UD$ D$D$ 4$\h[^]UWVSyU} tdUfc~U ~t;u[^_]Í T$D$ D$D$<$g[^_]ÍlUVS,ub Bt ;2u[^]Ét$D$ D$D$ $^gv [^]Ét$MD$ D$D$ 4$g[^]UWVSu:u6bw$ wWvK B v|@vF[^_]Ávfc[^_]Á 5[^_]Á v,낃@t9u~Ujtuc~OtDN9.\#p 51t$D$ D$(D$<$ce8#H2jUWVS}B}>`YD$t$<$`x [^_]É|$5D$ D$(D$4$d[^_]UWVS }_ rt;:u[^_]Í |$D$ D$D$4$:d[^_]UWVSLV8E1E <tmD$D$ D$.D$M‰ $McMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$MoGUWVS4Ë EEEE$襮E܍U}}؉EUEEU t 14[^_]Ã?uuU<-E<+u JMB0-DK~r1ɍ LH>vD{uU 4u<.}DCuuŰMэMܨ@uM1ҋMDK@u49rMԄMDC@&E DS@tc9rEu ]Ԉ^^FEȉFEȉFEȉF EuuEE9sEiEԋ}DC@u>1ɋUDS@u%9rUȄQUDC@NE9>DS@uE9&ENjUDC@ub1ɉUЋUDS@uF9rUċUЄEĉEDC@Eu9sEDS@t|9rz}BDCz}4BDCu;uJMBEcEE]z}DEBDC1.t&FUWVS= EM HMHMHMXˁHɁ@ =+-EAE-ENMb֍)É]؉л))Ɖuԉމػ))ƉuЉ]̅EEMbӍ)Mȹ))Ɖ))MUĺQEM)U)MEJ$)CEE4$CEE $CEUM^]EaE}d\$DD$@ED$<]\$8T$4]\$0]\$,]ȉ\$(t$$L$ uĉt$ut$u؉t$uԉt$uЉt$ ủt$(D$u 4$\E$YEt $HEt $7E Ĉ[^_]ú)‰UiEESEW), u RE ; er@ror:@ unk@ nown@ LOC@ RR @vers@ionE Ĉ[^_]ÍsEs}\$DD$@sD$*tQ<.tAx[^_]ÉȅyET$ ( T$D$\($^E[^_]Åt<.1[^_]UWVS0ÅVE荰EEEE$PlPHH8|$ x|$x|$@ D$L$T$ ؕD$D$4$ ~ Eƀ0[^_]UWVSu Gt-D$4$Ŏu?E tE [^_]Ë?D$D$4$ukV0-DPtMrD$ ED$4$JKҋMyE8m1Ɂ]1VUWVS+ul\ Gt-D$4$Սu?E tE [^_]Ë?D$|D$4$ukV0-DPtM肴D$ ED$4$Z[ҋMyE8m1Ɂ]1VUWVS;u D$4$譎FFy ;F|/} t)P}D$4$衎[^_]Ét$E$襝USÉEM QQy ;Q|< tZ[]ÉL$$W[]UWVSr7Eu E$\EEEEED$4$ÍF0u ǀED$4$2}D$4$贍[^_]UWVSímRPƠ8uWV@tWufFuFuFf~@tJD$4$`lj4$$R[^_]ÉV@ut"Fu먉F룉4$hfF@먋FuxUVS&Ơ8Fu t$ -XD$ D$ED$4$[^]UVS×Ơ8Fu tE D$ D$ED$4$[^]UVSIƠ8Fu wtED$ E D$ED$4$2[^]UVS,7Ơ8Fu *tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$,[^]ÉED$4$;EUVSmƠ8Fu t2ED$ED$ED$ E D$ED$4$[^]ÉED$4$EU68U]U8U]USÿED$8$[]UVSÑƠ8Fu t$ED$ED$ E D$ED$4$[^]USy>8$[]UVSRƠ8Fu Et2ED$ED$ED$ E D$ED$4$[^]ÉED$4$rEUVS äƠ8Fu t9ED$ED$ED$ED$ E D$ED$4$ [^]ÉED$4$EUSf+ED$ED$ E D$ED$8$[]UVS#Ơ8Fu t4$[^]JD$$dUSÕD$  D$ED$8$[]fffffffUWVS FE8tj׉ƅt|$4$2Qt@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVSdz}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$E2T$ D$D$x)$-EE룤u9sftuu_SfӋ]KUWVS0æE׉΋UU܋U؋U$cEM9L9MyAE荃EEuuE9D$E$st4$ME+x4$MyuE$EȪE؉Eu܉00[^_]ËuE$Exu)y9uωE)T$ $T$D$x)$ؤE1UWVS$Y]Uϋu M MUL$T$ L$U‰T$$EEdËUv‹9EuC9@@EJ}B$[^_]Ë]t*]t .]{<|.B]9Z.EM9s;D$U썂2D$ D$D$x)$-Eډ)؋ux$[^_]ÿ뛉댋]썃ED$ x$D$D$x)$뷋]臨EE}8UWVS(}B]Ӌ}u UUS9)ÃEM-U썉2M u2D$ED$ D$D$Ex)$EJBs1([^_]É4$Ex%([^_]Ë]wEEUWVS+m2EuE(M,} M0t8xU1҉}$tt$$JNNƀ?E4$lDžU4T$|$E$Fƅ9s9D$2D$ D$D$x)$-7)U4E$NjE$|$D$4D$ D$dD$$VJNj $‹>|$ $}Mtq}whM 򋽤;qt#t<.)z<7|0.M$qU$AD$T$L$BD$ D$dD$<$/I‹$9ќ|0-f @)ȉ~ DžƋȉD$D$<$<9u׋)$$|o|$ $1ɺ0yf; F01x JDNu.9uҋ‹)‹<$9VƋt)xE+1Ġ+[^_]Á}e}$# M$aU$[=VE4$)x2D$$1ɺA.:f; @tE4$X~벍D$D$$U yƋt)9\D$ $D$D$%x)$Wn}$<$wWD$QD$ D$dD$<$+E‹4$t$D$ }$4$fN~F$$T$|$L$D$D$ D$dD$$RD‹ $$ 9*4$3 $D$|$ D$dD$$C‹ $$Z4$$+D$|$ D$dD$<$dC‹ $4$PD$QD$ D$dD$<$C‹4$_t$D$$U b)D$ *@t$L$$94)51E)0~0 $09&4$a‹$Ly}$<$WIL$T$D$D$ D$dD$4$nA‹$E$HD$ *@t$L$<$2'M)(1E)0~0 $,b09`(4$ ‹$y*D$Qt$ D$dD$$D@‹ $GGD$t$ D$dD$$?‹ $DzG$D$t$ D$dD$4$?‹$&wG9D$|$ D$dD$$?$dy$Fƅmlj$2}u9$wM$)a|$D$ $U <$N|$T$ $<$WD$Qt$ D$dD$<$i=‹$D$t$ D$dD$$=‹ $qGD$t$ D$dD$4$<‹$']99D$|$ D$dD$$K<$y9;$kEƉ9$!yV}+}$Q<|$D$$U Z<$|$L$$U <$T)ƒ=эa;}$}4|$ t$D$$.4$9s?D$2D$ D$D$x)$-։)׉}4GD$D$ D$dD$4$9‹$IG9Q$Dž1%pƀu1$Dž |$D$ D$dD$$9‹ $^QP9N#$ 6@t$D$E$$S24$Ë$k}$L}4|$ t$D$$譪4$e9s?D$2D$ D$D$x)$-E$ VUUU)ȃ=l$)}$fr@<h  }$ZD$Qt$ D$dD$$6‹ $BxGGD$t$ D$dD$$6‹ $!GD$t$ D$dD$4$F6‹$GG<}4|$ t$D$$膨4$>9s?D$2D$ D$D$x)$-։)׉}49)=G$)B}$"4$F$$QD$t$|$ޜD$ D$2D$@4$~4‹<$|$D$^}$c<$AWD$QD$ D$dD$4$3‹<$P|$D$$U Q<$0|$L$$}$}4|$ t$D$$.@t$$=D$D$$U ) 1z9t؉4$nD$D$ D$dD$$K2‹ $yED$dD$ D$dD$<$1‹$R|$t$$U J<$-F$t 4$p4$eD$D$4$4$|9E4s3D$2D$ D$D$x)$->&D$D$$U `9zF09\Gt1Gt`$D$D$ D$dD$$/‹ $LuP~F$B=  $)u|$t$$U <$Q4$~$XD$D$ D$dD$$.‹ $<$|~$D$T$ D$dD$$.‹ $s<$fF $F $D$|$D$ޜD$ D$dD$<$-<$G$|RT$D$t$D$ D$(D$4$"-‹$}U$r VUUU)ʉЃ=p $)-^E$XaD$AD$D$BD$ D$dD$<$^,$}$fR<$0G$"D$t$D$ D$2D$@4$+‹$']4$9lj4$$lj$k$T}lj<$L|$D$$U xt9H\D$ $D$D$Ex)$<x}$a=t9M $i)_}3$.x$YG GGDž====Dž$Tlj9zw>9Gt1Gt`$D$D$ D$dD$$'‹ $4juP5G GGG GG GGƅ=G GGG GfDž==ƅ=W GGW GW GGW G$,Dž====fDž==e)aRD$ @t$E$D$$ y 1E)0~0 $309 4$o‹$yD$%D$ D$dD$4$$‹$p?2‹9@Dž@DžDDžHDžL@)‰t(19rE4D$ T$t$$˕$}n9s3D$2D$ D$D$x)$-)U49V<$ |$t$b|$OD$ D$dD$<$"‹$s7D9D$|$ D$dD$$! $yD$ @t$L$<$8  P1E)0~0 $K09f4$)l‹$yI)a 4$lj$V|$AYD$ D$dD$<$ Nj$‹\T$ $1ɺi$ B4$Nj$u4t$D$<$Dž9s3D$2D$ D$D$x)$-)u4t$$1ɺ`4$ ?$裿Nj 4$u4t$D$<$Dž9s3D$2D$ D$D$x)$-)u4t$$1ɺ]4$<$蠾Nj4$u4t$D$<$Dž9s3D$2D$ D$D$x)$-)u4t$$1ɺZ4$ Ɯ5$虽<$u4t$|$$9s3D$2D$ D$D$x)$-lj)Ɖu44$МUt$$1ɺm24$ Ӝ $М_<D$D$$U i}$M$a=O$U:L$ @t$T$$ …4$ȉ;D$D$$U 9Ћ$|"yWM$=/E$Ha=E$Ha=$=]a=}4|$ t$D$$螋4$Vd9s?D$2D$ D$D$x)$-։)׉}4$)~'$МD$D$ D$dD$<$$ :k$=D]|79$=]i$=]avD$ @t$L$$1E)0~0 $094$a‹$y)a$=T];aD$=D$L$BD$ D$d1ɉL$<$‹$sp$ќwUWVS8蟲`E  U8u)E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]U¾M8E#ʌʐ]UWVSбÕu}'|EtG9E r'Gf|t+E D$<$@y]o([^_]9} r+Ey;}uExT$ $T$D$l)$iE뵋E9E r1UWVSнEEu} lj~P9rCffVP9r1PffV 9r1Xff\V t9s]n(?1ۉ}D^ fu61ɉLu}9uF$F(F,1[^_]ÉD$ \$ED$<$XxUWVSEu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$uF,F,^(NMD$]\$ D$ED$$]良7F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~GF$gF(F,b lM]k]k(UWVS Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$F,F,^(NM]T$D$\$ D$ED$$]臻;F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9ErgMF,F(F(T~ 9~GF$hF(F,ciN]i]i(ffUWVS蝫fEu)M} OV~^m M0ȈE<ƒ?ك}Ou荶,%ULWm ]0وM<O ]O?9E]U\]\U]TT} uU u ;E}[^_]} Oσ*$ˉM[MrUWVSi.}u 'MYf0x}~E~p1M ɃT 7  ҃{T 7SƒuM9}{C.봋]9|Mȃ[^_]ÍH rȃ[^_]ÉET$ p%T$D$g*$ZME#g0̙ UWVQu̙ o^_]ø1( ÐUWVS\֮ϋMM8uM1t$D$ED$ D$2D$M $MQƃM9r,ML$$$<7M)11}U+u\[^_]øUWVS j3EE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EE >u}: w( ]u#M EÉ$Sr?E}~=Ut3}0-,-w\DAtu܋E Ƌ})x [^_]9u]䍃#D$ %D$D$e,*$cXÍM U$WEM E$DxgEEM E$HEmx>EM EÉ$MMCxEM UWVS1u4$!MH9MX} slu^uVt}} Tр:.utgz\t,р:.tU ƒ.} 1[^_]Ãt=z\tפftu?u&xU 몋E Pf} \(qUWVSE 8E1D$|$E$xFD$T$$zxT$<$z4U+u [^_]fffffffUVSb'EuUMx#L$ T$t$$<x9s[^]ÉL$T$$%[^]fffffffUWVS öutcEt\E $F&ljD$4$'u?|$4$#u%džt$|$E$D [^_]É4$#f\ZUWVS _$utcEt\E $%ljD$4$V'u?|$4$"u%džt$|$E$ [^_]É4$"YUWVS ϛÔu t\E$+%ljD$4$&u?|$4$f"u%džt$|$E$  [^_]É4$!CYUVS G uD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVSߚäu} tAv-u3D$4$$tD$4$`%F1[^_]kXUSs8EU tttu P1[]&XUWVS)}u t' t:@trt0 wvONuIW[^_]D$<$ $tD$<$y$wFw71[^_]D$<$#tD$<$<$71UWVSe*}u tPD$<$#tD$$D$,\ZЃL$|P/~ȃ9~D$$)D$,ND$(\$,eED$8D$< D$P!L$8iDI4N\$tD$t$|4$8bD$|8(D$tـ\$`D$XD$XD$XD$(D$0D$8D$< D$P݄$\$`.D$(FT$H)‹D$<ЉD$PD$X~T$D D$XD$P/bD$P؉ƒtL$tV(݄$4ݜ$D$P-otj݄$D$t&1ҋ\$Ptut ݜ$؅ D$P݄$ݜ$|$Xu DŽ$\$t>M"݄$\$`$n݄$\$`t$TFD$`ƒߍFXj‰D$|@H0tT$TD$</[|$PT$8T$H 8t|$PT$8}D$hD$|D$,$x D$D$5$<$\$t$$t$ $D$|$$$\$t݄$\$`t$ptD$|L$DD$`\$`D$`e[^_]Ë|$PȉD$|t^t$HD$PD$0JЃ w(D$PL$8\$| CD$|SJЃ vD$8D$H-0t ˃L$|0t)ÍCD$PBσ\$|BЉD$8D$PD$0\$TD$H|$8\$,Nq$$\$t D$`$ D$h$ D$8$ D$T$ \$P0D$tـ܌$T$`ݜ$D$d\$t @"݄$\$`\$HuD$P$%k)~&U1҉$4DŽ$pD$Pj؋D$tـ\$HL$H\$LـOD$,D$H$%u=D$0[D$H#$$T$P=܄$ݜ$m1ҋD$tW(C$D$\$td&D$4$$ $$$1D$XD$\𿃼$us$ue|$Pt%=/D$D$T$\$tD$T4D$hD$D$T$\$t1D$XD$\࿋|$P$$\$tL$X܄$ݜ$$C $/$%= D$Txu xD$D$T$\$tE D$T|$h|$$N$ځ$|$P3'p$\$tnD$`$bD$h$VD$8$JD$T$>$v|$0$T$Pܬ$ٞwq؋$ݜ$!$1D$XD$\?6$%=+|$\)‰T$\K)!؉$^$DŽ$M9D$0tS$$|$PtN%=w@k)9t:D$0ut$HSD$H#$u΁tz%$1ۉ$$D$Hqݜ$$DŽ$DŽ$$hD$,LDŽ$1ɉ$t'4$*$D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USuREM t.9t*?D$ d'D$D$p(+$,[]US1uM E%t.9t*?D$ d'D$D$p(+$,[]UEt t]ËE ]1} ]UStYUE ~;u;t5?D$ d'D$D$p(+$+[]ǂ[]Ãwǂ[]US tЀEU tt 1[]1UWVSsÏ$ pEtc@@x1D$D$4$EW1u E[^_]A184$x218EE[^_]UWVS.suthF~O9tHNM 1[^_]ÉU0ED$|$E$蠙U0u=FUF맍]D$ 'D$D$ZT+$*i|UWVSrr7}t;t-M tWt1$w;wr$w<$w[^_]UWVSr~}tJWt7E1U9}t#E4E D$4$!u߉[^_]1[^_]Í]D$ t'D$D$T+$)UWVSqH~E@EEE19ut|E%D$t|$ 811YD$DD$8f-uix. fLD$:$(1flmUWVS\YÆf׉u UuU8E1Dn} t>M1U+y \[^_]$(U 9ƉyfQffQ 9>f4ED$D$ T$t$ $X@ u1$ЅD 9MPPHDžPGO9=uDž Dž)D$t$ D$D$$XWDž@ u4$Ѕw8L8 9v<$ZfG$ZNj$YЋ9f}}$} )Q t$$D$t$ L$D$$VDž@  99uQ 04$=$Z_C{GvT'tO<$NNjE$N$O|$t$D$ D$%D$$%b1t9s;)d}dDž1 019tl!9hu狍Ƌf4JuZtJ9}A9p@ ‰))9~V׋2$sX<))9zrtft1mDt$$*x9P ]u,04$tx99v8Љ΃tft4$b=ȉB9}_D$ L(D$D$0,$b nD$ L(D$D$0,$* cD$|$ L$D$$P…s@ 899EP04$=+Ɖ<$P)9| t$ D$(D$$%j]4$p)9T$T$<$q8f<$Ѕ%WDž$+T 1q΋9 GƋȉfpfJ2r 9t H0f9ًF9}랉t$ FD$|$ L$D$$M…@ 9-<$P9D$|$4$o1r@ yyy )ʉ (D$ $N‰p<$%O\/D$|$4$n01911)fR9s<04$L2)׃ (D$$MljUWVS$MKXu}5EGBt $[^_]øEB $GE!= DžD$ED$ED$ D$ED$<$gE…xkF D$FD$FD$ D$|$E$MEEE$O<$ Et;$[^_]øE9E$O<$F tD$ X(D$D$0,$BE$?OF UWVS@IsVMu8‹E1kFB FBPƋ}ۉ\$D$ D$)D$4$~HƋ9s < tW< tS< 9sz~D$ $9H< u땸1$F@ "m)փ (D$$-CtƉKD004$@9]‹tft‰)‰ODžNtftR :)944$@9o‹fBf 8mDž1 D$ (D$D$^0,$3P$qD9%f)փ (D$$@%Ɖt$Cdf\UWVS`->JE‰Eu8E1FE D$ .u‰t$L$E$}žEE4$ML$ML$D$ t$ED$ $t`E$BE@ U+`[^_]ÉM $;M>ʍEbMUEƋE$tBu녍D$ ((D$D$0,$2[UWVS(<wIuE>FE苳 }teUE<$kML$ML$D$ |$UT$4$跬t,E$AE@ ([^_]Í뙋MUEƋE$oAt([^_]Í $ܫt: DD$ (D$D$ 0,$ nUWVS;JHƋEtvF u>ED$ ED$ED$E $E1lj4$[^_]ËED$ ED$ED$E $EDžt뼍oD$ (D$D$0,$1[E1UWVS:nGt@ËED$ ED$ED$E$ًU EfƉ$[^_]ËE1[^_]UWVS05:FE}u  t/10[^_]Ã} uyMMUUUUu|$M L$D$LD$ўD$ YD$ D$E$&iuE0[^_]Ã} tRa8t{bPWPtD@ 7 E #:T$ l(T$D$0,$OEx{UWVSX8ÁE}E EЋEEEE8EƋE1$(g51 E؍EEȉMԉ}܉<$=D$D$ D$D$E܉$iDžE؉D$<$譬ƅtEȉD$|$$ MЋIt9pMЋI t9^Mԉ}UEă< t< tM܋E؉D$4$&MPE tJ< < E}9yE؉D$$ЫtPuϋEЋUĉP MH}MHAMQM)ω}9}ЉG)ʋ}9nt1ɉU؋}U9rU؋}ЋO E)׉UA4$@9‹}؃UЋu؉2Ɖuԋu)ƉűEEE6tftuЋVuȋMԉ 2M)ẼEE؋}9SE؍UȋU܋4u4$@9Ern‹}ԃrjwt%ỦϋU)׃E (D$$7t 8E܋U Mԉ}M܋E$:E܉$:!E1uU+|X[^_]ËEȉD$|$$!Kt@ EĉỦ $iŰEωM[fPEЋPEEE$9E܉$9E>fuE̋E_M#Mԉ $f9EEfbD:z1E܉E8US3K@6D$D$@ D$ D$ ED$E D$E$[]US03?6D$D$ @ D$ D$E$g[]UWVS2ǫ?D6)tDÉt$ D$@ D$ $ًU EƉ$2[^_]1[^_]UVSk20? tpǃ ǃ ǃ ǃ ǃ 5D$D$ @ D$ D$ $,Ɖ[^]Í $eY t55fUWVS01v>ƅ0-8DGty]]ԉ]]]܉U؀0tv\G0 1 4H\Gu6.E]9tEprBDGu10[^_]Ã0 vNȃD$|$$Umr9jUЃ}Mt9u }U9P}91:u}zEt }_}RM)ыE U U$UJuE+|UEČ[^_]u\ǾP}t u}tdPu9shx)‹|9rSt$D$u4$IJuE1E‰xEEjPu9 1`)x,6D$ ET$D$I<$UExUt7H)D$ t$D$<$uJ:fE6L$ H)t$D$<$E룃}=:UrlUWVS/&2U-`7qD$E$膾E@(t/}}tt,[^_]Ãu[^_]É<$ E [^_]ÉЃtE륍D$ *D$D$-$E }D$ *D$D$-$R}!<$ E 10UD$$MNjE 8Ut E?*D$̑$ 1UWVSøu} t tJD$(#|$4$ [^_]ÍD$ )D$D$?-$u}D$ )D$D$@-$ӼUWVS[ }u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]ÍD$ )D$D$W-$ۻ,ŸD$ )D$D$X-$詻UWVS.}u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]ÍD$ )D$D${-$论,D$ )D$D$|-$|UWVSu} tt@} u[^_]rD$ )D$D$-$uŸD$ )D$D$-$UWVSs8u} tt@} u[^_]D$ )D$D$-$苹uD$ )D$D$-$]UWVSê u} tt@} u[^_]VD$ )D$D$-$uŸD$ )D$D$-$ϸUWVSW u} tt@} u[^_]D$ )D$D$-$ouD$ )D$D$-$AUVSÏ uED$t$ ED$E D$E$~>.t[^][^]USw< ED$ED$ ED$E D$E$B[]UWVS6 uE D$E$t })x[^_]9u<-D$ +D$D$\-$?E)UVSEPtY.J.tQ.t&.tPÃ߃Aubv-0 [^]ÉÃ߃AvXЃ wrÉȅu[^]û.HvHw@B.̃v XЃ v-u(rÉȉdJ[0 v1nUE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]US$ E D$E$[]USÿ E D$E$[]USÔ E$r[]USq E$@[]U 8U< E MXp7]UEf]UE]UEfU f]UEȋU ]fffffffUWVS(u}E EEGE؋U L,uу<9M E9syQ.tf@t|E E9sT@AuwuFcO} o9](([^_]"E E1ɍL,EM[<U|$M $}Ut~UM)ȍ<FD$ $}UUM)ȍE(\.uЋM)ȃE%E}9}EM؈vM؅<.U܃uwUD$]E$|UEE})C~x9F0-}ȋ?DG~ruE9E9EEEE1ȉU}f]tEE:UD$ED$ED$ ED$E D$E$y]UWVSDE܋EEpu؋EmE@u8uEU1Ã@;؍sL`uʋE EEEEȋ} EEEċEQuE;EM}ԉ‹EỦ]}?wxEËu)?fpхt@}E]Љˁ?@ ‹EЍpхuEEuEuŨ;U]M}ԈM]\MEFFEE]ro+E d9] [fEp}1EpBf9utBt&M]܍D$ ,+D$D$-$*MUWVS$mE8E1D$D$|$ ED$E D$E$t>ED$D$<$&tE+uЁ$[^_]ú/UWVS$ƼE MU8E1D$ D$|$E$t-T$L$ ED$D$<$cU+u $[^_]É.US]E M9r 9s9su[][]UWVSEU} E9slUP0ك@t$tNt<]败([^_]9sAAu@u;!E!29rUUX9r1[^_]ËE؃EȉӋUUWVSUuE t*X?w#9r6 )ЍXt9Aхu)[^_]É[^_]É֤()[^_]UWVSEEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]s uU270:ۅt9u1[^_]Ë] [^_]Ë](1[^_]UWVS ïu}E9E |2&6D$D$$ umtF;Gt1 [^_]ø [^_]UWVSDU2E uuW1[^_]É?wZ9rBZML$ ML$)D$D2$x(9E~9}ljr[^_]É(뗉բƢ?UWVSǖEU t_Z1?w%9r8D)ӍV[t9хuލF[^_]Ék[^_]ÉT(F[^_]øUSOE D$E$k []UVS$uD$D$$tD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]UWVS,SuE܉U؅Ot A"}܉MGEML$$]ߎu]NjM-+E0 EEډU1709~Kt$EU9)ߋE^SЀ vSW9U؅ttFE܋E؋u܉0,[^_]ErEJ0AkL$X\$\1ҹ1)ӉL$H\$LD$@.D$ D$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$ ׋D$XT$\19|ID$XT$\D$HT$LD$XT$\m1뷸n1뮁lL$X\$\n9>|$0L$X\$\L$X\$\1҃D$HT$LD$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$@.)׋D$XT$\n9}8D$XT$\D$HT$LD$XT$\ m1미n1릉$D$PD$@.D$8t$X|$\؃!|$\֋T$\ƸQ)ƃt$X|$\)i)\i(\ø)\ykddڋt$X|$\)׋T$\i)\iD$X(\ø)\d$XQ֣p=T$L9ø ףD$LD$H\$XD$0 |$8-9R9~&)уD$P t1ҍR9ڀ|$Pt$$D$XT$\D$XT$\ƋD$XT$\9L$X$uD$t;ÉD$(t$,EaŃ\$(t$,D$t;D$PD$T1$D$HD$dD$8D$tD$0t$X|$\9}Éщ\$dL$hD$HD$ ED$D$8D$D$D$D$`Љ/T$0D$H]D$dT$h\$\1Ӊߋ\$X1 t$P|$T11 7D$PT$T|$X9Ɖ׉ӋD$\D$dT$h D$XT$\D$PT$Tt$X|$\1Ӌt$P|$T1ڋ\$X9؉ӋL$\D$XT$\T$HD$XT$\D$0D$(D$,bT$4L$8\$;`\$T$4L$8\$$@+7Љʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$11ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0>$@L$ @D$ D$49t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Lщ€|$?ED$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G D$ 9tG +t$\$49t$ \$ ^T\$]\$UWVS ǯ}썙]| uu [^_]Ë}|:dNu쉼uMTډ ?-00tċu! [^_]UWVStg,\$XT$T˅. 0xt$\|$`IXPL$d\$<É s {9 l$dyD$<D$dD$<D$ t$lt$D$QD$ D$\T$`$T$\$X[D$\T$`E.‹D$T|$T:)؍))׉|$d)À\$l|$<ljύ))É\$$t$D$:D$ D$\T$`$T$\$XP[D$dT$ht$lt7k9)ʍJ)Љ)))șD$dT$hi"D$dT$ht$l7_u)Љ))щL$\D$X.D$(iT$h)\iD$d(\ )\d$dQ\D$dFEVED$ ED$ED$<$HƅL@U܋M;WW+EỦ9‰FA1EdF1Xn]؉E܋؉ }<$11ƅE؍(/F(EỦ9sUWVSPȜ\$|ljD$xT$pL$P8D$TƋ$L1fBZ<:\$t\$X4\$x0>D$DD$\$|$ljt$ȃ|$dw|$H1 ڃ9t$xuD$hT$l|$HyD$hT$l\$tCL$\qY؋T$p\D$HTT$8D$h9ËD$l!΋D$HD$\L$pD$hT$lDT\$d߃D$tD$t\$x9D$D#|$t$D$p>11ۉD$x":tt$p>t$x9Kp9|ѿBG|$xkfat&Dߍ$D$xD$|D$xD$P{D$D$x$\$|1[\$| H8T$4<L$@kD$0. \$X))D$Ft>8t$|$pG$D$\t$pD$`k XPD$H1$$D$P\$xD$X($\$HL$`t$t ;C suyt$tD$tT$hFP~L\$t9\\$h}4=}H\$t\\$h\\$PL$x ;>VD$\9]\$x|$dD$d|$pdF$ tftD$dËD$pXT$`D$x$\$|1ËT$`<|$`1>|$t @ϋt$xs&tftt$`D$x D$hu+uċ\$|8f1D$ht$t IlPӉȉnu6u\$xD$p@f$ $ f |$pdNeND$@1ɉL$8~$D$xUWVS萁U\$dD$tT$pω<<FD$tp@u1e[^_]Ãt>u)D$lJD$ht$t|$hwǍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdP`tftߤ1eD@t$p`Pp@D$HD$pf@D$`<9PHЅu>u)Ӊ\$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$ttftt$l0e[^_]~~1D$HD$`*t -~0 wËL$`)ˉ\$LL$LY\$4\$X\D$x-D$|"D$d$|$$58,,$|$8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$d.D$D\$@t$8ti)\‰(\= ף|$D4)D$XT$\9D$Tt$PtD$XL$\t뺨1ɋt$pD$dtlD$TD$P11D$Hy,;T$|| ,;_D$pD$TD$P|$pwt$dD$xD$T>7> 9iFuD$pD؉D$X1\$Pt$p>iF>kFuL$T\$X)ىL\dFuډT$X|$d9u\$PD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pX dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0ɨ뀋|$xT$|1{2D$Xf ndPt$pdPePeP@f2|$pdNeNT$hfM|$pdNeNT$h"fQyT$4\$\$@t$8D$XL$\D$DD$d.D$8L$\$0t$,ri)\P(\wf= ףt$8)D$XT$\p:σ|$@p/|$T9׋t$P}D$X\$\L$@t3빉L$\$0t$,D$,|$,9|$|$D$(D$d.$\$t$i)\P(\= ף$)D$0\$@D$d9)؋L$09ȋL$d؋\$(T$DЙD$XT$\D$8T$<D$ D$8T$CD$(D$DșD$XT$\D$8T$<‹t$FD$(șt$9Ћt$H}D$,D$Dt$0D$XT$\D$XT$\puD$DD$,9}bL$T$$D$@L$T$D$dD$03UL$@D$drD$0;L$dJ\$t$pD$(Fu=|$plFpFdFhFG\$\$@t$Dt$8t$)=D$pf@D$,:D$,D$p1҉PyUWVS=v}ƅӀ:tyɉ‰Džt;:1ɉUF E荈M1= ||9}~z>dN$]#=v޿T[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]ËE~퍖dNE荄dNNjE.9tUD$4$]|Uu_ɉ1DžuUWVStƯNjX U$"=EU~|$l $$ 5}# ,/dž _y>u EX [^_]ÅxE P$RpÉ 2(/dž 1뒋WZytىugb1ɍA /dN}D$|$l $UVSsl4$B uƃ 4$B[^]UWVSrEuM V~6hFhF1P9u dN9ut [^_]Ë]g01[^_]UWVSlr-UM Z~/dFdFP9u09ut[^_]É0[^_]UVSr~l4$A<$话4$A[^]UVSqÂ~l4$A14$A[^]USqL~<$D[]qUWVSkq ~$R3nt6ÉǹUu [^_]ÉE$v.U1USp}E$av[]UED$ D$E D$E$1]UWVSpr}l<$~@<$\, D$ D$ED$ $Ɖ<$:@[^_]UWVS=p}l<$@X u<$E D$ D$ED$ $ZƉ<$?[^_]USoÍ|E $11ҋE3t (/P([]USoQ|[, $11ҋEt (/P([]UVSLo|u , $1ɉEt t,/P([^]Í(/UVS o{] E$1ɉڋEdt t,/P([^]Í(/UWVSns{lD$${><$Y t1$_EgƉ׋D$$9>[^_]$1ɍe_E/ƉUSnzME tE_[]$E1ɍe_$[]USmÈzME t@ tE_[]$cE1ɍe_$[]pUEt@ E]UWVSXm z]} tC }1ɍe_[^_]UVS0my]D$CD$CD$ C D$CD$CD$C$D$(D$D$$D$$1ɍe_L$xLL$ L$KL$ KL$K L$KL$KL$KL$ KL$$K L$(K$L$,K(0[^]UWVS]u } IXP ;r B}y[^_]ÍIlP)׉[^_]UWVS kïxu} lD$$;X t[ t$RXPL$ ;p H}yD$$m; [^_]ËL$RlP)Ӎ<$*\UWVSET$RuXP$M ] ;H pDyE U $\$ ;A yyƉ;u ]|o9u ] $\$ ;A qyƉ9u ]|͋M ]11 1ڃ[^_]ÉƉ;u ]}# $\$ ;A y}'yϋM ]11 1)ڃ[^_]Í [ulPƉ)뗍 [ulPƉ)J [ulPƉ)RUlPE UUWVSiqvlD$ $y9X t< tOUM T$L$$Ɖ׋D$ $?9[^_]Í<$C uu} UWVSiu}u tstC,-t(TSNLKf9t)ȃ[^_]1[^_]ÍD$ 0/D$D$BX.$!둍D$ 0/D$D$AX.$ ^US]h"up u#$l tЋE$$UWVShte=t:F$V FtD$$W(4$Dmuƃ[^_]UWVSgtt}ƃp $dtCƉxtD$<$'E FEF e1[^_]ÃUWVS9gsuE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍyD$ ]U*`lUT$UT$ -D$E D$E$]UED$ED$ ED$E D$E$]UWVS_ÁlD$ -FX$(F`F`y ;Fp|4} t.FXPVX}D$FX$[^_]ÍFXD$E$US7_kE -Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US ^äkE D$ED$ -X$g []US^mkED$ E D$ED$ -X$5g[]fffUWVSa^&kM } }E EEED$E$E@ E@U~5M19E}EtfEtME)‰UE$uUE@몋U tE eM`TEfH @1[^_]ËUu G)77wWU<$UtًE)1u EEPCP@@D$$E[^_]ÉЋ}tftE@9y6U /D$ |/D$D$/$ E@U)ЋMAD$ $5E[^_]ÍD$ |/D$D$Q/$.0D$ |/D$D$=/$EurMuMu4UD$E$qEU)1u =fBfmyMyHMXUS P[hED$E D$E$c []US[gED$ ED$E D$E$c[]UWVSZêgEED$E $ƅPDžD$ED$E$0"=ifGfw sG$wG,ֲG(G Eu [^_]D$ D$D$<$[^_]É$"fG 1[^_]Í^D$ /D$D$>@/$0UWVSYzf}t5D$<$#w fD$<$1[^_]Í0D$ /D$D$;`/$ffffUWVS1Yeu 4$!9EU9s 9ru׃s$u8u:Ѓ[^_]Í 9rU9tՉ׃ru$u,tftƤЃ[^_] zfUS XEeE9ErD$E D$E$蝺 []Ԟf!̀rS[e[UWVS!Xdu F0u ǀFFF tHNtA})xT9VnHM9VtnF t tc[^_]É4$N})y9u/D$ /D$D$W/$+Vr4$t늉4$uS0D$ /D$D$</$_ fffUWVSVƖcӉʋ} MM tau!ƒuމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]B{} x|1utv҉)Ѓ0CUtʋE9ut OsECExtE1뙸)0KыEÿEX0C[^_]UWVSxU=bljօt:Fu1F[^_]Ét$<$fFF[^_]Í0D$ 2D$D$/$n UWVS TûaUM9 ?p9s΃ttUUED$t$E$y{MU)UD$D$$E}E01 [^_]ÉUE4ED$t$E${MuUEU JHJHJ H JHJHJHRPVU0U$OY0`UWVSLS}`ljT$ L$L$,11 rL$$D$(D$ D$D$L$uct_GЃ%uD$wPZw0/1ҍTPЃFHЃ v$uЉT$…L$t$$|$9|$  |$bD$D$tZFT$| |$t$L$8w%01L$1L$ 9<΃t$  9D$uʋt$L$9t4$W1e[^_]Ët$6뼋L$1L$ 9<qt$ 붋L$1L$ 9<IL$ 랋L$ t$ ~64|t$ t$ xL$1L$ 9<y|$ ]t$뽋L$1|$ ?<L$ y|$ 6t$ t$6t$ t$ t$ .t$6<t$ t$ L$D$D@$SNL$L$-~D$|$UUUED$;D$(i D$9D$sD$D$$L$D$ AD$L$D$|$UUUD$;D$(_D$9D$sD$D$$L$D$ AD$'L$D$K|$UUU D$;D$(D$9D$D$$L$D$ AD$L$D$|$UUUT D$;D$(BL$(T$$D$(OHЃ  1t$|PЃpЃ vt$L$<$|$UUUD$;D$(rL$(T$$D$~D$9D$sD$D$$L$D$ AD$L$~*K PЉ FPЃ vD$|$UUU D$;D$(D$9D$ D$$L$D$ AD$ED$fD$|$UUUD$;D$(rL$(T$$D$iD$9D$sD$D$$L$ D$ AD$D$ D$L$L$D$tL|$UUU{ D$;D$(D$9D$ D$$L$D$ AD$9|$UUU D$;D$(D$9D$D$$L$D$ AD$L$ |$UUU D$;D$(ID$9D$TD$$L$D$ AD$D$@࿀ D$|$UUU D$;D$(D$9D$eD$$L$D$ AD$,L$FD$D$i|$UUU D$;D$(L$(T$$D$@D$L|$UUUKD$;D$(qD$9D$sD$D$$L$ D$ AD$oD$D$f|$UUUP D$;D$(D$9D$sD$D$$L$ D$ AD$|$UUU! D$;D$(cD$9D$sD$D$$L$D$ AD$|$UUU D$;D$(D$9D$sD$D$$L$D$ AD$oD$|$UUU D$;D$(L$(T$$D$*|$UUU D$;D$(fL$(T$$D$]L뾉D$vL$|$UUU D$;D$(rL$(T$$D$tD$9D$sD$D$$L$D$ AD$oL$@D$D$D$D$0D$LL$(T$$D$L$(T$$D$oL$(T$$D$PL$(T$$D$1cL$(T$$D$+pL$(T$$D$QL$(T$$D$2UUU? ;|$(rL$(T$$9|$s|$D$$D$ t$1D$|$UUU D$;D$(rL$(T$$D$=D$9D$sD$D$$L$D$ AD$D$ |$UUUD$;D$(D$9D$sD$D$$L$ D$ AD$DD$ |$UUUD$;D$(HD$9D$sD$D$$L$D$ AD$D$ |$UUU{D$;D$(RL$(T$$D$8|L$(T$$D$]L$(T$$D$>9.t&14$6Lf"L$(T$$D$}L$(T$$D$uD$  |$UUUD$;D$(rL$(T$$D$DD$9D$sD$D$$L$ D$ AD$D$a|$UUUD$;D$(D$9D$sD$D$$L$D$ AD$KD$|$UUUD$;D$(nD$9D$sD$D$$L$D$ AD$D$[|$UUU"D$;D$(rL$(T$$D$)u<$fnt$1PL$(T$$D$PW|$UUUD$;D$(`D$9D$sD$D$$L$D$ AD$6|$UUURD$;D$(L$(T$$D$rD$|$UUUD$;D$(rL$(T$$D$0D$9D$sD$D$$L$D$ AD$|$UUUD$;D$( L$(T$$D$(L$D$$9$I L$D$$9$IL$D$$9$HL$D$$9$HD$@tb|$UUUD$;D$(rL$(T$$D${D$9D$sD$D$$L$D$ AD$vD$ |$UUUD$;D$(rL$(T$$D$ D$9D$sD$D$$L$D$ AD$L$(T$$D$^L$D$$9$GL$D$$9$GL$D$$9r$wGeL$D$$9U$ZGHVJЃ |$1tBЃD$D$JЃ v$q|$UUUD$;D$(rL$(T$$D$yD$9D$sD$D$$L$D$ AD$L$(T$$D$-L$(T$$D$xlL$(T$$D$ ML$(T$$D$.L$D$$9$#FL$D$$9$FL$D$$9$EL$D$$9$EL$D$$9$EUUUwF;t$(rL$(T$$w9t$st$D$$D$ t$L$D$$9?$DE2$|$1댋L$D$$9$EL$D$$9$DL$D$$9$DL$D$$9$DL$D$$9$D4$DL$D$$9r$wDeL$D$$9U$ZDHL$D$$98$=D+L$D$$9$ DL$D$$9$DL$D$$9$CL$D$$9$CL$D$$9$CL$D$$9$C}L$D$$9m$rC`L$D$$9P$UCC|$UUUwTD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$D$$9$BL$D$$9$BL$D$$9$BL$D$$9~$BqL$D$$9a$fBTL$D$$9D$IB7L$D$$9'$,BUWVSP<cI$]$} |$Dut$L}|$P8D$4Nj$L1'D$L'$@0u ǀƄ$D$D$$AD$0$G wf DŽ$D$PD$$$$$DŽ$DŽ$|$L$D$lDŽ$$D$HD$,D$xDŽ$$D$<$D$8$8-$%t >u$)؅$*$$A$$$j$$~Ƅ$Ƅ$FDŽ$DŽ$DŽ$FZ $1ዴ$4$$J+@F f B$fx0\$L<$$DŽ$DŽ$D$$$$D$$8$g$ǁPǁTǁXy 1B<,<tft$F f$f$Ff$F$F,$FD$$L$$DŽ$DŽ$DŽ$D$PD$ D$LD$D$DD$$$$Z5$@$fH @1ۍFЍPwFЃ v$>$FZ$/$Ƅ$$$DŽ$1ҍ$$D$|D$`D$TD$XD$h$t$$؋$9}$D$\s'$$u$$)tB$\$8F$$S$f$$tJƄ$0$t$<3C$$V$O$ǀ'|$|)υ$$$;Kȉ$$W$$$$t$$)-t$\$ZDŽ$$$$8$2\$ltD$l$$N;$$@ @ft DŽ$t$(9t$$ ;\$4$L+=$e[^_]9.t&S$$K$$r$D$h$_)D$\$${$$j*[,ۼ$D$h$T$$T$$T$ |$\|$D$$$$CDžl6$)D$HD$lt$$9<$${D$lv6<$w$$$tƄ$-$D$X=$$߃Gm|$h-($t$X\$\ É$r$D$xt D$Xf)$y DŽ$D$l$D$|D$`D$TD$h$k$D$h$D*D$\$FD$h$D$\$a}/X$3D$hP$$=$$$_$$"a. ,ۼ$$D$$D$$D$$D$T$ <$$>"$$$~|$\$ C#-vL$$$$$1۾ $$$$$$st$\$ 5$+[R$$Ƅ$1ۋ$?D$`$$ D$`$|$\$D$`$D$|$$$$$st$\$ !+[R$$ $$$y$$.,$[$$$$$DŽ$$Ƅ$1҉$$Ƅ$ $t$D4$$ 5@$4$4@D$x$H@87$|Ѓ01 Z0 4Jу0 vꋔ$$9+$N-v$$$ މ$$Ƅ$+ލW7*a4FЉ1҃ /PwFЃ v뉔$$$$$W$ 0!) $H$p$$$_\$\w*1҉$$$ǁ$Ƅ$x% ǁ$3D$`Ƅ$$p$/$ $$B%$$t A+$D$|$PD$|$y DŽ$D$\$D$|$$$1D$`D$TD$XD$h $ $$$$D$|$+$)$@$D$|$$$$$t$D$$<$$')$9~$Ƅ$$1p$$$$$$$D$|D$lt$$z0$($@$$$^*$$$$$$'‰D$l*$$$L 3 t$Dt$$LD$ $D$$D$$2/L$lD$|$$E$@⿀ $n$[$$$4$$$$$K$$L$ 3 $'$ I|$D|$ T$D$$4$$<0.$y DŽ$$$W$ $N$$$5$$$#$$3$$$$ʃT$\  &#ʍRR$$$$$ D$` $$3RƄ$D$x@|$h$h|$lt$H|$|$)t$X9~~@$$7_؉$$V$$y1ۋ|$X)߅|$X$|$x$ $\$0$$$3C$$Q$$$\$|$)$9~~@$$7_؉$$V$$y1ۋ$)߅$*$$$ A$$vω$4$$$륋$$)߅$&$$L$@$ ~UA$$vӉ$$$$$L$@$~$$$|$|)υ$$~$L$|$ ~UA$$vӉ$A$$$$L$|$~$$$ $$;$S$N$*$^$$\$0$$$7Gp$$X $D$HA$$^ $\$H)ޅ$|$,y$$Y$S$t$($$T$@L$ $T$( ~W1A$$vӋT$@$@$$$$L$ T$($2։Z؉$T$($I $$^L$@$$&$$$L$@gL$@$$s$$$L$@~$$:$$$$T!$$$ ~U1A$$vӉڋ$&$$$$$3{$$$$I$$$F$$W$$$ $tB$t$07G$$Q$$$$\$l|$H߉|$|$$$3C$$8$$$$$$ݔ$D$h$T$$T$$T$|$\|$ D$$$/ǁ$'DŽ$$|$X L$\9l)L$\D$\L$zL$|$$ $$$L$|,$$~$$B$$$$$$$wT$ 3T$D$^/$$'D$l8N$$`rx$$$$D$\$DŽ$D$|D$`D$TD$Xc$$|$||$\$$PT$xT$$T$ $T$\$$D$`e$)~Td$$D$|9}$D$|$D$`D$TD$XD$h$9$u$$1۾ $$ $‹$ǁ|$X$DŽ$DŽ$$PD$xD$T$ D$XD$\$$$$K$)$D$|D$\$$$ `~UA$$vӉ$($$$q$$?o$ $@$  $RD$`$ D$`DŽ$DŽ$ $ $ M$[D$`y \$`Ƅ$-$$$1۾ $b $ID$`,$? $[D$` Ƅ$$11DŽ$DŽ$$$G$$$s$$$$$p$\$h$$t$`l$`t$h2B$$K$dt$xt$|$)9~΅~9$r$$K$Q\$x y1)E$\$TCL$`C$|$|$9h$\$$$ ~U:B$$vӉ$ $$$$2Z؉$$t$x$$$$ql$xl$T.$$`D$x$$ȃ$|$||$\$$1h$$$$qD$|$$>1$$$-$$\$x L$@$$~$$$$L$@$h$$$A$$vω$Z$$$륅 |$hD$h$$7D$ 3D$D$4/$$0D$ 3D$D$3/$D$\$$$D$@$ǁ|$X$$ :$Pu`$3$$$$ $u$)ȉ$D$|:$$|$|0 u䉴$|$|$` )$D$|$$$Ƅ$-$ $D$@$%D$X$$R$D$\$$$$$ DŽ$$P|$|D$xD$T|$($\$`t$d$$ T$|$$ʁы$)уș׉L$`T$d$$)ii̍D$hȿƉ׋D$hljD$p%D$tD$pT$tyD$pT$tT$pD$`1L$`\$d|$|W0G$$D$XD$T<9 $$9~D$|PD$@GD$TxtD$T\$`t$d$$DŽ$V$|$()ы$D$|;$RD$`$BDŽ$DŽ$$$DŽ$$$~$$$L$@$$3$$$L$@ $ [ݔ$$D$$D$$D$$D$ T$$$/Dž%$)D$H$yD$HD$\$uƄ$D$lt$$W<$$AVD$l<$$R$$$Q$$[$$$J$$I$$ $@R$ z$ID$`$@h$ $ID$`$$ $R$$$ D$`$@$$$ $I$$$$\ $ $0$$$ƶP$$$$$葶$$$$@|$ 8  $ID$` $D$\D$h$+L$X$ $R׉$4)0ȉуcڋ$s0O9$T)ډщ$$ǃ> tft$$)ЉD$,D$\\$, $$y DŽ$D$l$D$\$D$|D$`D$TD$X(D$P( D$PD$PD$Pn$`8o$Ƅ$1%t$x<1\$X$1<9)FuދD$\$03$@0)ً$D$|$^s$$$v$$$\$Xt$xȉL$T|$`$$D$l$D$|D$h$؃|$||$\$$1۾ UD$\$$3$$$̉)1ҋ$$$)iiщƉσ$0$O$$DŽ$$OD$|$P|$h'D$HD$\D$HD$\D$h$1\$P\$PUWVSa}D$<$ED$ E D$ -D$<$豺D$<$[^_]UWVS9}D$<$諏ED$ ED$E D$<$QD$<$襏[^_]ffffUWVSÖƉ׉Mphtt[t@[^_]ËUuD>ttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVSý}ED$E D$EE$ą3E܋|\$D$D$D$D$%-uMAU$T$ 7ƅXT$ DV 9‰T$ s )HFL$D$$ND$ NT$99sH\$T$9rڃ9uT$9Ѓ9uU@]} ;tL$E$UE tE C9rwN9ue[^_]ËD$%-uMEED$E D$$6Ɖe[^_]ËED$E D$$6Ɖe[^_]ËED$E D$Ƥ$~6Ɖe[^_]úT$U~ t^E|tEXrUWVS,)}m|$D$%U <$p3m܋||$D$$%-BuM7U$T$=5ƅNT$DV9‰T$s )HFL$D$$菂D$VL$ 99sB\$L$9nك9uL$9ȃ9uUB]} ;tL$%ɋE$UE$tE$C9ruN9ue[^_]D$$%-@uMEED$E$D$$-4Ɖe[^_]ËED$E$D$$3Ɖe[^_]ËED$E$D$Ƥ$3Ɖe[^_]ú$L$U~t^E|tE\pUWVS`t9E(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$&¿3፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$ 4$.U:ue[^_]ø랸뗸1ffffffUWVSxn3t&*=E= =D$TEU D$HT$Lu 1ҋE%=D$HT$XzD$T~D$TD$pD$ D$tD$D$X$ D$DD$pD$PD$\% ?D$X\$`t$`D$$t$`D$dD$`أ܋܃݃T$`L$`|$nD$n fD$ll$lT$hl$n؋|$P)׉T$h<V(\$X,D$(D$4D$hljD$@D$,} <$00D$`D$tD$ D$PEExD$0|$@t$0L$$ 3t$4$ wD$8xD$0L$4ȅt~9 ))D$4)NjD$,tXT$0D$D$8$zxD$8"T$DT$$vD$XT$D$sD$XD$D$nvD$XD$h }~D$0t |$TD$,D$h   )ƒ& <)t$LE'E D$E D$$.D$`D$`e[^_]D$( D$4L$hD$h)D$4މt$,D$@D$h} }~1|$Tƃ}B }}}D$0UD$@‰T$ MDD$P$-D$`O}F|$T;|$PwHL$t |$@ V(D$@ƋE D$HD$`P|$P|$nD$n fD$l9 ؋Ƀl$l\$hl$nL$h‰L$XL$Xv ɃL$hɉD$hH0Jڞzu؋D$D$AqD$`9D$@}U E 0D$`e[^_]ËD$,D$D$D$XuD$DD$`D$`e[^_]Ë|$P|$t2} x )D$`D$dl$`\$`t$`D$d-D$$D$TD$T1|$TD$TDD$T@)捊 ym1}} }t=ED$0T$hD$()ȉD$41D$0EED$ D$P_D$hzIl$h?ED$E D$Ƥ$*D$`D$`e[^_]úT$4ׅMt$(vT$PD$0t$`L$D%D$D$ $oD$XD$ $L$h+0FL$hQu y 9|$P‰L$D1ɉT$hD$Tt@L$TD$D$D$tD$D|$X|$$uL$T6|$`94 vP9t|$8L$8=D$`0D$E D$$)D$`|$PwuD$t(.D$0L$@V(ȃƉDD$XD$t"W(T$t Ƀ ɃuT$\$8D$8T$ D$PD$4D$,T|$8D$`D$4t$PD0D$(t$DD$XD$4$a'D$,0L$hT$8T$4$rD$P|$D$X$r…@ fT$T$04$WrD$DT$0$jD$Dy}T$HL$T T$PN~}~L$TT$ht$D~HD$4$pD$D1t$Xt$$qT$hV9zT$,1t$4FD$hD$X$iD$h L$8tt$89tD$h4$iD$hƉ|$8D$8$iF(MZD$PD$D$D$X$djD$XD$D$D$pD$`p1D$@D$X$!iD$8lD$hD$D$X$^mD$X86+D$p[T$XBD$j¸ )6D$XD$D$D$;pnl$@D$D$ D$D$iD$DL$0D$ D$P8D$0~)T$4D$HD$`DD$8|$nD$n fD$lt$0l$lT$Hl$nd$HT$H0qٞىt$Ht$0T$Hكڞ.D$XT$\D$HT$LD$tx |$@t$4D$0D$8W(D$Xr D$D$D$8$mD$81fu T$hvx0t|$8L$8 t$8F$e…Fz tftD$$mDžYD$PD$4HL$PD$h9L$("D$D$ 4$`gƅ`D$8D$D$ 9D$8$.gD$8,D$D$ <$ gDž D$PD$4D$8L$؃\$HD$HT$LD$-@D$D$8أD$|؋t$`D$XD$8EЉD$@A$feD$Px}ND$H D$P=N)ȉD$41D$(D$HiD$LZOD$,DD$@V(ƒD$X T$T$L$T$HL$L?W(\$81tD$8 \$8uT$D$8T$E蝖81[^_]Éeq胖8Tu0UWVSP~Cm|$@|$0t$4|$Hfu|$ t$ e[^_]Åy1fu|$1 t$e[^_]ظe[^_]}/D$ 4D$D$400$BmUE fu%U ]fu%U ]ø]ÐUWVS{@EЃϋ}Ѓ׃|$d)hED$t1Ƀ ~ |$t9|$tT$l $7]ljD$hzD$tD$`M4OE|$tQ9sT$l|$tE9~D$`4D$h|$th|tT$`|$tD$hHL$lD$_L$l)Ɖt$PT$`T$lD$h$\$T$le E D$HD$hHCT$`$D$D$h$"g\$lD$lT$pD$T|$HL$P4t$0t}D$`D$D$D$t$!PD$tD$D$h$V|D$lP1D$DD$d T$`D$t$ND$HT$`L$`A|$49g)lj|$t|$8D$`)DŽ$D$\D$D$t$RD$t}t$tFD$zPƋD$dD$\rD$0=P}ST$LD$4D$tD$8ЉD$8|$PE@9E  D$8D$LD$\D$0D$`u؋\$TKD$tD$HEЉD$DT$lD$d)D$8D$LD$,‹|$4)T$\t$`$t$LD$tL$8Ήt$8D$4t$tt$D$H$YQD$H#L$hL$$OD$tL$h $LD$tD$h)t$4t$D$H$ SD$H+L$l95vB<9tD$< |$PE@9E D$8D$LD$d|$HG$KKWx q tftD$$IRD$d~D$<؋t$lL$dD$D$h$RD$hL$tL$$SuL$dfD$hx,D$<D$DD$l1D$< ezfu D$tSD$dƒ80tND$<؃\$TD$TT$XD$$-@D$(D$<أD$$wi؋D$8XVH؄tJuU tu ؃[^_]11US蘼]EHP$C[]UWVSD]&Eċ] CE}9G{}ELM܋uűUDE0EH1EЉE9uEEEEEgEU؉Ӊ1ۉMԉ]؋1ۉEE+M]+M]؃EEN9}s] }uAG9Es0uV+E)‰؍M9tGz q s7u/u(UE$]UBEUE다fuuJ z Mq ffUWVS<E 8Ex0E }Uxx}؉EԋE@EA…uA…t v0uAE)Ɖ9ME܉pE)E؉p$] )ƋE 9m1E ]9XE pE9)9E @ E؉$]S ]A"P0[^_]Ë](EbNF10[^_]ʋu< ǀ0^0tʋu<ɉMEJE?$]j E@@E}؉8E @}]@"b?)։Ut$E؉$]DžUt(N}#bUt$E؉$]puU3]K 8 t 9u~2U)49t$W0T$D$ $Du1[^_]Í~ u u 9}t$O0L$D$ $u뺋}}z1HUWVS0}F}u D$(D$<$\$ D$ T$$D$T$D$,D$4$c\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVSx|AEM]E TsCD9sϥ9r)؃L9s&)D$D$ $]7 [^_]UVSEPXM 9} u#9r1[^]Í~M t09tݸ[^]UVS{wl0)ˉލ, u썊a)ˉލ, u썊A)ˉލ, u[^]UWVSU} EZ]9BB[^_]ÍBEuLMuttb )E^M9uUM ЉFCU9rߋUM})}Lt% 9bE9rE})} E)B>[^_]ÉB$MUVS!zUBJT19r & 9st9sEE$Ɖ[^]ffffUWVS yÆDp7} w+L M4tetB-$G2E$RvƋEFEFuFF [^_]úMUEL )ȉE w|-$F"t-$F|UWVSxmut"F w"Dp7u&L 4[^_]É4$}[^_]-$UeFN?L 4tU$CF[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɉu}u܋EDEd}EUƉ׉1u}D9Mlj t"E9C~$E}|C؃[^_]É؃[^_]ËC$2tKSx s stftE$]u2uʉE$Efx s UE=w5=w=w=?v=]1x@u ]Ã]Ã]U$7t UP@]UWVSM CFM9r}ыU܋]9rB+M uUEPE$E$[^_]å9sܥ9rչUWVS}u F_)u)ODT9s290tۃ[^_]UWVS0u] C~)u:NDT9x9t] sމÿx1F$E؅3x F~}ЍUȍtu܍suStuquԉu}11Ẻ] E]EEK1ۋ@1))ڃ1EEʉHM9MrÉu}E̋] {}̉)ك9 }ω}uΉuu9]Mu}EA1)EU1USE9r׋EM܃})}ωuʋ}) t}؉GE؃0[^_]$UE؅t@@E؃0[^_]ù9u9ur }ω1UWVSEx|$Pt~^$2 )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS $ƅtc] %t D$ED$uDD$$&T$V ~tbM5)NjE8e[^_]ÍD$$T$tI ) |$T$~V~u-2MD$=)딋|$UEM Q tJu]UWVSyl>yutD$E $wDžD$D$4$E4ptt ʃ9t*xD$4$t|E%=at`fx ttpu ffx fp@sP$wP,ֲP(·P Ĕ[^_]H)1Ĕ[^_]ÍD$ 8D$D$E1$#)1(O1USjÿwE UD$T$ D$E$[]UWVSjÄwutFD$4$-nx$P8D$4$6[^_]É4$Aڍ0D$ ,8D$D$=<1$"UVS3jvut&nxP[^]É4$[^]Í0D$ 8D$D$I<1$>"ffUWVSiÆvu\1$!fUWVShfuuf~ D$4$F0ǀǀ F 1F t V$ЅxF F0tN@9t $mF0${mF0ǀǀD$4$FFF [^_]ÿF tF$mp4$_D0D$ @8D$D$8|1$D% fff̀rS[t[UVS"gsut8F0u ǀ4$uAnP[^]Í0D$ H8D$D$;1$뜸fffffUVSfWsut%V 1f t[^]É4$)[^]Í0D$ P8D$D$;1$UWVS&fru'`7FF <ufJ.t&fF FF uwFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $jF0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$3,e=<1ɋ8tBD$D$ N|$\$4$I y8t6D$D$ ~D$L$4$W8t6D$D$ VL$\$4$W8t6D$D$ V\$D$4$w?O8t6D$D$ NT$D$4$3_8t6D$D$ ^D$L$4$W8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$ku7O1$[^_]Ë@O58,UVS 7]iEU uMtTp4u 1 [^]D$D$4$f-u"udž0UWVS\iƋ4D$D$4$ -EtE$aGu͋$atMtf~ 18t$a9⋎t $p$4$\auu&E[^_]U98}]EUWVS[^h]tCƉ$`[^_]þUWVSY[hljUD$@$N\:ƋUu 1[^_]ËOD$M$\…1]~˃Mt|tatOt=t+tt9EGX<tE[^],[^]UWVSQK^} D$$cRƅǀM]8bL$ ED$|$]$"mF8FF F FFFF4- ~D1 󫍾󫍕xT$E$豃]~^ $]F]Um]StV4EHt }Gu]Stt LV1v4s$≕@DDDHN F$D$ D$ IL$4$葷BF0F(LN,NV<~$Q9~s~]WEP IT$4$0}M1Q\$E$KT$ ML$|$}<$$ ÉX TUMQ D$t$$xËVnNNFVnNNFV n N N F V nNNFVnNNFVnNNFVnNNFVnNN F V!n"N#N$F$V%n&N'N(F(V)n*N+N,F,V-n.N/N0F0V1n2N3N4F4V5n6N7N8F8V9n:N;N<F<V=n>N?N@F@VAnBNCFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Z1=x>alV]D$ <$ ;F@7NF(șdž‰Dž=N V DDTNꉖD$ T$D$8$]EP D$4$0}4dž$$$/G>pX5P܏x H NXePp[^_]ÿO$J4$0O81Ë-ftT$ ML$|$}<$48녋%8" 8F8FF F FFFF4- ~D1 󫍾1$F~ jM<811! 8ED$4$Bdž08!81UWVS$GÒTuF(x~(V0!UN9F9MUD$N $HMUF($N 9} TDTDF F,9sF0 F,|$}|$4$蠸$[^_]ÉUUE$CEEtlE܋UT$ML$E$ME)UЉL$D$$M $LEUVU(_US]ED$U $ #C,9C(}#C0[]fffUVS 2FREpFtD$D$$F u  [^]UWVSEÎRE0LHPH THxP@X~t=i`TIX=DHD$$$ FƅǀXHdž$$AljFXDt dž w^GGG G Gj5G9GE UtAtCFt$It$ 4$zI1 XxD$ ED$E D$E$XE EuM L dždž QXPtt!ЋPDPP9X1XA1T=+ff]fXD$ L$D$$ 4D$D$$Rfxuu fx!D$D$$E t @E@t Ey [^_]=1DžT1qDžPDžLZqDžXDžTcqPDžXZT t$ T$T$$D$$ 8D$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$D$PT$$XxD$$( X%=3D$`D$$ q` =b1щX`abcddefghhijkllmnoppqrsttuvw `b1uYduPh=w=u8t_u+X Љ lpOX ZqqFT¡T$ p8T$D$)2$TUWVS$}=BJEpFtD$D$$FUED$E D$4$MiDžEtwD$D$ED$D$ D$|$4$ !@uFЃ$[^_]ÉED$D$$CUЃ$[^_]D$D$$Ѓ$[^_]ZUWVS]<"IuE U VfFFVVfFFVV f F F V V fFFfFFfFF=*F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\N"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]ÍۡD$ |8D$D$b02$F xUWVS :FuE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\NɉHɉH@tH ɉH H ɉH "B9uȋF wۡD$ |8D$D$b02$F ƒv1UWVS(7íDEpFtD$D$$QFE  D$D$$譺Eb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$蒼$u 1([^_]UWVS6ÈC}wFtD$D$$,FD$<$tr$'tcFt$;t$;t$;E4$;<$;E$[^_]øUS 5þBE9ErD$E D$E$ []M|UEtu]11ɍT9r]1]fUVS5ZBUE X81rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS44vAu|E@Et M 9H 1MEEEEEEMP}GA у@0fuft utpfu{Uzu@G GGBPWxG8GBWO ME9Oft DAfEtD$D$ E܉D$L$4$VEE@Ex#} EHU ꋀEUEMƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$|3E.E@ D$$[3UBct MMU Q AUuth}OAMOMW:D$UT$D$ M L$D$E$}E4[^_]Ë}GMOUW:D$ML$D$ U T$D$E$赓E ]M؉0fufE@E܃!‹EHM<E0E@}IE@wD$ 8D$D$T2$|Ex QD$щT$ |$D$E$* E@E܉413'U܍D$ 8D$D$T2$OUB$D5USEP M TH}[]UWVS}/F<E}9UNFt%O L$D$$]UF$4FA4$]4E9t-F uFtUt NuM u6E9u1[^_]D$L$ D$FD$<$]萔tUSUE @@ @HKYXBP[]ffffffUWVS A.;}ED$E @D$E$t7ƅt|$$t [^_]84$f8UWVSD-Ë:uE 8‹E1lt$D$ D$D$<$+=5DžDžDžDžD$D$$<$$ƃtI<$D$D$4$tntD$4$itSD$D$$E+uqD[^_]Í܆$>X<8D$D$$4$8?rUWVSl,8E EċEE8EEEpFtD$D$$QF #}&Et&u}U+rl[^_]ËEċP}O9 E&D$D$$\DžFfN @EW)‰UEċ@UB 9EGfFED$EĉD$4$LJbfdž~ f}EF(EċP}O9E}9rY|$ED$4$赉EEEEȉEE@EME؉EEċ@E9s]|$EĉD$4$\:EEEEȉEEċ@EME@Eă9EЉEJ}.D$FD$$蛬DžFfEEGdžD$|$$謮ẺD$EĉD$4$%UljEjEf}}?}EEEċPMQ GO)MJ9MsLED$T$UT$ML$ EĉD$|$4$<}  1=f9Ms(UɋU)ɉL$DWD$DW$_UfGG)fGUfDWMċAE@BEB AD$D$$U UBD$D$MċUQ$F(tu 9Fcu4WwGu"f}udžfdžD$|$$Ҭ  YEED$ |$EĉD$4$91D$|$$腬aD$|$$b>E>}GD$D$4$hR1E=B҃9=FED$EĉD$4$聃~ f}t f}f~ }fFf;EfFdžG=w~҃E9džEfmMUۡD$ 8D$D$b02$MU?eUčۡD$ 8D$D$b02$UMUMۡD$ 8D$D$b02${UMkffUWVS0$1EUE@(tEpLB< _Gx ZU)ىL$D$$]Ćf}Ufz|rrEXft)ۍLZ]f9sf]f9u]t^JWf+Eft" F]Ff9sf9ufjE@(u 10[^_]èuE9PuP9Us݃UfBыM:9yI;MMA(  UEfEUED$D$D$D$ D$ED$E$]y~UYDMUD D$E$]較tՋUMOMUG D$E$]菃t_MUUE]䍋ۡL$ 8L$D$b02 $UEkE 1Et8UUEfEED$E D$E$]qUB=wbF9EEu!BB=^ƃ9EUEfE^EH(U]䍃ۡD$ 8D$D$b02$ƃ9EUzUUEfEED$E D$E$]~UE,2BLU1ۉ\$D$E$]UƅEfEED$E D$E$~UE@(EUUB(1ɉL$t$$]KUEMAEfAUUEfEEE D$D$D$D$ D$ED$E$]{UUD$D$E$]VƅE@U=UUEfEED$E D$E$]|Ut]U1D$t$E$]9UU]䍃ۡD$ 8D$D$b02$UjE@(E|EH(EH(]䍃ۡD$ 8D$D$b02$xUU1҉T$t$E$]}UUWVS Ú+}u FuIFu 1 [^_]D$D$$ӡtYVPD$D$$ D$D$$蛡t!VPD$D$$գ|{UWVS0&*ljU܃,E싗E9BD$BUD$$ƅUBfEHMTFEDtU D$<$N~UF=w?uj>t$<$ut$<$;0[^_]ÉU썃ۡD$ 8D$D$b02$~UE EF )‰T$L$Eȉ$(EfEfFEDFfENUBft?ЍDVEȉMU؉uuMf9sfUf9uMU؋uԍLQF=f+Eft2Auu}}Af9sf9uu}fnD$t$$襡E܃8tRE܉D$<$t#fFfFF 묋E܉D$<$WnD$D$$51QD$t$$1UM䍃ۡD$ 8D$D$b02$UMUWVS@8'}EpFtD$D$$螠F pt>tȃ@[^_]F(tިȃ@[^_]1EE䍃ۡE؍8EԉuED$E D$E$FƅEM}$f9t$E D$<$hwFD$ ED$E D$<$ E@  V=vE܉UE؉D$ EԉD$D$b02 $1E܋Uf9b~E@M=HfNfTf}܉u |$t$E$v,GD$ ED$t$E$GGHfuIfGE@=UEOfO`D$FD$$Dž@=FD$ |$D$4$G=@MD$|$$ҝMYD$ED$$话4=jU 1ɉȃ@[^_]ÉM썃ۡD$ 8D$D$b02$MKD$|$$"띍ۡD$ 8D$D$b02$D$ED$E$ڜNuG}1f;}uD$|$$蘜FEčMML$D$4$ CN9|fEۡ}Ѝ8}̉ωщ>9RAEȅ,D$L$M<$F,EE9NjM@9ED$L$M$ʛEE9ƋMTFD$FD$$6FEQvMԉE؋EЉD$ ẺD$D$b02$MԋEAۡD$ 8D$D$b02$D$ED$$hD$T$$ӚD$FD$$`Dž5ۡD$ 8D$D$b02$AF8@xf}܋98}fxXDy|8f@D$L$$D$|$$蒗1jmЃ}uf}D$L$$躙D$EȉD$$G!VFۡD$ 8D$D$b02$9/}suuD$D$$(e5D$L$<$ED$EĉD$4$h?[F,E׉J9OMUD$|$$蓘U싲1M91D$T$U4$bEM9΋U;EFD$FD$$ɕ…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$${D$ED$$Dž@=wU܍ۡD$ 8D$D$b02$UBU`fU܉1D$|$U$1҉T$ED$U$oDžUA։ffffff1̀ffff ̀rS[ô[UVS×ut5D$D$ D$ED$4$Ot6E[^]ÍD$ 8D$D$5|2$럸fffffffUWVS>UE pu8lE1ptEuAx=EGu4Ѐ:U)hx9׉drD$/$t)1lU+Ĭ[^_]Ëdr 9d`%$>F 9dgƀ>Xt։`dD$ h)D$|$`$Jpd9r9>/utD$$d"B/|%=@dt~{8u)сS?hD$ 8D$D$C2$hM+X\pD$E  D$\$8Xh9Ƌ` 9d)@u08p9hD$d$输u6Et)D$\$@JltD$\$@.89d`iSfffffffUWVS yEu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfRfUVS   4$D$$D$F $? [^]UWVS Ó}$W$W#1$WD$$D$<$x?t$<$> [^_]USW  $X[]US,1 EEVEEED$D$ED$ ED$D$E$t}u E,[]ø,[]US q $[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EU܉EEE̋UUUUĉM؋EEȋMMЉ}MUE te kE2-byEnd 3Eexpau֋Uĉ|]11 É]1uM1EMEu1]1 M1ΉMˉ]1uԋM1]1 Ήu1U1ىu؋uU1M1 }11Ήu11 Ɖu1UډU1ЉUE]؍E11 4u11E1]؋Eԍ8M1щM1 :]1؉]1ωE̋E}NjU1]1 1Ӊ]1m}uuUċ|UexpaUnd 3SUԁ2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C(8w68)|>)1ɃtfTȪLB@t@L>))t 19r\$4$)ߺ81tfff녪gf uhuW6ЃE1U U9rU6DfFf\7Ef렉ȪUWVSӉMp x$?tn@)։u|(9uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$G W$@9ue?Mt)ʍx(5tftM1H X$[^_]Ã}?$x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S+B,hB0kAB4كB8y!~B<[zP1uUuFu-u%BHBLB@BD[_]êftэt&f볪UWVSr \uFPEVẺUЋFV EԉU؋FVEUFVTXF V$N(^,M]N0^4x|N8^<`d^PP:}܃L}쉽HEĉUH]ux|]ċuȉ]u]u]ĉuȋ]ԋu؉]u]̋uЉ]ԉu؉ẺUЋE HE @GEU$T$\ Ɖ׋PSE EċUȉEUMċ]ȉEU11ډEUMċ]ȉEU11ڋ]3{Mыx|!ω}M!Ήuu}]!ىMu!MM]3M3]`dEUű}Љ11ڋM̋]Љ11ډ`dEԋU3E3UM̋]Љ!Ɖp!։tEԋU؉ƋM]!Ήh!ډlpt3h3l`dTXu}M]PE}܋M]TXx|`d9LE܉UEPpp)|>Q1tft:7~Qo1uDuQ1s^tft\$4$;ߺp1uwuh"t䪃ުn.f0uGu8rуM1ɉUU9rUif둪ofUWVS ÉT$ʋp@xD)L$|P9L$t$KD$-D$/|$41s@{Ds@{DsCHSLTT$T$T$CPD$$T$D$,CPD$B|$D$؃D$T$ |$ָL$F&tftT$D$D$$is@{Ds@{D9T$rCHSLꀋD$9wT$ ovjBL$D$1T$L$L$$C@SDC@SD9ƉыL$rCHSL逋D$9uT$t<Ѝ{Pt$tft1C@SDC@SDsCHSLe[^_]frЋt$ru^zfD$u[u@L$D$tCP{QBffl$L$L$BKUMt U E]UWVS } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E"]UWVSg, } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUUʋE ]fffffffUVS诳t EDžDž<|<s,>z DE5N ?=' ==D$D$D$D$ D$t$$&D$D$D$ 0D$T$4$轼tp0[^]=t*=uy늸۸ [^]ÍHúSu,t돃DuD$b$oo̸ XNDd :0&iDžDžDž D$D$D$ 0D$D$$l D$D$ 04$T$Pmz1vpDžDžDžD$D$D$ 0D$D$$ʺyPD$D$D$ 0D$T$4$G0[^]ødj낺FsGdD$D$D$D$ D$t$$"`&C0D$$0D$$h ~ m ^O@E3D$+*)(&%DžDžRDžDžm G6D$D$D$D$ D$t$$ /D$D$D$D$ D$t$$O D$D$D$D$ D$t$$ D$D$D$D$ D$t$o$BB DžDž DžD$D$D$ 0D$D$$t0 ><S,BD$D$D$D$ D$t$ޢ$1D$D$D$D$ D$t$Ƣ$Qup3fED$D$EЉD$ D$D$?$茰u}u tTE E E t UWVS ز x<$tt V6u譫c$Et+蕫t V6u<$sE [^_]kt V6uD$<$[sE [^_]US$i. t$[]EEED$D$ED$ D$D$E$"t u2D$ @D$D$A03$9] mUWVS踤} E U}0@DFƅtIFEM 9GJUD$F D$ $UBUtRFE VJE}9OT$T T$$GF]CE1[^_]ËM!@`B~ :MtEuVMQlj9~ MQT$L$ MQT$lj|$E$u;E]넍GD$|$ BD$F D$E$UME!@~ `UD$ $4tljGUL$$tMVJ}OUWVSϢÔ uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9rt% 9t 8t)؃[^_]ËE)[^_]UWVS]E xS9sHы0t/}U x9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS ^' E}E pE0EEE90EuNEU9sщL$MFD$E$]=D$t$$x&M)Mt2MVD$T$$]#ƅu [^_]1 [^_]ÉUt$E$]詢Et͋]E0U=UWVS(f+ E }}8}xEEE3UHD$D$E$%U)MMuE؉D$E$ƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$$1([^_]ø([^_]UWVSD }E pD$D$$U"tW@ u^JM"D$ED$$$"t&M)΋PUD$<$b9ur1[^_]ø[^_]D$D$$1$fffffff̀rS[D [̀rS[$ [US C EU D$T$D$ED$ED$ ED$E D$E$a []fffffS[î [.&f̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVS  tMƋuA~8t:F4@9s3`V8F4@9r$EF8[^_]ÉUWVS訜q E}}u8ENjE1txF8t1ɋ}E+wȁĘ[^_]ËF4E@E$]F88]E F4F0E|U1E} OxD$`|D$}|$ F8D$L$$]ɥUF8)UV4V0]UD$ D$`T$ $~4V81}׍ @rPu B8~8BX]9uE~t$]YF8]R9Ëtt]X8 t5UF8M]kX8F8$YX8F8M$]GF8tgD$`|T$|$ D$xD$E$=uUN8]Wt?]W{]xUWVS<̙Ñ EE M8‹E1%;E = 9ƅDƅdHD$$ BƅC8DžD > BD$4$)D$ |$t$$Ƅ=D)VD$D$$W>Ɖ׉Ug 8X9;-D$BD$d$诺D$D$$菺 {tD$D$$Ot T"U+ <[^_]Á}@ Džh1Dždd <$D$`D$D$ t$D$$ ~ 9WǸ։UD$ D$`T$ $!9_Q((1ɋx9zz11ɋ)Y99vЋu@8RщT9PuQ(9P(\n$tD$D$$訶t RR etD$dD$ $>tUt=6tftt\1Džp8H41`9t9F@FD$$Bu9;dt9FD$FD$$覵F D$ t$D$訴 tD$t$ $o9eu d3D$BD$d$ٴD$D$$@p8/tD$D$$蘳tOBDž.D$BD$d4$ 89:y``9_$*}d$>4$9HN8 t릃O4H4W0P0W8׉P8|tP ILP`9uM$=|tD$DD$$t_M?I‹uB8`9r勅9s$4`9u닅$V'$<gt{LtD$D$ $诰D$!<$`Nj@8@P1f^$;FU$;=D$S;,tLtD$D$ $m+_t΋$:iUWVSÅ <$ZE D$ ED$ED$E$MU EƉ<$Z[^_]US c( EU BJ  D$T$$ []UVS Ԙ utEىM)E}|$t$lj$UED$}|$4$UE<ML$|$E$UED$\$<$UED$\$E$UmED$|$E$UM܉]ZGu]E؋} 8MED$ED$ ED$E1uD$E$uMED$ED$ ED$1uD$E)ȉ$@ƋE]XQu]E)ًU)+U9xNuUT$ML$E$UUT$ED$E$UEEML$ED$4$Uut$ED$<$UuML$\$<$UML$\$}<$UU܉u 0sHuuʅ#ML$ED$E$U(EEED$|$E$UDu:}"MT3T$ @T$D$lt3$%:E aE T$ @T$D$mt3$9E 7Uq: UT$hD$ ED$E D$E$]fUVS 2 EU M9Mr/9r 4 9r$9fu49rL$T$$ [^]mfffffUWVS$рÖ lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$"AM1 ЋMu`EUD$ T$L$FD$$L;u<tVT$VT$$$Ѐf1$[^_]=UWVS« Ƌ; rEu =[t6CuudKStqPCS t[P ؃[^_]ËD$$胀Åt@C؃[^_]Éډiu1V룃T UWVS u xD$4$E%=D$($Džts@@@9uE ED$D$ EЋUԉ$T$5?EČ[^_]@<1Č[^_]UEU U U$]UVS)~ފ ]ts tWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D -D$ D$%D$3$ U D$E D$E$]UWVS.} E HMxPpt)rP@t3B E$h1[^_]ÃMt P@u͋MAUWVS,| }u ;VЃEljE@uyts;puXY LADTPPX Z O@H PWEuH@,[^_]ÉKE苏M1҉E܉UL$D$ $T$<1 ЋME܋UD$ T$ED$AMD$$VH9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA,[^_]É\ LoD i81o81~BEH M]8O1WUE PMt ʈP1]UVS@z ut PtH J H $u4$~1[^]UWVSyǷ uu #[tCtډu[^_]Ë$A[^_]fVSD$ L$t 8trtl@͉ .&vލ1΁ €t8u.t(8u!t8ut 8uHu1[^UVS yͅ U Et7Mt.ZYutD$D$ $E [^]UWVS xn } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Ku#ED$E$E܃ [^_]ËE+E15TEfH @jUWVS(w E܋})u UE XBE@ S]KE] :}Z]ru}_]ϋUfBfBKMʋE9s‰EЋutftE])XEUEUE @E)Ћ] Ct8E@ MY ]ϋUlu>}~}uC1([^_]É؁vD$|$$х~~)ËM IM)‹E PtEH,Pu>^E$]AE@ 9E\$ED$E@$EP,…EfH @HE1E‹]9sڋE@][}9Os9~‰ÉϋutftU]$]Uq)UU)UE @E)Ћ] CE[UJЃtUMEED$D$ }<$]e)EE9xsNMʋE9sBȋutftUE}8$])}UEHE9m1)yD$ED$E@$EP,…K)EMu9EPp)׋E 86p9rD$$]v]+SSUSCslj;C ЉϋutftE)P)UKUE$]1ɋU-[;Q]؋usStft]E)C=EE\D1$. *Í0D$ @D$D$G3$*u ]܍8D$ @D$D$H3$*yfvBvBfvEfXfvEf]>/i]+/ VUWVS0q} utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]0D$ $@D$D$V3$([UWVSpp5} utLD$4$F t$4$D$4$[^_]. Ơ-4$?$[>lj4$?[^_]ffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSnæ{ u`7t`F t4VtGF uuQFF1[^_]FF؉Fu(VfF u4$.t&;1뮋V0 t~@9t $sV0F FV륍0D$ 0@D$D$<4$\&DfffUWVSmÓz u}E Fft[xT$$<xEE%1= ‰UtIM VL=u*ֲ9F(uČ[^_]E Č[^_]ËE 千0D$ @D$D$,4$V%E 4DD$ @D$D$,4$!% TD$ @D$D$,4$$UWVS|tl9y u8E1F t)fF FCFFE+O|[^_]ÍED$ED$4$0EF u 9vEE$hk`8 P FUEFEuE f F vFft$t܋E f F Rߍ0D$ AD$D$|,4$#FfJD$ gD$D$@U$U U$EFD$ AD$D$,4$h"2p$辕XtUWVSiÐv Ɖ׋@0$7F0PEB;9EED$$;F0Pt$T$8$8F0PuD$E$];V0U:U쉂PF0ǀTu Xt$7[^_]ǀX\D$$:F0NjF0TXtXUhuu MDp7u]1҉]UWVShGu uDp78u [^_]ËF0$h6F0P9V09t'Pt($66[^_]ÃT1݉U9UPV0ǂT1UVSgât uDp7u[^]ËF0$5F0Tt$5[^]ǀP8$6F0Uig2t MU Dp7u]É]sUVS?gt uDp7u[^]ËF0$(5F0U t XtTt/$4[^]D$\$8F0ǀP8$"6F0UVS8fds 8E1EȉD$E$KU+u 8[^]fffffff̀rS[s [UVS"fr u tt$D$t,@E$[^]ÍD$ AD$D$9P4$5UWVS4eÂr D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"(#D$#ED$ t$|$D$($v D$$"8"L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]I"MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍D$ AD$D$Kh$(L$(=D$ AD$D$Mh$E"UWVSmc.p EU uM] $\$M] -}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVSbso u} 9vtGFfuUT$|$$)xFP^T[^_]ff [^_]ÍD$ PAD$D$Cx4$덍wD$ PAD$D$Ax4$X9vVD$ PAD$D$Bx4$%'UWVSaon u} 9vV Ft5ft\D$ D$D$$!Ѓt<V FfV fuUT$|$$?'[^_]ø8V F뱍D$ DAD$D$Vx4$2@wD$ DAD$D$Tx4$9vD$ DAD$D$Ux4$;UVSL`m u9vu`FftAȋED$ E UD$T$ $M!уN tFPVTfN [^]ù뻀fN [^]ÍD$ }1thcX|$ D$t$E D$L$T$ $7D$D$4$5D$t$$ &AljUED$ D$E D$E$4UWVS8GLT Eu}8E1>'cXT$ t$D$E D$D$|$ $7D$D$$u(u~5E+8[^_]:|$D$ D$D$4$D$t$$ t,JH󥋅D$ a7D$D$$ T:Aǃe$q…1A<+wLKuىD9u˃u뷃z럃b뇃Jl謋UED$ D$E D$E$R]UVSwN# t$ED$EȉD$4$UxE<[^]EӸ<[^].UVS<7DP uE EEEEEEN>w@ D̍ED$EȉD$4$x E<[^]ø<[^]USCiP :UT$$K[]{CDP -f̀ffff7̀rS[P [>̀rS[O [USCO D$D$ ED$E D$E$[]USBÕO ED$ ED$E D$E$+[]ff.&&$D$4̀D$̀fffffffT̀rS[O [PS[N [USBN Dp7u 8[]&[]f̀rS[äN [USAÈN $1[]UVSAaN t [^]É4$ ^uD1f1ø11GAN 1øUWVS<(AM  tse}1f1҉9r׃uF E̋ E fE؋ EЋE D$D$(Ẻ$U<[^_]f4…u"uB=f t4t$wuыB =uًB ΋B Ë t2 9s"8u +x 9rt {dƃ Uȍ|7D$ KD$D$X7$)UȋB7uD$ KD$D$X7$ UWVSg?0L D$,]\$`u }|$<]\$08D$Ë$1  D$`D$HD$ D$(D$,MD$D$<<%t2/D$(\$`|$H9s CD$`D$<D$<<%u΋D$1t$`@D$\ۉ\$PӉډÍ@L$LL$0\$0\$0D$Xu}D$X@tv1D$;\$0\$0D$Xu_D$X@tX1\$0\$0D$XuD$X@t 111D$;)1D$\D$`D$ EtK-E1ۋEx@Eƃxf t<$U ÃXsEEuʉ؃[^_]ÍD$ MD$D$:7$xfffffffH:JuUStu Zf9Xt 1[]1Zf9XuZ9XXJR9Pt ʋA9CuA9CuA 9C u1UWVSXy0>= ƉE8E1,Fu#E+X[^_]D$ D$ D$D$ t$E D$$ uL$:([^_]ÍF$~d ʈdGtD$$a닍F$E~GjD$ $,SD$ ;D$4$9tD$ D$4$uEO F $~GGD$"$諘D$pD$4$踦tjD$HD$4$蚦uXO@E܉D$ED$9$BOWL$T$8$#yO >D$OD$4$$t*D$ RD$4$ugOD$D$4$Хu O@D$5D$4$覥u OD$^D$4$|uZUm D$4$Xƒ?v?T$U؉t$E$|EUƄD$fD$4$uZE D$4$ƒ?v?T$U؉t$E($c|EUƄ(D$ oD$4$茤 D$zD$4$gu OWD$+*D$4$=5g)UVSTà $@Xt<|xEEE%EEEEMD$D$D$ D$ED$t$=}tT[^]UVS2 Et4D$E$'EEFEFЉT$L@$mLt׋$ˆL,D$ $L)&D$M7D$4$/ D$.4$HmD$D`$HDǀtǀxDž0Dž(<9$蓩D@Dt$D~DD$4$cu덃$T< tt< uDž0<4,LTDD|$@$0l<NFVe9xDw@ut;u㈕$<,t$$C<$t]TDLD 44 $4,LTDDDLD<ȅy_%=tdwL$,D$ $股L{;$1!$tDž0pvLusL@DDu|uc'z*D$D$J1ɉfLu LVfqUD$E$#]UWVSX> }u hl3 3 t;D$<$t  F FX[^_]Ë 9puttl|E*9EttIMD$D$ED$ D$D$t$OkBt  F F1X[^_]UWVSU E@ E~tE~mEX1&<1|1t_Bꀃ9E~E9Et=}ù{u֋ KJKJK J uv uꀃ9EE[^_]Ë OJOJO J uv uf̀rS[$ [UWVSd> TD$$]@$DžDžDžDžDžx@ N L$T$ VT$D$$艧\T$$w@ 9@ωփsUtfth@ lj)#Pd덋ptŋ t|$$vuf떋P04$@9‹(tft‰)@0DžuY tftlj)@4#tF4$R@9r1‹rf$Vu@ $]ś1d[^_]‹);Wh@ 1ffi$,t00P@~~ <9V) 9kVʉ)ȉQ1ҋ?tftH<@ lj)99h΃r뀍oD$ MD$D$d9$}x@ $r4$U@9>‹ytft‰)‰DžHtftR<lj)944$w@9`‹yUff^f# PD$3umuTk@ $f+ f넋$xp@ 6UVS ƀ7t$pw[^]ÍD$$}[^]UVS| ƀ7t$o[^]UM U]UVSk0 ut$v[^]ÍD$$B}[^]UVS ut$Yo[^]UWVSò u}t5W¸t[^_]ËF [^_]ÍD$ ND$D$|d9$UWVSn3 }uENH NHD$$<|ƅu!yH L$UT$@$ tEG D$GD$ GD$D$4$u4$*nG [^_]É4$ n[^_]ËG [^_]ÍD$ MD$D$d9$֎UWVS [ EC88  -:)lj}싓 u2E D$ $  [^_]Ít$E$lt$ $lt{ t1= ;txED$D$[luًED$ڮD$ED$ VD$9D$$ [^_]Í9D$ED$ VD$9D$$ [^_]ÍͮD$ pND$D$9$EED$SUWVS } ''w} )ƉT$U$tn  UT$ $_tG  D 1 [^_]ÿ'y qUWVS(Ǩ LJ LJ LJ  11ҍ VEE5 )Ћ  ڍAw ,ND>ЉD>]T>ӉT>lVMHL>@CD> C kTLTE֋ xzt =w ;NEt =w ;N tH~k LJ yM !؉ MeM썇v$  MLJ  M싗 1ɍN]MEUtwM<9ErMtu艷 Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>lV TLU;D> rU7UsD>HL>PD>HL> HU7Ë ; eLQH P H HLJ U MULJ D>UMD>ЉD>]T>lV T]ف9NLQLJ 롋 LJ LJ D>ЉD>]T>lVoMU -E8E䍇 $UMD$1ۀ} ËE)؉D$ VD$9D$$UMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@6UM^D>E싟 ]X] É %LJ LQ f gUUxz Mt ; r tXLQ H P H HU Ћ]!LJ  $$ffUWVS0M EЋ( u䋸0 }9EZuԍLYLWu썰 Xu؍Yu̍YEE]]EfD t1P}艗4 P0  8 5R}苗D < D$ $D < 돋$ uЋ Eԋu؋  À8 u }胇9u}U8 0 - E苐  -X U苂< }]苃 D$ D$ D$ $rL0 8 >E苀 P[^_]ø]苃 $K $Er…MtO1E0-},-E7LEDXtE7<$]~rƒ9r̉E8R1KU}8 MԈ }ԋ$ EU}ԉ+ E8 ЋD U< }Uċ:O,4 OŰU苂0 U9E2\9ËU)Ӊ]W(EUȉ0 ( XND]荃D$$!_E艘4  G,+UU]ȋU̍<Q9uUċ:,^MO uquF_ u؉G D$ $]Gt/U艂0 Uċ:MO u#O)ȉƋ_uGE荀:1uȉMȁ vE W18 M苹D < MċKщˋMD9UUċ]苃 $ WUuUȋ]苃 $hUE苸D }< M<4 ЋAE̅+}苇 $4 D < <EU‰ŰY9Q MỦ4 @D@Eȉ EăU2ŰEȋUЉEu艆0 EȋU}̋UUu艾0 fEЋ }ԋUM‰T$Uȉ$]MAYۋUBA ,Eǀ4 GEU<A,E苀4 E]~C]苃 $Xf]}8B} $}苇 D$ EȉD$D$D < UP$?a4 tU苚D < <AEE苐D U< }<4 Mč[^]-        Uպ U]U轺 U ]U襺n U ]萺Y  U|E U ]UWVSf' < u"$D uމ4$虿LJ< LJLJD LJ@ LJ0 LJ, LJ( LJ LJ 1[^_]US费y E$菶[]US葹V E D$E$蕻[]USg, E$˾[]øUS> D$ED$D$ VD$;D$$[]UVSï ut,D$4$XQff D$4$lQ[^]Í0D$ d[D$D$5;$pfffUVS r7 EpFtD$D$$=F!u  [^] vUWVS  uM.D$ ED$E D$E$腉Te>EDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$aqDžH V€ʀ UTPtD$ D$D$T$WыU !ȃP{vltat0<$T$~Dt01[^_]À Vt t0<$L  PxD$T$OP^E E DžTED$D$ D$D$$oDžt HƁ ZLsAs0E/s0 m Gj G:G a G G_ G[k GD$D$L$8PLPP LЃHtfD$PD$L$:H  D$ $PP D$돉Lq8PLen  P6D$T$NGP@ ƒ@ ud bb fffUWVS聳F }EpFtD$D$$8F p[  D$4$u_  t$ur  T$U4$Džu=U9B0E pp[^_]1UD$D$4$Mt̀N(UV$ED$E D$ T$L$M4$ !@MukF[^_]ËX[^_]F(V$tߋ9F(F$PD$D$$+7[^_]UWVS腱F EpFtD$D$$6FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$C !@MuFЃ[^_]úЃ[^_]ÉED$D$$6UЃ[^_]ÉLnUWVS$O }9EUEEEE;E MmG$Eu݋M…tUL$D$<$?UUD$ ED$}|$4$8u7}UcE;E sQ $[^_]Ɉ뤸$[^_]ÉT$$Xt㉇1UWVS(Ի uE䋆EMM܉;E E苷EHMU$CƃUtY9Euȋ})lj}苊U|$$舰U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$6u@EE9E 1([^_]D$ ED$ED$4$6l([^_]UWVS(聭J EU9}] E苊;M 9EE܋E9t<)t29ut&M\$U\$$] =MUD$ E܉D$L$M$U]5M9M Ut%E9s.E9hw1([^_]Á ([^_]É\$<$mDžUt([^_]UWVS(۸ EE] ;M sf]]9suE19r 9t[:u)ÈU]D$ E܉D$L$ME$]4uEFM9M Uu]1([^_]É)맋E ([^_]ø([^_]UWVS2 EU EpLB< D ?ZU )ىL$D$$]* f}U fz|rrE Xft)ۍLZu0f9sfuf09uut^JLB)wmft" F]Ff9sf9ufjE1[^_]ÉMU GD$E$] U M̉EU ]썋nL$ [L$D$; $+bEU UEU ]썋nL$ [L$D$; $aEU U E]썋ۡL$ [L$D$b < $aU EUWVS. D$T$$tb@D$T$U4$DžUu D$T$$h.[^_]D$T$$H.[^_]ÿUWVS 藨\ }EpFtD$D$$-Ftt88f [^_]ËE t9sF [^_]F(t‹tF$Pun$ 1 [^_]Ãtރ [^_]UWVSDƧË }wFtD$D$$/-F}   8CuD$4$D$ D$D$$nH F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$l;EtD[^_]ËMN$tD$ D$D$$G!уtD$T$$7;u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ_EE$D$ ẺD$EȉD$<$W3EԉEE؉ED$EĉD$$k‹E؃9tD$<${mD[^_]UWVS[ u~GtD$D$$*GD$4$G uUEu@t*$:]uU|$ $StUx?UWVS ů EE,E}1EED$ED$$]%ƅ@ @=fU1 9M rTVÃf;EuUMUfY]][]]}tH}t8MNDF,D$t$$]'E!D$DFD$ljU]荃ۡD$ [D$D$b <$ZU ]{_E}E9}twu})D$D$$]&9utAFD$FD$$]\$tVTP‹}u뙋u]^}8 [^_]ËEpE )}fG w [^_]fffffffUWVS$v uƉЉfMy} ~ϋX9U)ω\$D$M$]EfC 1U~U 93;DD"=. fLD$ E D$ƉD$$]`ËE XKMǍDUfTTQf[MfTftEff9؃0[^_]Ã9u}ԋGDC$GDM_=ƋC 9Ex}؍Oȅy¸} E PS$u}+D@=D$1]܍>fEEԉEf}eMfyvDTQ9.ED$E$E@EMU EHfEEf;E}f]fD M)lj}]U)؉EE|$L$E$]C9E U5]f{vDTS9szED$E$E@EMUEEHfEEf;9]tED$E$1MUEUԋMf9MsFfED$E D$uF D$t$ ED$ED$E$]ruOEEtE@EEEt5@EEESpEE@ =ufufČ[^_]fEEEE]D$ \D$D$8<$ AMt !EEfEE:M]D$ [D$D$S8<$@MgUWVS$ߔ Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$6ED$$Eu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$PR…t EME$EPEwD$ |$UDBD$4$Q tʋ@f8 $dž mDUWVS,u: uE xEFEEEE@ETGփ>VMM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$UU)UEftfDuf)tGfLGM yITGփVuJҋu9sM DG)fET$U܋UT$7$qU)UUPMf WfЍL)΁M wdftGuftGfWL$E$E*DEfEfDU܍nD$ @\D$D$y<$<M UaM nD$ @\D$D$<$<M VuM DGƃ=Fu!nu䍳@\uDG)fET$UUT$7$U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUt[u9s‰9E8Eu;p)E9pEfDN,[^_]1,[^_]fE D$E$E tˋxLUED$ E܉D$D$<$:UED$ E܉D$D$<$:nD$ @\D$D$<$:;D$ @\D$D$e<$Y:E@EnD$ @\D$D$k<$!: D$ @\D$D$b<$9FE)UWVSj3 EE @u E1Oft{DPND$ t$D$E$]fLƅt|$E$FfUH]uYfwfuf|Pu E]M IM1M AKEfE@ =\)ځɋ]fTKMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfAfAF^[^_]ÍD)wMfTAhU]썃nD$ 0\D$D$<$8E@ ] UfTK=UWVSH U EzMq uf+4GMM9U t$ED$DM$8u)uD$ U T$MDD$E$4J…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$袲Uu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVSI~ Eu} 'D$ D$DJD$4$]YItDPfzuft,ˍ< fD$ t$MDD$<$H aLJ(@f8u$LJ 1;D$ t$DHD$<$G…@ fEB@fE1fEE$#MAE9F ED$EFD$$OM1U)fUN fMD$ t$MDD$<$ G…ZM_LJ $LJ(14r9UWVS(w{< E։Mz@ =uW)ЉEN MMȉEGfEt$菀ED$$|UE D$ED$ D$t$$E9F ED$GFD$}E$E([^_]D$ t$DGD$E$E…t#M L$M $MEEvE8UVSu]ED$E$1ɋU Ct1[^]øUWVS(yÜ uD$E$1ɉE/D$ED$E$3EED$E$M fA fJE @EEE@E;EEHppfEHu7j/V1ZYtp%t0MPVZYMu}] EEAe[^_]Vh "hU "h-;UWVS]u 6+_h$"VS o tfuLp7-ۋ=P-)uZ=-u h$"Zt- -$"hj5-5- @u5-h$"jch Xu4'h$"jAMUW6ZYMtUBk `%u6h$"jVKSWh%PUWVS] 3 h5!#jvh5!#Sum@t h("P-DP-Zu-w$1--`%5-`%jjP4- y 5--e-=0 -v-u h("j-u#--("-`%-`%-%H%hPR3- yT-P-%H%hP5-ң- - y5-hUW$jl-w--u--u-H-uj-D--9ӡ--s-tá--t----- -t- -t-%h=`u; - ----%-RP5--P -t h("jh`-`h۫j%hj%1=-=-=--hh0 -P0 -V5--- t (-,- -$-9щss -- u15-5-5--P$ u15-5-Z- rPPhUW$WY[-u5j5-5-5--P  t5-hUW$XZ -------K-]-]-] --9Uu/9Eu*--ڣ-- -$-6esEUӣ-- --(-,--t1----j1=-=-XsE--EUMtH-L-EU-uRR? ----=ur=u=ۣu -t=- -9ȋ--s")1=-󪡘----- -t j[Z-5- tH -1=-󪡘---- - -)։-5- u-=-ujPY@u$8th("5--PZ@u h#j\|jxUWVSX ] 3zh5!#jIp h,"SuLg G-$%\-1L-(-X-T-1L-(-@P-z-L-1=(-YH-J15L-(-3D-$@-1ɉ L-(-<-8-4-0-,-=$-th?,"=Lp7tu hd,"jz1nuou-j,P{YZFt@jVf$-^Zu ht,"W8pj,WGZYt x>1>A!Ph,"h-Y jEP-4-=T-t t9h,"Buu/ H-t'h-"&=H-thG-"<-P-jW~X -ZYu hn-"y;O\-=D-t11X=$-uمtՋ=8-jWXY[^t' 9=\-tЃ=D-t ]tljti ȉ=8-\t 1Z01C PtjZP0Pt 1B" -~h u)Vc_Zu h-"j x15 -DRPוZYyƅu(3%=`ujƅu3i - PVY_= -i =@-t9PVYZt=0-Vh-"}=D-t%" r=0-ugh6$3h-" Qu =0-u7h6$V3h-" G= -=0-u3hUW$|XZ=X-t4011Dž8hha)%PV ,-5X-8i - 192t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t =T-u1&T- -=X-t50"; -si C1e[^_]USEEE EE0 [1҃vU|r҉-UEh1"RPj_ tvpt.Et?SuF-Ƀstxu0g-볡Lp7---Ph`%h- jEP-EE)ЉEEt9E8-u/-EH~P-)EEEHEj!1ۉ$:ZuYhxjXZjjY[hjXZh -Yt1h-h1"hXZh1"tHYh?j[X-Et^E8tTE04YtEEj0@YZyjZ,E8!tYEh0h-Z @Et9h-h1"ngYXE8tj/Zuh1"GXx*-tPhUW$Y[hx-"Xy"=-th-h#h- uY=-=-h-h1"fZYh1"#G1ۉ$Z&f%,-1-냋-| thr/"FXf%,-^1-#x(4x-PRRd tt 1j1ɉ -h-h1" f[Xh1"cF1$d=-ujpjZuh-5-h2"h-h-h#h- h-h1"eY[jaZn=-ujh-5-h2"h-~UWVSXu} 7nhˢ"膆YZu2" fuLp7h2"WV-[ utt P-)NvVE8}W\ZE1% tAB9EsEUPQMWr UuMt6QWh2"jYoփ빅u Wh2"AE@t1j URPyE ;F|E8tEph2"joE1~PS>YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmW4 UWEffEERhm+fEEERhmW 1!EPhm8@W x E%6Sho"j%nf9tfuPh2"EPsh3"KU1"#UK U83"U Tuuuuuh<3"U$uuuuuh\3"9uhz3", uh3"XZQURPW x%uSh3" ,URPW yShUW$j3mPh3"jjBUWVShu E1E1ۃ}~F8-tEh4"B_th4"PbZYu -h4"_th4"P8ZYu h4"{Xjh4"h4"֝!|EPq=uh5"d0`E_t<1ɉMMMMMMJh 5"{Lp7PuZYh+5"jkEhQ5"WE)PWE @}w}c}6to)}4E뷋Ed$H%}8tEKwn뎡Lp7Eh'5"5Lp7cVEXZjLp7E]EQEEP-P-}uCP-EuSP-4>tj@uY[t8P}t Uxu)NjMMU9rxtEE xt}t1ۋtP:Z\tSRXIEt'U)RPSMwSÃ~t C}u"h'5"h$EZYu ha5""}uEEuh-WuuEpEP茔uY yj=-y h|5"}tLjuVjhSJy h5"oXjVjh5-#y h5"oXh'5"親juVjpSjVjw5-,uy1ɉM̉MЉMԉM_1%H>v  DGu΍EPEPj =-t}t.D1}tE܈jEP4%/ GuEy ht"jhVh~f5-;Vh~fS/SMUEQ}u j uXZjzUE 0jalUVSEU J -uc1E1ۋ4%Vh.G#uU-H-Y^yhx-j *XZx-Px- Cu ^1e[^]ÍL$qUWVSQxq1%.%. %.$%.,%.8%.%.4%.(%. %.DžDžDž1|h ]"V9R @I&/0$%S'$(%1!-!-!-s!-d %.jP5Lp7 :uy5Lp7hw\"!-%. $.$%.8%. %.%.0%.14%4%h\"XC u,%.w(%.l%.Lp7j/SaY_Džu ;C3@;tGt@:t%tu@tj/[ZÅt8@tYt%@t3t@tij/iZYDžt+{tQt@tUt/{t@t)tG|h\"O%.Ph%.h%.h%.h\"5Lp7[uLp7<t h\"jzc=%.u%.fPh@%.PhD%.h\"5Lp7~!Lp7<u@%.D%.9sh\"뉅 @%.Lp7j/SY_t6PS_Zu#Lp7%=@u !-Lp7,.4%.!-!-Lp7<%.}5Lp7$+!-[=~ PZPh]"jBbP-)ѡ %.=$%.t 8%. 4%. ,%. %.tW=%.t t$h@]"4t=,%.t=%.uhr]"=%.t=!-uh]"I$.u !-iDžtDžxjjVjjtS9V@t,HYtjjVPjSV@t=!-!-=$.u/RP5_Zu%=u $.%. 8%. 4%.1 ,%.t1=<%.!-=$.uRjhh .PR4!-y'3 8uh .h]"'.Fƒt<t~'.wދN1ۉ ).).F 1ڣ).).>'.5).11h).@Ph).j N). ).É).).n@u"hZ"h).1ɉ ).[Ѓ<tπtʊt ȃ<uuutW119).).7).t19ƃƉDžDžf=<'.'.'.t P1#DžDžPŃw 1҃.1҉B'.t. Ҁ'.t"HuF'.1҉sBu ).).19}Et3t*pu!1ӉBDžDž,%.= %.t u$!-9).Ph^" %. %.tO %.5!-=%.|1RP1RPp h^"Zt=$.$.;8u h_"UX$.Ƌ@V=!-RPSQPvvv Wh!_"G [j XX%.1jhjjjщ¸c_"yX%.T%.1jhjjjщ¸}_"RT%.(P%.1jj?jjjщ¸_"+P%.h_"qO=!-Ijjjjj1ɉ=!-$tj !-W_h ).ƀ).$-#h ). ZY ).t ).1tFh ).h_"6[^h_"h_"%h -jdh ).6hR"ۋuw1ۉ4%. %.uY!-H=8%.= %.!-uÃ= %.uMh#`"YtpjhO`"wXZؙjjjjjщڸ{`":h_"tt Sh`"5^_1>'.@u >'.%. ,%. 4%.1}=%.$.Džt~ Džh`"'.Y=tk jhjjjщ¸`"Oƒti¶ f'.j).DP5=XZh`")Fjh$a"'. 11B'.tJ?tEWh2"F'.1ҋΉT 9u9u @u'.1;=). ).؀tet\Ph2"= ).1Ӌ Ɖ\ 9u9uGtDžDž19~JCWShDa"މD 9u9uG뮋y1RPjjjʉٸUa"3TƉV?f=<'.?'.%t%u ù19rGD8'.G'.%.11ۀt,'.t#u;u u@ $ut'.u돋5).).19}{.tK;tFȉ谿C219u9t'.A뢡,%. 8%. 4%. %.= %.uYhia"^=,%.t($. L$.t ha"[h b"YtM$.@$.2$.~ hEb"Z@$.~ hdb"xX&j񋅀Ɖ1ƃu h^"ϡ'.11;'.ÍPP耾ZYx+=w;)uvX%.=T%.5P%.jStPY 1eY[^_]aUWVS}] 1ɉ1Dž1hr"SW7 rfq1stwz1҉j P5Lp7ZLp7 8t :tPh|r"&78"[N5Lp7hr"jvKDž-DžP-)Ot6jhP6P2Ãy2 h).hedAP y hr"=J*.#9 #@fJ*.1ɋXu uXhr"!jh).hx-  tȸor"u5!#Phr"ZYDžfH*.h).fH*.h).-k~PSyhs"=jGu"PhwdS h$s"XS1e[^_]US] 3SuUS] 3SuUS] 3SuUWVS}1ɉ@j/E 0N[^+.t@E +.W ~ Ph"/XZ1 $11<8,(Dž4h_"u W:4à A6$%Dž,jhjjhLp7y"u/8jhjjjLp7Ձ"M//.jhjjjLp7"&//./.AjhjjjLp7w%. $jhjjjLp7"./.`jhjjjLp7>#$.ƃt @5Lp7h";.Y[Lp7/.jhjjhLp7#$E./.jhjjhLp7$./.jhjjhLp7"-/.jjjcjjLp7$$-!-jjjjjjLp7"-/.I@PhjjjLp7$-/. jjjjjLp7("b-4Lp71҉j PS-P< 8u 8t Sh<"h~"< )Sh<"hF"j FDž8Dž(P-)Ov9.< t5<@t<t# VHSh"DRP@Shޗ"$hd`\XTSh"購H 119t T@ܸ5!#t#PVShM"f=@.~yh'"PX1 =TRPhh"*G u"j 8Xt-h'"_ 9rj YShm"XZh"~Ph&r@ ~茕~z"uXl"~";"6 ,;..| (5. .9Ȼ&} VG9ƉS}M)Mt1jjs s M9ȃM} <&uXS)&t,;C|(s^C t"=ȅ.u!!>"=̅.t"=.t"h.5.Sh"j{jh"=ą.th"jn'=Ѕ.t3hhh"ƃ xjh"PrVSh"jQh.0.h&"Bj.h.j hH"[=ȅ.u=̅."" ""EE=.t Eh"E=.t k"=.t n"=.t w"=.t #=.t #6$ .PtPH1ɉ h{":jEPSn 0Shq"j0Sh""$ jjXZj%UWVS@u} E@h"WVg tTHth wT$`&ЁȀπÀ5Lp7+-X뫡Lp7|+-1ɉM똋P-)Ht&4jVhق"茵 tVhق"hW %j h..jVXZy VhUW$j| ]1uȉuԉufE5+-]S?SjWHyh"^jhyt Wߦ y8th"95|+-hCt W趦 yh"}tjjI'Y[t h"j1҉UUUUčEPXUWVS8]u 1E6XhC"VS x`At$M.ăa$,& ...+-2 #덡Lp7.!.v .k.`.U.JP-)Ӄ=.t=.t& . .t&= .utu@=.u7.+=.u =.t#u=.u. +-x-U1..hXUu hQ"j6=.tEPWjj11ҍE?1.tjh*"P蓨[Xu5.hUW$j1ɉ .jjh.jVÃt;tMdLSZV{X"4~FM3LK1=.e[^_]UWVSE pd.EX1=\.h"8PzZYu \.'h "P衲ZYu T.jݛ.F.9TM.h ̠Kl5d.h "PBu ._"=.tU #P_tPLDX~5+u!zt~Kh%WZYt WKCuBCt FCh"H._t8u%h"H.PAZYt H.>#h"D.PY_t D."1=X.tjh"_Z~PvjK =.u&j2PYujj=.t. T.ujh"UXZ5jaj^_=.uh#5S-蜰Y[uZ~jh"sUj,]5.7脊Ztj]pl.p.Bu@tD.t.6u΃=x.t$H~ 1x.=8.u @.= .~jh'"'STj 2O jOkWj|\UWVS]u 6b$l.uGh.$t.p.h'#P| uT.VS[^~1j蟘Y1uhf(#j9~!vu0.h(#VS u%/~k |Љ=X.vhz(#EXZšP-)Kutm0-DPu^SȬ_=vhh(#hSh . ;tCp. .5X.h(#j ]S9h@j}h@jqh@jeh@jY S腩^u h&#jn@uh&#jhx-h(#) u W-d.螽h"脴[=L.t"5\W-Yt5\W-h(#j1t Ph(#j=L.u5\W-袲Zu€= .t8jj5. y h(#*Pj5.t xh.j@.. @.%L.%@.%D.f`.. f^.X.華h.&h.&h.u&h1jҷY(#=T.tM(#PhUW$謝qVx.^_C6f=\X-t jBa[蔮E8W-utfEڃ=T.u*t{8,X-u1f=X-X-< t< uG< t< uMjEP5.蠱 f=Y-{5!#} u"P_8W-uEE5W-P[ZYf=X-tCۡ0-t (-fEjEP5. f=Y-uEP}X-he#jUWVS E 0̦.W1.T.h+-#&Y[t *-#3-#hI-#&ZtTMBugLp78tpjRPo :uS1ҋ .buV.. .ht.#u uà uC$J&5Lp7ha-#..먃 .륃 .뜃 .듺{-#Lp7낃 .vLp7u#h~-#h$K&h0W .h-#S^_À;1h-#SZYƿ@K&t&VRS- u <2t&h·%S^_SPh-#蒓 . G.O3u8=eRh-# 8=tRh-#RY[\3h·%S^ZƋtt ug(S趦YS@ZhǾ"4jPS^‹ 3 9r(<,tuxG .QRh-#SV7h.#萒~u5Lp7uh<.#hK&hKh,#訯1k$ .t!VPZYu ..yGhK.#VhN.# j\Lp7 .I=P-u). uA~=.u,PܚY@u h.#j .#c..Z!Ãt~@K&t%Ft!á.0Rh.#]  s.0h.#>XZ s.0h.#%_Xt Sh/#[^j uh-/#tthQ/#ݐjE uC.3hR=ǃ u R3ho"xPhP: tlj=..t $#1 &:%.hPW苽. uR5.h/#j8 h.PjZY@u5.h/#.t&h.P_u_.05.h/#j .=.t8.8th.PY.u$߃8u5.h/#jx =.uh 0#h4K&h0hjs蛼T. u sh%0#hX.P膎_Z@u shD0#`.%=tE.Bt,=@t she0#\5T.T.Y sh0#7CP..5.h0#]._Ztpp 0h0#@ .uB`.%5!#=@u,#-#uP.u-#RPh0# .t Ph1#ܔY[..th.P Z-#8th.P_$-##Nu@u h.1#jh.P^o"u RhX1#(.%=u5.C[@u5.hv1#@ 5.袻Y@u 5.h1#T.tP聻Z@u5P.h1#j^jzUWVS}u 1ۃ~^;-tP-11ɉ<8Dž4h=#VW2 it1҉4Y-t+:t!;B uBuLp7B뵃Pr5σitot8DuFDž<늅u Lp7{Sh8$h=#_ cDž8Tu#dx1jSVxCtjjj9ǃuh%VhiP踒 @u h7=#jWYY-7tvFtjNt^HuTHItBQIZ.0QHXɋ0u hF=#jW돃넃8t4t<t]j]UWVS$u] 3_h5!#j. hA#SV3 Btb$DM&jj5Lp7l.|..p....s|.dx.Up.t.vBeR0G.f"$M&H $N&a...G.1..a.1. .?.1.1."..1..1=.....P-)Ӄ.=.t*thB#. . .tbh C#jt3=.||=.t=||)=.||| Dž|4` .j .P Cx<hSh]-k=v ShMC#<h]-Y]-]-X/tK]-]-1h jXZ=.t.Ph]-,x/uP]-@]-= ]-wPh]-Y_@u\8Uxt)o%=@xtbK=.u=.t. .t P6rP6_Z@u6hUW$jh%=@t /t 1ɉt4h]-h_C#j . .tDžt Džtt$P蒒ZPvЀ8/uj|V>x 1lpupCpQh]-^Zh]-CHfuFs $Psho"G~pDžlpxmXu$wfushuC#~Y[ftf tt)]-C,-]-=~TSh]-hC#} o{DsC(huTttCpj/Vv:YZpt)xph">PYZphp>h)8/t z/t/Bс]-vPh]-hC#} VPRpp]- ]-= ]-vx/uP]-@ߋp=.xt Ph]-) Ph]-^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh]-hC#L|CP@% =@B%=@t,M1@ush]-hC#1Jp΁@tpw `~||t {DPS`ZY/sH . .u&fNush/D#F{Y^jSx*f5.V..lhOD#hDN&h6tCPph]-芬^X=.h]-shI"} E%=@t.%fuL=.u%.H..yhwD#hj/W6YZtxh%WG_Zu^h5!#VS @uiP-)Ãu]p0vZY@u jj{je;LtEPtIFu'/h"G#VSt w~fw$LN&1// /1////1 / /t/e/VP-4)Ã= /t/-=/t,/=1=/=/u /1ɉ /ttu#H%V1ɋP|=/xt)SW}YZuE%=u dSWXZt WhUW$jE%=@9t? ÃStUWVSu 6h5!#jjЉÁp1thl%Vus tVmtDžtptc5Lp7ȋXu5Lp7hB#jhWMpW 딡P-7hUW$ߋ^Xt!DžtpS]ZY_yɾߋuڋtV-rUWVS}] 3,h5!#j hI#SW tUit)ft5huP/σvu?/1//15//뗡P-)ǃy4j>s/h# j =/tuϋVPFTtP2l pY[uNj|%=@luh2lQà =lv2hI#jltx/tlƄ/CGh>W ZD>8/u 9tH@j/W,0ZYtPRdՆY dvWhI# sXZ"@PRl:z t DžphfppUWVS@] 3 У0-SuN]Sj9uEUEUSjR^_Sj9ZYuEUEUSj.^_Sj9ZYuEUEUSj _XSj`9Y^uEUEUSjXZhCi#z0ԣ01=أ0=ܣ0=0ԣ0P]1E؍}ȹEZ uVSj=xVSj- x"}ujVj y}tVSj xjVj y}tVSj˓ xjVj踓 y{}tVSj蠓 xjVj荓 yP}tEVSj n y1jVj[ yVSjI xLy y0hKi#0j谖 ^=e-tUjhH%ĝe-[^y hki#0ju0 #=e-u=xe-t @hЦ"Yt8u`."V躃ZÅt @|/tCP̣0_uhi#j0ZYtlj؍Pȣ0/h/*h{: jie- t! ttBGuB@9=/t hi#j=e-ue-F t 00e[^_]UWVS]u 6ch5!#j2 1hJT$VS5 tLtPt9P-t~hMv#._8/u|hs#P3XY^ukhh#S"X_ZuZPSY^@tHxPhH%i_Z@t2|9u;xuM9 u;EtjjhDY^uj SӖhx-.cXZ-@t h("j j%kUWVS}] 3$h5!#j 1hJt#SW ft]/WPtwR)d0벃vtbit6rtxu{Ĥ0ܤ01ؤ0p1ܤ0ؤ0ZԤ0K̤0<Ȥ0-P-9=ܤ0諓zu8QuthTt##lXt0؋Ht ʉA?jjФ0[ܤ0 ؤ0u t1=Ȥ0t =Ĥ0t@jPWǃ uhtt#C =ܤ0t.u)WXCHHf $T&PDs Psho"j%=ܤ0tC ?ƒuts Psho"j0k=ܤ0^KPSCđHjSW[C 1ɉK +C  Cu>S=ܤ0tCHSftYwifu`KPC_us+Z=ܤ0u&shUW$0Y[R蟍8XC=Ԥ0us襾ZuH1Htm=ܤ0ta8VS8?HE8r5̤0 0$10sRX 8t hB#jWZ[hxVSZYu8=Ȥ0tCj PSho"2i0_u=Ȥ0EE%=@uB=0uSht#h0Y[묃=ܤ0t'E%=u,S蠗B=ܤ0u=tىډ薏uh=@uS]=Ԥ0u SZtX轐t1=ܤ0uShUW$^Ƌ8 踋8?誋8u=̤0SȐX501e1e[^_]UVS@jj虈^X1EĉEȉEEjEPjߓ gpP¸9u 9E0j j=Y[0H 0jB0$5!#jxZYh#Vg-1ۉ]$h 0m^Zԥ0tt3Hu:0.\0X01|0E (00ԥ0t.U=f-v=X0i`=ԥ0tEPEX1Х0̥0tA:g-HyP1Xg-H J hg-ǩXpEHmإ0 0\0X0pʬEPDXu uvWXZu u蟶Y[}um=g-t,Eh#vA^E=0u PEuE=f-u}rEj @^=f-'7=0u踵h" [uY&jh #Pj7FÃP@$CY|=Vg-uL=0uCEPC$#賷Zu EPDX8tEP$@XEd01ۀ=ng-t$=|0uEPaCX|0ng-u'j4HY&œ^XC̈́RPZY=ng-=|04f-d050豦h"$$g-觧XUWVSpE 0Quh5!#j 1ۉ]T- 1P-] ;E9h#WֈZYEW[w_9Euph#Su tZftatDeuI렃gu=j5Lp7讐EZYz5Lp7hUW$jb^P-E ]SubZYy h#yEPhBt @ui y h#@X}Whht@ui y hʔ#XEPht@ui y hՔ#Xt$FvE 8uVEPuWSS|^1ɉMME 8URu V&YZURVYZuURV^ZuoE 00-DPt"VťPS{VS֜E9jh#Vv uVSGEZYVhב#aE E}tSjuq y h"j}t WhgtuJh y h#Xj^UWVSu 6rh5!#jxeس0 xoܳ011ɉhdt`p11ۉljhh-h#Vu譽lRtf(LtntMH1һ뮃PthtPdtXfuyDž`뇃vuhDžds=Lp7hDžpYMDžt@Džh1 P-E)t 4Hubuppt uY00t00pt$t*tt h#j t)00>=ܳ0tzj:W`KYZt@0j.W,YZlt!h0W*_Z@lu B>t0<#uy$0h0WH*ZY@u ۉ8xPWZY@u WhB#j=ܳ0tE0E0jSVǃ 1uhB#>pu jSW W许X CHHf wg$8p&s Psho"/^Džl=s Psho"^ttDžl Džl0ht)KPt;Qu0t;Au A<50RslЃ t"`ushUW$Y[dsZـ8t hB#jZVwZUWVSu f40H0茙 00 ʈ00D0P00 ʈ00@0ܘ10%0f60<0h+-#[tlh#Y r&t7GtPSrYZu ShA#WhR#j;1h#Vu A6$p&l0%0\0 h0d0X0=Lp7h"W]qYZuh`#WEqYZ;=Lp7N.j j5Lp7Uǃ u~8"u 5Lp7hc#D=D0j j5Lp7Uǃ t =H0~8"u5Lp7h|#jj j5Lp7lUǃ ue~8"t=05Lp7h#뺸Y5Lp7Z@u^PAT0I@0=1@04`0(P0 9ttm؉ 0v jhΟ#uh# <0tt h #j000ǃ;=@0u/;D0u"40;H0u109rt1= h-d0h0  h-P-=T0tP U)4uE=\0t=X0?X04=X0tt  1Ljhh 0PQ蛧PLy h 0t=h0uJLxPPWZYLu&%=ud0h0w($q&J\0PJPhЦ"^u`."h2#Php)%hSP]S褬ǃuShUW$Y[hr"PPXZthW誈h 0h0V50h0VV VpTX1\`dDžXhVXPjl Džy0z8#tjVjJht"dj艛_jVjP3Pxh"Nƃu5#SVhT%TPBTu h 5"jjPh"h $h $ÃuVZYSxTP^Z9ujVjwTH h*"V`LY_uVhUW$\XZ0e׋H󫋅LfLRXtPDžu Vi[eh?#m\hx-J$-H$-ZYyh -TX -P -0 t+@t( $-y h -S_ -P -Ѓ߃NPԩ^ JP= 0u  0 =0u 0 Ph0< Y[J}l0L0P=L0X=`0t 0,h 0h0hx- 50h0hx-Eh07Zxdh*"v^[_uvhUW$j(1JPhmdP h#jm^~WYu WhМ#P0eȺ0t jSR @ h0@ZIP5WPUWVSjj]Sjjh z&@u h#j:u誵YtjjSPjh z&@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQkMQhUW$]YU1G맅u) -yhx-j _XZx-Px- 1e[^_]UWVS ƅ]-ƅ_1ۉ(0,0(0150040001= 0$0 01h,#u u< ycPtJTtgxPl$@z& 0뫃 0q 0 e 0Y 0M5Lp7$0Ye5Lp7>Vj:V]=[Zuh#SH00t)XV3fZYXu C[Ӊ00=(0t h?,"jLp7tuhd,"1Ҁnuxouh-h·%PcG^_t5!#(0֋=Lp7u 0i5!#Lp7 0Otrhz&Ph #h-ZjsM^]00t00t 0P-M Tu)tP1ۉXhn h6m 50RXRrRhu#RL6eZYTLS jjLRPVo9X}XTPT0VhP訅à uj/S ZYuShق"hW %hSYTVXu"VXu9S^ty2LhV(à LVhUW$juhyG"LRdZYh#LRcZYSh=#jjhVjSǃu Vh^#j$h@0hzd@PT uW|X0`PhedAWT @uVho#W{V]aH__9~Vh#(NE XY_Ct Ph$>XZj =XF 뚅\\8rqvN`\jP׉\@Y_xuhSuiUS] 3>Su US] 3>SuUVSu] 3h>X] ue[^]UVSu] 3D>X] ue[^]"UWVSX] 1P0NhH$PC_Zu.CthG$P;BZYt$=`0tM`0$1Dž1VSuw @ B4s$ع&Dž=Lp7h"WAZYu 0h`#WwAZYt'h-hL$ܛ\0_XhX0=P0QP0B=Lp7h$WAZYuT0GjjjjjLp7#,Lx-qjjhjhLp7>#$X,D0P5Lp7h$"Lp70jjjjjLp7" ,P0jjhjjLp7#$+(0jjhjhLp7#$+<0jjhjjLp7#$+80jjhjjLp7$$s+$0bjjhjjLp7$L+@0;=Lp7=`0tFWzpYu0-DPuWh$j輤@Wem@jjhjjc$$*Dx-jjhjjLp7$*@x-jjhjjLp7$$*00ujjjcjjLp7$$b*Hx-QjjhjjLp7$;*,0*=Lp7=`0t.jh 0h`x-Wo]u hv"X P]Gh$WQ>YZu40Xh%W1>_Zu 1ɉ 40:h$h$hT%Q=Lp7hy$W=YZu 0h"W=YZu 0Wh)$Djj5Lp7̬ 5Lp7h?$PhjhjLp7$)H0L0=Lp7W-sZu0-DPuWhM$@=W k_+=Lp7=0j:W[ZYuj/WMZYth]$ ?u h$j 0P-=Lx-=P0u=`0P0p1󫍅l 0AuVE)Ћ`0)DžMDž>=0qh$5r@ 0jxlP5 0phH$K@uph$"0@th$, jr HM1󫍝`4󫋅 =D0u D0tJL0 H0P|[^@=D0H0L0s=X0u;H0L0}hRcR @uh $PE$ZY@uh$=X0h0V+[à uVho"j袟Ph0P%w ujhh0jP/syh0h4$!P#^_@tڋ%=`uh0hF$1=X0jjh01Q yh0hk$jP}Y[uh0h~$jh0hق"{8 0t#0VRW9^ZtN xRjVhق"+8 u ƃrVW8YZuSh0h$j=0u@0`PP50h0`@uh0h&1=0 0=D0uD0 h$Ytc uh0h$h#S7ZYu&0uh#S7^_t t Dž0?=0thk"hl%S7Y[thps"h0h&Džt'D0RP5L05H0HH0L05H0=L019|Y<@ t D0SQRPG  5H0=L019| h$t5 H0L09sSQRPh$jtdD0 H0ˋL0%H0RPM @u+5L05H0h< $j裛'0P_Z@uhW $蓡[^ #$]0P5Lp7h$jjjjjjLp7"]0jjhjhLp7#$k]0jjhjhLp7$A]0jjhjjLp7$$]0ujjjcjjLp7$$\}-TjjhjjLp7$\00PhjhjLp7$\00Lp708h+$DžDž}P-)Ӄ=0u 0Kt]14`E =0u 01=0u;00}hPkE @uh $SS[_@uh$=0.#jhh0jfyh0h4$SZY@t=0jjh0Dƃ yh0hk$djP6q[_uh0h~$;Dž0jh0hق"+ u Dž0xxjWhق"+ u ƃrW[,ZYtWRF,Y_uSh0h$ 뀍`PPjh0jv@uh0hԿ& =0u0u h$j t] uh0h$u7hM%P+_ZDž0t hs"h0h &j襐Dž0t(01RP5050;000019؋|i<@ t" 01SQRP; 0019| h$t5 009sSQRPh$j蘏tM00 0mRPV @u'5050h< $jm1$0PVtY[@uhW $fXZ 5$j迊j|P5Lp7 |:uy 5Lp7h[5$릣<2 3 33t hy5$@3Lp73j3@u 3 3A 35j|P5Lp7œÃ |8uy5Lp7h5$h5$j赉 3 3 3@j|P5Lp7 d |8ud5Lp7h5$`j|P5Lp7 |:u Pv5Lp7h5$#w. 3jj3Lp7b# 3 jj3Lp75$rYX|P5Lp72XZ|8u5Lp7h5$3Džh3(2z&u$u (2M(2{G,2z?tٗt h86$G(2v蹗t hT6$'=<2~蝗t h6$ ٽrfr fp(2٭p߽X٭rX\22߭X%٭p۝X٭rX 2 ݝ(uu h6${3%=u h6$' X@2t<2У@2`Hu 9P-t p9}hh335!# p3%Y^=u 3 3 u33f33u388ht,3hu ~ 3 1~ 353= 3Wm$3Zu Wh6$j3@30-t DKt@9t)Ѓ ~hx-53h7$j蠅EMQMQMQMQMQMQMQMQMQMQMQMQMQMQMQPh@7$RƋ33H19}L2@91B3uQhq7$_9~32Ph1"CZYj Xtm9} 2F's423xt&jSjh5 3U@u h}7$X3t&jSjh5 3&@u h7$躊X3t&jSjh53@u h}7$苊X3t&jSjh53@u h7$\X3 t-f`2b23c2D2g2t'D2ƀ`2')ˆa2ƀb2D2( D22)ȣ2`2jSjj5 3&y hD4$g2D2@dB3f@fJwuJB  3J 3J s*EjEPj j5 3y h7$wt)jwPj j5 3`y h7$3tTjh3j j5 30y7h7$q s'jh3j j5 3y h8$D353SPh3h38$ jhd-hh5 3yd--d-hP8$jhd-hh5 3qhj~'1ɉ 3 3 3 3 3 3 33EnEĀ1ۉ]]]]jEPj((hnj'm^_19<2~h2jqCXZh2j2^_ٞzt,-2݅(=2ݝ01ۉ@D%ݝ@1ɉ04h2j+XZ݅0zt -2݅(=2ܭ0ݝ@@2982}y݅@؞vj22h%s=`-t#3tp22hvܕ@vq݅@g2%(2vݝh22Jh݅hܕ@v݅@r joݝh 3EfEjh3j0 @݅hu hs8$S %ٽrfr fp٭p۝h٭rhPjEP@1k (0 '8" lh4"EEPURj5 35$35 30Ly31'8 kh8$ׄh-_X h2j$3HX[^~9LU83_ CkuPLh8$ 4 LX)dHhh@;42 hfX82Hff9u `-22󥸤22 2u202<@0231ɉPT s)hPU@ EʉU1҉UiE'%Uthp U2ieݕP22݅P22h-ܝPv ݅Ph-݅P2v2؉ff@352v!`t:(3<02Dž`9Lu@1`Dž<rff@39LHpfu2TPV`dq2PЋL)t&(uH3uS3t63h8$3 u23 t 3h8$XRLh9$ `<Dž`hf@fLffX-)J 3f~4t;KQ@PRh79$3t1h t 1< fX-3uY`uFHphfXfuTPV:$hR:$hj:$ h:$h:$h:$h:$h:$h:$h;$h;$Ph0;$jdhm_ hU;$dh8c^1ɉPTDž`1ۉ<jdhlZh@<t%w uhc;$<uh;$ht;$ Xh;$Ph;$^_haPh;$.jdhDl[0hfPfh@fRPh;$ jdhkYh<$jdhkZh(<$jdhk_h@t <uhW<$hA<$^ Phu<$Y[dha]jdhBkZ.h@Ph<$dhRa^_jdhj[h<$jdhjYh<$jdhjZh<$gjdhj_vh{%Djdhgj^Sh<$!jdhDj[0h<$3jdhjYhPh =$XZ3dh5_HpX<wz<Xx^FLs3`ts)Xh=$XLl^"LtkXD- `FLXxFv89~88X`;2uMSh`2L+ u5`t h%=$X8N)XL2`2L󤃽`u!)`h4=$_Dž` h3=$^L@].8LtkXDX t_뵃`uvh9=$E[i`uPHxhfXfuTPW=$ZYXOFLXLe`t ^hx-X,b02;@2)3UWVS}À8-uCh"S- ZYuD31uuu'h"S Y[1ۅu@3πh=$u Ws\ t[dw<$&Eσ=D3t 뾁북뮁gEE돡P-19tcM E1WtUPI ZU<R"XXEtPV1h(%V1ED>`tjhPhUW$j0p}tVS$h"jBp}CPDžuPA_t $t8=D3tj jh"gWh=$=@3t j jh"gWh=$j(h8j jh"g tVWh=$jhWh=$jg h5!#h!>"h=$hjjh5!#h!>"h=$h }ujjjjjjjj jjjj jj!@u h=$jojjl!ZY@uc8th=$=jG8X}uCj48_j j-!ZY@u$8t+h>$tY2 u h>$uZ W7XVS #hA>$t 0fjj ƒ 5!#Bu~=$SPhW %jnUWVSDu]  'T3h$&SV9Y v~j cStITtbLu|3뼃dw$&3x3t3l3zP3kh3\p3Md3>P-)ƍ3=p3tjjh%[3 >Ejjj"迟3jURh@hP脮 @u hV%sY=3y h%jl;u=33 @ WsZ) (    mt /  =3t1ɉڸj1ɉMhjWE؉EhjWE܉EhjWEȉEhjWEĉE hjWEEhjWljEhjsWEMU ʃ} ʃ} у} хuu hA"E1҉38gtj53x_X1ɉME5!#E5!#FEȅ"CEċS:-0BRUqZH3U$H&3"0-30-30-30- 3uj\3[X3L3A91&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸduCEċSEP1ucCEċSEPM̸djECEu/CEċSEP1ɸ1jX3uCEċCU_EuKMċs t^3hw$&]1R3F 3:(3 .03@"83@3 3 3 \3 X3t# 3 333t1\3jjV|1C R3u#EPM̉UhEXUUuEPM̉URI0^uCh%s2ZY=t3uh_B$htB$hn<%^ 3CHw)=t3uhB$hB$hn<%, 13SEP1ɸAhX]ċu3MuhB$5u>au uhB$"3Eġ3}tuȉuthC$jfMu}t }EEă=3uMEȉE10E18`31atctguIEc3Eh3b33@3t33l33333U9sHxt)Ј3t]E؊Hw uF:T80D019r)19r)1ELE؃9sIJ 33tMutHXSVh3 =d3t =P3t3C$]3tE}tHpVWS =d3t =P3t(C$]3tE}tHpVWSr =d3t =P3t6C$D]3tE}tHpVWS$ =d3t =P3tDC$\3tE}tHpVWSְ =d3t =P3tUC$\3 tE}tHpVWS舰 =d3t =P3tbC$Z\`3f`3=d3t!=P3u=3t']`3^=T3Sh`353 u( 87t \PhA$XZ9~kPhA$Y[]d 83u =3tHO 8t|3 x3 h3 d3PSVWs 11ɉډe[^_]_WObe[^_]UWVS } bhI$PZY…Uh~"WuZL Ut.at"t=3Lp73뽺붡P-])Åt>um3t&h#S]^_thH$SLZYCt/=3u&43sujRKuEVhI$h-VhI$h-jt=3u.3hI$WuZK t@rA3w$&z=3u3먃=3u3듃=3u3{=3u3c=3z3 G383)33 =3"3@33335Lp7}'3X=33=33j=3Lp73h%PY[>3/=3F33)P-E)tH:Eu5=3=3t =3=3]=3t =3=3txt4h#W2YZ!hH$WYZu/ h#WYZ7hH$WYZ"h%W_Z,@JK E*qÀ53jj535353wt53jj535353w;E53Sjl 0ShUW$jV\3Eo =3mE,ojEPjCl @u hJ$'bEUuuhJ$ [Jh`RPh2J$]t SX YyE  1SQ%1RPhBJ$ G1=3tv5oXhT%S_Zt#hH$SZYtCujOVhYJ$j VhJ$j.UWVS u] 1hL$SVF tRtfu2(3ֿϡP-9td1ɉ`|lPV誰[ZjxPP]xZY%=`=@uxh|uxPhL$[^Dž`ddPhVV h Y$eY5!# Y$"hn$e_ "oR$hn$~eX3l$#hn$beX5!#Y$hn$FeX5!#Y$V>jFXZhj*Y^hj*_Xh5 jq*XZh5 jc*Y^hjU*_XEt7U ESRPTà p;3uSojj*^_jXE j:0Y[t*E 0OKZuU ERP_X9jh3Y^uhj)XZhRj )Y[E 0j@V諾_ZÅt @hPWrZ E @1=d3t1ɉ 3 d3ER@PLTXZ=d3=|3uu 3ujSViP =|3t 1ۉ371҉T3Phn$53 53FY=|3a뿃jh3eXZhj{(Y[hRj m(^_e[^_]UWVS}u |hm!"PZYtWhh!"SZYthg!"SZYuT3)~3ltXnuzh{$VWE7 duP3׃Vt1PσwB0-뾃cu3T3L3h&h#h-jh&h#h-ShK{$h-jP-9u*=P3t Ce^x1`Gpptƀ8-utxt t1J=P3tdx1x`pp8uJ5-ƍxPVhZYtn=P3tSuO8uCV.-Dhl$1_lhuh 5" Z1th{$Y2E%=@uVh{$=u d Vh{$YZYS:X5H3 UWVSu 6(h5!#j=1ɉ 4 1hd$Vu4 ua`Gt+It2EtHa<$X& 4먁%4뜡Lp7u5!#4 4z4k45Lp7$5Lp7Ph"WC }Lp71} 4Lp7u5!#41҉ 4jjjhx-h$/4jjjhx-dh$NX|SPPhځ$h-jjVP-4 4ut 0|{>ttG|1;|j5`3跗hx- t h("jG5$4UWVSP}1ɉMM1hʃ$u W2 t3gt!utGu.Lp7ELp7;uLp7E85P-9覗t3SZt@E%U褗MM@uShу$jF1}1ɉM}t EݗE1}t6h·%EPYZt"8tu h$jFG袗DʋE 46ZZ@u6hUW$jFhH%Y@ttEPWW_Z@uh $}tuY@u h$jRFtuVZ@uh4$FtVRP2vhUW$jFh#n\Xu $jh$SSTDShUW$jEUWVSu] 0o41t4u4 `4#%1t4h-£`d4a1X&?t2Gt&W =o4uRho4!YX RwP=R |4k4|t4t4t4hx<%y[_1҉tu"h-h% :jEDuEl4he%SV 0 txmtW~փpt]rth-h%9jft$Cuht4ht4h%5Lp7{뜡Lp7됡Lp7t4o4twxPhp%3b[^uUu;EE|Ch%6Y1t:SdLZt@ <uNtS*Xu 1pjh#hn$u DžphÅtD5-75-7jjVPm4uh-h%7LtL5t45t4Z^_5m4 hhjhjhj 5-7蚮X6hh`4aE1ɉMj@Q*ljxj@B*Ɖ|tu1 jPt1>XZtu(xH%Q}u)x%;xt(}tjUxY~jRt-XZlN t t jjSǃ yShUW$jg?1tttWua.^PR[yh9%譂yh!9%t'WR%RjQjWQjhI#h99%h99%$<(t h/9%D1ɉ 4 44x-t-4@ftPhht@ ƒ PBt4$Zu h>9%PWQ^y h9%qy hT9%u@U jPPS33hi9%jj-Wià xtt148tjh{9%jP<1Ήș 44)tSP y8tjSh9%j;[11P2ƋЃYtuƉu#8t7u@1҉9t拍9u1 fjjj 9+uSLUWVS1 }~XE Xh?%S^_u h%?%[-hi>%SgZYu#h`&hB%fhB%d 101jEDž`#C% -DžDž$Dž DžDž1((,Dž\EEEEEjj @u1m%jj[^@u U%jjZY @u8%1$1ƅh%>%t>% Ph&Ru u#^V4M 6?4uƅ뛃Nw$&ft'j{$$&Dž<%`Lp7`Pl(5Lp7jl^X-Àt ˀDžx<%hDž$Dž$Dž$h%h%?%[q ƅDž<%{Dž<%gEH;P-t dSMlME tEpP-U)‰u 0S脓jjjSmƃu(h% ;P-!u uPjS蒆t%huąn h%?% $h4C%Y;P-u;VS&jjP-u 4S輈ƃ u uPjSL0t &hGC%PD@SP hXC%$LHS`lheC%TPSc g dh  t u, @ À翉  dhd%@Sd%uvtS=Zv8Sh " ~"t"t5!#hH%PShvC%j+0P褿Eh5!#h5!#h5!#hvC%j+0P}dE9P-u t1h%t0PY hC%HZ@uh<&hC%I[XCuh<&hC% jj H0Sh| jhD&vBPB$@uh<&hC%v Sf@YvKRhC%HWRt#v8t hO#S0Pz X'@RhC%oHSt dhӃdhu,PPP-] 4C dh u-CvPjP-] 4 dh 7Pjj @<8th<&hID%G[XdhuGw8hZD%88 dhh%hhpD%]PZY@u!8thpD%h<&hD%F hhD%(P[_@u!_8thD%h<&hD%F 0SaYt&uSh<&hD%SPhD%FhD%2F1d%@Z0F(Pjh0jT@u h%u,\(-Sh"j\9@uh<&h,:%EY_A@uh<&hD%?ut$u/>XcPhD%"E ht"E#hhE%h(\,rSh"j\+9@3h<&h,:%EXZh@S跭_tPh<&h'E%D .d%h u =ukduA%1Ƀu P-} RQ0P @uh<&h;E%dhǃ ?%u5!# ?%u5!#?%u P-U QWPhǧ%g0W=R@uh<&hME%#1҉h[P蜰ZY@u h`E%CXWh(j7@uh<&h,:%C_Xu*dhǁ@u dhQP0PJ1҅uHh<&hlE%\4PHZY$u64h|E% C_X$P$9x uً4hE%‹t x t]@h% hE%PA0P,d% uhE%oBY8t tjjM UXZލP0W7HPWF1d%@tWY8t" tWDZtڋdh@t) y tI߅uGÁt:Áu- hF%P@0P +t'%@t0PhQj8V0P|0[_~ tVhjjx8vՋd%@u hC%D@Xu u0S [hD%?dh@_dhShhjj7@Sh j 3@P;$ZYy)h<&hF%?[_ 1ɉ$ 1Dž$d%0uSZ@uh<&h-F%y?Y_PSmCXZt;t HxtyzP P@XRN1ɉ_VSaz _ZtP^ S赇S@y SS; -tP[hƒ@tRt \tBh>F%M>h@Yu&j$RP= @uh<&h":%[>XZ9?l_hx-bJh$tPRJh<&h$D%7h<&h5D%(%Ѝe[^_]ÍL$qUWVSQ@Y1ɉP441,41,0<48hp~%S@ ,H01$ ' 6% 65Lp7fP41Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @fP4F누0fP4%1҉Lj LP5Lp7٦ƉP 8u!Lp78tL8u ;Ph|%pj LP5Lp70 ~Lp7:t L:t5Lp7h|%4z 6@nw6t?h|%j& 6jhx-1ɉ \- `-d-^_Lp7< 6j LP5Lp70h-Lp7 :t L9t Rh|%j&@=Rh}%Lp74 6 0LP5Lp7術Lp7_Z8tL:t Pv)ݝ O5݅ tjNPh5}%!(%v5Lp7hY}%AٽFfF fD٭D߽ ٭F $\-`-߭ %٭D۝ ٭F d-xy5Lp7h}% uho}%軩d-^ 6S\4t$h}%j LP5Lp7;.8 xLp78tL85Lp7h}%&,% 6 6 6 6 Lp750-tDFu h}%1B卅(R$R RRRRR RRRRRRRRPh@7$Q ZƃH1Ʌ~ )1 6hq7$Y14@9u919~4Ph1"跮GXZj ̭ 6t1DžtDžxDž|Dž:h6Vj5Lp72tP菚Ph}%66rJB6R舚 6@Yj LP5Lp7+p- xLp7:t L:t5Lp7h~%=hh+~% 6% - 6k 6% 6%  6CLP5Lp7Z`4XZL8u5Lp7h5$8LP5Lp7X4_XL8u5Lp7hR~%P-@)Ht蝾"6j.SY^u S{Z)؉@?wPSPG@Ƅ t@ 0-t ,-fBۍ1V@KjKPV$@SVVdP>$TVh~%j Hd`hSVjSQX 6t=p- h~%贤Xt1DžtDžxDž|Dž:h6VjStPnPhUW$jA6BtÉ4ru h~%6Jr rrQ6 y h%<!6@t"56h6P W t hgN%<1DžDžDž:PtPj<tP|P ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizeoutput block sizeinput block sizeblock countfile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. Explicitly specify beg/end address?The bootselect code is not installed, do you want to install it now?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -An < LFS_MAXNUMSBnblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCAN%8u %4u entire track defective%10u SCIOCDEBUGSCIOCRESETSCBUSIORESETvpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x invalid console name, valid names are:Boot options: timeout %d, flags %x, speed %d, ioaddr %x, console %s console %d keymap %s Patch area in stage1 bootstrap is too small/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20251122160958Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-extproc-parmrk-onlret-cread-parenb-cdtrctsispeed %d baud; ospeed %d baud;lflags %d rows; %d columns; queue = %d; line = %s;-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfoiflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignparoflags-opost-onlcr-ocrnl-oxtabs-onocrcflags-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Read failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %juPri%s GPT at sector %juSecGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableCreating new secondary GPT headerMoving secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]GPT part %lsUnknown %#x %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AFpltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab MBytesGBytesKBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandLPSVEPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVncan't stat: %s%s is a directory%s is not a regular file.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.0_BETAxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initnd_dhcp6_invalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completedelayingmulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: redirecting DHCP6 message to %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Alink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*12aargon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist