08PDh'&<  'Dh{7P''`'-. -.Dh'&P@@<@T 08PDh'&<  'Dh{7P''`'-. -.Dh'&P@@<@TU Dh`'-.yADhDhDhQ$f DhDhDhRADhDhDh.ADhDhDh/ADhDhDhtADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhmKd$DhDhDhX`hpx$DhDhDh (S$qDhDhDh08@HPX`hpxP$DhDhDh+Q$(DhDhDh,JADhDhDhCDhDhDhADhDhDhADhDhDhmDhDhDh (08@HPX`hp\$DhDhDhu$DhDhDhx$>DhDhDhz$DhDhDh~$sDhDhDh$DhDhDhADhDhDhm DhDhDh$DhDhDh $DhDhDhADhDhDhADhDhDhADhDhDhADhDhDh$QDhDhDh $DhDhDhx $DhDhDh$DhDhDh$DhDhDh$DhDhDh$DhDhDh$DhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhyS;a6~[~]z*2A#u[;9=$o4/D1XBK-a|ֈ[^/74_1cSo-&M̵nsj*PeXUAaտ H21jB-. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4l$4 (@@ " "z\z\#,,$T ,,#,,NetBSDAPaXUSR&ffffUVSʏ( ,9s 9r[^]UWVS蕂Ú(]P PLt,1t&tuAt[^_]Yuڅtft9s1u+z 9suփ 9r}tt~t111us t0#t&wfuUSQE$uԋ}{̋CE29sSU]MȍXE9s1u\tED u|E9rϋU]u9r09Jt*tXE9ǍvuUWVS(E@@9s{* ;9r[^_]UWVS褀é(E u  -M <8ME @E  -t/tu>~,9s 9rEt E$,p$ ,9s 9r"$ED$E D$E @$$9 -0MD$ D$ D$$1ɉL$L$;[$SWD(5u1ƃ5$tЃt]$l_[SW(4uYƃ4t|$]<$kt(?t<$ktЃ_[UWVSh "h "h- # %1t:PR,YxOvh-j EXZ3hn%h-" h-j jUEU MsMU HE]UVS1ۋ %tVP-ZYu $%C܍e[^]US :Ph!"h-8"h-h!"`% CtsPh!"h-"jUWVSE tuh!"URhc@5-6 t5-h!"jpu俞#5!#M𻞍#5!#E躞#5!#WVSQRP5-h""E t#5!#RPh/"" u5-h=""1e[^_]U5-DXUjhc 5-f t5-hV""j蠑1USRj EPS2 xU:t Shd""jB]UPEU Ph}"" JtPh""$EEEPhc5- t5-h""j1UWVSSuE H1ۃv>PWk+ZYtC%uދ%Eh&"WB+ZY1tFEEPhc5-9 t5-h""js1e[^_]US u Sh""j"]UVS1%tSP*ZYtFSh""j%e[^]UWVS ]u} Sh}"" } ~Sh""1}{EFE} t!v""1UWVS`] u~ uh""Uȹ1Rhc@5-zE 5-h!"j譌0-DPEU Eu>M9Mt66EE1EEEK>tt,uh#""1}}}}}E뺉t9Wuh#"j܋U9Uu\}t }uEEEqEeEEVEEċ]9]}t;$}t)}t(u9ut8Eċu9u}l}uE EEEԅu.u9u<E4%5-h#" "}t}uuu1ۉ]EuM9~VQuh#"j֊k]lSrEYu h#"j踊1}E1҉Uuĉu܋UUMM]]}}Ph c5-P u EX@1}Wuz5-h$"juEuPE4%h#$"CE rh+$"7^ElU9U|@-h@-hUW$]XZCtCPh1$G_Xj _^CtCPCPh@$"$ CtC"PSha$"  Cts؋C4%h$" C$Ph$"ZYuJyXE\1e[^_]UE-]UE-]Uh&"j軈Uh-&"j謈UhD&"j蝈UhZ&"j莈UE E EE]-#Uhjjjuho&"c--Uhjjjuh&"c--Uhjjjuh&"c--Ujjjjuh&"kc--Ujjjjuh#$Cc-----u(Ujjjjuh&"c---u(Ujjjjuh&"b--UShjjjuh&"bӉ‰؉-- u jB ]Ujjjjuh&"fb0 -u j UWVSu-1--1->W衸XuWh&"j=S}Y_u Sh'"jRxxuSh('"]hjjh %EP uu뺋-#H t uhB'" P-WPZ_-t/#=t --tt hr'" X-ƒtuh'"<ۣt?%t4!t$t -ۣ -h'"jW-e[^_]UVS-uX------;--rgj------X=5-u-E -)EU}t 13A}uke[^]Ë-- t --Uh2%hUW$jeUUh0%hUW$jIUUSË@4URs(PZYts$hUW$j>S4K(E%= u!HPhm8@QR @ C !jjjQR Bu@u^,8uK ]USQ9s SkkZSPEPkƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h("j{C4WPs(Xe[^_]UWVS]uVh-jy4C4uu s(P(+8jVjW4$+8؍e[^_]UWVS-}t -- --EUEUEU}uH - t?11ҋ}9׋u} ytEU--E-- t(jRP5--P Bu@u 5-h("IuSh-Ɖ 19|4 u5-h3("%*8t5-hUW$j11-E - tKEX- \-5-5-QP(P-T-0-4-1ɉ - -5X-=\-9}u;9uu6E9-u E9-t8-<-|0-4-l8-<-9}u9utT-t%=-u-5-hE("XZ-t5-hi("jŀ)u}--+EUEU--=- -9}Er }ME EtUR-)P5-P --- -- t88-<-0-4-SQRP% ujhH%j0 e[^_]UVS]M Eu fft3SQHtlpCQSCAQSCAQSCAQSC AQ S C A Q S C A Q SCAQs[^]ÍL$qUWVSQ- -t/jh"j/ - -tjh"j/ jEP,i]eƉߋE׉ptid-%`-Ɖߡh-׋pt)ptZYt puDžp1t5<-58-54-50-5,-5(-5$-5 -h("jd]Sw,S$Sj.H-L- t7ƃK% tJ#QRPh#)"jdS,S`$Sj.$@-D- t7ƃK% tJ#QRPh<)"jdSS$SjM.$P-T- t7ƃK% tJ#QRPhO)"jdSS$Sj.$ X-\-iቍhltpRP#Ɖ׍xPjhtp$WVxPhlSQhf)"jd]S$S/$Sjd- eY[^_]a&Uuj#UWVS--5- --u3jRP5--P B@;1S0 -v[H0 -S5-5--P$ t -u:5-hUW$j{-uNu<)u-h)"js{t5-hUW$贁!XZe[^_]UWVS-- -u?j --%-RP5--P B@4tAfEEEPhm5--P tS5-hUW$jz11;5--5-5-5--P$ ~fEEEPhm5--P @t;5--s>5-5-h- ;-C;-7벍e[^_]UWVSƉ׉ˡ-҃Pj h5!#WVRuV&VSh#o(e[^_]UWVStÉ׃=,-t%tPh)"h Vh PVJ =P-ssVPh)"s$s ssssh*"0sxs1-`-tPC5`-mZ1҉`-YX1x---1U塈-t*P`-ZtPC5`-!Z1`-ZYu Ujh-h -(]2 yjd-d-h-d-1`-@=uUSUE -`--M`-Ћ] Ӊ)~`-@[]Ã06w $`%1Ã1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HøUWVSӃu]1-2--@ujjh-h-Zth."hUW$=Y^----`-)-󤢫-1-2--@ujjh-h-th."hUW$g=XZSjjh-ye[^_]UWVSƉӀ:0B؍}01҉U"<%]BuʀEt@9uSFYthg/"hUW$|9XZe[^_]US--9--RPSPZYu[ 0H[Ph#h-hı% 9-H-ua-tjtJj]-- -u -ųu١-P--M 1]UWVSSU-=-CE;U tM-119~149u1ɉs19~H -9E~@1Aˉt-X[^_]UVS5---19| t!-H<u -1[^]UWVSfEp E}u.h"5-_Z]tjEP_ Y^uD1Gh"RI^_FP-Zy }Ou PP x. E uhr/":-| zf%,-Ѓu-h/"RZYuu h/"6X넋-jEP [_bE --9-=}\SRMZYu[& 0XPh#h-hı%I6-H--tjj-- -u -uΨuً-EH--8lx #xtދ-PRRe yɍe[^_]U-1----5-O1҉--H-Yu-tjtjUWVSP- t u h/"5X 6ƅu -8u@-S5-Ë=-X9=-|^SYt=-tj jsPEcUjjjRV=;EtGSZyh1e[^_]Ë -Q-y ;-| tx-J x-Uhx-PXZUWVS u1ۉ߃=-tVI NyVXHF `=- -9^-؁}U|WQJZYU=-- -u-tjtj-u -C1 mCE -9-؁}ULQM5-"JZYMUuX0UPh#h-[hı%2-H-t -/t1 -- -u- u - KF @t.0{TPh#h-h/"=2tt- -}-8=-t=-te[^_]UWVSu VE=--E衠-E1ۉ--X=-t5-11҉UuiEZUU-5-YUt(EEtBD-PPjAƒ u- -t C-tjtj -u -uݨuEVu9uuHtg}tIu-=-tEu~h-h/"P-Y^=-u3B=-u-d-=-tJE -uh-h/"OXZ-t!=-t9uuu$-Cu -19uu=-=-M -=-t1ҍe[^_]UWVS];!uh*"CPwXZS h*"Pǃ u$^0QPSh%h-h/"Ju WYXyh;!u7WZy40sQPSh%h-h 0"4/WTǃ=-uVh$"h- -+E e[^_]UWVSu] }9tU=-t VP*VPZYy0{0PPh#h-&h$0".C1e[^_]UWVSQu VJ[=-tW1ۅtW;uRWNZuZW95-u=-t =-u BRUPu xËUF?륃=-tuX؍e[^_]UWVSPu]>!uhr"FPwY_V u Pƒ u$`0OPVh%h- h60"RuSRUǃ Uyl>!u7RZy4 0mOPVh%h-hN0".-RNǃ=-uWh$"h- tE)؍X؍e[^_]UWVSW11 $-yh -}^u -P -s=- -9-؁}U|WQCZYUu[(0NPh#h-hı%K,-H--tj j =-- -u -uΨu١-u-1ۉ߉ u--0--u,-@t?c0MPhg0"h-hr0"+f%,-1--f,-9t{t ---މe[^_]UWVSW-C{ u)ÃE-:TRPx Y^tE--9-ށ}VRA_ZuZq0LPh#h-hı%*-H-t1-tj tj 5-- -u -uҨu١-5-ljD s} us*Ext-M| thr/")YoE--9~P-߁}WR@YZ=-- -u-"%-25-NjM}t/s2PR_Zt-D } +s#- -9|R-؁}tVQ.@ZYM5-- -u-ux-Me[^_]UWVSQ]utuh0"XZ} 9EueF95< -}hx-h'%G^XP^w<\u7\t.ˆUPh0"wZYUtF-0"0"/B000CL r1e[^_]UEH!-EPhht@j x$Efv@ -Efv< -U=-uE-E ---9~ 1;-~hk_%='XUWVSSu -}t69-+=-=-=-t1C~ Ku"=-tn-u=-t[uSPEZYtI=-Mtj jqP;jjjWut9-Hh0"Y&X؍e[^_]UWVSP]U u hk_%.&XU19-~BPSYX%KM-uSwP(x?]9tWZu̸1e[^_]UE 0-DBuh0"%XP<-u-E -1UE0-DBt-Eh0"R%XUWVS-0--EDJ@t t E@-޹-0U?& } $`%}^@- 0--8f|y@t t@-܃tQN18j h-5-sXǍ v#8"uh0"A^t-u18UBQ@u^t -uօuhk_%$^1ۉj h-5-WÍ v8"unt@--.j-_t|%1Ƀ/QP_ZYt-M:+@- FP-@PX.t(@--;u - --9Et9-}؍e[^_]US1-----xL---- ;tK,tF -ʃ~--IuA-H -˃~-Iu J -:;v-l9t-t1[]UVS-11Å t]9 -u 1ۉ -J@։t-[^]UVSuj3Zu+0CPh#h-0hı%!FV CS FC؍e[^]UME 19tx\uHPQZY1҅‰UWVS=-ujEH!--Pjhr"h0"/ykh"a^tZP[=wJ@ P2Yt:WP2XZ|3/t 3/D3h0"SE 5-jhr"SjUM=-tI -QU=-ujEH!-jh -qUWVSE-1ۃ=-u-9t =-| t8f%,-=-?u1-B-: u)u ?.u tԍ4-WZu# -uo-tj=t[j-t PTCXPPj0à t9u- --u른e[^_]UWVSSu-Z;-|1ۡ-x-@-9t9u SEWá-ZYUSWjq/ u -t$195-~FPVjB/ u)ϋ-tj&jSS<[t<\t.RiZÅu!h>|$ { uh2"-[1C뵉) -=-9-Ё}UtVWZYUu[0 Ph#h->hı%-H-t-tj2\j 5-- -u -uΨu١-5-lj-=-tj jRPe[^_]US-< u h/" XH< u=-u$h32"XJ -R t8u ӡ-PKXu1-t=-u PAdX9j-Yu(E0Ph#h-hı%hK1҉-5-S5->ƒ -t+h'h-PR)%5-1-R]UWVS-P-M-1ۀx%u}M8Huu-h1"[s9}n-P-- -\P--2< -=-} -U8u-ف}|WuBZY=-- -O-tj7jm8uCH-B=-du f%,-1-| u6/- -9-؁}tVQZYuV0tPh#h-辴hı%6-H-j-U5-- -u----e[^_]UVSVu] 1- u 1ۉ-U -< Uu 1w8uA --JπwE1ɉj h-5-3. v8"uh0"1Zgu@-늸e[^]UWVS 5-]-=-}+-;-a&M 9}y;M)9 ڋEE-}RUuZYUu]0~Ph#h-Ȳhı%@-H-t '-tjtj-- -U-uΨDϋ -M9}}EMELE B19}})É>\GVrω0;UU Mr3)9 ڋEEW-}RUuSZYU-- -u-t -M9u}EMELE B19uu)d9|T-ځ}tVuZY45-- -u-_b-Cw}9|T-ځ}tVuUZY5-- -u--؍e[^_]UWVS] Sװ^|=-tj jsPlCjPju4p1ɉ E-}t9U3 9-ށ}V5- _Zu[0 Ph#h-Shı%-H-b-tjGJj5-- -u -uΨuك=-tjj   -NjEpSP-  9~U-΁}V5- ZY5-- -u-=-tjj S6 -Nj󤋅  ?u9Ћ)ȉË ؍x-9<t t tjPjuwmo-=}tV5- Y_5-- -u-~+ uEthG2"TZDžW=-tjj S -Nj󤋅 -f u1e[^_]UWVS--H-1ۉ]1-+-9U졤-@-Pmuu PuƃU-PP[Z-3E-1SwYu' --tjtsj-t PۭFZPPjƃ t9]u -u -uuE-G-E  Euh0"XE tu RRK x1e[^_]UWVS-E䡠-E=L -t =H -uhb2"NYm=-t -j--E=-ZZk EtTuaPR@POwGHm uu^13^@p][sHZPJJ@BE4qE@E܋]k  9]}3:}z}z}׉}8up}xK Ń=-t聺L --EL -H --EH - -u-tjt j`1e[^_]UWVS--Ht7k X< u'ʣ-B0Z9tSe;S ZY1--L --H -e[^_]US-9-}Pk- -EuCk- -u C-P-k -ZY]d-j Ph-* tPPh#h-Hhı%5-& 1--1]UPhr2"h-j -Q-y ;-| tx-J x-Uhx-PXZUWVSօt%ˀ9u RPh2"RPh2" uqRPh2" `{tZC<i1ҍ{t2Hs!t ,I< ϊG< ĸ>e[^_]e[^_]UPEEjEP5- U軾h4"Ph4"h-Φj躙UWVSf@8tXu1Pۿ1҉hW3cà 趿8#)tSWV 룍e[^_]UWVS} 5-%fDž<^K1҉hPjà t[ 88u 1ۉh/#Vf8uFt"SVW0 yFž8#u5軾1ɉjjPf @u蜾8th4"jh&:%)+jW2j!fDž=-t fDž9DžjRj fDž9fDž9-jSV @u8tJfu ft>(@ufDž=-u#K,-@tftfDžftR@u KfDžCe[^_]UWVSQ}u VWU[ZÅuzjjmXZu h 5"j;s jEPW+ƃ ?tE8thh5"j4ȼ8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19} 9xu90tEEEE1,]9Xu]9XtiB9xt A,9|90uU9P uU9PuACk,QMuZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPqHY_}ËBt1UjƓL$qUWSQ---w-ڞw ]]5-5-h5"j 5-5-h5"j  5-5-h6"ju 5-5-h6"j]  5-5-h36"jB 5-5-hI6"j* E$h_6"j EPP$hx6"j  =-t>u-1 ujteY[_]aÃ=-tUE PujC UWVS}u _Ph6"j~3#@-B9tT@-e[^_]UWVS$ ]5(-t(VF$V@0Y^ugh6" j0Pu l% yWp4$0ZtWVP u Wh6"Q5h%jj0։( y0h6""jju ։ƃ C Wh Vp%ƒ jjWt%‰ Vx%h 6_Xuh7"j[^jh h R(|%y RrY߉R[ Zt-w1ҁbt#bt!tu h>7"1 Њ Јt u hJ7"jYu V)ƅ/ t jZV8 jZVP~ djjP7& D-0tS SQPR(&,7kPƉ4W8t t10hb7"j^ \9s1BFu h7"j. 1e[^_]UWVS\]ƍ}ZE5x%(,a&V&0s4h8]EPSSe[^_]UWVSĀ]p$tVP:V9Y^㋃p tV3:V9XZ㍅xP1RPuut5 -9ΉЋt}"Q_85 -VPh7"/e[^_]UWVSP] AEH1RPuuƉMt1׋C|1׋ujQ1RP<t2uPh7"jNE01RPuuk‹N tkvkk ыEe[^_]UWVSTE>E8Iu EuEEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉU1EUE}t EșŰU9UuU9uM] E} uWVE,# E: =$-EEIu E5E@1 t1҉ËM ʋUщe ʋ}t}\SQE,c$h#5$-'Ãt#EUSjPVHzHt h7"TXS9X--E1--E<1EEt E\]ԋu)։]uEEIu EE1 t1WVuu肮9E E~1҉ t1EUWVRPM9E cEEEEuuԋE,#EЃ EtEЍDEȻ8&ELEЍDEȋEۃ0EЋHatE/haQuuPh7"3REЃP2‹EЋ^_9t"ERQuuPh<8"j E؉E܋EԋU؃EU1ۉ]]]ċEEEЀt)X@}99EEȋ}ȋW:X@9]9EEȋ01}WE9L9U)9E uuE,!EujP1Eă1ɉMEEËE}t;k;xd[}Nj}ljEu 9EcMQRPuEPE]tXpXju5XZ9u9]EE@]k,PuY^Ek,tԉEVFF EUFVEEtP4@0FVGPtP,@(FVGltF Ek,Dԉx(F Ek,Dԉx(@P$]Ep}}EJEt#1 t1EU!X1 t1EUEU9]LEE܃8t)E"9E1EE܃8E\]ԋu)։]uE)‹E#Ju E`Ek1 t1WVuuPuuh8"jyt E܋P @E܋@1ҍMQRPuEPcE0ju31ۋE;pE܋EE9shI9uEtpp E_uuE,#ujP=.EċE1 t1u}C<҃<DEE܋}k,PuE_Zu E}81ۋE܋EEE9k,}}܄t3w 0x}܋t|px u}px}Ћw04/81p}܋tpp u}px}Ћw(,px}܋wp J9utGE܋@ EMk,}D$uuE,ujP,EċEk,E‰r(Er$ t1u}CЋ]E<҃<]DE܋EEEE܃8i}Eȋ];\9E}Eȋ}9x }98EЋP9Ut,EQuRuuPh8"jfE]E]E Eu--EEUEԉU}E\uԋ})׋E^EXIu EEEÉ1 t1RPWVPuuSh|8"jE}8LEiEe[^_]UWVS uEP@F VM]_9EEr )ӉM܉]Fƒu>uFt 11E`E9sWu h8"jN1ۋE1)ډEUF@]t[ ][]ԋ]1ҋM])ӉM]E9Es 1)EU1U9ЋU_U܋EЋE]ÍEeM1SQRP FVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW}EEPhEp%ƒyEqRPh9"jxhj,3Wz}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QRPh/9"1ɉM؉M܉<EPURvSE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]<E1Em}----EЋU--ẺEMEPhp%ǃ yNQWPh@9"0FPhp%ǃ yNQWPhf9"j1eY[^_]aÍL$qUWVSQ9qD-8-,H-L-?1- -1$-(-1h9"VW ta#DtNJCLp7$-뷃b$%P-0-C-CT-u5Lp7 -e5Lp7+H-R5Lp7D-@4-/5Lp7d-,-5Lp7C8-XLp7(-h-h9"YXP-)lj80!h-h9"dXZ= -xh:"!= -x 8u50-t hQ:"jtjj)hw"h+jjY[_@u h:"jj hw"hjy00h:"@P)@ uh:"t|j/SiZYÅu@Rx-׉hjhjj$8@-P<-1urh ;"jjDz<-؉8hDj803PyP3h(;"jOW5<-OG9=@-=0-tf95@-~W<-4FX烽(ta1(,,9@- -_=4-tjny -xrP<-0j8-dh1҉ldPh <-p%à t$S8:ha>"j11ۃ=@-*6, <-,4@lXRjPjjT($tPhI;"XP :8zJt&Z JZ04z($J 04zh P&1--8Y_9t4VZyPh^;"jPhw;"j 3‰.Ju lxtH'‰`R840Ph;" tH891҉ t1҉Ӌ+049׋0|9؋4}Y 9؋4}s8014߭0ݝ0y11SQRPq1ډ߭ %ܝ0v7ء<- 40<- <0[10=T-pݝt{\PSw ݅y+؉Ph;"j ZjPh;" \`+EU58-9Ɖ 9jSZY@݅u؉NPh;"H-ܝp %ܝ0 LRjP011RPl$01tZL9rKjQ4#^X0290Q_|OlaGl막 9skQ k4 JHJZH XH J HPW4 D2 D2GlFhjP88P PuPh<"Y[# 1҉D<5P-D-8Hȉ9r09rÉ014#840Ph<"k840Ph<"j04 4111W9m09Ћ4J8JZ8<< 89 +4i۷m۶R<8SPh_<"PDPhX-SW(~LFD\`HP\PhX-W\DHY, X049Ѹ4}u014"80Ph<"p1ۉ898r;D\`j\PhX-W\D𙋝09މЋ4}88SK t+4i۷m۶hQRSPh<"DPhX-SW|$~FL,NY8&D8tX-011҉VPh<"K=98~k,0D$Aۉ7<1߭߭------1XT0 11198 P t$k,0Ћ 9Pu9 tyt_|;TRXR801RP 1RP1F P @ 9| ,PQpQRPjW'k,0Љ1;P} PTQXQ8)Q t p|룋Tșڋቅ044؋ቅ=,-t 1PX-k,8 $98p 9~Љt$DPSh="pPhp%Ã~qJQSPh'="jg#tV":t&PhL="j2,+ePh^;"j, E$) 048<11ۅt9 k"j,5<-(,{jAY((9@-ɎPh>"j0(5<-~=@-th*>"h%hh4>"覉؍eY[^_]aUE UMQ1]US]C Cs4SjS)1]UWVS}uj Zt"Å~{kP‰C X1ɅuS [1A9}XM1BBB BUWpUYMukC t 40YPSXZ1C Es1ɉKE CC{{j8 _u.1{ YC 9}k4mGZPcX7p 1EZB|DBAB @Ѝe[^_]UWVS]s$tV6VXZs tVV^_{G 9w~k4FYPW1XZe[^_]UE@H]UE@1҉P]UWVSEXC9Cuz@CPhp>"jkCPs ush>"j9C kS41FFF FsZush>"jiK kKK E UAQMCSEUCSEURPuuE UMA Q}} EENjEe RPu13|%yEsh>"j EC1e[^_]UWVSQEXCE19E~4kK qy9u U|Q 9U UQ} E )C@1Z[^_]UWVS]s4FECS,K0UM{ stQRVu t EWEC C C[MEHEUBȉEEbMRPsW6|%9CugCC\MEHEUBȉEEbMRPsW6%uh>"YC$Cs4SnXZ1e[^_]t@Ë@ tËÊtBRtUWRPDY_}ËBht1UWVS L 1󫍅xPEfE,ZYËEtPhEQuЋ}ԉ t֋Et+ +@|)‰1,0,9r 14DP0,us F(tȃ0tBE;Pdr,9u:s (tvRP7YY09us,9uih(_tZ t @ (jS#EY[t8(w690u9,GjSXZ (w t WV^_Ɖ׋E t1 $DH 9|([ (E9s@(ERPWV0,h>"(\  袋9.}*WV0,h*?"jy(fk,V4Z1ɉ00PHD0,hP?"j (X k,4 1󫋝,0rrz E(t=@PtȉB DH9v@l9}&E}t8Phj?"4<@E0]\)Hu E1ҋ] 1ҋ] t1RPWV)kDt 18x, $$y11jDP4Pu2DH1 9؋$}W $) $119ʉ} @H9؋}{ =-h?"jY^wM t1WVSPE(|%=DH9}bk,4_$S[G(Zj0zP4t0$h@"j MH=-tRP0,h(@"jEHa‹E1tIu$X1IuEC1 E E t14k,kD,49Et@E@8RjPjjEj8P h PR v%<DHk,49s"4jh Ep% bRP@8tGpBuE- -Xe[^_]ÍL$qUQ x-t-5p-5 -%EM MuQQ$RPhA"]MɍaUS]CtS P S tSPSCr s ZS |-X]USEPsH) h-l- `-Hu0-Z[9u -u' -uh%B"j(P4BPQ X4CXZ@]UWVSu EEE# --p- |-M11ɅtJA9~ʳ9M}#tp-h9B"h%hhHB"r}9x4u }9x(u9p$t버tp-e[^_]UWVS]uuu SO trNj@thjB"h %h1GGWX9w(~6GthB"h %hhHB"JrwVw JG [^WY`- -;|-X=-u =-uBGWu-GWtP-WGtG4WPZWX|-j@j^VjTG _4E UG$W(G,W0wE # -G8-tz8GC GtWP { _ Ge[^_]USEM PuhB"h%h4hHB"qP ʉPHPPP s E]XPs2H h-l-`-1ɉH -H-.1ۉXt -H- -H-P4JH8-9t!tXYX tAP]UWVSUu }uWVRcËECUtx-Rt-EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq= -Y,A0Éa,ڋyY I4 s RPWSQ|% RPWSQ%e[^_]US]C%CSjS]1]UE UMQ1]Uj̐UU P-PYtHJ -@ -UWVS] -C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd趻C註${s蔻 ]e[^_]邻UWVSuE EEEE%-1҅9su}K}9y,u^}9y(uVK0ts4q4s4 -K0ts0q4--C4-=-~ttpRZg{$u{uCuڋ[0n=-~ tRkX--t$;3uEE EEuCe[^_][؉؍e[^_]UW1---11҉-_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE -K,ϋS0c,ʋ{s K4 es RPWVQ|%9Cu CC17RPWVQ%uh>"蜼YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPY_}UVSӋEU tt RPrY^CSt RP]Y^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈS^Z19tPQhB"R Ћ]Uuu j"IUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus }C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPY[L(ștșe[_]UWSvh2C"hX%h hCC"gÉЊӃttRP(Y[LXștșe[_]UWVSvh2C"h%h"hCC"cgƉӉȊʃt$uҁTXe[^_]UWVS vhhC"h,%hhCC"fƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPmYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8jLËEEC1CC=_C_C 2h1C C$hjEhjM쉁j`jMAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmE虮Epd莮u膮S耮EE싀}@u jR^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u-EE %-S0tK0J4--C4-C(tS(P,-C,-މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hyC"h<%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhyC"h<%hhC"]@]9~ ]B뫋EEP*E̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuhC"}t/EEtP1uuRPhC"辧]9]tSuuuhC"蟧uu] SY[9t$PRuuh-D"su٧1҉U uǧXE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPd]MeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPWZYU9닋E芀{at WVhyD"wtC M苉9t.CM苉p9t$1SQ1RPWVhD"蠤C(S,C S$]9UrSPWVhD"rWVhD"^ ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/E"辣}hFE"hL%hhC" VEzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRPYEuuWVY9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWVY9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhME"臡EuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^E"<hx-]+Y^tCpStCHuRPuuEU}t hE"^ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhE"F-6EtM}`d)RPhE" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8jtE1҉PEMAx[A[A [1ۉY Y$XZ}t.hjtËE쉃P^_ u = -ƉE} t hF"][1ɉM -EPjh WVu*hjtËEp }쉻PP P jPXZtS Su -}URjh  t1RPuhjosEEp }}M쉏PP P jPW^_utCHSLC419|} tMh7F"[Y@Et} t#hlF"[Zu uuS9u uX SX]=t SXktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjqƉ_tCtPuq^tCtPOqFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h5|SXZ؍e[^_]UE Puj - UWVS]FHljL1RPuu REUt1EUEU싃C|1EUEU싃URjW1EURPVtPu hF"@ u~ 1RPuu QtDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuucQ€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhF" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhF"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt PhF"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhF"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhF"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuuEƉ׀}Mt1׋C|1׋URju1RPQtPuhF"d Ep 1RPuuADt֋F Ft:_vkk փ~t*uuhF" tFVC(S,FC vkBHMQjPjjRt PhF"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhF"ZYEP tu}rz}zP4PR:X17-t C0S4C(jjP0uu Se[^_]UVSUE 9| 19[^]US]CPPh*G"h-t+h-haG"A -CtsPh"h-@+j'USSE] t$uh!#so6ZY¸tr1EEPhvd5-d' @u35-ho"j蝛]UWVSPu }t}~^h"S5Y_DžtFh*"S5_Zt)hr"S5ZYthyG"S5[_t뫿}}uh$v5ZYuUEPhud5-& @u65-ho"j̚e[^_]US}tQ,Shzd@5-E& @u5-h|G"j耚'.x@uUWVS։ˋ=P%. T%.11~B? ʋE[^_]UP%.?T%.jh>RP8=vuX%.UWVSQ5(%.Ctt+ t&Pσaw <v ;v ju_{Gfw$k A E1E)й 19u5{$ 0-1TtDQt!@ u 9u1 Z[^_]UMU 9|]UWVSƉ׉MP%.T%.ÉEE1RPWVW7E)Ɖ1UQh5y%yXZ}UtT%.H9uP%.H9u u9rBRWhL"C e[^_]U塨!-=$%.tvPhM"5d%.5`%.5l%.5h%.5p%.hM" 5L%.5H%.5P%.5T%.5X%.h8M"5).h_M" PhmM"hwM"8h%.l%.5!-5d%.5`%.QRP5p%.hM"g,hN"b8T%.P%.5L%.5H%.QRP5X%.hN"+ 5@%.5D%.hnN" UWVSQƉ21ۉjEPV >u#ËE8u28"u w܉1e[^_]US1P"$5!#Ph5!#Ph5!#Ph5!#PShN"h-,j UWVSEM !-9uh9Q"5!- hOQ"jhًEEUMjؙ]!É]]!Ӊ]uuW BuAtV!-!-=PuR4; 3P50.R"; 9!-uNE!50.}e[^_]UWVSEUϋE E컙F"ti"EU@uShlQ"ڎXZff=Ut+=$.t fuuShQ"R ff=u%CthQ"$ fLJ_f=Ut1=.u ShQ" Y^.tShR" XZj(VP x0XŃ~X %.t\fLJᵃVe[^_]UWVS9).u).5).w1XƃB'.e[^_]W|$wUWVSDEUȉM̋EGWEUċG WEUEER"EEtEZ"11}=!-ET%.P%.U1҉U܉E1ɉMԹEM]̋ERPSQ1PE؋UEUuuRP1RPuuȋE؋UEUuuRP1RPE؋UEUuuRP1RPuhMR","uuuuuuuhR" h -jdh ).^  u hR"j装h-#h )./Y[ ).U슀 ).< <$u z Ћ 0-DQu<-7j EPh ). Ɖ׋EEh%P(EЃEPhR"u֔ tuhY#u返 t L =!-Ήʋ5D%.11WVSQ.0ƉuhR"uZ ui D%.ω%D%.Ɖω uEt5@%.1Et @%.1Et @%.1)Et @%.1)׋E؋]؉E]h-#S8.YZÉ]; t,h ).Zƀ).uh ).hR" 9uE|E9Ɖ]}.uuuuWVhR"tuȋ}u}e[^_]g_USE Pu|vhR"4$-H$- yh -Y -P -؃ t9@t* $-y h -Z -P -8 u hR"j1Y]UWVSEM䡘!-E@u hR"j!-EӍEƉωؙ!M!EjuuuoBu @u!-!-uhuP=3 nR50.Pk4 9!-uVjuu5!- Bu@t0.K!Nju5!-R5!-2 9!-ue[^_]UWVSRá).u ƀA Mz΍). S}8PRo ). e[^_]UWVSEыEU u1+ˀ @%.1ۉƉ)߉u}};=).}=). S"EUEUE9).).}= %.t Ev).KiE9t 5).tމ&ʅu+@%.9UE}M1E܋E9E܋U}t0}t}utsƆj/S"ZS"ȃ[^_]UWVS EӋEEh).@Ph).hE 5).t h~S"jEU9E|E9u|硠).] }) VRP5).31fǂU }u@@%.5).֋M)}CsKSCPKSs FSj).Ee[^_]UWVSE}u&B'.ƒ<1IE E#֋EU EUEUE9`%.d%.M%.19Et\tSMM1ۉ]]9ً]M}3M9MM }S"= %.]@uE%.˃t ). ).t!= %.>).1hj^i).[^u hNA"j}fǀUE裸).EU ).).EU).).).ytbt]t E^).QHu).<= %./hOT">Y7T"g%.=).).;).KxZ 5).t1;EM |9UE}= %.t`룅).E 9).u;]t~).H).1+]9~ Fu%uF PPR ). *@%.1RPEU ).+E).XZEU ).).EU).).S"S" T"S"Ѝe[^_]UWVSË@S t+5`%.=d%.9u9t hT"Y]sǹ󥉍1󫍍@u'CT" CuF"RhT"XZߋe[^_]Ã=%.u x t"1UWVS|Éסt%.tPjYj/SS^ZuS5!-hp)%ht%.' S9t%.Yt%.u hNA"j$zjPi,XZy5t%.hUW$5[^xPS-ZY@tMuи 9E} 5t%.hT"T 5t%.hT"?h h@.S+ 9t5t%.hUW$f=>.Ut5t%.h U"QY^S,XS,Z tjge[^_]UWVSÃ=,.u1Ҹ-#,.f=<'.u1f=.I؁=,.t#(.%.@..f<'.f~'.Ut>'.1~'.u[^_]UWVS á<'.fET%.P%.X%.%.11t#f}u&'.t9r $uɡ).E ).19E~+f:uzti 9t@Ћ %.t=4%.uaf}u'.! 9*= %.tu7hU"~Y=,.t f=.u/hU"hB%XZ=,.tT.!9t%.= %.tPhRU"_XPhU"ZYt 1=,. =,.uL-#t"%1j,.tr.!9tSP5t%.hU"= %.t1~f=<'.u3 .5t%.h/V"ZYu'. !%te[^_]UWVS(ÉEU EUE؉uF=(%.EmV"e[^_]#11ɉD11ɉt<u ȉhjhh%P%tPQRhvV" fu1k t Ph5!#hV"WVh5!#hV"r =!-RPSQPhV"Y[=(%.u" @%.9u1ۉ)11ɉj-j)XZtEPhW"/=(%.9tT@xthW%jjPRM7RhW"h5!#ShW"(RCaZ)uh5!#ShW" 6)uh5!#ShX" ƒ<=)..h5!#h=X", @ u Sh5!#h_X"WVڍC$u u*.j!oWXchNA"joe[^_]UWVS=$%.ujjju uA=%.t+5). 9$ֿ5!#uVWhgX" PVWhwX"VWhX" 1EU RPVWhX"PVWhX"$%PVWhX"kPVWhX"W ?PVWhX">%PVWhX" PVWhY"?PVWhY" e[^_]UWVSdEUMċu} ]t'BuUE$1ɉM9$1҉UUUUE>'.E̋EEE 5!#1҉UUE%.fE9).~5 ).EE̋EEUE$1E9$&E$1҉U9$1ɉMMMME= %.u(}t"uPh&Y"uuUEtuS&}t.Efu ukE ]PEPy E%.}u(E@EċE̋p1u}@ E1E}u E@Eĉ u"E̋p1u} u5@%.1u}E E4E̋@ E1EẼx `%.d%.)EU}t= %.@%.1҉EU}uE9Ɖ115).=).).E).E1E]9]~JE8t6EӋEU9ȉ|$E@1ڋ}w1EE뮡).).)9E]| hGY"u}= %.= %.1ɉ tG@B'.t0F'.1҉EĉUȋE9Ɖ|J'.1EU9Ɖ|1Eċu}E0'.B'.t8F'.1҉EUI19Ή}E9ƉU| 1EĉΉ볋E@Eău;5`%.d%.Q=0%.DhfY"_1}uEĩEęjhjjjщ¸tY"E (%.EuE1uu11}t#).).EU).).`%.d%.EU11ҹuuRPQw%VEĉU);E}EE}]u)։]u}tt).E).19}9}tH>tC9Eċ]|N1ӋF19Eċ]}|]9؉ӋM}EUG롾%.19}tHt?19Eċ]ȃ|19MċE}]9؉ӋM}EUGu EċUȉEUEU+EUȉEUE Eu hzY" E Et}u9}E}}u@%.D%.1RPuu u 9tۃ}u E9uuujjR#EUEPuhY"hY"_h -jdh ).*u hR"jogh ).[vEHƀ ).t'). t9EEHPh ).hY" uh ).EP uċ}ȋEEă}t6juuWVUċE0%.uD<= %.1EjuuWVUċEu=0%.tKt$|=0%.us= %.t PhUW$j[P]juuWVUċEt)/juuWVUċEu}t }tPhUW$j&f}uf} E U u }EfukE } 1E}t Dm:}ta}tE @%.1 ).).9u19tuugZY ).UӁþ]EU]̊EĈC})}̉Guw OWPE̍HPD3}̍_S^_E}tgfǀuEPkE }P| %. =(%.u= %.<t ).(hY"Ytfu'uEPkE }P =(%.9= %.t hZ"Zu(%.}ft= %.hY"[E̊@EċE̊XEčE@‰X%.p1WVjjjKZ"E1ɡT%.p1WVjjj^Z"Ã(Uă?1ɋ5P%.1WVjjjmZ"^}̊MO_U? ˆWGEĊ_EčG‰X%.p1WVjjj~Z"E(1ɡT%.p1WVjjjZ"ËUă?1ɋ5P%.1WVjjjZ"}̊MO_U? ˆW(} ).uKye[^_]UVSá$%.u hZ"$X1ۃ=$%.u Sh"Y^jjڸ%.CXZu҃=$%.u=).thZ"X1L=).thZ"u ShZ"Y^g ).RP1҉8XZ=$%.tC$%.9).A=(%.~hZ"\5).j5).5).RP 믅<f=<'.th:[" ^h["['.t=h@#'.Y=uh[""k Ph%["XZ hZm"XhH%X=$%.nPhO["yY[=$%.8'.PPhk["Y j= %.t>u Sh["<XZ9).} h["0X; ).RP1҉u Sh["Y^jjڸ%.XZe[^]UWVS ˋDžF" t DžT" @uh[" fZYߍ1jh["SK~ t 1/9Cu苅9Cus Pj{# ;Cuă=(%.t.{ t(s$s sh["e[^_]UVSPE!-;!-u*=$.u!URhmdP y h#eX%.11@uh\"B=(.u111H,.~ ف@.@uh>\"d^E).01C;).}. ).).).@@uShS\"tdY[1҉U!-;!-u*=$.u!URhmdP y h#7dXe[^]ËUPhp"h-jUWVS|E|x).wSh$q"h-jS8EEZuhS6EXZEE FEe[^_]UVSSPPVu ujVShM%e,@uL%tv"t"0pKZv"tv"PShw"jESjUVS]u VStYZu Sh`w"jDS;/t"Shuw"XZu Ew"e[^]e[^]UPhw"h-.jUVSPh*"P}[^t,PjPuVMV\t jPHZYSXe[^]UWVS EEu EE}]EEE1҉T+.$%1ɉ X+.`+.hw"Vu~= NtJb$@%1=`+.`+.d+.\+.X+.뗡Lp7T+.jWh%5Lp7~ u hv"jQP* YYh+.JP-4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjP/XZt1h$9}PPZY uċ2jWSh%b@uLtv"t"0GH^v"tv"PShw"jPt%@u=X+.p&X+._X+.MDžw"=`+.tDžw"T+.t #P=h+.t ~%=d+.t w"=\+.t Q6$1ۉXPMhw"h%jaOShx"h x"Vu h 5"j2Oj/G PZYt|,?Shx"h#x"Vetj/C PÿZYt|>XjUVS]u VS輤YZu Sh`w"jN;/t"Shuw"\XZu Ew"e[^]Ee[^]U^Ph;x"h-vj@bUWVS]u1 11҉t11ɉphxx"u u&9 athg$%5Lp7`CpX5Lp7!CtXDžp5Lp7XCxXDžt뀃K|wK|njVh@%5Lp7 u hv"jTMPX}tWWV~Y^Ɖuu~YYEU0`}tΉȋUʿBUƉ4s {$s({,s0{41{D{@{HUM䉓CPsKC 1sss$S{l} E 5+.=+.}t M U JpD1HӉ5+.=+.}tCS}t#RP}YYCh}t1ҋM M  t1WVڋE BY^1U ~ 9~}t 1҉TpTt1|(@ԃ} }t1E 1ɉKXE HpED1Hy~Fuh2C"h%h"hCC"*}t1҉1҉TX1HF붍e[^_]ÍL$qUWVSQXAAA TAAAAA A$A(Q,A0A4PA8xA<@t1É1ɉWV1҃t0119s#hx"3+ZRP:PH0jjjjXSËP%F߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY PCh%VZYth%Vhx"( u&;s5;slDž:DžDž u;tU('DžuLDž Dž;DžsDž ~|t~(uydh"y"'^_PDžDžt9t h@y"&Y9~Wthsy"&XZ.DžDž9|ċ9|<t hy"(&Xh5+.hy":Džy(hy"%^_uqhz"YI;rhy"%XZu) u 111(4<81L\0,$H1dH@D uj$_t⋅9t PhPz"G$Y^Ht2{{ @D0{{@D#Zt⋅9t Phpz"#_XG1t{${Q!#^t <8(Ch4CpHt ǃ ǃL@tA"ƸY9t Whz""XZHd 1t1\{ChX\Clg{ OtIhz"h-cD8ljPhz"h-7t@t)1L@t31#LC LClC XkT,PxuZ(xtJxHXCdTCT~*0CPPlxtxp1PF ^t1P YttuxPZt*1 t1s{ %1t t1s)Й t1҉p11Ҋp t1Ҋc t1hl t19s hl)ωptct hlCS s{C`hCpC1ɉt‰ Ju s1 t1WVtp ct9Ǎ@4pp4CtǍ@pp11҃ʃʃ p t1ct"uM 1FCXS\u 1Huw?ǃH3Qw ǃt)t%@ @ v#vxǃ ǃxd‰9rw~uZ9$}Ldu2Whz"h-{ 9Huh-h&{"7*XZdѽPho{" dt$h{"h-OPh|"Y7 v$tpPh.|"(^_j @Y@uhL|"h||" XZ+1߭ڍP %WW$h|"¿HuƉƉ1 t1 ‹)ЉʋCtSC8S< C$1 t1OD1t 0 ‰D2耽tC|PH9YBu@uO0*Phg~% tu `duCPODž1v 1񉅰 t1 t19u9t h|"_ tG ?9|$ tj jh}"q$t*uQ1҉Ɖbu 1҉h t1C` t1)CS\)CDž+x|ƒu Q]1 t1҉Ѝ Ɖ1҉"vJt\9Ћ}x|) t19r$mh}"^t+)CS)C +V ‰Ju 1 t15Q‰扅Q‰扅扅tV׉sX{\׉sh{l׉sp{tC`Sd*\ȋΉs<ΉsDCHK@hYu jj=-@1󫋃@t<<f<%fGXD@<f<%fGdDSP1R_ZtT81RP}XZ1ɉtpxpx t WVb^_Ɖ׉ t19s=Pd/D ]jƉX PYPFZ@HRjPjjt PhF"N>^_@ Gt3~S@1҉P-HG 1ɉO$)~\@HG~F F <@4PXjjXjjS'ptK KS1P1ZY$~dt.<f%Tf-f1GfFjs ,<f%Tf-f1ɉOfFjs1)щ1 t1҉GW jhZY<f%ffAXZ1ɉ19sDA u҉=v D PjVjj{@ Dž%Dž1p._<҃D 9sh~"5+.ho" Ft Pt#u?RP[Y^f*uGɉf1VfN@ tBh1~"hp%hqfFu=@ A)G G p 6p<uGG9rhK~"h`%hhCC")9rhj~"h`%hՉϋ)1󪊓t@@tf)th|~"h%hh~"LP4PRAH‰ljX1OtVjR1RPQytPjhF"66 H TƸ1tvkk ʃ@u51rrrrB 1z0z4z8z<@1OBB~B1ɉJJ(MB 1BBZN9s1BBrz 1BE]9s1BAJ1B$79s1zAJ 1r@4PY=/.u jSqqXZt 1{@{D1s,1ɉ9\FH|‰1RjQ1RQVAtPh}"3‹p JuI!F u1kF FtL<1 t1F tX1 t1 ‰ ‰1 t1ҋtC@SDC,F t 1 t1҉щ‰8ubvVt \Ɖ 1 t19Ɖs)щ‰jVXZ$t,CpSt'CH\+ƃu 1 t1WV@Ή+tC@SDC,)ȉʉщ‰_1v- 1Ҋ t19sƋ1𙉵st'{++C8S<++C$BHQjPjjR t PhF"/^_A |tVC@SDs8{8tGpBuE0.!-Xe[^_]ÍL$qUQ 0. 0.50.5!-%EM MuQQ$RPhA"MɍaUS]CtS P S tSPSCr s 5ZS. 0.X]USEPsH) 0.0. /.Hu00.Z[9u 40.u' 40.uh%B"jnP4BPQ X4CXZ@]UWVSu EEE#!-0.0. 0.M11ɅtJA9~ʳ9M}#t0.h9B"h%hhHB"/}9x4u }9x(u9p$t버t0.e[^_]UWVS]uuu SO trNj@thjB"h%h1GGWX9w(~6GthB"h%hhHB"萲wVw G [^WY/.!-;0.X=,0.u =$0.uBGWu00.GWtP(0.WGtG4WPZWX0.j@jVjG _4E UG$W(G,W0wE #!-G80.tz8GC GtWP { _ Ge[^_]USEM PuhB"h%h4hHB"UP ʉPHPPP s E]XPs2H 0.0./.1ɉH 0.H 0..1ۉXt 00.H00. (0.H(0.P4JH80.9t!tXYX tAP]UWVSUu }uWVRcËECUt0.R 0.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=!-Y,A0Éa,ڋyY I4 s RPWSQ0% RPWSQ4%e[^_]US]C%CSjS]1]UE UMQ1]UjUU PL0.PYtHJ L0.@ L0.UWVS] H0.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd C ${s ]e[^_] UWVSuE EEEE%`0.1҅9su}K}9y,u^}9y(uVK0ts4q4s4 `0.K0ts0q4`0.`0.C4D0.=H0.~ttpRZg{$u{uCuڋ[0n=H0.~ tRkX@0.L0.t$;3uEE EEuCe[^_][؉؍e[^_]UW1H0.`@.`0.11҉L0._]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE!-K,ϋS0c,ʋ{s K4 es RPWVQ0%9Cu CC17RPWVQ4%uh>" YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RP>Y_}UVSӋEU tt RP>Y^CSt RP>Y^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈSZ19tPQhB"  Ћ]Uuu +jhUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRP<Y[L(ștșe[_]UWSvh2C"hL%h hCC"ÉЊӃttRPn<Y[LXștșe[_]UWVSvh2C"h%h"hCC"詧ƉӉȊʃt$uҁTXe[^_]UWVS vhhC"h %hhCC".ƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRP6YYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8jËEEC1CCCC '1C C$hjWEhjHM쉁j`j6MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmE Epd u S EE싀}@u jR^_}E UG(W,}x0xdEtFVtRP4YY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM uH0.EE %`0.S0tK0J4`0.`0.C4`@.C(tS(P,`@.C,`@.މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hyC"h0%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhyC"h0%hhC"9@]9~ ]B뫋EEPpE̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuhC"}t/EEtP1uuRPhC"{]9]tSuuuhC"\uu] SY[9t$PRuuh-D"0u 1҉U u XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRP誝MeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPZYU9닋E芀{at WVhyD"wtC M苉9t.CM苉p9t$1SQ1RPWVhD"]C(S,C S$]9UrSPWVhD"/WVhD" ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/E"{}hFE"h@%hhC"PEzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRP*EuuWV9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWVƙ9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhME"DEuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^E"@}hx-kY^tCpStCHuRPuuEU}t hE"ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhE"d@.6EtM}`d)RPhE" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8jE1҉PEMA2AA 1ۉY Y$XZ}t.hjҴËE쉃P^_ u =!-ƉE} t hF"T[1ɉM!-EPjh WVu*hjMËEp }쉻PP P jPXZtS Su!-}URjh  t1RPuhj赳EEp }}M쉏PP P jPW^_utCHSLC419|} tMh7F"Y@Et} t#hlF"Zu uuS9u u] X ST X]=t S? XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjƉ_tCtP軱^tCtP蕱FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h;SXZ؍e[^_]UE Puj!- UWVS]FHljL1RPuu EUt1EUEU싃C|1EUEU싃URjW1EURPVtPu hF"@ u~ 1RPuu ctDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu詑€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhF" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhF"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt PhF"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhF"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhF"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuu'Ɖ׀}Mt1׋C|1׋URju1RPQtPuhF"d Ep 1RPuu臄t֋F Ft:_vkk փ~t*uuhF" tFVC(S,FC vkBHMQjPjjRt PhF"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhF"ZYEP tu}rz}zP4PR:X17d@.t C0S4C(jjP0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP苅 e[^]UWtBRBR t RPY_}ÊtBRtUWRPY_}ËBht1UWVSӋEU ΃tt RPY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]Uh"hl%hhCC"|UVSuE H$X(1y9)tNp1SQRP( e[^]UVSuE H$X(1y9)tNp1SQRPу e[^]UWVSEEEH@}W4}t D) D)ƅ  Ex 19}5uVSh"d E|BD1H)CNjEahE@ EDžp!-pp@tUkl1ɍ9~ډM}}x1:xURjV1RPQdtPERPh}"E‹Mq EJu KE! E1k֋^ jQ XZE4fHEu_ƋEJƋE1 t1E虋uƋEEڋ}tG`Wd}G@e[^_]UWVSEt1Pl@hEUE1EU}+GpWtEUG$:EPDUME@`1҉Ɖ׋E@H+EU)׉u}E@1ɋ}9ȋ}7UMEFuE^$EEtphxlppxt@DƉMAHE)׋EEIu E3E>1 t1҉MRPWVao‰C0E}Mtp`1 t1s(EAHEpNjEƉ1ƋEURjW1WVQ賹tPC01RPh}"kE‹EEp {0E,Ju I! 1kF t2EC 1 t1Ek( ju!EZYv{0t EEBƉ׋EE 1ҊM t19Ɖs)щ‹E[M t1 ))s(댋Eu})׋EEIu E>EI1 t1҉MRPWVlmC0EUM t1C(1E܋Etppxtpxx|E@HƉMALE1CCC$C@CECE‹ER t1RPEPEE}8W S E1CCC E}EEDu1 t1ES Et=p`xdrz1BBaB8C1B8BPC41BHC(})8OE@@B 1zBaE>BvB0C1҉PS41p C(})҃0C(E)ЉC,E@rEx<u/.@0.0.E@@]CjSJE܍e[^_]UWVS,}E @u +FEHPE؋AHƋE X01ÉURjV1RPQʵtPE @01RPh}"‹EEp E @0E܉F uMMЉF <u v0E@4uPuE܋E PEHEXYu܃}tC1ɋ9H~@ Ɖ߉UPSUȋ AAMX뷉Oơh@.l@.Nu"h"h|%hXhCC""ct5C0S4C(S,C 3C(S,PTPTC S$pCE @0膮E @BBEPuϦ CPCP赦^Zub ‰E1 t1҉É։1 t1Yt)G8W<)G$}u h"j衿E Xu9utpE MAP9q4ux@.|@. y(x@.@. @.@.A%AQE@@.@.EY눋Ep@.W~Z} 1e[^_]UWVS<] E@(E؃} G,u1uȃ{1ɉMȃ{E9C(rC,}t-wSu"XZEtEPt@pEЉUvӋE@HEEԋEYE؋E u1 t1EE}P{}̍OKu؋uЋ}ԉ t1WVR8}̉CPP}M؃1ҀMt)}}9s6H 1B׋}d}9sH 1qBC EsE̋E#u1 t1EE)C(C,}K S$u,C,E Ɖ1u)EЉD1E,C,EƉ1u)EЋUԉD1T11Eh@.l@.EUE@(E؃} G,utPT:X}!uhzd@u 5 @RhedAu 5 @uuh^"j辩41}󫍅Pu^_@4ȋ9l9t(Ћ}1ۉ1E1ɉ [Eƀ*Psqj PEPƵ1e[^_]UWVS4}jhPjW|tGjPjVWV[u$U ʋMQ؍e[^_]UE 1҉oo1]Ê u@ t utUWVSSÉ։WhV- tX1҉jhȑ#PEA Muʊt< tA1҉ESQ@$SURA ue[^_]UWVSÉ׉WhS- t?1҉8< „u<#tS?Y9t/PH u tuVhUW$,XZ1e[^_]UWVS,E"URu.h*"Pk6YXuWhІ"XZShV$, uWh"u+Sl(OPPPPPPhD"V u 1thV"+S (jtN"Ujt S'X@Pr>_vjVh"ƅM oP) YuSZ'Z ?E ot ⋅4)ȉ1Ɂ11ƃtjhhއ")S&GGG GGPh#S Hu GGSH&)XE ;ot$PWh") ve[^_]UWVS ] 1h*"u3ZYuuhZ"(_X,"^t uht""WVPh0%Pt%WVh0%Pt h"C1Ƅa2=u#,)%Yueao1ɋ0u<1ҍjhȑ#P< tj2WV耯2 9u+]hh7"PMƃaȖ"+tWuh<"' 1ɋu׍PPh~"VuP:Z;v.Phh"&aPWh͉"&@Aƃaa9tRPPhى"h&ƃa*."7^u 1ɉ]uh"VhV\ uVh"% S"j2PЭ2 9~#1ɋ!thE"):"mZt1sZ9{~c1ɋt Wh؊"6VhP[ uVWh"% j2PG2 )r"Yt uhc"1ɋ.th"s]PPPPh"V/\\\\\]th".$ !XZ4]`%t 8t0Rh"#  tG(p SP xAG؍e[^_]UWVS]CjPm _Z1uh@%h/"軤[^F9~?{jW5 ZYu Vh@%hL":19~DBh*"u -Y_uu h@%hl"E z"‰UWWw6Zt uƄsh"hP (shŌ"hP' R 6$RW:7 DžuƋSS9VhQ" u RWh"CPPPPh0%QGtRWh0"! ; ȋC AEVy_4Vp^19s~4襌 FY薌 Z1e[^_]USRÍEPjhjjj jSrU tShO"Rj›]USCPh_"h-/+Sh"h-+Shڎ"h-+$Sh"h-*Sh"h-*Sh5"h-*$ShX"h-*Shy"h-*Sh"h-*$Sh"h-*Shҏ"h-*Sh"h-v*$Sh"h-c*Sh="h-S*ShT"h-C*$Shk"h-0*Sh"h- *Sh"h-*$ShĐ"h-)Shې"h-)Sh"h-)$Sh"h-)Sh-"h-)jUSRhPU u ShUW$j2]Uuu u% @uuhD"j2UWVS(`؟ԟhV"Rh*rPEܟП119П~7̟hW؟m3 ̟u ԟ0F`ܟv1ܟȉܟ9}J̟hW؟3 ̟u ПԟEܟF`벅u؟hi"je[^_]UWVSlj։1EEjh<$%Q` t(jh"SL tjh!#S8 u Ejh"S uEjh3#S t}~Eh"EPhrWh"EPhrW =@.t="}t"PVhˑ"# }uE4%Vh"~# e[^_]UWVSÉ`hPdzlb1󫋅dhx|h"VhrS`h"#|xh/""0tplhf"""u"RPh""h"{"D1҉¸1 RPh"H"0Ph"3"XZ"4t"Ph(""84%h;"!?!rXe[^]US8Ph"h- ShP"h- Sh"h-v $Sh"h-c ShY"h-S j?UWVSӊ u@ ttg tbp\uPuh-h"XZWh"h- &؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃShF#%hVV^NjP ѡ`P.a5`P.kƃt(@hH%PZYu)5`P.CYu*LSh"h- 7Sh"h- Fh"P?YZu5`P.Z1Sh"h- `P.Ƅ=FVvhPSh1"h-j:hPSr1RPSVH `P.;5`P.Bơ`P.Xae[^_]UWVSuS_X؉8/u@1Ҿ1hC%P+XZۋtm;thlu1WP ѡ`P.S^5`P.Yt@9uVSBP uȋ2lЍe[^_]UVSu@Y1ۉ tÅtƋS ؍e[^]US]3X]]S UWVST=@.thx-hN"X[^@. nVUX=@.E}tPuPuS{ uSEZY~/9jPuSjSh"h"h-EPS,EPS"=@.tuuuuh%SC uS2Y[fft uuP Z5dP.Xe[^_]UWVS}E U#ÅuWuu h"=hhWAƃ y@Wh "h- h-:0W PhǸ"h- 1S ѡ`P.`P.0Nj[Yځ~RQWl @u55pE.5,E.5(E.h"h-\0V Ph "J=@.uURQV @uG5pE.5,E.5(E.h"h-I0V Ph6"h-$j%WVXZe[^_]UEU ]U= "-#tjjh "-Jh "-7= &-#tjjh &-&h &-7UWVSƉ׉ˉ t;5@.@.rWVh"; $f.RPWV(f.s{ S$=@.t [$t9{ u9suh0"S<XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh?"Pb<XZUWVu} 1 tC;5@.@.s.$f.RPWV(f.t;x u;pt@$e^_]UWVu} t;5@.@.rWVh`": $f.RPWV(f.t H$9x u9pu 1pp P$WVh}"i: e^_]UWVSujj[_ÅtJNJ/t tF@PW3ZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P̝_Zu1,VeY/txtEVh"9XZEe^_]UVSud.F `.9s%)P6Sijj*9tC/vKSh"Q9XZ؍e[^]UWVS}u hū"09[uYƉ< d.uE5@.B Zu hϫ"8X)@. d.9r  d. d. d.uS؍e[^_]UWVSu= f.uF5@.UB Xu h"8X@.Lء f.19r C$؃(t f. f.C$ f. 1ECCDžuPE  EujjY_t Vh "8XZVV_C[ٸ1Xj/V^Z@PPpC{G C_ Y^Et5uu XZYƅu h%"7_E UCS FC^1E E t)uu ZYt h@"N7XًE U<؍e[^_]US]SZ d. d.]UWVS]f{t hQ"S8Y^{u&{t hd"S7XZ{ t h"S7^_s{ t]WVqZYuh"S7Y^49uWVKXZt-~"ЅtP9uSP h"S{7ZY3 f.C$ f.Xe[^_]UWVS]E ?ƅu h"S27_X9stsF C^ j/u ZYx3WƉWC$8VPxfCu fCe[^_]UWVSd=@.thx-hά"LXZ@.E0hr"u%_Xu,0NO Ph"h-uh"55fc E1uE9@.@.ErFuuZYƅt)GE~SFPj6v}ӃEU1E1}E9@.@.EuuPZYDžttj$GPEPouGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP눃EUU(f.Mt@ESjjEPE $f.E9ʋE E̡@.@.EUMԉuС@.@.E؉Uܡ@.@.EU@.ESjj(EPzC @t,0fM Ph"h-uh""M3SGXe[^_]UWVS=@.thx-hP"IJY[}uXjj5@.5@.$f.jP@ (f._Zu hj"2^jjjhH%fHwjjuƃ y,10L Ph"h-uh"y2xPVY[y,0SL Ph"h-uh":2EЍXjS@ XZu hӭ"2YSWVA y.0K Ph "h-Auh"1j(PPV xV@.Z Y P5 @o.Zuh-hA"Bj(*-]UVS]@.PHo.=@.tPj |^@. -j:SsZYt"j.pS3[jh#SZYh*"hh"@.Y^ud0D Phh"hq"h->h*"h%@.u(\0D Ph%hq"h-j`s.Vh`o.XZe[^]USD.D.EU]SyPh"hx- D.D.MU ʸ"tSyZPh"hx-y "=XD.tXD.hD.PhC.5C.h"h-ChC.h#h-/$=@.D.D.EUSIyPh"5@. D.D.MU" tSyYPh"5@. "=XD.tXD.hD.PhC.5C.h"5@.hC.h۰"5@.u$5@.h">@XZ@.@ @t h"jK]UWVS} u=@.tWh"hx- EE]99ru4=@. ";]u5!#Ph"hx- {CPCPhȉ"hR=@.t R3C4,*-h"hx-\t}t?SHK))PDPPCPW\K"uSHK))PDPPCPu\+"<SHK))PDPPCPW\:"R@:{Nhα"PZYt h"PZYtJt%uCDPjW苖 w"?CDPuZY\"CDPjWܖ g"@{atNt)CDPjW w"?CDPu荗ZY\"CDPjWT g"@t=@.t/Rh"hx-A =@.thx-h"=YX=@.thx-j mXZe[^_]á8*-x=j.ti0UPXUWVS `s.}tt=h"]%[154k.5j.t=@. 11ɉ1(&:%e[^]USPu uh"jP]S莠ڸDn#c]USU x.Ruh"hSJڸ"]ËUEPh%"dXZffUS趼Ph+"h-Τh-hQ" *- CtsPh"h-蚤h-hz"b @*-XZ CtsPh"h-bh-h"* j:UWVS]} t~C7h"VzYZt:h*"ViYZt-hr"VXYZt#hyG"VG^Zt1 @uh$wZYt|1j}Wjj5.^e?E? EEEPWS5.$e[^_]US}thjEPjj5.]?w5{.hӿ"萟XZE5!#@uG"P5{.h"l G"y5!#P5{.h%"J G"}y5!#P5{.hQ"& ]UWVS(}tE 0iб]ع1XuEEʉUUfEfEu͍Uι 1EͶEjh'jSj V5.e[^_]UWS}t!]U1E5jh'jjjS5.e[_]UWVS ]} t~7h"VYZt:h*"VYZt0hr"VYZt#hyG"VЬ^Zt뮾 1uh$w衬ZYt|1j}Wjj5.e?E EfEEEPWS5.$e[^_]U }tjEPjj5.UЃu5{.h~"XZG5!#tG"P5{.h" G"Et5!#P5{.h"Ȝ G"}y5!#P5{.h"褜 UW}t5U1jh'jjjR5.}UWS}t]U1Ejh0ujjjS5.e[_]UWS}t]U1EEjh0ujjjS5.Se[_]UWS}tY]U1Ejh'jjjS5.e[_]UWS}t]U1EEjh'jjjS5.e[_]UWS}t]U1Ejh'jjjS5.ne[_]UWS}tt]U1Ejh'jjjS5.#e[_]UWVS] }~j PW5.K Rt$Nuj@EPjW0Ph"jej$pPjj5.rEЃf=t Rh"XZ91׹󪉍,ƅ8fEf;} 14zj 0P3wƒ 08t3h6"j D,ƅGʉLj Vj5.ƅ914}t1"jhM"sa uƅ5jhtj4Pj8P5.<hQ"hx-L[^1ۍ>1ʍu1ɉMfEEE'E0VhQ`5.虘 @u h]"j E<u 5{.hj"<u5{.h"h-ԛ ~<tP5{.h"h-赛_Pu󥀽_y-`9%CSh"hx-K j RZ<h"踗Xe[^_]UWVSE] h Zu h"j 1󪍕 19}J jQhF"\ ujQh"= u#Fuobu 4jVhK% ÅtIjVh"ڤ u'jVh"踤 uƅ7fDžjh0uhj P5.ƅp9؍t h"SoY_uu"-hF"S}XZthC"SjY_h"S]XZhI"SPY_u hR"S>XZS5{.5{.5{.5{.hc"}@tAtif@ffh"S蕎Y_`f@ffh"SdXZ(/f@ffh"S3Y_!u h"躶ZEVhܒ"褔ShUW$虔X4S׃X9uEe[^_] e[^_]UVS ] }t3h#V+ZYthk%VZYu E'j EPVE U:uy 3h#"Tsh#V֢ZYthk%VŢZYu E-j EPVE U:uysh6"jEPhU5.蕓 t hF"je[^]UVS ] }t3h#V8ZYthk%V'ZYu E'j EPV(E U:uy 3h#"Tsh#VZYthk%VҡZYu E-j EPVE U:uysh6"jEPhU5.袒 t hT"je[^]USUBBPJ R Ph`"F uEi"]6Sh"#XZ]UP}E 0EEPhQ5.t h"j8U}tqjhQ 5.Ñ t h"jU}t LHtpQƅRjh'hVjS5.+ ;fv1PWhW h"uWh#bLgQƅRjh'hVjS5.f=v1h"X1G9 5Ct9C LHD04%hN%hW %覎 {y0L%`vRh" 4%hn%oYXD4@%h "VXZ1ҀHu6C9s!DLPh1"+LBYXj :XCPShS/ Se[^_]UWVS,EE܋] h E^u h"jU 1E1E9}t3Vh"wZYtNVh$"fZYtAVhk%UZYt4jEPV U:u=v3h."jk1EGEEjh0uhuj EP5.~Er=vhP5{.hI"ьE1E܋U9UE܋EU܋ Ћ\ˉɉʉىӉ1Ɖ׉ Ɖf1u1u M ]1}‰E M ]SQ5{.hg"7qEEe[^_] UWVSEEu EBU܉EP XۋUu hu"j1ߋMEfEfS1j EP6j U:t6h"jTTdDG9}ujh0uuSjEP5.]e[^_] USUBBPJ R Ph`" uEi"]Sh"XZ]UWVSÉM}EU%qtE8uE8At=ʀ@tQVh"Wu;%tQh]"Wu# WVu  e[^_]UWVSDEU ]utlt"tWJ*P @ VBXHM}P @ j@WE4&hn<%VS蔈xw!V@4&S  HPw$w}txf@Ph"mutf@ʃ@t%"t"QPWh"VS>"t"PQh"VSՇf@Ph"VS躇1ۉ؍e[^_]UWVS]}hpVjSzPh "ƈ{vTh"賈Y {yj h,"蛈XZ,C@tPhA"胈YX,C t PhQ"kXZCȅt Phs"UYX{w j g_CȅtPPh", S C h:Vh" C t Ph"XZhpPjSuj Xu'tPh"趇j І W;} } <;u GVh"~YXujh "kXZjh "V^X>9tR;U }MuRlh "#ZY1ɋlhlPh<$hAlBXXh"Xe[^_]UWVS] }uh"^X1C9~D3Ph0"褆FZYj 蹅X}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u* @u h]"jkEtU{.<uRh" <uRh "h-m #<u jSRPRh "h-Hj1|e[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt2uBItu< }[yt ut܊ y_vCm t4\ 0H2N0H2N0HB]9uX[^_]À\um tf\\M t݈@UjPhB"h-肇jnzUh"}UWVSÉ֡D.PD.uhh@.+Y_@.h"h"hW7hr"W8_Zu͞h"Ph"j/ J. u.h@.Ph"h"赆h["h@.Ph5!#h"臆1X9ډ}Dh؅.$ $h"U .tWPjh.h?;9}~ڃ<# u5!#P<ؙPh"h`.UYuRh 2jMY[jx^萠1<$b1$j"XZh9"tXZ?e[^_]Ujh`.'U=ą.u h{"XjOxUSh{"h2j踛h2j講h2j蠛h2j蔛$hhh{"$ xVj"h"P莦h؅.(#j PSxjh$Sk(h.$h.SPS誨]UuPh"h-荄jywUWVSы0-:֍RD{@u1ҊBuT8t9s 0-DY@tJB[^_]UVSËHuPs8tIS8kC4`9s `R 1s0s4s8X{Xu1ɉKXCXtP Z1CXe[^]UVSu] EPu36~x9s)e[^]UWVS`ƉUUP 1ۋE9߃u*E|fE|Sh"j EPn~EEEEPh1"j EPJ~UfT ȃ0-DJu.D=uURkP U_Ce} t EPGYuh "1XZe[^_]UWVSS1}11#tAEtSWh"P迠ShG#P讠 @u h&h!"5WL }YCu}u#h5!#%EZuh&h&"jEe[^_]Uh+"Ph?"PhH"PhR"Ph\"Ph}"Ph"h-؁8jtU螙Ph "5+-赁. t5.Ph"5+-蒁E Pu5+-/. USÅtN衚 .twRtF .tit0 Ph`.h"QH . .u=.u2js .t#.0 Ph`.h% tŋ]UWVSEEEEujj}WjVP? @u"e[^_]ËEƒUt Ph"jBP ZtjjWPVu @u ]=.u5+-uhW %| ms5!#M;Ms"VvvPh"p|E f3#j z{X]e[^_] UWVSEE]EEjj}WjPSJ @u-u YtjjWPuS @t̓=.uuh "{XZv<9t's sss sssh'"{ ՋE荞 kT؋U9u FE1}h`.h="ZYdTEM9Mt?Sjhlj"8{ :1;{s֋TM4PhP"{G ,j zXue[^_]v e[^_]UWVS}}} }܃= .É΃=.tO=.u:=.t }u&}u35+-RhW %xz. 0hx-juV`N}u!Rh "Ez.Y_~7j SyX.~#.~}uڋUe[^_]уtut3]ߋMtu*E r4s6Ph)%4]ߋMEtPEPhU"b sPh#Ph#yXZM]ߋMtuuEPh\"]y$M] s SQh@$SQh#7y }uEe"e[^_]yE e[^_])xe[^_]Ã= .t.URh`.4+-hj"UWVS=.uh"sj-oj=P]Y^Xd 1Dž\ Dž`hj`Ph`.\PVSmJ@u!ڋ\==.jnDž`1Dž\YdX@DŽdj`R`PPQV @u!z0 Ph`.h"WBuh`.h":XZ& . .uPh`.h%Rw e[^_]UWVSWE}u = .R˃=.t>=.u3{=.tNu%"u25+-RhW %v. .hx-jWS]u"Rh "v.XY~7j u^.~".~uى؍e[^_]it1RE rGK=.tUPh1"@vYXUt2=.uUPh"vXZUB9|SWhȉ"v NuEe"e[^_]uE e[^_]te[^_]UVS]=.t Eh"S肄Y^uEEYH1҉jEPSEEUE 9u%Suh" =.jk8u8u̸]1PSEPuVuu0 @u1t = .1. .u}u}tPjUEPj "UENY^tF. .u}u}tjjMUEzjj "UEXZe[^]UWVS]=.t 'EEА18jjEPEPuu @uuh"kjESȁW5 u%Suh/"e =.xjjjuV+|W78u|1PSEPxPuue @u1Ft = .x|t1p. .tpjxUEY^?URVCEPVhL"jduVTqpPUEG$tk. .tjj|UE~XZEURtըEPthL"jd]SpjPًUE$e[^_]UWVS(+-8`.t f./.`.SV)WZYuVh.he[^_]É)@E̍EӉljDPh.?hC%h.0uUWVS`Eh.`~ZE&1]M;>r2jPRU$ Utj@uVRP8V3hV"WGjEPjh.RU4 UuE Eu1}u+E9Eu#/tj@uVRPV3hf"jGQ1EEe[^_]UWVSEUE5 .$ˋ .. u' . .h`.hv"[^=.tu*jtHu!u05+-uhW %p *hx-jSu3VHu"uh "oXZ=.~(j nY I~I~uڋEe[^_]1v{9}E0Ph1"oFYXt Wh"{oXZE e[^_]ne[^_]UVS]EjjEPuVuu_ @u Be}t Sh"jD. .tjIY2=.u Sh "nXZuuuuuh"ne[^]UWVS]uEEU E$E . .=.J. .t}jjEPjuV~ @tdMt]QM< XtMMMjjEPWuVI @tM;Mt W _j`.PY}e[^_]q }tuh`.h " = t)tu*Sh]" uSh"Sh1"Sh"SXZe[^_]UVS]E jjEPuVuu @ul} t Sh"jkEUEU . .tj cXP .u EPP5+-Shǧ%l&IuRPhLW$l uRPh"le[^]UVS ]EjjEPuVuu @u}t Sh"j. .tjE=.u5+-ShW %)l EU=.h RP` t PXuuh"k e[^]UWVS,EE̋}uu<= .t3EjjEPEPh"E܍Pk((U܉UȉMQMo XۋMЋUuwuM1BH(jjURPVW` @uCEԋU܋M؃t (9t$9uދẺE1uh"j 1C(9~ˋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPh+-uh"jUR#iUUС. .t7j(EY(}t GE܃t9]e[^_] =.uuh "jXZv$v vvvvv vv6h"i,뗍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph"|<Dž|tW< XuJHxjjxPVph/ @ut9xt Sh"j l%EpujjڍE_X= .t=19|Wh+-Sh"jUR&g jjUE{G ŋ=. =.t jQ=.u Sh "-hY[|~+t4Wh7"hG9|~ hf3#gZj gXue[^_]g e[^_]ÍL$qUVSQ$A QEjjMQuVRP @u}t Sh"j. .tjYd=.u Sh "GgXZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$hA"feY[^]aUWVS@]=.t Dž S Xuh&hUW$j1h·%RŜY^818jPSZ u.8"uShQ"9t8uShb"jT9tҀ8úw܉ h·%ji 1PSPVuu @u1t = .1ǡ. .tW EZ)APLr<$PUEV tV. .tj EvX1Pq$PًUESv e[^_]UWVStx|h`.ql`.$ .qYh .h)ȉl)ȉ .u`.u|uH1ۋx9t担tH%u5!#RPhAV%PPC뿃} t~|P+-xw5!#RPhW %PP|PH%xw5!#RPhAV%PPU Dž|+-|+-Ã=.( =.th .h "FcXZh .h`.hx".c EHv ht $h"<4&h"c_X}uC|@0|psPh"bY^P|p4h"b |p@h"b|0@.XZpt 5!#6hh5!#h@.yhh"h@.e·%ppu/hWh@.=hh"h@.)揃·%ƀt2hWh@.hh"h@.·%s2hWh@.hh"h@.·% s2hWh@.hh"h@.·% s2hWh@.^hh"h@.J·% s2hWh@.&hh"h@.·% s2hWh@.hh"h@.·% s2hWh@.hhɬ"h@.·%s2hWh@.~hh"h@.j·%s2hWh@.Fhh"h@.2·%s2hWh@.hhNW%h@.·%t7Vh26#j Vz^hWh@.hVh@.(h@.|p%Ph "_|@H t Ph"g__X|p(h$"R_j l^ }r=.= .u }|xXDž1DžtxTpj`SPPWt @pu\t|@9uߋ|@(9uΉdQpH ^dtNjp󤋅|@XPwP Y|XX= .uTE tN|@XpHv9} |pUE"<=.uh`.h "]XZ|@XPvh-"PwX}|ps E z-UEÃ}tP@uj-M Ph`.h>"jSs u|xtjh .h`.|@@uojjPjxt @uD . .=.h`.hU"|@@EH{$&|xtW|@8d uq=.:t.s j|xtjh .h`.S  . .=.h`.hp"[tx\=.j|@4p\J _+jjPRpx@PtF @pt*|p`t7|@4`&Rg ^Kw8 nЉX1ɉp`9ptkp`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQTA ZPtރ NjTCXpsR螾 X1.d1ۋ|;X4,F\s . .t%xQuujPtC`jjPSxt @jjjjPSxt} @UjjDžjjVSxt= @uIu8 u3 XjjVSxt @u jٺ`.|c^_9S [DžjjPSxt @tgjjٺ`.|^u6 Yuh`.h"5+-[ KjjPSxt$ @u jڸ`.*SU XZhƀ .lƀ`.e[^_]UWVSƉLH.j=P<_ZƅTt9sx?u @ƅTGhh#V*Y[.t+-+-8| 8Vs tG=^jh$S7e P` F<=t:+-M  T=.u h"s 41Dž81ɉh 1ۉtpƅY1j,T;_ZƅtF1ۉH1DžL1<1ۅkj=Vp;[ZÉluh-#VdZYu09@llh-#VdZYu D1j,S;ZYDt @Dha%VdZYHt;"Hua%PTh", =.jKr10jlPSH"!8uTp8h%V]bZY'p10jlPSK48l 9uSTh\"8uo8u48,0,90r48he#VaZYuTh" ډlHw^$&PmPaPUPIP=P1P%PTh"1L DžLpB^VTh"u D1މDu DžD<tTh" D$&;n1ɉjlPVJ<@l 9uSTh"8um<@4849Ƹ8r9us V\`QWh .h`.`. bTu"$,?\`P=.t 1ƅ[ƅZd1҉jPW| Bu@uUd8"u Kd0V9t8t Wh"t_Hwj"T PWh%DžN ZDž[ZDžE11RSRPPP讯 @u$Tu 11c8utRt+jj`.Ejj?jj[`.#jjZjjM`.jj`.\P`LWR^pP@@t9sWh."MY[P} Zuh`.h"*j;VWPSLPp @u%Tu 1M a8uS襩 Xcjٺ`.PjV`.PSm )HLjV\`e[^_]UE u@ t]UWVSuE 1ۄt[EtHvFHw 19u5CE  t)Etʍxw ʍyw̍Q lj[^_]US]y..`.kot=.t=.tB-ŝjvfAjO-S :UjhA"jfUu u蟣 ZYuUVSuVKP$@PVP<؍e[^]Ut.E]UVSË0>-u F0j PV x;3ue[^]UVS@Ë5(.=X,-tjtSvQZYuFl6j j5SHFSO$PFShZ-%P(.5(.F PhX"j@]SASfe[^]USQtP3=x.uSZ]UVSÉu=x.u VS<ZYe[^]UWVS׉΋]Uu E E!UuU[$t5!#[^_]USt<0„!1=x.uSZ]UWVSLEӋu>hh"V$ZY)ƒ?EljDUh}bSPEUDEj URPEU:*u%jjWSRPEP,tEuj>u% E9h}bSV e[^_]9`,-t3UVSRPjuV?`,-e[^]#.t úȘ.=.u̘.UWVSƉӊ>uuV.HtB1t.hp5܋.V=t.1҉t.hp5܋.S9=t.~؍e[^_]UWVS,E9p...}]6SP#8Y^y#...=l.u@. l.SsZ=X=&wAKw2ifF.7[nRfF.7D=,w$==!fF.7=XfF.7=KwJ=w$==` fF.7 =%fF.7 ===fF.7wfF.7lfF.7afF.7VfF.7KfF.7@fF.7 5fF.7 *fF.7 fF.7fF.7 fF.7Eۣ.Eݣ.Eܣ.eẼEfE1E@. 5.+dSj5.Ep.e[^_]USEPhht@j< 1ۅu E]u+hp"eaZtPy܋.X/.%T~܋.hk"5aYtP~yZy܋.܋.1ɉ \,-=܋. ܋.t.0h{"`ZtP2y.[]#~.hv"`YtPyZy..=. .P]UPUE.1J$& (U"U"lyU"U"U"ۍU"эU"ǍU"뽍U"!u,U" u...1UVSPh"_P_ZYX,-hx<%_[u%1ɉ x.Ph.[^Ht x." t x.A".".".Ư%."."|.!"y1ȋ.ċ.ԋ.؋.̋.Ћ...~1҉.E.U%tD.7UJ#u5!#.U#u5!#.U"r.U"`u".U"Eu".=|.t8=T.u/U".U%.=.u1..5!#=.u .5!#UE$̘.t8u.̘.5!#U%Ș.=.tt8u.Ș.5!#Ub#^И.t8u.И.$U"/Ԙ.t 8u Ԙ.5!#1҉.EPh5!#h5!#h.Ę.#$"EP5.5Ę.h..%" EP5.5Ę.h..[$#EP5.5Ę.h..[$Y# U%#Uu5!#.##t .n%Ub$ .tހ8tٍU:#Åu5!#Ԙ.5!#8t&jjPPul0uVCDE".UN%Åt =\,-u5!#Ԙ.5!#:t+܋.HPjRPu/uVtCDE"Yܘ.U#6u"ؘ.Uq#Åu5!#U4"…u5!#=.u5!#É.;u .e[^]Ë܋..n܋..^=.tg=x.t =@.uMU=.t=4.u܋..=8.u܋..1҉.]1.á.t 1=.ú.܋..ܘ.ؘ.USc=x.t =@.ul=8.u<܋..f.8t.8t=|.u.=4.u܋..!=.t.=.t9܋.~j CX]6]Uuj5Ԙ.$ =.u.8t ܋.Ã=.uUjlXË܋.И.q̘.bUWVSu M1+uAM]-}tue[^_]USÅthD$PAZYu "tEPEPS tt<`Ux& "Ux<& "Ux "Ux"]]ÅtVUVSQ覰Xue[^]t<+u;+uC؍e[^]e[^]UD$...|.m1.]UE t <-@t]USuZù¡.ڡ.ڡ.=.ttS蘯2XڡĘ..]US=.t.u ]SJX]US]SZ3.t]]]UuZu Y9Ã=X,-tUh("Xú.UWVSu}]E Et#jYu7u21ۉ] E-"jYut$RPyZYtRPjZYuÉE1ɉM EA" t9Et'hÃu1҉U t EX"Eo"vOԺu Y ̍1EEU҃Ut<9u t0G9Eu߃sڅu}EU e[^_],1E E"e[^_]@.B@@@ 9uUS]t=h,-tjh"XZh,-]Ã=@,-UWVS.@@ˁ1 }1119މM}Z .9t+9xu"9puUpP5@,-wS Uхtjh"FXZ뛍e[^_]Ë .…t8=.u/US@t &11Ҁu 0@4@[]UWVS$.$@(@u9t9pu9Hu,@;Ps D15.%uމuv@E9t(}9~u9NuF9,@<vԋ{9t utt=X.t @td,-x; @~QMh j ZYMu 1X.0 @@@xCSP{x B C{WG B POE܉G1GE@Gw x Ex.$@(@ EUF1҉E܉UEUEUEU9EM|!@uWE9@u E9@t`?@]juu@,Bu@ujh"[^&.M]艈@@h,-Ft*Th,-=\.1ɉMܻ.@Mt@ &T뾹 )QDP@ià u.u}艰0@4@Et]y*jh"XZ1K@,-yZ=\.u/@,-x&t"SVTRPO 1E 1E .ؙ@@^}t-=.uAEEPhUW$O.ZYEU艁0@4@=.u2j2X=.t!=.u+lt.8=.+.98t<WQ Gz8OW Q JMԍJO]É_ y z,@;F0De[^_]Ë .t&US$@(@ ,@1[]ÃÃ=.tCUu/ .,@w B,@$@(@1]ÃÃ=@,-xzU=.t,5@,-zP@,-5L.` 1ɉ L.XZá.4@uƃ0@u.jh"nXZ;@t.tUWVSu} .Uy 9}!@u EU@uG@E䋋@9u9t0E%@؉EPE9t8E;BuE;BtREU$@(@%,@1?E9ƉV.@9@}A@4.t&[^_]UVSjjY[t@.9t2ʋqY9t9rr}ы扰$@(@1҉,@1҉Ѝe[^]US.u1Q@t@h0@4@[ut RPPZYs@t.t]UWVS .t @t e[^_]pE11E9t:EP@ EUE@1EU9Ɖ}Ɖ׋EEWVZYe[^_]Ë.,@t H,@cUVS$@(@9}Q@u#%@Ћp9t.9^u9Ntv퉊$@(@,@[^][^]ÃUUx1ud,-]US.@uǃ0@ǃ4@|9t@@@g0@4@.1ɉ@@$@(@,@jjj@%Bu@ujh"XZ]Ujjju$!Ѓ@UVS.0@4@ut@@9} 0@4@[^]UVS]u 5|.q.Yh8@j.@1҉ @@1ɉ@@$@(@,@ǀ@ǀ0@ǀ4@XZtSYu .@5.5|.pXZ.@u@e[^]UVS.@ t4t&9tPQ Pχ X1ɉ @@uB u @JZ.t ǀ@P芇 1.j5|.*p e[^]Ë.1t@UWVSt/Bt/; r"H19|0<9Osr;s B1[^_]UWVSR1ɉM1.G-t.PS/0ZYuFFt! ̅ujh2"*j 1e[^_]1UVS]utO=.tڊt <^w7Bt.}t&<*u{t{tjnCPjnSZYuހ>*u:Vt3st!dt1k1uUE 0e[^]UVS h5!#jԈ hl"Dh.o h.e h.[ h.Q .x..|..p..t..h..l..`..d.hG"0D1[<=:tjh{"?j FWZPÃ$P&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=.tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=.u~ 9sSCM9sICKB~PR_<9r)S{Y"9sC%[tS[Z1Me[^_]U`.E1uNh.Ev¸u61-E^u =.t,-ED]U`.E#1uNp.E¸u601-Eu =.u,-E]UE=.tE].]USQ]uh"h .w?SSZt'؃@PCYu@Sh"(S5.SZt. S YtS5.j h ."yE .SEPEXZ .]Ux.E¸uH--E]UU 1}Du% ]UWVSSEIuRfP3#^X[RVZY1uEV Xt S#Y-h .jEPVPhuV)ZE8} tE 8؍e[^_]UWVSRh"V:h"J:Sh"PQOucjh"V=Oǃ u.h":Sh"POu0Sh"V O Sh"PNEWy Ete[^_]UVSh"9P9ZYu3h#V#ZY1t=h%V#Y[1t(VsZt ؍e[^]te[^]UWVSlht`ƍxPVĦY[{%=eh*"VEVx GShV #jh"V<"  1҉p1ShW  t t u@h"W"YZh"W"YZh"Wu"YZt<"u5vptp~HpSPV t!SjEPU)U t1e[^]UEԚ.U К.t@]UWVSSuE 8=.u ^9uO tu QMZYMuGCQzo Wto _Xu s ZYt,jjEu VC EC3FC^ Fe[^_]UU Et1ɉME U]6t E]鋙]áԚ.t);4?-t!Ujh .PԚ.@ UWVS]=.u3Ț.=.Ԛ.Ě.uP.Ț.ÀuĚ.%=ua%=tSSHĚ.%uF .A.Ț.9~1!PhȚ.ZYu(1Ě.K1=Ě.4LĚ.15Ě.=.t1ۉ.UU1;L?-u PS_/EZYKHA$d&}e,+1.#1=.15..t.8 1ۉ..= .vx u-x .= .w1ɉ . .5.GZq1..8\<1.I1.E1.:41.)91=..= .v6x u0.= .x Z߀x I.= .w15.1ۉ..8 u.8 o.oZ.Y1ɉ .=Ԛ.=h?-y.- .h?-_h?-[} t9s RUVh . Uuω_1.ItVh .. .XZ.8=.t }.tPj 15._.=EP[¡.u=. . .u"z.tމU&U; u C9re?-Ed?-E11ɉM .9t)9s"RUuV Uu ta}t%8EEF9rL< u+9sJu/8ENu9s,Eu뾉9suՉx1F\..tPLi Xj.)@P,..)RSPu.0e?-8uCSm<XuSA._WA.Wh Y[..t{}t1.Phؚ.o-1ҋE7_Z.E%..9.s.u,15../]1ۉ.Ku5.DY..= .v d?-8Huh"(ZuC%1.vȚ.e[^_],e[^_]UVSQM1uu .EQЀ w[jjjj uuuVtjh"Y[11RjjE0RPuuVuɋE@1҉PU8.uEPjEPc EUeY[^]1Ě.9.| .áԚ.t @@@ Ã=\.uUj11ҸgXUWVS\.t`?- 0?- .1Dž|P@$jjWPUVT:QDQhr"VXZ$fSftxRP8ZYx,E%=ufSfthP+YXh"%Zud P?>X~P?-1Ƀx tA ?-x t tlph"h#S|1ɉx =\.u:pl)ыt)PxG jjxPh"SSWV)Ve We XZe[^_]ú9.t9.t 19.‰USR .t>BE .Rd XE=@u$h.t t7tut g ]UVS=\,-u=x.t =@.ut/l.p.u ujjj5t.RPV p.u)=\,-u^5...1ɉ .-5...1҉.u H5zY6Y5..e[^]U]UWVSt e9ZƉׅu‰ .$..=.u0t;5 .$.}jjjG 1..ld8e[^_]UWVSQE)ơd.ud.d.ǁt#t1 2ux%d.Su5d.ád.ƒd.`. t;x- st jk1j1Ztjh%"蹱ZYtV1VJ)Xe[^_]USVáh.$N   tw #5X.jCP7tW6%I/f5D.S5H.5L.q1L.?E4X.؋]`d.d.PS5<+u C< u.tP` Z;u 1.S.X5X.jPCP=\.SB1X];!tl.tP` XSQ6l.Y=\.uil.uh7"h5!#XZMh7"P=\.ut71ۉD9tt KtXEC<tiи e[^]Ujj#UP1҉ .YYu . ыuUS]t CPX]UPKPEEUWVS<d.܋.@h.e=h.t1h.1X.\.L.=.t=`.tj轳_ .t x@jB8.<.Yu*:t!u5|.YBZujQ_=x.t*:t!vu5|.&BYujZ1x.=.u1.=P.tjh"1P.:͹t hS#Xt?uh9j::_X Ws^Y=.we{Ã=.Zh.$/t.-7iCЃ . jS_ZdtehT.X.\.^=h.t1ɉ h.d=L.uD.u_un@.ƒ@+t2tA!uI1D!-tȡL.=@.uLC1@ ‰D.j@D.]=@.L.  =tSZHOEa<H.1EЍEPEPEP虝L. tDFEĉE=H.u Pw P1_=E@Ƀ}XHNuEЅ:EPh" 15@.HY=L.S贜L.YuSEЍEPh"CH.L.D.Ht!5D.h5!#5H.5L.. RߓZt5L.j1ɸ/eu;&7C!$&*t0@tg!=h.7u-%d.=T.d.=h.7t%d.d.=T.=h.7g=h.7tWjh"j#]S*^SvRPσH=h.7t(3d.P_d. tA tS u݃=\,-u yhK5h?-jYO =h.t)SZH Fu]EE1҉UURPvƋEY_tPnXi Fc $&j1ɺØ#7 X.19\.}H.1;X.\.|ϏX.\.X=,.t5<.58.G^_jX.19\.}H.1;X.\.|mX.\.j1;X.\.|X.1ɉ \.=,.u+;X.\.}5<.58.YFXZjj5X.1;X.\.|X.1\._jjQjj5.V=jj5.v1;X.\.|X.1\.=,.;X.\.}ze1;X.\.|X.1\.jj5X.1;X.\.|X.\.=,.u5<.58..E_Xjj=,.t5<.58. EY^1I+X.19\.}h.=,.u5<.58.DXZjj5h.K7 X.19\.}h.jj5h.8tFm謹G5D.1;X.\.|X.1\.D.Y5\.5X.F5D.q=\.y1X.\.T.X.\.d9|d u=T.tX.d1\.T.5T.5X.H_XX.\.19|, GX.\.19| G{RPEv=\.y15X.5\.5D.5\.5X.YG\x-1EȍEPhUW$=|.uEtEPZ9%t0.@.,..(..jYj譧8..d.1;X.\.|X.1\. d. `.`.d.1;X.\.|X.1\.X.15`.Ѓt+Ѓ$5`. t d.1;X.\.|X.1\. X.1_5`.x1FP薶XdW[@.0.15@..,.1=..(.1.h"?맃=\.j 4?-" =\.z5|.6h#P u jh&"5|.P7YtjhA"ԝXZj ?-$t5D.jPoPt jhl"<;X.\.|X.1\.5X._vt\,t4uj^;X.\.5!#}"EȍEPhy"t jh";X.\.|X.1ɉ \.5X.Zi;X.\.5!#}"EȍEPh":1;X.\.|X.1\.5X.XuMjh"@/1;X.\.|X.1\.5X._u jh"V^ u 5D.RP>1;X.\.|X.1ɉ \.5X.ZJjh"?|15|.V`2_kPYt VVT2D.1@.P臇Zu egjP1D.@.j1ɺzm" =\.u) ?-$t,#j=\. jh"[Mj1ɺ"L_  1?PSq'@0j1ɺ">^  Sq?@j1ɺ";4Y u lpSrj1ɺ"%[Ze4 t u.Sp_e$.j ?-$% j1ɺ"^X.19\.}(.#(. .X.\.@.;X. \.} X.=\.+X.YX.19\.}(.#(. .X.\.X.@.1ɉ @. a@..=h.it Dj1ɺ(%iSXZ=t.tP.̯UE=.t@]UWS]Sj"XY1ɅxЍe[_]UWVSu}t ME  u TZE EE EuEE܋EEM9EEujEP5ǃ Ethuc;us^ .EPU9@%=EtPU9rtEt>WSXt1E9EsWQMS_ZHMt QXYKEPU8EtW-H Zt WJ YWEP.XZ}tE)}+} MJx҃u̓@tAu=. =.B$}mu;܋.}Rj#;k.XZ끍e[^]UWVSÉU΅!CEC1ɉ}M98P@uBgtB$@ur5X-(@t Att+e=. =.B!5܋.V9}Pj#Rj.XZ믃DuA1x8tLuxgt;AyuȍIty@8u}O@Gdufu die[^_]Ụ.ȣ.|ģ.r.]gUM Ụ.y1E E"]7]UM Uȣ.y1E E."] ]UWVS\.Et Ejum[^xPƉUY9E}jV= XZu WXjjjWBu@uSA W^_VSWEWMș}9u9tSA 륉 Et;u{Mu {+u{Gt|3t|3uHVSY[|3Eu3|3nu,|3du%{GE uVtXtuSUES> Ee[^_]Uhh`@-hh?-jh"jh jh"h"htjh"h"hjh"h"htjh "h"hUWVSEu 9.9.9.1D=GD=EPEPYXiuЃueue[^_]tKv1u u CvtCv u dudt4OD=PHZE܅tPX둉؍e[^_]UWVS(ÈUS膓Š[:E1Ɋtu0<\t0<:t< u)ЉE؍}ܾ &}1Cu1C뺉UQMYƋE9ƋU| u&VMQRU Uu݋E)PVWXZ;Ee[^_]ÅUSP[u(h%"zEEPhUW$au; s=.tjÃut[UEPh,"F=t3t. tSrEEPhR" ˨Bu@uEEPht"XZ]UWVS}] EPƉ$PEwU‰WZY1E1ҋG9t#39sVuS~ u \3d}t8d?-ECG9rI8e?-St< uӋG9s,uAډӋG9sEuA1C\e[^_]UVSu] u SZ؋V9s 8u@9r1e[^]UEM u@ 19sA8uH9s xt 9sH1]UVSuV"Yt]ujVx"XZe[^]US j]SBXZ}u}tS5|.!aY[`5|.l"Zt-5|.u5|.j!PSj5|."1|.أ.ܣ.У.ԣ.]Ã=.t%|.tUP!Zt 5|.Xá|.tUjPc!XZ|.á|.UEt jPB!XZUt P荂XUS]jSZYxIPlY=P.u9]EPh"YZat5DOtAt Xdt{ouNhSxU@,-XZFj S-@,-jjjPBu'@u$5@,-@,-Yjh"y=@,-y]EPh"GXZ]UWVS}9=|.tQƃ=|.t1 Ã=|.ttVZH V5x.XuV~[1WQP:`WÉh t,DždW Y]`\Rh"`<YZttV _u |$W=& XZtu hC%Vhǧ%WS}tjSY^y Se* ZPaX؍e[^_]Uh"ZjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'|.<%tx.tRPTY^CGjCŚXZutKH݀u=9us8Ft38Ft1 |.<%t x.tQPSzSÃCFe[^_]UWVS]S^u1jjjSBu@thVS ~ˍ19=.t)RP芨ZYu FSW_XSjW]ƒ =P.u9P4Yt"SWP;5Pi:vRgZd1e[^_]UWVSu'X=\.!8u#P^h+":PEyZYUt""RUiƉ$_YPQkL$QMWd?-Pe?-PURh4"MQV$W' tXUVZUtRhK"PMCG ShА#P;CV[' t'YWY>u V9' Z S0' X؍e[^_]UWVS}1ۃ=\.u\WnX$S~WhS"SPVuPǃ VP5ZYu S& Y1W& V& XZ؍e[^_]UVS]h#S^Zt(h"SZYth4"SZYƉe[^]UVS]SYuVS)YZu]e[^],~V&~Ze[^]UWVS u= .h\.ZjXhc"Y_?|uC؉E-uEh#V_ZECHtjhW"!u[^VuƉ<$T$RUF}WuURPpW?% V-% YtsfGftjEPV Ht-WZKtcu_E18E h4"|XBEP;E8E 0h#|Y^WtZ;u S$ X1ۉ؍e[^_]UWVS}u =\.j֐h"nZY~1E E"e[^_]sVWSyE4$nE<$cUMT$RU{EWVSURP$W# V# E@u# t]e[^_]qe[^_]U|EPuFQXY1xE%=@UVS|u=L.u1V[t&V$P{VP hB-\|PVPZYy VjXG1ۃ=L.uu#jjuuuulƃt*u Ee^_]+e^_]W|$wUWVS4GE̋G EȋGEċ7uu2,=.u2=.PkD.RPWVcWV4Ɖ׃ - $.uWVcY[uu}䡴.Eu藊t ub EUcuu3uuEUEU9uE.$ uuP&EU ~ÉEf=<.Et& t uEUĆ t t)E]Xȉslz( 艆E }  Eԃ.g} t}uS*(EƉ׃}s}t$ @._E@)1ۉu؉}Z~Nt;} t1҉U诅RPu%à }tA臅E؉U.襅t u`Ɖ1x. <.uM9)ډƉ1ۋM} t} u.Ɖ> t t u* uxuuل)ډƉSDL=<.t)} t} u}t裄ƉE„EWu؉}ܹ11Ƀ}t&=,.tM\RPj =$ Mj}!SQ{&uu+z^=$.tMWVuuRPEU$=p.t;}t5 u.t t@t!e[^_]g_鵃e[^_]g_UWVQM1yHL¸u 1=@.jjPWVeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|'EEH=.ukD.9EE}11軁 $.uEU)juuRP蹁EURPǃ[^y=p.tLۂւ t u, u.<ͅ u@)蔂.訅 u B@u2E؉Uuu+ZYZuu*_XE؋U܉EЉUuuY[1uuЋ}EEÃ.Ex u5#Å^IJ @.MCEă=<.XmRPSO!Eă J…u =@.~1҉x.uȉ}E=<.u  t umU4 Ut u uU Uu uE9ƉM_u}EUI}u}uEę)ԃ=<.t t u}tu}EE9ƉMq1҉uȉ}uȉ}̺1EjuRc"uuvt EЋU=$.t.WVuuRPE؋UEЋUԍeY[^_]aUWVu} ut\WV趀ZYu[t t u݉5H,-=L,-΂Hw t5P,-=T,-e^_]UWVSu} ucWVHb xb)ޅ~j2ajjjRPV tEjajjRPM)S=,.Ee[^_]3rWVEZYt1ۉ] E"e[^_]E\j`EUj`EUEU!YY@tE9ƉEU!ЉE9]}O}t-9uE|#jjjuuE܋.)HPt%x=u\P-Ux=uOP+Hx=uBP=ÍP^wƅPh"jWf"5j PWO‹ 9u5!#%#ʑ.Ze[^_]Ë.;.~~. . .‰.US|.X|..(.[]É19F-t @uUP`iYt̋.tԋ.t.tċ.UWVSD.UjS EjS }tUuu" YXtP5.} ljE5.5. 5. E.E.D.XZ1e[^_]UWVSÉ։9D.~..< +t[^_]UWVS׉ˋ5 .V .Љ[^_]M=.tt*ttt t XÃ=P.u[USjm5p.~ZY"t:t1ɺNC=.tl#t1ɺ*C]Uht#讽p.PYZt p.?"h#艽l.PƽYZt l.#jh=U.jh,U.D.h.h.ނh.Ԃh̦.ʂ hئ.轂1.ZU1}]á..U.1|.1 .9.~". ..1ɉ .@1......\...h......h.(h.h.h̦. hئ.1҉.UWV=\.uu uƉXZ11$. .u=\.u u$ZYt.@=$.tʺ@b P,-T,-$.ut79MM |-M9 H,-L,-U |.@x@.c B.9|.H1Ҹ WVY^1 tj uVRP;FVCƃ1.)9~1Ҹ G19tD=G1Ҹ |..e^_]á$.t.=\.u .DUS.9 .~$.<u.Ph.€XZCԡ. .|..]UWVS]u }Eu@0tjxYEe[^_]J=.tW~Z=.tw/P'x_uSQ~[ۃ .~K1S|YuSWV~_ZV.t2dZYu ..DV c_tW .uVb^ƒt Ћ.V.tcZYt t؋.t.tȋ.Ӊ؍e[^_]UWVSEUMЃt.} u)}u#=.Mh.}tuEPjEU RPu ugu=.t[.tR E .$.ut;UE }EU .$.h.u=h.tr1ۉh.1D=h.uf=h.uJ8u u1ɺZYG9{Ft.1k .ك}u E1O. . E1~RjEPy .1҅~ .TRPuu&Ã=P.u}u9EEEE55.+5.Ee;5.'EPv_@.9.uY=.u=.uEU ..1=.~+9=.~.81ɺGh.w|Ym19}E81ɋUG@.9.|1}uEPh.|XZ.9 .~Չ19.~=.   .<<@B)5 ...9@.}1ɋ. JKݸe[^_]UWVSƉP[=P.t<.+.;.~u u1ɉZYuFu1e[^_]UWV։PsWV ~ e^_]UWVSƉ19X.~ `.t X.)C1[^_]UWVu} =P.uWV1ZY ie^_]á .L..H.áL. .H..UU1wR5p.3uZYUS]1w%SZ1uS5l.tZY]UU1uj jL1҉PPYZUSE] xt+uxxt \tf1҃‰PTx6@E&9tu!ـuJAE&u'@S$Yu SZt놸]UVS] uVjSu 93sPuCZYHte[^]UWVS ÉUu} .E졸.=P.uuS.Zt .1..dSPEZYtJHWVM^_.xt .Sh. yWVMZY5.T 1.Sh.xh.k. .Pdyh.x.@}.2.@.9.}%h.xX..=@.9=.| . .؉ESjEP8tU$ t9r)ډh.w5. 1=.[^0.t .u"uu} U . p .~@9.| .|t .D0tu u. u#uWV11ҸJt1Jutq.ЉERj]S*sƃ .E9s=)У .RjSsNj. .?4WtVL).~뫣.m} ..=.u.PapY . . M9u3_u(t M:.t E)M Ma_uM.UK_uFM@t>SrZt .E) ..PoSPYtE u1. .t =.uuu} U .+|.4G- <.~9|0G-)ș);@.}sD.)WV(%U ZYu K=.tw.PmYtu} U؍e[^_]=.t+=P.t"SqZtSarWV WVMUmZYe[^_]+ UWVS]u }.t4 u ti5|.5x.1ZYt 1. .t =.uVuR=\.. 5x.=|.1P.T._@X.1ۉ\.i뷃=.tH=\. X.`. (=.t\.unX.`.ÀuWV1҉ZY%=u+%=tSl\.5P.=T._1%ul X.AX.`.9Ph`.'l[^5P.=T.th`.lWV`.. 0X.1ɉ \.uVF-S-{XZ1jjVM u뾍e[^]UE1҅x F-]=.t&.tUSJZ P+JZ HX[]Ã=.y-U=\.u .1\.jh#A5ZYá.xW@d.UWV1ɉ .5.=.,9Ɖ}jh#5.XZe^_]ø. @=`.u1`.........1҉.....1ɉ .UWVS EE} MEE..t"C 9Ku}9{u E9C֋s..t . 1.ЉpHMH MHxC;4-=.u`.PHE8}.t'Xp9ډ} EӉEEډÈ}tE죔..@B [^_]ÍL$qUWVSQQEU=\.t E]!@u 111]9؋]ع5..tF U9V}}6E9F uE9Fu N^*..1=..~t-uF"Hh$(V(h"( TEj舦C'j9jWj7Ej by uXh#Xu>h!":tu R5_UVXtˋURUÉ<$L$QMt5蔻WPURh]Y%MQSw W^ _urVZ5YS謳S? j=uUu-jVj8}t&u'h#'X,j &u& VC.u蜬X1҉Ue[^_]UUWVS]EEEEuu OZYt jh#hr"S轒YXujh#,XZFh$&S&h"&A%j 8jUjj 裑}u}u)NÃtNN@u,E UM;M MM|E UƉ @tt t MÃuV艕jj (j`Ujs7B.jTe[^_]UWVSu6EU_}u }tcjT/Ɖ[u u11j:/Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k.GPw'k.1.'t'.#tUEEPh"#**YX1ÉUS.w$tX.'^|..1....tP. X1..mNt jh4"g܋.K |. ....jh.{/|...Y[뉉txux ujh9#5)XZ1]UVS.1۰#4t'5t C'Ca1ɉNF FFFtPG Z1FC6ue[^]UE]UVS E%tYu EP.UEY^u uT@2M5|.sS CKCtP Z1C.e[^]UEt*xu x u]?@ @.]U Pu]jEP-UEYYut@ |. ...E ..tP Z1..UWVSPEf=.uJ=.uA=.u8|..1..D. ..tP _15.{u#jPs蓾Cst 1ɉKs {SC;|.u RWV UP號ZUte[^_]UQMt|.9PtjhF#&XZP@ UVS]u |.1k9.u$9.u9 .uPa~#4t P'@5u1҉[^]UU19.uǀ .ǀ.=u]UWVSu薾[1.t:PPV豀 uE..1 1҉.YS" Xue[^_]Ã=.UWVSu h#ut. C Suu.ue[^_]j }WRP` su sʽXh#VZYtVWsPh_#u|tUWVSEPU8mEP8 UtYÅE8 u@Ej URP!ƃ xuu=܋.E8 u@Ej URP Ѓ xCU: uBU1҉SK C9~CCtP Y1Cu,CZe[^_]USE] =\.t1E En#tS_,L.XLt1ۉ] E#u=@,-x1ɉM E#^S*áL.ZtP XS茫P軦L.S 5L.K]s@=@,-y1ɉM E#]J#L.EEPh#4#XZ]P.S-x$Ujh@BRP܋.RPD.USEtzE 8.MU u4@E Qh%RYS- }t jh#}Qh%RC }t jh#kD.S-aS-yD.EEPh#>Ph%#j ]SlS{~P|0uD]EPh,#"XZ]áS-x$Ujh@BRP.RPh(.USEtzE 8.MU u4@E Qh,#R<S- }t jhR#}Qh,#R& }t jhj#k(.S-aS-y(.EEPh#>Ph%#j ]SkSy~P|0uD]EPh# XZ]US] }u!jSŽYZt]EPh# XZ]US] }u!jS^YZt]EPh# XZ]UWVSUE t tP(.^w=\.t1ۉ] E#e[^_]/ P['PR蠗?UZYt]e[^_]3"SƉ׃utS莗5D.WVe[^_]USEU tXtugR%(S-YYR&áS-Zt=S-tP XS|P諢S-YX]] S-EEPh#QXZ]US] }uC=.tS'.Y, .hC%rrSlrXZE@]%r]UVSE]  .E.* .#tRGYEEPh#XZ]UEtHw1E E#]X.]U}u=.u]g.]Q.]UEu=. M.]UEu*=.~!EEPh# .XZUEu*=.~!EEPh#.XZUEu#=.t=|.to5Bu @u]]UUE t#u?S-^u2@t+S-!S-PJFEEPh #@ US E1ɉ . .E 8,t)EPh 4$E P }t jh- #3.E 8,uf@E EPh 4$E P{ }tjhE #XZ7.05.5.hf$j]Sa]܍EPh_ #u]UVSE] J1 RD+~vQQ r/d~Q wG$E&t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPh| #1CSPh.Y.E sEEE sF@tK@sN@ sR@sW@tY @AuU9uE-EUEPh #XZe[^]ø=@.u=. 1=.áH. ܋.+.UWVS }8uMEPh #Y[1bÉUP]m$@PƋUXZt=.t <\u {t C<$ut PWuEZYtFFC؍e[^_]U@uPh #j*h@.^PRh #j*h@.^@.UuBPh #h. .UU1t 1BS]UU"t B tB]U}ou<¸#u1]1=.U..EEPh #KZYUWVSu ]E0`_18-u@JЀ v#tuKuEPh #&j uP yu˅tӉuEPh #Y[뾅t1҉t؍e[^_]UWVSM.tFPtu)QjP_XD.ZjPEP 15.1ۉ]1U:BE<-t><$<~,Ht<+tO<9 ~1EM؉Uu7u*à U܋M~ZEE܃߃A<vG}-tA9u}t%9~-7rcZ9Eىu1ۉ] 1ۉ]EFt}u Er]$I}t}t E1EEȋu} t tE Ee[^_]Uh#zYtPϒZ~S-øU =.u[h._VZtL1.EEEEjEPj{ M9 .t._k..;EMMEEE=.t=.t=.uS-=.tuPjEP{ EufE=.u);>S-9u .&P\Xʃ=.t ƒftըu1ɉ .uu uz 1҉.=.u&u.@.~Fj.Y<1҉.y! q8mp8#_M9 .tu1 .Ujh.TUQEPEUUWVSp0 u`É4$`|$WVuho"WPCR؍e[^_]US]S̿ ZuSh#h. .]ÍL$qUWVSQ Yq AQEU}WRPq1kˉE؉UM܋EuƉeWuuRPYku؋}׋EUE؉U܋E!E1҉UԋMЋ]M]E1E9M؋Er1EEEUeY[^_]aUuujjdu uUQMAQ jhi@BЙRPq1U EEUiEi@BEjEPxXZUSS- .t,S- .Sh .5S-v 9t .]UES-]Ã=.t 1.s U=S-.r|S-PS-M1.E]UVSP.t .E1.EPSXZt'u> E.Xu{ VoYCe[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uu}MQuuRPlK}Њ# u؃}yC-^SuIXZeY[^_]aTUVS]1)EM}I#uyA-NQu EIXZe[^]ÍL$qUWVSQ 1AEI1EEEM؉E܊PЀ wPwW PwO79ʉMЉU}?jjuuuu}W/;jjEԙRPuuW9 ]F8M덃}tE0ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPwW PwO7;UU}AjjuuMSQuVs:jjERPERPV69 E8늃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPwW PwM7;UU}?jjuuM1SQuV9jjERPE1RPV8 E8댃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%.e[^_]US5à Hw ot tSRX]UWVSu}  .ouWV"XZE e[^_]$=.u`~hȋ.WVhS-nċ.\B1s9. .e[^_]@UEU E 5!#E5!##]UVS]u .uu ]e[^]S-P-ZE #E#؍e[^]KUS]tu uR4=YZtg=. .j ZQuj>X؋]UWVS]uE %=`.t >t:SW$PKfPjjjjSPwf$9twV} Xnjjb1=`.1҃=T. PSW ÃtW< _}t-jh#[^tPB6 ZY>1؍e[^_]US]tP3 ZY1]U1}]UWVS|}ue( u V[E E`.x9s^U xu Yw 8u 9Ut 9t'B@9Uuu>}1҉W1ɉNG랋E10E18](11}$1ۉ]]uuPEPjWu ƒ1ۅtEUE}yȍI|5xj9E E HMM9|_y1UE1ɉ e(s )؉ùE(tE}|9|u1Au߉؍e[^_]Åu1뎋M1yyuu$5!#E<:N<%<.uFu RPY[ +!@ *u5|.蜋_vG9^.1u؍U؉ƋU؍C<6$F& L.1Jk@.RY19. ܋.{9)ISQRP_[u  u11ERP[_19r ܋.+ .ISQRPg_1H.N5|.5|.P5|.PDwSң x(t u(5|.pRY EӃMЉ]1۹}9}RP薿Y_9nRPZXZH'u70EЉUsӋEЋ}!@ȉ9څSQZREЉUXE E)ӃMȉ]1۹}9}RPϾY_9RPuu@'u j ]SRPlWIx u ȁ`.wtL.1&t b$EV/";5|.KZtP X@=L.`.`.e[^_]U5S-US.=.t¡S-u@.PE1҉.]U5S-*UWVSSË@ 1uuC1uEl@tg}tC E;P p$}p tJ;V ~$}@}tՋpt%lj;Pp|;P p$| putC C 1Z[^_]UVSË Bpt9QuAACPrt[^]UVSË Bpt9QuAACPrt[^]USË@tP< Y1CS5Z]UWVSNjXt 39s|=jjj,VC 31CCGtX_CPSk,C e[^_]UWVSÉυu/1ɉH `.`.13CP苟 1ɉK^։URGZ9Us&RUjEP!P藠 Utܺ1҉S `.t `.SuWV>ƒx6Ct P 1CZV]G@$jCVP3{1e[^_]UWVSE֋xtBE3ExMAA ;NF |"Gt=NjEFOW9M}ԋE9G(u։NV ΋O W$9M|-G뿋EFOMOMW(]9]]|~E9G(uˉV;NV |9Uu=NV 9Uu9MuuwG\_ t;C$uE;C u K S$=EÉGxG tC X_ h9UuC;G$uM;O uFV G W$WtNZ9^ u;JuurBE(ÉGx GtCX _;C{u 1szp9uHtyt1ۉZY@9Zu9u E[;Zu;Pu E2[1҉PB;XEu [^_] [^_][^_]m.uU5d.Z1=h.UWVSE؉U܋uE)ȋ} )ϋ M]܉M]UUX9QDP9u9u>EU܃EU9EE} Uฌ.9}EU܉EUC뫃[^_]UWVSEUM}EȉE΋E?UtW tP9sFu h@ RPMEUu  @P4E4MEU Cuu h@ 7PMEU9r9ut6F5l.jjWuE)PV5h.5d.$'e[^_]1d.h.l.t.UVS=.t 5.}uuf.1ۃ=.uDSgYuu C܋.H9RPSjY wyr5.e[^]UWVSP,-ET,-E@u }H,-EܡL,-EH,-L,-P,-T,-=.u e[^_]=.t11܋.H9~qWEUwZ}u}tQVkUXE9E܋E؋U|59MEU|!Au#uuoWZI `x t e[^_]Pe[^_]UWVS]3t~v ܘ V֘ ZY1CCC ....e[^_]Uh.XUS]d.#t-=.ujh#XZ]1=..E]Uh|.'XUVSu] t1ٸ|.t;pX[^]UWVSEUE|E x.p$l܋.h5D.ux.tXsmS趏 Zjj1CCCj y]e[^_]v x.Cx..e[^_]U€u1=x.1]UWVS4..EU衠..E܉UtE؋M܋]MjEPjujuuu $..u}u܉}Mut}9Nju|M܉]E܋URP ZY..9E}|!@uc1}9}}Uuu[^tDjjuuƉ׃t$EUEUu}M܋]Eu׋EU裨..E܋U࣠..,jjuuEU}u}tu܋}뙍e[^_]U jEPXZ}u}t j)jRPuujgUj1.=.u]]USj5L?-#ZYt8jٸd.Xx =.u=.uS1]U=p.u `.`.d.l.]xUWVSU EEt :CM@tE3l. s+jh #Eu jh#=.=$.=.1ɉ .MMM1ƉӃu]5D.+PXZe n=.=$.jh?#_XE:jx^@=.@1ۉ..1EPMd.Zx. $. j1.#X=.t =$.TƉ.u}tp܋.xu }@u}uQ܋.HEP5D.X}tW&jjRP艞ƉӃ*W ƉX}CjYj111 ƉXF=G;=܋.}W؃&MxuƉYjZGMEPjEPjuujjE Mt=.t =$.tZ}~TJEu2EUutjEU9u9t5D.RPy =.t =$.tjFXEe[^_]UhjL< .XZ=.t.Uhבj#< .XZ=.tUE]Uhj; .jjm=.tU}tOhj;YX=\.uבPj;hj;jjz;hjn; 2jj`;jjW;jjN;jjE; jj9;XZUWVS.1҉.tijj ;/jNjj:jj:jPG$hבj:j. tH=.5܋.y9=.u95܋.t܋.@h.h耲.t=.tj"Xe[^_]UWVS E։ϋ.SRU-$EuUR3. u.{tUM tuWV袠C SXZ1e[^_]UWVSSE։jj)u,$@PCuPs {E C}u1C%uU,$@PCuP؍e[^_]USS-S-t%CBs襃 s蝃 S藃 1...]UWVS5S-'Vh*"P"= Z1ɉ .u+[ÍhVB i!tSVq, uNJ< t< utZ8tPt u9_8bPjP蛾 u1Px^u ȋ8t6t2\uG@x9tzP‰1Ҁx$‰uH11WQщ‹MS-S-PS-.ZY{#X=.tS-..1e[^_]UWVS u!b1ۉ.S-S- -TÅ515.hQ#AP>AZYqI&STYu)Z(lj4$($L9QZVh`#P 9tVB Xh*"Wp6W. f;?ScXYSTXjjщ‰S-S-PS-. VhP th=.t -tVa9XGP'_t u Ƅ@t Vۊ[ u0- u -DH@ZutfTP@tCu* fLHt@u C@tC fLHuDPttDP@yulDP@tG UDH@cBVQ8Zt1...%S-S-t..1e[^_]USS-hk#S(ZYuwhq#Si(ZY¸t_hx#SQ(ZY¸tGh~#S9(ZY¸t/h#S!(ZY¸tjS?ZYxP@X1]UZu E ‹E2ttHu jh#jh#jh#XZÍL$qUWVSQ .p x tWV虛ƉY[jj1EUXZ.uBEPEPWVNE؉U܃E EtEU}u}ujh#=Y[=\.tuuuu誗=P.tEUju4P4ESj:jEPuuS"4(eEu| S| XZEЅu u؋}eY[^_]aUWVS. .]11~1t2S-t AFKމt . .[^_]UWVS. .]11~1trS-t IFK݉t . .[^_]á.á.Ë.tUrIZøUjZujhh"-=ZYyjP=ZYxU.]øURSjEP5.hU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tPz Z1CC]UE1҉P]USUBt XZL[]UE]ÍL$qUWVSQʋEqyIZJ ZrʉWVEZYeY[^_]aUWVS]E EC9C|WtjjWVRPCPltjs3ZYtKljE3y XECHKM e[^_]US1;]}E Pu[CXZ]UEU 1ɉHr2P UWVSS] EEMȋEeƉϋE EtuuWV/M9u"9uu uEZYe[^_]Uju-jh.UE=.t&uf=|X-tE#]e.@]]UVSp.1=P.u.1(h\j-XZh\j-Y[h.^tTjj,XZjj,Y[h##4^.u 1"15|X-=.t j[P ֋5t.T-t,PVq!ZYu.8@1ۉ.#Z8,t@8u݋8tH5x.R.PZY.@8tSXh*"5d.^Xuc5d.h "Y[#Sh$S5.I& BP5W-P- ^ZtbShV  Nh%P#^Zu @׀8 uS Y #h-#P#ZYt @׀8 uSX'#8t%8,t8 t@Ћ8tH5x.R.PY^.t ScZ@.P 0y#Pe[^]Ud.jj)XZUh1j)X.XZU!`.jh@. -Q-y ;-| tx-J x-Uhx-PXZUWVSREƈEj}W5.$ f=X-tk1X.5X-DjW5.i5j/=X.t.V]"Ph7# Ktjh .5.# 럍e[^_]USQhN#0jj(jj(| SÅt4EPZ9u< hT#b0jjV(jjM(]jj?(jj6(X-j/SOڅtPjRSh-h#jwhY#jRh-h#Owhe#j7USQjh#5.2 f=\X-t#E tPE Z+u}f= Y-t WVh? #WVh# jh.5.)h@.jj葦e[^_]hV #{&X UWVSEhVh#F 'jh,"5.Q)jj!jjh.jj(jh.5.\*赼à yh #%X11ft#j~ƉXPgY~G9uAj5.ۋjjjjjV Vhj #rjf=|X-tj~)RPh| #ejh.5.a(h@.jj3jj# jjXZe[^_]UWVSE[hVh# 4jh,"5.'jjjjh.jj謤(jh.5.(Pà yh #{$X11st#j}ƉXPY~T9uNj5.vj5.ijpjj"jj$VVhj #j{f=|X-tj|)RPh| #jh.5.&h@.jjjj jjXZe[^_]US,]S5.<h+"u_@.u M e@.Sj5.Jh@.jj<]US,]S5.h+"uEu %ESj5. ]UShSh # S'EW-[tEW-jh$5.% UX-tUX-5X-t5X-5X-t5X-f=\X-t_X-t$X-f=X-th+"h#uY%Y-t%Y-,Y-$.5Y-t5Y-jZEY-t$EY-f=LY-th+"h#X]Ujh{t 5.jJ=jhzt 5.US]Q1uSjP;&XZ]US]CStu RZYt1]UVSEh #PZYtP|^yh#ay[Ph #hPZ\ƅulX-u $ &$&X)Z%$%1ɉ $Ph"SSju*ht"xX%X%X1%$h@.I$à Y%XPpY9u tth-h #gXZ댅yh/#xxuPh #uPh #h- Cƃ@.?.8 u =@.vH@@.e[^]USErjPh.h # uxh.hhP#|.yh.h #ZY?hSh # t h.~JX5|W-5|.S ]UVSjPh.h!#] h.h.PY[vE!#e[^]+Hu ..5.hhP"Ãy5.h #XZ+5.h(!#hVth4!#SVe[^]UEjPh.h # uXh.gh*"Pk uh.h6!#]XZ)j5W-P f=X-u.E.UVSjPh.hH!# h.h.PY[vEO!#e[^].Hu.Rh*"Pà uVh6!#XZ@.f=X-tPhg!#Pho!#hV&Vh!#S e[^]Uh-h"#cjUWVS}<1ۉx..X.%1u~11Ejh U-hJ&#u uO=.uh-h##3cjCt&`'FtrE96/ kU DЉEX.뉃a$J&nEtPt=Lp7W=Yvh%#Z?95Lp7jh"VU jh"V= h"V^Zƅh%#jmLp7h+%SZYkh:#SZYLh"SY[Åh%#뫡Lp7x.Lp7p.Em=.t h%#sLp7j/RUYZUt .5Rh12%h. EPjhjjjj5Lp7sX.U P5Lp7h%#R\$.teh+&#tML.P. .=.1vldZRP-E)t8HuR}t hk&#KE h%RU YZUtp."L.P. .h@jh@jh@jh@j 5X.h&#j h.Vh.u h&#@u h&#jhx-_EXZtKth+% h:#h" Xt 1N11҃=.1X-LY-=W-1ۉ|X-=$.t ,Y-=L.t5X.' Yu.t h&#j=L.u"5X. Zt5X.h&#jie[^_]U.jh.U4hejyEXZu2EZt1.=L.u!ujJYX=.h. Zu(j Qu= .$uZY.j)uY.yuhUW$ioXZ.Y=.LjPsXY.tP,Y.!URPBXZ= .uM@EPj5.o jh t 5.Z jjGYX1}UWVSS]=.uh&#~Yu h&#j1hh'#~Zt8/t P$ XxV-|V- '#ShtV-EP+ ƃ 1=.t6.x.\.L.1P.=X.u'X.%;/u%.jSY_tT.t t u!hF'#Sh'#hXZ h%'#Z_jV-9u QRP- V-Euڃ=X.u hX.h.#P/ @u X.%hT.h$u/ @u T.=P.y15P.=.u\)j:hw'#u# 1҅‰P..uShz'#"t%=x.ux.=p.u Sh'#j`fj:h %%u# $.=L.u3x.tP.tR5.ZYL.\.j:h%u%# t X-j:h$%u# t X-j:h"u" t LW-j:h#u" t1LW-j:h_$u" t \X-j:h2#u" t lX-j:h%#uh" t |X-j:h"uH" t1|X-j:hO%u+" t X-j:hO %u " t1X-j:hyG"u! t  Y-j:h %%u! t Y-j:hI#u! t .j:h#u! t LY-=8.u 8.hV-=D.u D.`V-H.t Ph"|^_@.t Ph9"fY[4.t Ph%PXZ<.t PhF%:_Xh0.h?%u, @u150.h,.hb#u, @u1ۉ,.h(.h "uc, @u (. ....tj,SaZYt@..؍e[^_]UST Ph'#h-jSh'#h-ZjFU=.th.htj j U $-yh -DZuj -P -=P.҃ !UjjM\.h"<jh.dUh@.jj# Uh.jj  U E E1ɉ \.hjEXZjjEYXuhUW$XZh.YtnE sujYXujXZ=\.uXE M9Hh -ZtU < tU EE9sE @E $-xˡ -P -UE Mtt @8u1]UWVSu..FVtI)~@'#t8u\Q ^@P u f^?봈@.[^_]UEP^vp.^?<tP@q.r. p.q.p.]UVSEPh (#3XZ@T-;t[Ct =t.uGW-PPh(#sC <Ƀ*PZVQPh(# 렍e[^]UVS,u]S5.gVSTVSEԀ€Uԃ= .t̃Ef=LY-tMẼeewfEf=X-t %‰USj5.7e[^]UVSuU ]=P.tSRV1 y@19t . @8u h$(#E&:%e[^]Nee[^]UVSPW-EÉt.@T-t68u-Fu#EPPhUW$pSV1%tك 8]tjEP5. Íe[^]UVS!S 9X<uY8C L{ t VWZYtAEPuWI YVfC Zu h)#Xc9s ts tC Ke[^_]UVSá4.H!vd3VY4.4.Swt^'-H-x&x-Px- 4.P4."~;-}hx-j XZf{ u<@4.-H-y;-|x-Px-!hx-j!^X3hUW$Y[{Vht#4.C ^ZtaP;4.s Vh)#>Vht#4.C Y[t'PPh4.$hUW$i =4."~14.h"TZe[^]UWVSQu E]K:EE<\t<^up{tfKG^KCxЉwŠSzЉw>#)#t18uG(NJKyЉvK KNjUBbM8t1ۉZ[^_]UWVSS]hk%SU^_ug@W-; CteE0ƅUB@t14.Ze[^_]UVS@W-t'CtPkZtC C tC C 5X-hE)#hSh*"SƃtJVhS t0=.t ShO)#YXj S贖YZtSZVX%W-e[^]UVSu EWøtACtV+‰[1'h$u ZYu VX{Սe[^]USSjhJ*#5.jEPhf@5.Eu9jhxt 5.jhyt 5.KuhN*#X1^(~(Ph@.5.Ej0h@.u(jOh@.ZYtjKh@.ZYn]UWVSE1ɉMhj E[^1=.h.Ztuj^_1j5lW-_$EP5.# j^[]]1uY9sE:0u}FEtjjxXZEe[^_]Uhq*#Y.jh.UQjhxt 5.9jjhyt 5. j5.S$jj5./jh*#5.*#<3t<0th*#h*#XZjcEPhf@5.jh*#5.j6 j5.jhxt 5.\5.UVS,]2mf=|X-t h*#Xhx-vuV5.M@Vj5.~j5.$ jh*#5.""jh+#5.؊t =u,@Sm$S5.jh"5."5+# ؀1uj5.x[^=.ujjhn*#YC<w3$TJ&h!D%h`"h +# h+#h&+#ZSSh3+# hn*#X1o돍e[^]Ujh"5. HUVShV+#@K&XN%1tlRPhW %h-CttHu)h-hi+#h-hq+# h-hw+#DYXf3#uR+#Fh-j XZe[^]UWVSf-fuURhht@P Pu fEfth+#lL&[ N%tIt>UQM_Y9MU~ R+#QRhW %h-Ãf3#h-j &XZe[^_]UPPPh+#h-w.t@th.XjbuUh,#hK&hqh,#G.UWVSSt ÉֺlL&"h,#hJ&hh,#u :u!USP\ZYUu=.e[^_]VSh,#`jUEuh1#hJ&hh,#@0h1#N1UEuh1#hJ&hh,#o@0h2#1UEuh1#hJ&hh,#9@0h/2#1UMuh2#h\L&jTh2#11f3A@=uUVSEu ]uh1#hPL&j`uh2#hPL&jah2#t0ffPh2#fPh2#fe[^]Åt$1ɀ8u"UJRPRPj 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4L&ZYt4G (uh 3#5h%hTW$h-q L&E24ݠL&h"h-EC uh-j _X<sR@8t54V$@W]$WVVEPMU1e#sj@HEPgW susuh03#uhF3#uhS3#uh^3#uhi3#U$19ŤL&t@ uRh3# 4ŠL&hu3#[^}tEPh3#ZYh0)uuh3#X,01e[^_]UWVS]uh1#hL&h{uh4#hL&hh3#11{ uh4#hL&hWVhPsu s h14#=ts h>4#ZY1=߶xt uh4#Xʍuu-WVhPsus hW4#N노"=thPs hd4#E^e[^_]UWVSSljUQ/ ^t#u uSuWPÃu VB8 ZHWu uSVWm9uSuVf u V 8 XV8 B벉؍e[^_]UWVS@]uh1#hL&h8C@uh4#hL&h9h3#{ uh4#hL&h:߃uh4#hL&h;ŋuh4#hL&h<뤋1ɿ 9lj}Ph4#99|CƁ t!Ph"5# 1jjh V= tS h fUtts h5#_X1jjP9u 9t-uRh14#LPRhP5# tu@ku h5#Mu h5#m󥍵ѶxԶx9t PRh 6#`3e[^_]Ë -Q-y ;-|< tx-J x-Uhx-PZYUwPPhA#h-jz.W|$wUWSˉ1҉.M]m %h}fU fUm]mURp pSQh]-0hD#h-$e[_]g_UWVS]E }܍p(}p4EPSiY^tShD#8XZe[^_]UWVSPu} FM% FVFt5RPW;à tF1ۃ8t/h]-hD#[8[XRPh]-Bà tŁftvWZYt#/vh]-.ZYu}u2}u$h]-hD#7Y[}te=.u\VlU1҉UtRWZY@uT8-tRh]-+ZY@u"~lth]-hD#s7[XuVh]-VZYt؍e[^_]UWVS.dt2h]- h]-Epd h]-!jjEp` @EuphUW$6_X-xP=.t . .t 5.t2} F=.u:xPh]-N[^@} 1ۃ=.h]-hE#h-?$-H$- yh -PY -P -0 t+@t( $-y h -Z -P -Ѓ߃Yt`_(,h]-h{$5` DždWxPh]-8M[^@t1E%=tEjhGPhh]-Wà uA 5.uh]-hUW$kh]-lGPhh]-ÃtNjOGXW\X\t;X\E@hDžl]-X\ptX \TX9и\T<0XPjj`jjPj$zTjwXPW> X1ɉX\vRLP)TPSS L9th]-hUW$3XZDžd:)։1X\=.tX\hoPTKY^EphUW$(3XZ=.Džd1X\t~hh.`ƃ ~KVh.Sj 9th]-뎉X\=.tX\htP`yXX=.u`bXM=.t#S`$)Y^th]-hE#92XZ`(^du S[z.dtSWLZYd=.um} tgG t^.9GuTxPSͯY^th]-hUW$1XZDžd$E9Gu.#G%PS\Y^uSpZth]-hUW$`1[^Džd=.tWh]-9ZYde[^_]UVS]hVs u sh7E#'Ƅ} t'h]-8Zth]-hDE#0[^.h]-VZYtVhOE#١.t jsPZYe[^]US]} th]-Zt h]-hDE#sh]-ZYth]-h[E#@0ZY.t1E ]]i]US]} th]-]Zt h]-hDE#$s$s sh]-;th]-hfE#/ZY.t1E ]]]UnPPhpE#h-腸jqUNPPhE#h-ejQUWVS|Ӊ΃= /u\PF=/tFR|Y_u%=@u">|hUW$.XZt#h|Vu5 =vQZVSFY_u%=@t=/u^VSDF_ZuQ%=@u?VT3^u?XPShp)%hS]=΃= /=/|8/uVPEZYti|hF#UhSW4W@0t=|Php)%hWұVWeEt|hF#-_XVSEZY= /S|^_uS|hF# j/|hZY|tpj/ShY_xt@xxV`_Zt= /|)~= /ix)؉t=9|u fDž.Nj|ƄPR/DZYkx9Íu fDž.׉ދt󤋅tƄxPRC^_|9;x9 ;p=/hx-薟ShF#h-訴$-H$-yFh -蹨_H= /=/uS|BZY=/u -P -0t- t( $-y h -NY -P -΃߃Yth-h G#=/t%=@uS[6S#Zu4= /C1=/ PSj|jQtS=/u1#|/PShG#ү޸e[^_]UE TET]雾UE MQTU TE]逾UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_][^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]鋽[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_] [^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]鄼[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_][^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]}[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]"Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]ɺZ[^_]USU EAHtRSHtG t uF u:] M[]9t=t/uyDutJt] M[]%/1 []UWVS(Ul/ x/ D/01d@DHLP4TX\x|hlEE8jj h5!# SQj]S膽@u hG#jShG#-XZ=5/FډWVRPEG#=|/tG#RPQ e[^_]Ë -Q-y ;-| tx-J x-Uhx-P_XZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPx/tvv RhG#Ã=D/=/tBjj h5!#v\vXjUR@Uu hG#jRWhK$誚à L /AF`VdEUQRuu6G#=|/tG#RPWQ\Ã\/ X/Et*=h/tU]Ã=8/u=4/tF%=@u FaÉ؍e[^_]W|$wUWVSEUEP;EZuEG#EC u=L/tECu}EUE؉U܋=/} /ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut'C  CtNV [[^]UWVS(]ji//X=(/uEԃ}Eԋ@ ẼM AqP=x/tvv s hG#M=D/F`VdẺUЃ=/tBjj h5!# RPj}WG@u hG#jX WshK$ K /AEUЉMMuuRP{{G#=|/tG#RPWQ螗EPvEԋxvs$EPhG#u=/u7s,hH#Z wshH#G =/twsh:]#+ F%= u9N % 1RPs4%1RPs0h H#dVXN\=/t3jj h5!#QRj}W@Ws(hK$裖 "{(G#=|/tG#QRWP=/tF(V,=@/tF@VDF4V8[\/ X/Et"=h/tMUF=8/u=4/t@uZF%=uE@ Eԋ@ JW|$wUWVSDӃ=/tSD諷^_gjRDZYu׃=/t;jD(^_tDh I#ShE#h- =/tjSZYxtPS ^_ajD軔ZYuMP|juPjuN(%V u5!#SVPRNPhI#h-P $-yh -hXuq -P -0 t[ $-yh -6_u -P - uЃ߃Y=/tSDhI"4 18tSDhZ#tVSZYu0|%=@uS_tSh/I#SVDZYu.|%=jjD<ƃ y D|hS@ yShUW$Vٳ =/t18<Eܣ/P /_uj1ۉ/V胳@띉8<=/tt1ɉ /߭8 %mٽJfJ fH٭H۝4٭J4Puu<8SDhD#h-$5/5/V轱ǃ ~ W5/@b 9 뗋,a-YShL#0j@$a-/X0Ht u hL#jhM#jܛXZe[^]Ã=/<=(a-/UWVe-wh8M#j薛XZ=//u6~OfEEEPhm50a-| y/~uz1=/]xl15/5/~SuOjjj50a-|xFjWVRP蒚)WV50a-^|x(a-"1ɉ /=(a- hgM#hM#j蓚XZ1e^_]ÃUWVSPE1҉P1;EE (a-/jjj50a-{Ɖ׃xtEU =/ux/] |/9É}EjRP50a-{{y%hM#0jК(a- )}W =/t1e[^_]ÍL$qUWVQ1y(a-I/u9hM#9jjj50a-zy(Wh*N#0j (a-)y11҃=,a-~hWN#ZjRP50a-hzh|N#~"019}oMQRPWV?U UthJ#j茘XZjfEEEPhm50a-y yu脖VhN#0jC'(a-1eY^_]aUWVSx-=e-t-P+5/=/X u1=X0=e-Oh5#WV5"05"0赘RPVhN#hWw5"05"0hN#hVnw0WVhN#hVSw}}t^=/tU5<0580hN#hVwVh/hO#hVv(V+$Vj` =e-ubhr$t01WVRP趗RPVhN#hVvV5t0hO#hPtv0h5#"0"0"0"0WVRPPRPVhN#hR+v5"05"0hN#htW v05"05"0hN#hVuRWV5t0,a-HPX00h-O#hPu8}uV50ho"Smz%V迃$Vj }*e[^_]Ã=0a-y1t0//UP40 0t@=/u7= 0t У050h^O#5У0y5У0d=/tGh /50a-nZYu1(/%=u |/ x/u5/1/X=e-w=@0t a-~ jP蹜YX50a-L a-Z~jURPY 40 0t.=/u%5У0h"1 05У0c 0a-/ /u 1t01//=X0t,a-40 0t̃= 0tУ0J1 0=X0tg50hO#ڃZYuQ"0"0 tjhRP脔jh5"05"0jRPhO#5У0)xj5У0b1t0ZYUVS Shԣ0j yhO#0jݓ jSj輙 yhO#0j豓 5/=$a-B 5/6=0u50hO#[X/hDa-S贂ZYjhU#h4~/t/CFtP50YZy"0|Sh\U#0jK=|%=@t50hU#j&~ @YA%ma=L0u )؉h%'2\yDžlh/BSZth/&Zt80 ,0u#h/%h/XZY )P1=///PV 9hsh/hU#j3}tPWKZYu,0=80t:t:090W 09$0u090jh/NZYy'jhԣ0jt7`% 1ith/,YYSWh/O xݡ0 0u+=405У0h/O* 0XZ}tPh/-YZu=0t;=0t090| 09$0090]t0=D0t h/ h/Y+p0tE t@wpPh/YZ h/Zh/WXjj50l y80dydRhZT#0j{h/Wjh/XYy#lPh/3h/^W Rdlh/\ dy Rh/ Rh/XZlPh/YX=40~= 0qУ01ɉ 0Ze[^_]US"0$0="0u X0@"0"0=~~ h~PhU#ÁthPhU#jyK"0Ta-5/CZx&1"0"0"0"0‰"0"0 >y밉؋]U"0$0=e-u>"0t5=~~ h~Ph(V#thPhVV#jy@5/Zx%"0"0"0"01"0"01 y"0$0Ta-~"0~UWVS0t hV#jf"0="0Ta-u"0 yI"0+"0EU EUTa-EEuuuuwu})׋E9ƉM}u}WVMZY+u}"0 Ta-19}d"0 "0"0;"0s5"0PY_"0+"0RP_Zxh"0Ɖ5"0Ta-"0 "0"0Ta-"0EU)"0"01ɉ "0 "0ze-hV#jwXZ؍e[^_]Ã=Pa-US=e-uhV#jvXZyx1ۉ"0"015Ta-5"0ZY~%"0"0‰"0"0"01+Pa-~C9}PhW#jTv yu뙋]ÃUWVuM "0)ȣ"0^_]UWVS$]CDž$$ x$|$x $= 0u15xPu O^_y狳sVh9K#0jmvPuYOZYud%nshBW#0j(vۉ15Ta-5"0u |ƒ "09|Ru -WQQRu<9uUy%rVhjW#0j@u79|$u9x$t hW#jtZPu MZYyrVhW#0jtNjE49}u;0thW#뗋9}3t)1;x$|$}Ru ye[^_]Ã="0t1US5Ta-5"0ZY~'"0"0‰"0"0"0=u.=X0u"01$x1"0"00]ÍL$qUWVSQ Q1ɉMM u15"0="0)9}Ή5"0)ډ tƋ"0]؉}܍MQWSRPoƉ׋EUEЉUԉËU֍ ƉύEPWV yEU)u}"0"019<"0+"0щ9|gx t%u؉}9}M؉]܋E"0+u}뢸eY[^_]aUWVSU Ӆ~H"0+"0U U  )څ$ 9~؋5"0}5"0)É}봉[^_]UWVS}x$|$hlGdDžp } xAxPu JY[u]%ndhBW#0jqۉtE1҉P`1h9Ɖl  "0+ "0 } ^ș9hl}hdSpPtPQ5"0u O]hlS} yE] Cpt1;x$|$5"0=00\t`A9\u\"0)hl} xdptZ;x$|$}L pN;x$|$ap#ƄWVZYp` `D$@$WV:WVijVhZ#V PiZYVh[#j_ U]lt lt)w$V#pZYxDžl=0tVh Z#RjD`뒉l<$8$VO lxDžl0=0u =0tCi<$8$Vy =0t#($tA$u($(($$u ($.($($tbYX$50hO#NYZjVMFYZxPVfYZy+\\thA[#0j_WV@1$H%# PVXZ=0u ($j0 e- e-t[j $P3VA=e-u =e-t51$PjL$H$X$T$t1e[^_]UWVSu }SE8uEEME;E~])])؋ME8tR<9rt >8u9@}jؙRSuZ>Zu hY[#E18}t}t:00E06SVu譽 9Zu hw[#i00E0ҍCtPRО XY P蔙 Yuhi[#j%\XZ>CPVЉUP覾EU 0j\̍<+E e[^_]UVSu] }u1NjjjVA=y YSh[#jhĢ0V b yYShw[#0jt\e[^]UVS]u x@PAdX=<0t*jjL$H$X$T$xe[^]UWVS(]} $(v(11ptWPu b ~ pt1@9uNjt9|$up9x$th[#jsZ xPu S4ZYysXSh9K#OT$9X$u;t h[#jjju ;y$"XSh[#0jZp1$1e[^_]US0tPK1ۉ0آ0X0um1 $-yh -2Yu9 -P -9d-uu%1S 0 t뭅u tډӡ0Aܢ0uܢ0 @ܢ0tϋܢ0zyP1ZO밣0j50h00 &1]U=$00=(0t0=0t 0@=0u'h ܕ 0Yuh[#jjXXZ1x<0t9UVSut>uh%\#j 耕 Xuh@\#jXY[FVNFZH~ 8/u3E ؉C1C=0u00X01e[^]áܢ0t@=@0t Ԣ0= 0u4=P0t+UE$uآ0tjP50觑 US=<0t801t6{u+uhg\#j(WXZ3h#h-< [Ƌ]UWVS]=Ԣ0u =0u$15Ԣ0yx50蝋آ0YtHHQf $O&=<0tȋ@PURURpp p0;9xjjuuuuآ0pph\#j6Vph\#h\#p jW Rph\#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=<0L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPY\ y$آ0pRVh\#0jUƄ  ǃ$h آ0pCPh آ0rP̶50hO#lD t1ܢ0@8e[^_]W|$wUWVS<ÉUMMQEP#u}jկ 9ƉЍM}Qh]#Qh"]#j@S.ue[^_]g_UWVS\]uCE=40uPh#VF8 ue[^_]#}W($"kT$X$E(j8$Ej<$Uu5!#u5!#PjRj4$Wh.]#V7$ w'@$  R%Ph@]#|$x$hK]#Vu7uEPhT%V`7$Pw ShR]#u ShI"V*7 Vj 0ZYV!Xe[^_]UWVST]}T$X$uV($iSWVhZ]#aQe[^_]UWVS]u fVfuPK+Zt%t0SRjP}WmVWSCۉu ]e[^_];e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVS EEU1} t EE1EED}u^9r^MHYW wY0Xu}u}} }u,HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UWVSS}]u 9yK@G?ș9GG1 Ԋ< u G9r11҃G11ҍO9OYЈ\$ w %Y\$v Y\$w\ D$G맊YЈ\$w0GD$9r h11Y[^_]UWVSUED1}uo9ro]H 9޻r0WHM] M] u uu,HM0Hu} u} } }t9sԍr19r)A9r)‰ð0E E [^_]Ã=00!u%U00hc]#jMXZ1ø1UWVSSu] E}MM1҉Lp7=0u0K 009-u B0 P-=0u" 0Q0u 001Ҁ=0t7tMM}E] ue[^_]鍄E] ue[^_]UWPZYtU:u W3h]#(x:u9P-9}Lp7@P-W3h]#h-1?e[^_]1UE E EE]<W|$wUWVSjEPS2Ɖ׃EU E9Es 11M9ttuj,VZY…tUj=VY_DžUuh ^#Uj E ZUuh]#jJS贐 ju0 0B010Boe[^_]UWVSQÍEPSPH^_u C #ƋE| t@E]S貇 Zu01 KDe[^_]Uh-h"^#j!e-t 9tUe-Uh-h^#谔h-hV_#衔h-h-`#蒔h-h'a#胔 j!UWVSPuhC%SSIZYhC%S_ZÊEhViYXuGVha#0jOJ }t/1e[^_]UWVSlj/E 0^_0t@E 0he#P< Y[d0e#00111҉U11Ejh`a-h7b#u uKzX$ P&Lp7"05Lp7h b#d "0렸1Pa-덡Lp78-uxu1/Ej/[$0Q/!b#BH030$1e-=e-u'b#>|100=0u 00e-c@0T5Lp7=Y140oL0` e-G/99%80Lp70#(0EH9~2MxPVL XZMuh]#jFjEƋLp70PM/=$100005Lp7E/`e#f/e-W/e-H/e-9/e-*/e-/e- e-Lp7/ģ01xe-1ɉ 05Lp7"DZ4P00P-E GEt0>}150jP$Y[yRFEMhb#S2ZY;GCjP[^u}uhb#P>2[Z_uh#S2Y^ -uS(…u_h#S1ZYtV9^=0tShb#zFtjP8ZYy*h*"S&XZuSBhb#RU1ZYt8jhb#UR0 UujjRZYMpjP؃jSu1ɉ Pa-}J/t 88hˢ"Ь/Zt 8/2" 0!"11jh`d-hc#u uwz$ R&1d-ă뿃Lp7"05Lp7h b#T0P0xLp7/fL0 T/!b#EH0@3D0΀@0 Lp7Lp7h-hc#ψ5d-hn%h-" 5,e-hn%h-"h-h$蓈/99%000Lp7Éѣ"0"019| 5Lp7h6c#%thhMc#jV=X,0Lp7Sh"j-ZYuPa- SN[Pa-Yyhsc#j5Lp7Z\@D(0/$0Phc#j<jl/1ۉ$05Lp7Y5Lp7*Z0 0@|0g0U1xe-Iģ0:Lp7/+/=$0 - h-j #Y[{%E1 u1e-У0x-nEE ue- Ge%1ɉÁ ue- 095 u e-܋E5 _e-.1 t\50hc#h- 1 AI!T&Ph[n$š-P- e-uuX0,e-v/t1jj} 4 P-P-9EmP-9Ehd#j9ME M0PZy$jj} 4g^_'P-P-;E|1ۉPa-e[^_]á0t P0Ã=0t[UX00h7d#jN9 tp0hfd#h-50he#c)ZYu1UWVSM11JqX?tCt*tK[t~=P0ttjMYZF}uvQUtPU!uX1C<]t:m~-u Vt]t:E :U|^:EuĿ1}!9*A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puhe#j7D։9r KNKNp19r)XӋE}tE9r NKFC1e[^_]UWVS 50he#6[_Vh&f#6hVf#|6hxf#r6h W6h"W'ZYuhf#W$[= u hf#&6Y덊uhf#6ZX<.uuhf#5X1t3L@LuL@L%H9s tFCC@9u&>t!tWDh>g#j3|tHL@t<uDhag#h-` WDhwg#h-Et@th WD̕0 1e[^_]UWVS]t K΄u hg#4<\u FFu8uj2p Xuhg#j2^_DžoGjQPמ t2hVP݅SVhg#jd2 W@x [띍V֊t\uF8t)F=Wx Shh#j2YR¹Zu%Ww hg#j1$N1GtYuh7h#jln XuhLh#j0[^C31CV3ZC 1ɉKECE C=0u00X01e[^]US01t6Cu+uhyh#j0XZ3h#h-` [Ƌ]UWVSu0t$tS=@0u S1u=P0uSu$t9ut0}FP讷Yuhh#j/C_Zt/1srCt/1ɉK;WZC Hǀ?/uC C$c‹@t 9uBSS`u 1ɉ$[:hh#ja/XZe[^_]UVSu1ɉ$0u,=@0u1=T0{C |/t[t0CuPFP3 KVPZuɡT0u '$tVZYx 1$e[^]UWVS]=xe-tjs{.u{.u Ct:u hj#j/V諾[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVhj#j& TE@j d Xuh k#j&Y[0t;u GM1GtAt0yVhSk#&O}thE8t`W yuhok#j%Wk bGƒWt+G 9OG}Vuhk#j%Wk 1G=h0u=h0d0x=d01 hk#e[^_]UWVSM=0tPÉֹ=1:t9pt@9u9U}tjfb ZUuhk#j$[^1p1ɉH xe[^_]Ã=0u1Ujh Df 0YZt1hl#j$XZ1UWVS}0$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujZa YtGGP襫Zt0 $$$CSEC ECECEC1vSi Yh/l#j#XZ\Uh 3 P! 1$$CHCUwC33i S-i [^e[^_]UWVSM04$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3h X]e[^_]wh e[^_]UWVSS=0t51ۋ4t#1ɉ v0EAh EP8h XZuC u͍e[^_]Ã=0UWVjhGc 0_ZuhMl#j"Y^Cxl#=ȣ05̣0PQe-Z@u"5̣0Vhl#0j"5̣0PX1e^_]1Ã=0u1Ujhc 0YZt1hl#jp!XZ1Ã=0u1Ujh=b 0YZt1hl#j3!XZ1UE$$ $]UWVS(}=0$ $$$EUE 1҉EU苟,$0$E1҉!މu؉!ȉE9u9tE1!É]!ȉEܾ 1EE11ɋEUÅt#@ u9pu u90g@E]!؉E̋EU!ЉEЋEU3E3UЉ Ӊ] O $$$Å}uIE EtAj?] X11q $$$AQ C AK 1St$p0t0p0t0 u+p0t0M!u!9u^9uZtLp05t0 t:Uj\ Zt+UM܉HUPp K HC $$$3GPhm#jhIm#j$P @ $$$E؉,$Eԉ0$1e[^_]Ã=|0u1Ujh=*` |0YZt1hm#jXZ1Ã=|0tDUVS1|00tjjs sss3觵[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ |0=1Et#؋M9Hu9p u M9Hu9xt@$uj([ X҉UtMuQUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!R;c XE m#Ee[^_];e[^_]UWVSEEE EM}|0tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3b Sb XZ1e[^_]1UWVS]}E=0t";/tPS3^ZuShm#j$Y YuShn#j. hSڣZuShn#j ue[^_]a GFG4W8F VG(W,FVGlFF x0F5x0e[^_]USx0tvCx0=0u{ t s3hXZe- e-tjjssss 3輲=|e-t s3YX3*a S$a x0XZ놋]UWVSSUE @~ T@119}At41ɉMU1ɉrE1uZ[^_]UWVS u=0FhGSPl <9tjww 5e-;Wu;G t ~h1n#*SR5e-+{ 9؍tRhIn#0j SR  yT$X$G9__W1j$W Xjjj5e-6G WxNS5e-z 9u)T$X$GW0W8han# whn#0j7 W_ Xhn#j#ZYe[^_]UWVSQ0uhn#jXZohu u Eޅt6u Y_tcvj V ^t;uWƉYt#uFGZt _E81QVZ^ XWS^ _h o#ja[^0^SuZYtS'^ uF_Zuhn#e[^_]UWVSu} 0t=h7V t&3V7ZYuusVuz [֍e[^_]UWVS EЉ1lj t׉ EE1EEL} t} t} uA HA@ AA4AA (HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=0-ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh1o#h SSyEVh9o#h SSy=VhDo#h SSyVhRo#h SSce[^_]USSˋ t%RQPwE38[ 1U1ɉ EeveRu Pw ]URPh]o#jUjhoø1҃=0t1UME1҉01Ҁ<u=Bu} u,J=0t01҃8]UVS]} ~;uqjhe#P u%=e-u e-ho#j0ZY1e-jjPƺ 9؍e[^]UVSiÅ3ho#VZY[uh1b#SZYt)SVho#jh1b#ho#ho#j e-vSVh$p#jt0o1e[^]UWVS]u hVZYy\- 1{ǃ4$K<vCVh00 x Rh00 U jjFdPG%($jjFlP/8$jjFtP<$$jj F|PEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1$$$$ 2t|,1ǃ$ǃ4$($Qw\1ҀKƒ $x$|$ށ$1$$$ǃ$($w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%$1$$$1|/uDe[^_]UWVS]$Hwv$PT&=0t_hJp#j hsp#hp#hp#Ń d~ Php#뮋p3Sc~Rhp#땹1jdRPr1ɉ$$$ u#EƄ5/jj o11_Z1u9E2jd PEPGrjj o11wE1Ex$|$ƅz ynH0P t9uon19r)J9r)lj°0󪋅 thq#$%$1$00 ,0t5T0=X0 T$X$($1jjWZY8$1jj_sZY<$1jjgRZYjj {5^_un1jjMZYuJhP٠^_y>jhZYx鋓$  Ѓh-q#e[^_]11UWVS}} ?jhe#V ÅulhRq#VnY^¡0 0 u0hZq#j XZjjPƺ 9tPVhq#j ؍e[^_]UWVSu] hS2ZYy- 1~dž4$1E쀻Yt"h YPWnz/@E K<vM E)Sh00} Rh00 } jjCdPo%($jj C|PлEUUEщx$|$@uAjj P T$X$H$L$`$d$ƃH<$P)PGyjjCtP͹<$ ƃ(8$P PZYyjjClP藹8$ 1$$$$@$D$<6tL<5t_<2Pπ2s#hP莕ZYy|jj ԕ[_x졬0u$  ЃH50PC¡01ۉ00_Yx)ЙRPnZYy넸e[^_]UWVS$ƍ@- 1U ډe[^]wUWVSu>-u~t2h*"V`_Xu$(0N PVh[s#j[ -1EPSZYt/G}vEVWhns#jEUt -u1 S%Xe[^_]á0t UU RuPI50$UVS]u F50tRPSd tD3j SZYu1e[^]US]}t 00 40t= 0th-j 1 0ZY50h "h-Su h-:Hh-j  ]USjhh"Y[xEhr"P#0YZt&h*"S 0YZt1350ZSX=L0thh"hs#j ]UVS] u}t 00 40t= 0thx-j 1ɉ 0XZ50h "h-Vuh-u,Ƹ^ À~|tH;= ÊV~-t >θ(%)%#Ƹ Ƹ^0e[^_]U50PhRu#UWVSQ5d00d0PÉ5d0^=Fg-t ru#uKt;u%1҉jEPS/Ɖ 8uE8t+8tu#`Ba& tBUUue[^_]W|$wUWVSE܉UM7E܍Hw$U&u# u u#!AuEU Ѹu#t݃} uWVuu WVuu&MΉEEUM EUEU)?EU t1?EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉM][EU11 EU11 ۉ]1E.E!EE!EEU11 EU EUEUe[^_]g_UWVS }Ӌ7VT_=0%us Љ UU_EU=0&t u#wE𡤥00S1 VVڋExYtEUe[^_]UWVS(Ɖӡ00EЉUtSUЉt@ vSUиƉX^MƉׅuGMIt!ElM̍YWVщ‰Y[ƉWVh5"j]S`jSu e[^_]US7=0)u _[]W|$wUWVS4ƉӉMЋ?E1Eă0HI00SuЉE뭃$9 "tFكPE4EȉU̸u#=0#4EEЍpًt(SEȉŨwhf0SEȉUYEȉŨw><0ƒ}'u1EURPh5"juVjV3EУ000S]U]00SWڋEXY E1ۉ]00SWڋE ЉE҉UXs}t u#V00˃'u1ӉMȉ]SQh5"j]SjS50  v#똋M̋EȋEċ}eʍe[^_]g_W|$wUWVSEUϋE܋sá00EUVU)0Kvu^*U&8U&|u0VQ{0YYuRPUMY_KwU&9M~ ߉EUce[^_]g_UWVS}USƉ׋ 0AZwSjƉXZ=0uJE졤00MQ1  SUEY 1ۅÉ!1e[^_]UWVS}USNƉX=0uJ=E졤00MQ  SUE X1 1e[^_]ÍL$qUWVSQ q}W50XjLP!ZYt5xIu,xNu&1҉Uj PZYUtB@)։50@뽉00m1=0t v#EЉUWEЋUԍeY[^_]aUWVSRE} 5!#_f-f-`0`0HO;t(`0sx&P ωʋ7`0tx BMסP M҅xJ 軡H+ f-QОX5d0SƉRPhLW$k1 e[^_]Ë0Ѕt /tt@1ɉ 0HUS]u1Z;/uPhH%WYZY@tEPSHYZY@tҋU9u;Eu3E3U ]UWVS}VVP- tS覝0Y]e[^_]kSeBZ8"u뺅u/02 Ph6v# e[^_]UVSu=0uE=e-t.1҉e-hMv#PPYZtS0Xue[^]3e[^]UVSu4t =00tPE* YХ0@Х00010jRХ0HХ0Zu̥0tG =0t,j50hJv#Lj50hMv#:jhMv#[^1V@$]0VP胾f-f-`0 >/t[50>t'`0H`0FxFCXVԀ~/u#`0Kh"VZYu$f-9r :ƅuh`0K;/u>thH%VeZYt `0x/4tX/ gXV>t`0H`0FxފFC9f-u `0x/C 'X/=`0u`0Х0@Х00tP_( X005f-Ӛ0j50hJv# j50hMv# Х0HХ0u ̥0u@e[^]UWVS} ]Х0@Х0uKYy Х0u̥0tuj;ơХ0HХ0Zu̥0tut hQv# Y4u1-=f-u =Vg-t50h#XZuÍe[^_]UWVSf-hƅdh{v#cYt ^t>h#W6ZYEth"W"ZYEuEE1}}FHπ\ut}tnxP0tB<wV$U&NE1>: 6 2 . * &щǍ@0w\9Eu}g-HyPg-H X JF>/g-HyPg-H X J }u-g-HyPPg-H [ J 5g-g-fBYtfBhAw#j(1e[^_]UWVS]u }g-tg-9tx u hg-Xȥ00uPh "hg- ĥ0tĥ0Ph "hg- t&WVhg- x0h%hg-ZYxS( PhUW$hg-g-HyP#g-H X J Eg-e[^_]e[^_]Uإ0uêUԥ0jPȻUU 1̥0Х0@Х0tuRj uХ0t ̥0U1̥0EEEEjEPj =X0t=f-tjQjjj  U=(0u (0E Puj:UEPu u(UE(0jUS]BSu 0uU'uu 0uUEPu juUuu j}uUS] Su0^ ]Uu u0A UE Puj+ Uu uj UM`V&ft9uPU t@QhQ%j hܥ0ܥ0á0UWVSPAYuOƋjjPgǃ t 3;ZC jjPAǃ t s{Xe[^_]USh5!#ĨY08tNf-g-M0thB sXZ0XjjSP50#j1]W|$wUWVS ƉӃ=0uj'ck<0X 01ƉU1}m %M1EmPP$hx#jSö;6u{0ujh2$S29F SZÀ{0u K{.te[^_]g_1 0000US]tvUUt[F~#CtVj RPWjEpS:~5j Rs cWE@C us XCX C @C[놋]Ã=0USQjj]Sjjh$f-' @tBEP0Zt,jjSPjh$f- @t0PATH@=501 0f-X0]á0US ]t6;u1Ct*p~Zt0PjEPCp1(]UWVS }W1t@Х0BХ0PWDrE_XZsnEX;t.Ey"xVfY0" Phx#1Psus ua Х0u̥0t[~5jVJXZ}xuju0 jssYX}yjs_XZxV^uuYu u|Z upX10 Х0u̥0te[^_]UWVS}u g-tu u101E܍]SÌXZ$PW&uwYX=g-m= 0%jw~XZ=g-K0  04jwNYX=g-= 0=0= 0t>VW VW=S- = 0tVW= 0tjwXZ=g-= 0u=0uSŋZU ?1=0)= 0tuW = 0tfuWSi = 0tAuWfك= 0t(www+1ɉ 0jwXZ1=00jwY_=0tr0f= 0tW,S踊XZTjVW S蛊6Rhx#)hg-ES{SpY Sgf1S轊X$0t}=f-t0t tPtj=e[^_]UWVSE ǃE܍uV5d0ju^1jY=g-tKt>=g-u5tUXUt E܃PuRcXZ= 0u V苉X^VZu10tje[^_]UWVSWE} _f-f-`0`0HO;t(`0sx&迊P ωʋ7`0tx BM蓊P M҅xJ wH+ f-Q茇^0PS}ZY100e[^_]UVS]01js&XZ=g-= 0tT 0u0H0x1 0뼃u 0Q0 1ɉ 0MwE50=0; ut-t)E Ps50XZ= 0Ro 050e[^]UWVSu=0=g-u1EPIE؉E܋^Yt$hPSO = 0b[E؋E1҉0]؅6Fd0=g-P0P莦PCh"9v 1g-xWPyPg-H =_ J=sg-xWPYyPg-H X J 5g-?_jsv E Pv =0=g-uJ 0t:u0H0-1ɉ 0Hu 0H01҉ 0 0=0EPPXe[^_]UWVS]uV薅E؉E܋S d0jPsiM[= 0{tuGd0EpWRZYtV1= 0uZ=g-uQSC ; td0u P 0[_.[d0u P0ZYu뇋[g10VlXe[^_]UWVS]} 31EsZ=g-{5d00P*Phx#Stj RU5g-UR hx#Xu hx#Xg-HyPVg-H X J 5g-XХ0@Х0ujSguSPEq}trt8u4guu Х0u̥0t3js"WsjХ0HХ0u~̥0tunUu;Rf1ɉ 0Х0HХ0[̥0e[^_]Rr0Х0HХ0Zu̥0t tJ=g-tA{t;5d00PjPhy#g-Ee[^_]e[^_]USDإ0EE1EEpX=g-tlExtc5d00PZYEP$x#[EXtj S5g-X [hy#g[5g-XjEPЩZYtlEإ0ԥ0jXEuKt&:EP$y#X5g-XԋEt0j5إ0让Х0@Х0Eģإ0j EpXZ1ɉM Х0t5u Ep-Y[Х0@Х0Eإ0j!X Х0t̥0t뻡̥0tEt"EPK$#y#?X5g-Z]UWVS}] 1CCC =g-EP聀Х0@Х0E^y h+y#xjWfdjWPyu31ɉ Х0̥0tujujWuyE؉s Х0HХ0Zu̥0tEPwXe[^_]UWVSE ,1@0X`0(\0$1`0EP{X10E@d0ptEXt8sl_u&Cd0hpPSG [u[ċt1ۉEp :^x|EXtCd0sYu|1҉4pjxPSF [븅t4B4닅4P}_0pt0J0H 䋅010T=f-t"=0u4~0@T40)Љ0=g-u 4fEE 5d00P}ZYP0[xuvp1s%Zg-Hy`PXg-H =~=WXtNg-Hy8P_g-H {j=WeY^ƅu뽋J=뫋J Ӌp t:g-HyP5Xg-H J s^X뽋EX g-tRSP t [HyPXg-H J 5g-h_gxsjhW&VV u Xԁ} ``041 Huw)4)400tX4t-X`0QRUR0af}Zf}tJXZ:-{z-uzu apu CSu>E- `tfE= 0u Ext,AEftfwE= t= tˋE@fat5Х0@Х0ju^[^nf-9tߋM/t/CUuS膎1ɉ $0U^_}9uB$0<:ttB1::uBMuġZD+f-Ee[^_]k1e[^_]UWVS|uj/SyY_tAuu VS\S xP6&_Z@ j6EPǃ tjMy\=$0uSuu VWu>8t4װ8t*Ͱ8 uxPW:&ZY@t 誰WkX뀃 h u tCƒv~ (0PSP6ho"jUWVSuU F^fftfftdN0$U jS$PJPj IU yхtvhy#XZWPXtkhy#<XtZhy#+_MtIhy#ShUW$Х0@Х0v~P$PbХ0HХ0tShUW$NY[?̥0thy#,Phy# PShy#M~ t-g-HyP^g-H *Z J*g-HyP1g-H X J e[^_]UVSuf&t"8u%uCVPqZYt؍e[^]UVSu`f&t8uVP?ZYuCݍe[^]US,f-1ҋ@0tHft fux@ |u[]UWVS}Х0@Х0@0t,Pfu9x fu9=,f-| PB X҉΍^0t Х0u̥0t e[^_]Se[^_]UWVSSu0X'1E8Et$}u <:uWE}:u uW@u6u#<%uUFPhz#uZYUt>:uGFC딃=,f-y t ,f-u1҉MRM ,f-Xe[^_]UWVSХ0@Х0@0t!f{usS XZٍ݉w0t Х0u̥0t e[^_] e[^_]UWVSutA%<@0@0tCVPZYtdߋ} tXХ0@Х0VЛ$eÉ1fCC VCP)Х0HХ0 u̥0th= 0؍e[^_]US`f&tjP)f@SPXZߋ]UХ0@Х0 0 P Х0HХ0Zu̥0tUWVS] j/uPs^_t[EtFxPu5 ZYy 諪8t衪8t藪ffCf1CƋM09tMEthz#QYpY_tM ju_Zt>HftftfuEEu E u=,f-yƀx u91ETtE,f-tuDYDžDž\DžXDž`juEP` Wd$0Z?/xPWYZ2E%==$0NEW)Lȉ`+f-$]cWabjuƃfx`QWTfXZF FfF CfF fCFC,f-f~tF\`9\HPhz#pZYtuYDž 5$0hz#epYZ`9\~88k8]XKWuhz#5Х0@Х0dTujuY_f~udfF`FDžX t@Et$jXPuh%5g-Tf`Х0@Х0dTujuXZf~udfF~ Х0.̥0!1 e[^_]UWVS$EE111E11EEh1z#yEZtPEbw$W&1EE1ɉMſE뵾뮻E랃}uutjLY1҃}u/}u)}u#uEEE081@0tROft!ftfIu:}fu.} }tуtEЉUSW>XZEЋUԋ?몃|u5g-^g-@h;z#[EjWZYt[@ft:,fuu>0P08ufHu*}"fu}}t˃=,f-x t0PuЍEPW}t f}uA-tf}tjW~Y_t jPFXZvd]uEԉERuIEe[^_]UVSu Х0@Х0ju!Ë@ZYft&fHu sgXfCFC fFC FC Х0u̥0t e[^]e[^]US ]Х0@Х0fEEEf-fEu ?EEPSLХ0HХ0 u̥0t ]~]UjuTZYtfxup)X1UWVS 1ɉM11uhz#@vZt(ptvtVuEEлɋE 8ctu ދM Mt4Phz#Ht}t5hz#40:t/1E 0:5!#0:gz#RPhz#m[&jjV XZu}jV)XZGfEGEEfGfj/VjZYEEԡ0}tEjVEPGEP\My`uh#XZ0P00Ihz#.j wi hz#wh#0 8g-HPg-H 0P00YV_8uVPZYmIwh {#owh#J 0P000PjEPV1MfHf5!#tuz#Ph{#iY^jV_Zuu h=J$FYV` 0l Ph" 0P00 u%h{#uh.{# uhC{#fVh#0P00_Xt!0P00E.h`{#YEE~uhz#넋Ee[^_]UWVSEPyZ0+f-PYf-XY}GE܊_tkta}t\} C<v2u+:t$ t/t6EP=Vg-t"E u `0xB [P}눃=`0u[`0f-8uu@h"XtVAZ^E %E1boP YuVZZPK X VZXu‹E|}u5F< v@ `00y8[P0Csu2c& <w `00yZP08t8}t!߀u8CuEԉEtCW tC̃W8uΉ֋EԀxAȋE1҉U]}t usu]uM΍HMЊ1uEΉEAx<EЍp[<:Mhm{#VYZYEąM9EЀxupx9uBa&EEE9s2>uF9utsEBa&tdU9UvsԋUE͈@ĉƃEM9MUPG YPEPb EXZt\uuЀ>-utF<]tm/uu}NtFuc=0Uqxvtu@r t@١0;}u50S[rxRPZYyZ9tt1t9s'@ZxvttE]S@ϡ0;EtP9Uu8/t}G H%C%PXE90t@/Džp>t F1ptJxw@tu@o̥0tSTYpu{F/uSZt߀x .u o.uǍx jWt tptWuik50 덋EG@WPu@/VP_Xle[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFuĦ0skY@uP0DVƴY0u+f-,+f-EEt;t}1ɻN)ЉE=Fg-8<@.<*&}tE<VE)HPhp{#(1ۅI~@`0H`0Cx0P0S։MAP0SM뻍G1҅~օ)xu u܋E%PV1ɀ} k0+f-ыE))00 `0@} uStZ}EtsŠc& <w2 `0x0H 0U@H 0U `0x0H 0U@H 0UԈC뇻11EԀƒ v! `0xM0H 0CuJ `0x0H 0ĈU7@H 0U뫈U@H 0U뫻1111ɋE%Et>@u=0uM @1 1E @€}E$PX&U50Q80^_Uzu LuЉU E PuY[ExU^1 `00yB?P050+5f-uuuuVuu%0+f-ʉ0)@`0uZ0uuuVuiƒeuXE)d0 Rh{#誩}O#uOQVHPRh{##u EEEPVE)HPRh{#grSu9u1ۅu"uԡ0+f-Pu 1Ҁ}t`]uu E]Etq|wt ܦ0 ܦ0׃usuKt@뿃uHuEe[^_]UWVS]E %E1ɉME tEg- 0u $0E0+f-E;~uE t u SXZE 1Es}B~< O$X&:=J{s{u{y{@u{=uz10E} t `00ys<P0e s `00yI<P0d0 `00y#<P0 t=0t"0+f-M9~xuH0 uE uE 11 `00y;P0҃}u C< w `00y;P0S `0x0H 0U^;H 0U߈ tsd0E#E PVu Rܦ0plܦ0ܦ0VrXU `0x0H 0U:H 0U߈E {~=u}1Eu V[X ud0 `0x0H 0U`:H 0U߈EE RuuEZY0+f-jPHP wމe[^_]UWVSEu ]=&g-t1҉0P ܦ0f-0f-`01ɉ ̦0 Ȧ0Pd0Sp_Xu&0=`0u90`0 `00yg9P00+f-Pq6Ħ00XtAh0W&Ħ01҉Ħ00Y_ÀtS50+50_Wj6xĦ0Ħ0Y[kĦ01҉0tNFe[^_]Ujju5f-@E5UWVS$EPEߋ50+5f-hREС`0H`0ZYx0>8P0=f-VWW]S60+f-P+55d0WݔEԉUS6f-0)Љ0`0`0 70uuh5"j50蝜0׉Gu}"tj)PV} 0)O0)=`0EЍe[^_]UWVS]u =ܦ01}DPSXZ0=`0u70`0=ܦ0}=f-}t }tA"L;tWh#hg-褛jY&Et{#PV)KSh{#֡jWV肥+0=0)`0e[^_]UWVS]u=ܦ0CvKE%PuXZ0=`0u560`0=ܦ0 f-}M  t?9s@UVWQM MUt <CÍY9s1:UVWQM{ MUS9st{u8u@@9r9sS륍Y9rVSQM, SMt9s{u8u@@9r9sS뺉A9SVSQM u;Mt;uCCӈ)ȉ+00)`0I9tKCCG+00`0x C04P0 0`0e[^_]UVSu]Sc2F ܦ0f-0f-`01Ȧ0jv`0H`0 x04P00+f-P1ju PES2Ee[^]UWVSuFPh#蝘g-xWP[_yPg-H Y J19}E 4HfZCWhG#?g-xWP_YyP莖g-H [BJE 4xg-xWPYyPFg-H XC9| J1e[^_]Uh |#Uh |#םUUM 0f-t 9PuH]Ë `01-0f-B t xt 1z1`0 X0UWVS}u ]Х0@Х00f-z tj.0f-J B ZB$B X0P`0P\0P XtK =X05`0 Х0u̥0t e[^_]re[^_]UWVSQ50f-^ Х0@Х0{t-WRU]dZtUD< t< u g-Hg CX0C`0C \0F $9tS譻 X Х0u̥0t e[^_]ӛe[^_]UVS0f-H `0tBu y8 `0xxhg-Ǔhg-轓XZ0f-=\0XX0hS0f-p| qu`0\0js8tġ0f-xus8#ujjjV} xtPjj>} xh-|#茔Xu\00f-1p 0f-PX0X01ۉXъt< Y\0t,1ɉ \0 `0hJ|#Ϛ)щ `0H\0! H\0)H`03=g-t5X0ד5g-[XZX0PX0~e[^] `0xX0PX0U=~u! `0xX0PX0]]U0f-`0P \0PX0P4f-Pj8r+0f-@1҉P P$P0f-YUVSu] Х0@Х0hc[ VwjjV|{tt0f-@~PwY0f-s{uh*CZ1`0\04f- Х0u̥0t e[^]魘e[^]UWVSĀuХ0@Х0jVhzY[y Vhd|#ÍxPS8L_ZuE%=upjjjSS u]jtWSy u"jhr|#WL uSzVhw|#jjjS[S tSzVh|#MSu^9uSzh|#2u PxХ0HХ0ZYu̥0t蟗e[^_]UVSu]Х0@Х0} t5X0V_Z`0\04f- Х0u̥0t e[^]=e[^]US0f-Х0@Х0CxPuXCtP¶ Y{ t0f-S觶 0f-P `0P\0PX0@4f-Х0HХ0Zu̥0t ]顖]á0f-US]0f-9t = 0tD 0t h|#і]Á=0f- 0uU=0f- 0u]U}u"0f-@~Pt0f-1҉PYUE9f-uE f-]UWVSU0)i5rO9f-t5|0u1#f-(9tC߉9} }t}tVǁ[f-t?iӀu.tiրuf-f-XZ[^_]UVSu95p0=X02f-tPmsYjhh"vf-[Z1@tI5f-rf-hb Ps5f-蚁t0y;"Shzf-Z@uCt SGYth|#!g-X4py;t0t jj[Xjj?jj6jj-=y¡\09t PjZY@uk0_ hd5\05f-qY[@k02 hPh/}##x¡t09t&Pj1[Z@uk0 hPh }#5t05f-ZY@uik0ʺ h5f-qf-jjGjj>jj55p0e[^]UWVS]u+0i5rOCShW}#Х0@Х019~Qi@tǃu=uFjRhZY@ujtP Ph~}#9+0i5rOCSh}#輒HJ΃utBƃs Х0u̥0t e[^_]e[^_]US]Х0@Х09t P葱 Z1ƃ1҉ Х0u̥0t ]霑]UWVSTÉ։Mt&uPh"Sv =E,EtM}~EtEtCzMB9tMtEttt t tM IuɋE0u#E@VYEEHEvE9u]=0)i5rO f-+9t# ti1;J-R@Ph}#jEP舊h%"jEPs UREXZEUt%‹E0h}#jRUDURXǃE@T=uh}#RzDYXu*tQh}#jRfhz%jRTu =t̉UQ j URP/E@Ut$RWǸ@)$D=Ph}#`/ U:P_Wlj$URXZKyS赇P Y P G~SEPHXZEu EL}tzKySgP _ P KySEP|Y@P|4M}tWh#S藈 iEM0EKySP Z P EEE}S{X>e[^_]UVSMt.t 119}9ivtC䋉11tJiD} u&ƒuu=tă[^]UWVS utF>%~W..[tW-XY~#*Ft~uH<-tB<%t<+u:f-}#f-i0}#0|0E1MxdtS~JH~?u(UFPQM*YZMUt UQW,YZUu뗅uV7-ZtjV,0|0XJxRt~i90tM΅x29|0~*i0t"~# }#~#1ۃ} uVPL؍e[^_]UVSh5!#6X=x0tYh$~#rg-HP5g-H Y肈Sn0Z8P0xj00Y^u h4~#請=P+0i5rO@PhV~#8 9DiPh# FXZՋJ ;1e[^]UWVSQ111Uh^~#5ZUt$jtptguܿպλǍH~hb~# 0tyt h~#辊UjPYXUt 1t+0i5rO@Ph~#t$Ph"'XZ1tiHi0i0h&#g-BHBCY_y3R4X9H g-z99y9H y:؉؍e[^_]Ã=x0u!UjuZYu11áx0u!|0 0Jxu 1øUE=f-t@=X0t7uR+0i5rO@Ph~#5g-趂UWVS=x0t.5|00NxtS{X1x0|00JХ0BХ0uh=ViP*Ë|00i߉_19~i9uFP蕧 ^0|0iƄDŽIu|0 Х0u$̥0t膇t Х0@Х0=Ng-1ɉfǃp0)؃} ~iE PZ Х0u̥0t؍e[^_]UWVSu]=X0tSSzYXuM1X0إ0 0jcjjz1p0XZ}u*=f-}u=f-)=g-t u k0Vj_X}u-V5f-rZY@u ^0k hPh/}#\SjrSjr{}tx0}u`SjzSjzu }um߃u2`u)jHhjh%\g th%hd|#Ѕt$=f-tSj\rSjTrSjLr_e[^_]US]U M=g-u1t uEM E[]gUWVS}tE1ۉEPu EPǃ u\8$0tХ0@Х00E1i|0M9i MEEM99u]Pu Uu6$уu>t6Uu@ƃP}uuPtуut 1ɉM1҉UY}t-}u tƃ<tƃ1҉[tgu tUP=X0t =f-u;u uEɃ@ ;u uEuEug-P Х0u̥0tȂe[^_]UWVSjjjà ~ jjj=g-tQCtN5f-o^9t7P5f-nZY@uVZ0跩 hjPh/}#訂1095|0|btPu=x0u>SX5E t t&tt M ڋE8F떍e[^_]US1h~#,Zt$ltptZu⻀ۻԻ͡0u t8t PhUW$2Gcj)GY[=f-u =Vg-u@t4j00‰١g-0P0YZxuS5g-?XZ1]UWVS411Eh~#+Xt)ntput h~#&50Eƃ}t1E̅u4x0E̅trH08uEu=x0tO*jjV~ uVh~#jV9Y_t Vh~#蠀=x0t}0 |0=0Ix.}t ?u1҉1E؋Eԅju4EZYtxu M؉}tDE؀u8jPqZYÅt j7V薃 =f-)ugXE؊u CM؈`08tu E؃]ȉ1}ܡ0|01Jx8t(t uEuEĿʼntEĉE܋E܅u%}jbjuV贂 OuA1ɉM܍EPjj @usE܅u ߉:tU܊jRU_ZNjE؋U9t}uuRY_Eԅtt h^#'X6jsjs u7{t1hx#Xh]$jshż%1[(hb#js u h#_hI#js { t&u h#n^hf#cjs T u h#H[hm#h"hq#,XjsZYu h#Xhy#js u h#Xh %h"s h#jsyhx#js h~#Cph#s t=jvih"djv U; uh#h#A_vh#s)h#sE#1H#%1i"1K#1N# B#S9tRh#j}W^oWV^w-C yh#f-)f-f-UEf-f-Pf-P`0P d0Pd0]US]Х0@Х0f-9tf-P XCf-Cf-C `0 Х0u̥0t ]l]UUХ0@Х0Bd0R~Х0HХ0Zu̥0tkUWVSW f-\ kХ0@Х0=f-5f-G9ui0taf-CPW¡f-f-J f-+f-`0f-d0^^t5;8u1H+pp X@MSNjM󤣐f-f-X Х0u̥0t e[^_]je[^_]UEХ0BХ0f-)f- Х0u̥0t]j]USf-f-`0f-[]USf-+`0f-)أ`0f-[]UUf-)f-f-f-+U У`0]UWVS,ME 11˅t MP:2ZMwDGƋ܃}tE0v h2#PjFPKE0u _E1t0wLG V1YMVuHMM̋3XZ̋EЍe[^_]UWVSD011EE hO#wE_t/}pt}rt}duܡ0EЋ0E뿋=0?u hU#ijE^tt Sbe[Ejh e"pEZYuE̖%EP 5f-f-`0X1EEЉEEEÉEjMQj8J HMu6U߉Ӏ\uN}\}uKjQj J Hu U߃ u Eu}tjPa[X9UUtRUuZYUt@Rh%ZYt}tc }Eu[}? `0_/}] `0xFUpUԈ+f-E1ۉ]E`0u#EJ`0xFpUh e"7u1ZYUu.J`0xV }P+f-RE^)u\`0j5f-7k 5f-f-`01ۉ]3=`0u2`0#Su4ZYt*Sh%#ZYtNEf-9s}~}tjuh e"j j5f-7|j t jhY&PEP+E؍e[^_]UWVS1h#/E[tХ0@Х0j譥P襥Х0HХ0ZYu̥0te01rErǀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD5wFuD5xFD5EPEPEPh#C_Wh#0__X0 wI112NЀvSh#%ɍD=vB:u҅t Sh̀#ePХ0@Х0S-^u Х0tW<0 PSh#dׁWPEI,ËUR Х0HХ0 u ̥0t9d̥0t)dӁSʣY5g-\\Zg-@th#]XEEe[^_]UWVS,f11}Uh#E^Ut*}St}at}HuMЃMʺË]E`Y&Eԃ8t@9tE Sh#c08}Ѕuxt h""c}uEh"uF-ZYEЉE1E؉EEȋE@HЃ w7̋}9 ErXk] eډΉ׉u؉}뷅t uh;#IEX 1RShj 9}9Us uh(#}e؉[}uE`Y&11114Eh"E\j h%9\ Et‹u}eh"\X}j h%[ YX;EPC P\sCP3hJ#[EE|u}eC 1RPWV7ƉRPh`#[ *C 1RPWV7ƉRPh`#][ Oj h%I[XZ M؉]܍}WE@ PZY@M؋]u80M Phf#HE}tXEtM]tM]WE@ P[^y80 Ph#`EԀx udj0/tM] EtM]uu h#qZY$E@ 1RPSQ6RPhLW$MZ 5g-eXZg-@th#YXEE̍e[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPSM t#9t9uƉׁvSh!#Sh #_e[^_]UE0 w @8u1]UVS]1tS&'Z1tpVhT%S% ¸tVVh3#S  ¸t<uh+"S辂 Y^¸t0 vSVZe[^]Åt2USf-t1:f-uf-Auf-[]Èf-Uf-PSg-PXZ=0tM=6g-uDBPGPA0%XYr%u,#jPh9#b UWVS}] Fh=#UW_%1ۃ0t 0u7;0P00jPƿ00XZ=|0t6u hՂ#XH 0|0Pt0000001ۉB9tt 50 0e[^]U}ujjjjuXEХ0@Х0jc0Z8tPX Х0u ̥0u1~WUU0 wj jR蜐 Hu100UWVSu}Et8uLu+E@1ۉ1۾E?C:-uލBztՃz-uztĊ] :MtKu5>:u$EEEjEPh#}[à uVh#cJz:u벉뮍Hz:xuWمuU6<:u!EEEjEPh#[à tuVh#hg->Pjh#`1H9ujQh#Zà 1Mjh5!#h#Zà M+E@1?1ɉE11ɋU Ph#j MQOhMQh#_Z ÊEEEjMQu EZ( t1E1҉URjUe[^_]UME  h#UP u0=0u01ɉ 00h0h0RppUVSM0t:u>0u1:-uztX0z-uztBu 0ͅtɍr8tuPh?#9Yy:u܀y:u.zu 0J 02u PhR#T50150e[^]UWVSj,0^_zthh#:8->E 010j0Ytzthy#(T0uD8-u @P50P)Xg09Zyh#9|EPáХ0@Х00 0)<}_߉ƋM9sω9s x19r )ЍpkME9s 150 Х0u̥0tRS[PY09} h#Х0BХ0)أ00ljNx=0tE7r ZEy1ۍ 01u10 Х0u̥0tR1e[^_]Ëg-z8U `0x@ 6@g-J8g-z8]ÃxuUSt Puq XK]HÃ8uU1҉P8u]UVSƋXCF~hy1A1ZAf@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉Pg-JHR P UPUSUJtXxv-u~u C $t hv#g-B0+B8PCXe[^_]UWVS4f-E=u6E8t h[&3=f-f-`0} E=f-f-`0\C`0\GNà " `0 G4f-(=k`0H}t`0G u͡4f-@4f-=-} uE( u ƴEu 9E@E菴t9u& u4f-g-HH FՁt| tf,jE)VP+ &kx\[x `0@x 4f-g-HH `0xO Hf-)Qg-X4f-U)Ѝe[^_]UWVS@} g-B ]urVY wVh#Vh# 4\&h#j"S|GSQZ؅tWhń#}xM4\&hڄ#jPGGSUWVS]S;5f-MM E,ZY9f-ulP_H=09s<wDu 9rMW50h ZYt%0=0M܋=050 ##S>e[^_]ø5!#g-ztGUS0ttt* ##Բ0054f-P0ZY]UE0jZEEU\uHر u"4f-g-@8xtjjX聮jjh0"耮 镱UVSg-Xt 1ۉXX=x tjbg-1҉P Yg-1p84f-P0 `0xX0PX00Fƃ)c t,~tŁF $ Z& 4f-g-PP @\ |td;Z=t 蘰 uc?&ug-@19g-@_|ug-@g-@$&t;u,g-@ g-@ 訬g-@g-@rg-@_蒯=t0 u74f-@4f-g-B0ztjj[Yg-1҉Pjhe&Và ؍e[^]UWVSSág-@tuxt =g-,uyGEt7[&t,O8uQPZYu[&^_8Et2jwE.Y_t XS4$PSd Rt g-1҉P؍e[^_]UVSg-p$ t jjg-ubX(x,u{ upV Zuh$#P: uBPVLg-BC1ɉ ^t‹(wjpVe P0+P8RuF Xe[^]Umg-B]US]V9tjS]UWVS 3t u%j 8XpZʡg-@؍e[^_]UWVSg-@}t11[Wt\&t1MHwRFuvg-@@},jEu-뤃uj p1AXumtCMuj 18XMHXj 1҉WPMHGYljރ}t' }uZߨjE#BW}uGg-}u:g-@@ t\&}t jjg-@e[^_]UWVShEӉMg-@E1Eإ0E豮E+f-]jEPwZYtujXY>tt-uVƉCY;0} ;0~0}>uQy>u |u &u !Utv&uya1ɉKg-dj`dB(g-@(X4f-PZ-g-@(u @  1҉P 蜘y1sg-X$g-@ Wg-\H,hP SVg-pg-@ X P(Xu1 `0GD`0r5H"0ǗjhډMX`0HXq{t Ba&`0X+5f-T `0`X@Džd{1d#kDžd}tmBa&uW0-DruJt?:}u500jjh0ٖ 1ɉd躖Džd Ba&`0t> `0x`@`H`Ba&uKЃ wC `0x`@`H`iÃdt@@Ѓ v6t'H`0X`XX, Džd `0x`"p=d%:t #u)Ph[& [Z…t!Džd[Sh[&ZY…uH% `0x:F p:Džd `0xF p[&{`@9Ë`uBW``Dd u(}t# `0x#F p#Džd詔d1ɉdGfxufxt dTf-Jwd@ ӈd ӈ{dNj@f@f@dK@e&1҉P:'uAW|e&u1`0X\Nj@@c&f@`0X$諓H `0JNj@@bb&@f@e[^_]UWVSSg-1ۅtXC1g-0x tjRg-1҉P YF8Pv v^S‹FP U8tSjg-pZjhd&P`g-HUJ@ B 萘]e[^_]UHu+]UWhPTإ0lژdg-`ȥ0\}1󫡨g-X1pjEPoZYEإ0ȥ0Eg-Tjh` jhd&Pc g-B t$Pt=^g- hppDžt1ɉxR|T}Eg-jjtP袉 f-pnXg-`g-d蜗Zlإ0\ȥ0ԥ0u jlDžp5!#u^j-Džp3#Xg-`g-d.Xlإ0\ȥ0pu hpp}UWVS g-@1ۉ]}U g-u@$x @40$[&j袿jCjj Cu;jiF EjUBjbjUB뻡g-xu jF Y1҉V @j]j ág-x 14$pCjj_Cjg-@A. ug-x,u pr[u hK#j腾 g-PS @0CBg-Yx u`x,uZhK%p^ZuGu g-up0pY1҉US@PvjjfHu?8j@g-1҉P Pg-J0HCBHYvBg-@-ttjjjCVg-@^Xjk g-B0+B8C j fg-p0C5g- ~ uhK%vZYt hK%CEFug-xjƋE0FEYg-xu;g-x  jj p0‰EEU表g-@Zu UBE밡g-xt jj@0FjF g-@Yt-Pv jj u g-@FEM1҉@{j jeC1҉SY^tNjjLX=Vg-tt3jg-@X&}tg-@uWd^_Tjj g-u@$x@1ɉutt;tj ;XZÉs؍e[^_]UWVSV} uE E1ۉ]1]g-xn g-u*p0QƉXYtաg-pZu1뿋H up$E0FE뢋}9u}} uwjg- 4f-H4^S ZYuha#SZqj/v` t h#t g-4f-+A8F%Fg-1x4R@@u} u jj1E1҉j1ɉHEFE F g-@0F[e[^_]UWVSSg-@1uG u=Vg-th#g-@puWj Y1BUjBËUBpXYUj)&C^Ut1ɉ ֡g-@tj)pZƉe[^_]UUg-1ɉHHPtjjYXg-1҉P t/Ht3g-@jg-Ytrrh#n&g-1U11ҋE]FUU Et 9Pt]UM0tPt9JuB]US]j袷SCU PUPUP X]UWVSEP7i[y h+y#%u;5g-~5g-ExW[Z=w PWV% `jjj uNujj:jj1jj(jj$jj SEpujtu|Ee[^_]1=0UWVS}u }t~h@VWgà VWgZY}t9u9t:WX19t-yL0K PVWhy#SSVWh#$9g-}g-؍e[^_]UWVS]{tN7Gu 0} t} t&Wxjw PR+GxP}YWqC Z1Ce[^_]US0Х0@Х0uSw0S4C Х0HХ0 u̥0t ]T#]UVSu0t1u(jS#ZYFxPX6utse[^]UWVSu] 95g-}5g-9g-}g-9t7SjjSV%9t8VuWJ PSh# #؍e[^_]USg- @g- g- ~.CPjj x9g-}g-P X͹ؙ } 0]UVSu 0 ~;0|l5 0j VWà x9g-}g-9t PSh#A%ЋM !%9t'PjS* @u0!> PSh?#}j 1}PMZh^#/Xe[^_]UVS]u M1P1<\&t#KySPMX P\&<u~tvh#S S4\&ZYt vVuQSh"MShr#EF y)KySP-Y P-Ph#Sq SvXZۍe[^]UVS];0u&= 0u 0uХ0t]=0uTY= 0uZ0tO08tCt>0$0@$0=f-tuХ0u ̥00[^]US]SVYt ]]ߴhC%S{8 YZtSXZu]US]#t%S$ZuSh#j h00]UVS]} t"KyS P ^ P VPhUW$S  t?uSh" ZY?t.!KvyS9 P X뭋P 롍e[^]USХ0@Х00t8t P3 1҉Y0u1 0 Х0u̥0t ]-]Ë 0u0t9u=0u 1UWVSu} = 0t=X0t?u;0tۃftGtt;@0Wt2<=f-B0uQ=|0uH=ng-t?$=f-=g-@0u> uUT0tY<I<tG<0<#t5<<@0uw EPjV @}ttKtR1N=g-t tFv =f-u <t9uy PVZY@t\u@0u jV?ZY1E܉EEEN>v  DjEPj e[^_]UWVSu] uh%sZYtsh6$VY_uh#B j5g-h h#V_ZǾ0tlХ0@Х00P/ 1ۉ0^u Х0t̥0tjWХ0HХ0ZYu̥0tG@u15 01ۉ].{h#WZYth&+"WZYu/p[vtEuEu11j1}h%3ZYDžt}N}u N_}10t@taGwuu%h#WPhn% WvPhn%C ~h"__1똅t h"L^110t\08uPu%h#"VPhn%'VPhn%tC ~ h"[1F@ut h"Y1ۋ0t708t+hȉ#0P SPh0#C@u}u3= 0t63{Zu;?-uu1t 11EFhщ#EXE=}}uU0t0Ph#tY^PƃX?vsh]#5g-- hȉ#0Zu h# 0P XVPh0# 넍FuuzХ0@Х0Х0@Х0u1 WX0t0P<, Y<0t jVxXZ Х0̥0L EEe[^_]UVSuu  00tJ8tCХ0@Х01P-0PХ0HХ0ZYu̥0t 0uu e[^]#e[^]UVS]u @0u VSYX@0<vjSXZuƃ@0e[^]á0= 0u t8u1UWVS01ɉ $00u@@u 0e[^_]1҉0= 0u‹0t0}W-50SjP9S}* ,t }wW,50Xe@Ht 0tUS]90t$jjrjjijj`0]US\1ɉM=0u'=0t0t EE0000$0tjEP-[Zu Eģإ0jEPZYtХ0@Х0jEPY[uO8Eģإ0= 0uы0tǀ;t 10jSXZ몍Eģإ0ZjKtX]~ ~Cvv1ɉMMMMEPjvIXZjSUYX1EEEEK>v  DjEPj kSP XZ50nU0E0]UWVSh]&P!ZYj'V_Zu <)ș19e[^_]áХ0@Х0g-t,UP' 1g-g-Z Х0u ̥0t Х0u̥0tUWVS]߅~91Wu uG ~ )Dž~E u F ~) 8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu0CfKS u>Х0@Х0s6C CCХ0HХ0^uV̥0tMFfu9sХ0@Х06CPRC S)SХ0HХ0ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9g-u]e[^]e[^]U5g-uXZU5g-u~XZUPuu EPE u hw#ouPJu% UEPu u UE Pu5g- UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'Vť_Ztt~tnh#V@ZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h]&VKZY<tBEt7KyS'P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KySbP'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9g-u]e[^_]we[^_]U5g-uXZUhg-Mhg-CXZU8ruPh#PhNJ#@UWVSSEPE X85f-f-`0j=RUZYj=SZYU))9~߉Ӊ `0I `0t$<=t xFU蔗p UCɅxUvU] Ue[^_]UE1@u,d0+`0Rpp h#jh40ɻ40UWVS]} Mt t9u t113Ba&ƍCt9tBa&u1@t)؉[^_]UWVSS110tZuA=u܍P襓EY10t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uEʼn#e[^]h#S <ZYSZ9u;ShUW$j'S Y^ƅu+Sh-(%XZ/<'uh #sXuS)Ph#t e[^]UWVS]} sSt"CtS҉XuEs1Et Wh$!Y_}t5uh$ XZ$g-Jy R` g-z9 _F>=u y:Cu}th2 #FPZYg-HyPg-H X J e[^_]UWVS=L0uH0 h8L0Y11ۋ0tJG} tE t8tEt.H09P5L0L0%H0XZL01҉Ѝe[^]UWVS0000su"f-s f-s  論YVCƒJujvXZ=StuPF K DPY_F u vh ZCFC FCFSO X`e[^_]UWVS111Eh#{Xt2vt&etfuEՃxuп뽋E u0t0}tUP( YUtW2U XZUʉ؍e[^_]UUE  E U?t h# jpp 1UWVSUUu Х0@Х0j臅XU:-u0zu*5f-kf- f-C 1ɉK^1jEPRUǃ UuSj=R蠓_ZUtRVVP?VjR E81ɉK C1s@C O t0KOKGt u tGG <=uRUVP tjRULXZU wh0u1 t0< =u\0H`0{0000 Х0u̥0t e[^_]e[^_]US]tu s?XZ]US1ۅuh#'NtxtIuhϋ#貜Yu 塈0P0t SPXZ]UEU )]USME )u AR)[]W|$wUWVS1҉j EPSƉ 8t98"u/EUE9EsShH#0-9]u ShY#EMDJ@t@E}u9tՉe[^_]g_UWVSQƉukIe9Fu[~>R9uJjj\RY_UP(PUR3R Hx N9 uW XF!؍e[^_]UŠH8-u>1tfzuhd jjh_&1zuHhy jj h@`&BR耢.uhd jjh`&hj#P褹ZY1u`&UVS|ƉӀ8!uxu :\|fxqpftft!f u&P舢Z?;*;"|f uPS<[^1PSQ<ZYuNf$^&|&E%=E%=@E%= E%=`qE%=bE%=SE%=DE E E 6M;MU؉!]i]O9>(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$_&SVwY[SVg_ZYSVZ[^SVIZYƉ׉11 Ɖ׉11 ylj։91lj։9rlj։g9(Tlj։I9PV9^_xPS9ZY04]E9uc9u_E98PV9^_uWxPS{9ZYuD04MU9u9uE98f9]PV79^_t1PxPS 9ZYu鋅|9u;xu͋ 3E3U ו>~u5!uډx!(u;)u{u ?e[^_]UWVSu] h$3_Zu!Nu xtP!zUW)Yu UR0-DPtÅt S訬Z@tM}th%6ZYu }tM1EE8%u!Pz^X6h# _Xz謿1ɉj EPuljыE 9Et:8u5 t/u u5!# 9uMY8Mt#y޸"uPh# EGSWF YZ@u'`#|x"RPhT%$ Etu jW XZMurUVS@l<0 080 05<8t j=SYZt hSLXZ Ph#j@]SPjSh$#|j hg-h e"k(j h#h#W賃ƒ r%u,#j Ph9#2j,h)#h#!j h#h##$e[^]UN=ԥ0t 1`0\0cOg-01Ԯ0ܮ00=0t jYg-g-g-g-g-tP/ 1g-ZUjR1ɉ 0Nf-1p0f-Zxt@ۆjХ0@Х0jXZ1@0uƀ@0@@u Х0u̥0tUEt]UVS]u tVs XZe[^]UVS]u h&$h&Vs [u CEe[^]s dVDF4$VsJVs Vs[Vs Gs$VDF[ ]VsVs C[XZD[*uFE$Eh`&#V(Y[EEE8.u(px*u Eh`&#V_ZEEu uh#}f?f}‹}G}HE @,1e[^_]UVS]ss 3sh&#aj&tVTRPhQ#? S S_ VPhX#e[^]UWVS uj:u IrZYE u hm#j@E } hk&E P|Y_8j=Pq_ZqxEPh#W7E #u=#t">#E#uD#t"E#L#uK#t"L#T#uS#t"T#rk\#@u[#@t"\#KDe# ud# t#e#$n# rm# s!n#y#xx#y#y##r#s###r#s##}#r#s##[T#r#s#2+ r#a'# s##>}w t2#&# u##r#r"##@u#@t"#y“#Àu!#y-“#Àu#PIɓ# rȓ# r#ȓ#' ϓ# rΓ# s#ϓ#֓# rՓ# r#Փ#ݓ# rܓ# r"ܓ##u#t"#~#u#u"#^W#u#t"#70#u#t# u^#?'#t#^#}wu1 #% #u ##u#u"##u#t1#`%Yt@!#J)#@#>uM #*tO(##M # (##^/#3@)##^/#^/#}w s # r#%=t)wt=u&r#=uz# n#v#Q# r#<}vw s37##'7# r6# ?#r>#r#>#F#rE#s#F#N# rM# s#N#V#rU#s#V#oh_#r^#s#_#F?’#sÒ#sjÒ#^}uSf#Pj&;t3CaP3hm#jd,Wz 1 11ɻj&;}t SC8t{$(Whv#j ,(PnzCPhv#j }(PGz$A u,P肝W|Y_1Ƀ bt,P`EPWXZe[^_]U褖Ph{#h-~jqUس0#=ܳ0u"PRPh #h-~jtqUWVSQÉ诗10;#uCj EPSn蒗 8t ShUW$jE8tWShx#je[^_]USÊt%<#u"SdZt@0]UE E EE]-UWVSÉU}utj VSm @t 9E s Ֆ8"u"3O;t)t:Et0-fDB@fO1e[^_]UWSPhʕ#mZuD0.j URP^mà uW8"u hڕ#j1ҍe[_]UWSPh#ZuH0.j URP mà u8"u h #j1ҍe[_]USÃ=80t =$0t?<09t6t2`#t""=u`#QRh(#r <0180$0]UVSƻs&t[PV{ZYuICƒ@0D0CH0C0C 1f‰80te[^]% VhD#jbe[^]UVSÉ֋t8uVh]#jURM1YZtVhu#&qXZ(01EEe[^]UWVS11Dž=P0~ Vh#pXZ1 RPhS8 =t=P0Vh#&f}Uu1.=P0Vh–#ap[^v49tVhx-h#Ea6WhR#hx-uvWhZ#hx-uF (tl#;f=L0`PW0%SVhi#l=`0t e$h 0Whx-50Whx-"WW`V_%eL0 1e[^_]UWVSƉӉt \0tQuډ=\0u1It 00= 0 09s Sh#jh0P$ډXZe[^_]UVSƺH t 1҉[^]6U=@0ɀU E]UU EtPh0_#XZ1҉UWVS( 0 0 1hSd 4 h#S%>^_th-#SZYÀ;tj:SO^_xh-#W诈ZYǀ?u=1ɉhp%S#y^_1jh%ST hp%Sx^Z w&t"SPZYu w&f50|w&uhP11҉\^_thu#bvSh#b f0he#S5xZY1;ph6t"SY^u hAt"S_ZuhFt"SY^u Sh#a c0h#Skw^Zƅuq;jP11҉ZYth#la_X 0Fe돍Vh#S HuEt90s(h-# a0f 0[^f 0uƅhݛ$SsvZYujh0h{%SSvY_ujh0%M {hJ#S(v_ZuAjV11҉Y^0)hk#Su_Zu.jV11҉Y^0hy#Su_Zu.jV11҉PY^L0h#SXu_Zu.jV11҉Y^ 0lhs_"Su_Zu.jV11҉ZY0-h#StY_th#St_Zu.jV11҉Y^~0h#St_Zu2hV11҉@Y^<f0hՁ"SGt_Zu2hV11҉Y^f0Wh#St_Zu2hV11҉Y^f0hÝ#Ss_Zu.hV11҉wY^uwf0hН#Ss_Zu*jV11҉;Y^u;0h۝#SGs_Zu9jV11҉Y^tWShW#f0Pa<w{tSh#;=0rSh #"]<~!jSh*#]‰0(0]‰0(0h-#S要^ZÉ;uh]#j\Y[v&1VoZߋt ujPSV uOv& 0VoYÀ;th-#S^ZÉ;1ۉw&]0-DPt7hP11҉ZYt&hu#l[^X Dž" !v&ShK#<[hz#2[1ɉ 0_ ƀ0Ft<$p&u^ \0Ì0F (0!(013FfF0Ì0F (0ta(0t613Fs0(0h0Ze[^_]UWVSP1۾v&#ZXZ]W|$wUWVSƉ׉M1EmF(1҉EUm %$QN81ۉM]mRR$hU#hWX e[^_]g_W|$wUWVSÉ֋W t>$u ~#EPV;EZY9u#_8t/j]} tu Sh#Ƽ Sh%趼_X뿃} tu /Ph#蘼 벍/Ph%肼[^띋$t $P_YPRZ}tEGjPS]i y hH#-XAЃu ƀt/tu1P辭$u ho": e[^_]UE0E 0]á0á0UE Puh-Xh-j >j7UWVS]]8ށu=0t50h "@YX= 0t"=0u50h#@1 0XZuu ק ZYyW¬Ph1$@ t7=0t.j ?X=0t[P50h$#K@j6e[^_]UE Puj' UE Puj UE Puh UE Pujja6UWVSx1ۉ0PhC%^_yhT#hVue ]t Ƅ1PSZYyShc#LY[u%=`uz 9u;u0Shh0" ƃ uShs#뜍xPV<_ZyV끋%= Vh#e= u:u*ShVj t ÿ"Sh#0SΜ[+SœY0hVMn u|h0hUW$5XZ|듉e[^_]UEPZtPRPhȭ# u uh׭#hh@0<@0U$0tjXj QYUSZj0h@|&jb (0jjWqZ]US^ZjL{jjWjj{W>Z]UWVSÉ֋x CPww wwփt=0~j zX0e[^_]UWVS1=00010001 Džu/hݭ#h#6[^Dž SUYu荙Åu~3hVjl ǃ uVhUW$XZAP~XEtVh#C< Euu듋CuOHujsVsUYE >9 C 8H1u"Wh#h-M? Dž CC jhPjV迃 Ãt'$Phzd@Sr; @uSb [W7HYD 0-9rDYt)PH0t4KRWQ1I u <tPȉjs W"s C1ɉK C C1{;0C00XZ{ t%VwxIYZuVh*#3XZ?jKs Vr Gr G r GG1CG8{DžaETuDž0Eu0} u:E 5j 8YtshF#9s _Xtvhn%96M 9~=0 1ۋ9U tE 9}?Cԉ a^ EtPs sshO#9…g=\Qs sshh#h-H<ҋC'BDž 10C0 1F0H0~ + 0(P9^t509F6냽tr0t`5!#:t#h#Ph#h-};0t/";tf3#Ps sshή#h-H;͋ 0 Phܮ#0Y[0F1҉StPVS sқsʛSě uU89;00?uǃ tuU E t$9{p1҉ e[^_]UWVS]fU ffCffBCffBfCffBs ssY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssY^} GWssY^GWs$s wY^G W$CDȉGDs,s(\Y^G(W,C@ȉG@s4s0AYYG0W4CHȉGHsNjCSMEAE@ufFZ[tA 1h0Ee[^_]UWVSu^8C@PvBBp+BtPR|[^t00 h#qY=x0t-5(i-jjjj00 h#Zu5,i-RPjjPt0=x0tohȯ#6b50=0 t(jj[[XA!HfAWV#100XZ=x0tj _00 tjjRPe0 0u hӯ#+5050[^f%f=@h#h# ZY50=05(i-jjjj00 xRP5,i-jjy\jj5050ƅDž9 WV@@PP WVf@50505050蹷^_8th(#1ɉ h0[ 0$0 tCjj RP. {C9s#Qjj RP+ N019r)#u 5050u"hI#Ah":41h0XZ謶fH^_f@t 5050h"u6!@t%h"50505050)Z[@@fA\5050f@5050Chq#<$u th# =x0j XeY[^_]aUWVS}u w wTXZCfEE9ucP0t=x0t =|0tj jjjw w'uP0jh#W  w wNYXG 09O u,i-;0tf%#f=@uӦ"Rh#w wgE)Puh#=x0us=|0tRyNj hư#XZ=x0t2hܰ#1_=x0tfE)fCe[^_]Z h#eZHt1ɉ h0x밍e[^_]UWSá0p8hSY t& 0q0RP¡0H01z 1҉Ѝe[_]Ƀ=D0tf‰Ã=D0tÃ=D0tUWRP˹Y_}UWVS(}M] U 0040;E] w+EU 90p8}E9|+F]!É]E !ЉEEUEU9}"=0tWN#uVu uh# 50}̉Euuu u- EmEԉU؉E܉U\TtFЋ]!FEU؉E܉UFEUӋEUEU EU9ME FEU}9Ћ}=0tlSQu uh"#"  0\Tumq֋]!qISQuuh:# ZE̋UEU؋}9Ћ}};=0tSQu uhZ# 0uuhs#l $럍e[^_]ÍL$qUWVSQ0QEU}9Es9= 0$0Esuuh#"{H0L00sx1uЉ}ԉ t9E}rEU9E}\1ҍMQRPuu$ ŰEUEUċEƉE؉Uu܁Tt-s։!U!CЉEUuuuub& K` t1Ɖ׋Cu}ܡ0t`s0WVխ00@x1҃ RPuu$ M])Ӊ H0L00@x1RPuu$ 0R=p0tЍeY[^_]aÍL$qUWVSQ8QEU80<0Ӄ 80<0}9u}9u9=(0,0Esuuh#y0040E؉U܋E9EEE 0@Ẹ 00\1ҍMQRPuu!" UEUEUEƉEЉUuԁTt-s։!U!CЉEUԋCx1RPuuc$ K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=0u  00 00EUܣ0040Suu505\0腧=H000})E50=p019}VVdf%ZYf=u Gvdv`CYYF`Vdvlvh0YYFhVl1tttpMYYM؉DpTtA u1MYYM؉Auv<=80u 0(1E؉Ẻ}EċM9MSuu505X0躧rVVif%ZYf=u+=0u"}uFV c9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡0@0@0=p0@0ЍeY[^_]aUWVS u} 0M]1EuuWV  ‹Mt WVh۱#u1(0,01H0L0580=<0500=401 0=08#AH0=p0态1ǣ01ã005 0t C0 =0 0Qhs0ZYu h#te[^_]á0tUP jZ1ɉ 010UWVS u=p0tFVFV zEU0H0AEUSQRP$  w 1҉UtE4P`X30RPuu  01{{E U 1҉CS1CC E UC SEC$EC( p01E v 9st DpTtD(D,T0Gу} w0090ub11tDXGu뺍PR!eZY=0u h'#r00d0P00e[^_]UWVu} 0RPWV 0t9xu9p tWVhF#re^_]Ã=0tQUS00\;0r 3gX50g50g100ZY]á0@ UWVS$Ɖx@t@VЉ_uDžo v vv 0p0vvxNjH0P0@t 1ɋ9}=؋ÉA빋EU RP É19r=@0thp0tF1ۋ9}&G q1蛬YYQCG W5X0ɣ[X9}W ʉ@~; 09Ht09Xt~zG=p0t T <tYv vh]#hRRV莤t"G=p0t 1ɉ ؉L1҉G 1h0C|W5X0[X"~@)EU 9GG=p0t ȋT tdtJ1҉FVuVЉYu uXZ]gE E H1ۉh0FV RPRPhS¤Sh~#o h#蟛Xv v!ZY=p0t@V+EU FV@V z+EU oFV h#7!T0gX g؍e[^_]UWVS uE 8t18E 1ۉX0X4p0tFVFV щ} G$W(ff%f= 0fua(9=80t;9ظu!t F Fu~hu)}t@󥋅 󥋅 w0NӉWVSQ 1p0 t 0#8tU@DNL!Ή!؉HT t0@8] C t`d E x@1҉h0P @RPRPhS聡Sh~#hl h#^YHE p p^X=p00tp0PCSp0#@=00 0+ 0$0 00 0 50NF)ڋ~,f,00Ӌ~4DӋF8׉֋ $(+ 0040 00 t/SQh# RPht#  =09z=0t4h#0XtsshĶ# j X=0t4h˶#0Xtssh# j X1=0=0=0=`0tm0j ]04h 5050[5050脋=D0t0PP[^50U0Y=T0t1҉h0jX1ۡ00;Z,sDtP?FXCP5F10X=P0t =T0th#Qh0X=`0 =x0u h/#zQ_=T0t hV#fQ^UP0PhC%Y[u70t-1҉,j,R PhC%hl%Rgt=x0u hv#PX e[^_]UWVS ]s{{@u(EUE9E;s WVE܃ WVhr#s sD80<0EU80<0 E9U}Xs sh#/P =x0th#_Eh#{^u1ۉh0j jNC EE}n}uPE1ɉM؋EԋU(0r800jWV tEWVhu#s s0040EU0040 E9M}s sh#j :Zu#1ɉ h0h˸#Nh#z[^px0u001҉ 0 09t9zu9rt9yu9qt0C0S4MEEe[^_]Ƀ=D0tf‰Ã=D0tÃ=D0tUWRPY_}UWVSDRPlep0t&uff%GW$Off%GW KftGj`h0GpP5p urjhP0Pp uNuJG G@j0h0G(Po u+j h0GXPo u uhtkh߸#Lh #xHu=*^_=p0t 0@ 0 R1ۉh0 (0,0 0t04A09؉rEA09؉r#f@u;9ظ=0 h#)=x0fh#owYHu|XZ=p00@4t GWGW f0H0ASQRP y%=0 RPh#O p0f`t f uf=0:9h0G(RKd1RPS5\0xt h6#H=0t1ShJ#PG(P舚=p0t 1GG1Gh/0(p0x_ș9rL=80t;9ظs)(t G Gtht)t 9ظ Dž1~V@tʋ롋 p0 9ظC tNDp Dttރ=0u0D(PShq#*j|(볋DpTtRPSh#5 0119Ћ}{AtRPQ C뷋ORPhֹ#_ t uC~8|X=0euDXPh#^_AWpq[20 0GfBf[j 1Yu01ɉ h0h#Eh#q[Zu-jj PH00f@u> ЃW0  B=p0=0tzGf@t`r@GpufGGhtGtSfGyXZ G=f@u1004080<0FV =p0tGFDG FHGXGpFDGtFHGd F@VW[X=p0=l0t =0G\uG`Wd uGhWl tlh #Ch(#ou 1ɉ h021G\G`GdGhGl f!0XZ=l0ub0X4 ؙN0ʋF4f0F0V4=p0LGWF 0W\tF@I0D11 0 G\<#8ts@DYL!É!ÉIT tA8F D`Td uDžFVVV[tbGhd19u 9RPhP#mA=x0t h#DYh#7mZ_XF0=p0tV4CSCh~@jjv4v0vHvD wh#@h #lH ZY=p0t 0@ 0 4e[^_]UWVS0E1ۋ 0;Y,EUu\TtA!A1EUAEUEU11tAu}׋E9ƉU}=E1EEU(0CBHLY4DEUE9ƉU}:E1EEU(0븍U1E; 1ɉ 0 0 0 0M0];X,}|1Eu| 0EXZ\Tu]e.Qҋ}!Q1E]]UuI SQh@0p5\00}=H0t =D0t =D0t50u5\0P =p0tE@x 01҉EU=0t60p,kEd1<SVuPh#h-10=x0=|0ExU t1U u E#uhѺ#=_XExU uۋ}G\M]ȋ} }tyt<҉UEyEE0ËEsM]1EUH뫋u!Ƌ}! uEU9]u9MuډM]EE0ËE} u 1s<}%?}u}9t uuu(xYuuh#;ju1xM󪋅xC|UEUpt|}9r WV/XZ Mt9uɋp9u|]5(0=,0|U(0,00M]11 19E}eu509|]s1-h1l|]+hlȉ uvE/0]1t_}}9u}9to<%?u9tSQh#:jM]Wx+Y[M]u Wuh$#9MEsE)lj1VEi1@0e[^_]UWVSEP@EUE@ E}juu# t@0t`}9xuPu9puHEuuhu#Ep p{ @0qyEpxu}qy @090u 0u덋=@098tEUMK؍e[^_]UWVSTU1EE 0@0111E0x,9}=0t2kEd1E7uWuPhQ#h-@1=01ɉM0M;9ظVSXZts]uD0=p0tGuEG.GptEGtEGEGtEVSlZY8tEPWZYuEHEe[^_]UEU @,+B,]Ƀ=D0tf‰Ã=D0tÃ=D0tUWRPrY_}UWVS EX8=p0t 1Q=0tt1; 0$0slj}1RPk@C^_DžE@4} G0.3ChH%PZY'Mqy u9tXY_8u6950|_ssدFXZC SCS u950|)js s]Ahy#,#h#%O 3ss訦1ƅs{Džq ^_=p0tBBBpBtVR`ZYu h#["_PsstQDž: ss輥VPtVf@Y[5050~VfHXZ:e[^_]UWVS(EP@EU0E0RVuuJ EEmƉׁ\TtCЋU!CQC RPh@0S5\00}=H0t =D0t =D0t50u5\0 ExU t U tuhȾ# XZ1ɉME@ Eܾ}juu |EE1E؋UԋMUM(0EMB0Åt4}9{u}9{tPHSK0PX#E}tlExU t}G`ǡ0RPuu ӉE1EЋE̋Uǃ00Ex@t+jj0@4 ؙRPEpHpDp pa 0Ez89x t0}t*E@$ EL@ EUMM}ttto0E{89x u^E@EL@jRPEpp K` tPuSYdh 5050o5050W=D0t0PP-zXZ50"0h@0zR`0e[^_]Ã=D0tUWVS\U1E9 1u0X,9] =0t/kEd1VSuPh#h-C1ۉ00u1EE1ɉM0MU;9WVWVQEu} p0tCECECXCpECtECd EEP$D}&EXftbWVYZt=0WVh#!WV^YZt!=0WVh=#脬 SEP襛XZ0Ѕ9xu39pu.JZHX0Rjh#EPLjh#$tC CC Cu jhe#jhq#EP躴`WVPhy#E?Ee[^_]UWVS00|jj'P1󪋅h_X=0xX$=x0uh#*G^uh#)[=x0t؋1ɉ$0h 5050l5050+T=D0t0PPvXZ50t0XHXI$~6#9)#~$tl<hNjH`ltW,Ћ9G0sVhο#$^_n=x0tVh#Y[h#EZC=x0uՋB,t|Fl$1~H`F|@ltË#XLS50 |^_u h#|00h 5050i5050Q=D0t0PP/tY[500Zp0tt DžPLDžHLPP1󪋅lPP TCHX$~@=80u\t`H`CXDžU X)Xtu{xlLtuQ+HhVHXDžU 1DžPDžhDž\TPh)#1hDž\L1 0׍G@tutL9t G@L9uՍ1󫋅<8tx@8txؙ!lj!׻9tx}^x`1d`dtx(0ttx1tX,9t=0t4ktd1=VStPhL#h-誨10tl1p𙋝ttƉߋ\Tt#@`Ћt!؋C1Q@ RPh@0F5\0|=H0t =D0t #=D0t50|5\0r =0u-|xU tU ttht#[^=H0th@0(H`0Y=0t =0uH0 0 0 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP505X0kC 0𙋽l׋pЉ`Ɖ׋`ǁ\TtAЋt!A1qhARPh0E=0tth#XZX0ph5050c =D0t5050*n_X0\8 uǀ\T5050KY^=0th#PE_Zu)5050CY^u9l0u 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP505X0Aj50HXZΉlߋpËlቅlpplp8T<DT9ƉD} TDp0Tl)Ƌ|@`ui@,L`tLH9t||`t||`tLH9tușD1ff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU u H1׋h󪍕U u P1׋Xu"xLu DžU t11ۋ;WVBZY< <<tt<<tM U u P`ك⋍`9s WVPh# CVtuPU u PU u P1ɉ`T9lpD(08lp1ۉL1[8L9˃<1҉@<@8 rRځU uT ڋ`Lى4ً4 @LC99hHd`1HU u HU t PLP1~\Hd`11ы1Ƌ1f$H```ktgU u Tjj(R``)ٺ!PMH8șlp`3$\`x`11;dsV`!։lt @lt$9~؃҃u`GCl뢅t$9~ș`l tLjS P+ =0`t'W3VslsQs th#踘(h:#PX<ZYtej PSYh 5050Y5050A =D0t0PP-d_X50 0^1ۉh0=0tP|x\|P* uT|PTxU u |PTHU u HhRP* h^#\P@;ZYtw\S|X HU uHڋ|xU tT |GThRPQXh@0c;`01h0=|0u)|xU |P\1ۋ9PU u P|U u |W\ !8uC<1ɉt[|xU t |B\u0tȉlPhv#,YXlAu1ۋ|@H9=U t | |G`U u T !8uC<1ɉt[|xU t |B\u0tȉlPh#OXZlAu농U u PXRP' txh#P8Y[taU u P|xU t |G\XRPUh@08`0t j SVU'  =0ts h#ՓDh:#Pu7_Zts󥋅ƀƀh 5050T5050<=D0t0PP<_Y[50&0Z1h0e[^_]UVS1;] s8Sh%"^X1E0Ph# FZYuj XÍe[^]á0!UVS1ۍsrT =x0t40i-hO#螒YX" #t7#P.Zty=x0uɡ0t4象01ɉ Lh P50tS5050;=D0t0PP]XZ500X15h0Kt00=x0t hg#ɳ[h#-Yti=x0uۡ0 h P50R5050:=D0t0PP:]XZ50$0X1h0jWjWYXuj]Zuj]Xe[^]UE0E 0]á0á0UE Puh-h-j jEUWVS]肭8ށu=0t50h "萐YX=`0t"=0u50h#l1`0XZuu ZYyWPh1$A t7=0t.j KX=0t肫P50h$# j腆e[^_]UE Puj' UE Puj UE Puh UE Pujj UWVSx1ۉ0PhC%!^_yhT#hVu蜵 ]t Ƅ1PSx!ZYyShc#LY[u%=`uz 9u;u0Shh0ƃ uShs#뜍xPV _ZyV끋%= Vh#e= u:u*ShV) t ÿ"Sh#0S [+S Y0hV  u|h0hUW$5XZ|듉e[^_]UEP/ZtPRPhȭ# u uh׭#hh0h0Ud0tjXj USXj0h`}&j觲 h0jjm0]USj jjCjj:]Åt3USӃ=x0tPh "YXSh#XZ]USu=T=Tu =Tt=Tt=8 uIL0t=u 1111D0<0 @0H01<=T=Tu = 8u1ہ=L0묃[]UEl0 0t,\Tu ǀ\8 Tu ǀ\ 8=0t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXC"Zu"hA#'[=D0t h`#)Y=H0t0PPQXZh 5050 G =D0t5050QY[0\8 ul0ǃ\T1\Tp0uSChEZw#= V 0΋0ѡ0ƉϋKdC40RPWVޤ 000 =0TC,HEƉ׋Eǁ\TtC!C1uCRPh0'=0=H0t0PP^PY[0ph5050E =D0t5050&PXZ 0\8 u ǁ\T50Q50u tc=0u#EKh#=00shX9s΋9tRP+0Ph#赃h050*H0 0[^ 0t[h 5050D5050,=D0t0PP#OZY50 00Xe0e[^_]UWVS]u e0X0d0xPS'Y_y蝟0PSh.#f=t0t(jS[ \0_ZyTl0PShA#5%= tSh]"wh#p u1U=0t X0=x0t"hT#/_jS˨ X0ZYyShd#1ɉ `0x0 `0u Shv#XZ1`0000001000010h hn0h hTǣ0h h>0h h$0  ʅ ʅˆt h}#VSڏY_¡t0t"ujV聧 _ZyVhd|#T^\0=t0u%RRjPVM8@t00t:0 x0 t0PDPj5\0S7@u Sh#Y^Tu Sh#hl%tV؎_Zt%h#VǎZYtVSh# `LuSh#C\uSh&#+50V4uShR#uShy#f^_uSh#܍X1‰11p~u 1ۉ0}Tu%HSQRPr DžTӃ~ ƅtBtѥPD1D1É1P1RPWV۝ OډSWRP踝 h#Z1ۅ~;srPƉρ}Tt!1׋ t101t ;r5Ch#h #h)#hB#hg#h#h#=}50h#@^_=KÅt0\Tu [t1ۡ0!`0=x0tth#[u h#YY0 h P50=5050%=D0t0PP-HXZ500_1ۃ=0t0Ph.#|Y^0=H0uNtJt2=`0)#=x0tR6$Ph:#XZ=x0u h_#X08<0040C, 01=$0C0k NKt鉅 ׉ ЉNj׉   =p0=00=0x=x0t h#^h#[01҉XǀP1ɉh P50k;5050#=D0t0PPE^_500[=p05=x0t h#Yh#ZX0PP #0ǂL1XǂP1\h0RC h 5050o:5050"$=D0t0PPD[^500Y0 tyPh#h # Hu^0  h P5095050 "=D0t0PPlDXZ50V0_0vuh2#ghW#`[^Hu\01ɉh P50a95050!=D0t0PPCXZ500X0@_X50?00^0(=p0tx<Php#JY[=p0ăx0(=x0uh9#ZHuqh#_=x0th 505025050$=D0t0PP=[^50m00Y 08<qH։9u9RPh#q0BHЉ8< =x0uh9#. ZHuqh#X=x0th 5050"25050K=D0t0PP<_X5000^ 0@DqL։9u9RPh#0BLЉ@D =x0uh9#U [Huqh#EY=x0th 5050I15050r=D0t0PP;XZ5000_0=p00PH҉8<PL҉@D1500=00=0?,=x0t h#i[h#I Y00ǀ, 04ǀ(<PH҉8<PL҉@Dh P50/5050=D0t0PP|:XZ50f00X=p0OL9=x0t h#lXhH#L _00ǃLǃPǃT\ǃX`B,F$1҅~K`F@#CLh S50.5050=D0t0PP&9[^5000Y =0tv0=0uhh P50/.5050X=D0t0PP8XZ0ph5050-h05X0 50Sh‰L^_u Shm#1׉1ɉ509)~09~NjLWF8HLNd t1RPS5\0 t>t Dž)h#h#^Zu1ۉh0j/b=H0tHWSS6 0WA8HLId t1RPS5X0 =D0t WSS6 0@0 004011Sh£(0XYu Sh#1׉^,jS0_ZuSh#}=0 0$0 ȉڃ9 sA0001ɉ 0 0jP:ã0j50&0…ˆt0Ph#"Sh0_Zu!Sh#[^1h0jZ7&0 |0=t0u*t!h#PGxZYu 80 0>hSP505\0ƃ 0 000=LBALt[=80hF#h9#Y_jjjjjS6:=0fGW69fG 0CJtejPhe#k =x0uh#BZu9h#1X=x0tC=0fGW8fG 0_fCff=v]h#Y=x0uh#Zu8h#ʼnX=x0tfC=0fGWZ8fG 0_fCffuih#Y=x0uh9#lZuDh#[_=x0tjjjjjS8=0fGW7fG 0f{f9}zD3<:uƃu}EEUEURP50u u% 09u0E ;}|v0EUtJ9tFRPؙUEЉEe]EUSQRP RPhj#_RPhĶ#_ Fyj ^Xe[^_]UWVS}u EUEUEE0ؙMʋEeEUMuuuVWڊ 9Eu`0UM"whx#$_X19]~KؙEURP50VW艊 09tؙEURPhĶ#^ 0E e[^_]]e[^_]UWVSQƉӋJt,B=0#9u5!#s sRh#C 1҉Sss ssV01E1ۋ09)؋r09~ƋL߃=D0t VWWj) 0VEA8HLId t1RPW5X0=D0t VWW) 0X0Ede[^_]UEU z t]]UWVS]0Hdu } t1 09{ u9st7S5X0$0uWVs5\0Cs{ ECe[^_]UVS0500t+NdEU  t19S u9CtCt[0uh#uu uS$SPC00X0K؍e[^]UWVLU1u} uĉ}ȋEER艪Xe^_]US]U tuwtttoPh#9{@uRs s8 RhUW$XZ=x0th#}Yh#Zu 1]UWVE500x=D0t50p50 * e^_]0ÍL$qUWVSQQ9 0 $0s RPh#H50 01ۍ}WSQRPs U Ƹ8i-;sAeY[^_]aUWVS\]u EUEUEUEU uEU3E3U u uE C%)uu1_Z=00u <vuE "]e[^_]00U1EEƃE9Eu E9EEUEUEUEUEUEUEUEq ]uuMURPZSf)lj$SWwG/ 9raEUEUE Et@EUEUEǺ E"RPMURPcZC1ɉ 001҉00100E EtF?N)Eu ]e[^_]BUWVS]\TUH} FE 8uh`̴} XE u h?#h`SP =0t hf#z_L=H01@J =D0uE PP1$Y^E \=D0uPP#XZ1fEfffE@9uރ=D0tE PP#_XE \Ǎ=D0tE PPy#Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\P UWVS}u=01h0X0y \0h0P^_=e0=0=x0t h#v[h#VY=x0u׋0 0=p0ux șRQt 00h S50 050S2=D0t SS XZ5000X0Xh05X050h@05X05\001t-0t%FS5X0{s跸S豸ϡ09t )Ph##1=0=0=h00=x0t h#^h #[u 1ɉ h0=h00ƀ1҉PTXh P50050S=D0t SS(^_5000X0r[=x0u h"#uY=0tshH#ul0h 5050 050S4=D0t SSXZ5000X0_=0tqha#t15l0h 5050050S=D0t SSY[5000X0hZ=0t"$0 0kdPQSh{#Q/5\0ny XX0Ee[^_]Yy e[^_]ÍL$qUWVSQ(E11҃}50~8]9 0040)ӉMЉ]ԡ(0E1҉])؉EȉE9‰؋]1EEЉEEM]KE9t*EȉEËE]̃rAMEEE؉U܁\TtFЋ}!FEU܋0QF EURPh@05\00=H0t =D0t =D0t50S5\0 {U tU tuhȾ#XZ=0EUؿEЋEU (0{U tEC`؋Uu؍  0EU9Uuu50=00MLU9P8u+KIjH`URSPU)S$) )Q h 5050G050So=D0t SS^_500h@0 `0EY[E]9]yV11ҍeY[^_]aUWVSu 0!Ut 9rt8R}t-jlXu h#s1rBЍe[^_]USM 0#AUY9u ЋR9uX[]USEU 01!t4^Fu(9u 9t331 É[]UWVSu} ]9WV+ZYWVqZY0,0t9ZtjSP,0 ,0M]XM ]$HX (0t}9xtju50e(0 (0UMHU M$PH e[^_]ÅtUWVS E uV8 ~&<}EEH89~kًEuC&E4`&ߋE9x8|EU!9u(EU|EUqU߉eMMG빃 [^_]US] EUR`t(t7uS /u<<+  !8]Rh}&h#UU ME@`t+tDuTɃu:< %ЃPh}&h#oUSE MUR`t't6u?Ƀu)3  Rh}&h#]USE MUR`t't2uAɃ)u+5 Rh}&h#舺]UWVSu E$ %EFlU(EFhUEEM}}~ ExE$E8NpU9r UùupE9} Etуu EFB܉)EX؋})EyEؙ}ǍW?ك9M}tu :JI)ˍD}9~} UEU~E U+EU~E U+EUE$E~CUuI[^_]UWVSu]tV薽 _uVh"jQ `1ɉPhd@u 被 tGRhedAu G @u!d8tuh؅"2XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h$R" ƹ ߋSh"V耮 CPhC"Vr C Ph"V` CPh"VQ CPh'"VB CC,$C,Ph:"V* C0PhO"V tP1K X}!uhzd@u F @RhedAu cF @uuh^"j蛺 41}󫍅Pug^_@4ȋ9I9t(Ћ}1ۉ1E1ɉ [Eƀ*PPj PEP1e[^_]UWVS4}jhPjWptGjPjVWVl u$U ʋMQ؍e[^_]UWVSu] 1PV~ZY1ɉ%= j/V_ZxrPRV)Ph#h0WCjPu ‹ 19}e WPSZY u$PV9ZYyA =@uu`uÉ1ɉ PS[Xuk%=@u/h#h0VAVOÉD= ji XZy.hh i à 1҉PSl;ZYt-SBj Y 1ۉ 9u 9t0P9_Zq8T8PRPS6 s>PhFS$B yL^8Si Y h#j$W@jjWh Ãy}tWMZt8PhF|@SA y&hF SA^_PtPY}}Wt9P賥 XZtP蔥Xiutڎߋu0Pa_t PTYt詎ZxS>h 룅t荎X؍e[^_]Ƀ=D0tf‰Ã=D0tÍL$qUWVSQ0EЋAEqy AEĠ0Eס0X0]؉E܍EPuuWVX UMUȉM̉E9މEsMp1Mȋ])jj`SQ[ ǡ40U4ڃr h#迯_W!ʈEċxlEHX0!9tPRPh #u40u< =x0t h#?a^h9#2[u 1ɉ h01!EPT@P}ЉWE1҉PPPTeY[^_]aÃ=D0tUWRPY_}UWVS EԉUMQƉ׋] 0H0ș9Ή}EE5EPWVuP0;B0u Exth.#tX0@0RPWV\ UBEuWVPuU tUB EPE܉UM9E9u9t/MC E܋UM9Mt}u ƉaE9t }tcM܋EPEEPT@PƉ׋]E9u1 ce[^_]UWVS,E @XEȍ]ܹ1juȋEp ޅtPEp[_E P@#EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0hE#ˬ,=x0t h#^Yh9#Zu 1h01)V] CSFV sC8S<e[^_]UWVSPhjjFƉRP/ÃfC9EPjjSN0;B0u UztWV2K_X5D0u  0QrRP3 E@ `0M ȐȔh P50$5050[^=D0t0PPEZY50/0Xe[^_]UWVSE XChSlEEUE EE=p0tP@P @ƉuOEXuh#1҉h0YX5D00@0RPWVqS E@ `ChSlEUE Eu h#蛩0H0ș9M}sE E>EPuuunL0;B0u Exth#PX0@0RPuu*T UBEPT@PChSls}EgUBXEU}GWEU G8W<50#uTGPWTEUTE@ U B 9t`1e[^_]UWVS8]tE"# Ey$#00}}{rT 9RPYXJ0ws$Ā&1҉Ut4Vh#=x0h#ZXt4Vh#賨=x0Fh#ZYRt4h.#kj.t4+XZf%f=tC0ڔڐVPh^#5=x0h#ZXEPjjQJ=0;G0u Ext+Crt4ljE G0E1ɉ ‰L_XP=D0%JXF^9t(ߔߐVh#蒧E`QB9uР08BufJEf9uwh #@_uS h #/Yu(h #Zu1h0}t0ؔؐ,F_X01ɉؐؔ0{rT uDVh#ʦXZ=x0t hȯ#X^h#YsS50,XZ0t4*EEPjjujH0Z09u Extuh#1j,@E܋E=p0tP@P @u4puSQRPQ EPԑƣ40X1}9}~h0X01uE)ù`1j@@P跕_X1U9} MȉыU @ۍzEE܍Hhhs EPUEk[^1E9E~+u܍Lphs EPUE#gG^EOScSZYE؉E 9}EW諉XEEԍe[^_]UWVS]KE{,uh;#h&hF h#^;hˀEY11S04tAFVEUEPMU'Zuv vu uuAu6G9{4sEuEe[^_]UWVS}]O,uh;#h&h` ؙt,h^#h&ha h#:U Mgu)u؍e[^_]UWVS}]O,uh;#h܀&hq ؙt7h^#h܀&hs h#:UMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}90t5X0WVSht##SWVu5X0R1e[^_]UWVS] u}90t5\0WVSh#"SWVu5\01e[^_]US=0t h#趒?j5<0}[Zt!h #聒h#zZYuj5<0sX1ۡ<09XL~$90t@Pp0h*#/" Cҋ]á<0t%Ux,tP%Y5<01<0ZË<01t z,tUu uuuRUWVu} WVWZY=p0t@X@d=D0t1s#0f`u331 ‰Ѝe^_]UWVS0tH 80 800!`t'RhW#h# "jyatuhlpx1Rh#h#躼 thr#輐0 ǀdƀah P505050=D0t0PP$^_500[1111 0!PRWVjh<0h#h#ZYhr#0 ǀdh P505050=D0t0PP\_X50F^01ۡ0dJatP Ph#h# h#01ۉdƀah P505050&=D0t0PPZY50oX0 Rh#g؍e[^_]Ujh0&Pc UWVS] 1LPTX\`DH0&d󥍵dh#uS|} < @VhUW$htQDhdv$v tQhU#W>,jVjhdv$v W 6lQPl/SlX1e[^_]UWVS ƉUMjQRPtuh#V_XfUt+tuuh#VSVl^111 tuB t@uمtr} }uWuRJtjjh#V~jjh#VjSjjjjjV pfuuh#V~uuh#VjSjjjuuV,E E܋E E EWOM1ۉ]G uuuh#V ~#1ۉESPuuRRh#V EԊWуt=t8juj1RPEUEURPVi u[]PB2EUE UM ]}uSQuщ‰ @tE9 STjX렍e[^_]UWVSu} hjeY[u)Vh$#XZÉEEU(,E$E U$0418%jhSPV_MuhVSFh9#Sb<RPZY@uhE#B$D%=u?$Phd@ @uhQ#S&^_$uhh#M, ((Phd@b @uh#뭋, (h#S딋Eu ǃ$$, (uO1҉MRQWV("  ‹MtQh#SV  (,u(,EU싋$1҉MRQuu,# Ɖ׸9ЋM|RVh#StRVQuuh#SWVS @tEjjEP11ɉ @t_jjjSEtHt*jSZYt`@ P$@ t^9sVu jRPS@u7tP* Xh#SSf 1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@, @u%h,#SXZuShK#S E]o) ]US]jSYZuh#jS YZuh#SXZ11;FN|#~$u~,u;FF |F1҅8tZu"[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu+_ZNjF,uVЉ||t2@|jmURj$O8QJUR|P tijWR uYjuWUu!@uuZYjuPUu@v0sh#us[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h#S 1e[^_]ÍL$qUWVSQ qyAQEUy uh#S{ZY8$E܉E1EuuWV.  tuWVh#SBHEPuuuu Ɖ׋EU tuuuh#뷋]9ً]}eY[^_]aUWVSu 1ۉ^h·%5Lp71 _X1td1SщU@&M YZMtUBuSh'#u} D&H&  Vh·%j*1 XZ똉e[^_]US1L&@&uhC#`u܋]UWVS ]} Wh5!#S{ 1D&H&E؋E!ЋM#M t:5!#;tf3#UWPSV|W@&SI|UҋE!U!E`uE Et;uuhQ#juV5!#;tf3#WPS{WVS{؍e[^_]UWVS]} tEU E U uhX#S_X S^u E@P;E sPu hg#S؋E pVSZYEtu h#S 먋EЉE܋EЉE؋E#G0EE#G4EEU E UG0W4S(_@fVSZYM#H0MM#H4Mu} u }p0x4S^@+u h#Sn Ee[^_]USP] ;u:j EP5Lp7O U:u1҅u5Lp7hO"u Ћ]UEUitstau+u PJ uPZYUg@Rh#P UE ft*u 5Lp74ZYt5Lp7h#uA US] ;u#5Lp7Y1҅uh#u%XZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h#PY[E1eRP6 $RPn[ZR@8Zfu%S5Lp73ZYQh*#P\ ֋]UWVSu }jj h5!#WVj]S yEWVuhC#}t Sh1$oZYj Xe[^_]UWVSQ]M tu ET"EF"QhK#S'M $j-VXZM uWhf#S 9jVQjjuuS U 1ɅuWh#SKVT^ -tUS[LEPVZYPEPV @'Et M 9 P-uPh EPVh&jBuS e[^_]UWVƉj(jJOZYt*0xUM PH 1҉PPUP1ɉHH H$e^_]Åt!USÃx$t p ]SZSVSX]UWVS }t>VEUFV E܉UEUEUEUE9E EM|vuah#WE UEUEԉU؋E9EEM}6u&uuuu uuuuh#W(1FM]3M 3] t?uuuE Uà h#WEXZ맋M܋]3M3] ut.u}t#uuuuu hj#WEFE F E$F$ku}tR#}w+M &#}w M &#w &RQh#Wx1ɉNE C E$C$E;Eu6E;E u.FCstX^EUEUV#E9Eu2E9Eu*FCstX^E܋U+EUFV vE U+EURPEU }PH SK UMUMUMNU܋M+UMVN VPC^sXPtB؍e[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuu  t/E؋UWVRP2 щΉE؉UMWVuu  t/EUWVRP щΉEUMEEċE܋] ؉EE] ؉E}EăxfPEЉUԸ]9ظ]A}tE9E؋E8E؋U^9uEE؋U܉EU}TWVuu EUE Et6EЋUEȉUWVRP Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}tE9EȋE̋]9uȋE|E] u?9}EEPWVuu ÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@Eu1EċEčeY[^_]aÍL$qUWVSQ ȋ]yIX P@EUw Uyh# %uh#urXZ~th#O_ ȉFV E؉U܋E Eu.E؋U܉GW FGFtxM؋]\MЉ]uuuu M؋])ӉM]MЋ]9]u 9M9ME}uuSQh#uEUGW )ډVFV )ډFV uFGFtxM]SQM؉]uu   ‹M؋]t&M]uuSQM] M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U M]uh#u+GxpF)^N^ 9MEu h-#~t hQ#FV E؉U܉ȉ+EUEUE9E؋E܋U} h|#E؋U+EUEUFV ȉ+GW VE Eu FGtxM]dM]O_ ˉȉڍeY[^_]aUU Et 9Pt@]UE]UEt ‹@u]UWVSEtf1yAQ $T$D$T$ D$9E E\$ |I11҃yuEԍe[^_]UWVS@]u }(,EUEh#WV6 t(qtsu&jsEPjjS@uvE95P-th&j[^uujjjSlEЉUԃ}u}t.EЋUԃEUE Euuuh#SE$1RP,( Ɖ׃u؉}܋}9ЋU}uuuuh#SjSEZYtE̋EЋ@E Et h#fEЋ@ EjS^_u h#?jSzZYu h,#!x G EG$EjSG jS9 tu hN#S^XPH UMċM9Mu"M9Mu}u he#SY[1p GPGT<9s/jh0&Vg tV(F,9ŰM}ỦEȃ͋u}+u}9űE|uuh#4E؋U+EU9E̋M| h#U9UEUиM}9|E 9ȋU|&}tE؋U܉EUh#SXZE9E؋E܋M u}uU4}u h #SYX UMH0xh#S{XZ1}9}[uujSD@1jp juuEU+EURPS uh&#S @ r $󤋃p PF V$1FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@.Eu}U؋EhG#S_X}ffuS7Y^@,he#À}|h#SXZje[^_]UWVS]1uuuuu11h#uu i1 btENtoat%itClhN%Y1EPS &EPSEPSZY@kq`1;EE}=S0UU܋UUZt&xuPtM9Hu M9uU@օtE 9P-uEU t th&jZYWVRPuSe[^_]UWVS EЋu} jj h5!#RPj]S yEWVuh#n}t Sh1$ZZYj rXe[^_]UWVStƉPZt 9St[Rh#V *{ Rh#$1s3щ¸#$1s sщ¸#WhUW$hV (Wh#htS SVouhh%VP SVh#]GPh#hS Sh[#>$jmSj$G8P7Sh#h#G0W4 uh#X1RPhP?Pލe[^_]Ë -Q-y ;-| tx-J x-Uhx-PJXZUWVS֋U} $,&E*#` u>h#;X ׋󫋃V6h1#XE#e[^_]hA#X8Sh#htS Sh;#shP#E_#Em#뚋A t h1#~Xh{#sC SX1ۉ019u 9tCuE#! #t5!#PPh% h#_tjmWj$8Sɽ1tttSh#Sh#hWWh<#xZY?h#jXu+u"E #VE E#e[^_]5e[^_]UWVSxhw% h#h#x h#h#xà Džp#Džp#s3x ps sx pt Ct Ph#AK Cs31 W{ WhUW$hPD Wh#htV*VPuhh%PL Ph#XZ{ h0h#hVVh #Vh:#| he#ojj h5!#x$K x$cRPjVq x$K x$cRPhZE" "jmVj$G8PVh#h#G0W4 uWh#X[tVh #GPh#hVVhUW$hZYgRPhPPPh$"9K Cs31 OC tYC 8P)s t󫋆Rh#hVVh:#1e[^_]UWVS}] u1EEEEh#VS' t^l`~\a wT$P&ut:xuCMÃM뽃M뷍EPW EPW6ZY@uM딃M9P-th&j^_xjWZYu h#X]t UI;]E}1WUM^t xupt9Hu 9uu@܋Ut4hw% h#`h# h#Kh#IW+ƃ E#EE#v6 uv v u  FtMPh#XZ N Fv6U vXZp h&"}Y볉؍e[^_]UWVSD] 1}0&}E8#uhE#uu % tditHTt*PLt7olt Pwb&hN%Y1tukVS_Z@ut6PEPSB @u#tjh0&VX t E 9P-th&jZYVh EPS&e[^_]UWVu }^_]UWVS]u 1ɉMMMMMh#uV$ tfitLat%bt0lhN%/Y1txEPS~thEPStXEPS"_Z@uG1;EE}1SM}Zt xuPt9xu 9uU@܅t95P-th&jeZYuujjuSe[^_]USЋQfPfQfPQPQ P 1Ҋ\ \ Bu[]USÉIQHQH QH QH QH QH QHQHQHQ0h#RS~]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk&WhV uu wuD uRCu1jSk&V-V u%u vuXD uًU EGue[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh#Wm 4 uEyƒtsVҳZYu+C xu"mt s sFYXj ףZufXe[^_]UWVSE @80ƅ77Ph"u t 7u%Cu X0u: ^t h#0p jVhp(7 Ttg81ƅ9h(@󥍅8Ph#jPS~0Ph#jPuV~ VSh#j Sn[t h$j T˅t_S zuR(,WsCZY,u1(zu%B  TShh%uU u 跿sV般ZYu+C xu"t s s>YXj 荜ZuXe[^_]UWVS@J9sr[^_]UWVS]u)ZuPe8E_@u h,&h#u0^uh,&h#j< sP3s Wsh$uw t.Ph Eh$C$uw E tZuF EYLEPh#u }Chs@PuS @qh#u?w XZt Vم Yh#u!w XZt Q軅 XMEPh#u E Mu {hE EEEM؍CU`EPu u @Muh,&h #fEftft5fu6t2C t Wh/#j }tC(UhO#C0ut3hk#j] t C0sHtS4KL9sщ}t:s@shu us@s`u @u;4虷81t/sl`}t$CU[s@s`u诚 @uEsd6CptSuZY@u s\h#s8sXuw @u s\hUW$te[^_]UWVSPuBs Zu1iu ct _tQV趣 Yt=Wx EWu u MuS荞 V螣 [^PQSu uV胣 ZS s X؍e[^_]UPEPhqB$u: ƒ 1tEUWVSu\Ph'#V t\Mfnj4Zu\VXtd$1jRVVhiS/@tt}f1RPh'#u ' 1e[^_]US]uu S? @t ]]1]UWVSu us [^u wP. Y9EsZ?V8 Ƌ}M)1Ze[^_]UWVSu ubs [^u Pǁ Y;Er?Vс Ƌ}M)1Ze[^_]UEPhi"u@ ƒ Eu蝴UWVS8uEPh#V uhF%hP&hh#h#Vr _ZtP/ ƹ}[E]ShiV5}ĉjSL Ph#u r ƃ S軛 Yt=EUu؅yكۉM]! EjEP~ XZuVh#u r V\ He[^_]UWVS1Rhiu4 @t|j7RPh#hSހ>tVh#IV/t j7RPh#hS;tSh'# S\ e[^_]UWVS]h#Sp Y^tVPd Zth7#h@&jVh#;Vj ƍUܹRhiS3@u hY#j e[^_]UWh%1󫍅hPhiR3 t|}UWVS\Ph#uy uhF%hؕ&h0h#聫dShiu13 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVvZtÍEPhF$V uhF%h@&hh#蹪uS1^Xu h#jt CPS| ZYu h@&h#Ph#u o uh@&h#j. SP1e[^]UVSSu] EPSV @uh&h #j h#Vn ZYuh%h&hh##Eu$C$PRSo He[^]UVSSu] EPSV @uh &h #jv Eu h5#j9 h#Vn ZYuh%h &hh#bPh#Sn He[^]UWVS}h#$Wm [^ulP| pY@vh!#VsZu h6#j VPh#$W@u hO#jw xtdPhiWp0 thf#뮉`SX`e[^_]UWVS}h#Wl ZYu觮rP]{ pVYXuhs#DVSh#WE@u h#j 1҉Uu]EPhiW/ @u h#j SX1e[^_]UVSÉЉʉƃ ι#u5!#QuRPSh#&e[^]UWVSu1jS,Vhxi P@uh# UЉUPXۋUu h#j U]Vhxi W趐 @uh#ڋE9E~E1}~ WhUW$}FXZ;u} j 茏Yj 肏SjֆUVSPuVZt"ÍEPu V @u Sh#j} @P艆UWVS$ƉUЉh#Pk [ZtPy ƹY1@]Shvi V.j Sw Ph#uek à V, HZe[^_]UWVS0]EPh"#S uhF%h&hfh#֥MԋU ;@uE̋UЋM]Mĉ]ȅy+كۉM̉]Ѓ]!ىΉЋU!Љ E UȉƉ׉u}j EPv XZtVh#u j VR He[^_]UVSuV[th$Vi ZYuh%h&hh#Px ^fx PS+ZYu h#j PX1e[^]US]EPh(#Sw u ٪&juS,ƒ 1Buhȕ&hUW$pXZ]Uh1#ѯ1US]dPh-U%S uhF%h\&hh# d|lPhiS+ @u hh#X1]US]dPhX%S uhF%hP&hh#蘣d|lPhiS>+ @u hv#sX1]U1EEpPhiu+ t hf#j 1Uh#ug ZYuh%h0&hh#Ph#u %h HɃ0 v+BwBÍBwBU]UWU1ERhiuG* @u h#jI 1}W|$wUWSÉЄtGjj h5!#QPj]S S0 z5!#t#PSh#膋 h"¸f3#Xe[_]g_UWVSic uh&h#j jLhr-{p_Z5!#t#jmhr-_pZY¸#u5!#WPSh#h-~=ho-t VW?Xjmhr-pZY¸#u5!#SSSSSPSh\#h-4$V1 jUEU P]UEU P]UEU P]UEU P]UE1҉To-To-1]UE1҉\o-\o-1]UE1҉do-do-1]UE1҉lo-lo-1]UE1҉Pto-to-1]US]Shr- oYZt 肦=CЃ v؃߃Av `hr-mZ>uC r-1]UE1҃t@0]UUpo-t H9t@]UWVS81ۉ]܉]E䀖500EЉ]ԍEPjOZY@MЋ]u h#EU׉uȉ}̋}50ɚ;EEtJ*EUʚ;EEt$ӃMЉ]ԉ11EȉẺEЉEԍEP[@tEЋU ЉEh$j uGEċ@C t@PYEąt݋@EtCt}tMEU9u2U9u+9u}SEZtjEPu Y[=0u4]늋U9ыUjSZju.j}EPjNZY@UE]9u]9u9}~ 9UȋU}h{"jY UWVSÉHPZtP_D 1D1V9"LY@u h &h#&RPHSƃ uh &h#j R1RPh#hWlWVh|#t jVWϽWhiL]@u Wh#t Ph#)XZjVW腽Wh~iL@tt Ph#Y_j pHZ@uh &h# u =`o-j:RPh#hW?tWhA#sWY| j:h#hW?tWhS#-W| tHSW?YXjVWhDž@WhiLuh`#轄XZjS#jVTWDžd1hlWhiL臄 @t|hhXu ht#l@1dWhiL@ @@u h#@lh#@R =0t%oA"w&Rh#̓Y_HS XZ=0u0=~0u'DjHSDP jV`VV~0-{k?PLh@uG$=~0t#Pj h%#0%X th$f3#X thA"f3#oX th#f3#MX tRPh#胂 h%#0j_ th$f3#^ thA"f3#Y th#f3#Zj 5Xo-X%SV65po-tjHSVv e[^_]UWVS]S^t EPu S @u Wh#j u wY SWZ YeY Etuh&h$jf EPEZt h$jt u1EVtRUWZYU}tRUuZYURhqB$S tFE=0tFtj=0tFu[=0tFtL=0uE=0u+Hu)}tj sXhx-vZY U6"=0tj @XS譄 u襄 uŲjvUWVS,ÉUP(^uh#@h$SZ ZYucU̹ Rh8i(S @ux8t h$j jh$u uh,&h($j Eܣ00u VhE$j e[^_]UVS։PzVSPhW$jc UWVS]U ho$S"Z ^_uh6W%h@&h2hy$v‹0ށ؃E u %ERUSh NjURph WPI$tDPEV֨ZYUu #9ERE ËE É0X1e[^_]UVSP]U Ch$SMY ZYu WPg Sg VP#Ãt7EPS50ƣ0Sp1Fu{#U0e[^]UVSP]U h$SX ZYuh6W%h &hhy$Pg S4g VP #Ãt7EPS50`ƣ0S1Fu{#U0e[^]UWVSS]U h$SX ^_uh6W%h&hhy$pƋ0%EVef Vf WP^"ƃt1PuQZYu$EM É01e[^_]US]U hEPh$S uhF%h&hhy$ 0%˃ uˁEU ى 01]Uh-h$PXZUWVS]h$SV ^_u3h$SV ZYu"h$SV ^_uho$SV ZYtP0 00!‰0d$1󫉕tVh7iS @u h $j e[^_]US] u諣PhUW${E tP(Yt Ph-$zXZEPZYtPShW %z ·%܋Et Ph6$zXZ]UWVSuV[u h#/VYu1P4Z@u h&h#p 81jS8P踱8Ph8i(4@z@`%1󫍅`PhiVT @uh&hC$jQ tWphS$yX&Ht#t8uP9u Q跛XVh]$yXuShd$r_XjPY^u h 5"j \8Ph8i(4Ny @uh$HfPhx$yh(%HH9Tt$h]$xh(%Tj)wj wP4Z,H%(hS$x&_1ҋ0t` &xtO(9u 09t4#HɋL f3#u5!#QPhW %6x ,딅u h%x^j 3wYjmZti 119X~M%9u>uWPh$w h$wh$4j vF뫃 u]e[^_]e[^_]UWVSӉϋuuO 0O Zt2tVWPS u3{ 1ɉ [u1V{ ZV{  Xe[^_]UVSu]}t Ǔje NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjP6u?BpWf^ Y_u  ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URP {Ɖ׉‰ 9иr E8t虒8"uo芒;sC| C 9s} i"WV Y^u O 볋K(PUE Z@tE}G _C G1e[^_]UWSËtPy X1e[_]UWVSÉUMU1}E;E t[ztMUj8^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PXC$ue[^_]UWVS1@}u +-E@} uE@ } u"PRCO [^uPR.O ZYu덅LPhi"E 0] tu 112L 17 uu_tHh·%HPcH,ZYu Dž,%E@0tj/S~)Y_0t @0`1DžTXDž\@PTP,Saǃu.@xuP0 蕏kTtHu@xPSkYZHu.fDžtt0u_SXDž,uTtt,(1҃0u$SZDž,T(j DP0,D (t8t,v ,v蜎"SJX%Dž,(S1X(jDž,10dr<wWr<w7 0 u0 Ј0E޹Eވ0 A$(P_,fCNj ֋$B$@tP\^(SW S LEHVUE [@2Ex0$,S ZYu,Sh̢&h$jm @PV W V uh̢&h#j? SEpE0J uSWs h̢&h#j S@s XE}G }xG }G1e[^_]UWVSu]}t WY{Zv /W Yu #NPڋE Z@tEC sF C1e[^_]UWVSU1EX1u܉u؅Cu3}Ej1ɋUE ?E1҉Pupup Y\uu}Wu Pu4EAuq }uE$EXExtHu E؋Exu[}t1}t.E}ue[^_]UWVSQu}u轉EX$Cu S{0u3PE 0G YZun?-uGPRU{YZUu{(WRw{YZuA{ Cu CuHPE 0{G YZtPE 0`G YZu^CwH$&P[ -w7 w7 XZ1u(78 _uCPh.$j ȋK 11PE 2Z@tEF EFC4FCF1_ Ue[^_]Ujj$ZYt$&U PUPUP UPUPUjj`ZYt&U PUPUP UPUWVSu] FtVuVVPtX1;}t$jXt0TQ1҉FNG1 VuVVP-XFue[^_]UVSuj(jY[t2&EC1҉SCCuu SB @u SX1C؍e[^]UVSj,jOY[tDÉآ&E CEC1҉S$C$C(uuuMU @u ShX1e[^]UWVSPu]1҉U1+Ei̋M ;}|1_t79reGM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EVcm EtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S: @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps @u܃C4uu P!Z@u1]UVS]u jZt$pSuCCC]e[^]e[^]UWVShF$uB hM$upB tÅu'j`h &hT$}` VP SP Y[@8FthZ$^F1󫍅Nv󤍝tJvr󤀽uCU9 t h$j |t uh$jP. jS& PhJiu @t1 h$Xe[^_]Uh-h$XZUWVS, =0 ƅƅF1RhKiu3 @PXujP Y_VjWhQRP$qpujP XZpVjRhVpQP~$h%W&t$,h%RtZY,t $tRVRSPh$de[^_]UjhIiup @u h$j 1US]Dt-9t@tu0@50 X ujjSx 0 u Dt-Dt-]UWVS ]UUEt ;0uK,-f|JxuEuE} tˆUPu 2IZYUtC}t:=0-‰EHffUtSUBf<fuh8$E9r^hk$ E9rhO$\X1_EtE ,-WtU0 ,-fW ƒF-C+UE9~)1E؍e[^_]UWVS]u ~;0uS,-f|PxtN=0-119} fLOu0t ,@t@ޅtt SVh|$SPhȉ"b %hz7$bY19};Ph1"ubGXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9s~1LuÍKكt :M؍AMPͽZtfP׋Me[^_]UWVSQUU} uj[Uuh#RZu h#j jPV֘ u} ]e[^_]]aUWl$1E|Ru ul}UWVS,E u:[u h&h#j6Y@uh&h#j% P薌Z@u h&h$ݍF1jR sXo^_C xyDž@Rhi` @uh&h$ZYq:u]S 0PjjhVPRu+t"%t$VPh"_ 2Xe[^_]UWVSu FPZu|8+u1h%j \`%1juS{t \vSh iR^ @u{81t{8/th$NXpe[^_]UEU =0uRP*ZYE E$^UVS] t4sVuUmZYtC P;UuPVZYft1e[^]Uh-h$XZUWVSSÉ։M1S>_u}uJh$j jh$Pl uW0-DPtVh:iSf @؍e[^_]UVS]u1ɉh@uh&h$j EPh$$S u(z)EfEVh9iSƒ 1Bu h,$j e[^]UVS ]u1ɉ@uh&h#jR EPhV$Sn t,juV E؀8t-EPh$$S uyy)EfEVh9iS=ƒ 1Bu h,$j e[^]UUE9@t-EMfuu 8$tURPh?$.\ ËPt<f$Pt2k$P}$Ptq$Pt "øx$ËtI'k$t?x$t2f$}$tq$t "ø$UWVSljӉʋuFEE9s]19tc  ^w@v|UShz7$Wu K 1UvAE9s:2UFPh1")ȉMP^M UuRW* u9utD7...}e[^_]g1e[^_]UVS ]uVhiS @u h$j EPh$S1 uhF%h&hh$pE߉EVhiS uEh$XE1e[^]UWVS$]uӹ!1j EPhI%S?uh&h$j EVhiS @u h$j* 1e[^_]UVS ]EPh$S uhF%h&hh$puVhiS @uh$E؉EVhiS @u h$j 1e[^]UWVSxhSh2 $u@uht&h-$j6 DžDžDžDžDžSh@$f_Zu?Dž1ɉDžDžDžDžjShH$C u ؉8 0-DytRx:uL҃0jWVh·%Pt;9u8tMhQ$j jRVjPdƒuft;t 1҉Ŕ@|Phi8uƒ 1Bu hq$j e[^_]UVS0]juVh $Sо@u hh&h$V Zu Vh$j9 Uf@fEލEPhiS4 @u h$j6 1e[^]Uh-h$'XZUWVS] 1}EPh8i(S @t&E1r r%1ʹ|󫍕[!RhiS @[< v Phg $j2 h $U[P\P <fDžLVhiS @t%fNth $=0t h $UXfDžLVhiS @t%fNth $=0t h $OUXfDžL VhiS @t0Nf=) Ph $U_X=0t h $UYfDžLIVhiS9 @t0Nf=) Ph $TXZ=0t h $TX1|󫍅|Phi8S @t}u(j S$PhiS@)_h $YTEEEEĉEEEԉEEEEE|Phi8S^@uhB#TXr}uMu u uuBEH~HE0-DJtx:t~&jPh@$ uWh $S^_Eyh@$SY111Pt՘hXZGj,xRDYyh@$BSXh $5SY4t8h $SXZ h# SXj &R_PhiS= @PhiS! @jh`&P u ftePh $R[^Vf"fP\ Ph $eR ft Ph $JRZYj bQXe[^_]U81EE1҉UUUUUUUUEPhi8uF @u hq$jH 1UWU1Rhiu @u h$j 1}UVS]EPh' $S趺 uhF%hȥ&hNh$guVhiS @u h# $j 1e[^]UWVSÉUPhUW$*QS^Ǹ) 6 9|j<+P)X$j<P))_ j-P[/UEPh1"PEZYUJt)Dj>OXe[^_]UWVSƍt1fDžfDžRhiV y h $ju h' 1p)֍H(@!P }_9p}p' Džp h $ha<%h $h $h $h$hx $pph# $O(G(\G!PO(!W Y@0t @0EA0tI@tc@tC@tP@ tS@@tB@yA@_GlGdw19~L9}B`fWGu uw%k pfx p@tp d#z= tt= w-g [=wOf?v'k 11?1p%1=$v-- 1p-1ƍG P h@0Sld`VPPpphL $MG"`G!\ƃ0`*w/wNtA2FltU0W=0FQSPhw $h} $ MQl=0=< $5 $=0$YdPhUW$LXZi"d9 ʃl5!#y$lRPh"LC·%빀=0FPFPFPh $h $YLF1d^1ɉll9d&j>AK[S=0FFPh $WKStRTRPh $KRPh $K l대=0FPh $KXZlF=Ptlbh $hUW$fKY[=0FPh $HKFPh $5K^ fdV\D $t5X\PQhW %J\K zm"XdˉX\lT\l` $XtWlI $PtV $Ptf$Pt"PQhW %YJlX zm"렊dزT<\t=PuEFu:h $hUW$IXZ=0%FPFPh $I t#=0l5 $h $hUW$IY[=0FPh $|IXZ1D dD ҃L ll\5!#lte $dRP\Q4&h $ICuh: $hUW$H[X=0FPh $HFPh $H^V l\lD $Xt5dlPQhW %{HlK zm"dNjXfld\ Td\` $tR\I $tV $tf$t"PQhW %G\K zm"lXkT؃dPh $GZYkl=0.N=0'$&j $} $ts $ti[x $`} $Y $R $K $D $= $6 $/ $( $! $ $ $ s $ $F)`j E)hXh'e[^_]UWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh? $XE1e[^_]UPEPhJ $uª uhF%h&hh$\ME\UPEPh $uz uhF%h&hh$7\MEUVSjjj" y hS $\1ɺxBhPSk y hm $˿ZuufiuSl Xe[^]UpPhiu< ulh| $iXl$Eu h $j EE1UPEPh $u肫 uhF%hԥ&hAh$ZMIE@u h $j贸 1UPEPhQ%u) uhF%h&h4h$ZM E@u h $j[ 11 w-USE UUXt=EEEE1҃UjURPl_ 뺋]UE Puj US]S辯PhH $j S^0P0~ UuUE Puj蛯華j܀ UE Pujym Ã=0tMUEE EjjEPEPjEPƒEBuhY $XÃUSP^k jh&Ri jS*i uSh~ $6jPjZ@uSh $j]]UWVSd@u~Q1}=0tC&;Et7EE jEPjjjV!@uuSh $O 1ۉ]]]]]E}W]Sj]VSj|]uÃjh $.HZYu $ $1uuuujEPjf E!"1}jh $hv# EPh $軳 h $hb$j~ j\u6h$r[jjjh jWj\jVj\_1ɉ w-jEPjth u]8tih$Z+U9uU,Rh$jWjT\jVjJ\ q Ѓu,t$h$BjS9g = w-k = w-tjWj[jVj[ w-SӃ  LEEEEEP0e Xe[^_]UVS]E pt&I>v g\![^]USQjj]Sjjh w-芨th "uH0Zu h 5"j蓳 jjSPjh w-Lu‹E0]USiZPh$h-Bh-h$LSh$h-`B jI5UE E ]MUWVSE u}8@D$ 1%$1D$D$ 1 %1ۋ$T$ L$ 1 ډ9t&(  9\$ tl& P&11ҍe[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t&/ $ 9L$tl& P&11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]& $09tul& EP&11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t& $9L$tl& P&11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t&9T$l&uwy|$y|$L$ ˋL$ ˉ$4$19t&9L$t$$9T$t$ P&11 [^_]Uh=u jjh@w-u11҅tPUWVS jEP? Eu_X1E9}2uSPHZYt!SPHZY tG1EEe[^_]UVSQË0tRVh$EPItVERqZe[^]UWVSQ1:nuzouPqX1҉Uh·%Po ZYt98nuxouSPZYu}SPZYuE1V膝Ee[^_]USTPPPh$h-i<jU/UWVSÉϋu ,PQ) ZYu Wh$1}uHt*hOw"VNZY41yG"Uu1u4hC%,PF^_u)w"~u M }jP ZYt1ih$Vjh$WE uU jZP,PE t% 9|\ 뭋QRSPE up0 t0u1Bh$Wj Vh$6Et!#Etu#EtyG"Et6#%&u0P,P- ZY@tjj@o^_,t#jh$SeD uh$V/Y[0>w"tSh$ShL$hV40 ,Dž@h·%,P%XZ9 PW oXZڄtVB L<-u.1j=VY^t$S@#S4Q ,t1ɉL=t0t>}uh$4_17=x0u卅$P; Y@uNh#!XA=x0u}t2ҋ4hn%j4GXZ9j }3X=x0t=t t6ht"躮X t 蜘XP菘=x0tj}t0$n[ jg[ j( @u h$N_w-,W3hp)%h,RK2P,R NP8tV,Rh# ;u$P8uWVWh$խjN t 讗[P街Y}u, Ex](pZ jj L WS$7Y ~)t}u2hx-,PXZj P$X ~j,PZ @uhH#X,Ѓu ƀt&qttPwPVho"X+H}t0 p00SVC) Y_@uVh$lXZ e[^_]UWVSj Ph#$u1;11to&tZ&t =t0t>&F]$tf3#QPhW %1 !ǃ 끍W#]$tf3#WPRh6$0udtj]$tf3#PhK$0u t 0hUW$ h#a0XZ=t0KtSp+F=t0u=t0KtSp]$tf3#QRPhY$ 0=t0hf3#hUW$/sds`sTsPhk$/slshs\sXh$/0=t0~chSjjhOw"ju.t%j S^_tSh$V/ hż%QQY'"tκ#PhUW$-/XZ 5!#He[^_]US] 1t-tPu=ZYu|01=|0]UWVSEt48nuxou |0PX1uhǾ"(X1Y,u@B uPw_uh 5"S[^ljxj,SZYt X1e[^_]UIPh$h-1j$UWVS]!11tE1҉Pp7P-111ɉplh$u u; 0r=dS6EXZEE FEe[^_]UVSSPPVu ujVShl%ܮ ,@uLBEtv"t",E0荔Zv"tv"PShw"jb jUVS]u VS YZu Sh`w"ja ;/t"Shuw"1!XZu Ew"e[^]!e[^]U3CPhX$h-K+j7UWVS]E1ɉ#11d111lhh$u u HuLf$M,9tQG.C|g$@&UC| C|C|C|5Lp7 CpZDžlL5Lp7CtXDžh.5Lp7CxX5Lp7Xjuh&5Lp7aTu hv"j誚 P TX5Lp7%cXDždC|P-P;Ut0ttSxt SxߋM |u4^uWUEhtFlt#uuxPWY^@uRWh6z$j xPW·YZ@tECp'xPW訷YZ@tǃluECpECtuE%CxdupVҟVB@$XZK|ǃe[^_]UWVS SVdPhWu u hWdSh#% ,@uSVhx"j f@tKRPh|&hSWjSh$B$0jUSP]jEPS,U :9uySu hx"j/ ]US]ScZt@ h"SZY]US]ShZt@ hy$SsZY]USP]jEPS蘡U 9t :uy Shx"j褗 ]UVS]u VS YZu Sh`w"j襗 ;/t"Shuw"uXZu Ew"e[^]^e[^]Uh $j= Uh>h($h9$hV$h$h$Ph$h-g& jPUVSQÉj EPS U:uVSh $jϖ e[^]UWVSuEE@t"0 1VFe[^_]P_u hǾ"j視 VP ZYuj]e[^_]髆UWVSQ]E10u1w-hk$u up 2F$@&=(0t$0뷃=$0u(0c뛁K뒺aLp7C8K t ,0hK\cPDLp7jC@K@2K&gLp7@P s4K ILp7C(KK@KEPuh@&5Lp7Nƃu hv"j Et ,0tctKtK@tK t=(0$0 s=$0t(0c@tKt1҉,x-sc sKsC  sC sh"VL 0Y_EthN9%V{LC$KXZEth/$VaLC KY_Eth5$VGLC$KXZEth>$V*LC$ 0hN$XZQP^u1RPh\$ 0hl$Y[hz$XZ1e[^]USP]jEPS腍U :9uySu hx"j舃 ]US]S:OZt@ h"SZY]US]S TZt@ hy$SsZY]USP]jEPSU 9t :uy Shx"j ]UVS]u VS. YZu Sh`w"j ;/t"Shuw"XZu Ew"e[^]e[^]UWVS]fU ffCffBCffBfCffBs s=Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssjY^} GWssTY^GWs$s AY^G W$CDȉGDs,s(&Y^G(W,C@ȉG@s4s0 YYG0W4CHȉGHs$&1t<16 1Ƀ 1Ƀ 1ɅtuRh~"jx 1ɋuЋ} t1M!8"t$M tM9uM9t Suh"맋E9ƉU}7=\0tuuWVSuh9"-uuWVSuh9"?9u؋E}<=\0tuuWVSuhi"uuWVSuhi"jw e[^_]g_UVS=`0tPh$h- h$Ph$h-h-h"lXZ=`0&ttsh#h- ju=\0u UPcUWV=Lx-uHH׉=0t&ɉ HffJ=Lx-u f@ffB^_]UWVSƉ˃=`0t/=X0t 1}mQD00Puu PסD0RPSu5h0- 9t 0=nPWVh"&$j"ve[^_]ÅtUWRPY_}Ã=X0UWVSSƉˋ D0=`0tSu 0Q S׉ș։ЉEMRPSu5d0, 9t +0mPWVhH&$Jj$e[^_]Ã=X02W|$wUWVS#Å=0u0BB4p00 D0 ;H0L0ؙ=0;|*90_1)։ؙ5t0pؙQ Y&JtRz!9t !9t ҋ1҉ؙ=D0Q 3Xe[^_]g_W|$wUWVS,EU؉M܋ 0A Id t15x0)X=0tx050PPV x0xU tho&$!{Xx0H xU t@\M؋]ȋM؃=0tx050PP 0A Id t15x000JH,1X9M؋}ruuh&$ 0\E1ҍMQRPuu lj֋EUEȉŰϋEЉUMԁ}Tt.CЉ‰!!SʉEUԋCx1RPuu$ K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05t00_\Tt0@xRPuu Ã=0tKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu_%ClRPuu Ã=0t]Su,XZ1EtttpƧY_DpTtF u1E螧Y_Fu @ߋu^%CP0H05t0EЋUpXe[^_]g_UWVSQEӃ=01}=Lx-tBBfCUC)f UZ[^_]USÉЃt't7uFɃu0 ='Sh&$h- ]W|$wUWVSLEUȋ 0A Id t15x0yY=0tx050PP x0xU tho&$1҉U؉U܃xh&$_1E؉E0X`u؋}܉ tu}}zU tStX~KM< Ʌ0@8EU܋x0J9M؋E܃|R`뮅tGt%b 4!Ή8뗍 ?!8u{!8hvSh&$h-* Nt% tSt1\uWEah'$Í Í ? # Sh;'$h- 0$~?x0EE1uԋEЋUEUClM x0EH00EHesE@E=Lx-nKdu؋} t1RPWV }WTU u}WT }U P}t}}}GXE1}EEċKdu؋} t1RPWV MQuuRP EыEȉEEeƉϋMUeuuRP Eȋ}EЉEeЉƉϋRPWV }f E9C0u'=0x050PP K4EDS8)‹}W S8)‰ }W$D4Ɖu}܋x0 09A8~zU tR`˃]1ɉMM]ʋ]؍ @뛋 0A Id t15x0$XE؋U܍e[^_]g_W|$wUWVS։ˋ@1`0=Lx-t@fxfDžAx$ ‰|fDž y-=Lx-t{-0@40u 1ۉ,0@DJL!ȉ!؉ pZ4JdQyt@f fDžA  ‰P(,iKL04H8)$ 0ǁ\Tǁ 1A0QtAx1AA8A$1A@AD<A4=D0A|ǁǁ1҉XǁLǁP-ǃ\Tǃ1C0StCx50~4F8H GډSWRP ӋRPSQ^ ȉN8ؙ)ˉ^ <~Ntn0؋ËቅkF0 HËË048<k9}VRPhr)$x{ ,00@x<8@)׋@8tD11U00ӉʋKT t1҉ u1RPWVS  uDž1WVy 9؉s(WV ȋƉϹ19s11ۉB,$1~ ȋʃƉ׋˃1ɉ1׉11ۃ~hH` tσ1 1Ӌ@0)H11ҋ)׉ߋ1RPWV5 1Ɖ׋ȋʋRPWV 9sv Dž19s H11WVRP KRP ȃȻ)щWVRP F 041~ H`9))HRPSQ 1ɉ ؋Fȃ1~H`F9}Sh)$DG 0C`Cx1CC8<Hщ)9~)׉8<C,B,$1Ʌ~ @SL!Љ=Lx-(C|HL!ЉjjjhjC4Pj@£0uj'0H41󪡐0H|000H4 ډ0)ʉ0@`#PL ~ PhHx-P<(0PX$0P\401҉PTX Hfǀƀ&A0%ƃC4D8<KC,ș)׋C)ȋ1)׉C8HK` tƉ׋Й)׉!lj!׉11ҋ!~ ) 1҃1)׉@D04=Lx->C s(H10t ǃ^F=P0s0Kd t1RP߭ڍ%VV$h)$ 0 ؙy8PۅI4%WW$q,h)$ 0A0= @ p0l0=`0u\Tu kУl0jjjhj5l0j£t0up09l0uh0*$6 j& l01=X0LH0L09|RPhK*$ H0L05t0 D0H&[t?t  Lș)FOu뺸2=0t?jj50S$=D0STb D0uPؙVpjV uؙ=D0VYt00Xlj=0t PRXZ0xt0\=P0~ hc*$k XDž=P0~ 0A,XÉƉ׋ǁ\TtA!A1׋AId t1RPh#jjf-ftRhht@P DžPu ftP0=X0tu1'1=01w,10;x, hx-~ 01҉牅8[9<}Ƌ\TuAЋ!AAA)uky4D1ҁTtYӃY19Ћ|h*$ (_01=x0x0CU C )C50$~N`Cp=Lx-u*{tFx9sCxNfKxF,H9u fSCf{CTCXȉC\OK`ȃ~:=0uCh|{lN`Cd9sh*$U %P[x00P t+)lj1ɉ1xU u@\€ x0H xU u@\€ x0H ?xU u@`¡0@`0$~%x0Bl5x0F0=Lx-~!{8x09rKd1VT~U uVT~U t PFXƋP1~FKd1111f30@8P!tx x0)D4)Љx09s?zU tR`ك 2x0B$C1ҋ9r)0H`艅 0x0BY89&zU tR`A`0$~%x0Bl5x0F0=Lx-Kd1VT~U uVT~U t PFXƋP1~FKd1111f{89rN05x0$.Nh񉍸Flx1Dž1҉)D4x0;xsxU t@` x0@$벋!ʉt:@t@;Npr1tɋ$9~‹GDž붅t$9~‹0B0;0u^=0t0s4PP |0@|00Z4Jd150000H41[0Z0 } t0؋5x0=0t50t0P5x04 0X05t0ދvxx 0\t4Tu1%Fl1%CPO붡t0p0𙋝ڋÉƉ߁TtAЋ!A1׋AId t10Y\Tt=P0]s8l0){0ƉK`Cx1񉅰69s)9st0X0%Cl뀡t0l09rߋ 0A01q8𙋝ڋÉƉ߁\TtAЋ!A1׋A׋1Id t1(Z~==X0j.X܋ 0𙋝ڋËƉ߁\TtAЋ!A1׋A׋Id t1(%u5!#WVRh*$9]=P0D0P,t,=X0t h"X1j X1b~j X=X0tjtx|m_u=`0th+$v5004=Lx-0FF4+=_w h+$j> t0X󥋅`1=0tR50蘾[^t0=T0t ǃ\8 50x\D0RP SMY=0t00r4PP蔽 0X4HdLH t1500Z;0sE=0t0r4PP8 |0@|00Z4Jd150X5l05t0[0@4P50[eY[^_]aÃUWVSu]tV> _uVh"j:= `1ɉPhd@u , tGRhedAu  @u!j8tuh؅"CXZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h$; ƹ ߋSh"Vi/ CPhC"V[1 C Ph"VI1 CPh"V:1 CPh'"V+1 CC,$C,Ph:"V1 C0PhO"V1 tP X}!uhzd@u j @RhedAu L @uuh^"j; 41}󫍅PuPY^_@4ȋ929t(Ћ}1ۉ1E1ɉ [Eƀ*P9j PEPG 1e[^_]UWVS4}jhPjWYtGjPjVWV u$U ʋMQ؍e[^_]UVS]u VS, YZu Sh`w"j9 ;/t"Shuw"̾XZu Ew"e[^]鵾e[^]ÅtUWRPopY_}UWVSuuuuW É֋EU)jj`RP] Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVS]MpM1}tfF^1 :^F: 1 MKMKfCCCCC s({,C8C1ɉ 2\-hx-5h-+22uXZe[^_]W|$wUWSøth3h3$jXZ582h#3$X502h<3$H(3t PhR3$1_X82t?029} hc3$[()%MMEuQQ$h3$ j 02Z13(3EE2ۃH~-2]PP$4 %RR$S2QQ$SEWW$S h-PP$Sh3$2<322!]22Ezu%ٞzu%=02\$=82$h3$褛e[_]g_1Ujj舵XZ1=02PU=`-u =02ujhuu?82ZY9@2~@23ueUSá22xFأ222%w%r\-y1]Y]W|$wUWVS282ff2422=29=2u ;22f2f2]f21Ej]Sjj53P yh4$[jh3jjh253觿 y3t h'4$q_EjSjj53O y hD4$j h2jd` [^242f23 s$ 2ɡ2ȉ 22s223}f2Bf224fpjh3jVP5 3訾 Ã9t:y h`4$kYSVh3hg4$h-'Z1`-82% 82 @382@822222 2u22222Av.}fE fEm]mE22 %52=2 222 2U u}fU fUm]mU}ЉEΉ߃ɚ;~ʚ;Eހ}2 2222H %؉ 22 22E22=ɚ;~ 22-ʚ;2(2rW 22 22 22 222=ɚ;~ 22-ʚ;23t ;3te[^_]g_UWVS<ÉUM3tUUEčs}uyMăA}9}fE؍t E;42uJ122u5}t43u+JEPuh4$蓕 Ѝe[^_]W|$wUWVSEU܉M7C]3MQURuh4$+t h4$XWh4$3Y_t,%E %RR$Ph4$ה3t"uC-e[^_]g_韑e[^_]g_US%=D3u5!#SPhS=$h-jUWVSƉPG ¡3_tEtPh>$E 39U|} Vh?$jD tt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ 31҅w =w"=w'=w?=w W=w F=v=w=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPsS PVh?$ S4F PVh"?$\BhPSjlPVh0?$4S^PCPVh??$hx-xXe[^]Ãt"¸g?$7tM?$tURZøZ?$USљRPQhShx-S ] -yUhx-j FXZáx-Px- UWVSDuhx-e[^_]ÉÉh~?$B`&aXE1ɿ!t0\Љt }uCEtHP1DA u1tЅ}t2}uKU1ˉj.h3EPj:U1ˉuQ VPhUW$j.h3h3hn%<XZT5x3VPhn%G 0=d3UWVS @<tPh?$܏Y[C&tRh "Ph?$賏^_Ph?$裏XZCH<$`&h5!#C Ph?$wC@& Scssh?$IC! &<t&<t&COS C #CPh?$ CZYPfwk$&h @$h@$X1Zh@$h!@$h/@$hځ"輎_3h4@$誎^!h<@$蘎Y PhF$腎XZ뢍A9shC@$u EԍsfCfhw:ffEPEPEPEPEPEPhP@$"jfEPEPEPEPEPEPEPEPEPEPEPEPEPEPhs@$轍F$HF$Rh-G#XZUVS$`&E׉Íu 9stMtJ@ShwF$袃XZe[^]UVSU %tYE uLjjEPήà uU1j.0hY^ƅth3@P4YZuUuRC ZhPh3[ 3e[^]UUE Pjjhh3PRB thh{%h3h 3UVSE UMYt @ȅu˅t6t1R )˅t8u3jSZYt%u %hPh3 VShF$hh3ـmVPRhF$hh3谀DσVQPRhF$hh3苀VSQPRhF$hh3j 3e[^]UWVS$u} KE 0~y111119Bt} |t 1M LtMw tLxw tHuGC@u?6ttxtu#2 @"@Ƅ9t(Bh1u "ω9)51u- uh %h3y[^vthF$zyYEPjjhVPP>? t h{%V_yXZSVhQ%hh3~3e[^_]UVSMQ3Q3يۊ@&BZ@&XÃ@.)օ~=3uC3[^]UWVS uE Eԃ=4-tL1ɉ 4-hh3'[_u(j.h3rd_Zth@Ph3K 3uhh %h3% F<t^<t<udEԉE FEe[^_]!Uڹ1ˍ}fEu jEP [^uԍEPmZY6e[^_]VPFPhF$hh3}3e[^_]US]U MC<t,<t<u/MU ]]OMU ]]U؋]!S"PCPhF$hh3|3]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV _XUЅҋEtuu SVZY SPV }yE EUW$e[^_]?}tEEԉE E:]#e[^_]}EEԉEE E+"e[^_]|UWVSXEEE EEEEEEE"1EEEE1҉UjjuVjj]Syh&A$)EuhF$荞 Xe[^_]PtXu jj jjVWjSyhF$݋EEhF$@ XE9^CU!‹M9A}tSyM9,sxEt  Cy;8-t8-PuCyPP C E1ɋEtttHP1DA uЋU؋uЅ~uE'uPsRV~uEuPjjucE#CP>h#h#hF$ {-H-$yhx-j 见XZx-Px- }e[^_]DUUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һF$~kMUD8-u^@PZMt$Ut:u?DX,t*DX\}uCNv t4}tEEEe[^_]UjjEPEPu u-h?uuum(USŔPhF$h-|Sh&G$h-|ShGG$h-|$ShUG$h-|ShtG$h-|ShG$h-|$ShG$h-u|ShG$h-e|ShG$h-U|$j>oUVSƃ=3uWPh/I$p CiVH Xe[^_]UWVSV1}jj}Wjh& uTEEPwjjWPh& t S[!h(%S蕦 ZYtQh(%je[^_]ÍL$qUWVSQpqAlA EAEAEjjj hJ$ݑ Y1iPEZuh 5"Suj A E y hJ$j E9tSPhJ$h tt/u?EEJ$)"aEEJ$*"LE@EJ$*"7}uEPEPt _XEJ#tEE5!##S{YE܃}ƒ}E ˆwtRExurW{Z9EsEh'K$h0K$h+"h+"Suh9K$uh@K$|n$EX1EЉEԉEȉẺEM}ltp9CECECEEEUEŰEEEEUEUԀwbEU }E]EݝxM؉WQRP} PuSuhZK$mu؉sEܵx 0%PP$EM)ș WVRP0 PEU WVRP PheK$jj h5!#RPj}Ws @u hG#jj h5!#EU RPjEP@ @tjj h5!#EM)ș RPjuV @tWuSuh~K$lsEܵx 0%WW$VEPhK$l,*}MЋ] }tajj h5!#SQj]S蕍 @jj h5!#EȋU RPjuVh @VShK$l MЉ]ԋu؉uEȋU WVRP袋 PWVMЋ]SQ菋 PhK$}"Mȋ] }jj h5!#SQj]Sˌ @Tjj h5!#EЋU RPjuV螌 @'jj h5!#EȋU+EU RPj}Wk @WVShK$kM]u؉uEȋU+EU WVRP螊 PuEЋU WVRP聊 PuWVM]SQk PhK$jW}MMȋ] }m]m]jj h5!#SQj]S蓋 @jj h5!#EЋU RPjuVf @jj h5!#EȋU+EU RPj}W3 @Eu 0%QQ$WVSuh-L$uh3L$|M]u؉Eu 0%RR$EȋU+EU WVRPG PEЋU WVRP- PWVM]SQ Puh-L$uhML$Fi$uXeY[^_]aU舄PhjL$h-lj_UWVSƉUσ=$3u'jh$3 3ZYuh$`[ 3Xi $3}u)VUPwZYUub`VUP[wZYUu9Rhh 34ƒ 3uPhUW$j K k1e[^_]UVSƻ@-tPVvZYt%VhL$53qk83 OC St8tPRhL${ RhL$ {ZYuj 3h3 C33묍e[^]Uj訷X=3t%3fPftjh"Ps jh3g UWVS=x35t3ÉDžu¿L$RWhL$53yj53LUPhPh -$y'1=T3ShM$53%j,-fDHfn,f?trfauHt3ShM$53i (fptfqt#1҉x353h5M$ Y[C1T3ShOu$53i &SShMM$53pie[^_]Ã=T3tO=3tFUVS5x3t3x31ɉ t31U5x3t3u1҉T3[^]1T3Up;3j芵Z=`3uj踆X|3t\3j蝆jh@3ye UWVSxEUtk1ut=tu0-DSt1@֋]څu$EE%@ 0-t ,-fBuӃ}tgh3{q[ƋE]tC1ۊ3t8u9s&H3 CuݍHȋ])=~ E봉EE} %Uй 1]13trtl$t\uF8PuQ@@x0~-H8tWDЉ\C8tu\:u;81ɉLЋEǸ3:[tL\t$ HWыu)@,-x$uvX0-DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj20-DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX50-D^tS@0uU tZBGOu)~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuPd EE53hN$x EXZ‹Ee[^_]USEU t~Mã(%@-3tRQhW %PMd^#Ph# 83ZY/t!h3h-N$53d183 B]R]UVS]53u93twE p3u13@-8t 9XtShON$jF @u=3th3PhL$Ss PhL$CsZYu353e[^]U}u蜢83]økN$]U}uw83]øU%]fU}uR83]ørN$]AU}t-h 3hxN$53b 83U}th`3hN$53b 83U}tšh3hN$53Zb 83UWVS1}uEE PPEu jHt}6hN$E PEP] uhN$E PEPB t}E pXE Pu r"3 3t!eO$tVWjVjjhRSxySnJX 83e[^_]U帥+"}u#]U}u ݖhO$hO$hO$53jW183UWVSE]uu1҅‰uTpuCE xh+"WeZYu u0Hh#WHZYu1t/#@ u븥+"PVhO$53Ve[^_]UhO$hl3u uI83U}u83=3t3E EO$]A ]Uh&P$h3u u83UVSE] u1=33u{+"yt ash+"V9ZYtBh#V(ZYu 134V^sh5P$53U 맣33노#PhVP$53U =3t53hlP$53kU 53hW$4 3Y[t1҉ 383e[^]UhP$h3u u83UhP$h3u u83UhP$h 3u u83= 3t13UhP$hx3u uM83UVSE] t~ ܓ1=X3X3u=sh+"V莹ZYuX3h#VnZYu1X39s?L3^hsh@3 T3@3X3 A L3T3#8u-#QPRhP$53SX383e[^]áT3t8u53hP$a 1X3ZYƋ L3+"UhQ$hh3u u83Uh&Q$h<3u u83UVSE] u duosh+"V7ZYup3T3_h#VZYu1ɉ p3T3HVϻZy$shBQ$53R 1=p3p3T3t +" 1#T3PQh\Q$53MR1=p383e[^]UEur83HuhvQ$E PEPc tЋE phQ$aYZu9=83uJ=3t53hQ$蓷 XZE phQ$xaZYu331`3USUE 83u C3Pt ]馐pYteP Z@u ShQ$/@=3t"h3hQ$53 Q1ɉ 83 53hQ$ȶ XZ]]ֱ]UEt~83=HuhN$E PEP tӋE phR$``ZYu 3USSEu轏83HuhhO$E PEP访 tT3hLj E[Xjh3L XYE tE ;u1ɉ T3jju 讯à uu=T3tڋtShR$_[Zu 3E =T3u=3tx3x31ҋtT3x3tuj>XZ1ɉ T3]UEu蓎83}Ht}6hR$E PEP uhR$E PEPd t}E ph"R$^ZYu!E ph*R$^ZYu 3UWVSUU] 3E=3t5x3x31ҋE _¡T3t@T35x3ujZY1ۉT3EM9t EPޫXe[^_]UWVS}u <jj薗ÉXZSn CYujjfh# à u $j/S _ZڅtPhRW =p3t653S 3HQPY^y Pj AMY^ J }~j5(3h"WS6  jWS6 ShR$83j<~PG Z9uWj腖[^WjyZYt1 hR$X83e[^_]UWVSPEEu豈83%HhR$E PEP袸 EwɋE phR$X^_t 53hR$׮ Y[}hR$ Zu ]E XShR$XSR1 t뙃}hR$譗 Xu ]E X ShS$PXSQ1 t-U}u"E X ShS$XSQ1 |3Ce[^_]U83}t\=`3t =3u#׭=3u3E ES$鯭 h3h4S$53G183 U83}t=3u#P=3u3E EQ$I h3hJS$53XG183 UEu茆83{Huh_S$E PEP耶 tӋE phS$VYZu9=83u<=3t53hnS$谬 XZE phS$VZYu 3UEu83{Huh_S$E PEP tӋE phS$6VYZu9=83u<=3t53hS$ XZE phS$UZYu 3UWVSu huS 9}1hE4SO F 9~hh(%S5 GShUW$zUY[Hu jNZ3e[^_]UEu˄83/HuhS$E PEP迴 tu uh5!#- UEu83/HuhS$E PEPs tu uhT$ UEu383[Ht}6h#E PEP uhN$E PEP t}E pphT$NT USE3u贃8323Hu hT$TYE ph#T$SXZ3]USE3PvW8323Hu h1T$SYE ph;T$SXZ3]USE3u8323Hu hHT$ZSYE phMT$GSXZ3]UE} tu覂83=|3thUT$SX#U} t}uj83Ã=|3t jjXZj`Y=|3t jjuXZj5Ujjj5UWSREEu83=uE XhZT$蕑 Xu]ShS$@RSK1 e[_]UVSEu蕁0Hu ZYt\83*E pЂE[@u 53hcT$'}u 53hxT$Ex u53hT$葧 MhNj舎Y[j_XEx t3=|3u*53hT$U XZjU_4$jG[^Ph-#h@3 ZYÅt$h@3J)@$A3Sh@3 j E0]S E XPEHPEP XZ1=|3\3j^4$j蹍Y[e[^]UhT$hH3u uY83UhT$h43u u783UVS]u t~83lu%1D353hT$& D383ZYBD3@D383jvh3ʽ u 3jvh3誽 e[^]USEu)1ɉ @353hT$諥 @383[Xu 83~}~hT$E PEP u@383j 5(3![ZÃ=`3tC; t(3j S ZYh5(3h3ͼ C; thSh3贼 ]USEu&1=0303,3+"t ~E Xh+"SZYu 03h#SϣZYu1031ۉ,3*h%S譣ZYu03,3u##=03t+"PRhT$53">0383]U*U$=3u1Ph3u u8313UǍ@$|GWS@PͲ =333EU313333jjheO$M qVh`O$c=3EU333(V襕Ze[^_]UWVS]u t s>hW$W軙ZYt.hP%W誙ZYthW$W虙Y[t뷻v[Zt3u6hW$R 4 tT3tT35T35T3hW$R3183e[^_]UWVSPU} uRUyZUuUE W$3Ee[^_]3Ë@t P舔1ɉKXW讧CZ=3ttP3hX$53`3e[^_]USEU 83t tt<]~r-t8Cu5!#PRj hX$532jrr 183]UVSu 83}t e[^] rvxXuvhW$532,Ct P1҉SY3h"X$53o2183 e[^]US3}uq83<=3u3E E3X$] 3h`X$A3X]USEU 3Hv3q83P=3u3E EeX$]鎗 3Hu hX$nAYrhX$^AXZ3]USMU 3Avp83Y=3u3E EX$] 3BuPhX$@XZrPhX$@ 3]UWVS @Eu} t-p83AHhV$E PEP tЋ5T3} 19~j kS3Pw); t*Cu%whZ$53m083 h@h@3P 1ؿkS3X 9Xr0-DP@tC@3<$t<\CFC 0-K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP@3)PE 4V E 43߿iu6CDžؿ9}~)@3)PE 4VŬ E 4j8ƃF;rT30oXu 53hcT$u!53hxT$蕔 83^X~ t=|3u 53hT$΃=3t:53h@3O 3HQPYYy Pj 1YX J j 6R T3P5T3V =l3t3~t-3HQPy;P| J Pj1XZh@Ph@3x qT3ET3E 9XCؿt G9}ce[^_]USËt Pg1XCt PU1ɉKXCt PB1CZ]USdp;3jyX=3t>DPh&Z$jd]S*(~!3fJftPSRN jh3) USdjkyX=3t>DPh@Z$jd]S'~!3fJftPSRN jh3>) UWVSƉӋ:j:WYZuWhZZ$V蛦 :WjP|YZtj%W YZtWhcZ$VeWC uf{P Huf{tCPh_$V3 h#V%XZe[^_]UWVS ERU5ZEE0U;OwuCuRS uCEÊ u w)tu C;OvE1e[^_]UWVSË@t P 1s_stV_4Y1Ct P1CZe[^_]UWVSljӋu3u<MP]wEPMQSW航jEw>yFE8 u@EuhnZ$) XZ,HEHwuE1e[^_]Å8UWVSH%Pt=0-ufTwfUtePt^ftwftO0Euf]fۃW})߉0ufWӉ)Ӄ@YA]AXZ[^_]UWVSUu u hZ$j ljjhZ$P豩 uW1ɉK fCPjhZ$W芩 uWC fCjhZ$Wd u WC _t36vCvCF C FfC (WuhZ$K Ef: j/RU* ^ZEUu R腜8)ЉUHQM ƋMQURP { uEuLCYj@V ZYt_{ u1҉3Mq@Pj:Ep  t@PMAYE@E@tu[uvVj]RUY YZEtH:UttWuVhZ$)PERVMV蟕u WuVhZ$tEx:u-u%p/Uj:VYZUt>t3 3ׄtK3Gpj EPV/ >tU:u PvWuVh[$/fC*C tt5P3u5T3t5!#V軚CZ{uC%{ tC%P蛚CX1e[^_]USZKJy ;J| t Y RPc)XZ]UWVSP1ۉDžfDž1jhZ$PJ jPQ^$CZY@tt8tt8uVh7[$5uDž8tj;P [_ÅthH[$P艊ZYtChP[$SxY_t>hX[$Sg_Zuh`[$[gVSh[$Dž DžsDžVÉj@P t1҉3@PΘYj:M^_@P覘[H8?u1;u11ۃ/j/S ZY9u$uHsjhC%S蛡 cu)uRh31ۅ%pu'jh3u911ۃ=h3Džt*1;t%h[$SCZY11u @11ɉ>t+h[$V_Z1ɉ=3=|3t jj_XZ=3:hPWT 1 t1ɉd31҉d3QPZd3|3YZu u*"#Hu9d uWh[$ u Pj衾PjrY_t ;1$j/SP_Zu Jx;hh%R 1ɉ 3Pj=3u/; =83h-h[$ۆ XZt>ut>uGt>t݃t3hSSX hhC%S hVS $hhxO$S! 1 tL5x31ɉ x3=@3t hhuO$ hhyY$SÝ Wj$5x3FD3uj/V [ZtP1ɉ=@3t WjWjXZ83-1ۃcÍc؍e[^_]UWVSl<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh3 ZYu PQ^$Y[@SG^5<$!Zffu0t#;th]$SZYt h]$3t$?t?u+u =D3uhB]$W苑Y,,D3t <,j/P _Zt@,PEZ P2YD3 t 8uthh]$c1=3=333DžtDžx=@3t0 tRP?ZYu33D3]$,h*"P+^_44u ,4Pt$PY[u/tx3353=3 t14P_1҉$WVPFy,Ph]$=3u=T3<T3 -,Ph]$53U 33 3 u53j [^RPh]$QhSh3赘 33p8-/@dj VP 9pd8/Pdx*u,j pPRv pd83 3Gh3`$\`$d+tXH ׉dR%s^_Džh8HRYtxk`$dtd襁2u`$dt]kN$dth`$Xr`$d`ujh`$^_p@9`$d't`$dƅu a$dutPmYV̀Zt<oZu&J3 3ha$_t 8uh7a$ڡ3P3~ hba$^}31uQu2P7ZYu8Ct 1}e[^_]UWVS 1\;3X;3hfjChݻjCDž7311183113u<PBl;3HQPYPcX Dl;3Hy P;_ J= =~-v*{l;3Hy PY JPh#l;3Hy PZ JPhhh $5h;35h;3X 5X;3\;3jAX}t9l;3@ t.jBjB8311T3jSX=3t21u4&hc$535383jAjA`J: X )=35 Ht%0-Dxk83 DУ8383w=3uL3=\3t6tuv3=\3tstQuaIu&831=O53hK#53N 3u^83w7t~*u%0-Dxu=ti1ۃ~UuO t+)t&:3sX@CW=51$du(t9dt5d u-ut183u )b5E9@3 5u$ 3u3 d53Xx u@uhPh;3)o =83ut;3t R_t$839tu1t1ۉT3j=j=j==83t ujOY\;3f!ȅ!Ѓ„tt jZX;3ݻ!ȅ!Ѓ„tt jXF(#e[^_]UVSu=h;3uh d$ 83[11ۉ\;3hfj<ÍE PV5h;3S5h;3h#U 5h;3T3 hUT$V^ZPƋ\;3Y!ȅ„t tjYSjF<XZe[^]UWVSDžX036363jj63P葒d;3 yh9d$e T3tjXRjhP7 63<t <=3=353=p3u 3h4d$WÉ53_~It,=|3t#83-wQ53had$&T Y[=h;3h#531 =|383-v+3hd$Z=|3=3=353=p3u 3h4d$xÉ53_~It,=|3t#83-wM53had$GS [^9h;3h#53R =|383-vtP3h/d$Y=|3u9 =,3t 5d;3P53hd$y4d$ /d$uh/d$S_Z83$ w=t53hNe$,63<t <flpRPdPRRRP`P\Phe$h73荓 , \`dtk=6383$ lpRPRRRPhe$h73 #631f63 Ћ Ћ ȣ63lp ff63963YlpRPdPPPPPPPPPPPPPPPPS`P\Phue$h73ؑ \t-53hd$

=63%h63j5d;3[_Zy h^f$O_^63=3<<63<63P63P63P63P63P63Phf$Ã=|3^=3Q1҉36363=3t f63d;3tPy _jj63Pd;3 y"h9d$U^^ 3=3u#jXRjhPz @uhe$$63Ph635d;3Տ y%hf$]Y5d;3 d;3xT3tjXPjh5d;3 Džh631󫍅hPR5d;3% @h0f$x=3,3=3 3t$=3=3\t63<u1ɉj j WhStPtPn 53=p3u 3WS\h~f$aÉ53~5t=|3t37h;3h#53M =|3u Iu<t=|363P63Pj63P63P63P63P63P63P63P63P63P63P63P63P63P63P63P63Pjjhf$HÃX1st 3<uBDžXjXPjj5d;3芖 5d;3 d;3X1=&53hd$e[^_]UWVSD}d;3=03tWPHjjPX ƃ HPj5d;39 @-d;3EfEjEPvrM]ġ3ZZ<ډEUjEPJrM+M̋EZ[+Ey@Biy1QjEPV B8t88#th)g$63EEPEP5d;3 à ty5d;3 d;3VjSG @t?}uEjEPjjS W5d;3JY[Quhf$ X5d;3W d;3Z1(8\v8#Nh g$&Y뽍e[^_]UWVSu1ɉ \;3h2j.E[_t=`3u "3+3=`3W+3 "35`3|3|33thPBUP;_ UBC3 63󥿴63 󥍺6363l;3<<l;3h;3@@h;33DD33HH3T3LLT3P3PPP3L3TTL3H3XXH3D3\\D3jh3`UP^ j`Ph3] jh3U썂qP] $jqPh3] @3U쉂@3hh3P] hPh3] $hh3UˆRc] hÈSh3M] ujw,\;3 t1\;3EEe[^_]e[^_]UWVSQ}j/W [^t#9u jhC%jWCXZ/jhH%.Y^y WhJg$VnhWh 3\ !3ƀ 3. d1.F9t@BUUjh 3XZx9U0t8u-Ou53h\g$zD XZ10jh 3YXy 3F<.u1F@F0볍e[^_]UWVSuh;3u/hg$ X=;3t 831Ee[^_]<fDžƅfPftjjWP腁t hg$TXhhg$5h;35h;3 l;3Ã(t hg$TX=;3t 83j3<Xt(t#fVfthWP+ j]Yu=83(ujDZj1ɉ 3Dždah*"u _Z\\uu h##N[^aDžd@\fzt \@xRPZYxE%=tu heh$53 EЋUԣ33Jjh`63 ^_B53=3 hN$uZYthN$uZY3twC\fxu \jWVP, \@jWVPyu h]$L_X+5353hh$  DžTeO$}tEuuhT%l H3T^``u"uhUW$*ZY뽡T3h|h$h&h+hh$)9T53s&P53tP6XT3T53PH_P53j"^l@ujj !ZYl=3t= 3t =3y 31ۡ3`fxt `P\fyt \@S535T53 P53- uu h14#BK_Xj8 33\P+XY@X t0`Xz33\J뭅t[pt9533|@3#,53[^pt3pt륋`@ @tu@o` 33<\H Xpt 3933|3 {\@ @tʸ#au h14#IXZ`@ @tjhh$IXhjXdtd\R^1\`P1ɉ` $b[nhPjXZDžh=T3ted;3xP Xd;3`t`P^1`j[831;33}j;Y 83h@u l@u"hPjoXZ㋅lPj ]^_d;3xPh [d;3du `u)\tꋅd\RY؋`PXP 31҉3333e[^_]UWVS1043PT3t$1=3=3L33 3(<3$h`O$uZYDDu =`3uVu=3t}t}u&E 8-u}tuh1h$53 뺋E PhZh$53 ɋDtE uPu 1ۉ8Dž<Dž@1=43uDHjh`63 ZYt=T3tzjXhjNY[hj@^_<}tWE jPS[^E j/P΁ ZYf8tN\8 tDE PhJg$ F[^83M E h#PI_ZE 8|uuU C%t,H%%E 9u jhC%E jP^_/ jPY[n=L3t 8 uW@8 u"E hP _ZyE Phh$6=L3t 뽃=L3tE PYE D3uJutYjjjXZ39u&ju0^_3383ujPiY[=ujh`63 ,_ZDu}u-k33 tRPhh$0 ͋E8t8PuhT% Hh*"?^44uuhUW$Y[ȃ}E h#PC_ZuDž0x-15 35<3E 8|uXjj _Z@E hr"@P Y[00u E @PhR$A15 35<3Dž8a=E uPY[00uE Ph#8CXZ#Dž8@0fzt 0@xRP ^_@tE%=t1ۉ 3<3T3h6b$h&h3hh$9L53s&H53tP,YT3L53PX?ZH53jX=3t= 3t =3y3,1,3Dt@33 t/0f{t 0IjRPQ53L53 H530fxt 0P4ft 4@,VSu u08 u33hh$jA^ڃD43 3#0jjjPC 11y=E Ph]$AY[Z0Jy/0PZt΃ t*;533|0H уԋ0jjjP x N33,334J4Pt_ td0@ @ul0 u4J4P(^t, VL@L Hu ,PT9ȉ*3#153`XPT3ډPT33띋4H 0334H PT 39533|3 {4@ @t=ʸ#a8 u33 hh$>Y݋0@ @tE PhW4#u>XZjX8t80R^104P1ɉ4 $I[Lu33y3`LPhh$53 53hi$, XZ뾋D$ u=<3uj6 _苅8=@ju)[^X\Bu@j`SqU^_X\lp1tE SPG ZY@XP԰$J+‹E $Ph>i$53`jh`63~ ZYt$831;33}4jX Y*hj^_=T34PP[벋<@u @@u" jQ[~"l;3tP̳Yh;3tFP輳Z=jSjhNs jShh6s 3(83 Xe[^_]U53hi$u& XZUE }ut83h Z$WZYEt ue[^_]Z2øb#=`3t{l$Phl$53K -t$=`3t~ tPR2PS$2 SO%YE ]e[^_]ئ QMZƒMuQWhl$53ѽKSu QWhl$ދ}u#Uj PMQP; MMEPjUR rPj hX$53y릍e[^_]UVS 3 U3D3$t!uItJuBD3(31D3P 3-8!- u @ uD3tJt D31&D3(3 tGtBB@"u\uXu@!@B؀"@tՈButBU3 3:U3 3D3tHt D31D31(3[^]US 3@3U3 U31ɉ D3T31ۉX1T3{P5T3/XZtT3@ڋ]UVS 3=3t,SP! $^Z8tPh$53膻 53Vjh@h@3h -*y}uB53hl$t.=3t 3Hy Pj OY[ J Ãh(%VQ+à <ЙRPhCp$)PPÃuh")PPȦà 3fPftSVP eY[^_]aUSjX]á3@ `t1US3HyP`Yu1ZJ,ƒ uɍPv"u|33HyPZuJ"\u%3HyPZuJCC3uhip$< Y333HyP薞Zu ZJ, „t@Pv8\u"3HyPWYu JCC3uq-=3th3P>ZYuC ߸ ]UWVSQƉUh3P[_tHj.VZ[_1ۅt6uPZYÅu#)Wh3V) u1ۀ31ۉ؍e[^_]À=?3tUWVSh*"h?3蔩3^_u"Y8th?3hp$ Y[1$hSAM_ZyƅEj.S葊[^pu Džp5!#1btH uuzG uҋp3uSpEƅt1;4 3*%u_3uGE uh3"} h3PBZYtE thn$P#[_tB3fPfttRP諜ZYx|?thp$5 hp$w$xAE85h3|}X 3fPfttRP2[_x"|?thp$輜 hp$貜 E8h3}z=`3t53PܚYt u 3Hy t u53hq$JɋT3u53hV$XkS3S3éS33HyP_Zu@J0-DB@uGG9u uT3u3S3C3=3HyPYuJkPkS3BS3kS3S33HyP趙ZuJ< u6T3kS39S3u@T3 {u@T3KZCh3hmq$֚ _X3@tR轗[53hq$ XZ53蚗Y 53h=q$ۍe[^_]1US]0-uhq$S ZYu3DB@tCjhX$S$ u 3Uhq$S ZYu 38h%S ZYu 3hq$Sq ZYu 3]USZKJy ;J| t Y RPXZ]UWVS3=p3u 3hV$萳^tIhq$h;3= ZYƺ9¸} ;3.uh;3Vhq$53ijhq$h;3# 5`3tjh$h;3# uSt 3 313j hkN$h3 t\h3h-N$53 Bt 1313t*j hq$h;3Q u53hq$y ^_333333t;3h`X$Y1u<3u 1҉3@u31t;33e[^_]Uh;3tP褔X1h;3|333=3u13d;3133\3tPY1҉\3=`3u1T3Up;3j"X=3t%3fPftjh"P jh3 UVS]r0jX=|3tfh;3t-fPftjP 5h;3袓1h;3 d;3x jP 5d;3 d;3 1|3j虾X=|3t>h;3t-fPftjP 5h;3+1h;3 1ɉ |31\3jCPZt ShEr$j 耹0e[^]UWVS]h3=T3t =|3u$u 1ۉD3@3Pu7=D3uED3D3PD3@1ɉ D3=@3h53V= /thhC%V hh_r$V VyVhmr$IXZ1pP6 =3Xأ353 313 3} t1=`3P̼Xr"EEt!jjRPPh7R$Z"ҡ83-cvt;3} t1=`3PbX=353 3h*"V轞@3V =@3uuhr$ߓ ^r$5@3hh@3V u5@3褐1ۉ@3j h@3ZYu@3e[^_]UVSQQMq3=p3u 3=3ut953hr$^ Phr$EYZuBj h;3^Zuj UR@Pn M te50-DN@tVu=83u=3u1ɉ 3t=p3u53h;3 3 XZz3eY[^]UWVSQ4MY=3}=83}=p3u 3=3u}53hr$I fPh s$0^_j h;3~ZYtj.h;3}^_th;3{Y;3uKjhs$V裦 u7Vhs$53f;320h;3hTs$53Л;3 1}VZtVhgs$53蟛 EPhs$V6 tEEP跉_uu p3u\]3gu=83u=3u1ɉ 3t+=p3u"53h;3 3 XZE3E83eY[^_]Uuhs$j2h3r?u hs$j\ 3UWVSP}u jjhb#jWhs$V5 ƒu&Whs$V5 ƒ uWht$V5 ƒ USjSEe[^_]Uhh3%f ZYu3UWVS`35383=p3u 3hMv#贩_uSj h;3{ZYtA8thUWS$]؍U1EEEEPSh%u| ƒ1uuUz Xe[_]UWVSu] }VuS萇 u1N tut$tt$fN lSbZHˀ; uLUJ9uD $-y h -Y -H - t@u҅tu$ff t1҉e[^_]UVSQuh@3[á3?vPhu$E juh;u$PTCƃ@3 1҉UUR@)RA3Ph -yhAu$uhKu$53 jrT319T3 U e[^]UWVSD]} S\j j VhRuWLK t&hh"R2 j h"V% H3tzW9Vt vuvvS)8 @uT8jjjhSvvJ thh"S A8Sh\u$Y[4jjS腲 ƃ u(PPh$hou$PjSG @uPPhu$fDž=3~"jPc3XZuWS% @w8$}uc8A^PPh^$ >jP+‹Y_+y@Biy1fDžRjP藰 uY˦8u=3~{谦8#tLVjS ƒ 1BPPh "nun< tQDžPPhhSq? @u e[^_]UVS]u Sz$(jPV t@uSh\z$tShw$ljjjVo=T3u[=L3uThh P ǃ uj jɖ XZuPhi"D[_g=L3t1ɍP3Sjj1ɉV_ t hjz$YtWB Zt hz$XT3u,u#u Pk_Shz$[^jjW ƃ u Whz$xPVfZYtWhz$@V觕 9u9t2RPhz$=Vh P輻S讻VH DV= jPP ZY@uShi"=T35-ShW %hRl=v -)A5-=T3u:hh Rȓ ƃ uRh/{$ h -3c Ix[ _=T3uVK Y@u hz$ZS薺Xe[^_]US?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋC1ɃL Muj RPI[ F 5454h|$j ؍e[^]UWVS ÉUE9C8uqBhzu0t'Phh3M t Džh3)ȋDPS4F hY[< u5454hJ$Ph1hn))=w(SXZDžh3Phh3S 5454h$1_1ss C1C1҃u\#u~nu 44@ f,4,454]K_1+4=4u8#uxnu 4M 1M I t44t]Ut @uKf 4-t41ɉ 4=,4;G ,44t1BJM pЍe[^_]U4@ t=4t/= 4t@HyPKYuԋJ54P`m XZ1UWVS|u=4uQ(48u==4t h}$j 4 -4w$4x-4("44tQHyP-KZt@ J54Pl 54h4h4Ǽ ÃYB4= -u 1~1PAI[= 4tdh 4ݠh 454M| t $&<49P4r<4kP5@4@4XZ=P4k 5@414154{u54sJ Y[ =L4uuu =4z 4t54CPj V7 u4H @))Ӊ4SPV  Ij5454h4;jjh"h4j5454h4Fj5454h4\ jjh"h4Aj5454h4) 54s2 4<4@=4x-uX=d-u[h{"I Zt8tPn d-X9TPhht@jnG uVftd-d-<=d-u d-t 11<tR<@PPHt%tv$@P 1DžHP u?F;5d-r54h'% ^_54j$qC 54j dC 1.WYtKWǍZ;d-r54h'%蠯 ^X154Hj@L,tfWEYtZPh&?+_ZNjd-4t;d-r54h'% XZ1@HЉ0,Ph?$54H,B 90uH@)< F;5d-r54h'%q Y^54j$A 54j A 4@ @a¸:taPP54ho"j۸ 4 4u45454j54*=4t54j ^A XZjh4g^_1ɉ 4jjh"h4rjh4,@=45454j54*=454j @ XZ=4r4=4BHPj W2 ƅt*44)44H85454jW)=4t54j +@ Y_84444 4u45454j54)=4t54j ? XZjE9<49P4r<4kP5@49@4^_=P4k 5@4CFPbOYFG=P4%=4CH@u. D4t$P9Qs@4R54PhE$jV 54j1ɉ@9^Z"1ɉ p441҉HLC0tZ44uH 9Hu;Ptj0Whl4CP Q44pP @9u9t)HL1LH9L}jjQhl444PHσ)HLL'Hj@$YZ"L HjHWhl49Q tUAQ )HLLHj@YZ 44QNu9AuAQ 똋 4j)ȋ544PQhl4~CP 44P @@DjH+@P@Phl48 t4󥸄44l44l4t|4l4Cxt45454j54%=4t54j W< XZsF uq=4u~uhh Pe F @t"5454Cp;d ;4t Cp jh"Cpd Ht1 H4=H41H4[=4h{uhh s=e C @t5454sc ;4tshUW$j蹲 jh"swc Hփ=4ujjh5!#h4o\4󥸄44444\=44Hw{54=-t 1X4449IFTu@1*jjTPkH<9Hs B@9u[0QPV 0uՋ@9s3<jp$(PhT4.<jjVhT4 )H*t4󥸄44T44T4td4T454h$"54? $4 4u45454j54H"=4t54j 8 [^?Cv1s L4ue[^_]U`3txt1҉P x{u@jjh5!#h4US];] ttCje1UVSQƉW1҉jEPVǞ S >tE8twWgW1:"u#C@؍e[^]USPezYt@Uv‹EBu Sh$jx ]UWVS Ek<@-Ex19~BURE@u9 2u19)VD PRkE{42@b4&t4Ƀ5|4-aX؋]#]US]E U$H&1Ƀ=k4if4 ~h4 we44k}i4_h$h}i4 7YZi4t=i4t h &Z(j4 $5k4[`X؋]Q]Uh襷t41U14jO1U14jOc1Uhh$h`|4表 E Uhh$h`|4z E Uhh $h`|4S E Uhh$h`|4, E UE.tgzEEPjjp׺ UE.tgzEEPjjo贺 UE.tgzEEPjjf葺 UE 0^Ph$jjcpUE.tgzEEPjjhg UE jUE jUE jԨUE j躨臮UoU ]U輬U ]U衫U ]UaU ]Uj7`U Uj!`U Uj `U U踾U ]U |4,P1RP(U |4,P@1RP(U |4,jh(U |4,jh@u(Ujjְ1Ujjư1Ujj趰1Ujj覰14,Uh$4_ Uh-$ _ 1Uh;$_ U@1]U4o4jo1U跱1]Uj.1UY21]U01]U,1]UVSu] hE#C Zwt @t2E0f~ufFsHPh\!%h"e[^]Ee[^]#UEU ttu(8o4u4 }4]]UEU ttu(v4 @`4  }4]X]UVSE 0ڸuhX$[ hX$[ XZjShX$( jShX$ 1e[^]U{4={4uhX$[ hX$[ XZ%jh{4hX$ jh{4hX$ 1Uj4&=j4uhX$4[ hX$*[ XZ%jhj4hX$e jhj4hX$T 1Uzs4=zs4uhX$Z hX$Z XZ%jhzs4hX$ jhzs4hX$ 1Uh$hy40ZYuz4dOhhz4h5!#h$1Uh$h}i4/ZYui4dhhi4h5!#h:$1Uh$h]r4~/ZYu{r4dhh{r4h5!#h#1U5 |4Zujj5 |4 US] |4)thkj`XZ0ƀxj3Pjj35 |4S1 ]UE ]UE ]UE 1҉]UE ]UWVS É։M}}} }PfуP19~Pfz fSC9uh$QuR~ s1h(%QuRb CuDSu0Kx9tF( Fat~UCuBEs}8})CuS փ9~Of{ufKf9|A)fKsfuu)K9M|9~fs)y1fssf9u|MS9~09},CPuAERuFYXMCu9}ys(unXZ1C9uf{thP$uQs%CujjsS~ uC}S)Ps褩s蟃e[^_]UE ]UE 1҉P]UE @]UE @]UE ]UE 1҉]UE ]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE @]"U14j'B1U14jB1Ud4 11]U@c4 1]Uu41]U@b41]Uh腩t41U@b41]UhTt41U@c4 ~1]Uu4c1]Ud4 H1]Uu4-1]Ud4 1]U@c4 1]Uu4q1]U}41]Uv4 1]U@`4 1]U8o4ep1]UE uU]US] |4)thkjOXZ*ƀxj3Pjj35 |4]UWVS ]u t/{u)P>vPK t6vWYC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>PVxC ZtsP>Is 1C sXs 1CZY]UWVSP@-1AƉE1U9}HQG t5fu.O)ljPD PRktadt\<-u(=tK=tB-wH=Rt/=Su8t4+=4E9s$ X>t 4|h-j XZCSCf.S K)y1fK)y1fCYCfEECЍP9UK fM)y1s9~fSUʋMM9EL8fKsnXxufufCVt%z `~x~Ha (aS9USB CfC> =S=VYv10-DB'h-jf V{s smC Zt sP>_XshNYtMF t!u S_Zt Cx~fF ft\uMsQmC ^tsP9>s 1ɉK sMs1C4XZu W_XF u|slC Yt sP=XZsMXCt2Po1s_$uCD0tPoC1҉T0YEC9E|ӋC4tu S_Xs-1ɉKC ^t9P1C Z+u uMu5-77le[^_]UU4U fP]UU1x94~4]UWVSP.5449=  MRPkY_Mu1146444uj 4X1]US]w>`-t-t)94r!DP%> Zt;4s `--؋]U54cb144ZU54XU54XUS]uTu PnSPjQ]US]u+u PenSPj(]UE Puj UGuPhUW$ UuPhUW$ US ]uuPmSuuu jPQ$]Uh5!#uuu uUWVS}5454pXZun},u4u(PnmWPjj ǃE}t'E8tE$9}uB Y|EE$|9}AE6}Et)~%E8tP ZU$D9EeE} u)@E }y$uw[Ej PZYtE@M}})ȻEE9~)Ήuu uWQM54-ÃMu$u uWQhɇ$54;M11MDS@/XMtV5-70ZYMM54uPSL54PSjjS_$SdE @PE@PWMQ54,P,S P54SPP54xu#u(P]kU,Ru$u uuP$t6S^XtSV/Vb Sh?WPMSGe[^_]Uh5!#u$u uuuuu u/$US]uuPjSuuu jP+$]Uh5!#uuu uUS]u1uPkjSuuu jP$]Uh5!#uuu uUS]uu PjSPj]Uh5!#uXZUS54u54؋]Ujk US]Sv h"苆 P% sl =$`4t7S螈Ph%5$`4! 5$`45$`41$`4=n4t8S^Ph%5n4 5n45n4x1ɉ n4=4uh-h%d XZ]UWVS h*"P _Zuoh~RjP觌Ph#h-O SA_ j2 h-#S _Z؉Ph#Y[&tCVhSL uWJ$WE t ;u뵋Ct{ tዅh-#R` ZY€:=uZh-#SC ZYh%Sz ZYWS{ ;VXe[^_]UEPE 4UWVS 1ɉJ PL` ^v Zp j h%V< uՃ{ uC W hC%W. VW. WujƋ;7P yC9C u=CPWY_ZuS YaCPsY_ZtۉC{ CP֞GC V躞Y^e[^_]Ã=n4u U塄t4t uPy XZj Uh"΂ YtPc Zt hC%T YhjhQ~YZ hZjXUWVS 1ɉM܍}14o4j1j蜇[_ ]߉jjPN =4o4u:SZxEPj b_X}cjhy[^1=4o4#X^j |4PgZY~>jh6j |4PgyjhY^=l4;SZujh_XS^u |41ɉ$HuWC^ |4PhUW$jXj_ |4)t]SVZ4}EEjP-V^XEE119EtMԋ 1҅t9t; tB F@܋Ekl9tH41҅t9t; tB Fl19t!4EP_ZYu S ZYG19tPZtG}WfX1;Us=klE@0 t.Hdt'yt!U؋ Ph q1p8p4kUB19t4UW:ZYmUBStY_S}Z^u`S[Ohj]jYju8j]SZYu'S֌SiS jj^֍EPݛXe[^_]UWVShPVu hh%VFv hVWdu $hh)%W!v VNu1EW=Zt/SSSSSSSSSSSh"h4jj*Y[ WVSXZ뷍e[^_]UVShPVt hh%Vu hVSt $hh)%Squ St VSXZe[^]UWVS}11u܉54o4jj._ZyjVP7J e] |4$*u u^)uYjhb Y[,u>tPZt |4$PX |4$S|^_EScSDZYS<^_%*%S^5-7Yjj5-75-7NS5-7XEPj }tChj_jZju,jSZYu%*%̉SXe[^_]UWVS}11Eܣ4o4cjj]ZYxjSPhH xpu |4*u$tPV_XEV\[u4EPj ZY}t!hj`jju VXe[^_]UWVS1HH;E E8u EH1LEL0t < tLEL8P$Y$}1ۉ889E SZ9$PuS$ O]1<%rA <%t)0-< u"DB@CC8uj PPS P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< u0-DP@tC8u$C<E X1lSR pY@ltJG9r7tuvQ_FE 1ɉ^dWQBE XZtNp1F1}uSS Xu5$`4t,Rh@&h%P }tS ZSe[^_]/ UWVS0u 1EEEPVEP ] 1EԉE܅unVh%E܍t0SE)Phȉ"V h%S ƒE9E؀8'uE؋E؀x*h(%u ^_]EԊp<'uMCj'S^_E؃}u ScY؉E؋Eԍ4VuAE_ZOSh%jT j 벍Jg<%u<@T)IB*E6j/V5 ZYDžuVF EXuVF E̍GE/X}u_HEur\ M܋}ԍYtqUĀx .tx uuW uˋU;2tEԋEԍRUu@EZYUWVE)Ph%E܍DP y;2tVCXu.: XoE܋M1ۉO]Shht@j f}ufEf}ufEPEt|e s+-7EjP5-7k5-7E6Et55-7@j5-7+5-7蠾^F-7EڋEEEfmEPuuًU܍Edh -yL tE@ Eu ڋEE]^S|ESXZ;-7hPjjtS9-7ut h"X$upE_E@;-7uX]UVSh4$4$h4h 4Z =4tR)~4.u4Ph4NBZYt+hhH%h 4o[ hh4h 4[[  4e[^]UWVS1ɺ!idu$xtx豙 jPh49Z 1ɺ%idu$xtxw jPh`4Y jjjà < 1jh4VY Vh8i(SS ugL8PhPh`4Y $8PXt*hVh`4-Z hSh`4Z ·%Íe[^_]ÍL$qUWVSQ-P4T[hd%(Pj y,$`4t Ph% A ^_h-h%@ j h{3Ƌ([1ۋ(?RXCYX9h$WgW ZYPWVt| h$WOW |0-LDžX -XtMQD$HDQV uHLDAEXhViPW C (uV:W:XZ0iƄV:W:^_ujrjoY[ PDž$Hjj$V(Wh%K: @u"Dž$ jjVWh%+: @u/ ;Psh%jP|YZt,뱸 ;x|s:h %jPP_Zu(hre^t4DžT jS5XZYt5t4zXDžT 9tf@ @ &+hujjjjjjjjjSXjuRL411PDžhjt`hPLϿh uLX 9_X 4hiPh4U jhF%h4pt(jhB%h4X B%F%1DžPh" %j@$W jjPpPW8 $@t puh4X&h4hW %h-jct8DžpjpPjj$V7 @tVh4 %e^[^1=4s(u=4lu 40-DJuPhC% ZYt;rPhC%n ^X1hH$PY[hH$P_ZÅu 1DžPkjv<$1󫍽p!󪍍pi\^@u 1ۉ$Nhh9 %tVZYthh`4h`4jf=`4thh`4h`4hhZ"h% % Ãt{PhR %jh\hz %S]\h~ %SR\h{ %SG\$h %S9\h`4h %S)\=`4th`4h %S \ h %S[^_h %S[h %S[Sh %j[h4h %h(h4h %h$S S.h %h`4ZYh> %h`4^_hG %h`4Y[h8$h`4_Zh"h`4y[^h(%h`4`ZY=`4h`4h4hN %jtnh4hi %$Pj8~ $X$4_hh`4h`4j~-hJ%h`4`41ɉ @4hh %S[^h"_Zh4h %h %hDÃ3P @4h %\Pj_ ~h\h`4oP \3j h`4e thX %\Pj ~h\h`|4P \Y3j h`|4 t=`|4t @4h %\Vj ~h\h4O \2_=4u8hb %Vjh ~h\h4xO \2Yj h4m_Zt=4t @4hh4uY^u =4u @4111hP$VN hh4h4jxhh4h4jw,PVg^Zt%@4Pu*jh4h4jytjh4h4jzetih4 Y=`4u=w jh %"P?w jh %-wjh %h`4N jh`4h`4j{hh`4h`4j}@4u:1llPj豷XZluhh`|4h`|4j|VDžH`4=`4u DžH8$DžD`4=`4u DžD8$4=4u8$4=4u8$`4=`4uJ%`|4=`|4u8$HDVQRh4Ph4h4h"hV,=`4u DžH8$`4=`4u8$4=4u8$`4=`4uJ%`|4=`|4u8$HVQRh4Ph4h4h"h(jjjr T%x PX@4RhUW$h hZ^L,X?/h %jktj 4Y=`|4hr"h" %j XZu>=$`4th5$`4P3 hh-P3 j h3 %jTpWD W WPhP %hm %VT =4th4h %VlT =`|4th`|4h %VPT h %jATjV=4sh4h4h4h %j5h %h`4 hh`4h`4jjFj jh$<uch %$S h`4Sdh(%dP Y_t 8tVE XZjj`RPPuf=`4t h`4h4h4h %jPh4h4h%j5=4toh4L$h4v [^T=4th4($h4R ZY~=4th4$h4) _XPu΀=`4t&h+%hh`4hF%hhhd%hr 4j 4TXTeY[^_]aUU5!#wH&]UWVS] }Vh$.ZYuu ƅ?jh~%yp:jj\f@jh%M7ZY9t x/t/@?/uGjh%MXY1iR 4$SRPh%hu e[^_]UWVSƉˍPh$$ZY5!#uu%VQPSSu4t@d4PVSWh%he[^_]Uw4E]ZUS]S+VZй`o4؋]9USPEEPj褰EZYt=u45@b4=@b4/uAb4SPhp)%hhm4 1]US]=4ujXE]EPj (EZYttu4K|t4@b4=@b4/uAb4dSPhp)%hht4o @b4=@b4/uAb43SPhp)%hhk4> 1]U _ZExN1jSEp6 SuVSuVt~tg`PRQ^[^tEPPRZYtU6 8t,8u"E@t$RP]^_uhl%EPY[tEXt p$l(h,`d04t:$VSa]_Zt'EPV4Ph%hS \EpFjh%ZY@MFh%h!%S^&Vh0%WR&Wh<%Sȏ$W葸Ph}DSSq] ?PhM%c t0?u'hZ%裎[_thm%P蒎ZYuXRhp%P$ tjj h5!#,4,0RPj$WV S0- tHLDJ@tSPWVhw%hFP W 41󫍝DžƅDž4DžDžShQVjZ 4Džf=t#fyf4f=NE1f=FX!щ11Ҋ44t'w8X$'wX$$(uJ1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VY^ ?j!jAj.jj h5!#,4,0RPj#R (PW#RVh%hS Ijj h5!#,4,0RPj$WU WVh1$hS蹮 0E@8@}~P# $uJ< uuƄ$jj h5!#,4,0RPjW SWVh%hFP 4be[^_]UVSPjjuVjjh&l@tbu2 XtSjjVSjh&E@u SY2h(%SJZYt PuU ^Zu So[ h(%j1e[^]U EEE EEhEPOZYtEU 1ɉMEUhEP%ZYtE1UWVS`NjEA w1h%w ^ZuhC%w ZYth &3[^G,Suh &3ڼZYt\tBJ@u xt@wt4 |4$t)tVP҉[Xt |4$1ҍ1ɉ9 |4PS$YZtXP,40Sƒt/t#VRЉXZu\RY8pu`$uVP҉XZtً$9jjjjhSQRPx jjjjhSQRPx h~.%P芥 h |4PP. hق"V_ h |4PV- W(R蹸[XT`a9lhGPP- h_SV- Ah~.%Sͤ hwS_- hق"S认 hwS@- (uYh%V胤 hV- hwS., Ph·%Sa à ƅG1ɋÅthyG"S蒹ZYu!Ph·%jIa à uh#S`ZYthu#SOZYthH$S>ZYthT%S-ZYthh"SZYtt hh% hh·%V, hSV, ƅGw PV à {whUW$jj9Z؍e[^_]UE1҉UMU ]UEEMU ]UWVSQ]} E10$hmj6S=u E%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVS E 1ɉ1D󫍕D1҃=4o45-7p.h - 5-74o4 Iuujj_AXZ1Ҁt,DžfDžDž&+Dž=v Dž1ۉ11119tD5fDŽ5DŽ5&+H5=fDŽ=DŽ=&+BC8[ty1t1DŽZfDŽDŽ&+DŽBt1DŽXfDŽDŽ&+DŽBhjjjjjjjjjRPj谛Ã4uDžhuhUW$jJDžPS!tuiu5hjjjjjjjjjPj$ƃ4t@DžPV趐ZY^Hy V֛XS͛_u?t6hhPh´-w&  |4-Džc=4o4yu4o4Dž<1ۉ4o49i8511ɉ9=4o4t9i85t4t(~SWmYZoڋ`d4 |4ƀy1҉LPTXjSPh% hCP |4"PQ% jSh8o4D% 5 |4,, 0$4(804$ u1҉DHPWHDFP$ |4()l,, 0$4(804 uȉ1DH$=4o4 pH DH9jj h5!#RPjV jj h5!# |4$P@ RPjP[ $`48t$ |4VHDPh%R耥  |4$pvơ |4$0`RRVP |4Pjj:5Dž1ɉ$Pj行^_u65 |4h_u1Z%$P1$Xu@P4o4P5 |4 PA^ |4$JZDH-1ۉ,048DHƂ( |448<=4o45`d4g_t4Y`d4tu t4h%£`d4a1X@KyuƆy$tP,40WD$͋e[^_]UMw1vB ]UWVSDž1 |4*)Ph%hS۝ l%t+hf/^Sh%h訽 jubhC% |4Ph12%hSe hC%ShZ%ǃ((hC%ShjlE0p{11ۉR YZtsE;klEX{41ɉ Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CL_cLuПXZ=4o4CLS9SRV茍ǃSRjj\ 1jjB6u$&v=IC`,tPh%hVG Vh%PQ C`,tPh%hV CXtPh%jW WVC\tPh%jWɚ WVSTz"t$t#VPh%P诽 CH@l%T%GCX,tS\tPh%hVL Vh%PV %p%h%P3 XZ#%v%h)%P _X5%~%h=%P Y^I%%A%{Tu)%PP XZM%%d1]l%c%NKPQhT%hcǃ-1ɍPY1e[^_]á |4*;UWVS ƅh%Nhr"hݭ#聊谇Ph%j$=$`4t" |4X芇SPh%5$`4v u6hx$`4Zt Ph%, ^_jj 3Y[h%W*$ |4[^1҉D)kSPGBZY;PdV’ P,P诒 Vh5%W#TP,PA$T\L1PL9Phl"HPZYHuuRS" V7,TXhh1TRjPZ*Pn(P V^P1ShL%W" PAVYkDlEXC uDED;rC,u{Pu C0u tCLtċC4jjjjhVs8PRx 1҉LtL{tCH5!#DžHN%L#CP w$&=11DžPt $L#"DžP%uL# DžPl%hC%HZY҃5!#uhLP S%PLhj%Sy؃RPh%W8!RPh%h%諄X11DžP5%11DžP#%<@hC%HCZY@v ExtSx uz^~1;s}O19t }?;tBx(u PYFËEx u$Z&1ۋ;sx(u PXC1ۉ؍e[^_]UWVSu1ۀ~ tB~9s*ًx(u1;tB9uPXC͉Me[^_]e[^_]UWVSQ8ME111ۋE;Xs-E؋MMQrPEPL tu}CˉeY[^_]UEPE P0]UWVS}EjjjjhSuPRx u1=jjjjhVu WPx tVSh%he[^_]UE8b]UE,4Ƃ ,4*4fP*4fP1]UEPE ]UE E EE]雗US],4)PCC0 ,4R C*4C*41C1]UWVSÉM1u1sNуtX`44tJ}s<0u%1Ƀs1t0uAqtG,J EE띃}tB 3BB3EEZY[^_]UWVS1󫍵HEPE jhjjh-jh544jj jPSj|Ã8VPlrS}1e[^_]UWVS<Ɖ׉1E1;S sMQRUSPL <]UBjluZY1҅E1EEE;C M9MMQuSPL k}lE̋UЉQE܅t8tjPQ HL >_4EG8EċUȉGh~jh%*hVh$V5m4hx MjW5m4bh&h&hSjW5m4)(SZt PSVT MVlV[jh5m4 5m45m4jjh%uÃ(xj VPS=e[^_]UWVS։ϋ1׋B˃1t.0uKB1t"`44 `44ȍYu1[^_]U1ҋE ]U1ɺE ]UWVS ]ju ^_jdu h%%PO u h12%W; 19tNi sQWVՍ uΊa<w ~[BjjPǃ :1ɉPhd@WR u u W輦Z`RhedAW$W蜦`9< RFaPu h%%W jjW3ǃF s9"hh"4W@u W諥Xjh0%h"4 u܁="4usjOh#4Pcƅ_ OusƄW4u h_&%s CRPh1$P $1u2jau h_&%s CPPv CtC @C wF-1e[^_]UWVSEEuu(&T& @&*41&ƃ`44@&u1`44@9u44j@{44j4{44j({44j{44j{ƣ44=44WLË44$U99s}Ë44RUZ9s}Ë44RUY9s}VZ9rVh5!#h%jjz 44EEe[^_]tU|EPuXY1uE%;E Uh@uÀ=o4tuUho4h6%j5 t1Tu4hd4hR%hp)%hht4y h@c4hR%hp)%hhk4y (ht4sZ1Uhu.UQ *4 *4u0EEE jjEPh*4jEP*4*4USh$TzhJzjj J hp$hhp$hh[%j S SXZ]UVSP]u EPVEP蝛 E u Vho%ju SSPh%jƘue[^]UPEEPjeEZYtMu4DWgh@b4Php)%hht4^x 8gh@b4Php)%hhk4?x (1US 8PhC%p [X1u?9t3h0!"S0ZY¸th$SZY]U hh!4S>%x%ƀ!4h%h!4X ZYj/P[[ZP}4]UVSE] ut VSP n4tu] Ee[^] e[^]UEPu u UVShZ"h%eZYt6u bPh*%jVuSmSYkh %j$e[^]UVShZ"hF%NeZYt6u tbPhW%jaVuSSkh %jE$e[^]Uhw%h%WXZU帞%u1 "t "]US]SBZ1҃vjh#DP9 1҅‰Ћ]US]h$SYZ¸l4tSZ¸d4t@c4]US]h$S˂YZ¸m4tSiZ¸t4tk4]UVS]u vv9tWtNVSjh5-7h5m4h5-73q$h5m4 qXZ5-7JS5m4?S5-7, m4Ee[^]US]S Zu)軏0Ps3h%h-av %]UVSjm V` VhPV j VW t[q"tC(PV5,45}4hf%hue[^]UVSh%(`hPh ,4N h ,4~Z,45}4K,4Ph ,4hW %hh+4p (jh+4h0"k hCj賋j< hh%jjh.jHj j j jjjjfLyj jjm zã-jPw\-Sgjv jj95,4h#%hVo (h%_hPS5 S߾SVXe[^]UWVSutrFF=,4SWZYtMSXtpW%,4Sh ,45,4h%hh+4*o jh+4h0" (fF-~PeXYtSUPSGXZ1e[^_]UjjAXZE<H UEEEEPj[EUEEEEPjZEUS]0SnEpFnEEEE1EEPjZE]US@-{/ttPuO~ZYuC۰]UuZ¸@d4uu4UWVS hٴ%EPh Y[$5!#EEPn]SuhW %hBnEPWYEhn45 `4h:%jn¸uu4u>ZE\URuh@b4PVSuhX%j"¸$KEtVSkf Vyà E)ËE9th%h&h h%QEe[^_]UWVS EUˋujQEY_tG UR#kuSPQÃtPESXZEEe[^_]e[^_]USj$uQZYtD1ۉ]XEPjhjjj EPSMU Vt;M rj$S뱋]UEPM UXUEPM UƳXUWVS 1҉<P&jƅpPh%V t#hjh%h%j %!hjh%h%j )%Ph}4rd Wj&V  Hvw=4uj輒_1-Dž-Džjhh$jPj(Uu1 h}4h-Wݢ 5!#=-u.h}-h$yZY5!#u=-u%WVRh4%h谈VSTc =4uj̑XDžjhh$0iWj'T-=v4+=@`4=}4hM%Wb WS h}4Whp)%S Wh@`4hv4ha%jڇ$VSh' %jWhb %j讇W VSKb Y^DžWj)SXZX=8o4tZ=u4tQ=}4tHhM%Wa W h}4Whp)%S Wh8o4hu4h{%2;e[^_]USڸstjSn ZYuSh%jʆ ]US13tjSzn ZYuSh%j芆 ]USS1$tsf1EEPj%REZYtt`Huȃul"hH%fX t&j hH%fYXKuh%jTXZ1]Ã=!4uiU!4 "I`}4%:4%+d}4#4[5% }4r "4]USE] tP7fYSjQxeXZm4E]UWVS18Z^1Dž@DžDDž<jjZuWU2ЉXt0tp}4haujPjP_SV tl}4uQX} tExuh%j老Y_}tuSh"%heǃShK%hNǃ V VXZt-tt}4ShUW$hajj@=u4t=t4tSho%j E@`44t x}4e[^_]UVS]u Stt uhu%OXu%C%2u%jjPVSe[^]UWVShhR%n4_Zt Ph% [^h}411۸@-P/t 8t`44u uA؄t h}4Dž@-{5t}4/z;i`44\l}4u1uSZYH0l}45t}4j5-7@5-7@5-7=3|}4x}4P5h}4h%ja_1u4Pj wKtu`44|}4uf|}4ƅ1N1tσ0u@/u(Ht!ȿ1`44uƇ`44Bƅ뼀t/|}4'tju ^_`44tx}4h}4u9uh_j5 0VR5l}45|}45p}4Ph%h^ jjY[}u%l44h%j}XZo44tkh%h}^_Hu%h,^jY[th%j}XZh5%j}ha%jw}l44l44hC%LRP urh}%eLxRP uT|9u;xt8h%h%.Q^_th%j|h%h%MҴ\[Oth%jT|Y[ju XZ1e[^_]UWVS-{t0u1#W3(PYZtWhUW$h\ ك1ujhXZe[^_]UWVS1h%$KPhUW$P~ ytQP|XHh%JPhUW$P~ xh%JPhUW$P~ y6륋tP!XuhUW$h3[jjw_xPheO$H` à tH^ySkRhr"PNXZ1ɉu|SHRW蒃uhUW$h3)[jjBRh-#W1z ZYuh$ui t*WhUW$V$ ShW`U u<=uDžSQVQ_Xtq![^u ZYtCh0Zj^_u2ՃY[tjh2.XZ1 jh3詨螨.#؍e[^_]UWS]S 1E CM [_]"Uu uUWVSSu] V 1EStitcklЉE1}9z4u@lM9ut@FjlP‰FXYt*1}9{4ukl4 @lM9uܰ1e[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF;s rEtEȋỦEUEЋUԉEU؍e[^]UWVS]u 1V,ZtƍCڍe[^_]US]s 6s$.XZCE]UWVS]1;3s8klCxdF@0 ttW X9sklS9zduBd@1;3s>klCx4uFtWXF 9sklS9z4uB4@s芼XCEe[^_]wUVSjhPjut)uu PW @uyt0S0lt0Z1 SXe[^]UWS] 1Sh|duw t#S;S t%iSR3uZYt3轻X1e[_]Uu hzd@u)UVSujhPjV.t(ju jPV+S_~y s01e[^]Uu hedAuUU EHJ Ju B%Ep8e[^_]UWVSXu} ]=T4hKT4PYZY9T4}T4hcKT4PYZY9T4}T4h?KT4PYZY9T4}T4hKT4P_YZY9T4}T4hJT4P;YZY9T4}T4jGJT4PYZY9T4}T4jHJT4PXZY9T4}T4jIJT4PXZY9T4}T4jJsJT4PXZY9T4}T4hOJT4PXZY9T4}T4h+JT4PoXZY9T4}T4hJT4PKXZY9T4}T41ҋ;Q$s+k UA(0IPXZY9T4U}T4BʃT4F@ u3{4g@ =dmY=N=p8>P dmpEMt0t(t h5!#5T4h`%vktstZ~ tS4C8u%uh u hH_hPRY[P5T45l40o41RPssiRP5T4%5l40o41RPs$s uiRP5T45T4ho%v胘=5l4C S$CS 0o41SQRP!iRP5T4몋P ]uC( PGP5T4]u CH@L؃PGP5T4]uCH@LPGP5T4a{uCHpX5T4{uCHp\5T45T4h}%+oCHP`u&h#GP5T45T4hf%vSOEERh)%jPG hFURjPà P5T45T4hf%vS袬kfx5T45T4h%v֖CH@Hth%v轖XZCH@Hth%v襖Y_CH@Hth%v荖XZCH@Hth%vuY_CH@Hth%v]XZCH@H th%vEY_CH@H@th%v-XZCH@HE %FEe[^_]fnu%CHP5T45T4hf%vݕI+{jPMQKQWsPRdk B(0`EMQP5T4hf%v蒕0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4I8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhH SPXZ1e[^]UWVSu jFHP]S jSSjjjjj KH0-E܃,11t]DS@uu@tA^Ht҈Uth#W TZYUu CcL'/t C/jWjWS) FHHL1e[^_]UVS u vDh)%j ]SmC j SSjjjjhG0S軦FDVHB`1e[^]UWVS jj%蝤[^9hBC ^hBCC^hBC C,^ E1҅tuB &tME4}GF ^u/UDEjh譌MEZYU}B}$w"uuh@BF ^X}$th%h&hh%Zjjjjh&^hjj jjj%SjM8ƃ4xu Pg.V9S迧e[^_]UWVSQE @4uE x8u-u uxXZttt =t ujj ^_x 1҉j4&U茋G `UBXYu؍{shAh AChAC h@ǃzojjjjh_hjjjjj SjM7ƃDxu P3-Vs8S苦1e[^_]UWVS] ;G(S119tuklKI0΃@jj h5!#GOOgRPj!Wb jj h5!# A1҉SQыcRPj'Pb 8uth?jPPVm E@ tP?jPPV 5!#u h?Xp?0p?'QWMQVRPpjjAl4,jB=?SPh1$j -P=? l4jC?SPh1$j :P? l40j->SPh1$j GP> jD>h> MYÃsU4LZ£U4~ް-T1~CVƄ5T -߉TPh %jPhU4R> j.6>hU4P5U45U4GP:P-PhF%hhU4> Dh$CXe[^_]UWVS] |4$DV(Y_TV$ C8@@8 QPVRL @B r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhfhajj7jjjjF)ƃ4PVV)E)PB89B4<藓ZPufLW WPF8PP8 WRPQLP $A!%SZYu,Z4]U E]UWVS41ɉMԉM؉Mܡ |4f([ |4$u|jjjPkPÃu1 |4jjHDjjPtϋ |4$KC19};DH} DH |4$}ЃEȃ=(Z4uajj]Sjjh-oy1ub(Z4Zuh-hC!% p ^_jjSPjh-o1ۉ](Z4u9}MkT UWuAZYÅt FuMŨup |4840h%hJEPEPEPuCxtuuuh%h>150Z4EPEPEPuIC~(Z4wL3Mh/hY CSEȉUjheRP Pusss shT!%h(hMĉ 0Z4h0Z4j,F 0Z4u/EEԋEE؋EE܅t+EPEPEPu,APUԋPU؋@ Eܡ |4$tuuuR |4,jhP |4$tIytCf(u9PH[Ht' |4$P |41҉$Yhh^X]9_~GL (Z4AEȾe1Puqqq qShR!%hEX$뱍EPj-EZYD(Z4D0Z4se[^_]雃UWVS5,Z4t/uujP SgthjbXZe[^_]UVSE X(uNpƋ0VPsjhSà uhjj ؍e[^]ðUE1Ҁ=,Z4t]]UE} t=,Z4t[1]U čha!% hm!%j!EjjEPEPjh-ik$@tEU th!%j XZøøUWVS,uEE1(o4,o4uFVEUFVEUURURVЃ tԋ 0Z4EUA |4;\`|.}t1hjq[_uCP@^N t9Ӊ}ډȉ(o4,o4 (o4 ,o4EEЋEE̋E E11}E,E1ɉMԊ MˀuMJ}uE9tEԋMu}t>MJ}u29Mu-*}tMJ}u 9Mu }ˀuGE }$vE0EDr%=uu r% = uuS% = t;}yhjΏYZ|tT0Z4t&@t 9t90Z4t@u%}*h7j袏YZ-OOBOu5(O~% E tSE (!%~ v$ t!%~ v t "%"% E uW!%E fUu)8t$EU |4;\`|ˀ}t4U uWNE (}uƒ ҅u uuth hhXjeZuWhUW$h!"%V艎e[^_]UWS0]}ȹ 1E1EEE =,Z4ujjS@ jP4E܍EPjS@e[_]UWVSM 1 |4f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuh/"%j]UWVS4}=,Z4PklUVE 0.^ZYE UlVSClP11CC,C0CLCPCT |4$F( t1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC}}w1] 1ۉMԉ]M]x(Ã}t*3M 3] uM ]M]U9uU9u y;u U| 9u܋U}U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á4"UWVSLEԉUȉM]E EUE}ԋwu}9UM}։lj]19؋]| E1ɉM;EE}HuuWV  t4EUuuWVn );uE}u}]ԋEUCSEU1҉ŰEUEU]9]E9ƉMEEEU)EUEE1EЋM9M#} E؀x @11ӉM܉]3M 3]$M]] ]9u܋]9ƉE9ƉUE9EEM܋]Ή߸;EE#EUuuWV );uE}u}E9Ɖ]w)]9؉ы]}EUEЃEE9EE]|Eȉ0xEUAQ EE̋EU׸;EE3u}uuWVK );uE u}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]USQMAQRPRPjjjjU} IuEU11ҍeY[]UE]US]sh&%j ]]mPUWVS]} j/W ZYƃti)PCDPW ƒuNV`~EJ9s4t'19ty u9t@e[^_]Uju EDPUEvPEDPu Zl UVS]=ȃ4u s ȃ4K$9C |`5ȃ49s sUjjjjRPRPU t39r,1tu{(u t @9|1e[^]UWVSU}119y u 9;] u}t uz(tt}h~[nЃu"9uǂǂ1J Z$1ɉƀJ C@]t&%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVSZ41ۃ<`&t9jS2FFXZSF w&ӉӉƃ"ue[^]Ã=Z4uUZ4]øZ4UWVSUu}E EE9E sX11ۀy u9t 9] tC9] r8@9E}tMa}w}uWrVi 0}t.1HR}t PRhZ&%PRh_&%WV R}t PRh%%PRh*%ԍe[^_]US]uhmG%hP&hhd&%ds\LX]]OLUWVSÃ=Z4ujZ4u1hujjhjjjAjjjRVh襼E4URPHu膽V+}51Dž<Dž@;us<`RVSPL t$hl`d<@FjH&4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV)׉<@8ڋE"C t @]fCEf@ DP:Xe[^_]UWVSEMt]X$[ EXUjS$EZYtI-Ut#E@$19tD BMNju1ۋE Ee[^_]UWVS] Ep+s8k H(L9tWIw\hWKQVs4RPdhWWjjjj@(48WVs4PRp Vs4RPh 1e[^_]UWVS0] K4Uus 0RQPVL Utss ssuu3輥C S1e[^_]UWVS0] K4Uus 0RQPVL Utss3CSuuPR|EU+CS;C {}C S1e[^_]UWVSDÉUEE1uu11;{ sGMQWSPL t2EԨt+M؃9u#F}y tEċUȉEUE̋UЉEUG봅u*}pƋ0VPjhKNtY}yS}ttURURSЃ u1pƋ0VPjhVSRYt }WSЉXZe[^_]UWVSPuIh=1҉UU:ÍU.WVhW %jjjMQR9|ڃRjjh(%1e[^_]UWVSl}1E EEURj-1[_|ËEPRHEU |4PLEUYE9ƋE|EEE 1}EjP4E̋MEjjuuuu0o41ҋ}9=0o4׋u}EURPjEPQEƒ01EUEUEUEUhjjhhhj6jjjuSj{ƃ4u S$ZkEPVVQSi$}u#EMQ]SP @u uXUEEP tB]fCe[^_]UVSR] 1ɉMS4t&uVRP u uXfC<1e[^]UWVS] E@fHPR0_usCthpW-@ ƅhWWjjjjp t%RWP@ZYuX붉Ɖse[^_]UWVSLu}1E EVUEURj-CY[tUÍ}UE;P s WRPQL hjjhhhj6jjjuSjj4uSs"ZwURPEEP7SO"}u*UE;P s]SWRPu uX1}t UnEx fFe[^_]UWVST]SSPHEU |4PLEUZY1}9M|EE1E}u{3jjuuuukMeRPjEPS,HEUEĉUȃ}uuujP8E؃ jURS @tQEM;M qku0}u jjuuuuuujURSЃ,Hu1~Uع1EUEĉUȋEUẺUЋz!EjR4E؋juVStVPSRLƃ txtjuuSe[^_]UWVS|] |4tf(ttuh(%hH&hh(%xF54o4t\UP^4hjjhhrhRjFjjjuPh`]4肰ƃ45P^4Y20艹Ep||7oxwajj h5!#jh0jUR,jj h5!#jhjMQMQURW|xu |4PjhqN@h$ |4$0ظE |4$pEEEEEU׉ u11MQMQSЃ UtEfEEEĹf@ @ #@f@@4=̃4w@ f@*@,EhujjjjjjjjjQRh蹮ǃ4t P苮@,BEPWKW苯Et11!UMQWSPL UuG;{ r"E EtEuEȅtօt1hIjHY_u$`4zPh)%! S3ZujhQ_XO:jS[^JsjhsO |4@u ǀ@>U1]1EEPVXZ}y1Q1҉u1Hùxt%| q1@ 4S-|GEE;xrB;Us E11ۃ}t E;]sP,C_PYV觭5P^4XZ}e[^_]UWVS0EDž}uEl̃4jSZYt jS^_u+Y15jS_Zu[^ƅ1;̃4Ѓ4} tE 9[uE(u)tMQRYu';s{Љ E, UHD9Ɖ}djj h5!# WVjWhpƃ 3WVPhI)%V5 V[ ƅ3诳Pe[ XZ00@ V_w%tDž111=uhnjj h5!#E,}H,DRPjVeE$ho觲RjPESYƉ<$T2 ‰$SP S[Xf S $uf <$S WVV9r$hT)%h&hh(%uձZ1hjjjjjjjjjP|Ã4tPS_X19s <19t4<@YڅttVZ tSѨXe[^_]UWVSljfDžv/ƅujhH%Y^yhhH%SW3 y蝟t&蔟8t芟WPhp)%hS虰 hWS3 =Džp!j/Sg _Zt-xv9tH9s8/t@Q9 YyߍxPW@DYZ%=pu>hQWv iƄ/u%蔞QPhW %hS蝯 %hQS2 =@uW9 ZuhWP1 =hS Y_1Ҁ;/u 1Ҁ{‰hSAp<$-ZlhЃpDl=w4uhhC%S2 =whWS1 =v ?V _y VGY~V ZV.jX1e[^_]USÍEPSAYZx7Et.jSXZxj `PS t SY1$S`Z=vf u]UWVSEUP ^ƃ}t11ɉMV+ Zt{fx vX jh*%S uSuhp)%EPw @u hi[#&) 3Et}tESWuhg)%j+u[zVX XEEe[^_]Ujh*Gj謤 UWVS hv)%11tY+ڸ)%xuڸ)%wu#WS@XZuWS?Y^1yah)%觛hPS. WSZ@1u h)%聛PSh)%j,Sh)%j7hS?h)%ShPPi. WP?u'h)%S蹚PPh)%jh)%hPS. Sh %jtPh)%h)%jjuhw)%SDhPW- h)%S'PWh)%j-,h)%S hPW- h)%SPWh)%j,hw)%SؙPh)%jMh%S赙Ph)%j*h)%hPW- h)%S|PWh)%j(hv)%贙hPW, hw)%SByth *%S# Ph)%j' h *%YhPW, h *%Sp14`-Php)%hW迩 vtpWh)%jC utjh+*DXZte[^_]UET^4fP]USE@k `&t!`&ShWE 0荪CX^4 ]UWVShƍPhW@jM@1jh*%_ZRhW@P 11!tVk `&`&u Dž"BVP芸ZYu=T^4DŽS GjjjjhA jjjjjj!Sh˞Ã4tjPS`S蠟Xe[^_]U詖X^4tPPRRRh*%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡ0o41RPSQ*RPh#j]S ]Сl4EԃЃ7P٦URjP:jPPh`^4]) S  e[^_]UWVSĀE@kl} GNjE @u FuG u G08uw0WEU1EEPj ĒXZ}E MQw8P uEP^G81ۉ]E ];Xwk]lE X{8tIC] su19Mtklu ^c0AO0u uu ]u]u tu9]}UEG0uW+EUu FV}t ]U]EUWE <1e[^_]UWVSd} E@9E Ek] lEpF0t0 tfA A B}lj@&fG G5GG G,G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{`S(xE+C$PR)XZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQPfYZuk{8ueEC8EC4FV SVCEpxP@EU(o4,o419| EU)AQ1&Wv @u1]{]4VNUMEP$@ EU]9]s#kElx8uyP@P b]9]r,1]9؋]|ZEM]+HX M]11~8u(V] ]9E]|V1]9؋]}yV9E]}jM9MsWM]+EUuuSQγUUMNk]lUMʋUeʉT EUVEM]+HX M]11ҋ]9]sV]9]s kul7T7]9]s kulD7T7 M])ӉM]19Mt1E9t$E9t8uW t G0u)EUAlʋ}9}}y{&к 9ʺsbkEl}GËSEUu}+u}uuWV()9uE}u}u}EU)SE};xM] uuSQ3ы}ϋUʉӉ]u9ދ}|}9׋u}ȋU}MOQ)EUE@EE}EpxPEU19]EUC<S@9Ɖ|]C0EU9ƉE@9Erk9EkElU‰UM]) Z19ʉ|EXH 9|1ɋEHE0xP0tqP0EH0bEUӋEU)uuSQҰыU2zk]lu΋Uʋ}TE0xEPuFV e[^_]UWVS@PEU 80%WW S0pƃ 1z t 31묃u1돃ty  ?VI$$@c)((A6,,B 1ɉ Ph#jSW jSSjjjjW*[0S4 ZS% Xe[^_]UWVS(]}h#uVpQ _4XYu81ɉU&MVPdZYU9‹M}ƒ$uӃ_4} E $&h4?V Wtjj"V_h5ku20o41RP wRPh#jEPU h6&tjjUYh7u)tjjUZPhUW$jEPU h8t"u h#jEP`U h9t"u$h#jEP+U h:bt"u(h#jEPT h;0t"u,h#jEPT h<TVP_4PhY%sؤe[^_]UWVSX1ɉt @@_4t4t=$txuP1$Xytƃyjh}/%裬_X=4ԏ4|uÐ Dž81ԏ4ktƒ8B1;8 8.T8 RPhp)%hWS 5t41҅t8t%FWPcZYu Ɔyԋą`d4ƀy1LPTXƀ);ԏ4ǀ,ǀ<jWPW hW`d4"PC =t4u/`d41҉t4hݯ`d4aljY t_t4tByu/t49ut4ы9u􋐀뺃G5t44@k<Љǹ1󫋅PB qsC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB q$CsC C8RPL u;H ruكtЋSO_Wk<<󫋅PB qCsC C8b]1fD @9s=d}4t1&󥍅Pg^&󥍅P6[=4tcDž DžDž؏41҉0&󥍅PY=`}4t1D&󥍅PX1B eTB n_4yFHfGe[^_]UU J E]UWVS0EЉUĉ1ۋ9}qGE̋GE11ҋũ<tw9tMBu9uSuhAV%jEP;M 5t4tFURP[]YZtEЉChjXZe[^_]UWVSL4ppp h/%V# h/%V_X1L4k,<PXR0PRE GPZYtcOTt[8jjjjhRQPWxL4؋QP :jjjjjPqTRPx Ph#VJ 0)h/%V)_X1L4k,<PXQ0PRD GPZYtcOTt[8jjjjhRQPWxL4؋QP :jjjjjPqTRPx Ph#V^ 0)L4p$p pph/%V*h0%V h %jV@ j8L4tPh0%hi uqL4tVPh00%hhuKL4thE0%hh u,L4thX0%hh u L4DpC1e[^_]1US]1{u4{ t; |1C4dv"{x[]Ã=48UWVS`1Dž114P~Y5t471ɉ$;H QPRL t tt߀8tPR"B RU /thC%R(~XZ4 QRH+ ZY9st6t-Q/UZUY99}tt$;H s41VTD 4$Vhp)%hP6F 545!#t)"PP@ XZt4PtYV&Ph)%he488  RPVhq0%he$tt;,($ PRPh0%hbe$!PRPh0%h?eu&4@40|81e[^_]1US]1{u&{@u1C4s" {x[]UWVS_4t4xtt$u ƃxaPYt0$xtEjjjRt1PZu#$`4tSh0%PH pÅt$`4tSh1%1=d}4'p4P_p4p hV"S K8u8=`}4tyjhg#CPM ƒu]K0L4Cxt79Hu211Ƀ|Pt |XtFB,@uVRp$h1%p9ue[^_]UWVS8E$C } yB11E$;X bMQSPRL tEuuSuƃ C19E +=d}4p41Ƀt7t3:t(}9z@u } 9zDu}1r@B AHă=`}4E L41tT}tNEQP1}t,;u(} 9zu}k,1ۉ\Px@,0u @,0uFp맃=4E ԏ41@8=uFtC}t=9Q<1t%]9u] 9Z$uɃ}t k81҉T<@8=u1e[^_]US`d4; |4tt4t3t49ut4ы9u􉙀[]UVS0]u$MQu PRL t>41:uJ Jt @ =u_k 4]ȋủ44BMȋu1k 94u94u94t Bu1҉444e[^]UVSMU194u4r94u;t = u1[^]UWVSGDžt41|?1$%$;p WVPRL } t} t!} tWVS jVSSx k|<$tjjjjjtVRPx|ǹx󫋅tfDŽDŽ&+| Fhujjjjjj |}@Pjj|Ph/Ã4u1}?PS%S0 |9ṣ_4k<}Ee[^_]US<] EjP_4ZxD1k8|<u$MȉHhNhT>jRjKjjj@PVh&ƃ4u _4w1=_4 ĘSVVD' =_4uL |4$t>t4t5xt$h`G0jY^tjjXZǃ=_4؍e[^_]UB=4tuh2%jPO UVSuu1r$ugjjjVyÃtjjHDjjFPt$ |4KS;DH} DHe[^]UEx8th؍#h&hm h2%F@UWVSQ} E@E19u~aEX=su8u?G8.=ru8u/Gx=muWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$蜖$zuubPrYtWWZtNjE@ u WV_XWPV. tjVSE@ t VPZYVXjjSƃx_4 e[^_]UWVS] uUYP}Ĺ 1󫃽PuPZt苅P$V_xt2jjjVǃtVYt P$VPHHLd 1Zw j&RjP8x u0h؍#h&h h2%CRXue[^_].US]sh3%jPA ]]_UWVS} EX,1t)C@WPO1ZYtCWP?1ZYt FӃe[^_]UWVS4u}E E th%h &hh2%8EPuZYtjDjYXu1K&u+ CC4C8"C1t4Q,1t9E t @11tt:[]UVSQMp@19|hc3%h&hh2%/9ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s6SrY;C K$}%jjjjRPRPU Ɖe[^]Ã=_4uUhђfXUS]=_4u1;_4s k<_4[]Ã=_4uU_4]á_4UWVSSÃ=_4ut=;t6_45_419t$USF P'ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}hx3%R&ZYuj juZC,S0h3%V&Y_uj juZC4S8h3%V&_Zu0j(u Y^ƅj)P _ZFh3%VA&ZYuEh3%V!&Y_u j(uh3%V&_Zuj`u@SB Oh3%V%Y^u>hf3#EP XZt(&>ttVP%YZuG C<e[^_]USPQRh3%EPj3~-h"uLEjh&P$t2uz[1Eh-#EPQ XY:tjME+[h"jpLEZYuuzX]UWVS1jhPjEp^ÍPhd@S @S<=EP,[1Dž Džƅ ƅ tfÃuCt=ut2Ѓ  uuЃ A떋Ex@uS@4tPh3%PQ ƅEpPh3%j3t1EE@@Ep0Et(pv0v,h3%j\3Vy1ɉH0X,t(Eps8s4s0s,h4%j 3vE@61C,S0Vщ‹VZ*H{09L;C, P{89T;C4 PCP ^_;t' Ps0s,h"4%jB2s@\PVT"ZYt$Vs0s,h<4%j2q{XZƅ11ɉh"jH>^Z{ƅ1h-#P XZ>tރuJtjaYj jV9J t*t t/j jVIKj jVI u7thh(%P߈ hVPʈ   h_#VgZYuDG8PW<G4&hm#VZYu)+hP#VZYu)j h&V t򉕨hje^Xۋu0iY19ȋWi[j`RC@Pt C,S0C4S8 u+t)CQ RPYZuƅu_, G 1E u G1ɉOOO_O _$UWG@jhRjPuLƋ_,tjP4tKRPPs0s,V0t'8t"PI PXZ@8u ǃC4S8)G W$q1ɉSh|dV iR`_ZugYSh|dV4 u܋1;s̋G,tpH,9H0u0;u"H49H8u;t밉jSP߃ BuV*Z1e[^_]UP}4t 1=4]USÉIQHQH QH QH QH QH QHQHQHQ0h#RS ]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk&W覔 uu wuт uRCu1jSk&Vk u%u vu薂 uًU EGue[^_]UWVSu] t>u1}WEPEPEPEPEPEPEPEPEPEPEPh#Vū4 u}w1M9Mt ]K1ߋH X$9} 1҉P P$ )H X$EE}Uz=tVwAtLw"Q w=RX<Á@1HøUWVS։M11ۉ9uuRjSP07Gуt `d1ɉMMu]썜SjuRVPEЃc}t09tGE}t"MM슌 MtMuʋ0tt9tGEC01e[^_]UU 1tEMh]UEUUqU ]UMEPЃ< u1tE0]UE1҉UU ]U EEEEEEEP}U EXUWVS]xu,P4x1p3?J} @0P4x1p3?J} P PH1ҋuVi13k?] 319[^_]UWVS u]}1u܉]EPU sZu tX5%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EEPEPEPMȋUEaE )EЙ]u)։]u]uEEEPEPEPMԋUE Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋuԉMʋEeƉωؙMʋEE)׉ t/E Et'EPWVuu&EE Eu}tE}}5E؋EؙRPuu!EU |4DH~1ERPWVuuRPEE]ÉUӉыUe9E1EPEPEPMȉEp xKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9ZXeY[^_]aUE]UWVSQME܋A1҉UE؋E܃0EE1Ɋ t.}uÃt&<t" ,1ۅu9ut@u0Eu1ƒ< PWEpWMUE{11҅xE1ҍeY[^_]UWVS,U$}(E,u01ۉ]]]]]]1ɋ]9ً]| E1ɉM܋]]19U}U19E}E1EEU ẺUЋEHXE;E9ME0juQuMU]M MȉE@E1;EE }H1u}u uWV)׉;u} M}EE)9s U)‰U1҉UM1ۋE1ҋ};}}܃}uu VN^ Eډƹ19 Ee[^_]UVSEP$9p |$1jjjjSQSQjURP>,1҉Ѝe[^]UWVSuMU ];k _(u/ȄtaB 19t Bu,1u.R E@M,9du 1dd[^_]UEUUUUUUEUUURU UEUUE1҉UP0UURsU UEUUEUUP0UUR(U ZUE1]US]MEE k B(u#1tAƒ<!Ѓ;ukE U1uQЃ<![]UEUUE1҉UUURU UWVSÉ΃8t2$41jVRs $Rh{dЀ3s jhPjR:@ue[^_]UEP0RPNUWVS]E EC0E1xp@u |4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@u}WuSZ yуtu G{0Ea;hh ZYohS9ZYa }U׍e[^_]UWVSEX01҉U1Eߊt]}tttR<tN U4M쉊4݄&4U4G@k_4D4_45_4Cue[^_]UVSu ]=_4uXl4tQw4tEt 4t11-t1w"RX1t kD4[^]Ã=_4uU_4]á_4UWVSkDԐ4Ph)%j QM# hs4SPhr%j(RU 4M쉏4U4(4LJ4k_4D4_4_4e[^_]USÃ=_4u+kD44u []5[]UWVSƉUM] 1F1EUSF C1{ FCFwtw A,<vy _4CFU,U9u _4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU Pg 1]UWVSUE}u NtGtRutG_tvpS GPh)%vS FD64t(vtvPS2j e[^_]USR] =_4uj EPu ƒ =w uE8tt h7X1kD44u]U U1vEEUEPU E7ZÅt*UVS14LFZuSLXe[^]UWVSQu>xp19|h@6%h&hxh6%d ]9|@89@|ue[^_]UWVS0uU= |4]ډ@E =~Mȉ\1ɉ`Uډ@8;FF| FP1RPz~ tjURjVPL tWEċUȉḾ1 u@dž9|Ӄ!lj! t9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E E thK5%h&hh6%w hj F^_&u# CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP+@ǃEPu9^_t!ẺEЉEԉEȉC1҉ ؍e[^_]US]=_4uF1Ҹ;_4s)=w9t kD4B1=w kD4[]Ã=4u ^4UWVSƉ $41󫋅 EU RPVh=3%h4P E jhPjVM,xShydP @u V} X1Vr jSue e[^_]UWVSlu] E EE$EEPSV EP߷ډzXE8t%E8hX6%h|&h h6% 1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}t }t#1A}tPh12%%uPuc "}tPht.%Ph%uu ؍e[^_]UWVS8Ɖ˹1jhPjVZ*1ɉDž11؉1u51 RPhSZ =|n=ZbƋ!!Љ u9tEXH!ƹUEXfUtƒ<<„t <uh[0101ff=Ut f=u(Ћ,D1ɉNu1󫋽~wRXu[tO ttGEt%,MPP,1RW PE Pشx rt6t%F,dDž $t tW9,sAu1hjP>^Zt1ɉF1*1҉uX1u1fǃUe[^_]UVS0E E thK5%h&hh6% hj=^Xu1E u CEUY~11ɉKKCSǃ?ǃjh>RP@ECǃ1҉K0SUE^@uSoAhރ{ u_C$9S }NURjSPL t;M܅t44t,41@=tD9u=uSXe[^]UWVSSMӅtY0uƀ1҉8,0)߅uU,)ƀX[^_]UWVSP}U] J3ȃ<tu&`t$[ch\XQ1EEJE,K1CB C 1CtqE1ƀEDtP?1҉TY}`t01`1ɉEǃ<t}tAu1ɉM1EE9`uƀ1҉vN09MuCt:j6%29Mt΋0ukE00,09u/1O0t0uu 10M`0 e[^_]UWVS,É11@jhRPS"yPhd@ @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< 󥋅EE 1h1󫋅,t20t"uh؍#h&hh6%  u/ƁƁƁƁƁƁ} }t~1É1uvB? ڈD>1É1uvB? ڈ49 fDžU1 uAWVhPx30J12XuWV)׋1҉!!SB9uE9u=H!؍SS:ș[9-9!qX؍e[^_]UWVS]Euh6%h&h .1uEE}lj1Ʌuh%h&hh6% s{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVSÉЋ{1Ҿ44tBt D9u3{u}s{ u}u}u}v}t t4M1;})ωxMH PC u hk"kE UP XZ܍e[^_]UWVSE }Ĺ }Put&4u{}1ɉt4t_41 h6%h&hh6% D9t Gu]u1ۉ]]]]E1u)E6%}vuuE}t8tރtu݋M\Z]1ɉMZ1]u뼋u^0]M Mt3] ]tu$}rEdu uXM]M9M]uUMUMUMM9M]uP @x|EUx|EUE9}}}EE`ut.1EUEUE9EE}}ދ0Ή1}9}}U|s1EUEU,Mp1t1ptM9ȉЋM|/9t+E9EE|}E1hj1EZYEfǀUƀEEE1҉RPtpu9uu|H1+EUẺUЋE,ujPE}܃ t"49ttP[5W'w 4Y_E0Z}w1u}RPWV)׉E9Ɖ}ME,}ȋ})1ҋu}׉u}uĉ}ȋx|9E}}EU+EUẺUЋEujPE}܃ t"4t9tP|4WHv 4XZ0}9ugucE,9EE}Ohj/Y_uEct4}},fǀUƀ0Ë0}00UMыE`E]}v& }v}b}X]puu;u}ʉUHX M]EEjREpRMUEEE1ҋ]9]ЋuEEM1ۉMĉ]ȉ$tuNEEE1҉UH1ډƉuuRP)׉}9ǃ}U1UĉEȋEċUȉEUEU1ҋM]M]9ȉ} +EUẺUЋEp0\EX}T>uuuE}܃ t3UŒED4Ut9tP2Ws }UD4_XE\FhqjjPӪ 1}?t;_uE@EuՋE1EE1ҊG9Bt<utE0E}tbExt99BEXEtكt&t!9B1ɉME}tX̋E돃E9\=,ujSE6}܃ 49P0Wzr 4XZЍe[^_]UWVSL]E EEEuC,t)uC0EMċUw-:PX{,BC0EMċUHu1uĹ 1jjjj1RP1ҋ};}}EURPjEPS,tEUEĉUȋEUẺUE؄4jVSUE uaduVh`&suuuus&C,u*E̋U19}'SjRPuus &C, X({,tˋC,tPC,e[^_]UWVSdE}Ĺ u^0]H441@=D9u€t 1ۉ]1}t ߃tu‹};} uE@uǃt"9t}h?]QEEM1H1EUȉƉSQRP)׉u9}1UĉE11҉uts;E @˃tuZ}`tMt;E ti@EMt˃tt9E tA@E}uы0Bp}t E7%E}U1ɉMEċUȉEU1u9E8ƒt<E`EUEUЉEUMEu49MEEE}tIMtƒt6<t2,AE1҉UI1M]‹E9‹EU}0n]уtt@uh؍#h&hT:u09EE}}h}[UUűEЉEuEEE,EE] E9sEjQEpuMUy}$Ed7%]]1ɉM1҉]ĉUȋE19u֋M}ẺUЋEuuWME]E EE t];u ǀ]܅t'EDt9tP*Sul DXZEt uDEt ]TE9u/Eu;hqjjP1 E̋UЉEU1҉}ttBuh؍#h&hl8EM]M]։u1}9΋}})щ h6% E}uEgEe[^_]UWVS]uh2%h &hk h6%e Es0h9tSME M9u㋶0u͋EtP^C,t PY`11d(FZus(X]e[^_](UWVS}G,t PXjhPjwL Ãt7WjR$YXtRVS Va(S]ZWXe[^_]UWVS\E0h^_E0h#jP]S8 jPSSj Sc Ǎ@^>w̋E0h#jP]S jPSSj S/ ƍ@[=wʡ |4EHDEU}~ E1ɉMRWuuSVRPމؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ |404}81HDEU}~ E1E}u?9}/jh>uu=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ] |4480h%ht}WuVEPS$xuuuh%hqWVEPS>tuuuSЃS,e[^_]Ujj jg j PUS P $5!#PShV8%h- j U=-u Y-4fPftPZ9-UWVEE왉U1E}ujEPjE e^_]U0E E1EԉE؉E܉EEEPEPu ƒ xEÍL$qUWVSQ@@u5jh4#R 44󥡨4444XZjPQ 4444+44_X49}944s74󥋅441=4uh(jjE(t!j$jjV =4u`h"P裷 4Y[tPhUW$hP¼ x4419߭y%ݝ݅ %߭ٽf f٭۝٭y1d~dVho$)P=P Nj4~-4t P Z)Å~:ùdh5!#)Sh`&Pho$)P=P誻 ǃ119ʉst @u4H&SQhp$)P=PL +44+ 4y @B%ڽ߭ 4419ظw ȉ߭%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4H&%11d PVShp$)PP覹 449lj44)ލ 9lj݅99Ћ}h6p$VQ۸ à +44߭߭ٽf f٭۝٭?~~h)p$rtPh"VQ5 Ãh(%VQ" à <ЙRPhCp$)PP Ãuh")PP迷 à 4fPftSVP eY[^_]aUS j X]UWVSPu ]Ett v9sc 71;uuߋuE9s$;ut:GFFPhGH%jW ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=0-DWtDOt uxu 1!tjjEP5  FCE덉뉉؍e[^_]UWVSujuLZYt&Vu PW9uF 7؍e[^_]UVSu huà @tuuSiS؍e[^]U|EPuaI ZYtM EUQ1UWVSEE 0Vj S7 DžuVjS% ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U <v }D&7Ep V/ YƒwCljt)1E@EȉC,ub Ex txj(Zu h&M3XYǃ,f@S(P1.1;,s$k(рyus1(D@.u e[^_]UWVSSƉM׋ttU9t7{ t1 ufujuP< t[뼃 S Vh@:%~2 e[^_]UVSÃHt1HL~t< HXP- 1LXPt1PT~t PYP 1TZ`t1`d~t `XP 1dXt/tV1I,X 1҉Yt/tVH,XG 1Xt/tVH,X 1Xht/ltVH,lYh 1hZe[^]UVSTjjjVmD@PjVj48@t@сt t t48SVQkXZe[^]US]E ftPh&h:%/ jP t(@t  h&/YE u1҉U E].(Sh?jPe#@uE &E,:%]I/]US]E ftPh&h:%7/ j|P t@D v|y . 7`x |AxYZt>1҉Shj"@u;E &E,:%]x.h&n.XE E]']UVSĀptQPhhxVS@u h&.XV Shk:%- e[^]USË4%uXh:%S蔔XZ{PtS0Ytp%tSLt:%Ju+#PSIXZ]UWVSÉ׉΃t t%:%t1PS®S]jScAu:%tґ#PSXZe[^_]UWVSÉ֋8 Ph:%,1ɺhXZu:%VS蘓Sjj$1ɉK 4%ujL%XZe[^_]UWVSUM8tt^@@tR{ tGu}  t1҉CXZ[^_]USÃlt1u?hvPplPh:%+RPXZlu]Ãx tkUSË%u6SF% Y u=uSmZ S.YuSۜX]US]SAYuj#XZIpQpcvPh:% +j#ShLjdj"]UVS]E ftPh&h:%* |)RxPj uh&k*X;|t xD8t|xthx- H 1tf -yhx-j * Y^x-Px- Sh?j@uDE &E,:%e[^])jXZu Ee[^])"e[^]UVSjh%ZYuh%hj|#)[^"VP'ZY@u Vh:%(ZYS-Xe[^]UWVSPu~ % tVXtpE&%Et%`u VYE%@u$t+`u#V+Zu}V+Xt%e[^_]UWVSE48ځ` u %t8tf% tWYt ߉%@ tWS+Zt 翉%` t떁1u ځ u@\e[^_]US];(%P6(jj"&jj&4]UVSS]4@tp%@uft0t0VY%t1҃w`&R Vh:%&SvSZ%tw4`&Vh:%W&[^8%th;%e&jN Shj4u^%@tTS,-1ɉMjEP,@u h$&"&Z,#ǃ,Xe[^]UVS]h{"&48с^t:t0t~ u h:%VwYXvj\XZe[^] @48]e[^]6UWVSD]u Ctt,PCQPhj@EP耖@uh &E%EYE{ VEPW3buVWh(;%$ {EtSj@VCxP VWh:;%$3'`U D@RWP_Cx3_UXZe[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3^UM   t*;xMu;0tQhR;%#11҉[Y^{ tHEU  Ѓ t3 Z@uh&#Xe[^_]UWV։ϋD@WVXZe^_]UWVS]%t S &_u Sh{;%"Y[ % ڋFEj EPju{ }PWh;%"M1҉1;,sYk(jQMu, Mt5j EPjQ?PMAPuh;%#" MQ~G럋 Su3Z@uC Ph;%*"Y_ t{ uSC2%ZtSxdX{ tS8_t>{ u8u %҃RS耡ZY@uC Ph;%!Y_t { uSmZt]e[^_]e[^_]UWVS(]} uS$ESẺ{Ls$S$ ({ }u }s uJS蛣Yt?Vh;% S~SdS认j3XoE ;%]e[^_]nVh<%f h:%SX11҉ 9C$u/S#Z@%豳 8E&e[^_]G jjSn"SH#@uz 8t h& _1EE A]e[^_]2"}{ tC uPh<%Ph4<%Y^{PtRStCQEЍ}ԉƉщUStCtZU9uPEPu) t{ t911҉{ t411ɉh+#SS.ES6]e[^_]e[^_]US]C Pt$ZYts$sLP ]]n UWVS];1{Ly)tC$tjjS 14%tutEC$u?tS!Y@u h&xZjjAS @u h&]X]e[^_]US]C][]3UWVS ׉΋U K 9}!E4UQMo YZMUtB;u t9{ ;u u{ t|EUhI<%S_jjM%tuuS %tS虞ZSKSX+9t'C jjM$S [e[^_]UWVSS] 84%@tjE1҃ t6HjEP,S @hD&h":%_tm>hn%h<%he<%@t+XRDAtxUhU<%h^<%he<% UhU<%hu<%he<% 1Uh}<%h<%he<%p 11h<%h<%he<%Kt [h<%h<%he<%<J@ulh<%?Y_jjja KPh<%3<4u544%u dW4XZe[^_]USS]E uPh&h:% jEP,茷 uh&j4YuZ8t$h&h<%vj,,<ǃ, _w$jPh&h=%j6U8tu h:=%mYuSRXZ]US]E U{ u)C щ‰ { t][]~[]UWVS ]]} utSEtXZu 蚬 w{ tC PhO=%f=%^_CStP }tQSSh[1pEPjEPu Euh&YASuxXZu ~ WEtKYXt3{ tC Pho=%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh=%11ɉtY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu ؍e[^_]UWVS]DžPPhhC @uhl&h=%)1XZh=%%Y^1hPF1׃ u Vh=%XZu 87t 8 tt Vh=%^_\XPS+ǃuhl&r[ttlHp VW ZYu VjS ϋFVt=PVF PtZYt%VhHjj 7u7W1FtPV2VP~ t11ɉ3Vh6WtPtStPS| e[^_]US]E ftPh(&h:%a S躡Z@uD臨 87u ]]q 8 tg 8Vt] 8tE(&]]UWVSD}U uMtNˉUMPV ZYUtOMv_ 7 }E X&Eo"e[^_]G(1f9u2W>G(1f9uW>uxG(f9t& tʉUQPG Ph=%UfW(W>8uHUPVG*P  Utn uG>j u G>T tGj%qj%O _>t G*ˉe[^_]UWVS,}E EЋEE܋EE؋hi>%S跘 ^ZuEE s>%+hz>%S薘 ZYu,EЋ@0S~ ^@E] EЉEe[^_]h>%SY ZYEh>%SA [^u EЃHo1E9}E4 Y\FSEZE1ҋE9}?E؋ UQMޕ Ɖ$MQu )KEƍ@E UB 뺋E@uh>%u01P-E 1E111EEM̍EPh&h>%uuvMtvkt@(NtT4tW6uE븃UuM@몃ptxtnu딃M뎁M녁MyoEcP-E%@4@E܉E1E11ut0tX~ tMڍN U9U~!E4UQMt ZYtUBM9]uuVju EvjEPEp p uot0tR~ uvڍN U9U~!E4UQM ZYtUBM9]uuVu:u @u414E@t} UE%  9]u%}uUMhjQt8EE̅x ލW u9u~E4RU ZYt FUEЉUԋEU E Uԃ}t}t}u}tM 1҉EЋUԉ/tP9]u>t9[E4tY[tEX]9][tSu؋M܉^XZ9e[^_]UWVS] U1{>tNf}fC(ffGfJuj ȋuFZK>s*S>+Ee[^_]UWVSu} lhfF%hPVZà t1=whlehfF%hhzF% < 8thfF%hUW$ XZhh[u h&r huPhY1l>u?G PhF%( tXZ{>u[C PhF% XZ1hDPWhohnRPhnR7 =nwHƄn ƄoPRhhfF%V@u-h&hF%~ YXhtjWhà phthF%/ Xϋpe[^_]á4tU4P4U4]UE@]UWVS]u }uh G%h&hG}t}uh\G%h&hHh.G% tu "t 9ptIC ujYuTHtAJHt6BXCpf@up MH1҉PfxCM1 K뽉Cȍe[^_]UEM uh G%h&hh.G% u 9 t 9Jt BH@MUWVSM Ep}y1yy9s)}_+Yy tʚ;1Ƀ}t}[^_]UWVS$Ǎ]SjbG EPGPShEUЋG uʚ;)U܃tHPU1ɉM؋]9ڋ]]s 1҉P1 ])ډPX )9s tJPMىH 봃ue[^_]UWVSU} uh G%h&huhyG%h&hh.G%d }ʚ;vhG%h&h܉É΋P t9zuM9Ju JuK$݋S(tJtHK,JjqYtcUUrEB zEBEBC t&H9r 9ux 9}sHJP1C$BS$1e[^_]UWVS]U Eu}xx xʚ;v蠛 [^_]É}u M[^_]USEU M]]]] 1ۉ][]nUVS]u E1MMMM i@BU[^]4UWVSUuuh G%h&h|h.G%谔 B 1ۅtI} t} 9xu5}9xu-t9pu$xtyz$x18z,xB,C볉؍e[^_]UEuh G%h&hh.G%1 U PH@LUEuh G%h&hh.G% @L11UEuh G%h&hh.G%ӓ U P0UP4UP8UP<1UWVS(]}1EO1E@uh G%h&hYh.G%t 1҉ỦUЉUԉU1;s4s,C0 I>v 蔙  DFu EPj* @u11EEEE1;s4sjEPC049 @tF1e[^_]USjPjr[ZtÍ@PjB ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tg>U t9FuV9u@uEFtB.NtH C1҉KNt RKXVXs@1s@sDCMYC t6HtJKHPڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]NUWVS]uCh G%h&hh.G%% 4t,4H44C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t0zLu%1t]UWVS\u~>u $ Vv 7EEEE1]Mu EMQUE UJHOuԊEEjPS PF PhG%F>PSVk}(u V*N>׉e[^_]USEtSjS[ ]UE t E]& ]USEtSS[XZ]UVSEu Ʊ9tt ut1t 1@1[^]UWVS}] ?jWS s jWV wmj:VW ZYDžt?EPjhjjj jGPm C8 }tO UC8jVCP0-  DJu <:tFu}Wjhjjj EPVl C0E t/it.u#Wjhjjj j@PSl C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WPr ZYt[u{9 1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPnjURWPVsu juG(C*WtE4%@u1t(SrZ@uhLH%AS SwC@SzvfCDCCHSu @t CPCHC pSHuCL1s@CX_XnƅRe[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[% ؃4[^_]O US]S_qZ@u:jhj @tjhj @؋]UVS t=΁u$B Ƅ Ӄt ӁtӃuӃ uӁu [^]UWVSljQ5 ZuhX&LÉEhf3#EPV ZYtfP XuhX&S[_LUj@PV UuhX&SUR q7SXe[^_]UWVSSƉϋ]jhXH%RUFt UuA}H} L @ð`jh\H%Rs u>MP} Tð0M@} DKS0CPp}7uMU E$e[^_]UWVS EӅt΀9uE1҉1j/Q?J Y_DžuuV諀 _ZumVhcH%2@EEPjj jjj ju$` }tuhzH%2Y[:t SPv[ZuuVE ZYt/1tE0Xe[^_]UWVSÉUQM)q YM<9"u"OAIQMjϫXZMt3t 9usÀ 7QS蘫Y[1҉U}u9tEtCE9KEp9ush4#Sj ZYudžEPjjjjjjS  }Sh I%ZJEPjhjjjjSW F }Sh*I%8%EPEPEPEPQEPEPEPMԉډ 8%CEPEPEPEPQEPEPEPMԉډ jSuuuuuQt ShFI%fjSuuuuuQujSuuuuuaQ볁111otq;tlj/Sy? Y_M̅tU@j/PX? _ZDžUuًE#ًE/*O1t1ۉEEEUEPjjjjjjS蛣 }}ShYI% )‰U썄jYu hvI%R9  T uhI%oj,S> _ZDžtxu ShI%V9u:K j@Yu h" t%Ɔ EPjhjjjjSS E, }t hI%_ )‰UčEPSs _ZHUu-t 7L U䉔) jWY ]̈ T <4t{4u  ;6t{6u @C빅EPjjjjjjS? }!ShI% ~LHL+j,S; _Zt S]c P U$U^YUSh J%RPT 1ɉW跺Y}Eu Ƈh5hN%Sd ^Zu ƇhhJ%Sd ZYu ƇhhX.$Sd Y^u ƇhSj\E^ZPl躶EZYuhl&^lSPpY[{u Ɔ 1kh"Sd _Zu Ɔ Nh%Sc ZYu Ɔ  1hJ%Sc Y_th$J%Sc _Zu Ɔ Sh,J%pt$ jٺ@[u hCJ%1 EEEU | m^O@8%'EPEPEPEPQEPEPEPMԉډ jSuuuuuJjSuuuuujJjSu8%EPEPEPEPQEPEPEPMԉډ jSuuuuuILjSuuuuuI*jSuuuuuIjSu,^j=S8 ZYu hLJ%@Ej hgJ%S` up}u11҃uM#EEEUIj hsJ%S7` u}u:1ۉjhJ%S ` u0}u 1ɉM1jhJ%S_ t@jhJ%S_ t,jhJ%S_ tjhJ%S_ }u'jP%XZWEEąuhJ%OE@MEM̍UE@u E "M1ҍE@tE WB#XEPRU2EPU̍BP2EPU̍B8P1WURP%$1ɉjhJ%Su^ }u'jP$Y[BM1ҍE@EW{"Z61ɉMURPEK1URE̍PR;1EPE̍P8R+1WEPPH$$1ɉjhJ%S] tjhJ%S] uB}EPjjjjDjju~ }`uhJ%j hJ%SA] }uߋEj/u/4 _ZDžtSuj} Hu_Suj} HuOƆEPjhjjjjGPȘ }t uhJ%uhK%11Ƀ}^ٍUE`j/S\3 Y[uEjP  JM JM ٍUEsj/S2 _ZuEj P  J M J M \ETPT'E߉EEUEEEU  %EEEU Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ Ɓ DžtG1ҍEj@P   JM ^Åu  8%t EPEPEPEPQEPEPEPMԉډ jSƐVuuuuA" g 8Sh3K% q $LS $Y[ hl&> 4%tu hK%fF@u Sh\K%  s d X @I : + uhlK%V EEẺUЋ4%t%E̋UЉ1tt hK%E̋UЀPt @_t1j/S. _ZDžtGڍEY@uShK% 1,E̊EE19M k(Pu*t,Uf9Pu#U8uU8PuU8Pu U8P A밁  K  @ED1HEL PETXE\EċE18E1҉uZ }tEHM Eą hK% EH$MH(MąuhK%}tdƅu Sh L%r EPjjjjjjS }t ShL%C FÅtMh-L%k1uLƅtFj:S, ZYt8URjhjjjj@PxE 1}̃}t'h{t8@,9tt(MMċJ]ĉ k,1CC C$C(S_YE{ECs Cǃ}t uO ZEủ)1 E}t5E- }t }EEHh@M%`" S?^ud}ShZM%@dMA2Džt @he%SO ZYUĉMȅt"he%SO ZYth%SO ZYuEċU ẺUE%E̋EȉEЋE̋UЉhM%SEO ZYu\u hvM%30uQWj6o HRhM%PQWj o Hu؉߅ h%WN Y[thM%WN _Z@   jٺ[u hM% nbV@JEPjjjjjjS7 }ShM%tzEPjjjjjjS }ShM%QtEEPjjjjjjSʈ }ShM%PYuh N%XZjE@P(W i(,P,k4EfFFE̅tHEEFEFEFF}u!1}F1uFj/W" Y[Åt/uWjl HtJWhK%1}_X/uWjsl HtWhK%}̉XZuf~jCEPjjxjjjjS^F }CShJ%FY[-e[^_]UWVSEu} EEEE1ۉE싀&tM܉UVPK ZYUMtCnuFE샸&uu u EY#DEEEE} &EEe[^_]E8%uu EFI%e[^_]e[^_]UWVS]}1P-} t]%E苃%`E?EPh&RuuّtAjj5Lp7PًU E=ƒu$E8E%>%t>%뢺} t*%Ƌ䟉 u }쉳UaUЍe[^_]UWVSQEE] 1 t 8t R苟ZP肟X1t 8t R`XPWXEtu7jVu| -"$@%8tjjV4 txTuxTjP僻DtVr,DX@HXLtVE,LH蕞P_TtV,TPiXY\tV,\X=(2XZ]e[^_]!e[^_]UWVS0uhdj蜙ZYuh|&X9Áǀǀǀǀǀ@ `h8&P48Y_tt %t 4 4up4@4jjj? tP` 4 4Xjjj tP_ 4 4!D_ 4 4ЃhF+P P2 =v1 1ɉ} !8%j,jݗ@_Zu h&!Y ǃDj,j豗H_Zu h&Y ǃLj,j腗P_Zu h&Y ǃThh&Wc =vh&h,N%XZPPZYh-#P& Y_t u-PP1҉xWYC ZD9t t ux\tH@ߋ@D1@DHLPT1HLPTXh\l1X\hP0V*9u0h&ho" ut=w@ƄS0V 91 1} 11PP}YZh-#P$ ZYt u t:RyA YD9t֊ t uʀx\tH@߅tC%䟉1h8$B YZ} uj`@Pd u>ju P& d` Zuh&_G`hI%PB ZYu;}uP)B Y_$h#A YZuA}uPA _ZutDž}tuhHN%A ZYtOPPًU mDžY1ɉLu}tSVN XZ1+u؍e[^_]UE E9r9]UU19U t]UWVSǃEE1fUfQMKZUu8؋Msۍ;ƸE9EsOƋE)Ɖr=89s "@G19r)SEЉ‹E9s )։1e[^_]UWVSSU uJTuhP%h&h~TuhQ%h&hhP%HG YLGL9t)cCu)U QM<W<ZY8ËMU t u7F|B|u t  tAH+GHu9r9e[^_]UVSjjVà tSVJS訔 ۍe[^]UWVS8}1}عEX}ى‰+E pE؉U EPW_ZuUBtt U Btu VStZYe[^_]UE UU E]rUS]hH&P8h&ØS']US]S Y1t S Z]UWVSuh R%h&h hP%E Ɖ׉j<|QS CPZtS8j 2uhRR%h&h߃}uFƈPV XZt1SVIuhjR%j uV& ىSe[^]UWVS8uh(&]S褼hH&EP薼hH&}W舼u WVY8$th&hyR%_X14SVZYujEPjEPe[^_]SVZYt1xjjSà jSEPECT x t8hS_tC8PsTr<ZY@u hR%XXS;U t0C9t ;E SEP藻Y_ CT8ESPxXZC|twG|tڍEuEGT9CTuG8PC8PZYuЀ{Yu Cx9GxuCXPGXPZYuWu9W <Et(SPZYt`HT9KTu 8PC8PY_ 1ɉt8SEPSEP9t|B h&SXZ]PV&;_@uMB 8Vt hR%[jjWà jSW EC S9;U tSWCSEPu~CTt 48%u=t=ٺR%Sj2ZY@uxA 8tnA 8t h&XSY]';E ASV蓼SW蘺9t*A h&̭SXZjjuVà uUWVSSljӉMЙ1Ʌxtؙ)ѸFE)عy11X[^_]UEuhR%h&j;hR%/: Ptt Y@ /1UEuhR%h&jQhR%9 Ptt @ /1UUuhR%h&j}hR%9 Jttt8? /1)z 1zuz uzu 1zUEuhR%h&hhR%39 Pttt-c? / xjh&Pt 1UUuhR%h&hhR%8 B<t<tt>? /1z'1zuz uzu 1z1U幀U E]UWVSu] }uh%hx&h{uhR%hx&h|hR%(8 Fu#<u;FuFPhF$WS* @u612WSPFDPhÃVWSPFPmU Ã؍e[^_]UWVS}] uhR%hp&huhR%hp&hhR%{7 GS8t)R78s<t<t1&vvRS Q葳 e[^_]UWVS(uuhR%h&h$FE<t<FVU1TF1 G!)JO9t< B@t8t}19sF8}Єɹy$At}!u}@]9s 8t1sb< /^1ۀ=4uV}ع1E׈E4S}W=WV&thS%h&h'hR%5 4؍e[^_]UVS]C<t<t; /g S؉U Y=4t154S6Z;E th S%h&hnhR%(5 4Ǎe[^]UEU uhR%hd&huh.%hd&hhR%4 fPUWVEu uhR%hX&huh.%hX&hhR%4 fe^_]US&tPh:S% XZ]UWVSD1}]St4Z@j0Sh51uuuu}WS51;5@&s/D&H>v <:  DF1;58&s/<&H>v :  DFWS59 1҉u uSjE0EPƃ S 4YEt 9 0e[^_]UVSuEPu V uVj ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWhBS%Vu 1Íe[^_]UWVSU} u19s$@u9s8uhHS%h<&hC؀xthS%h<&hh\S%~2 u1X9s%UjKQP t؋UGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`PoXZ- `S X4%@t _t^Fhv#軥YuS%PhS%S @ PhS%S @uWhS%S @dlhhS%Wj) YZu@htDžphxDjVYZuGDžphS%W) YZW ' Z|6hS%W( ZYuDžph:%W( ZYh+#W( ZYh:%W( ZYh;%W( ZYhr"W~( ZYhf=%Wi( ZYuh:%WT( ZYpDžp Džp_t@F PhS%SY @pL&tPhS%S2 @84t pNdX؍#tT%Rh T%S @VL%t e$Ju1<%PhT%S @ZvHh'T%S @BFPPh3T%Sq @(v$hAT%SY @VPhLT%S=@~Pt?vtFQPhhtR@ttRhUT%S @~xu=4%@J1h(&tPQtXY#FxPh_T%S @uRz u RuARTX,QXtP ZYX9TthjT%S ZY@jjtP諮ƒ ttqXjjP茮 X9u-BTX PhUW$S7 @XjR뛉Xh(%hUW$S  @Xu^jPSjR @Dh:%W3% ZYu-dXT%؍#hS%W$ ZYh:%W$ ZYh+#W$ ZYhr"W$ ZYh:%W$ ZYth;%W$ Y_twpulelxOpu VZ;puh/hxDpjVnY_؍#T%؍#Ph{T%S9 @WhT%S# @VIuZ%u6u_%u*PhT%S @ut:u%uߞ@t>(WtY%uPhT%S @ubhT%S_Z@Npubll@lq PVh)%ST@d)%h@pt!pNVh^%S 1huvh@Lt㋍hqPPVh)%SL"@urpt)ptptVS*ZYpujlt l@u1d lqPVh^%SS@d^%QNppuA 8tV _yhpHpDVh^%SZ!@WpCPhUW$S @tXd 0uS SY^u h0&賛Z#_tFP`P u,h0&胛X_Džp؍e[^_]UVSË2;tPSe e[^]UWVSQ} utu=GL:%t +#Htr"}tE1@ۅt"a1ۃuZ xut@xt:HHu 1HH}tE-@uCt WfZt!CE}tS%EE@t]jW[^t WYuu"Ep}tS%Eƃuًt 8u1W Zt^}t8EgÃuˉ؍e[^_]UVS]u tPހ~t9, :jhT%S& uS1 S \ZY9rhx-= X1e[^]UWVSEE} u |Uƃuh&Y[jhT%W uu Ee[^_]E1҉UWPE PhT%5EPFƃuuh&ho"x jEPV6 @u + 8th&hH#=1ɉM^_Euƒut%hxD%hU%WVF `PPShs>%hxD%hU%WV u.P9r)ǍGPCP$ZYtۍP9r:)e[^_]UWVS EPf EE[tF  >SP ZY} -];уM I+ѻ}hf3#EP ZY;tjh\H%S ujhXH%Sy uu1;}1u1;} uJul$ [EPjjjjjjS5R }tG,9uSv  ZYEPjjjjjjSQ }u9G,nFulT$ d!ukX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9!1E؉EErE,@x B# VuQ9uu+# "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms " 7뎉ߋM_.MIE)M܋E9,}v}" M}}9]ttC }Ut;]tC } t}E[^_]UWVS u }EEE]1EE9EEEPs2&&Csy7Ku-y)‹ 0-DAt/rumr^s ‹ 0-DA@tZ! t\tFx+B 0-DAt/t U ! Uu=k t#w 7f\\Ev\0C0C0SEttNCEqt(tsExu EE [^_]UWVSÉ׉U.ƍPSWrYZ@WhUW$S @}uSj= _Z@u$p h"S| @u@ s=Vu hV}^P~n sVu S?> _ s Vu SD=  u V* t.Vu PhV@VhUW$S?sh#S,ZYsE1D0t<0u FuM )tSP Y_@u|u } 9K;} u@tPh)%Sj ` ^Z@u3tPh#S @G루tffPh)%t&ffPh#S @c t Ph)%@tPh#Sk t%7sPhUW$SO @sWj.VWj4 tcVhUW$S @tQ?tGV%EPg @u1ɉMQRhBS%EPG ރ}s1;{ U؉E@uW63h&uhFV%(}u/}u F OW63h&uhrV%蝇0FuDv s YZuuuPUEf@uW63h&uhV%8UU)UG,B{(}{$1;s(sUEk,D t'EPjjjEPjűEЋEt1҉PF‹M9tCB,E;S(rEE)E؍EPuuЍEPEPEPűEЉǃt:s$1F t Mu뮉UPWuQuuuu UuOa h&;Xe[^_]UWVS]1ɉK{1;s s WF,Z{$1;s(s WF,Xe[^_]UE UMMU E]DUSE UM]]MU E[]DUE UU E]DUE E]I UVShVu;D =tu11ƄVjCXZtSWU YtVPcCXZ؍e[^]UWVSÉЍ4 1ɉt19rM -}tJz}1҉A u1[^_]UWVuhV%h'hօuhV%h'hhV%  xuxuP uf@ e^_]UWVS É։ Et A@E}xE)ȉE9|s'UWt[ZYtnt|UzuvRUY^U苃xt lj}t21MExzt1 jRӎXZȍe[^_]UWVSu  É֊B<t<<BfBt&U׉DRtۈY^Rt:S>uUWVC*P_ U[҃VSWm_Zu VSm[^tRXZRYtPt蕉rVS苌_Zu VSZYtX /1  ؍e[^_]UWVS(E̋A tӉ΀ytuq xVx}WY@$1FCt}ЉF tCUfCF t#UԀzu ztK|@FtC8F t CXUF0CxFftPEtq_ZF tU tUԋECTt14~t  h%Et܆CTZYuՃe[^_]UWVS8t F1Dž@jB UPP8vfDž ˉhPhiUp UJ>r*hPhip ,؍e[^_]UVS1ƅ@ CtDžC8P^CPƋƒYu9)Zu)CT@fCXP5_u tЃtЀC| t Cxt(1ɉ,uCT1fDž @fp׉މ;tHH tut󥃅 T upVXZtHHt'CstHHt󥃅  t'CXsXtHH)fSP @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP&X@OHuWiSY1CPWPXZ$jjVSjLPW@uu 8 넋H؉@D@9DDx9@s, DD9@r׉F u]dETuGuSXu h'wX?$RuSU ^_u1XZ]]o@UVSË%tJC><vBD&FTttT9t0t&NT9JTuu s< 뻋@À{>v P ShW%Wc e[^]UWVSÉ։h,j9ZYt:PǀcScufǀ,1e[^_]UWVS0ÉRi^@u PhX%qbY[.Gw*hH PhX%Bb %th, Pj8XZt@dtVWv<u?(9x u1Wt cScuGhu @F @(GH>A<wO*󤋅% t&x utmtdf@ tStJSj*jPS*V9Ѻrf‹fP@TȋG,CD7LJcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$tQ~DcScuHu ~<u|t2<t&)ڃ*f@6Vt4L7Pu"uJƃv9C,m@1;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃f9 ffC tHGY u<)9dCM A 󤋵 \ tC)9C= A󤋵 \tIt @W uD@Wt"@W uv tD)9UC< A 󤋽 \ttRC4%u+@t@Zu)؃fPhP ƃ tt)߅tPjVPYY9qQS  C{fCWVY^g0Q COt/t+V Z@)9 CKt tRG%t4@^u()؃ftC uO t>P)9rNC A 󤋵 \C))=+w/D@ PhaX%^XE3 e[^_]UVS~\jh_PF\ uFH 8u!5L-hzX%WY[ Sh'ho"W 1ShjpK@uh'h,:%WXZ1e[^]UWVSE}uhX%h'hhX%] Ӊ΋S IuN EEE싐%tZt Cts mjSu@ u3@C CXJP S@p@P& Z J(H J>r*󤋅uK%t9 t/hQQ@PiPB PhX%8B>u1DhQPB*P/P RhX%Rh 'GSXe[^_]UWVS$Ɖ1iu1hX%Rf.-Xfth$SPà 1GiPV RhY%ZRh$SP6Ãu 8t8iW Vho"R!w h' VhY%R 1`64%@u"j5S,Y^@uƅS$Zu h' RX뢍lj󤋅e[^_]UWVSS]Sj8^_t]u1ƀ8tCP<$Ztlje[^_]UWVS$ϋEE Eh1Y%R ZYu}]ƅP $#Xۋuh4'QYuQVhRSV+<@t-PPm XZuE4'e[^_]P1j6j4a@uƅw x, "j@,Ph@hW;u&WPh "WPh "SVhFY%N$v "t$u)軆PWVhYY%yN(蒆PWSVh6Y%ON ]e[^_]F*UWVS] 'tPh0# XZE1E;s31;Et k, 9t@v 6hfY%` PV膹G,1;uts 3hfY%: PS`F,܍e[^_]UWVSEvpE E] P1}tEu蔅SPhQ%um @tBE^PqPhn%uK @t E9sT;] us< v!i Juj } ZY@u؍CT9Ub0 "ujG ZY@te[^_]UWVS]u }~EHt t4PWhV+@uxVhUW$S Ut" QSj ZY@tǃ7XPhUW$S4 @tE)uSj [^@uL 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hpuԋ@E܋E E@_tE@o^'EPjyMԋU܋E 5^XtE5!#,EPhMԋU܋E Y[EnY%EU1҉Uw|MUu X1E}UċM1uGEEPSuEPCPhEPC8P[Suɖ tEE99w< v YЍBEȉD9EMa "1E )уȉEU@t~TCtE@Tt 1ɉMEPj!MԋU܋E XZt؋Euэ<1E9ECEtu :Xu EEU9t M;At;A u1EEIʸy,%=tс1utȉE@uFtEPV֡EPFPɡEPF8P輡Vu* ]E@PEPjMԋU܋E Y^u1҉UU9u XEEPW/EPGP"EPG8PWu胔 ]뤋E؋E%u3E @hu$uЋE PhrY%iHE؁ Ee[^_]UWVS(}ƅj4uM{Y[@uƅEXuX uExlSxPu hY%u@ujuMH^Z@t'a1Pu hY%u誡@u-S1PPu hY%u@ujuMZY@t,E#pV~Pu hY%u:@@ ؉P~Pu hY%u@ut Ex,u@GhElPhhS@Su hY%u趠$@ut 1;j@E,Ph@hSSu hZ%uf$@up;s VgC,X鋇@1ۋ;Ds V>C,Xh1ۋ;ls VC,X鋀1@D;Ή⋍T1P1ҋ9tk,;BፕRPMU[XtxG SVhPu u7裼 8}u@v;WP诱ZYt*SVRhPu u7X ,1;Dsp⋍TPuARPMUZYt&PhG Pu u7л F,낸e[^_]USEtE.1CL[]UWVSujh0juR t)Ej}WjhPp@u SX\jWjjSfp@tjWh@hSMp@tȍU1EfEDtEjRSf @t؍e[^_]UWVSWÉU8!4%uFtNI9HUu tt` FdPF`^uhx'CY؍e[^_]Sh!jP6@uhx'h,:%BXZe[^_]W|$wUWVS?E苷EF$E1FH~ t)vFFFF F FFF1ۉ^ ^XNvUE䋀_ ƒYt=Ep+Ev$_yURPShZ%AF0FH8Z%%t$v$&yPSh?Z%AF0FH\Z%7~@tFHcZ%F0u*F8F4v$xPShkZ%iAdwjShZ%{AF0 V8F0u0E1Em %}fE fEm}mE؉F8A9r=E1Em %}fE fEm}mE؉F8PShZ%@ V4F0u0E1Em %}fE fEm}mE؉F4B9V8s=E1Em %}fE fEm}mE؉F4PShZ%}@ F0E؃>u,Vdt%F$;BuFhuPwuPSh&[%?v$ywuPSh&[%@E苀4E%t*FHS%hS%WҦjE8~HuJFt.Fhu(VJ9Hu~<t>t FHa%FHC[%>u FHJ[%FHQ[%~0uF8F4bWhv4jEP7Wh`v8jE77(Whv0jE7v8v4ShW[%>$E䋀~@uH%u>ViRUSh[%>vvhUR7 @Uu Rh[%>Y[^hE䋀t=W[2Zu[E苀8E%t]h;%_>jEE7 >vHW>72juWt(tFdFhӉe[^_]g_e[^_]g_UWVSPuE EtuVjj96(tl%ub  CiP63V@ t;{t5{<t/s$tPF Ph[%\=1ɺVjj51s p1C Cs`CCCC 1CCECHt V0Y1ɉKdChuVΣXZs1CC C$Zue[^_]^e[^_]W|$wUWVStEUM]EEu\Pd?_EPT%[%u'Ht :tRQE Ph[%;1ۉ]EPLt @v@}GLih Eu>ZYEE1}m5%EPT%[%u'Ht :tSS$RQE Ph[%+;MUEE@iEEE@ht 1ɉMExdtj$PuP% t؋E@$EtˋE@EPWS u{4%t ShH]%5[^jWS t jP&ZYF MmFuWS uho]%h\'h hX%  FdH PF )Ft'N V$vX]e[^_]e[^_]ËJh1ɺBUWVSËN t9At E9F$E;2UkPC Phz]%4FiP3EUu~@u kUjRS EtjPn%XZESjj,E%tBFH:%h:%S48%Y^ u-j,XZShjj+Ee[^_]UWVS(Ë4%Sjj+V BuB EjEPS u2N }vuu܍EPEPWS%BPt3t P)#u[jP Sh]%2SAXe[^_]UVSËu<wPh*PBP 5 uhx  X\`\u TT1ҋTX#DT9 tj`9r7-bPh Ph_% \X`#D`9  `T9`rj5dohYZ@u ƅo4\`%th Ph^%)XZn o`< uBHvWdVh^%WdVh^%`  uWdVh^%uWdVh^%1CLDžXXX\Dpt;jXdhZYtWdVh_%.XXuDžX`m\@6@t:j6dth-ZY@uWdVh _%WdVh1Y%!dhƃ tPh Ph_%~(V; h4%u$h_%hCiPh0订hhsPjhCPu CP+WdVh_%;C@FC$CD1C<wPC*PEP) u%C PF PhQ`%~uMU[뚍e[^_]UWVS8EE] }uPYt99s&}E EE P'Et`%e[^_])WPS W nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉgfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMк EUfҋEftu`UPE Ph`%<(fEfu)T3EPE Xe[^_]UWVS$}E ^\ftPh'h:% cCubh$RS u#>t=G Ph'ho"xWsPRWt^\ue[^_]UWVSE 0xjPu* uE$'e[^_]ËOwv&TPw Sh`%<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhh'h:% t @`jVPo u hh'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuVXt,swsos g \SVtttt:uj@苃t$Pǃ tPǃY1Ze[^]W|$wUWVS tu}P.YUK>vuu{(Ofu  tu%ue[^_]g_h[ ƉE1Em5%RR$C Ph`%ShL Vjg(e[^_]g_UVS]ShL jot~ht j3gXZe[^]UWVS E} wLBuB9{d4G PuF Ph`%VR1Cdh:%V|V GunC t{@;GusPOPF Pha%%t VXE@hu5jZt9^duFh1Fd뮉e[^_]UVPuu,jy^uEhP' YE1҉@uUWVS]} SE^uh@' %t Et09Pt jPoXZjWSk ƅu&j4Xt^FFF`EF EFE0pE79DN }WPhQ%jQM+ E0D #C$Mt1"PWQ Sh/b%Y Vj豕@u, 8th@'hNb% Y[FtVZ1Ft1E@F0Epe[^_]UWVSQ]tdue%u=t-htGdt jPXZj3ZY^wHSr j3xZXZ1GdEw$jVS t'W(9P uW,9Pu PC Ph`b%: 5w8w0G,PG(PVSu О 8t둋AhAdjVSh ƅu Shb%d ]}tEW$9Pt jP(YXwdGhj3YXZ?uwHSq3 e[^_]UEt tH]UWVS]E EEU}uM MM$MM(Mutu |RPCEZYhPaXu趝 KUjWuR Ã}Ut} tuMUj4XۋUuE0'e[^_] ECCC 1ɉK BCZ;C t/C 67@VPhQ%jC P~ }t EC1CECcHwnEE] Ee[^_]CtNt;C uCECKtHJSHwuSjà ]e[^_]e[^_]UWVSut=t7;Ct+a& PjCPC PSF PtjR$ōe[^_]USEt6t,ttHJHPX]]y]UWU@Euu) Y_}UWVSQƉ uXӸH'ljU@'9r 9EsҸX'ljUP'~9M9 uZ[^_]UWVShPLufJ}xv #htAEH@‹EEhЍHdfhdZhb%hPh虁Ëh U 8th'hb%XZh?w8j@Zh_uh'^Lhǀ@h @uhSh/S҉ =wPƄ ƄPPhhb%hV@u$h'hb%h1҉Y[hCjydwZXETE`\fu `\\@)ЉDʘ 7RP*RuM UuU]UWSU v蘕 11}}u1'M[_]UWVSUt΀yv ; u1y tËAdr@t$tt @$u@hb%X؋U-ÅtF PSYFP}WWCPYFd@t KthX( u} WC8PY_XC9@VCXPjYZY؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PV;LXZ?1e[^_]UWVSQEp1҃t<t 19sDB]۹yAt}u1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}EEEHfw EHfvm Ef9EEEM) u k@w ¸ w w w ?w xK9~%Ȓ "}u1EEf}tdf}@~9f}? t1҉EUE) t1$t@E) t1u}11ErEUEa ׋UM U MEREC1[^_]UWVS}E uuGd((*1ۃ t%jPG@P ut #wdۉ؍e[^_]UWVSu }WVuw)WVu(pttSHIH9JHs؍e[^_]UVS]CtPV SjjV]e[^]UWVSuFhPF Ph.c%EVj@u3 81t)踐 8t讐 8t褐 8t h'GXF@t>jVC@P ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjSu'ƒ ujjS0n ]UWVS} uEtMtGu{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVSu 1ۉ]]]EdߋGdEuu;tGu}묋WtSWuJMQ1ɉ uHJt6GuCu;W_IuWYUOuUJOUjW@R06 t)G9Au!%uFEPQXZ8MWG E1҉UE܃YtMuW Xe[^_]UWVS} Et0t[uvtCPEP_ZY@t/C@3#Eu%CD3G#EuCH3G#EuCL3G #Eu붉e[^_]UVSEt0t.ttju CPP t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j|Zuh'YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZfECCdUSǃt_{ u Pu uƍS@ C t@sdKQPuR@u{ s{ u @t{ u j.EPC G{@u RURY^@s@t~{ 1UĊ  L @uj.EPC@Pj tJSRPhQ%j.ChPQh jC@Pu t @`C`KdK`C`uKd h'SXZ1ۉ؍e[^_]UWVS EEE EEU}uM M܋M$MM(M؅uE苀t2RP9EY[EujZEԋEt?jWC@P u(EC`}}StP뽃}}WSjVWueP|@u 1C$C {4s(EC`1E@CEX}CPt Nju h(CdEt CdtS` ttSX{@t4E胠4uSuu!uSuu}uLSYMCAe[^_]UUjPR 1t!hRu hd%uItUE1҅t%tHd((uH`ۉ]UVS]u!uu1҃jPS, t8Hu@`tFP^jRPStk1ɉJHB1Hd@ @$ǀ99jPj3y=uhS%SUXZЍe[^]UWVS]C$t1jjSP u苃%uuS6^u묉%u^f{(uGC>Pu<{*Vh('W tVh 'W u ` P VEuU1Ejj@VSHƃ@$@ 1ɉMH P@%t<u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLV5 V8FHtV FHE88V 1ZMjG@PRU U܋Mt?uRG`t%tEGhPG Phd%+VC sj.FhPRjǖ 1E@F0EpjV@e[^_]UWVS]} FtHtJN HPZڅt0jjjVtEE Ee[^_]9jjjVVd1Sjjq$e[^_]US]-XE]UWVSQEvI~ E 81ۅEjG@PE@P? tGd(1E@`G`}u!GdtGhPuG Ph5d%bG` ttGd uCtWZOd }u/GdOdt OtHU JOWX}3u1ۉ؍e[^_]UWVSQu E@EhE@PE Pu[ǀMU@4uUr4{(s41ҋECEH$Q+B9sȉC$}O : v: K vu9F s| SEZ11BCZ؍e[^_]UVSÉփhPC PhSd%VSt VPZY h'Xe[^]US ]Sj&ڋEXZ]UWVS Et_uVj%XZ؅tt8;Cdt,w PjCPPCP@SF PtjR $če[^_]UWVSEttBu[0tFd%=u1҉vt Pu 0Y_6ϋEu@EtE #1B*Et E @ tt^tTCƅtDGPEPj9WRV =EPFP_t @ FUMvj±ZYUt0Mt&@}wFH r*NjM;jC 1CUe[^_]W|$wUWVS %ue[^_]g_h% ƉE1Em5%RR$C Phe%ShaVj1(e[^_]g_UU t,t9PuƀRhBhjjUUу1t3wt-tRh'he% UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`PEF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS<1ۉ]]]E1u1EEE9CEׄCdKTMЅtYURQP谘 t t0u5CPE Phf%1ɉKd EEt9sEsxF URV4RP> t tlVdtRNh3S%t$QPF Ph+f%zVja@uj 81tj 8t h'dZ1F$F fdEt9sE6NEtXMPF$Pv莗 t t1F0PC Ph=f% NtHVujuPECPEЋCL }ffMM9Msi KMɉMM̃щu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u%}uƃEă}v1ɺ1]/tuhdWjEa}t?E PhRf%aEESjE0#hS%u<e[^_]UUt&t9PutƀU]\]UWVS}u1-0t9~t6^xtuu S0 u؍e[^_]UVSEu1(0t^xtuu S u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EEP 1ZYtU9pu 1ɺPGEttu4@t$Pqǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`u @tײy1҉[]UWVS@EPjE _X1EE 9CEuh}f%j uVG CPVhf%u+ @ursXsTVhf%u+@tuuVhf%u+@tCtPVhf%u+@tC`PC`^E'+"uE5!#fC"t 5!#Au6$" u5!#a#@u5!#5!#y,]#uRWVQuVhf%u+ @&sdVhf%u+@ C1C;s WJF,Z拀H1C;Ls WJF,XCPECLE}EfE9Es d SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQhYPB PEPu2ZG UU)U-sx1t8Fd%u'~ t!GFhPWEPhf%u)@6ċ<e[^_]UVSu Ft%tF9CuuVCxPusݍe[^]UVS]Sjj1҅t#09XuƀلtKj3%Y^u=t hS%S5XZe[^]UWVS] 31<t0h>h%xNj 󥊅zp 0hli%>11Ҁ+u8B,CdtG{$tA1ɉڋ8u.ڋ8ChP0hi%s1s$ )t1ɉEP8Q )xdu+81҉EP8V2H4818EP8V2p*v>xdu"t0hi% *?)t49$8xdt⋅4t4^u0hi%~Y[+(뗋4t=4O8xPc4j40 8Y4jj468jj4 Z8@`y *t[j@t/*tJj4>^_@u80hj%虾Y[$*0hj% XZ4e[^_]UWVSp]U Dž 11DžDžDž0ftRh`'h:%Ͻ jWV4Z u h`'蕽YWSXZe[^_]US]jjS u"C PhZj%ShbS]É]]xUWVSPu} UUjWC P{ Utۀ8j%u %UPCPC Phj%hCjV UuDt&9tH9Kut倸u܃xdtCEe[^_]e[^_]US]ShbjPShaj; Sh_j#]ú@ 'Jt f9tUWVSEU MftEv0f9sN 1&f9u}tMf9)N [^_]UWVSEu} tRU w N 'fɋ] ] +39sdN "1?fҋu1҉]19tu692uA,t[^_]UWVS8EċEȸuѸЊURj uQЉƃuEfǀ<M GfEfwEă Phj%pY[f>ff}fuEfǀ<M 1҉1ЉЃEu.Ef}w 'Phj%j ]S(/ 1:BUP_XۋUuhd'̹XߋMDڸuf}f9<t >Mčq RVhj%P~S联Ef]f<L 18f}uVhj%߸}ȃlh(Y[Eċ4%tj˱XZE΍e[^_]UWVSSƋ1;,k(f{u{u4{u.{ t&{u&{ u {u{ue{u{tYCUhPCPVUt1ǀŦ Kf1ɉHGEe[^_]UWVShEwmK EdEEEE@|tXdÀuXdBEAE1ɉMM}qEf9UrZ9]s#J E Phk%蚷XZ0u<}])Ӎ{}ff}ftftfu f9s#J E Phk%1_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSPL UtGF΅uE4%@u+j EPjEP\tPE Ph3k%f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPtuSVPE PhTk%!(g1ủuEEPM1ҋEJE[tE2Eƀ>#f}uEȅWeEEEPjuWƃUЍ M))Ufw#H E Phxk%荵ZYEܹEȉEUʉU9s'H uuE Phk%.qEX|ۍEjPSs uCduCdcd{4u EC$U9S tKdS C E}}uuE Phk%耴 f}t2}O`MQ9rG`E̅tMqduV9rAdE}E؉E};aV}9GhUGhMjhPu~ǀŦEfEĉ{(u 1ECEEe[^_]UWVSljUMu w@ Phk%F 1҉u1ɋUYtF E1ɉKhKdK`ǃu uVj[XZƃ>VuMUZYuC;u}tG Phl%[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[]E 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύK G=DQwWF(1RPQh!l%讱~(WQh;l% EPjSuuAtBf}u;8σ G=DQwWF,1RPShUl%T~,WShol%ı e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@l%}tQuЋE؃ Phl%u18ujjE؋$EPj'$'8u ǃ8l%EPj s@s<Qtf}uʁXsXS`1CdChǃJ8u ǃ8l%8u ǃ8l%8u ǃ8l%8u ǃ8l%{`tts|C`t}t8sLCDCLCHCPCFd rFV t#tFhPF Phi%衬 1F$upFhPF Ph$m%説 Vd s"1F$F VjjF-NtHN rVXV蓮YHE؍p C`;u PVh>m%MuVhXm%,KdSh tRQPVhpm%uH)uVhm%u1 RVh\%ujE0XZ}uA}t;WVh[%聫sHsDhWE0& @u Wh[%ȫ_XE؋_|tACdƒ t ujC@Ps? tKd Cd uVhm% h8u"E0 E؋4u$}؋t%ujţY[XZ믍e[^_]g_W|$wUWVS,(h1Džh#fDžBDž<"#K8Qff@7 w ƅ< Bƅ<ƅ<0ƅ<ƅ<H 4u/ƅ<H8%t,Dž41HhPb 14 D8X@0fDž$118890HPT19tk,<>98tB9rIpr@uHtHu f$8,nt104tj i0\ZYHu" t\10fDž$H8% t#j@wPX(| @p|1(Hx@1NjDC buy(u4tƅ,18$|Dp<@D&v P PhW%) DP4B uVftP1ۉlp\r@,Ǎ\󥃅,f88fnFDFLVHVP1ɉNDNHt h:%SXZP3e SjjMw0%t11҉SY2~Dt hl%SRXZu ShWo%f1ZYe[^]US]?S Rho%PC ؋]US]C Pho%2XZ؋]US]?S Rho%Pސ ؋][US]Shj߉C Php%踑؋]US]?S Rhp%PcShj~1҉؋]UWVSƋu5hX%褐f.-XfthWP- 8PV RhY%^hWP6 Z4%@"PPR @ {TWjj} u +)CTSXWjKZY@KhtD1+9}F Ph]%*Y_DsDjbCD_Zu h'nY#Nj󤋅CH_1҉tjhj|P蠗P6 sDj1CDCH e[^_]UWVS] E1E;s31;Et k,9 t@v 6hEp%" PVHG,1;uts 3hEp% PS"F,܍e[^_]UE@|tPd(t1]USEu1X|tuu Sp u؋]UVSEt0t-uvX|tuu S( u1ۉ؍e[^]1UWVS} 7G@4j.DSFPj'8 4wShMp%y)}tE@<"jWu蜚< u h'iG8@Pj48PNj<% tj<01ɉ,0,;(⋍(tx}HlaDP< Phq%,<;8BPj48ƅ0tfBu0S@tWC<8uOBQjRPDt8fBu.08r$PDP< Phq%O48sunu StHuZ%uGjSƬY^u9ϋt# w~tn0ueeu1t1%thDjVYZ@(@,1҉P|P|10fǀ<fǀ?SjhPujjS襂u"C Phs%v~ShBS詉FSX:Ѝe[^]UEtQw]UM E]UWVS É։M苐t 48UMtSjjPfv u EU S贀Zt~8 1pp@1x xx$3@u Sh'ho"}:SY(h9s%SXZP3YXt jjV|P蛅t j3XZwLXGDGLWHWP1҉WDWHYt=t8E%Uu=t}uE3s%uStZYwLWw4WwPhs%t YX؃t w t u F17tA9MuuUM7Ph(% XZUM΃`Ѝe[^_]Uh-hs%HWjX 44t9W|$wUWVS41B41X-% 6f 6 s f4.s f4P s1f4f P4f 446 1s44 ut/44 44 4f41=p-Of44ff4f4=4tjV Eȣ4Eȣ4ZYp-X44684U1E4]5<4@4jh4456ƃ x9u h>n%f XVS54ht%  6Hujhl-j 44󥸄44 4u4󥺜445\-=`-u؉}mrqd-E؉ 44 44E44=ɚ;~ 44-ʚ;444 %we[^_]g_UWVS4ƉU)'ht% Y>^ ht% FfVRVRPWSPh u% j.]SFPj uj.h"Sk Sh,u%J j.SFPjh uj.h"Sdk S' F^(ZU)ڃ<,wJ<w1tR<CSPSPhlu%<+hDu%"<:tI<u%s ^ICPPhKu% CSPSPhu%3 'Phu%# ZYӋM9h" Xe[^_]UWVS@<WPPhu% 1ۍEPEPEPSWVoÃtjE<t!<tG<T@8Phy%P $ '<uT@<w*$ 'h9y%BhQy%;hzy%4h9$-h9$&Phy%,T@t <uhW<$hy%n^ Phy%X Y[THLhz%3 T@Z<t%w uh&z%<uhaz%h8z% _hLz%Phz% [^T@8Phz% THmhz%hz%hz%hz%hz%hre%hz%h{%vh{%lh-{%Zj.STPjd uj.h"S`T Sh6{% j.STPj. uj.h"S*T ShF{%hV{% hf3# T@f8fZYfw2$ 'hm{%h~{%h{%h{%hx%h{%}9Huh{%nh{%h{%O S1ɋHU t Sh1$h{%&uj.VSj, h{% [h{% hf3# T@fHfZYfw-$ 'hxx%!hm{%h~{%h{% h{%hx%~ X!6t-T@<m4 'h"Ph =$I ^_ 6 !6uhx-芿 [g v狝t݃{)!C2t!#t1 h{%3th|% C Yh|% C HC SRRPC Ph+|% HKǃxPhP|%f XZ h^|%X XCPhq|%H Y^19~gVHKYZuVhz|%# XZCj.RPj: uj.h"R0Q PVh|% F땋L 9؋44t9~"6 4t494 =4P UWVS]u#P6tP3^1ۉP6T6S T6@$ +P6Yu U1҉L650-t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSUtWB<:u1<2E 028uFut<@t*}:u<:t"u}:t;EuݍG1ɀ@t1ɉ[^_]UE-]USE] u:À|u%u@C8t9EsHt:t @|u1[]UWVS4}!}u[=P6tQu Wn[^u<5T6Pi)YtHWPD3XZh5)^1u? Dž)Etw}xjjju !jh@PSE xDž1ɉ1ދ9rqhQuƒ ?tuZ 0S0 0HЀ u%V1It 1:u4:ut75Dž\t&Dž t t11҉V9r)ډ)ށVSj,ZYu"S/^u[Ɖ‰,1i<#au SZYNFS;/XDž-K1j=hݴ%S Ɗt F:uFHX)ىMQRPu[Ë tK}t uXWt.^tCu F:^DžBDžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QWU*ZYu:W-Xt uXx- _<ljljƉlj )PVQ蹉 SR覉 ,Ymt u^)؍P9s&PS:)ZYuS, XË Dže[^_]UPjujM UEUH6tPڽ 1҉H6Y1@6L6D61UWVS1=@6uE @6=H6uYh$@609 H6^_u=`P5H6Y[t?Duz1=D6P6t=L6uL6H6u@ @uP 1H6@6P@6@Zu 1Uh$PAڋ 0-f\Yf:u#t =D6t|0\LD6E|0\u D6N1ɍt:uf:Y\tAߍP5H6SY^u'H6tB @R 1H6ZD돁NJ|Äu :t@PFjWjM EÍ@ wCe[^_]UVS]u uu ][^]UWVSj=u uj Pjd ^Edu! l4uEdUz}<:<^uFC<:{Mu])CdPV%ZYuV([{<\ůCt}<:tyHЀw1GOD9t0v뛍{1e[^_]UPEPhh7h7uƒ1uEUWVS} uHu7uuW1ɋUà =7u u1Ɖ>1e[^_]UPEPhh7h7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ`&#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס|7EС<7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSPU} u]RU $URjWk $WjVZ $Vj$SF ZE] Ee[^_]lUVS@ÉjjjQjRPx tN9tLtHVPpJ ZY@u: j@]S0:O h"Sh%P-=7t 1e[^]UWVSSÃ=$7tO1t L7<!j蝮ơL7!P7)Y9sRU|$7Z9Uu)@uÅu,x7!1ɉ1ƅtÉ5 771e[^_]USX? 797r 7É 7 4t1[]À=7UVSh5!#h5!#h5!#h%-h5!#h"hZm"h0%-- fC"=7t"%=7t%Z"=7tP"QRPh<%Ӌ5-s$=7t %#=7t%i"=7tXs" %=7t%SQRP֋-U㡀7h5!#h"PhU%Ӌ- Uh5!#h"Ph\%Ӌ-UX7ih5!#h"Phk%Ӌ- U\7Ah5!#h"Phz%Ӌ-UP7h5!#h5!#Ph%Ӌ- U㡈-h5!#hκ#Ph%h5!#h5!#h5!#h%- e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVSSh7l7d7k(0hp '@PH1ۉ^,|7~0XY1;l7s6U1h` 'GPHKGU C(XYk(|0h7l79subC[^]á7uÀ=7>UWVSV 0DžDžDžjjPh7jSu@u 7k |7Px71 @Ht7hSh%Q tƄ181ƅGh%<Xt uʊt͍B<9;$` '7R7F7:7.7"7-t7B9H-@-77-H-t7J9@--H-t7J9~}@-u7l7c7Z7Q7H7?767-ƅ h"Rh%P-C7n3 0=7t h֫ Y-9-}-=-‰\7 |7 p7s5l7h7t7)I d7X7H T7tH `7 -P7XL7 H7Ɖ5D75@7#x7tA @75@7)<7=7t*1҉j Ph 5" h 'h,7Cj(7$7 7h 'h7C1177}ã7u&7 1t71e[^_]1À=7u1á7u 7UWVS@É;(7; 7j ¡ 7_9u739u0PY; 7u;$7)$7 7jVS2 19Z;P P7PPh7C=P7XZVS? Y_@u:2 j@}W0e0 h"Wh%P-=7tv 95P7u"tX P7PPh77CXZe[^_]UWVSEЉʋL7!Ë t7)){ MA L>D=7tMjRP1 M95@7sxu@)lj|| >;D7Fs"J| u| | DT>| T 9Ss$EExSWWDED CSWRB;sss{uISC P(DXZ=7uE@,t P7EX,P7؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC t7‰ى[^_]UWVS¡L7!9t> t7)su܋tu 9t)D @!u܋D UEPh,7 @@ZYe[^_]UWVSQӋL7!‹ t7)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS$E܋L7!9_C E؋ t7E)puЋ|7Uׅu9u)Ӌs V}t Z}܉E)+F$Iu*w  'w) 'wT '1;SsS |C@C;Fu ;u1ɉHt SFPAXZN]H9t9sxt PFP?Y_SV?XZ{EЋT }t Z}܉ыU܋E؍e[^_](E܉EEPh,7=Ph,7(A=7t KZ{ SC 77e[^_]UWVS9P7tP79kjjh7\@ǃ t؋_ jWh7C@EWh7@7=7;(7r; 7rw1ɉ Åuj}먋 H71ÅuP=$7@u1jNjL7!‰)[9tP$7Y9uō3 7t]EPh7=XZt>G 9r7 39s0jWh7f?EWh7?7=7}뾉؍e[^_]UWVSÉU t7EC1t}9xts@ƋuzơD7EF}}1U9s~VEP<bs,t1{,IP7ƅt^X 1ɉHD7@7)NFL DBL DVS<XZ t7@7ƋU3e[^_]UWVSE9p7A;`7s$E1 @k(ut0hl79\7r)T7!‰U -Dk(}t01dE -1 @h7Dk(Mt0t{tO{~jjW=à t PWr=Y_YVEÅt@p F E SFƒt )у}T1҉SC11LKx7!‰UEO…tͰ=7u =7t 1׋MЍe[^_]UWVSL7!t%:Džtƅu7=71/G _Wh,7|:XZ=7u =7t1e[^_]US9<7r][][]fUVS uuu=7uÅu6=7t ( h5!#h5!#h7%P- n 1ۀ=7t1Eu]j EPh 5" ؍e[^]UWVS0u ^uw-1=7!蒾 h5!#h5!#hd%}u=7E]!;]|79s 9r9<7rx7։!U!ʉU;UX]ɉMD9r )M?)‰U؋E9<7=Eԋ t7EE܋U؋EƅL7!E_ t7!uX})9]t }܉|C]؋U؋})RUE-Y=7=7)؉EƉ})UEЃEU9UtE܋UЉBẺBEE)PUEE؋M)ZtMϋ t7PUE[=7t=71MP79rEL7u!9r)?)ЉEEE ƅu7u57wG!uU)')ȉM؉E܉‰rEƍU)‹Mt3VEp XPh,76ZY=7t ?1=7uu01 =7t+蜻 h5!#h5!#h%P-` E011ۀ=7t!1EEEuj EPh 5" ؍e[^_]UWVS ]} n҉ƅu=7umttc t tS95<7r8Åu(2Åt%=7u;(7rJ; 7sB1߉81=7t 蒺 h5!#h5!#h҃%P-V ػ 1ۀ=7t1Eu]j EPh 5" ؍e[^_]UWVS} u'=7t}EE }EEܡ<7;E `79U s=9UE 1 AE1 @9O\7;E r.9UrBu9r;T7Ӌ -U !!9u9sx7U !9t&U Å=7tE9E r]=7E;E M )U1L7ҋu9sNE ؍ 31ȅu@=7t9u s+M UU Z빀=7E;E }M E돋E!9E(79Er 79Eu !։UEEEPh,71Ph,74H7PVjEËU!Su|Ã$uWh,72Y[WwG Wh,72XZE9E s=7t+u U ڰZE;E =7tyM )1iE Åt9L7EuE܉ߋu9E s M ߋuMEaTt=7u踸 13E Åu%3 h5!#h5!#h%P- ]=7t"EEE E]j EPh 5" ؍e[^_]US ]=7t]1EEj EPh 5"W t ؋]]UE]ø-ø-UU0-fDP]UU0-fDP]UU0-fDP%]UU0-fDP]UU0-fDP]UU0-fDP]UU0-fDP]UU0-fDP%]UU0-fDP ]UU0-fDP@]UU0-fDP%]UU0-fDP%]UME 1҅tt1Ҁ8‰]UEU ]UEU ]UE]UE]UE]UE]UMU 19t <t@]1UWVSuE 81ۍujPVXt C9]s؍e[^_]USUE 1 t @B9Es[]ڡ-$ UEE]UVSME ًpVPy;P| uE ][^]鍟 r0 [^]nUS4ݠ 'u葧 ZYuC u1]UUE H w UŤ ']1]UU1t <t@]UU1t tE ]UEt0-fDBf%f]UEM tt 9t1]UWVEu U ^_]UU,-DP]UU(-DP]UVS]t%;u5!#5!#T 0PVShL%h- e[^]UU 1}w-t:t1]U5!#}3u"]UWVS1ҋE] ypw v w 8t 8u tB18H[^_]UWVSUM E,E(]E:t*E](E,EM Ue[^_]i 1$(t(?$(Ruo`'$,u.`="'u׉```="'_vڃ1t`, 11ɉ0401t'9C'4'88't(hQ@VwV! @K)K)21ɺCPY^y)VxK)]K)1ɺACPV*MKZ{uoEA)VHXK)P؍e[^_]}O}M&؍e[^_]5e[^_]UWVSSlj1=-H9s?MjB,@Pr(1 Mu e[^_]C(S,z{,f P{<t[F,-01=-H9s (-29se[^_]UWVSfU0P9s'H9r f8f;}ux]u)E-HuVQMږ t uMQ ZU9ufG}uf 1e[^_]UVSË@9r{uC7C7KP9s+9s'8[u"x.u. K9r !f3r9s:.u z]u{uC7C7[^]èu'B 0-fAf'f` ЃðUS1u4@#'m ZYuCC u1]UUE ft҉U<#']1]UWVS É1=-H9s33C8C,E,-E(-E1E9t*C(p{<t@}f;t5}f;t,Ff9{419ts04f;|f;V~ @1 1{8C pPWZYuF;s$rC8e[^_]UWVS Ë0F;CsGjh%Vs u 1ɺjh%VV u1ɺmS j@B@Pr . u ؍e[^_](K A QrqЉE1}C @t E@<S9s8^u @E@89]u @]-@-9H:9<]<-3K0-9)BC9S9{uC7C7S9]p9rD-tN[@3K9ȉu,M؋U먀=Vʀ-ux]Z {uC7C7{uC7C78Dz@U׉DRO^fE11=-H9}"uQMBZYMt UGjE@$E@PEp + u j}G W$JO$f4PY{uC7C7EH9G8:>x]49r{uC7C7<]t<-u{uC7C7=ȋUC9r{uC7C7S9sH9s8=ux]u {C~8-P9x]x-t  -f9=-f9~0{uC 7C7f9UG1=-H9|f9jE@4E@PEp0) u MA0Q4f8fpBQ4EV~{uC 7C71E, U%Gu48-u@-U;Cr{uC P8]u 7C7{ Ex8tC @tEH-E11}tf~)f=t#M9tFfE@fNt/Ex,x4uzx$utx<un@(ffEf=t^U܉zC P U܋pEp(Ep0tEp i1}U܍D2 9Eu'C HC M+H 0؍e[^_]Fe[^_]UWVS$@ @tbF 0-f tNt ,- t< (-ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]UWVS]CE q39\t[p;sr{uC7C7Bׁ)>t~+90y<1ɺE {*.MC @+1ɺ(1ɺ4~t6BЉE8NdBM@a C @Dz({PUCxMu*@uC 7C7{ 7щ3S9ryn3S9Y>*ubF3CHE)PHAKE)PCHE)PXKE)``[^F9>\~{3ƋK9sI:,uDz;9s6J0-DJt%9~{uC 7C7PU:SY9s"H9s8\ux}uDH9r 9r 8\ux}u{uC 7C7 1($S B@pr@ wML(h/S9s#H9s 8\ux)t)\ wCDLpS9s(H9s!8\ux)up39Zx*{uC7C72SUEECE^ ]k3US9֋My*CU z5{NGe[^_]UWVS]x;s?SB< $#'^[m\p{|;{r{uC7C7S B@xz@ wt(hw;Cs8)t~)p wCDLp@;Cr{uC P8)u7C7 1E1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ]};US|1ɺ(N`g;{r{uC7C7Pu1ɺ1ɺ!Cxu{'{9Jր?u#@}{C {P9sx 0-Dyu@<,t<{uC C77}{uC 7}~{u9C 0@}t{tE7C7+uN+ue7C7-7C7C 7C7+tv *t?{CH)VH$K)PrCH)VXK)`L_X5CH)VHK)P^CH)VxK)K)o1ɺCPO^MNj;SsE:,u@BJ0-DJt%9~{uC 7C7PSY9s8}u @48}t#@9r{uC 7C7 {9s9r։v!?t{u#P9sP0-DPt o1e[^_]UWVS} U0E tEp9) Wā [jLYt3SUUw$@@EjP|1҉UYZuSX ]lp1tEEU1}Eu4%Džh$1z911h1xEEMU싅hE1C CE$C1C C$C(C,C01҉S4S8S qAG9r 9Y0-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ0-DJ<_0-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,0-DJu _9wu G9w NDJ_9< u AЋ 0-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hj%NC0Y(9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV uE @MC9uEƉ]]uuu uMrE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMQƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB ;E!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS4ljUMȋEEЊEЈE׋G(E؋G0EܸMjPh{PM UE}tEfEE9G t9GuGt E@fEM E1uE9GtfEE fE1ۉ]̋M9Mu }tEEf} u@uIf}t6f} up`@(E}Qf}tP0-1Gu@$E~1ɉM1f} u @uDf}t*f}tr1w@(E}{Gt f}tByf~u"| f}G1҉U}@(E1f}u1GuEf}t}u?f~gGuE1}uf~@}u f~u7tÉEVuuuM UEMuf~u;11ۡ0-f}UfMQPf_tIf}tAf}uf})E@0-Buf}_uڻzf}0-EDBu#f}_uff}thf}u4fzXf}tLf}ufztBf}E@Buf}_ufztf}u;rfzu"yVuSuM UEf}tAf}tY 0-E@Af}_ fE@Af}_ 8uY8E0-DBuf}_f}u7E0-DBu&f}_tVuhwuM UEUąUt }udU܋E9UtxM9MtpEU9UtNM9MtFЀ}tEVPEPuM UEuuEfEEGE@}t)EG1EEf} 0-1Ee[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUEju uM‰9EtMIFEEjSVMU tUU9tESVMUjuVULEju uM‰59EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y0-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ0-DJ<_0-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,0-DJu _9wu G9w NDJ_9< u AЋ 0-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hj%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PVI uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0He=XSw =H=PM=@=`=h=wF=w=xU=o==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEfflEffEff}yPTfEff<@-/f}$(f}UEMA k MM)ʍ M ыEEHM)ȉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1uԀ}t!puRUi UuEEf u@EuLft:f} upucp(fE}Rf}tT0-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U‹}}f}}t4EC1E>t$E@Ef} 0-fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUwEju uM‰`9EtMIFEEjSVMU: tUU9tESVMUjuVUEju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tT0-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U?‹uuf}}t4EC1E>t$E@Ef} 0-fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVU|Eju uM‰e9EtMIFEEjSVMU? tUU9tESVMUjuVU Eju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y0-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ0-DJ<_0-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,0-DJu _9wu G9w NDJ_9< u AЋ 0-DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hj%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV4 uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=-lt1ۉ]tMEAEWH YE}M9M) N,F4EF8EtwF}׉ƍWOt%%"F9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$U6DžDžDžDžDžUE@fE@fMIL$D$ D$D$$ t$ D$D$ 4$ EDžDžDžUE@MIMI Ɖ ȉ } Dž UE$(D$D$Ɖ$|D$:4$v Ut p9EDžDžDžDžZ DžE@fEEDžDžkzR%KwҋD=V9s%u9sF?V?4 r9i_oJgNN9sVu鋽D$ S~D$D$$D V9sNu鋽E@D$ D$D$$ ^V9sNu鋽*N9sVu鋽gNN9sVugNN9sVu=ExI @t>ዕt9gNN9sVugNN9sVu ygNV9sFu鋽Dž6pSgNV9sFu1fTA D$(A D$$AD$ AD$AD$AD$AD$D$ D$D$ $ ȄLN9sVu鋽AD$AD$AD$D$ D$D$ $7 lBD$D$hBD$D$ 멋AD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ $D$D$ $/ dAD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ D$D$ $a N9sVu鋽N9sVu鋽}nȉN9sVu(@D$ D$D$ $t N9sVuA D$A D$AD$ gD$D$$ {V9sNu7@D$ D$D$ $ N9sVuD$ D$D$ $ N9sVuZD$D$D$D$ D$T$U$"N9sVuEDžDžDžD$D$ D$D$ D$L$U$mtN9sVu*})mUE@D$ gD$D$$g EDžDžDžDž DžUyzUWVSt>t CU11 rEEEEEEEEEH>U DEED$ED$$P:U}ĉ|$T$E$n0 ƃtdE$/ ƃt'D$ED$$91҃ډ*1 MD$|$E$ 0 1 M0 8D$ED$$90 8t[^_]0 UWVSP r Dž/devDž/XtyDžyXXD$h$S:t-ƍD$D$FtH4$ 4$;D$D$ D$D$y$uS@Džgpt0ƅpD$D$<$s9ƅt訖L$D$<$=uD$<$=tg$9nC/ P [^_]. 8u)΃wΉ<$:uD$D$<$8`S9EE ut|$E$ Ut#ED$D$ $qEtED$D$gt $M 1P [^_];DžUVSo |ED$ED$ E D$ED$E$tK ƃt?uE$L8E$c8[^]ËEUE$%8[^]þ[^]UVS `o e|(Y ;L D$D$($ t@L $ ^ ǃL ($7ǃ(ƃL 1 [^], 0ǃL ($[7ǃ(ƃL t, 0ǃL ($ 7ǃ(ƃL D, UWVS<Dn I{uD$/4$ D$@4$5ƃ%D$T$$a5+ 4$j6Ƅ=D$D$D$D$ D$D$ D$$ tVuw: ul<[^_]ÀL uM) Ɖt$ XD$ hD$D$4$ =* ?L * UVSl yu, 3D$/4$ "(t$L $p s L D$D$($8 BD$ D$D$($P !ЃL D$D$($}1[^]Y(RD$D$%@4$b3(D$t$L $ɍ ' Ɖt$ XD$ hD$D$4$ =) ?)$ tƃ, Y( 8#t( 0z( 04$ƃt( UE$]fffUWVS j ÖwE@ E։υEE y ]]U ] }ED$D$ $D$s&ЉM;MM }$UM T$L$ U$D$=&ЉM9ureMϋE eƉϋ]ڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEE9EE }E2MϋE evUWVSPi vD$T$|$$|$D$$D$,H*)R)L$L$|$}<$cteEU +D$T$D$T$ \$,K)v)D$T$)iD$T$ e[^_]øUWVS8/h 0u}܉E؉Uȋ0-8}tGC@%-Z+]E[t_E@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }KtO0)Ӊʸ9иbv-t9+E]܃}thEȉE̅um 8[^_]E@ta(uk1f)uAÃPt((uރEPXEȉ 8[^_]18[^_]Éc}ȉk}ȉ^}}Љ}9s]tSÃPuހ.tEȉEt,},-UЋuԍLDFt uf}am}a.m.f}pmR}p.m.1EЉ$]< 1E܍ h'D$D$EЉ$]= t#tWuՉD$EЉ$] u݋FV }؉WF2}S1}؉}+E܍,}̉hD$EЉ$]s tu}܍0#D$EЉ$L K,"hD$EЉ$]& Hu݋E܍L}ȉ+hD$EЉ$] u݋}Љ<$] |?sE܍LD$EЉ$] uE}u8}DGt.E܍D$EЉ$]d u1ۋEЉ t.u}.E}Q} auD$EЉ$] usu̅u#D$EЉ$] uݸUWVStb yoƋ'<'wwEVN)щȉMEED$$bdt_FMȉFD$F$=dt:F]؉F>FDF 1[^_]ÿ'E {UWVSa ǦnD$\D$`D$dD$hL$tL$D11rD$DD$xD$|$$1D$TD$PKD$LD$T>,M\$XD$Xtt$T=qw 9?D$Lt$Xtt$T=qw 9?tD|$P\$XL$HD$TD$dU ID$Tb\$XL$HrEOT$X)Ћ$‹RD$\T$`F3W>D$|t$xt$X$1?\$H\$PD$Ptqwt$H<g9D$XrD$TD$X$@e$$1eD$Te[^_]D$\D$`CE@$@@(L$XD$|)ЉD$|$)щ$P0lPT$|@A$D$\T$`AQ T$TeD$T!,M\$XL$XD$|)ЉD$|$)ى$PiKtсqw 9?lN;$rD$DD$|PT$|X$A$D$\T$`AQ ND$T\$XL$HƉL$HD$|;$rD$DaD$|EPT$|X$P$T$dL$hPH ND$PtD$PD$T$L$HYЋAԉD$81\$(9ډËT$8QˋIL$0;T$@9щ‹L$0ً[I<9qUD$(B$L$HAQD$ D$<Y $\$щ‹EL$XD$|)ЉD$|L$H)ى$PE@ $T$HJZ@U@pHhXl둋$L$HAQD$ D$KE^D$xD$XD$T݉D$xD$XD$TD$dU DD$TD$xD$XD$Tt$P\$Xt $D$|;$rL$PD$DL$PYD$XED$|PT$|t$Xp$B$\$dt$hZr D$XND$Pa,MD$H&E@ $D$H$D$HD$\ E@$D$HE@$D$HvE@($D$H_E@$@($D$HDE@$$D$H-E@ D$8_$D$HX4""""9ȸ"""3ȉ)L$8 I] ApAhQl5$D$H@MQ m$($,$u@yރ1D9$($,DŽ$\$P $D$$0$$L$$\$($ \$$D$,$$L$D$DŽ$DŽ$DŽ$DŽ$DŽ$$\$,$à $  .D$ t$$|$(5 D$ t DŽ$L$$$$\$PD$TT$XL$$D$L;$o ;$b D$D;$Q D$<9$@ D$,;$/ D$;$ t$T|$X! $D$DD$D a$4D$P?D$L%w\$Tt$XD$\D$\ t$D9%Gtԋt$P6 WL$T\$XL$l\$pӉD$DŽ$DŽ$DŽ$D$T@D$< Tv\$P* TUVS 07 5Du3]D$D$at 4$+ t7D$4$F`D$4$6`D$4$&`w 1 [^]É4$`fffffffUS6 ëCt$M Pt 9u[]Í j[]UWVSU6 ^CEPt`E%} tcEL%u1Ɓu u%9tJtÁuσ9uȃ[^_]ËEjȃ[^_]ÁUVS5 But+1tut Xuۉ[^]UWVSp5 yB] Pt+Lt 1ρu %uVuہ1҉ [^_]! [^_]UWVS 5 BEuFt7>t ] 1uUT$$]>tFuɿ [^_]UWVS4 èAt:>t M1uU T$$M>tFu̿[^_]UWVS<4 AAPt:L>t M1uU T$$=tFu̿[^_]UWVS 3 @E $2{ ƋE%EEgUuUT$$ …PLU>t M1uUT$$*=t1FűuUEEu54$8E [^_]ËUt }1]uЋu9t!$U D$UT$4$ E0E렃}tE1҉UWVS2 â?u Ex}u 4t+D$4$TuF$6F $64$6[^]UWVS0 =E 1t 8u$-E]M $ x NjExlD$4$1MA XEU PMgEED$<$Dž?nED$=<$~ HE u M D$<$9uM+E UR V tMV}9~t!Љ1OMV}9~u oSEK1ɋE gP t&}G$4<$41ɉME[^_]É|$QD$$hD$4̉<$4E$4뷐UWVS8. ;u D$rD$4$SuD$:4$ DžD$ D$4$ShF$h $o+D$$蜏D$D$|$ D$D$Q4$=8$*AD$D$|$ D$D$4$7|$$ƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $)  $D$$ |$$ƅOD$E D$ ED$D$$$D$E$VPtD$$}$1$1 8[^_]À>/uEt$D$<$ t'D$<$^ 8E D$t$E$N}8[^_]ËE D$bD$E$ME D$D$D$ ED$D$Q$5BE D$t$E$CNg E D$rD$E$EMDž1D$ sD$E D$E$Dž1` E D$rD$E$L10$J t$ 'D$E D$E$<$1sD$E$ D$/4$H E D$D$E$!LDžDžk E D$Wu E D$WUS(m) r6EEED$D$ED$ ED$D$E$`3x E([]øUS() 6EE>ED$D$ED$ ED$D$E$2x E([]øUS(( Ú5D$ D$$?D$D$D$D$D$ D$D$D$D$ $2x D$([]øUS( !5ED$D$ ED$ED$/s$9-x E[]øUS' 4E$IU' 4U<t <]Í,<]UWVSp' u4}|$E D$E$I9s [^_] ?|$ t$D$$<[^_]UWVS& 4}|$E D$E$J9s [^_] ?|$ t$D$$<[^_]US & Õ3E$m t []ÉEAsT$$<EUS J& O3E D$E$l t []ÉEAsT$$<EUVS% 3u4$"t[^]ÅtEt$TsT$$<EUWVS% ð2u} |$4$&t[^_]ÅttE|$ t$@T$$<EUVSK% P2u t$E$v't[^]ÅtEt$nsT$$<EUWVS$ 1}|$E D$E$K u[^_]É 0|$ E D$hD$$<[^_]UVS$ Í1uE D$4$}t[^]ÉEt$sT$$<E[^]US1$ 61ED$E D$E$uEsT$$<E[]US# 0ED$E D$E$DuEsT$$<E[]UWVS$# Î0D$ D$EUD$T$EUD$ T$E D$D$E$˿ Ɖ׋D$ u $[^_] L$ EUD$T$EUD$T$E D$ ED$D$$<$[^_]UWVS$" /D$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]H L$ EUD$T$EUD$T$E D$ ED$D$$<$[^_]U" /U!QፀL]Í]ÍS]Í]Í]Í,#]Í]ÍS]Í]Í]ÍA]Í]ÍM]Íۤ]Í]ÍS]Íu]ÍS]ÍY]Í]Í]Í]ÍF]Í<]Í]Í]Í]Í/]Íx]Í]Í]Í]Í]Í]ÍA]ffffUWVSP X$Hp)9s L H 9r,P 9s P P P$@(@,[^_]Ë #p VpUWVS\ a-ƉUx HEU D$ T$ED$9s)L$><$~F [^_]D$$ƿۋP Hx,tP(9s ,P P 9s 

S S KC S$T$ʉs[^]UWVSTH Q,E}>11L܃r׋EEċE EȋEUEЉUԋEE؍WỦ< <<] E;EriEE؅eEU9s UEUȃE9sv ED#UȅtEDgET[^_]ËU#EE%ju}ču܋EU$T$?uẼƉE wt ~ 1ҋM!E! tE̍PUP v)E;Es MĈEEU̍JMR wډuuUtE;Es U>EE1ۋE؅EyUE9U9v UD#Eȃv UDEȅUDwMaEEEE}ωu΀FE:j=*}_]̋MEU$T$ڋ}i]EE߉]̃{u]bO?_]̋EЋU t1҃EE̍PUt'E;Es MĈEEU̍JMu܉E}ESfO?~w<@p]fEЋU t1҉EU<@t$ t1!E!UGE̋EFE̍PUE]Ȅt&9s MĈE]ȃEU̍JMu9s U=EEEU$T$U]}EEf@E%#jxE%#joEUE_]̀}FGG9U}1 CEt'E;Es MĈEEU̍JMu܉E }EEEv_]̀}fGU}1 HE;Es U=E]̃EQpEЋU t1҉EU<@GE̋E"0]̉EUD$EUD$ T$ED$E D$E$p]fffUVS ÷%uED$ ED$E D$4$D$ED$4$U[^]UWVS4b g%UEzlj(aED$/<$~ t<|$a7D$ED$ ED$ED$4$/4[^_]ËE AE|$ED$bED$ӇD$ED$ ED$ED$4$ub 8upED$ |$ED$ED$sD$ED$ ED$ED$4$|M 8u 6EL 8t ED$|$kD$ED$ ED$ED$4$  US ì#EU Mð]]] ]][] USEU M]]]] ]][]fffUWVSt> C#D$L$<$c8t$#D$<$m1 Dt$D$$ymũED$ sD$D$$9rt UWVS D$ED$$t{NjE88/tbD$/4$j…tL)JBU=wsG|wdD$}|$M$u Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVS }UtlƍxD$4$E tD%=`u'6$U tĄ[^_]6 O1Ą[^_] 1UWVS $}U)tlƍxD$4$QE tD%= u'A$U tĄ[^_] O1Ą[^_]u 1US(} ÂEEED$D$ED$ ED$D$E$px E([]øUEM tP8u ߉P81]à ]UWVS  }tc$FUT$U T$$ ƅt/tV$ uDt$D$<$MƉ [^_]ÍD$$u [^_]U ' 0U T$UT$-7$]U EtUT$U T$$]ø]US  E D$E$`=u$ED$ED$-7$ []øUVS t yuED$E D$4$x=uED$ED$4$H [^]øUWVSL $E uUŰPUЋPUԋH M؋HM܋HMHMHMH M@$EЅ$EPU@E)99}W~E}ủuĉMEU1NjEĉD$ t$EȉD$E$qE9}u֋UȋED$T$E$J<E$e1L[^_]` 7Eԋ U2bL[^_]UVS4 uЉt$E $^ED$t$E$y4[^]U U T$UT$-7$D]UWVS_ duEE}ED$E D$4$Z;t}EE u[^_][^_]UWVS4 -78ủt$E$聣E D$t$<$4[^_]UWVS ûEE}-70E D$ED$4$:t}EE u[^_]?[^_]UWVS4Q VuED$E D$4$U:t%}̉|$E$轢ED$|$4$4[^_]UWVS4 -70E D$ED$4$9t%}̉|$E$YED$|$4$w4[^_]UWVSH ÓMU }Aq)9y}ȋ:}̋z}Ћz}ĉ}ԋz }؋z}܋z}z}z}z }R$UUątj~;ƍỦUĉEuƉϋEĉD$ EȉD$t$<$!nE9u܋EUȉT$D$ $M8M $1H[^_]` 7}ԋ Uy'H[^_]UVS4t yuЉt$E $ED$t$E$4[^]U 0 9U T$UT$-7$u]UWVS uEE}ED$E D$4$7t}EE u[^_][^_]UWVS4 ä-78ủt$E$!E D$t$<$4[^_]UWVSV [EE}-70E D$ED$4$L7t}EE u[^_]p[^_]UWVS4 uED$E D$4$6t%}̉|$E$]ED$|$4$ 4[^_]UWVS4 ×-70E D$ED$4$6t%}̉|$E$ED$|$4$4[^_]UVS / 4EM thP8t P8-7@:t1 [^]ÁP8a?D$D$37@<$GH8붸 [^]UEt @:]ø]UVS  É-7t^D- -T$XT$$3-7tE$\1-7$S$-7 [^]Í$2u뎍s$W$}fffUWVS0 uzE$z~}UU}} M߉ME؉4$#aƒ  UFD$ D$FD$4$蟉U9UX9UF?M0- DQEmML$D$4$34$W`ƒ4S;} E8E}E;} tu}MMD$ FD$FD$4$fD$ FD$FD$4$fMAE9N~D$FD$4$!3mFM9ED$FD$4$2EE9;} tɀ}TUD$ ED$FD$4$fEHU9ЋUE9F M10[^_];} D$ uTED$FD$4$eED$FD$4$12xD$ D$FD$4$eeFD$FD$4$GeD$ FD$FD$4$&eFD$FD$4$1}tE9} uD$ FD$FD$4$dFD$FD$4$j1D$ ML$D$4$dFE[^_]UWVS0  E}GDEE-798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$] fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]虁MEE9G~0W,10[^_]Ã]1^E:<$]?}1U  -7$]UVS -7p t4$u N8@[^]ø[^]UVS| Á ut4$nu N8@[^]ø[^]US$@ E E UD$ D$D$D$T$T$ D$D$E$$[]US$ E UD$ D$D$D$T$T$ D$D$E$$[]fffffUWVS~ à } uUE%tUG$-Ul ` 7tUF$U/ ` 7tBU$U ` 7,048<@DHLPEtE@$Y ` 7  $(EtE@$ ` 7TX\`dhlptxE tE @$#w ` 7|UUUUUUUUE}$tE$@$X ` 7U UUUUU U$U(Uċ,Eȋu(tE(@$&9 ` 7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉ`T|t ʉt ʉ\|Mt ʉt ʉXUUt%  TŰE@|E@hDž$&' E@,8@1fN9 4>ff~~ tωv$uE@,8@4F uf~n$O HG 9u͋940f|0yW}$G,@fD00f|0y.GDfJT$G|$uĴ[^_]Ë$#E@,8R|)4xLlx9kf+fdG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YUR, rfVAtωp$HN HF 9u͋tp9dl9h0\d$xy DžxEP$ty DžtEL$y DžEԉH$yy Dž4$Qy Džx|Ƌ)΋)ȉlp9`l9E@,H1҉tvf~94>ff~~ t‰ljv$@u}O, I4F uf~0r$B4O HG 9u͋9 Ƌ9p9pDžAlxE@,8@xM8MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bff~~ t‰׉v$u}O, 9I4F uf~k$b O HG 9uϋ9 p|9|)ȉ9xE@,@u0F,@‹NHJfB91ЉNDfHD$F|$YuX-7}9Gx E@,@1fF9x4dff`FF tƉv$uE@,@4F vxfFXl)\N HF 9<$u,9|?EH,|f+f49@)fT094‰PЋLf`\Pp tv$OuEH,@D gE@,pfFE^*LN HF 9-$-utE@,8@1fF9t4PffXFF tƉv$#uE@,@4F otfFMh&LN HF 9;$ u9|EH,|f+fD9@f+f|094xH8f`Txx tljv$uEH,@D8 KE@,pfFEЉM,LԉN HF 9Nj$u3-7}9GG800D$E$/f1UWVS| #Uu}} ` 7M  M` 7 ` 7  $( Q` 7,048<@DHLP ,,}` 7TX\`dhlptxE% TT} V` 7|UUUUUUUUEE % ||}$` 7M MMMMM M$M(Mċ,UȋU$ UU}(` 7]̋]Ћ]ԋ]؋]܋]]䋙]苙]싉MM( M̍M̉L$ T$D$|$t$D$ D$D$E$|[^_]ÍD$E $tUD$$t1D$4$t,t$<$ct}-T|$E$Dt} |D$E $t}$UT$E$$s}(EM̉L$E($syU$ U$T$ U T$UT$UT$UT$UT$ U T$UT$-7$w]U$ U$T$ U T$UT$UT$UT$UT$ U T$UT$-7$]USI BE-7t0ÁtZD@.7tu8.7 %BH[]US UE t0ÁtZD@.7tu8.7 %BH[]UWVS Eu] %tFDU@.7^HFE~TFU1~_V,@M}@t~D8x ߉xf@9uڋ}9}uD$4$]]1[^_]Ã9}uf8.7 Y[^_]U UT$-7$]UVS Et=PHӁ@.76u @D [^]Éց8.7;1uڸ[^]UWVS< !U Etzu<[^_]ËB$E@DE̋E@HEfEE@LfEEẺED$E@|$dEx|U B$sU BMADBEȃvgDE9tKuU M$X8@MąɋU  AxDE9uU <$U %@.71t MAHALQDUEfEfEE}}ȉ|$A|$[|$E$1ҋEH~]E@,<1E@~=U E9p~*W DtL$Eȉ$E9p֋UăE9PD$E$ [<[^_]ËMA|tBf8.7 U $@EH|U U UT$-7$_]UWVSw |}-70t=Gt6G$+&|$4$D$4$(Z1[^_]ø[^_]UWVS u} t=Gt6G$&|$4$D$4$Y1[^_]ø[^_]UVS ëEM tlPHց1@.76u7PDQAP|tA\Rtu1[^]Éց8.7;3u뭸[^]U UT$-7$J] ǀT UWVS8 u-7E8@-…2-7E̋2-7E؋2-7EЋ2-7EG -7EG$-7E܋GT-7EȋGX-7EԋG\-7EG`-7Gl-7EGm-7EGnE0Ћ2E̋2E؋2EЋ2EV EV$E܋VTEȋVXEԋV\EV`FlNmEĈVnE4$"F-71ҋ2‰T$$V -7V-74$4$ 8[^_]-7E-7E-7E-7E-7E-7E-7E-7E-7E-7-7E-7EUWVS ë}D$4$ƅEdž3E Fdž2dž2dž2dž2dž2T 3ǃT džh2džl2F`fFddž2dž3F FFFdž3dž3dž3 $3dž34$6t$<$}o2PJpdž2D$D$D$D$ D$D$4$TFD$D$D$D$ D$D$4$F4$a4$譏D$D$D$D$ D$D$4$謡F tjD$$4$$4$t4$4$6HH-7t 3t4$#4$A[^_]Ë2t$fd2$g29tDžu拆3$L4$D1[^_]ËRhD맍$RDžUWVSg l}2t$c2$ig29tƅu拇2$g"<$a3$3$-798t<$[^_]<$l[^_]UWVS ÿul +9uǃ >ǃ <ǃ  ^ǃ$ vǃ, #ǃ :ǃ 'ǃ #ǃ  #ǃ #ǃ0 -ǃ( -ǃ8 _ǃL |ǃd oǃ, -ǃ4 -ǃP <ǃT >ǃX *ǃ\ !ǃ` f2E@tgt.Ex tAu[^_]ËE싀t(VT$?T$ D$D$E$ 1l Tp=u[^_]US M1Tpl =u[]UWVS, l EƍME$+#FF(9u݋uD$$@8CuxuAD$$$33T$$6ǃ, !ǃ +ǃT !ǃ ,ǃ| !ǃ  -ǃ !ǃ$ .ǃ %ǃ, 0ǃt %ǃ `ǃ %ǃ aǃd ǃ fǃ ǃ gǃ %ǃ  hǃ &ǃ iǃ %ǃ jǃ, %ǃ kǃT %ǃ lǃ| %ǃ  mǃ <%ǃ$ nǃ %ǃ0 qǃ #ǃ( oǃl #ǃ8 sǃ %ǃ< tǃ $%ǃ@ uǃ 4%ǃD vǃ ,%ǃH wǃ4 %ǃL xǃ$ ǃd ~ǃ #ǃ, pǃD #ǃ4 rǃ\ d"ǃP yǃ e"ǃT zǃ ǃX {ǃ `"ǃ\ |ǃ ǃ` }E2xUl U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$?L$ D$T$$Epl }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$>, $<T $^| $v $# $: $'d $# $#x $#f $-T $-B $_0l $|4 $o $ $p $rD $y\ $z ${ $| $} UUS l ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0 æEU܉M-772EE4El fEE$ƒ=4M4%y 4 44fǃl EDPf~M䋑f8>@El fWfcftf.MlU܅-7Q)ʉ$1E$ƒE@ @M M4 /UfB 49}} 4% 44;4yfl €"7f1҉Ѓ0[^_]ËE44%y 4EDPfl y4D$ D$D$$M 4449)‹4L$ T$U؋MȉD$E$ 4;4U}dž4…fl 4xp4fǃl +E$/t3E$=Ec0U$)4fǃl E܅U 0tE@ U؋4 E44B%y 44D$ D$E‰T$E$y4%y 4 494114M%y 4;4$fǃl Mԋ4D$ T$U؋ED$E$U؋M ~4y 4 49411x 4Wy 4 494"7ffl @}AEE܅U$D-E$ƒUE@ @MM MtU-oE@ U؋4  UfB 9 4)fǃl &E܅{-7Q)NUj 4}} 4Hx6 44m4%x4|뿃ߋ 4}} 4%y  44;E@ }fG Ef`  -D$ D$!D$,$G $WdU. +Efǂl ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSXҿ u-7MV8у$33@-EEt-7E(V8t@N<)tE11iE}uDX[^_]ËFv3@-7D$-7$#ǀ3E AX[^_]EE] (.t&KEEED$D$ F@D$EĉD$Ủ$UuQUT$4$ M)v4$ 33} @-!EED$D$ F@D$EĉD$}̉<$P|$4$& E1EE$E%V88uF @tz 8t!F }fG %E g3t&-7D$-7$M1҉3E@ U赻 UT$-7$]UWVS 苻 Ðu}ED$E D$4$t} u [^_]r [^_]UWVS 7 <u-78E D$ED$<$3tu } [^_] [^_]US E$ []fffffUWVS 豺 öƉ$h $詷…t"ׄtN<$tȃuЃ [^_]ÀF$@ Ut p@뮃$<UVS !ƍD$4$j sD$4$i 4$g vlte110B<1ɀ;Pt0tD~ȃu9mt(B< v-1ɀ;Pu1[^]ø[^]É묀;tD01ɀ ɉ떀>uF[uVmtÃt0ZcWKUWVS0߸ Uu :uH2tU$9LUF@fu2ML$ MD$T$<$S2MEPJ(N$JN 3\s$ JD$D$$8FTs$D$D$$FXV ~$-79-7NT´-7 °-72P3B0ozpdH12džp2E苂E싂TEtU܉Udžp2ELɉME*EEUwD$Eԉ$U:E܋U؉$GMԉ $U܋ED$<$Pe Uu p2EU܋ED$<$"e Up22@@ ,F@f`L$ D$cD$<$2E41E$D$E$zd u džx2EED$E$Od u x2|$E$*d x2Et ED$E$c u dž|2EtD$E$c u |2|$E$c r|2c~ LSMt|$E$Gc u x2dž|2EEdžt2džx2dž|2džp2MzEdžt2džx2dž|2EbtW|$E$b uDx2dž|2džt2džx2$dž|2EEdžt2džx2dž|2E&U˱ Ծ-7D$E$]US裱 èE¸-7H$ ¼-7H ´-7HT °-7HX ¢-7Hl -72 p2| t2x x2t |2p 2$QC[]U  M-7tJX-71]ø]fffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS , -}ƉDHfx 4 [^_]Ëf=tnfDN4f>tM$]ެQPf9uǀFF [^_]ËEFf\Nu]ED$$]蠱MME$ ]JUMtbf@f@@ f@@f@@]\]X ]]UU9uU]p$$EF] -D$ D$D$P$5 $ F]$Ʒ$EUWVS G LƉ׉M$3\ ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS裭 Eu^9t)fxf8u@$9u׋~1$]9> $]ɲ4$[^_]UWVS X9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS脬 É}fǃ $yPf9uǀ2ǃ ǃ ǃ lR2@tL$Y =w4D$T$$N2D9u[^_]Í$ڴ$CUS e bE E-7t+2UT$$UPE []ø []U UM ~*-7t2t 1]É1]UWVS 赪 ú-7te3339}}<31 [^_]à D$$裬‹t!3333뱸빋33D$BD$$V 33]\33o'U ۩ E-7t%2UT$$1ɋUE]ø]U荩 M-7tJT-71]ø]UWVSY ^}<$mƃuOG @tIg 8u?-73t--7D$-7$yqǀ3[^_]UWVS ڨ ߵEU-72E EE$3= %y   fǃ LNfu f9q fmffjMUU$ E$mE@ @ME@ M  %y   LNf   yt鋓  9f y [^_]ËE$At3E$8=DEMR [^_]ÃUfB   9| <  9f [^_]Ë %y  ; fǃ Eu-E$E@ @aσufF -7Q)=  Ef` [^_]ÿ -D$ D$ D$$, $<UWVS$X ]u-7M~V8у$?p33@-M MEt-7BEF8V<F11‹F5 t%F@f|$$5 43`3<3h3@3l3D3p3H3t3L3x3P3|3T33X33\3383d3Fl83Fm4322<32D32H32L32P32T3222@3%2fdž2432<32D32H32L32P32222324832@3%g2`33@fuT$D$$ [^_]dž3-7-71 [^_]ø|$$2 UVS -7$LtHl¢-7 Pm-71[^]UVS Ș ͥ-73ug-7-7ǀ2233t9@fuT$D$$u [^]q1 [^]UVS * /-73ug-7-7ǀ23tE`33@fuT$D$$ [^]1 [^]UVS 茗 Ñ-73uc-73tW2u<23@fuT$D$$E [^]Í291 [^]UVS ]C=w"Dt-7XD$-7$]UWVS u$y 33|$ D$D$F$52VT$?|$ D$PT$$]2VT$|$ D$PT$$/F@:udž3[^_]Ë2VT$|$ D$P<T$$-78-78 w+3<$31҉31 USō ʚ:[]讍 -73US荍 Ò-7$Ŝ1[]USa f-73t-3@fuT$$& []1[]US -73t53@fuT$D$$ []1 []謌 -73ts31膌 -73tu31` i-73tUs3E1]ø, 5-73tUu3E1]1U -7U31]UVSՋ ژ-7@@fuUT$D$ht@$, t Efu5 PwtU$Ѓ[^]Ëǀ3[^]Uft-7-7UWVS,2 7   }-7@@fu|$D$ht@$, 4UǼ-7f-7-7;Pu9HtL$MԉT$U؉$rNMԋU-7;Pu9HtL$T$$JN43@fuT$$$ 3@fuT$D$$8k$$,[^_]EfEf-7;tǂ3U9ǁ3-7-7gEEEEEE D$}܉|$$'F ǃ *ZnD$$;D  ǃ  US   t[]ÍZnD$$C  ǃ  []US貈 ÷  u[]Ë D$$C ǃ  []US$j o t$[]ÍgEEEEEE D$ED$$D ǃ $[]US$  $[]ÍED$D$$D  9Et $[]D$ D$$eD 1UWVS4r w-73;3@fT$$   y-7B$YkD$D$ HQT$PT$@$莣€37@|Ua?E؉D$D$ $Uԋ@t A:zUԋ}؉|$D$$b|$D$Uԋ@X$@@$ D$ D$D$@$nǀ343@fuT$D$$4[^_]€37@|a?M"E܉D$D$$]B  9E -7R뒸 D$$J@ ǃ   |14[^_]a?MvUԋM؉L$D$8$Uԋ@YD$ D$$A CUWVS,蓄 ØEEEE uԉt$}|$$JEEEED$|$$JD$$ L-73tD$t$$|J,[^_]ʃ Ӑ-73trUS襃 ê-73u-3@fuT$$; []øUS M R-73@fuT$D$$5 []US -743@fuT$$ []>US 貂 ÷E U€37RtI|t7a?T$D$$x-7ǀ3@$ 1 []Ëxta?T$D$$/-7ǀ3@$ 뵸 []UWVS E-72tt_ [^_]37@tǂ2a?T$D$$@$ [^_]37@@ttǂ237@jǂ2U -72$]ffUS]E  }t J;}R ;~1[]ÃUWVS詀 î}tG8 uZ@u[^_]ËtG~W,EO(G\p;}@ ;~E9uՋu뭉<$VG8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtTx^F9}WҐxR)9H t7~,}߉ˋF(D$NQT$$U191[^_]É봸USEt"H~X,19t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًUI9u1[^_]øUWVS}] UuG9)9UtYW,G(tX] UG(uU r9|_9}G(r 9 _9}"E E9E |1[^_]D$OL$$bE9oƉ\UED$ PT$D$$]UWVS}G~CW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]t]{tVO~Ww,19tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]UWVSĀ{ ÍR433x,}396F8 ,4};~E<E1uuuuủuƉMD>EED$D$ M3@@D$ED$E$OV,UD>UЉ$iUЋM;4ED$ EF,D$D$3$bED>$EENjE94~WD>D$E$BE!эP$U' D$UT$ ED$D$4$;EE[^_]F,D$D$E3$EV2MD$ T$FD$4$D$M2$ҸEE[^_]ErUWVS8=y BƉU̍R4EԉuЋ4M8<$' ƀ?tqE4EEEEE'E$譁M9ErIUU)ր?Et7E܉D$ t$|$E؉$Ey8[^_]EEEԋ@tCuҋEԍPMulEEЀ4uŨ8[^_]}E)9ǃEԍPtt$D$ $U U)uMtMȉ׋uԋ6sRtftE‹u)uEmut$D$ $U UIuE)muuzEfUWVS,Cw HEօE93}ʅD0-?@tDG@uM$U$ MɋUM4M׍MMu܉ƉUE$1}Ut7)ր?t.ED$ t$|$E${}Eyĸ,[^_]Ëu܋U)׉|$$…tٍNDvu4]Xʉ1,[^_]ø1ɍA1USu Ew"DD$$=3[]øUSu ó-7t3tUT$$\[]øUS ju o-7t&3tU T$UT$$( []øUSu $-7t3tUT$$[]øUS t -7t&3tU T$UT$$ []øUSt Õ-7t3tUT$$\[]øUSLt QU -7t*3t ML$ T$UT$$<[]øUVSs -70toƆ43u'3tU$}3${[^]Ë2Ppt%T$$ D$2$[^]øUS ds iU-7t$3tD$T$$ []øUs  U-7t~;3TR4]1]USr -7t3t$U[]øUSr â-7t"3t$Ut DY[]øUWVS Tr Y-70Ɔ43uj33~BE14u_uE;3|Ճ}tO3$y [^_]Ë2Ptt&T$$D$2$ [^_]øUvq ~U-7MMM ] USOq T~-7t3t$Y[]øUWVS q ~-70E E4ED$ D$MML$$xtiP$UmDžtUU UED$ UT$ML$<$]xt&E$U%Ɖ<$v [^_]þUSHp M}Et3t$gS[]øUWVSp }u3t$"3~#14$mu;3|ߋ4$TuD3ǃDdž3D$0$p4t`2PtD@@X~:Ɔ3$G/2@PX3@$41[^_]Ɔ3UWVSn {u3t$3~#14$Rt93ߋ4$9t[^_]UWVS]r3Y3KE ~443 u} })u}}11]]9t0z9u}9u]1~39114uu;3|ى[^_]B,B\4u u )lj<)} t7ƉL|G1[^_]ÿUVSl zutNFX32@@T%D$4$ E D$FX$1[^]øUWVS l ÐyEExD$D$<$^uƅt,)‹M tEt|Etuu)1 [^_]ËE tmEtYutREM@.7 u)1MfT$|$E $tE 01f%и [^_]øzUWVSk ãxEEuE $%tƒw]}E(1M149rEtfEt1[^_]ÉEE $s,} E9tl$stEHE 103EE1MM9rMEtfEtЪW‹EHE 1uu1U7U9rUEtfEtE%}@.7t]ft  ؉EP1u 9r[^_]ÉE'[EGfmHfmBЪEfmEH>UVSdi YvUE ӁttH@[^]Í ` 7ʋ JHJHJ H JHJHJHJHJ H R$P$ [^]UWVSh uutv4$}uVȉ‹9u F0$&nF,$n-79pt]9p tJ9pt2t$$m4$m1[^_]@u@ 9pu@9p uUF4$m>9UtU?$9Uu~X24H90t…#ȋH90utJ$70RM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]Qu`E9EuM܉r9M׋GD$ D$t$<$]9uuE7fP 1fUME VRUT$-7$j]UWVSE89tZ@EOE)w~>EP,G(UW,΋M4}y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS(C P}GDE-798 GH%EWUOMG,E܍40UunыpG9UfFE9svffEF%M ȉFt$G|$Nu¸([^_]ËOU9~VUEEGGE܋D01E_GD$ ED$ED$<$%<$ 1([^_]EUB O-7$]USB †OE] , *t&tL A, P 1[]øUWVSu} ^(1Ʌ~&1 ~у9tT,y)у9u[^_]UWVS0A NE,E-7E, L E1-7EED$D$D$D$ D$T$UE$t!UB UUB(ɋU~CUMT$$Vt=9, ~#tyڅlE)e)Uǃ, 10[^_]UWVS@ M}W$G(E~w1U9w(~hD,tO L$y؉D$D0$tuED,yD$UЉD$D0$ tD,E9w(E[^_]EyUWVS)@ .M}G(~"1D0$9D0$=#9w([^_]UWVS? Lu, 1~019t% 9P uDŽL 9uۉ[^_]ffffUWVS ? ÆL]ƉE׉UM$2L]EPt MA +B A(EEuFF]^]^FT4$]j 1ۋNv]uF,MzF.1ɉU܉fGU9VUGfGFD$]EG |$F|$3Ju [^_]ËEED$E@,$]@tыuF,U)D$F0$]c@tF0V]K +J K( <K,[+ZR,UʉUrprpP 9MuԋEU܋zUED$<$]KUBEE9FEP1 [^_]ËVE}ǍD$uF4$]p?ÅF4F0V, M܉ً]Ӊ]u܉HXXXX @x9UuҋE];9NG EOsC9~ HOCU4 9C~FO$w CC 9~ pw C Ѝ197~5U?9u1E)EEE1)ùUWVS < IE]SCJr9~ FCr΋M 9~B1)΅K zB 9~ HK B U9 }B}M :u 1)ȍ<?E C EC$E-791[^_]C:}-7-79-79-79S9M 9u M S E-789E9EE)Dž#E-7tS} x }x$}u UM su 9+E-78;}~}낸[^_]É1)ƅ.$1NC E1'CM 1U9 FE~M ~-79B$t ]1]ËE 9B ]UWVS }9 ÂFUE -7Ex$9}h-7P H4 9unfH$p <19} JBzo-7P H4 9u80H$p <19}  0%D$E$hu)-7P H< 9H$p <19} E}x$} x ¸-7}:¼-7} :2u #vt@:u$wvuE$؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )9)UWVS|7 ÁDE-7ǁ3~^U ~W;A$t^U T$$D$-7$t [^_]ËE D$$t$1[^_]ËQ 9U u1UWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVSU6 ZC}M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$|$4${D$<$茸1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8u ⿉P81]Ã@]UWVS 5 BE} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]7BFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HR$x9tC9uՋMQ ztɋQuut duH8 uX8UWVS(3 @EUMQI$0ƅ1ǀǀǀE܉$0EF,D$E$4ljF0MF4EFXFF]^EF^ F$EFE F F8F}É׉΋@Uu;ES ;U MMC9ME S9E-7UT$ D$U T$U$UtSCDADCHAHy q$ YQ0q1~9uL$M$TMȃ[^_]1ɉȃ[^_]ËS S+U 2MS+U :MUSE] MEP UU PUU[]USE] MEP UU PUU[]pUSEU ME]] ]][]IUWVS$/ <E}Uu eiE E Eu,uED$ D$T$<$UEYDž$ ]6GD@.7t 8.7 GH?G(GE G EG$M1UEE}E@,]8~xfHf@uEfx~SE@uJUR#h2u@.78}}$J t$JutE1[^_]f~E@t܉-7fy~ӋUBvuGfd묅t}$:J {뎁T$-7$G}$J G_UEPT$ PT$P T$P$11f]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]뭉U델[^_]UWVS Ò(-7@@Mtƀ37J ya?ED$D$ƀ37@$6[B@d"7#B@t2ED$D$@$ZB@h"7#B@~@.7t $hD[^_]uW~udtƀ37a?Eta?D$D$BL$jZ`@ƀ37a?E*ƀ37a?EED$D$@T$ZB@l"7#B@&ED$D$@L$Y`@@.7[^_]UWVS Ǧ&}ƉӉ$N,4;]u;} t;E"D$E D$ ED$|$$]6[^_]uUWVS &E-7Eԋ3 ]-7]ZJx< XHUE@8@u B8@B B@ ]a?t$D$37E@@D$XEԋ@@HT D$u4$]Hf8E@PhtfEԋsEHȅuvϋE-7EP,11M~9z_{}~r}41҉9} L$M4$]MuՋE̋K,SB9E}E@@%ƋE}9})EU*Ct}EU9/EEPB%9uUEuE}ċE)DžyE9U)E9EEE}ӉʋuEEȋEMȉEЉ]u]9]1MEȉE܋ZE@,}܋xB,p1҉]M؉M9}L$M4$]TuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9Ex$EaE̋K,E؋mEăpSBE܋]؋}̋7N,"XV9EM$^E@8MEԋP]CD$CE$]CD$C$ESPSPU܉EE$]t,M؋E̋E}Љ9}9}r}h}ӋBM E]ȉ]ȋ}MӋBy9nE܋U9~EċEBDM9 tS BDt$B|$]gFfFEBLfF9uE̋sE; _C1ɍ UL$D$ <$]U€w֍V)‰։L$D$<$]S‰EЋE̋@  EȉE]9~]E])؉E؋UĉЋ])؃EEH,E9p]]]E])؋UЋUЉ֙Ӊ]1uu܉1M9| M9]9]9]E؅& 9]܋KȋŰrU9Sf E䍐 E̋@=vuEEE܋Hىωָ   tftEE =wEဃ)ȋ]܋Kωփ~ tftE܋]ЉXE̋BD$ D$ED$$]蚇EIeWdIt$D$$]D-d]a?t$D$$CMčGED$D$ E؉D$|$$]M U܉ MDD$)ȉD$ ]؉\$EȉD$$] EE@T]a?L$MD$$CU܉E܋ML$D$E@$BE܉؉}܃}EUqd^]̋R, ]9]uE]E@,E]EE9E|EH,EE}؅EX]@E܋}ȋE)NjE@X0ppuCpM}UčJŰ;JSHFEĉD$ML$$](da?t$D$$AD$D$ D$M܉L$U$t$D$U@@p$6AD$D$ EĉD$D$$U@|$$xct$1|$$@E̋@D$D$}@@0$]9ct$D$$@D$D$ D$D$Eĉ$&t$D$@@p$O@D$E܉D$ ED$D$$t uD$1D$ ED$E܉D$E$]1a?U؉t$D$E@$]?U؃9uHvtHT1҉Ut$D$E@H$];?U9uUD$1ۉ\$ EĉD$E܉D$E$]|$E@$waa?t$D$$>E)ED$D$ D$D$E$]TE@|$$at$D$$c>D$E܉D$ ED$D$E؉$] H }y D$1D$ EĉD$E܉D$E$]1a?U؉t$D$E@H$]=U؃9u 1E@Ut$D$$]}=U9u ppu;t#t}učNŰ;JXLJEĉD$ED$$]_a?t$D$$<D$D$ D$M܉L$M $tt$D$U@@p$<D$D$ ED$D$$*U@]؉\$$]^t$1|$$5<E̋@D$D$}@@0$]^t$D$$;D$D$ D$D$EYučD>ED$D$ D$E܉D$E$]TE@t ]̋ ;qtE؉D$$]]a?t$D$$C;D$D$ ED$D$EЉ$]E@E؉D$$]a?T$D$$:D$E܉D$ ED$D$E$]SEa?Ủt$D$E@$]c:Ũut$D$E@L$]):uk 3Ea?t$D$E@$]9uL E̋];X iEa?Ủt$D$E@L$]y9Ũu)D$D$ ED$E܉D$E$]|$E@9E؋]9Efuucfr 1t`u 9}tQpt$$]uE䍐 E܋HcfwZ]䍓 T$Uu܋F$NU 1ɋE䍸 E䋀 EE܉E9EBEEUWVS ]-719X‰PtAC:uf11ɋCD$ CD$C D$C$KtB[^_]5C9u-7 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]U  -7$]UWVS u] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$t[^_]FF9u-7 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVS #ut$;#vu[^]UWVS }GDE-798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$wD$D$<$"1EU -7$]UEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVS: ?U} w to1t6~RutF$u1[^_]ÉU$t8U F@RuDžtÉv$CuG 멃UEU  HJHfJHfJU @ E]UVSV [utv$u[^]UWVS # (Mq~X1Q,zQ~>1҉EM׋q tMv$zuME9xԋEM9A [^_]US] t.UӋE ȉt %1ȃ9u[]ËE[]UWVS]} 111 ȉt %1ȃu1Lȉt %1ȃuڋK t4u14Ɓt %1uۋIuҋu9h[^_]1[^_]US èE, t$D$  $fx)0 1[]É$1[]øUWVS0G LU, 0 @ E싃< Eǀ37HApEЅ-7EE䋳8 utayFEԋE%Ey E܋EԋuƋUE99ЅyBU)u܋UE)‰U.E9EEEƋEU)ЉE9gFEԉu܋4 u)y ‹u)֋Uu9Guԅ+^Ƹ-7uu܍t9B~ Eԅ3LD$D$ $/ǃ@ EЋ< EE1ҋ8 EMM܀}EEơ-7>< ;4 ЋM)ȉEԋHAEЅzEEE9E| E9ALT$D$EЉ$$/@P#< ǃ@ ;4 ^J  U-7UfLT$D$$.0 >u Eu@@l8 < ;4 J< Alu, (D$ E$#…y0 )Љ0 p, t}쉻@ }艻< 0[^_]Ë=-7EEU싃8 EMM܀})y uyFȉEơ-7> -7ЋM)ȉEԋHAEЅ < ;4 }xM9M M9M, D$  $)0 ǃ@ < ;4 t@ 8 E܋E9  EL"t$D$$,@ ;8 ~a0 p@ @@xu, XD$E$<y)0 @ ;8 < L<< t$D$@$,0 < ;4 @ u؀>8 u)ʃ-7E䍃  EԍLEfșƍry )ƋE9@M؉L$D$$V+@ 8 EE0u9~1$ 0 ]$uXE܉E< ;4 < -7u܋R,r@LE؍  E0, 0 0 u@ R98 E܋EP,< 4v4F‰EEu@M؉L$D$$*@ 0 yu9LD$D$EЉ$)ǃ< ǃ@ UNE;H@uRFuLf~-$@ D$< D$F $?V0 f=@ @$ @ 0 , tD$ Eԉ$…y0 )Љ0 덋@lLT$D$$(< < E94 EЉEԉu($ \], t'D$ Eԉ$4y)0 $ ǃ0 , D$  $ׯy)0 0 E)ȃ9u@LD$D$$'@ 98   EL"t$D$$^'@ ;8 ~b@ @@xuɋ, t5D$E$y)0 $ f0$U됉Ƌ< , t*D$  $蚮y)0 $ 1ҋ8 EUWVS o tE苃8 -7M19|4 8 @ < 94 -7Eǀ3794 9-7Ea?E)$ JEu ǃ@ E98.@@ltˋM t‹UT$D$$%뵉4 < PBh9}d8 T$t$$GƅtDE;@ t4$8 U a?D$D$4$%uU14 < 8 @ [^_]Ë8 -7Eu@@h9ME4M䉋8 E;0 GE< @ ǀ37p >u~x-7Ua?t$D$$I$mtGUt @@tut$D$$$@@lu$ gmu< ǃ@ -7E4 9P))Ή4 < $ 둋4 xǃ8 Uh qU8 U4 U @ U< 11]U, 5U8 U4 U @ U< E1]ffffffUWVS %-72-7E-7]19u9uV~sF,E1҉MEF~PCH1U 9F~59uuS9~S 9}͉9FˋU9VMIg[^_]Ë]S~Cs,~DUMڋXCӉu΁9u9uu9utɃ9u 37BH8~NHD~GBlthtËuu拐tt 1" +37@ xUWVS( ƉEY37EBH8ˁ:uƬ-7u@D*= }ƨ-7LJD -7Y\A`fAdBt%]a?D$D$ $N EBt8]a?D$D$ $ -7p2!P@EBlhzǁl2ǁh2BxT2@@Tƒth2t h2t h2t h2 t h2 @t h2@t h2t h2EHA\$fǁrǁt"fǁ~ǁfǁǁfǁǁfǁǁfǁǁtmfǁǁtLtfǁǁ~/Rrff@f@@ 9uǁp"ǁt"~&p"p"ff@@9u}苇D %ȋTp"Xt"LJL LJH 2-7E-7E E9tE9tE苘D ZHB~UJr,EEU܉}؉ϋ~HQE% ؉9u9uuҋU܋}D$$]_j1([^_]øE-7ȋtǁl2w-7Ћtǁl2Ntttǁl2)UWVS ëEU MfUfMf]Ǩ-7;7Lftv-7949)-7l2tot"уt>]f9p"t"]fp"]fr" 1[^_]Ét"ufp"ufr"fMfvt]fufEftwft8fXfEMfCfE8fufEfEfE}f9r"*t"BfEfE'UVS EM ]f-7;B`N4f1Dfl2t1[^]ftf/ftTfufft9#ft*fuffuffufffff릸yUWVS$7 <U} uEEEƉEljEf-7;B\ @ frftufv37 I ytX2RtE}|$}|$ ut$D$$-;a?T$D$$1$[^_]øUf cEfx?-7;B\}1@rU f tUf vEf1]ø]  -7ǀTǀX-7 t%D ǂp"ǂt"L u1U勀D %1]UWVS} }M -7l2t^fTfVǀX-7 t)D fp"fr"ǂt"L ug1[^_]f3fthfufto'ftVfmcfuؾfLBD %1[^_]þ뜻닻^ g-7h2UVS A F-7l2tu?€37Rt*a?D$D$$p"7M!A@f@d [^]UWVS H t-7} 3x@tOu f-7f9pdt6l2t*-7fpdQ@E % ЉA@[^_]΍N} f_f|S-7UL$2@$7a?L$D$$UUULf`L$2@t΍N} ff|-7UL$2@l$ 7a?L$D$$bUUULfL$2@h$6a?L$D$$UU-7$UM fxGU-7$sUM f -7f@dUWVS ÅU-7pFFy ;F|# tH4$b [^_]Ét$$zUWVS Uu FFy ;F|# tH4$hb [^_]Ét$$zUWVS -7x|$E$Ɖ<$b [^_]UWVS| Á} |$E$eƉ<$a [^_]UWVSA JU-7tJ } xCH9M ;X9}4xp,9"49M uM HP1[^_]Ë#ָ[^_]UWVSEM UtK xEpu9|;p9~4Xx,9"<79Uu7PH1[^_]Ë4&ָ[^_]UWVS Uztzr BEuNjEBw u)]ZڋOM)ʉ x=_]93O9},_w,9~ ! ΋M9u3GWGu [^_]fUWVS@ E}E E EE E @$]XÅxyGEGE؋E @ G]% upE-7E_E))9@L$ED$<$]؃@[^_]û놃 uG1뼸@[^_]ËG,U؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9r)UԋAFAFA F AF9sڋMA E @EȉE E%AfYE HvJM܉]ĉ}}$]M \_ XG E9u͋]ċ}EԃUt1Mٍr}}ȉ8)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]Q<$vM1 EGy1G1 <$] E9GT G8  <$]T1E D$<$]v1 UԋUЉE  E9:]ȉMĉ:BD|$B|U$]-UBHGfG9}s*w tUv$]uUG 뜉]ȋMĉU UT$-7$&]UWVS u}ED$E D$4$t} u [^_] [^_]UWVS Ôu-78E D$ED$<$tu } [^_] [^_]ffUWVS|- 6E}}M E $]EQw$]E1EHMGEȋGEEċE @M qMMM-7M t[E2 $ ];ÅyEEę)EEĉEċt& uE9GTu G8 )EȋuڋwGEM)ȃM9EEċGEȋE ]EM-7MU rUUEM  / m$ ]LDžyE]ĉؙ)Mˉ]ME Et MuM} EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9ZU@t)G$fE9r)UGFGFG F GF9sڋEȋUUċu}ỦUUĉU]ȉ]UUuEȋ^,EEEF@ED$ED$ED$ ED$ED$4$]&mmuE]4EȋQT$ UT$D$ $M]LE 8 MQA(TE@ 9}E <U1UĉU uKEEEEE E E$]yVMmEEMmEąy1EămyEF$]y)EE9EbEWMFE EĉE_$]KymEHU8mEąy1EċF$]y)E<9e}U&FHGGfGfG9}FD|$F|$]luE$]=|[^_]ËyQUEĉAEȉA $]{MyUQE9ATtNEȃE u{}ω4$]<$qE1|[^_]E $]xyMEu붋E$]=U U T$UT$-7$q]UWVS ãuEE}ED$E D$4$t}EE u[^_][^_]U D$E D$E$]U  "D$UT$-7$]UWVS u}ED$E D$4$tE} u [^_]h [^_]UWVS ÑEE}-70E D$ED$4$t}EE u[^_][^_]UWVS ' ,u-78E D$ED$<$#tEu } [^_] [^_]fffUWVS ÉUM0-ljEDWp1҉]]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}‰ DOu냉1sUWVS( EUM؋ufUވM݋U 1ɋU EEԋ}0-Et$$UEx}P$u܀G$H Ut}EMU E1‹E Et~MލAf qC$WЙDžNE݉Et$E$Uu0Eu1([^_]À}. G}ԅ~Mȃf wC$WDž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVS ƋUE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ %t$D$$E[^]ûu111[^]U P R D$ ED$E D$E$]U蜿 P R D$ %D$D$E$]UWVS] VNj2FEF<\<^t{Ѝ\0-r7%Ӎru<: <&~Hپ!J'JP'EE[^_]ÍFFZ%P0- QuJ{E< v^]v.F<0-]1DsD]}MMލ[{D~Dyuu}M؍\u2<\u7{ESȍэf  ΍ f )ʃ0Qfv)f )ڍ)Ѓ0P}E[^_]ÍJ{P]1TQu<.tt]<*yMl1nVU}uf%p}O0J%}d J]܈ZQUdEVU}f%p}O0JJMf%ctEF =8}Ef%pPU}W0PUEtEHM%+%c֋EE&VU%p0%Bp0%{B2}%*fB %-}O0JJUECVU%p0%B{10}B%/%{B 16}%B*%p0B%{10B}%m%B+}O0JJUE'UB\E%p0%@p0%?}W0PPEUMU܉ȉMbËE%>%tEU܋EFt E%+%;E֋EEL1<1JfKMC|D7<\F=]EPU\EUVS ƀ37t\ t~9t $sK\ EED$D$E $`uI\ tG@t  D.7 X @xT [^]É댋E[^]É\ @uUWVS(J OUEtBEE37E}<$e UT$ D$D$<$ԑu蹵N)) _U܉e)‹M) _UѸg4 )3lD$<$}f EtTH tCp$1҉}܉ 9t-~fuUE܉D$$=f UuF([^_]1([^_]ËP 3l([^_]UWVS( UEtBEE37E܋u4$c UT$ D$D$4$腐}kLЍB)^UeЍBM)^UѸ>Љ)<;kD$4$*e E܋tRH t>x$1҉u܉ 9t(nuME܉D$$d MuՋGy([^_]Ë;k@x([^_]UWVS(觴 ìUEtBEE37E܋pu4$lb UT$ D$D$4$1}-?L) RЍ)ЍlXGEeE)  IȍE) GE*SRЍ)<;l_D$4$c E܋;p_AQ tJy$E܉u9t(~suED$$[c uދF E܃9u؋E܅tЉ)EkD$<$^ -VUE}<$\ UĉT$ D$D$<$bMĸ-?L) @)ЍlXAE-?LeȋE) @E)AM*SRЍ)l_UD$<$] Ute}tu}cu }uFEE3l$z<EEk$J=p_$0>렃}u E$1҉UffffffUWVS1 6E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUj Uƍp@Hπw09}맋E D똉Ufj UUWVSj k48,.օR@08G4<11$rD$ \$4$01󫋅0t=1(}J90t <u 90u狵(P)1~u,H]Y8^4~!%u~V%8H4X0@,q9r0t$$4P8C,s0K40u4` 8$4ϧ8` @0@4$4蛧8G,_G0Gƅ`%40- Dž,Dž$Dž(Dža`0:~LJwDɋ4nXKJw! .ʋ DNt{,4ʍ\qЉ,'~>aDž,>~`B<=w^4nW0)?(t9,> z$t-.(M,Dž,Dž(hDž$YilP[J߸ V8uo'dwEOI PDEG/8W,G4G,[^_]É,] CEP0 ]P,&Vҋ4xoE EP(, B08H4X0@,T9BtD(\$ `T$0\$ȉ$4Ft8C412<'urR1҉,,0O0PD]PEEP08P4H0@,Z9PJ8K40U{UJP,0$4T 0,OPDŽPUw}7D$$>D$t$$-‰E$20UtYEE[^_]Í$7ƅSE1ҋEEut$ D$$eM$-@ x Utb}ut$1tD$$)EJ\ D$$$5 Ex t;MEt$FtD$$轰 D$$觰ED$D$ht@E$e< tEftUft IA(Q\uEt E1|$t!D$D$$RB($tD$D$$¹RB끃}, D$$ï#tD$$譯UVSW \EtD$ E D$ED$E$ƋEt$Q,[^]fffffffUWVS ƉEωD$$I tB4$G ƀ?u1)9tXzzt"D$|<$ …uۉ<$G 9t 1[^_]Ét$ED$<$~[^_]ÉUt$ED$<$XUu[^_]UWVS 5 *uEUt E<t]V  [^_]É΋Ex %1ji˃1҉9rExtftEx(1}fWVu~9Vt"VT$<$]/ljFVEptft]CPSD  Ћ]XgËuVf;h{CftMWҍTRӉEf}]}^ Qu F 8vE9uڋE}f8Pf]s} H u yf}uHD$$%]]C ExD$$!]诗‹EPn!f8t;Pft2]{u0 ftXHt݉f8pxE;x T@$`|$D$$]% Ex E@$E11MȍV HnsffvrRPMu v@@1҉P 9rjD$$]l]C(11ɍ&mC}G G$t$]肚G$uyf fE@$$]%Ex D$<$]誕]C$f$ffs@sU@@Jru9U@}t*JrHUznnJrfM6fy'bUWVS,腓 ÊE׉MT$ \tD$D$ E$3=v(&Q Q 8,[^_]D$E$jƅtʋE$@ UU܉T$}|$ D$ED$4$&ltJUMt@:tOE$Eǃu(EPEǃu E䉃l 14$m,[^_]ËE܉D$ |$BD$4$ ku΋MUD$|$E$致E=D$E$iƅUWVS։Dž)t Pv9s:ut<:t׃u)u͋[^_]ËrtftƄE$txDžiDžUWVS  ǃl dt$豼8/u$5… ${vt$tt!4$‹ [^_]Í$At,D$ tD$D$<$04$t [^_]Ínt$޻TI/@$Wlj($<$_uDžD$$Nj$ OmtQ<$)4$‹4$|$$)t4$$q<$tmtl 눍ctl wUWVS艎 ÎEEE EUUD$$rtƋM‹E1lj4$tKMUEt81ED$E$> t' uMȃ[^_]ùȃ[^_]ÍHPEEE[^_]US賍 øK Eu[]ÍED$E $+[]UWVS֋N ufS[^_]Ë~Of JN fJy8VӋ6s!uu [^_]äftuutYyZfUVSČ əƋ$NF$CF$8F@$-F$"F $F0$ 4$[^]UWVSS X}wu G9r [^_]Ått$$dtw[^_]É4$UWVS U MuR u+ftO؃tXf;0t&nt(suXDuI 1ۉ[^_]ËEx DC볃UWVS x }E 0@ Eu Ct8t\tɀ^tăt8uH[^_]ùx1[^_]ÉdUWVS5 :uNE|F9sXtd|$$LtH~NU fFF}t<]fFFF [^_]Ëu1[^_]É<$렋}<FUWVS<荂 ÒE@ EE@ 0t$$sM4$E@E܋uFX1tftE$谇u}D$|<$_ HM|$E@ $E$/ xDMED$E@$M;UBNju`P0@|$E@ $k$EP/ Ǎ@ED>D$E@$tUu$辆EE<[^_]ËMAOMփEtfEtǤ$vE܉$kEP p,@ @(@$@,׃ EtU?Wx0My ɍL L$ T$D$E$$t8}uWfUE$謅Ep@@LEMA@AHADALudfx= 111D$ T$L$t$D$ED$ ED$D$E$tam7GED7Mnts{HP|1뉃}t>px111rx@11buE4$襄E<[^_]px1113u܉4$}֨u8uDMUUu$WEU r}fm몍u$E0GU7UWVSS~ XUJEtB9swt$U$cUt]rJ] fBB ]fBxzE:us:u.u'EBB [^_]Ëu1[^_]äftu%u0tۉ4$zU]EfUWVSH} MuVzF9sHtT|$$ct8~VM f FHNMLF [^_]Ëu1[^_]É<$yUWVSX| ljED$,E$} D$|$]_xD$|4$] PU4$]N* = t<$7* = E$]* = D$$P]5}ÉE܅F@ t$$<Et E 2t E D$,E$qEN EEE0-E̋EE u<.tjDy@u붋}]}5 D$ED$4$]蕖ËE8g E E܃x f_EĉUED$ EԉD$E썈uL$E $@EċUڍwEJЀv)ύ)ȍLD$4$P u [^_]ÿU:o 7|E=w l]1]UWVS o |u4$ UT$ D$D$4$I}-?L) RЍ)ЍlGEeE)  IȍE) GE*S)ύɍlD$4$> u [^_]ÿUWVS4n {ufF(}ȉ|$$ t4[^_]É<$C1t9,ufV(4[^_]UWVSm üzu  F.7fV ED.7 4$@V(EfD$FD$ $U菏=UwDE |)ʉM싆t7T$UD$E$NU9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$D.7[^_]ËUыU|UVSml ryutgF$qF$qF$qF $qF$$qF,$q4$q9 t 1[^]ǃ k x @k x @tÍAfffffffUWVSk æxlj$U D$$ & Et$UT$lpU$19UuED$$ R& 1[^_]ÉUED$$ 2& $3UD$3UD( UWVSdj w8EE1EEƍEE> tqE9D$t$U$1Utˋ$2p$2UDŽp( 5Euu ;t1< tHv0FIU$2p$1UDŽpϯUWVS<#i (v8U11ɍˌt6u& E+<ȁ<[^_]Ãpu@W@0ƃ:uVƅ/lFul$ё9$貑  Ή$k0D$Y0D$D$ D$D$o4$K{qD$@|$/$t:tRP:uVpƅz빉1$L/Ή$[2Ή$*/D$/$ /D$2ω$.D$.B$E$/u$ߑƅD$/4$5/tY1ɉL$T$/T$T$ L$D$4$Tt$uD$${"1҉T$T$ L$D$4$빉ouvFUWVS $uT$ U MT$L$$ L$\+u`[^_]ø'UWVS ~` ÃmExw|lMpt_ƃtAkƍU$(ED$(UED [^_]Ãu$(Ɖ [^_]UWVSp_ l}EU 8uM1ɋ]p3lMpmQm8@E~Eߺ81xEM}E )|$t$ʉUM$]M&MUЉ΋ʉU$]P'}D$A'UDk !\$T$$]|]U+p[^_]ê0f%.t&CD$D$ ]#D$D$@}<$Gj뉉f>~$E~LSC9u1Uf~7g]u ]USt] yjEPw*pt6 -[]Ãӌu$([]US] $jEPw*pt -[]ÃӌuU T$$[]UVS \ iuD$:4$ t!D$bT$$ tE D$4$֏ [^]K - [^]UVS J\ OiuD$:4$t!D$bT$$Q tE D$D$4$# [^]ËE D$D$4$ [^]US [ hEMPw*pt - []ÃӌuL$U T$$# []USa[ fhUBwpt1[]ÃÌu$[]UVS [ huD$:4$at!D$bT$$ tE D$4$譎 [^] - [^]fffffffUWVSZ ǖg}E1E xt=1}t ƒu@u[^_]UWVSĀZ g}E|8xƋE  1@ E0 E|1E]EH Eƒx  EB A ǁE9uʋE%u, 0 < EpxEPMHx }1E]uJ˃4x MN K u9uʋ]uE%BzBE9yxE+?1[^_]ËU 1ۍU @t?ELt鸓$I )9uu1믋}@ E1ۍLE0 EEEu1}}}8KtDAuEƃ@E}t,ى%I$))9D E9u }u _]uE^@],1҃DD [ u̓E9uE, a:!@t$EDu۸@u܋} Ƈ ,E}8L8 0u} ] ]E M }~Et M  ЋU 1ҋMDŽ  r1ɉ]] u]U1 L ȉу9uMՉʉ EMU1 L ȃ9uMՉʉ MEE@ttM Љʃ Љ Ѝ Љ ЋU‹ELt 1itEUEEt @FEǀ  ]UWVSXoT lauE EM8ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE, EEEƃ4x  EF A Eu1E1EE܉}ԉEEƃ4x  NjF A E؃uĉ}EEHE, EEˉuEE܋E؋uu؉EEuuEE]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ ]3 ]3 ]3 3 3! 3" ]3# 1EEԋ$ ]3% ]3& ]3' 3( 3) 3* ]3+ 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u u3 u1E䋼$ u3% E1ljE3 3& 3 3' 3 3( 3! 3) 3" 3* 3# E3+ }m1]E%MɁ ȉEE%MɁ ȉE1E1 EEE0Ãx  NjC A EuċE8upuE+u!1X[^_]ËME 4UWVSP4P =]E̋uM M8EЉNjE19$}܍]]ȉ9u<$…E<_t:t< t<:tMAE̍$v}ЋU+ZP[^_]ÉUĉ}؋}1D$ D$E؉D$$u+EҀ09uE؉$tEԀ8*sx0iE̍'vdEEEEEyD$ D$$<$]G9tD$ )D$|$E؉$Af}2ae}sha1f}1 }argo}argo}argo}n2d}M̈ _ȍ  MEE Ȁ`QŃ?}<9E ЉEE9uËUċEEԃEM̍ MEM̍M/^Ń?}t}<9U}Ĉ  ڃM4`À@~^뿍^҃?뷀@~Q>Q҃?3}EԉD$4$p< .t&U<:MMEM̍ MME&}n2idN}DEԉD$4$대}EԉD$4$ nEËED$ T$EȉD$}̍ $,EfM ȃ?9K?9K ?9K8EfM ȃ?9K?9K ?9K8CEf?9K ?9K 8CC EEԉD$4$I2}n2i]֑UWVS)K 2XE8EEXUэuuUS1r 9uZ9MuߋU$U+u[^_]Ë]^UWVS,J WE؋U8ENjE1Z}uU܍S1MJ 9uMZ9uڋU܉U} D$ D$|$<$uEUZ8uECу9uF9t܋E}U+u,[^_]ø]}UWVSDI VU uU8‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$&S @D$$ T@D $9sÁ t׉D$@BD$ <$L$ $?293?!~9.?J9)1?߲9%?+59#?x}9#DžTDžJD$$KD$$K(D$$(P489ȉ )ڋ09<} D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$n$D$$!tD(,481։ 1 <90Dž|Dž@mDž ^DžODž@Dž12UWVSE NjREu 8‹E1D$D$H $4yDžDž4$腌8$u ~vt$4$Ɖ$DžD$$8vu[x=uUT$$ D$$P DžDžDž DžDžg|$4$3ptjtmt2$@I1U+LĬ[^_]ÍT$$x*tT$$y6OT$$xۋ%t$6v$uDž!t$>v$DžID$$ƉDžDž|Dž[<Hv2BIڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/Ӄ? ЃA! = ЅiD$$t*D$ a7D$D$p$$WF 4$|$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$sD$D$4$sD$D$|4$sD$D$p$s$%D$FvD$ -$ՅUVS-? 2Luv$SD‰)Ѓ[^]øh`UWVS4> KÉED$Zvut$u 4$u3D$ ED$${EE8$E $]Ch`)‰UE E h`9tt$u+E E܋E$]2NjED$ut$u t$u܉t$ avD$D$bJ E$J t$|$ ML$D$E$_}v/lj|$t$ ED$D$<$/9]uىE D$E܉D$ED$ED$ ]荃jvD$D$b}<$U^D$O O ȉD$$9EPU9uD$]J J  J ȉD$$EPU@D$D$4$pE4[^_]14[^_]EWfffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSƉEfM䍾}܁H1۹1҉}f;]ǃ? u}19uEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uu9Muƃ[^_]ÉǻLUWVS8 E9ɍL  dH USHlf`TEPƋ@D1\f;`6 uދ\19u111ۍhXdLD1` Ѐtfu Ѐu拕`1Љd1f< Ȁu1hXLTdPhxP9GTP0`DP1\f? uዽ\1Љd1fH Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@D98uԋX1ɉ`T1f|=؃ u9uѻ@TXO9uu⋽`E؉`]BbJ9uߋHfǂK $2?ƂK aHK ƄK $,T$ uvT$D$$7D4$`D$HD$T$c14U+u{[^_]Íxƅ??tOlEȉDRHuUWVS/ <u(} 8E14$$?$u 1H$9u勅)ȉx  @4$ $D$(|$4$eD$|vD$4$KT$|$4$/}<$$D$(L$<$T$T$<$$D$(L$<$|$0, $$lj~T$,D$4$Dž0Dž4Dž8Dž<$,D$4$7t&D$uڋ(D$4$uڋfǃ,L $1ƃ.L $ D$D$/L $ ND$x~vD$ B$Ot$,$1s$D$(D$<$z ɋ D$,D$<$D|$,$fB<$ʉ)Ѹ%I$))Љ)‰ :D$,D$<$ ɋuo$D$(D$<$9$D$(D$<$a D$D$<$: $D$(D$<$p D$D$<$ ?,L  L D$06 < ȉD$$ L  L D$17 = ȉD$$= L  L D$28 > ȉD$$ L  L D$39 ? ȉD$$ L  L D$4: 5 ȉD$$w L  L D$;T$$M L P L @D$D$,$]E+[^_]À$')MDž0Dž4Dž8Dž<Dž Dž DžoUWVSX( a5MMUu8ƋE1@Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\E[1ۍT009u$.D$@|$<$董E D$D$<$x|$$袥<$D$@t$<$JD$t$<$0|$4$`E+[^_]Éu4$nUT$L$4$Ңt$4$Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TjfUWVSQ$ V1utJD$ED$4$NjE9t.8u)8"tE 81[^_]Ãu1UVS# 0EU ]~Í у? H9u[^]UVS# 0EU ]~Íу? H9u[^]ffffffUWVS8Q# V0ƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$t8[^_]É<$5uEĉ|$4$Eă8[^_]U" ­/Et t&t1]ËM t6v]ËE tv]ËE tv]Í-v]Í>v]Í6v]UWVS:" ?/u} 4$9uw[^_][^_]UWVSd! .u}$}(E($EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$a…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$ <$&UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$)8UtE(D$}<$} E0D$E,$k <$%jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVSv {*u4$xu1҉[^][^]UVS> C*u4$@u[^][^]UVS *u4$u[^]}[^]UWVS )}u <$ …uA}wLU>…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSXF K)M $.ƉEE$0ljE4$#ƉEE EEEED$ML$}<$1t.1EM $^!M $S!4$K!EX[^_]ËuE$EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVS '}u <$ …u8T…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSc h'}u <$b …u=…u+t"11U2 у9uUɃy Ѓ[^_]úUWVS &}u <$ …u=h…u+t"11U2 у9uUɃy Ѓ[^_]úU ‚&E##+Pፂv]Í-$]Í4 ]Íl ]Ív]Íx]Í2x]ÍEx]ÍVx]Í ]Í8 ]Íl ]Íx]Í ]Í ]Í ]Í ]Ív]Ív]Ív]Íw]Íw]Í%w]ÍBw]Í^w]Írw]Íw]Íw]Íw]Íw]Íw]Íw]Í ]Íhx]Íxx]Íx]Íx]UWVS ' ,%EwrE$c5NjE $V5ƋE$I5E|7E$ 5EU׋E$4ƋE$ 5 [^_]Ãu$tffffUS o x$U T$D$U$SK []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVS]u 1ɋ΋T11Tu[^]UVSW \#u Ee…t5҅u.URу+?҃/ [^]UWVS É։ϋMER)Ѓt$9uuE [^_]ÃEE9sDE11փE? كCwʋE9EuljUt)?UZsEE9rEE [^_]UWVSEUEEEEM4u}Ov(}W];;}}UM0~^z) ҍ^!ڻZ) ! ڍ~л9) Ӄ! ˃+Ӄ>΃/փ? ҃A! ځ}w ҅Uu}M[^_]1[^_]UWVSE0 wG׉1w7  r-у0 v9t}0t ؃[^_]Ã9t1ۉ؃[^_]UWVS * /u} FEFED$E$O?$ug$ED$EUT$<$u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=u}tUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSXY ^}EE8UE1D$E$wƋẺ$-E+} f$OME Eĉ4$U9PMMȃ/MU)ƒ$v=yM}BEŰB8D$AYUĉT$ D$D$u҉uȉ4$I4$N‹E9\BPBMыE)Ѓ+$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$_I4$ǔ9M@}uȃoMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$H4$<‹E9JBacMыE)Ѓ,p=yM}EŰB0D$UĉT$ D$D$uȉ4$MH4$赓‹E9BEЋM)уf$xqE̋H@$i)ƉZf$E̋0QG}̋O $N1}E+/EX[^_]Ë}ȤA}f}ȃ0f0ft&"ffvE}}qM^rEM)M(W}ȃ}f}ȃE҈AyuӉfE҈AyuӉfE҈AyuӉ fE҈AyuӉ$fEn)UMR)уtu]UVSU ṽщcw[^]ffffUWVS_ `|$`Ѝ$$X03ps$X$\2z9uً$XA$\A$`A $dA$hA$lA$pA$tA $xA$$|A($A,$A0$A4$A8$A<$A@QD5т歁RQ$$AHQL5l>+h$$APQT5kAكD$ T$$AXQ\5y!~[D$pT$t$X$\D$PT$T$x$|$`$dD$@T$D$$$$$h$lD$(T$,$$D$xT$|$p$tD$T$$$D$hT$lD$`T$D$06_D$4:OD$8+D$ $D$PT$T$X$\D$pT$t$$D$8T$<$$$$$$D$@T$D$`$d$$$$D$0T$4$$D$xT$|$$D$(T$,$h$l$$$$D$HT$L$$D$hT$l$$D$T$$p$tD$ T$$$$D$XT$\$$$x$|ȍ$$X3J3Z3 3ZX9ue[^_]UWVS]u {@1ɼCg jC;ʄC gC+Crn+C,hC0kAC4كC8y!~C<[ڍ~@M]u 01pq]u11r9u]u 1[^_]êCf8fUWVSLS XuE 8U1҅P?EEEEEEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$tFXF\FPFTUWVS]Es8U -ST SP!<}J`)ЉE< u zeSC@SDC@SD1EU19EsH{LS`#ǃE}} =%M ȉEC@SDEUC@SD1U9иEs11sH{LʉMM逋E)=w}U `< u s,uu1[^_]äftuauit11t&fuUu<oҹ`^PffE pE땸+UWVS lj(UE u8, M1ɅH?fM?W0E1Dž2Dž6Dž:Dž>0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$$&$p 1߃}rMEuQEuHD$\$$$D$$(e1,U+[^_]äfEtD$$$($tBXB\BPBTD$$D$$$Ǽ$t맋(@UWVS\ ÙML$} 8D$‹D$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$T΋9EAT AP1F@VDF@VD1FHVL%t$FPFT)ȍT`D$D$$^V`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$~n!D$0 un"D$0 Wn!D$06 9n"D$0n!D$0f m!D$0Hm!D$0* m!D$0 6m!D$06@ m!D$0Igm!D$0 Im"D$0q+m!D$0v, m!D$0Xal"D$0:bl!D$0l!D$0|l!D$0gwl!D$0NYl"D$0;l!D$0l!D$0h6k!D$0Jk!D$0,k!D$0k!D$0k!D$0,ik!D$0mKk!D$0-k"D$0x k!D$0Zj!D$0?EEEpD$D$$]}}GU܉B0G??E VEX}E؉mE؋E@N?EX څ}wOE ]UԋuM؉]]BƃvUԋU]uM؋]EȋM)ȋuFMA :E@O?EЉEEE_ E}M̍}WPGX WTG\GG?} mmEԋE@H?}uЁxE܋UĉP pUԉxuUVߋuԃItftE@t E@ \ )UUԋEHDM)щHDE@uFDF:?9EP UR$tB1ҋ}G9?E@;}W$tB}GDG;?}wCE@Uԋ]uMBƃvUԉ]uM؋}EG< }E̍%XU܉BE@Q?UBD?mmEԃ} wCEUԋ]uMBƃ vUԉ]uM؋}]SdCh s`}mw ) }E̍ U܉BE@Q?Uԉ]uM؋}uȋE)} 老B??or]ԉu}벋Et1] 9uE|0C$tH$MtKD;H(s ACDEuEP)uuԉ E@??E21] 9uEE|0C$tHMtKD;H s ACDEuEP )uuԉiUԉ]uMUԉ]uM؋}uȋE)}ԉ]u}W4])Ëw89)W,ƋEPD9sȋ}9s)E)‹]SD}9u}ċEPD @E@R?E&А{9UsBE]ԋu}MCǃ9r]ԉu}MظЋ}!]CDCD})U:f*EEE@P?uȋE)EJ c M)ȋ]]]MYl]ftYt]9]U}E؋UMyQ?x ft }E̍ U܉BAQ?EE1UċuЅ2 E}GDuGH?Uu ЉEE!ȉp@U9Us|E5]ԋuU؉}}xCǃE!MMȋMMHfM@M9r]]؉uu}U؋Um})}؋M}v]ԉu}EǀXPHX׋E!Hp9Es_UԋM؉}؉]]ZBE}E!u4E~v9rĉUU]M؉]m)E؋]艃sD 3Eǀ@??Mu)ƋE@D9E@#E@ u}UU1Ez@ t$EԉD$UB$]#cUB)uuԅ=REǀXPHX׋E!Hp9EMUԉ]E@`E@ 9t$EԉD$UB$]ybUB)uuԅR"EpHXL@K?9]sB}^Uԋu}MBǃ9rUԉu}MظЋU!Ћ}GHU)]m)E؋U艂rDE@M?U4}wC}]ԋu}MCǃv]ԉu}M؋Et }@$t@0NEB))9E}E̍%XU܉BE@Q?}/]ԉU-}E̍c{EPD@B?} EEUԉu@}E̍6|]܉CE@Q?QqItDUЋ])ڋ]ډD$T$ $]̅`EHU܉J0X xEpEu99E̍|U܉BE@Q?EЉEE}U̍{M܉QUBQ?mmE9s55]ԉƉȉs9r]ԉȋ]M)؃1u]M؃w-E̍Y&]fDSt9uE@lu荆4FpFPFXD$FXD$FpD$ D$FtD$$]n}{]܉CFQ?]ԉu}UT$UEԉD$}G$]F^GUzU}E؋}uȋE)BEԉu]?EED$ED$}G$]]G7}E̍|{]܉CE@Q?} ։uU! yf}q<9}swU}]]؉EEIPUuU!Muu4NfMvM9rEԉ}ω]؋E]M)ȉ])E؋M艹EAD<"E@l@E?1EPL@I?]K9s5\]ԉƉȉs9r]ԉȋ])؋MF]tKrM}uMEE@G?} }uȋE)EEP$t EEt E@ E@6?EEfvPjEfED$ED$}G$]c[GGEE}UUԋuȋE)EE>Eԉ}]>@ WlaE@l@F?1E܋UĉP UЉPUԉUPEUPuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS | }u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$q\ML$M L$$[\9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS${ Eԋuu8E܉NjEEFE~@@}S?}GS?wH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃUEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]fffUWVSs E}Mx11 rtE xfDU9uEExfG0UofxZUWVS4d q}̉ÉEЋ@,E܋{t-Ek@^S,sɀ @\Yl])…A8D$ T$D$u4$]x-FlF\4@u FE@@\Yl])…x?A8D$ T$D$u4$]-FlF\1n1N1w1fEP}]ԉU}]ԉUt}]ԉUc}]ԉUR}]ԉUA}]ԉU0}]ԉUUWVS3 @} EJEqEp3 Y}OE@ M苔M9~(uaE9tF}LDDF|EE[^_]D$E$E@FtFl9F\EXYtYVDFLfDBDD$D$$dž   9TE,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS 1 >EuE EM}EEEEE U$o81f8]vEFF ^$}uEEG} }UD$D$F($V ÅUF0@*P@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]A|A13u3 eEF$EF F( [^_]øCE` -@F4$}U ED$ED$D$D$D$ D$E D$E$]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@ CL{DMqD-{uvuju^CMQ+QS $ | 0 E[^_]älfb.t&ft.t&`fV&ft&fu5AfY{8f3f+0f(-f%*$ E1E%>* G7UWVS8$* -7EȋM }׃}TuĉU 2A3؃u߉߉UθEEEE]ȍỦuEʋ1E؋u3ruԋM3JMЋ}3z }}3z}܃<EEEEE܋EU U҉3tRET  }9`U릋}>X8Xr‰]f9]s‹EƋE܉D [^_]ËEX8Xrf}U냉E܉D [^_]UWVSLÉ֋EЋJ9}A EǃPǃT=1E1M̉ыU"P\ ƄXE9tf<ufD9uM̃YẺMM}ȉuK}11҃P\ fƄXU)‹}}t T7)t4}뤉MMuEFM̉uȋuЉuM̋uȋPM}̉uu9B3XEfpfq~` UЉv}` UămẺP` ` }Љ6` MȋTMEUĉX MTMȉT Ѝ UȍUffXEX8*%MuET` Eȋ}P FE̋AEAEAEč< 1mu1 9r EЋ}fD}<ET PEE]<)ދ]4 ]EtD9}7]Ѝ DD]9}EfA9u|‹]fC< ]9{11uK: fNuExBuЍ|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]ȋ}tEčPUȍ4C: fEȉC< ftfC< fK< f< Uą$=uS< }ȅt>uă\ 9M|uЍ<L9t)fWmuȋuĉ뤋MċEcȪf1E*ȪfUWVS ERfDHDE1E69t*9}tuf| 1]9Mt>9|9}6}f| tK9U19Muƒ [^_]Åt49]t Ef| Ef u1]z E$f u$1ENf t1E*]1UWVS BE%Z]\ ]1һ}܉fMMc9t|~ | Uf UU)9fGHOOGPWW )UUDu  ډU ʹ)9fGHOOGPWW )ڍL0~E fOWZ_WGX_ )fEu99E1EM9MUUUUVU9D$U:^NjFD$U$0tE 81 [^_]1 [^_]UWVS - 2 }GtUD$U]ƋGD$U$x0t+4$P=yarauE 0輺 [^_]É4$r1 [^_]UWVS õ }GtUD$UW]ƋGD$U$/t+4$Ӥ=tciduE 0? [^_]É4$1 [^_]UWVS3 8 ED$E D$E$5tSEt4}D<$\ƋED$<$h/tE01[^_]豹[^_]虹[^_]UVS åut$E D$E$袜t.yaraUFƅu [^];0[^]+0[^]UVS1 6ut$E D$E$3t.tcidUƅu [^]̸0[^]輸0[^]UEU E MMM] UEU E tcidMMM]UVS ÉE D$E$vƉ$Ǣ=tciduE0[^]1[^]UVS4 9E D$E$EvƉ$w=loobt 1[^]É4$ŊU[^]UWVS E$ډt,ƉD$E D$E$vlj4$M [^_]1 [^_]US ÆE D$E$uUT$$dA[]USH ME D$E$YuUT$$A[]US E D$E$ uUT$$A[]US E D$E$tUT$$)B[]US âE D$E$tUT$$WB[]USd iE D$E$utUT$$`B[]US+ 0E D$E$8t,ƉD$E D$E$`olj4$( [^_]1 [^_]UWVS Z _E$D$7t,ƉD$E D$E$nlj4$ŗ [^_]1 [^_]UWVS E$D$y7t,ƉD$E D$E$nlj4$c [^_]1 [^_]UWVS ÚEU$T$7t,ƉD$E D$E$9nlj4$ [^_]1 [^_]UWVS 3 8E$D$6t,ƉD$E D$E$mlj4$蝖 [^_]1 [^_]UWVS E$D$6t,ƉD$E D$E$qmlj4$9 [^_]1 [^_]UWVS k pE$D$66t,ƉD$E D$E$mlj4$֕ [^_]1 [^_]UWVS  E$D$5t,ƉD$E D$E$llj4$s [^_]1 [^_]UWVS êEU$T$q5t,ƉD$E D$E$Illj4$ [^_]1 [^_]UWVS C HE$D$5t,ƉD$E D$E$klj4$讔 [^_]1 [^_]UWVS E$D$4t,ƉD$E D$E$klj4$J [^_]1 [^_]UWVS | ÁE$D$F4t,ƉD$E D$E$klj4$ [^_]1 [^_]UWVS  E$D$3t,ƉD$E D$E$jlj4$胓 [^_]1 [^_]UWVS úEU$T$3t,ƉD$E D$E$Yjlj4$! [^_]1 [^_]UVST YE D$E$eiƉ$藕=gntst 1[^]É4$'tU[^]UWVS E$'%t,ƉD$E D$E$ilj4$j [^_]1 [^_]UWVS áE$$t,ƉD$E D$E$Gilj4$ [^_]1 [^_]UVSB GE D$E$ShƉ$腔=atadt 1[^]É4$vtUEt 4$vM[^]UWVS ED$E$tt,ƉD$E D$E$uhlj4$= [^_]1 [^_]UWVS o tED$E$4ut,ƉD$E D$E$hlj4$ې [^_]1 [^_]UWVS E D$E$gƉ$P=gntst 1[^_]É4$$P$UDžtڋUT$D$4$$t U:[^_]É<$.UVS ÈE D$E$fƉ$ƒ=gntst 1[^]É4$A$tU[^]UWVS & +E$V"t,ƉD$E D$E$flj4$虏 [^_]1 [^_]UWVS E$$"t,ƉD$E D$E$vflj4$> [^_]1 [^_]UWVS p uut*t$E D$E$%flj4$ [^_]1 [^_]UVS %E D$E$ʉƉ$c=loobt 1[^]É4$yU[^]UWVS E$xt,ƉD$E D$E$lj4$9 [^_]1 [^_]UWVSk pE $jxt%ƉD$E$蟊lj4$[^_]1[^_]US E D$E$ˆUT$$/[]US E D$E$艈UT$$F0[]US ëE D$E$PUT$$0[]USm rE D$E$UT$$0[]US4 9E D$E$އUT$$0[]US E D$E$襇UT$$0[]US E D$E$lUT$$%1[]US ÎE D$E$3UT$$p1[]USP UE D$E$UT$$1[]US E D$E$UT$$1[]US E D$E$舆UT$$1[]US êE D$E$OUT$$1[]USl qE D$E$UT$$ 2[]US3 8E D$E$݅UT$$ 2[]US E D$E$褅UT$$2[]US E D$E$kUT$$2[]US ÍE D$E$2UT$$2[]USO TE D$E$UT$$$2[]US E D$E$UT$$12[]US E D$E$臄UT$$22[]UWVS çE$D$#)t,ƉD$E D$E$lj4$ [^_]1 [^_]UWVS? DE $D$(t%ƉD$E$llj4$豈[^_]1[^_]UWVS E$D$d(t,ƉD$E D$E$lj4$N [^_]1 [^_]UWVS ÅE $D$(t%ƉD$E$譄lj4$[^_]1[^_]UWVS $ )E$D$'t,ƉD$E D$E$Clj4$萇 [^_]1 [^_]UWVS E $D$D't%ƉD$E$lj4$5[^_]1[^_]UWVS g lE$D$&t,ƉD$E D$E$膂lj4$ӆ [^_]1 [^_]UWVS E $D$&t%ƉD$E$3lj4$x[^_]1[^_]UWVS ïEU$T$,&t,ƉD$E D$E$Ɂlj4$ [^_]1 [^_]UWVSH ME U$T$%t%ƉD$E$vlj4$軅[^_]1[^_]UWVS E$D$o%t,ƉD$E D$E$ lj4$Y [^_]1 [^_]UWVS ÐE $D$ %t%ƉD$E$蹁lj4$[^_]1[^_]UWVS 0 5E$D$$t,ƉD$E D$E$Nlj4$蛄 [^_]1 [^_]UWVS E $D$N$t%ƉD$E$lj4$?[^_]1[^_]UWVS q vE$D$#t,ƉD$E D$E$lj4$܃ [^_]1 [^_]UWVS E $D$#t%ƉD$E$;lj4$考[^_]1[^_]UWVS ÷E$D$4#t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVSP UE $D$"t%ƉD$E$~lj4$Â[^_]1[^_]UWVS EU$T$w"t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVS ØE U$T$"t%ƉD$E$~lj4$[^_]1[^_]UWVS 8 =E$D$"t,ƉD$E D$E$U}lj4$袁 [^_]1 [^_]UWVS E $D$!t%ƉD$E$~lj4$E[^_]1[^_]UWVS w |E$D$A!t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVS E $D$ t%ƉD$E$?}lj4$脀[^_]1[^_]UWVS ûE$D$ t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVSS XE $D$ t%ƉD$E$|lj4$[^_]1[^_]UWVS E$D$t,ƉD$E D$E${lj4$b [^_]1 [^_]UWVS ÙE $D$_t%ƉD$E${lj4$[^_]1[^_]UWVS 8 =EU$T$t,ƉD$E D$E$Wzlj4$~ [^_]1 [^_]UWVS E U$T$t%ƉD$E${lj4$I~[^_]1[^_]UWVS { ÀE$D$Ft,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS E $D$t%ƉD$E$Ezlj4$}[^_]1[^_]UWVS E$D$t,ƉD$E D$E$xlj4$&} [^_]1 [^_]UWVSX ]E $D$"t%ƉD$E$ylj4$|[^_]1[^_]UWVS E$D$t,ƉD$E D$E$xlj4$e| [^_]1 [^_]UWVS ÜE $D$at%ƉD$E$xlj4$|[^_]1[^_]UWVS : ?E$D$t,ƉD$E D$E$Xwlj4${ [^_]1 [^_]UWVS E $D$t%ƉD$E$xlj4$I{[^_]1[^_]UWVS { ÀEU$T$Gt,ƉD$E D$E$vlj4$z [^_]1 [^_]UWVS E U$T$t%ƉD$E$Gwlj4$z[^_]1[^_]UVS E D$E$iuƉ$}=gntst 1[^]É4$}tU[^]UWVS b gE$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS E $7 t%ƉD$E$US ÛE @tURtFtAD$$UbaU [^_]H4$l [^_]1 [^_]ÍAUWVS ÞutJ 9u@~ G$…t,Ft/D$$U`U [^_]1 [^_]ÍAU0 -Et 9t1]Ë@ ]U Et 9uP@tt ]1҉]ÍA]US Et 9t1[]ËU tH Q9Ur@tD$E $_[]ÍAUb _Et 9t1]Ë@]UWVS' ,}t; 9u1G $ƅtGt"D$4$j_[^_]1[^_]ÍAU Et 9u @t]1]ÍA]UWVS Íut 9t 1[^_]ËU tM 9uFtA F EP$UODžtŋE HɋUtOFt@L$D$ cD$T$<$cF~}~ t$sA븍AUWVS ut 9t 1[^_]ËE FtE $qF EH $M…tFMtI} |$D$ cD$L$$UcFUV}~ t$oA믍Y}D$ `D$D$;4 $zUS Et 9t1[]ËM tM 9uL$$)mUS ÚEt 9t1[]Ë@tU T$$ar[]ÍAUSA FEt 9t1[]Ë@tU T$$ r[]ÍAUS EU tG 9u=t99 u5Rt@tT$$q[]ÍA@uፃAٸfUS ÈEt. 9u$@tU T$$Wq[]ÍAfUWVS 3 8u~(Ft  [^_]D$ED$ D$D$4$1tȋUBU$DžtFD$ED$ UT$|$4$t}M9Muu>uyF8"udF1M Z$ zƅt' D$4$eFF FE 0 [^_]É<$D$,fD$4$ctՋMofffUVSUE 9t4J2Ht"JZxPx3H3X1 [^]1[^]ø[^]US藿 Ü5D$$L $蠍[]USY ^L $z[]UWVS41 6M EpAQAtpl}D$ T$L$D$ uԉ4$^D$|$E$ipt2t$E$5mt|$E$^q4[^_]Í14[^_]ÉD$ T$9D$D$ uԉ4$$^y D$ D$D$ $uUVS! &E 0t$L $<4$1[^]US D$L $ƋLD$L $1[]UWVS蝽 âlj։Mm{ML$ED$G$9WVEU9ErfEG[^_] {8"u1UWVS lj։MzML$ED$G$諥V!ЃtNEG[^_]z8"u1UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS0 5ƍ5D$$XL <$7t$L E$t $E4a<$ UЃ[^_]ÉE<$$ ŸUt֍lD$ $M`MAFAFA<$證t$E$iMt+$E`<$脉M $UЃ[^_]ÉL$ME$iM9uE<$HUЃ[^_]Ís}D$ (D$D$M $xrUVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS轹 utl9u4$^[^]1[^]UE@]UWVSz wEt l9t1[^_]@t9H@1һ9ˉr|9[^_]ËP@Ӂw?Ӂ19ωr-9[^_]ø@[ QU誸 §Et l9t11]ËP@]U} zEt l9t11]ËP@]UP MEt l9t11]ËP@]U# Et l9t11]ËP@]UVS Et l9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVSm jEt l9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS Et l9t1[]ËHX@uȉwދE []ËHP9ȸsUS腶 ‚Et l9t1[]ËHX@uȉwދE []ËHP9ȸsU Et l9t1]ËHP@txE P]USܵ Et l9t1[]ËHX@uȉwދE []ËHP9ȸsUVSq nEt l9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVS Et l9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUSl iEt l9t1[]ËHX@uȉwދE []ËHP9ȸsU Et l9t1]ËHP@txE P]Uij Et l9t1]ËPH9иrE ]U |Et l9t1]ËPH9иrE f]U9 6Et l9t1]ËHPwE ]U Et l9t1]ËHPwE ]UŲ ¿Et l9t1]ËHP@uxE P]U胲 €Et l9t1]ËHPwE ]UI FEt l9t1]ËPH9иrE ]U Et l9t1]ËPH9иrE f]U辱 »Et l9t1]ËHPwE ]U脱 Et l9t1]ËHP@uxE P]US6 ;Et l9t1[]ËM tM 9uL$$[U Et l9t1]@tHxUxU M3P3H ]U诰 ¬Et l9t1]@tHxUxU M3P3H ]USb _Et l9t1[]ËHX@u xExȉ3E 3U []US Et l9t1[]ËHX@u xExȉ3E 3U []UWVS软 Ǿ]1ɍuEEESt [^_]À{(uSU-tn+ti0u UzxtmMMti;t D$oD$$~tU [^_]ù RAu_Uu>fUWVSP议 ó<$evH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$)fuP[^_]Ét$D$$_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$GeuP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPw W ӍPЀ w 0 1UWVS<1 64$}cB BBB$BBB(B8O)Bf^.t{BqDžT$T$4$Є\?D$D$ D$|$4$D$D$ D$|$4$Jcut)B wB8|<[^_]ÿ"[upBXSxauZxluTxsuNxeuHxBJB(z*xru"xuuxeux̃+)D$D$ |$D$4$D$D$ D$D$4$bu1<[^_]ÍHJx"t%Ql(cBB(Qуzc<$N1USEJv[]ÉuUS ը ڵE ;Et1 []ÉD$ED$E$ []UWVS萨 Õ]u}E E $lV‹FUJv<F H!uix-x-PVHt|B-ttlB-u<-uz>tBFv1RU/}u*}~,Fǀ  *fu1[^_]À/t>t t  ủ)N] t9uʉT$D$E $]Bu?/ F(<>tt uHvf~ t{ lqG u\.x$E]}}D$ D$D$( $^ t=u)Vx"xPV HЀ"u c"tXuEF(>FFF F$GFV1u)щN$x><UWVS0袥 EEu }8X1t9s]<<{<&uKatAlt,gt{qu({uu"{ou{tu{;u"례{tt;10[^_]Kmpu{ouހ{su؀{;u҃'`{;u<M{tu{;u>4EMMt<".E<\tdMt&ȋM)]9t 9rD]6U멀{p'{;CEt)<>tuE$p(r EpD$}t$$t}(u GtXtA1(u~u EpENjE$l[^_]Á8versuxsionuE tE E D$E D$}<$t}DžmD$t$E$z<$D1k~WIUD$E$m]UWVS $8lp$thD$D$E$zfp0xD$p$C8$MЋEԉhl!tW91!ȉh! D$D$p|$D$ D$T$p$Ƌt0<$fplD$T$4$KkE D$4$NjtPD$T$p4$kpT$4$ t$Ĭ[^_]ËlЉhdD$D$p|$D$ D$D$$Ƌt0<$ehD$T$p4$ajD$D$D$D$ D$lD$p$VptdtAT$4$t$1p$dt$1UD$E$]fffUE 9E]UWVS ƅtBD$$Et E$@ژDžMu% $R1\$@蹘DžtED$<$@D$G$?kEG,w0G4G8G<[^_]US@ EL $ai[]US XD$ $DlL $#i[]USܚ D$L $hD$M $1[]US蔚 ÙED$E $zJ[]USg lED$E $JJ[]US7 <E$(jE $j[]UWVS( UM܋p4@,EEGEt@E<E t}D$ ,D$D$ $KUWVS uFt09u&x<$cƉ<$c[^_]Í D$ D$D$ $2KUWVS舓 ÍƄt1fƅtptC[^_]ÉUx<$Uc1ɋU5ƅtpt<$4c[^_]ÍD$ D$D$ $JUS E xt"D$ D$E$C[]Í}D$ @D$D$  $0JUS舒 ÍUB4tB4R,…t8$ 8[]Í~D$ D$D$ $I}D$ D$D$ $IUWVS4 UM@8t 14[^_]ÉƉ׍@E$aMt9pE}<$6Ex4$C7E$a4[^_]ÍXD$ $bL ljE؉$_UT$M Mԉ $<E܅$6<$V_V09V4E$`6N4F,E؋U<}Nj2UЉMԃD$E$@MԋU|A)D$|$E؍D$EF,}܉8MHF4F<E؉$^E$[>E܃,}<}ܜ$;EMD$ $I5}|$MA$t*EU܉PU؉$^|$}ԉ<$E܅$5U؉$]E@,vu1<$\0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PUUE܉4$<E܅UT$ D$4$3~D$4$<4$<U܋T$4$P tEO49H1gEq<$@[D$4$>Ɖ0[^_]Ë}4$(<E$5mD$4$v9n}э D$ D$D$ $UB}E$l5n 4$;EԉD$4$J= ~D$ D$D$ $AUVSJ OE 0t$M $eF,v Ƌ@$F8,uUB딍@D$ D$D$  $p>1UE]UWVS賆 øU9z<$VUB4pEthUJ4tR1}Ǎ ΉMr,Uv$E+4$+EMH,EqUJ49r}uN4B8F8<$ VE[^_]EE[^_]U Et9u$t`8]1]UWVS蠅 åu~<$UF8uF8<$|U[^_]UWVSa fut 9t 1[^_]Í~<$8Uv4<$-U[^_]UWVS ut 9t 1[^_]Í~<$TE 9F0r<$T[^_]ɉUWVS訄 íu~<$TƉ<$T[^_]UWVSk puth9u^F4$_"EFE$=TF4tD1;~4s8F,D$E$k&uߋE$TE$)E E$SE[^_]UWVSɃ ΐutB9Uu5~<$SU9u/U Ɖ<$S[^_]1[^_]1USm fEU t$9ut9 u 1[]1[]UVS Eu Mt 9t 1[^]ËP49P0r [^]@D$ D$D$  $R:UVS詂 îEU ut 9t 1[^]Åt9 uH49H0r [^]W@D$ D$D$  $9UWVS,% *ut 9t,[^_]Í~<$RF8t<$Q,[^_]ÍMU tߋUUUHMN4MtpM9MV,U܋MM9UM)L$M܋U؍TT$$n4F<E$'E$&T~D$ PD$D$u $8a~D$ PD$D$v $8t~D$ PD$D$w $g8USʀ ǍEM t 9t[]Åt9uM E[]TUS{ ÀEt 9t1[]ËM tM 9uL$$*U@ =Et9u]1]U Et9u]1]US Et 9t1[]ËM tM 9uL$$1*US âD$E$4[]UWVS p u}U uFt  [^_]ÉU15t~(Ut [^_]ÉUE$(|MUt E [^_] $$US~ D$E$[]US ~ øD$E D$E$:5 []US~ ÆD$E$L[]ÐUWVS Q~ VExU(E P $D$L|$E$/E p@ E4E}pM9D$E$C+E}D$E$!+ED$E$+trmEV0MM<NʈUV?UMD$E$*.1 [^_]ÍLD$E$0 [^_]Í D$ TD$D$sX$[4}EE}FU}><<E]E tE $[^_]Ãt}E9E)>E1}E9E)><<Nkr<[u1R}GEt"E9E7E)ȉ >}> ~D$ D$D$eX$0=2ƤD$ D$D$,X$/UWVS x $ u,D$$UUBB BE u Ѓ [^_]ËE $tUtJNju} s5E u%E uBE B Ѓ [^_]äBE B fE tM $1UWVS 9w >u} tEt=$,tt%,T$$EAE@px [^_]11UWVSv ׃uE u@1$sDžt,D$<$GwE G [^_]ËE $stDǃ} s E uE u뛤ƐfE tM E tE o1UWVS v u} tEt=$st%,T$$EE@px [^_]11UVSu ôutG,9u=Fu!F D$F$tH[^]É4$[^]1UWu TEt ,9t1]Ë@ ]U/u ,Et,9u@]1]UWVu Et ,9t1^_]ËU tP 9Urptt} suuɤfuufUWVS]t bEtH,9u>P pt0t{$U@qt!NjUs*ut[^_]Åu!1[^_]ftt鍃D$ DD$D$X$Y+D$ DD$D$X$/+Us Et,9u@]1]US_s dEt ,9t1[]ËM tM 9uL$$US s Et ,9t1 []ËM9H uU tL$M L$@$ []UWVS r u>t=~(u7Ft=D$ T$VT$$t F$ [^_]ËFD$U$11tՋ}O $MGoEtFVT$U$MUK9}D$D$4$I$nƅ,D$4$FEF~ E 0%r/D$ED$F $JljEt\UF$F 9:" ~D$ ,D$D$X$(E$v [^_].8"uE$v$mƅtEE$bv1 1Up ¹}Et l9t1]ËM tM 9u9]UVStp y}lt$4M $ƃ! D$ D$D$|$!`D$ D$D$l$ UWVS@i EvƉEx,}UD$$OjtQUtBMI0M s!MA,Q0E$}n[^_]NjuӉF,V01UWVSh óuƉ׋P4@09rJF8u:9t(<$ V,F4HN4<&D$4$Xu1<\\D$\4$-tӉT$4$tŃtaD$$Buύ T$ T$D$# $0t][^_]UVS-M 6Z]u {u3vut&D$$}t,u[^]D$<$Su 1[^]D$/$6t6u Ht>D$$u뼍 T$ T$D$D $E >][^]UWVS][^_]zUWVS J WUEx } $Gƅ$GtzFFF E Ft.ED$4$ׄu`$P14$O [^_]Í<D$4$u뵉4$O1 [^_]D$ 4$ztFu2D$4$kD$ 4$ESD$4$-;>@D$D$4$-D$ 4$Ex UWVS KI PVED$E$5t>Ɖ$&E U4$NU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVSqH vUutFwyM MJ]ZMJ [^]$Et|] X]XMH ]X뼍D$ D$D$Ap$QD$ D$D$Bp$'1fUWVSvG {TUu }t`t`tAtA}tA uutA} $L[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍D$ D$D$Zp$UWVSED$] u}څu59D$}t }GȋT$[^_]9sut E|$8XD$1σL$uT9r9ڋD$)]t}W뗉u 11҉ËD$\$Z D$)‰$ L$t$ ؉։L$T$ ދT$L$T$ÉӉd$ D$T$9rFt>Et(D$+D$\$ $|$ }_D$9D$sq+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )D$T$‹D$ ‰T$D$ L$L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1MD$9sFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$uy9r9,)|$ȉ뙅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ ЉD$T$\$\$ L$4$Ét$Ӊd$ƉT$9rDp7u1[]$#1[]US1 >Dp7u1[]$1[]US1 Ê>Dp7u1[]$1[]USK1 P>Dp7u1[]$u1[]US1 >Dp7u1[]$;1[]US0 =Dp7u1[]$1[]US0 â=Dp7u1[]$1[]USc0 h=Dp7u1[]$1[]US)0 .=Dp7u1[]$S1[]US/ <Dp7u1[]$1[]US/ ý<LP ?jITM  @tM:u DŽTM с?x"LP ] LM \U1[]ÃӅ~TM 1  9~:u뙸#[]U/ <E@M LM 1]U. ;E@LM ]U. ;E@DŽPM 1]US]Cu U C1[]US . Ô;Dp7u#ED$E D$E$u []$) []øUS/. 4;US[]US. ;$S-[]US- :$qUS- :Dp7u1[]$1[]UE 9E]1UVS- Ä:ut$E EED$D$vt4$u[^]ÍD$ 0D$D$;\$UVS- :ut/ED$D$wt@4$x@Eu[^]ÍD$ ) ‰L$D$$菴yX1 [^_]ÉM4$vSM랹čoD$ D$D$>$넍UWVS# 0Eh+l}ptDžxAEEEEEE|(D$ut$$;]E$D$t$$Dž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$_XD$4$|$4$D$04$5U<8D$hD$t$ D$D$0$"G,&V4$G,48D$t$0$tD$(D$$D$$D$$pD$|$$4[^_]D$$[^_]Dž4c ,Dž4GD$(D$$yD$(D$$D$$D$$UWVS@ Ơ-t$0D$T$L$4D$4t "|$GD$8UT$$\$0uL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$D$L$8D$9\$0&"D$8D$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$D$L$8D$9\$0M"D$8D$D$=u4$w7)EE8EE1҉MԉU*}D9FEE>tHED$|$M $޴uى<$蒳}9EuEEE>uMԋU܅{UWENjp,T-t$E8:tED$ED$$XGxTp70E<-<+<::gB9FB 9F <;uEz8;EAXT-0tE8:tD$W$袞Tp7WE<-QEx:T?Fw E؉Gw t01]E8[^_]ËMԋUEE$ȱEMt$ T$UD$_<$EUMt$ D$D$<$>u4L$ Mt$D$`<${EM:L$ t$D$<$O3D$ D$D$a$  <:z5E*E!w P]ẼuE MЋM؉u\[^_]Írd`P :u>u\`t E8:?부xt\Ad됋\>uTx:tL\9MAdE8:`t*|$ D$h1XP Ad\[^_]ÍD$ D$D$R0$貵uD$ D$D$S0$}臹|$ D$D$ -$芡E 4=:dUVS utD$ D$4$[^]ÍRD$ D$D$/$ѴUVSW\ utD$4$fe[^]ÍҀD$ D$D$/$qffffUSE$~1[]UWVSEtut4E@D$Ex E@t$9r0E@ 1҃[^_]ÉuU 9E׋EP @D$E@t$9s뿋E@D$M);u ED$1E U9Nj]C E@t$9ANE E D$ D$D$$5׋EP @D$0E UdOeD$ D$D$$űTUWVSUB EEEu1u}u}9}EE}B269rz])9ErEË}u sHu(u J J ZR9r [^_]ÉftEË}u rucuk량UGD$4$oƅt[UB)ǍD|$D$$'U0MJB E4Xf넃BUWVSúu} D$$$…0x@@ D$D$!D$ D$D$$UDžt)D$$[^_]е18U$n$d蟵81蔵8US æE D$ED$ -X$ []USjoED$ E D$ED$ -X$[]UWVS*/u} t(ED$ 1D$|$4$gC[^_]Í0D$ D$D$4$0UVSþut'D$ D$D$4$B[^]Í0D$ D$D$A$îUWVSKPu} t)D$ 1D$|$4$B[^_]Í0D$ D$D$6 $PUVSut>D$D$ D$D$4$Ut [^]1[^]ÍD$ D$D$0D$̭USV[ED$ D$ E D$E$8[]UWVS uttE D$4$~7肍F0u D$4$胍[^_]tIF0uҿ0F0뻍0D$ D$D$/h$ج]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVSE0x$Itu[^_]1[^_]UWVSË} tE}2tGfp f@UPx$MH,UP(UPDUP [^_]þEu1UWVS }u$‹EE Bzr EBttpE tZE EU<1UtnMfH f@PM H$x,p(@D*P [^_]ÍE뭋M tE E딉UU$1 [^_]UWVS UE trB0~4r,txM q J$tE D$ E 0xt$|$$Q[^_]ÉUD$ D$D$<$軩UY0D$ D$D$;$艩U US ED$E D$E$ []USED$ ED$E D$E$j[]UVSèuf~ D$4$F0tN@9t $F0ǀǀ FFF t1FD$4$ψ1[^]ËFߍ0D$ D$D$<$KL軭 UWVSEU tdP0~4p,t} r H$t} Lj $>M Q!Ѓ[^_]ÉET$ T$D$9$}Eg0T$ T$D$8$KE.UWVSutFD$4$;nx$P8D$4$D[^_]É4$Oڍ0D$ D$D$7$踦US BGED$E D$E$9 []USED$ ED$E D$E$7[]UWVS,Et8uj}ԉ&;h#$薛FFF )t$|$$脳,[^_]ÉEԉ$QE؍EEu}w 끋luUEx9h#]Ël]Í ]UWVSTUE }}8}M1ɉցE- tM9utID$2@D$u4$4$OPEu2}E+ЃT[^_]Àu3p4$PEtΉUED$t$E$JU밉t$ D$D$2u4$蚋4$̙PxU@E 7t"ED$G$胛ut$ 눺Ƥ}U|D$ (D$D$X$蒣UE4T$ (T$D$X$]uE7M,E|T$ (T$D$X$E=1fUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVSãut;F)F3E uF F[^]1[^]ÍD$ TD$D$Y$蔡UWVS!u} Uts~F<FF DWPWPW P F F 1[^_]ÍD$ @D$D$v$ԠU`U:D$ @D$D$w$蜠U+UVSut~u@~w:E [^]ÍD$ (D$D$$/뺸UVSöut~uAF u9<.w5[^]ÍD$ D$D$$ǟ빸UWVSHM}u t5u%G u<.w~9|D7[^_]1[^_]ÍD$ D$D$$AUWVSu} t*~uPF uH<.wDx>9؃[^_]ÍD$ D$D$$͞몸UEu E D]1]UWVS49}utQEu@D69E r4E D$D$<$v6GfGG[^_]1[^_]ÍD$ D$D$.$UWVSÞu} t;~uaVL\WQWQW Q F1[^_]ÍD$ D$D$M$茝뙸UWVS4 ƉEԋE} 8uЋU1҅x'PރT$D$<$]FGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍT$ T$D$h$WE܅E܋]ԍƃT$ T$D$i$Em]5*UVSÒut~uEFu=:Fr6[^]ÍD$ D$D$$蟛뵸UWVS %u} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍD$ D$D$$ffffffUWVSÖƉׅt18u9s1[^_]ÍF9rFލ҃D$ D$D$0$萚=uUWVS t ljփu [^_]Rw%FGT$D$<$q[^_]ÉUރD$ D$D$0$UUS{ÀE x[]ÉET$ T$D$T0$蜙E[]UWVS"u} Et,tYPσF)F 71[^_]ÍT$ T$D$b0$EuET$ T$D$c0$ErUWVS_hEu}UxE ;Eà EME9؋M)1L!ȉ)1׉E8E 8t@‰ߋu s}tftËM؋})p)ƉnE0)F=^EX E[^_]EE[^_]ø‰ߋu rbEX]荃D$ D$D$0$?ÍD$ D$D$0$W]荃PD$ D$D$0$ܖf;{PUWVS6?EuM}~ 9)1UD!ЉEUE)‹E1UU ˉM] E )P)‰U|U)G=Mw]_^ ȃ[^_]1ɉȃ[^_]Í^^ÍD$ D$D$0$茕MM]荃PD$ D$D$0$TMkUWVSu} tt~)F1V J 9\ t+9sw[^_]ÍFፃ+D$ D$D$0$舔]D$ D$D$0$Y*UWVSE} ux)ubHQσwWvPH Y 9r>\ tHډt'9s89t9t!P9r P9sݸ[^_]ú߉1[^_]ÉE+T$ |T$D$X0$XE6T$ |T$D$W0$&EUUE ttuB]ø]UWVS xEEEM<v}wwٸu [^_]9]rE}t81ɅU t9u rEtuutit9A=QMVVD$D$$]iMEEFE 0 [^_])Ӊމq̉M]썃tD$ hD$D$0$轑M9ME]썓T$ hT$D$0$肑ME.UWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉t 뭃먋E[^_]UWVS] U}EEt6u1]t7U9s tCB9rr9s[^_]ËEP8Mt9s܉ uM1+E[^_]UWVS] UЋ}uރstft[^_]uuBfUSOTD$D$ED$ ED$E D$E$Z[]ffUWVSPƉЉ8U1҅SƅD$D$D$D$ T$D$4$5t1U+4P[^_]Í1ɉ  rFDžDžD$ T$ƤD$<$ eutjƅD$D$D$D$ t$GD$G$5ut$$軄tu<$1b $b9T$ T$D$G$輌rUWVST38Ɖ8E1 ƃP ƅD$D$D$D$ P D$|$4$4D$D$D$D$ L$|$4$3;DžDžDžDžDžVDžDžDžT$ D$ƤD$$btjƅD$D$D$D$ t$GD$G$2ut$$膂thuGtLD$ D$D$$9$_1U+uXT[^_]Ë묋$_ʍ9D$ (D$D$G$AjUWVSϋEE uE8E1 JD$D$ D$D$<$軶=/D$ D$D$$2t6D$ D$D$$rk*$D$$D$$o$ɘD$=$[;$蕘$臘)y$X$Tt$U D$E D$E$G]UVSrwutD$D$4$[^]Í D$ pD$D$G$脁UWVS ljEE Et8|E1;DžDžDžDžxD$D$$ɎVDžDžDž -D$FD$$DžD$D$<$ޏFD$FD$<$`<$T80F8=f~4$Dž,8#tf%$v D$xD$$j|E+Ĝ[^_]Ã$`똋F?UƅD$D$D$D$ |$FD$F$v&|$2$vƅD$D$D$D$ |$FD$F$&u!|$ND$$EjD$[D$<$D$[D$<$A>$D$ @D$D$ -$i8tD$FD$$DžD$$ D$ D$D$4$\d4$rD$t$<$赊Ƌ$er9fDžfDžD$D$$譋D$L$$芌Ƌ$Zt0<<4$qD$t$<$謉4$^qD$t$<$苉4$=qD$t$<$jD$D$<$萊D$xD$$|D$D$D$D$ D$D$ $"u(4$莠=4$=L$\D$AD$<$肈DžD$ D$D$G$dzCnD$ D$D$G$,z|D$ D$D$G$yD$ D$D$G$yD$ D$D$G$y~\$$草<$腉!D$t$$ tD$t$<$#tƋtt$뉍$ $hD$a7$뛍$$rZt$UWVSluEEEEEEEE8E1MGUqEE fD$ 5D$D$ UЉ$U4_EEEEEEM MEEML$ D$UT$$O=EPt%D$T$T $U9UEML$ML$M $MƋE$ELE+l[^_]ÍnD$ |D$D$G$vM|D$ |D$D$G$vUD$ |D$D$G$tvEeD$ |D$D$G$?v6$3KD$D${$X>UD$ED$ED$ED$ ED$E D$E$f]UWVSlUZuEEEEEEEE8E1xMUEE fD$ 5D$D$ UЉ$U\EEEEEEM MEEML$ D$UT$$xLE@t"D$D$U $UU3D$$ttM 9HtCED$ED$E$MEƋE$IE+9l[^_]Íu$D$ ED$ED$E$ME 멍nD$ D$D$iG$sM^|D$ D$D$jG$sU4D$ D$D$kG${sE D$ D$D$lG$Fs$:HD$D${$ UEUD$ED$ED$ED$ ED$E D$E$ ]UWVSY^l}dE TEPEX8@E1D$pD$yPXDžHDžLphl0-`,-\dD$ D$D$h$lsSD$ h4$l?:p< `\?.< t.dЍLDSt< B< u< t< t< u< t< tuh9>uPp<+<-iq<@pHLDD$ D$LD$r$l薚؉DžH<+tj<--t$X$lgPH;v31@U+%[^_]ÉFg<@qs<@PHLDL$ D$D$r$l衙DžHhUTd [4$lL uCF)<@t$X$lf DD$ XD$D$4$l֘tthKqUTqUT؉DD$ XD$D$4$lADžHDžL1bUT%LUT LƅplD$ 8D$D$G$qm0lD$ 8D$D$G$|[^_]1䍃ʆD$ HD$D$N$W UWVSt16EUU8M1ɅtBE}<$WM L$ED$<$XED$<$U+u:t[^_]ÉE؆L$ <L$D$h $ WE3US茞ÑE D$E$[]USbgE D$E$[]UVS7<D$D$W 4$bD$ t$ED$$3s[^]UEȅyt ]%]]UWVS0誝E؋}u 8EԉËE1tstX|$}܉<$]1| F TFuF(}ԋE+uS0[^_]$)]2ƅuՋ]؍D$ D$D$F4$RU[]xUWVS̜ѩEE EEu}8U1ҍ $D$@$ d \19ȋ})׉ 9}PD$T$$cc~3D$T$ $19|v(|Y0$+dgY0t 14RY0$d=Y0D$ $U+uw[^_]D$ D$L$$F<$c1몍D$$4tыptvSUD$D$D$D$ E D$E$]UWVSxnsEUU8M1ɅtBE}<$M L$ED$<$/ED$<$_U+u:x[^_]ÉE؆L$ pL$D$4 $GREpfffUWVS躙æ ]4u 8$ËE14ENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ |]Ћ~$x}ԋ^(p]؋~,l}܋^0`]^4\]~8X}vh}l1u1u1lj]11ωtdn߉Љp}1U1׋|1ljh11ljpu2n׉l}1u1x1Ɖω`11߉lhnlj}u1u1t1lj`11׉hnωU}u1U1׋p1ljߋu11ljd`2n}U1׋U1׋l1lj}11ω`n߉M}U1׋|1ϋh1ljNjU11\Un׉u}M1ϋx1ϋd1lj}uM11ߋMXnlj}M1ϋt1ϋ`1lj}11׉T1nω֋}U1׋p1׋\1lj߉u11ljPu2nE}U1׋l1NjX1lj}U11ωLn߉M}U1׋h1NjT1ljMϋU11HUn׉u|1Ƌd1ƋP1Ɖu11މDnƉًux1މ`1L1ÉމM11Ӊ@Mnى|t1ً\1ًH1M щˋM!ˉ! ً];ܼىxp1X1D1M !׉! M}MܼMωutl1T1@1Ɖuu !! }ܼ։׋ph1ڋP1ڋ]1‰U ӋU!Ӊ! ڋ]ܼЉˋld1ȋL1ȋM1E !! ȉEEMܼEuh`1H1u1MM !! u>ܼΉ׋d\1D1u1‰U ֋U!։! uܼӉƋ`X1؋@1؋]1E !! ؉EE]ܼEÉM\T1ً]1ً]1MM !! ً];ܼˉىXP1ڋ]1ڋ]1‰U ӋU!Ӊ! ڋ]3ܼӉƋTL1؋]1؋]1E !! ؉|E]ܼ|ÉtPH1ً]1ً]1Mt !! ً];ܼˉىLD1ڋ]1ڋ]1‰| Ӌt!Ӊ! ڋ|3ܼӉƋH@1؋]1؋]1x !! ؉pxtܼpÉlD]1ً]1ً]1tl !! ًt;ܼˉى@]1ڋ]1ڋ|1‰p Ӌl!Ӊ! ڋp3ܼӉƋE]1؋]1؋x1E !! ؉hElܼhÉlM]1ً]1ًt1Ml !! ً];ܼˉ]}1}1p1lj} ׋l!߉! }7ܼމu}1}1}1Ɖu Ɖ!׉! hul>ܼhhl}u1|1u1Ɖ11߉ubhUu1x1u1‰֋l11ʉub‰Uu1t1u1‰։ډh11ulbщMu1p1u1΋h11ubˉlEu1M1ȋM1l11ЉMh1bƉ֋UM1ʋM1ʋM1‰ыl11ډM9bU|1ʋM1ʋM1‰щd11‰hlbӉEEx1ȋM1ȋM1ld؋M11lM1b|t1ȋM1ȋM1E11Љ|bӋxp1ʋM1ʋh1‰щl11x]bډtM1ʋM1ʋM1‰ыl11‰t9b׉ :dpM1ȋU1Ћ|1‰11؉pl bȋd]EU1ЋU1Ћx1‰1؋d1؉l2bƉuU1֋U1֋t1Ɖu11ΉU:bM}U1׋h1׋p1ljىߋ]11ljU]b߉EU1ЋU1Ћl1‹E11U bЉEu1|1u1ƉM11؉uMbȉEu1x1u1bʋE11UEu1t1Ћu1ubʉ؋U11EU1Ћp1ЋU1<bËE11؉Ћ402މC(lj{8 F ,EF$E+u~[^_]Ë D$ D$D$\$.<4< D$ D$D$\$; UVSkput7#EgFFܺF vT2FFF[^]Í D$ D$D$\$e;UWVSE[U Pu щHs H?J]Ӄ?@)Ӊ]<u EEu|UHL$$EU);MEƋ} T$4$dڃ@;Ur)]] U<u sRtft[^_]äfEuMEC] }|:}h T$ T$D$\$9EU xE؆T$ T$D$\$9ECfm2u KM &fUWVS(譀E}u 8EËE11U1ۃÉу\u݉UD$]䍃$D$4$>F%=Ut,D$\$4$F%=u݋UD$T$4$t!1уu}E+uo([^_]Ë]䍃D$ D$D$\$7]䍃 D$ D$D$\$7]UWVS0/8E؋}u 8EԉËE1tstX|$}܉<$]1 F TFuF(}ԋE+uS0[^_]$)]{ƅuՋ]؍D$ D$D$F$6[]UWVSQ~VEE EEu}8U1ҍ $D$@$E \19ȋ})׉ 9}PD$T$$D~3D$T$ $k19|v;0$E:0t 14:0$E:0D$ $U+uw[^_]D$ D$L$$$E1몍D$$ tыptvUD$D$D$D$ E D$E$]UWVSx{EUU8M1ɅtBE}<$vM L$ED$<$ED$<$_U+u:x[^_]ÉE؆L$ L$D$ $3EfffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8puX]H MPUHMX]HMX ]P$UH(Mp,uX0]H4MP8|@yZ<3 h Ӊ 1Ή\uh3n\  1Ӊh]nh  h׉ ؋h1|9n ׉ 1}:nh \ 1ڋ}h;n ҉ 1Njxn \ P҉։h 1΋}\;n <P hӉ\ 1Ӌu0nˋh Nj\ 1u1nЋ\ \1u2n 1ڋt7n \ h҉׉ 1Nju\0n ҉ 1΋Unhމ \1ӋUhn  h ҉Ћh 1Un\ h 1Unh 1!1‰hUܼh  ωh1!1ω}>ܼ<2  h1!΋h1֋UܼƋh 1\!1Uܼ h1!1tܼ\ 1!1ًUܼh 1!1‰\Uܼ\  1׉h!1ω}>ܼ<0 1!1֋Eܼ h 1!1h]ܼh 1!1hEܼh 1!1ىhx ܼh h1ˉڋh!1‹|ܼ 1Ӊ!1ȉËEܼ3h 1É!1։\uh3ܼ\ 1!1Éh]ܼh  1߉h}9NSh  h։ 1t2NS ։ 1ʋu0NSh4h ։ ʋh1u0NS  ֋h ։\1ƋUNS>h Ћ\ 1؋UNSȋ\ \׉ 1‹}9NS 2 h׉ 1ʋ}>NS \ډ ׉ 1Ћ|;NShlj ׉ Љ\1؋}h;NS  Ӌ\ 1Ë}>NS ˋ\ Ɖh1u1NS4  Ӊًh 1]NS h PӉ 1ʋ]NS< @։ ʉL1x0NSPӉH pm h T։\ 1׋]h>pmNjT \Ӊ 1]>pmы\ 1؉hE>pmh‰ 0 1hE>pmh 1Ήh|3>pmhh ։h 1Ӌu7>pm h 1Nju1>pm׋h 1hM >pmh  1ډhU>pmh  1hE>pmh 1Ήhu3>pmh \҉ \1ӋU>pm  h 1Njt>pm \ ׉ 1U>pmh \׉ 1ڋ}8>pm\ 1!1hEvmzh 1!1Ήhu3vmzh 1!1Ӊh]vmzh 1ljh!1Nj]vmz  h1!1]vmzh h1߉!1ڋ}8vmzh h1!1xvmz؋h Ήщ\1!Ƌ\1΋t vmz 1щ!1ӋMvmz\ h1!1NjM\vmz  1!1M vmz  h \1!1ڋ}h8vmz \ 1!1hEvmzh  1!1Ήhu3vmzh 1!1Ӊh]vmzh 1!1ljh|9vmzh 11hMʋh 1ډM1ʋx M1ωx1׋U ߋM x1ʉ1U Ƌx ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11EE 11؉E|ME 1M1ȋt U11‹M UM 1ʉ׋U1׋U U L ׋XUzp4 <UrU1ЋU1Ћu l@؋uF ЋL ȋH1P]NSdыUȋUBU `HEĸ[^_]UWVSE}O_M]ʃ?@)Ӎ41u}Mqy9rdun?v91۾@ω؋]E D$<$Ov@9s]ËE19s-)] }|u s~tft[^_]19rӃ[^_]Ë}}]}|u skEu[EuREUED$E$U)֋E9r{}؋]HuVu=ffEtuVuƆUUoD$ LD$D$<&$fffffUWVS.Z3g} 8E1}D$D$HtHE$t=ED$D$<$$|;Es1U+[^_]ø"㍅D$E$ktt@D$E$1u[ED$bD$<${;EsED$|$ H%D$`d$T$UID$ TD$D$B$S|UWVS XeD$,W \$E$qƉ؅u [^_]É{01UWVSpXÊeU,[ ut$$,[ @B1E}E1uNjU:ME1uEHt$$xx,[ @B1Ƌ}E1NjExME1EH D$E$Qu(,[ ]ٸ@B1E1؃p[^_]øp[^_]$'謣,[ 8D$ `D$D$HD$UWVS#W(dD$7sD$E$|uE-@t&tD$E$u܉[^_]D$bD$E${t 1[^_]ËEpD$D$4${E@<-u?EP0-DPtEPD$ ED$$U7uMU9p9g^My+th)ƍF߃1BD$+D$4$zE@t<+ !M?!UU‚bE?w-t u]Ë u@u1]UFU?bEP>w -]1]UWVS( Ubu}܉|$D$4$xINE uG>wl8EظE! EED$|$4$~([^_]Ã>w28EظE EH;UWVSBTGauD$ toD$D$l[ <$y)L[ -t@L[ [^_]ÍU T$ t$)‰T$$H뵍a7D$D$l[ <$dffffffUWVSSÆ`ƉЉυV=vlot ufus  E ] ^}+}-}=uFЃ[^_]Ã+t-uuXE #EFЃ[^_]ÃXtguy-t~F+։} RF F+֍R먉} 룉UfT$ T$D$t$ EFlFaUWVS-R2_u ] EEEE}|$EԉD$$/$v$EvD$|$$E5D$D$Ẻ$vMẺE0EU0-DPuHщMEE1EF$3o81rUWVS vE{RƉUlc tG$ ?uE8rt;F$ u [^_]D$$pn$ [^_]Ë$ FuEx+uD$$/nD$$nF$b Ex+uUWVSDíQlj֋E8rMD$t@G$EGF$ MUVN lc lc [^_]Ë$EFG$ UMUVS(D"QEu] WU EUE"EDp7uT]\wmƃtK]wEU $UDp7E@([^]Ë]썃$뙍EU D$ED$]썃}D$ +D$D$$$]0wDp7t]썃$'E$]HE$z E$o 01([^]Ë]썃$]썃D$ 0D$D$$w]썃D$ 0D$D$$:UVS 3B($UM$M~9E~L$$d‹MfffffUWVSP=JEu}b]DE E AEEEDE{~ 0jM_U tEExGz;EGEkMddeEUMEEE EE܋E$] 8MԍD9E 0>EUM]L$\$ $T$],9tu׉EUM]ىeщٸ9и| E AED$ExD$E܉D$ˉу2΁ȉ%ƉƸQ)1ʉ)i)\i(\ø)\ƋE؉E]ʋUʉD$ T$]‡D$E D$E$9} |P[^_]ÍnEEEE`EEAE$UԍD9E ỦUMED$ |$}܉|$E})lj|$D$EЉT$ ]͇D$E D$E$1ÍD$ |D$D$8L$er]D$ |D$D$9L$0@zfffffUWVS87æDlj։MEuEE9r[ff=?txf=[f=*t!f9tc]9ttg9s>18[^_]Ãf~*t{uE9sfu!f=?tf=[t]]uuf=?uS`EuLCEFfEf=!E؍FEf}!&f}]AE܉EFE1]ԉ}ЋE܋}]f9uxf]t(fx-uf9r f9Prxf]u؋]ԉ}}ЋE9Su]oD$ D$D$ڇ$5AD$ D$D$ڇ$ED$ D$D$ڇ$FEvfuf]SƋ]UWVS"5'Bu} ttFD$$[4[^_]ÍUD$ D$D$Dڇ$4uD$ D$D$Eڇ$UWS4ÔAׅtkt/tPWu 1[_]Ãu[_]ÉMET$ T$D$qڇ$ME뙉MERT$ T$D$pڇ$PMEZUWVS3@8U1҅tWF @D$$tV$U+[^_]1g㉅'T$ T$D$Eڇ$nT$ T$D$Cڇ$K/cdyUWVS$2?]E։M5_VЍEF t =F}|$$]4DžF\~MfyuE)E $M]//ÅM‹EiFJ‰F u $[^_]Ë}E=v]ԉUE$].DžUt߅FT$D$<$]'D$ D$D$ڇ$]썃'D$ D$D$ڇ$vo$]6FVNUWVS0=ljdhlE`E XuEpEP8<E1h`XphfX9r9f>*uf~*u1f~*@DFH9`PD$pD$ HD$XD$`$lhdDž|hfDžDdf8$pD$)D$<$Qp@ @<$P TTp@ @0Lt4l8\T$LЅpQ tPNy~ x .5 h\9lHfOfuት\9lD@u5p4d*4|%=H`h#W89sfG/fPD$pD$\$ld=hfDžHDž@DžDdf8tpdHu|%=@1P(X|%=@B9pp/%`BX븋`D$ D$D$Sڇ$M`:k`v1҉p/!UWVSDo$p18ƋE1Hf~uQ@ *΍f}f/sP9uݸz0fd"f*ffʃft@f?f[uZx!#qf92f[ʉfuffP u:!N f?ʃDW Ӏ_ Y9t fx*f*ʉك |$|$<$U+D[^_]ÍJfzuf[Qr f2f]u답f[!Vf]tI։ύOf%ff-uFf]fG-Of%fG^Vf]uH Af]N9D$D$ D$D$$P f 9 9sVfPfu9t.P9fx*P9fx*ʉW 9B ˽T$ D$)L$pP$薞f[!ʃoV- 0!$K…DD$D$ D$D$$Y@xf@!EfH9'?'|$ D$D$ڇ4$R|$ D$D$4$4jMeUWVSé+Ɖ׉MG tMA PQ f>{tBEEft>f{uED$E$quۋE[^_]f~}uf~uM[^_]'D$ D$D$ڇ$IMUWVS0þ*)9YË)ډσˉHPftDΉ1ۉff}tYFftf[tWf{uFfuM `E10[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1=f[uSf]fً9CS{f{f,uvu91ҋLf fuM }1uLfAf}=s-%qQf]tyىC)D‹΃tfFT$ |$D$ڇ4$ ɋ'T$ |$D$4$'T$ T$D$ڇ$u=$SًfvSdfPUWVS(&u} UDžDžDžDžuBB EBB]uR} UfP9~ʅ\uVtM@ɃfH9Nuft ([^_]É\@x'([^_]B&} U맍YD$ D$D$ڇ$U} UhUWVS7<%EtXEPtF@ CE$/ǃc []UWVS8 }u #D$$D$D$D$$D$ T$(T$T$D$4$t6t$ T$w3D$41 1ۉL$\$l$ǃ\$ 9r؉e[^_]D$ ÍD$ <D$D$F$D$$D$D$D$$D$ T$(T$T$D$4$*t@D$ T$AD$ <D$D$E$1ffffffUWVS Æ$>3tƀ8u^AUD$L$ D$D$c 4$UE tE 8 [^_]D$ ED$4$ &xT}untHuG<&wHt$Ј$D$$t$$ՠc WuA@9|w뵍8=9,@뽍!?ЉED$ $@EEUD$ $MEbffffUWVS æljD$\t$<$Jt8t [^_]UWVS8af8E11҉g rc g D$ D$D$$g L$$cytzg t8#tg g g g D$D$ $藞-g 8#`g Qg t8xuxxu xg 8sxwx|Lg <$g $g U+[8[^_]ǃg ǃg t)$0g lt$g D$g D$4$:%g Dž<$詰u؋t΍ 7tt$$ouታg >x~x~6%1g HT$$t&HUVSg tftKg [^]ǃg D$4$貦g ut$s$.1[^]UWVSrwuǃg g t0$ɟt$g $2tHu1v>D$<$g uΉ|$s$1g [^_]ÍoD$ D$D$%$GUWVSß uǃg g t-$t$g $ZtEu1>D$<$=g uщ|$s$1g [^_]ÍoD$ D$D$%$@JUVS ǃg g t$([^]ÍD$4$荤g u҉t$s$ 1USTY g t$荖ǃg []ffffffUWVSL ]ԉljUĉM؅uą]1E0-EEu؃EĉEGET]DCtE,- ?*WЍL]DS<*E,-}<* tЍ\]]DStڋEЀ*Ҁ[i\U؃B] ȍ{}}\\ ]]DKtE,-M9L[^_]À?*vG[\U؃]]Oh}눋}].@렋]у]}ы]]}L[^_]Ë] ȃ]_]_]|}܋}D_]}E,-M‹u}[}]ԍCD$ D$D$|$nYD$ D$D${$?},-};EӋ}E//E/(EEE,-EE؃E}}tÍLUDBt EE$ME/uEtveu؉D$/E$]>~gEEÄ[^]UWVS}u D$<$զt*lD$<$迦u t1[^_]ÅtwUWVS8w|8‹E1D$ D$ED$E$E…uZDžDž$$E+0Ё8[^_]É$ T$ D$ED$E$Fƒ$nEDžDž9~&t$$Xt$|$ D$ML$U$ƃD$|$ D$ED$E $9D89trtftƄD$D$ D$ED$E$ƃɱ1҃8-DžDž1DžD:1UWVS@ÍUE 8ƋE1D$ D$ED$$Q…uZDžDž$$E+<Ё@[^_]É$T$ D$ED$$%ƒ$wBDžDž9~&t$$Wt$|$ D$ML$$ƃD$|$ D$ED$$9D89trtftƄD$D$ D$ED$$ƃ迮1҃8-DžDž1Dž:71vUWVS@~ÃUE 8ƋE1D$ D$ED$$Q…uZDžDž$$E+<Ё@[^_]É$T$ D$ED$$ƒ$wBDžDž9~&t$$Mt$|$ D$ML$$ƃD$|$ D$ED$$9D89trtftƄD$D$ D$ED$$ƃ赫1҃8-DžDž1Dž041vUWVS w|}"D$E D$<$utuFtf [^_]UWVS }"D$E D$<$Sututf [^_]UWVS ü}"D$E D$<$ututf [^_]US Y^<8D$E D$E$薴 []UWVS!&}U 8E1EteMyu )čD$UPtMP}y:u}D$<$'}U+ue[^_]ø+2UWVSÇEEM 8E1EtgEǺu )ԍT$ MJtJx9uD$T$E$XxU+ue[^_]úE1USED$ ED$E D$E$ϲUS ðED$E D$E$BUS ÅED$E D$E$kBfUWVSQVƉUtb}u +t"D$4$uM)[^_]0-DPu 1[^_]É4$[^_]ÍD$ D$D$$oU®Et8t س1]ø]UWVS\x}u8EE1*t$سD$Ẻ$"i h }e1󫍃h EЋM̍#h |t:tEЃ9s EЄu$h t$RD$Ẻ$;oFD$tD$Ẻ$oEЉED$D$Ẻ$ox,uЍBTD$4$sdh 4$D$:D$Ẻ$Ztdh EԉEȉD$/D$Ẻ$sZEԉ4h EȉD$[D$Ẻ$st EԉEԉ`h EȉD$/rD$Ẻ$qEԉh EȉD$PD$Ẻ$SqEԉh fEpxEfEbxEfEfxEfEoxEfEtxEE`ah E؉EEEčEEEt}4$ďT9u f9t]:/t9r 9֍vtJ:/u9u .t&8:/u9r)vi 9u(Ƅi [^_]Éր>/t>)i ǃstftƄi [^_]Éڍ#ffffUWVSE$}|L0-DB,-fkfbfg@_D$ ED$E$*zEUE8E9t8u|8"tQ]ڋEƍ EʋM Q1[^_]fmuAxn1bM]9ȸs 蠝[^_]þUSÚD$ E$轧[]fffUWVSaf}tz?tu<$HD9u p9ti8/t9t`sc~/t9u)=vm ׃rtftƄm Ѓ[^_]ø)€8/t Ƹ봸#US<ëEEEEEEEED$ẺD$$tEMt<[]ø<[]fffffUWVS !&7ƅt $茚UtE t [^_]Í#$8E uD$D$!$cǃtD$$D$<$D$<$~<$zpUSCHEt=tU T$؉$[]UVSutE D$D$4$蕤[^]ÍD$ 4D$D$1 $ fT$D$Ít&T$D$.&&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  .&&T$D$L$  .&&.&&D$ffff̀rS[T[Ḯ̀rS[4[ḭ̀rS[[̀ffff̀ffff/̀ffff^̀rS[[̀rS[ä[Ḥ̀rS[Ä[<̀rS[d[̀rS[D[ḇ̀rS[$[̀rS[[ḓ̀rS[[̀rS[[`̀rS[ä[R̀rS[Ä[2̀rS[d[ḩ̀rS[D[P̀rS[$[ḷ̀rS[[Ḷ̀rS[[ḉ̀rS[[̀rS[ä[Ḛ̀rS[Ä[̀rS[d[Ḩ̀rS[D[1̀rS[$[Ḍ̀rS[[òrS[[ìrS[[l̀rS[ä[t̀rS[Ä[s̀rS[d[r̀rS[D[p̀rS[$[j̀rS[[m̀rS[[̀rS[[Z̀rS[ä[ ̀rS[Ä[S[n[.&f*̀r׋L$Q1fffffỲrJ!QۓUWVS q q D$$q q +q q s$uu[^_]ä[^_]ft뻋q Pq D$D$D$D$ D$ D$$6q 31q D$$LD$$-$qGf?USòq E)9q t$([]à T$$[]USejD$i$q u !$k[]fffffffUSúQ)‰э)y )ȍ BЅyBut*$I )Ѝ)‰)[]i)\P ףwƒUWVS ÉUB< we΋EE11u v4B< w-ύLzЋuU<9EsNju9r9MrE؃ [^_]1 [^_]UWVSEU1U9} t?E $M迀ƉD$ED$M $uˋE8E[^_]ËUt E1UWVS$opƉ8E160-ʄt/}9tBt DK@t⋍t0DCu1U+u]$[^_]É $<`Džtҋ0F D$<$_F$F(<$_`떋UWVSXDME؋}E }x EEEE]0-]wu8EX]E]܋DJ@u.<%uEUMYC}Ѝ~}E@}GEЅ>MUЅM E؍~E -D$ ED$T$<$ƉEMEU$c1ɉpƉEE M]ȅt)ExQ)؍)MEH}eMEoMMЅGEP$1ɉƉEM =MEU$nƉEE}GEЅMMU$5xƉEMwu?%}ЅMEU$ ,ƉEE}GEtYMUЅKEP$ ƉEEx @uMEЅM E؍uuЅETMEЅE؍lM$=1ɋU[ƉEEMEP$1ɉ.ƉEE gMU$ƉEM踓$I )؍))ыEHEMPЀ E MEEЅMU$c1ɉoƉEEȅmEHQ)ȍEE}GMEP$;1MEP$ EEЃ} uG' MEP$1ɉƉEEUMuDBuMU$c1ɉwƉEMEMpMElU$'1ɉ5ƉEE-l}G}eMvMEMEЅ7E؍4=%]ЅE ,}tz]ԋEpE@El‹}̉)ЍH$I )Ѝ))ыUčD)֍D)}G؃Eԃك}}}Gw}Dy@&V؃DY@u] utU܋DB@UЃ@)FUDBb3v%ME)EERUЃAD$1$E؍ډ[t"UB M)i]D$1<$EDŽ-ډM]K U8cUܿ -D$ ED$E D$E$b]UWVSD覿ëEu q 9PMP lM܋HP UPUPUElS *DT$$ML$ ML$ML$ML$M܉L$ML$ D$|$4$^9D[^_]ÍMP MMIH??? F??? F?? ?F ?:??F:?? F????fF =|늍d9gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ D$|$4$]9{T1D[^_]U趽q D$E$]US8落ÕEЉD$E D$E$LtUT$$8[]US4LQEЉD$E$LtU T$$m4[]USE$CLtq T$$4[]fUWVS@ѼUE u8M1ɃtHMċNMȋNM̋N MЋNMԋNM؋NM܋NMN MN$MN(MMuăt,tSt9$zU+@[^_]Ét$D$t,$1]׉t$D$t,$]t$D$t,$]뫉E UL$ L$D$; $tE UL$ L$D$: $sE UfffffffUWVSQVu} tQt!1t  9t)ʉЃ[^_]ÍD$ D$D$8$Zs볍D$ D$D$7$.sUWVS趺ûMU Etx $MhxMMEpEt';Uu"|$t$F$V9UtމuE tH9uMtFE]ȃ[^_]E千ɉD$ D$D$I$Dr=D$ D$D$H$rUWVS 螹ǟuU Mt;A t+ ÃutF\$D$$mI [^_]fUWVS 16MtU D$E$ED$}|$E$0ƃE $fEL<80t6Eu1 [^_]ÉL$M$UdUM $…tU $fUMȉ׋usYtftE|=Eu stf`Z뉋E|떍oD$ D$D$C$oU b׉D$ D$D$D$oD$E$uf5Ef,zE UVS E UtuD$E$ܸ [^]ÉT$D$E$Hƅu E [^]ÃTt Gt01EtB[^_]ÍD$ D$D$M$;f?et[^_]Ft$DV tQFtB1ɉωMT:0$ V T:($V D: $M;NV r$F,t$ݲF4t -$ɲF8t$躲4$貲[^_]ÍD$ D$D$K$LeUVSҬ׹4$z,r D$E$s4$z[^]UVS荬Ò4$z,r $s4$z[^]UWVSNS<$oz,r D$$JxƉ<$Pz[^_]UWVSuED$@$iED$E $qj…t?t$U$[Ut'zu Ńtt$$[uUEHutU$BEUЃ[^_]ÍoD$ D$D$<$c7UVS!4$=ylr D$E$h4$ y[^]UVSתܷ4$xlr $h4$x[^]UWVS蘪Ý<$xlr D$$iƉ<$x[^_]ffffffUWVS0AFUz0-E܍uu<0 1E1M؋MLYtyu 8<|EuȋM؋uԍE99)11 ؃9ruu\M؋uu9tzwr<.uUy<0BÃ߀Xt\E f)Ǎ|uԄAEDX@30[^_]B!D$ D$D$F$`UTuԍE9t11UWVS afdD$D$ -<$LE tED$E D$<$mD$$ FE$?USeUT$ U T$D$E$oUWVS 豧öUEtaEEt88 [^_]à "EE ,獃JD$ H D$D$,$v_p!D$ H D$D$,$G_:}}43k } ;cl uuEU}#Ћu0u9dtt4}t>}9tȋEE T0-EE } =Y n}E vU 0-DPueE 7}} Ј3E T0-&E 0}E E}E } ;U 0-DPEE DЍPE}} #}}E1EEu } \Et } %Et } &Et } =uE E 0<EuЈEE} ?U  Ћ}E} } U 0-DP[u VɨEE IEE 0<}Ј@E nwtlEE T0-ME 0u Ј} -} ^E0-u DpuE EE 0uE[EMEEXE+E E6E E"E EE EE EE EEEEEE\EEEcEUdugs 1cduYE 0E E PH,-WEUE,-WE EE1FEzElE ^UWVS,Π˭u }EEqE/O]}}؍}}܉MEމU)ߋED$ E؉D$ED$E܉$Uw{( GAM ǃEE@uUD$ E؉D$D$E܉$/U+E,[^_]ÍƤD$ < D$D$,$ӉUXUs]9EC6D$ < D$D$,$ӉUWU6D$ < D$D$,$ӉUoWUXEE؍EE\QFtM ƃUED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$s]UWVS5:ur />3)Ѝ)Ѝ:~ 9w$&r um0"U$Ѓr $U4$Ѕt?w$WD$ D$$UֿUЃ[^_]É4$$uw$Wt$ AYD$D$ $U=E Ut1҉Ѓ[^_]Ër t;U$(NjU4$$CЃ[^_]Ë0ǃr 뫋U tuW3ǃr $r ^D$$=貝r Jǃr 1+1UWVS:?ur ))Љ):~ 9w$&r um@"U$Ѓr 4U4$Ѕt?w$WD$ D$$UڽUЃ[^_]É4$4uw$Wt$ AYD$D$ $U ;E Ut1҉Ѓ[^_]Ër t;U$( NjU4$4CЃ[^_]Ë@ǃr 뫋U tuW3ǃr 4r ^D$$趛r Iǃr 1+1UWVS>C}E$#HDžr fE|81ɃP9u/>3)Ѝ)<7ɉM~=~}|$E$IMAF$U 1[^_]Ër VD$ ED$$譻E$(@F$맋r u0$Ѓr $(ƉuE$(@Or a0t $Ѓr @~0u㋳r uED$$=Ɖr lǃr ǃr IUWVS?D}E$$FDžr gE|81ɃP9u𸿿)))<7ɉM~=~}|$E$GMAF$U 1[^_]Ër VD$ ED$$譹E$8@F$맋r u@$Ѓr $(ƉuE$8@Or a@t $Ѓr @~@u㋳r uED$$Ɖr kǃr ǃr IUWVS?DUE,tЋr t'Ǎt$蓛9uǃr ǃr r t'Ǎt$X9uǃr ǃr ǃr E0E ,E(E$1[^_]øUWVSTYUE<tЋr t'Ǎt$訚9uǃr ǃr r t'Ǎt$m9uǃr ǃr ǃr E@E <E8E41[^_]øffffUWVSZcpUE DžXE/tBD$E $p,E $Auv E t E tDž`Dždxhً]/]=Ut Ѓ/u.t+M L +Mkt/l+]utftl+EthD$E $p)%=l /=@_Ot/t?+Mu~.׉ڋt9E щ`p\`d 5lD$D$E $pMYDž`&$`p?D=`=A߉փsetftdl /tf\`Ut9E etE Ĩ[^_]Étzu \`l5pN?t9E tX$pU1nىf t~uf.륃8/utщ$p\E tE XfE pME /t/tpMpMwM?paM>OM1UWVSRW}E ttrD$<$3'xX[^_]Et$<$}JDžMtAt$$&ymt L8"tƉ<$r1[^_]L1fffffUWVS衎æ}<$<r $芋r ǃr 7ty0-E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEuE1[^_]Ër t$Zǃr ǃr K yEUWVS肍Çu} u <:tu1[^_]8ut$8tu<@t΃}:t& u}:t;UuF~@t[^_]Ät<:u[^_]ÍD$ D$D$$#EYD$ D$D$$DU{UD]UWVSafu} tb 8u$ u|:9ƍt&s :t|tu[^_]ÍoD$ D$D$$%DoD$ D$D$$C:1UWVSlvwƉE 8E10}!H Mu0r t |$$p$҇Dž DžUD$ ϏD$D$4$*D$D$ D$D$@4$%D$D$@$QE8DžDž1ҋ9slxȀ %:Dž\1҃ t t DžN9 ΋9rD$D$E$P5xȀ Mp@<#D$$2ߍFDkDžD$=D$<$… <:Duz)ED$T$E$EƋt'p<:tu))|:t:Ћ)ȉ)9 )؉D$\$ $MT$t$<$7$xy?@E<$ Dž:΍N9))t$$X0r1eN1nCȋ)Љ)Ћ))ӉL$$訇ÉNjÉC:{DžtE$M)P9rg8E+~l[^_]D$ D$D$E$%DžD$<$虆xr $@Njhr D$<$D77DlNj4A0<$DA0Dž$ D$ D$D$$;D$ D$D$ $X;oD$ D$D$ $;E$=KE$'KƉ<$6$<0D$ \$|$4$V tBt(PuADž4$VDžDž$/H $~DžL$T$$4$V18XoD$ D$D$$W9<$rtE$\I> <$3t> 4$VX> $u!$օ냋E$HUVS EM ut.t^UD$t$$P[^]ÍT$ T$D$$ 8M EuM ET$ T$D$$7M ElM EoT$ T$D$$7M E1USr t$Lǃr ǃr ǃr ǃr 1[]UWVS0~ÿME 8ƋE1Dž]r r 0-r tr uD$r $;D0Dq@:#r ux|\u ǃr ׍:\tWut$r $:lDҀ|\tǃr ǃr r $<#Ƌr u$8ǃr r Pr @&L$$!r dǃr ǃr ǃr f:wu<:tAt<|uD$t$$ƍ@E+0[^_]Ër $"uhr $ǃr +r r 0D$r $t r 5r t$ǃr ǃr ǃr ǃr D$ D$D$$N3tD$ D$D$$37ǃr ǃr ǃr ǃr $ǃr UWVSHzMu} tPtzr t$sǃr ǃr ǃr ǃr } u[^_]D$ D$D$$&2uD$ D$D$$1WUWVS$yyEu} (TED$=|$4$ƅl$d]:vDž<:9}d]V<\ֈmt>}<:tkOML<^uF<:mu‹M])ىύAdD$$]zljEEd<:u]WF<:XЀvP2MҋM FE1]MVD9ut 0v]M :]U})rtT$<$]yEEM$[^_]Ë]뽸 y]䍃RD$ t D$D$$/ÍD$ t D$D$${/]䍃D$ t D$D$$F/z1*E$]N|<$]9|]u4 UWVSyvEu} uE0D$=|$4$Dž$d]:sƅ<:d <:tCZtsu)Cd]D$4$]xUn‰ƹd<:uЉƍX)Ӎst4\$$U]wU@Љ)ӍsűE[^_]Ë]썃D$ h D$D$#$-E]썃RD$ h D$D$$$_-ÍD$ h D$D$"$.-Z]썃ՏD$ h D$D$`$,)D$4$]vt-M14$]y։4$]y]2 UWVSt"}E uD$#D$<$R80tN 1G<w/G9~ƒ9G< w91[^_]ÍG<wG@tftƄ/ DžDž)S$O9>:hf . 81Ƀ4uA )čD$pxr󥋵t$D$$8D$D$$5|$t$$5D$D$$5oD$ 8D$D$EL$'udurP)1)rBvBDžqfzU un~{<8D$E D$E$]UWVSDnI{}U 8E1EtqMyu )čD$UPtMP}y:u}<8T$D$<$#6U+ue[^_]øBffffUSmØzD$$Dv D$ $uLv []UWVSHAmFzu} }ԋEE8EЉE1\D$L$J>v u}MfMUT$U܉T$ D$ UT$$FuM vU܋9Eo} uv t%9v t1uЋE+H[^_]Á} u v uD$D$ $\E؅tDEċE؉$`KfxHuPPM3J$z 1 uԋM3JʀuNjPD$EĉD$$UDžuED$UȃT$Ẻ$;EsE؉$^ % ЉD$&D$ M6D$ED$Ẻ$ ;E1B9EBf9EwB U؍yM|$D$Eȉ$lEċMQUUȍD 9E89}r5M̉ωփs1tft1HE؉$]3")UuuB r EfUSKjTwD$r \$ ED$EU $T$u؃[]1[]ffffffUVS…D$LT$8D$h$rZ9T$8T$4T$dNL$84j|$t  D$hD$D$tD$ L$8L$$t$D$<$FCS}D$<$ED$ ED$E D$<$)D$<$[^_]UWVSER}D$<$PED$ E D$ -D$<$D$<$G[^_]fffffUWVS qEvRU L}`7D$$U U z0u LJB usxfB EEJw9hJ@U 9{<6}|$$GEU 0ulj΃}EEJ0u1uqH MHBD$$ E [^_]ÉU #U fb ߋrEt9spE94JhKE$ t:t4@t-UT$ U T$UT$V$Љƅu;E[^]ÍD$ \D$D$8, $N@0E[^]U =J -D$E D$E$2]UVS=ÖJE$ tAt;@$t4UT$UT$ U T$UT$V$Љƅu;E[^]ÍT D$ DD$D$p, $u@$0E[^]U<I -D$ ED$E D$E$$]UVS<öIE$ tAt;@(t4UT$UT$ U T$UT$V$Љƅu;E[^]Í D$ ,D$D$y, $@(0E[^]U<I -D$ ED$E D$E$$]UVS;HE$ tAt;@4t4UT$UT$ U T$UT$V$Љƅu;E[^]Í D$ D$D$, $@4#0E[^]U&;/H -D$ ED$E D$E$$]UWVS(:GuEqVt M>$ I}|$T$UD$ D$D$@$ыU'$ tLtF@Ht?|$T$UT$UT$ U T$ML$4$ЉƅuGE([^_]Í}몉U썃P!D$ D$D$, $?@HU0E([^_]Ë$ 1ҍ}QUE썋$!L$ L$D$J, $EIU[T$ T$D$} $E]fD$ D$D$[ $qUU8E -D$ED$ED$ ED$E D$E$]UVS8òEE$ t:t4@8t-UT$ U T$UT$V$Љƅu;E[^]Í!D$ D$D$, $@80E[^]U 8E -D$E D$E$2]UWVS7DKD$D$ -<$QEt8ED$ED$<$?|$ D$D$$跾E $DD$xD$$E$US075DD$ ED$E D$E$j[]ffUWVS86CÉEċ}u t$E$5Eȅuu}EEEE̍Eԉ t1 E U]M!ىˋuM! u t뷋]u!M܉!щME܋UM t1҉EԉU؉ƋM̅t_Mx+Mw&EEԍHwq{E@N4$];ƉʋEE8E1x}} EuD$$42^ D$<$1e xDžE %@  1)ttu䋅D$ v D$T$<$6x9 tvu1ɸ)u)lj9usu$yD$$0p 1󫋅Et# 9uE t *H uE t 'H uE t E t E t E t "E @u \E HE 2 !L$ L$ U T$KL$$ׅu͋$R3$D3$63$(3E+DĔ[^_]Dž:D$ D$D$$D$<$D.UDžpD$ D$D$$LEj1UD$ D$D$$!D$ D$D$$$x4X 1󫋝8Dž-t0)؋t9D$t$$<29.9Ëϋtft6tt$/$/$/9&!Ɖx!։|x| t1ҋ9ҐD$ D$D$$ $0…t01DžDž1 t1 !! u e눋 09Ћ!ȋ!ȉ t1ҋ1D$ D$D$$L/<$C0t 01s^!D$ D$D$$MD$ D$D$$ "p fEqX#111҉mldUVS$&3EE8EE EEEMED$ UT$UT$$1!xEU+u [^]1BlUWVS%ƞ2EE8EEEEEMU ED$ }|$}|$$xEU+u [^_]1kUVS%"2u t44$ D$ UT$UT$$1ҍE=[^]1UVS$1ut54$U D$ ML$ML$$E[^]1UD$ ED$ED$E$M 1ҍE]UU D$ ED$ED$E$ME|]UU E D$ ED$ED$E$MEI]UVS#0EE8EE EEEMED$ AT$UT$$1xEU+u [^]1 jUWVSb#g0EE8EEEEEMU ED$ A|$}|$$kxEU+u [^_]1iUVS"/u t74$D$ AT$UT$$1ҍE[^]1UVS"Õ/ut84$|U D$ AL$ML$$E[^]1UWVS9">/}u t74$D$ AT$UT$$1҉N[^_]1U!.D$ AD$ED$E$M 1ҍE]U!.U D$ AD$ED$E$ME]UX!a.U ML$ AD$ED$E$ME]US ! .EEEEED$E$E []UWVS$ -DžE = tIƍD$D$ t$|$$%tyDž 9AD$E$uƋI} t9rcJ8 uv9t<$M%$Džf9t4$$Ё$[^_]ÉUE D$E$K]ffffffUWVS,ƉЅtK Љ Љ Љ Љ Ѝx|$F$!tBF~1[^_]ÉU`T$ XT$D$y$E냸UWVSqv+ƅ9N rn~PRuF$D$ D$L$M<$褜^M΃ډE:BGuETB[^_]ÉUy(MED$|$F$DMҋMUu~ LЃ[^_]ÉMU`D$ @D$D$$MUMD$ @D$D$$M9N r~y(MED$|$F$CUMu~ 1UWVS)ƉυZF(JJrPf~Jtt$ $ uKLPthF%=@=\=DĔ[^_]Ott8t$tB$Ot9z |1tft Ĕ[^_]fx t~B8z<~ ^z0Z4FB@zT.IBpDp@PDH41ًP01 uH<1t3P8 uҋpx9t<|1tftFĔ[^_] nĔ[^_]ÉtUD$ LD$D$$tt`D$ LD$D$$tkzUtBT%=.8t f{f{UWVSæ&E։ʅE@(tvBXU$U@PxTZrtftP,}WP@ @J@ @@[^_]ÍU$txTULYHP놉M썃`D$ 4D$D$$U"U썃oD$ 4D$D$$U1]UWVSY^%ljօxlxD$$tE3G4U3W0 u|3G}F)uGHf fű~t$z u} EHDu@8/tF(t`F[^_]ÉUD$D$@)$>ǃUtq#F<$b<$ufF몋E@[^_]ÁN(i`D$ D$D$1$oF11UWVSutpDp7u4E4$u(4$< E$6[^_]ËF$$뿋F$$F$$F$$뵍$D$ D$D$B "$蛻aUS $ -D$ D$D$E D$E$l$]]US ED$ D$D$E D$E$l$]]UWVS8àƉ׉t,M=U= =T$E؉D$E܉D$ L$|$4$[R=ƒu܍M؁ ʨtUEԃ8[^_]1EEkEhEEMdҺ뱺몋U른s"كؽ8[^_]1Umv -U E]UMU E]ffff̀rS[4[̀rS[[ ̀rS[ [US EM u Et9u[]1[]UWVSÚ u} ttB|$4$v[^_]ÍD$ D$D$BT"$諸uD$ D$D$CT"$}UWVS u} ttB|$4$[^_]ÍD$ D$D$BT"$uD$ D$D$CT"$UWVS@w t$0D$T$L$4D$4t "|$GD$8UT$$\$0踪uL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0跹D$$T$ D$(T$,D$T$ $D$iD$L$8D$9\$0"D$8D$E $]?D$@E$LE EUP ]P]썃ՏD$ D$D$"$被uu1]uUWVS}G $wt6$suG[^_]UWVSûu} t"tL D$ $荢[^_]Í1D$ D$D$:"$ªu@fFE܋UVtfNȃ8[^]FfF1E@EÿE?EEURҸFfFFfFs1]fffffff̀rS[[UE]UWVS$íE։ME}E؉Eut[E9UsH߉։]EƋE D$\$4$U~" HS9uE)9ur‹]ڃmu$[^_]Í|=D$ 4D$D$r"$KEQD$ 4D$D$s"$"UWVSXEu U E } XE EE̋EƉE$]XEȅ EE MȍANjEȉEԃ)֋]ދuމu؋ED$E$M#EȍDMԉED$EED$E$U1ɅM9uREEEȉEEEE؉E܉}ЋEM4u}؉9_u E9s#ED$ED$4$U9Etщuă9UM]+uED$T$U4$U}9NjUt +EMC1ˉUE‹E9rU]}M9MrED$ED$+E$UEEE‹E+EMȉEuM9M}ЋE9 EEE]ԋ}čGU9Eщ}U܉EA‹M)ʋ}č M9xȋU)Ћ}lj}ԋE9E9EM]ED$}|$]$U}]UEE؅:U!ED$\$<$UU9~ ]E9rՋE9M̅pU܋E 9r}G9D)EE܋M܋E}89uM܉E}9}M9M M]E̅uU܋E}Ћ029r}GU9CЃ)E܋}EԉE9DEԉEGED$E$MEEԉEȉEċEEȋE9EEĉ$]1X[^_]Éˋ}M 9sWEƉ}Q+ME }uڋEE‰]MĉEE HZ9Eu]M9r}M8E}ljMĉ]XJM9uˉM]9sMˋUMUuދM9U]3]M9ËED$\$<$UM9Ӊދ]19ME9Ms?}u}9us'<3ED$|$E$UU9~؉9urً}uE9Zu̅U܋E 9rUB9)ӍCEE܋M܋EU‹9uM܉E}9}[M]U9UU̅U܋E}ԋ029rUB}9G)XUE:}܋u9rUB9)]E؉ËuEߤ9uu]]Uމ+]9UED$\$<$UU9ЋUlM9se}؉ߋ]M ֍E9}s8)1ÍED$T$UE؉$UM9ȋU‰9}rȉ}EE%}܋u9r}G9r))]E؉ËuEߤ9uu]]Ҹ}܋uEԤ9r}GU9s/}܋uEФ9r}GU9rщ)EMċU9EȋMĉMȉEU9UrEЉE}ЋEMԉE؋MuuEU)ЉEĉڋE]XJ9u]uE}9EŃ}tuED$}ȉ|$Eĉ$]H}!]D$ DD$D$&"$z]GD$ DD$D$'"$HÍD$ LD$D$x"$E*]D$ LD$D$y"$ߝ]LNUMVUT$<D$ ED$E D$E$y]fffffffUWVS EuNt4~^ȉMtH1ًP1 uN9H u [^_]ËMM$]t"N^HXVP MF [^_]ÃUWVSpuuDp7uu[^_]=F$$v4$*NjF$$a[^_]UWVS}E wuq6tk9uFNW9V uW1ʉUW1 UtGD$ D$L$$GWG1D$<$StG9F [^_]Í$T$ \T$D$i#$輛E LffffffUWVS16u8F}9FiF FD$ D$D$$$FVFD$F D$$FtotfxWFvthV uAzN)91FJ u M ]z u F MЃ[^_];1})81F u1UWVS(-}Dp7t2G$$=D$<$ƋG$$ [^_]D$<$Ɖ[^_]UWVS ü莟E脟Dp70E@$$賯D$E$,ƅ@ ‹} >HE@$$HtlEM 1 [^_]D$E$ƅt[P } uuuF脞uy}8눋E@$$跮_uJT}8E Y=If뱤&fvft  [^_]E xDE xfffffff̀rS[ô[ḃ̀rS[Ô[UWVS$qvutoEEE E-8D$D$ED$ t$D$E$Zƃt 1$[^_]8 uۜ8ፃoD$ pD$D$< #$3bfffUWVS0ƉE̋]E 8U1xu2  t8u)؋U+0[^_]Í}1 r}̍]ȉT=Ѓu]t; t\="t]y$]Ջk1d]̍U$fffffUWVSæ}U utrt<Ѕt .t&HOtuxu)Ѓ[^_]ÉU 6D$ D$D$=H#$艕U 뒍6D$ D$D$<H#$ZU \fffffUWVSM} UthtN49t8u)Ή)t3ttu)[^_]1<$[Ɖ[^_]ÉUM6D$ D$D$A#$膔UM]6D$ D$D$@#$QUM$USEy |b(9~)ML$$-D$E $1[]ÉD$ UD$ED$E $薘1[]UVS]bEy |b(;}.D$@$-D$ w 4$r[^]ÉD$ UD$D$@ w 4$[^]UWVSu} taEtH,-EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]ÍD$ D$D$?#$誒uD$ D$D$@#$xFffffffK̀rS[[UVSuLimNA90%[^]ËTPH9rLTP[^]9r싋LUWVSYZ}L^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓TP419|[^_]Ë]싃TPu޾ UVS@E,4$auLU4$D[^]ËE4$-[^]UWVS} LEq,E$L@}j}wMǃǃǃGLHEG1E$}E[^_]Ã}?vB}<6LP)ȉЉA[WLЉU艃HEPPU)ЉB}҃?}Ƀ}Ɓ}tfD$ D$D$Y$$蓎`E$PEUWVS LEEẺEыE)ȉE䍃,E$ɋUL@EHLt)̋EʉP1THE$\E [^_]ËLP)ȉGffD$ D$D$$$8UWVS,<$ޢƉ<$Ϣ[^_]US ÉED$E D$E$t []USSXE$[]ffffffUWVS!&}tHD$<$ƅt&tt$<$[^_]1[^_]ÍoD$ D$D$A8$$ UWVS×uD$4$9Dž|$4$ t>UT$D$E $;Es17[^_]"썃oD$ D$D$V8$$<N謐UE U9r 9]ø]UU E9r 9]ø]UWVSpuLw Lw uLw <8E1ɍt-ωD$4$&t Lw PEu׉MD$D$4$ MtMljMuD$|$E$ Lw 8Ftt$E$ 4$;uMETw 9t$$ǃTw ǃPw [^_]ÉPw TD$D$$aa[^_]UWVS*/u} t%>D$4$Itt=t1[^_]À=t[^_]UWVSut4t$<$ƅtD$<$ 4$3[^_]ÍxD$ D$D$\$$͈UWVSUZ}G$Tƅtx @D$$f[^_]UVS ut/t$$tU 9P [^]1[^]ÍxD$ D$D$\$$ UWVS ×U<8E8s7i1}ƉUE D$ED$<$~u E <=,ED$<$Åt:<=t4D$D$<$xU <8D [^_]1 [^_]UVSinl$Zu [^]É 01[^]UVS&+l$u [^]É݉01[^]UVSl$ԛu [^]É蚉01[^]UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu#B[^_]ÃHPtJ ȃB[^_]UWVSӉ΋t B SuUtBu{QtBunQu Q9tW[u믉 St2tAu(t@uAt@uSI[^_]ËtBuBB[^_]uUEU P@@ ]UWVSEpVUu 3t)+~E D$|$F $EЅu׉[^_]1[^_]UWVSExOtX1҉UM~]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSExOtX1҉UMy]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSEpEFM ]M19MƃU;\tkCEZE [^_]UE [^_]L돋 u{Etu>E닉Lt9ur 눋}bM υtIMyED1uLC yvyEE)fffffffUWVS!&ƍE E벅{UWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVS*/u 8E1Vt(r.E+VЁĸ[^_]ÍF\DžTDžX)DždhV\f9DžllD$`D$ TD$XL$U$j …UD$dD$ TD$XL$E$ …hD$t$E$l‹\f8\qP\p9\hD$t$E$r\ZqP\{F\DžTDžXDžhhD$pt$E$arq\D$ hD$D$4$|\D$`D$ TD$XD$E$ \ Dh̀rS[t[UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS u}F9r+)F|$E D$F $~  [^_]1 [^_]UWVS 訰íu}F9r+)F|$F D$E $~  [^_]1 [^_]USc\EU ]t,HPP UP[]ÍlfUWVS}u tot$<$,t t't 1[^_]Ãt$<$[^_]ÍFD$<$0t̃t$<$[^_]ÍD$ hD$D$$$ggޑD$ hD$D$$$g8UWVS#(}u tnt>t$<$Bu[^_]D$ FD$t$<$L[^_]ÍD$ D$D$X$$g떍D$ D$D$W$$fcUWVShm}u tt$<$u 1[^_]ÍF D$<$ftF t6u$FD$<$苚tăt$<$x뵸[^_]ËFE }F[^_]}D$ |D$D$x$$fRD$ |D$D$w$$eUWVSeju} t tJD$|$4$_[^_]ÍD$ D$D$g$$seuD$ D$D$h$$EeUWVSͬҹ}u tet$<$,u 1[^_]ÍFD$<$˟t~uD$D$ F D$t$<$'뵍D$ XD$D$$$dqD$ XD$D$$$ddBUWVS}u FFt 1[^_]Ét$<$&tFD$<$ϞtӍFD$<$tF D$<$tt$<$ڗ랍D$ HD$D$$$cVD$ HD$D$$$ac'UWVS}u  GtNu$G tWt)FF[^_]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ ,L$D$$bE GFG F[^_]ÍD$ 8D$D$$$$-bL$ M썃8D$D$%$$UaGUM6G EL$ L$D$ $aE   FFufffìrS[[v̀rS[Ե[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVS!&u} Mt}t]MF9tDJuMtL} XU tz9ut@[^_]É11fu1[^_]1MD$ D$D$;$$_MNɉD$ D$D$:$$_MfUWVS(ƉЉ8U1҅D$ |$D$${z<$T@9EED$|$$Fu1U+6([^_]E @NteulN u`L$$ $SHN tD$ 5D$D$ $XE4t9u΃tft%D0 oT$ 0T$D$%$_]2T$ 0T$D$%$$]FD$ 5D$D$ $>Du-uFfUWVS ƉЉU 8M1Ʌt=~t3 E+ȁĈ[^_]ù۹Dž9FfXtvEtoEfD$ 5D$D$<$B<$Q9E]ED$|$$-Vu5F~uN uF=tu ~tMEEhED$ t$|$$rw4$"P9E}ED$t$$M1@FȉC:9DžM9FF ftV ffuu҉T$D$ )D$ȉM)D$4$=Mx 9=EtEȃiviD$t$E$ڿ1T D8D$ 5D$L$M܋E$=M܅x9E4FD$ 8뻋EYQEE@DEԋ}1AE؍@E܍xEЋE؉M؉u E8EЉT$D$ E܉D$t$ $M[<MH9@)ƃu1q҉Ű}UT1AE؍@E܍xEЋE؉M؉u ET8EЉT$D$ E܉D$t$ $M;9M)ƃ9}u1MFD$ 5D$D$}<$s;<$IM9L$|$E܉$ԽMUU܉D$ D$ȉM)D$$;M}9nD$T$ D$L$M܋E$:MUWVS@lj΋E8EG uY$ato|$$bt9wuҋtD$G $kJu1ffh$tOEtPD$ ED$4$O'PPuEt8u x[^]ø[^]ÍUD$ <D$D$X%$JqUWVS( ƅt Ftt 1([^_]ËFy ([^_]Ãu ӉM܉ЉUUMxy=fuVfǃ  f|M܉UHD$ HD$D$X%$IM܋U0u?FtTtG1M}|$ }|$D$$*B0@MQVd5<볍3UWVS诐ôƉׅt4tdvu 1[^_]É $GuMGT$ $T$D$X%$HMuMHT$ $T$D$X%$tHMlMRT$ $T$D$X%$$誁…(88,,D$|$B$触8 ,&Lt!9 ft LL1.Bvq'tlH$9}NjE $,}$]~|$t$D$ D$ %D$D$$%蓑81H L)Pd8pT4 DH8@@11HrLXDž\Dž`HTtDžxDž|$@(4)L$ׇP#LP3者1.} 1-D$|$ 8D$PD$<$ƅ@@ u<$0Ѕ8Ɖ<$}/P9,| rGL"fǃ DfGljfWtuˋW҉NKE+&[^_]Í\0DD$$jZ(FF FFFFL 9u8΍ Gt‹@u iDD$$t!H󥋅DD$D$ D$D$$%聍81Lx $轄臂15M(18<pf1f14DD$$SW 8FNN uuD4$,DD8D$ D$D$X%$"6_D$ D$D$X%$5 NnD$ D$D$X%$5($GD$ D$D$X%$5D4$ +DD8,D$|$D<$"8ЉD1_ <$}w1#Lu .8t189 u拽,t t҉11UWVSp|Ɖ8NjE1>$xB$x11 rFFtGGFUF19~1ɀ.уu9`d9@ HDPDDžDžDžDž<$Q88=}3G u$1ҋ~`{Y}$v$h1xƋND$F D$F$Ƌ@ut2OD$G D$G$tF$~$~U+p[^_]Ë넅tJPd9\.$1ҋD$ D$D$$qu~d,@}뎃1@<tE12Dž$1ҋ. {u@ z81.늍oD$ D$D$ X%$/$1ҋg{z@u6mGzHDPDE$,|y1jUWVShvmEhpPt%={4DžthE11҉ rMd11҉`d r`VtA<$q49y.yt[^_]ËhMEEdUMEE$1u`11 rU؅tkhd<$3hE[^_]ËhMEE뀋hMEEd<$c3ЉddiX2\P}`1}dX  rOTdDpP|HXLƋX9H`D$ PD$D$L$%hL$P T$ D$HD$l$6xWE11҉ rlUEE!$\X;l$x9T#X\dwc\$1U`U؉h<$1h(‹d뎋DA‹@uDn> t1҃me9Gh9wGw9uhtQl$|dL 9u`q@D$%l$h[l$至…hl)D$L$4$|XdX`phHP HLT v~u~hxa G<FEu11 rE@t`EEEE<$8ML$ML$D$ |$D$E$twEЅUp[^_]É<$MML$UUT$D$ |$D$E$Kt?E$?]_p[^_]ËUEtFE$]gMEԋAE܋A EAEAEAEAEEUԋEg{EЉƋ@uj~ZUWVS\ Vc8NjE1 D$ D$ D$ $jƅ8#3D$4$D$4$xDž< < D$4$cxt$$yt띋AAA AAAADžD$ D$D$4$ ~#|$$u@D$T$1ҋE+Ё\ [^_]Ët։։vt.ttދ$닉GD$ D$D$ X%$a 3oD$ D$D$ X%$& IUWVS4S`EȋE0xU11  rŰ]ȍD$T$mEЋ]̍EЉẺEEtCË@uE)uEЅt $]gEU4[^_]UVSR_uD$F $ TtP PH p[^]UWVS@Rç_ljE8EG ut$t$$tӋD$$tD$F $ue$@=wI$‰@=wЋЉ==1U+@[^_]Ë~D$<$Dtu狵1DžЍtftȍtftD$D$ GD$D$@$)9OtD9AD$D$G$!t<0L9_YB 9@3t9'9uۉD$D$ $藃ut$ D$D$$+u9u [u3fvfvBfUWVSN[}utHt$F $E $UF t[^_]ÉE4$zE[^_]ÍoD$ D$D$&$fffffUVSÉ1   lLLLL9r[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVS7GF0F u9D$D$ D$D$$gF0[^]Ë$f 뷸US] $)1U C []UVS8Eu4$F$K>FFF0$2>F0F($ >F(F,[^]UWVSa8fEE@0}  ML$$Ԭop< t< t򍃖D$4$褬?x4$fM Ay EpE pED$<$[tbP1tJ< t`< t\E@H9tTE xFE7ED$$tgPuuE @4E [^_]Ã됉U }OD$G$c9DžUtBExE xzt7@ D$$ 8ƋEp0E$01jUWVS$6CEuUE@ u*x(9P,ӃCtftEp(ff} GуbF9SNO F|>L)/9!A)‰UtEHE HU1EE.E HFD)ЍtEx9EEPB9uҋEPU@E]?ED$UT$E܉$ \MuTMEHE Hb@ ]D$D$ E$[]0E$E@$U:E@@@0$9:E@0@($$:E@(@,T01$[^_]ÉT$<$]6DžqEx(UP,ӃuCu*E $[^_]ËEH!fZUVS3@u F tcu.tR4$(tEED$4$+tE[^]èu?V$ED$ ED$T$F$ t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$b[^]ÐUWVSh2@E̋UD$D$}Љ|$ D$D$]̍4$<vEЉ$/cD$D$|$ D$ED$4$WF4N:V;m]4$^/P]ۃV(F,}EF-~E F O(NEEfE= =w=w=?w=ED$D$ 11 +D$$D$]PGV0N8F9/r<11͸11UWVSk(p5D$E$ƍxD$4$}и9ED$D$t$D$ D$|$$葉t4$sttFD$/D$ E D$|$$t Ĝ[^_]É|$t$[1߉4$R1ȉ4$1UE@ ]UWVS='F4EEU ;P snH,X<3t;t-?19r09Pr+HE)E1[^_]?SӋ?̋]Ӌ]UWVS$&ç3uF$ED$ F(D$ED$E $O~;N:]f4)ЉMЉF$)É]]]f4)MЉF$)É]Ef4E)MЉF$})lj}F-VMуtitT <ωf0ED$ ED$)N8N9^ )߉|$4$K$[^_]Z D$D$$茹9ԋD$ D$D$=$10-D>DBu.L$$u9ċ+$!D$D$$ǸZUWVS !EĉED$ED$E $b&D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,yaD$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,aẺEEfEEEfEEEfEEEfEEE`t2 u&FlUopU x;uED$|$ @-D$'D$E$E`t jED$$;E`FED$ D$D$ה$8D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,_(D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,"_D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,R^rD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]ND$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\*E`Yl‹w puED$ t$D$E$l‹w p8uED$ t$ t$E$訲kWZ PH8uED$ T$t$E$ekWu Wz?uED$ T$t$E$'E`t tED$$ ED$$1ɋuEED$$ EED$$@EbED$$EEEf Ef Ef EĈ[^_]Í T$D$ D$D$<$.o D$D$ D$D$$UnU D$D$ D$D$4$n D$D$ D$D$$UnUP D$D$ D$D$4$NnK$D$”D$E$4Ĉ[^_]ËED$ D$D$$詒ED$ D$D$$ED$ D$D$$UED$ D$D$$+ED$ D$D$$dED$ D$D$$בED$ D$D$$譑@ED$ D$D$$胑ED$$ IUWVS$ uE }8U1D$L$ t$U‰T$$ xVD$t# $U+u#$[^_]$."1OUED$ D$E D$E$]UWVS! &}ED$|$ ED$ED$E $ x8Ɖ<$uH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$âE8E1D$|$ D$E D$E$&…tD$<$E+u Ё$[^_]NUWVS }u Gu 4 Gt*D$4$趞uUt E[^_]ËEtE[^_]UWVSÞuZe~M u ( ~t9uUt E[^_]Í L$D$ D$D$<$iEtËE[^_]UWVSu} dVu + Vt!9>uMt Ev[^_]Í|$D$ D$D$4$#iEtËE[^_]UVSkpu,d\l Bt ;2u[^]Ét$D$ D$D$ $hv [^]Ét$UD$ D$D$ 4$\h[^]UWVSùU} tdUfc~U ~t;u[^_]Í T$D$ D$D$<$g[^_]ÍlUVS,1ub Bt ;2u[^]Ét$D$ D$D$ $^gv [^]Ét$MD$ D$D$ 4$g[^]UWVSuzu6bw$ wWvK B v|@vF[^_]Ávfc[^_]Á 5[^_]Á v,낃@t9u~Ujtuc~OtDN9.\#p 51t$D$ D$(D$<$ce8#H2jUWVS}Â}>`YD$t$<$`x [^_]É|$5D$ D$(D$4$d[^_]UWVS }_ rt;:u[^_]Í |$D$ D$D$4$:d[^_]UWVSLÖ8E1E <tmD$D$ D$.D$M‰ $McMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$MoGUWVS4 EEEE$襮E܍U}}؉EUEEU t 14[^_]Ã?uuU<-E<+u JMB0-DK~r1ɍ LH>vD{uU 4u<.}DCuuŰMэMܨ@uM1ҋMDK@u49rMԄMDC@&E DS@tc9rEu ]Ԉ^^FEȉFEȉFEȉF EuuEE9sEiEԋ}DC@u>1ɋUDS@u%9rUȄQUDC@NE9>DS@uE9&ENjUDC@ub1ɉUЋUDS@uF9rUċUЄEĉEDC@Eu9sEDS@t|9rz}BDCz}4BDCu;uJMBEcEE]z}DEBDC1.t&FUWVS=> EM HMHMHMXˁHɁ@ =+-EAE-ENMb֍)É]؉л))Ɖuԉމػ))ƉuЉ]̅EEMbӍ)Mȹ))Ɖ))MUĺQEM)U)MEJ$)CEE4$CEE $CEUM^]EaE}d\$DD$@ED$<]\$8T$4]\$0]\$,]ȉ\$(t$$L$ uĉt$ut$u؉t$uԉt$uЉt$ ủt$(D$u 4$\E$Et $oEt $^E Ĉ[^_]ú)‰UiEESEW), u RE ; er@ror:@ unk@ nown@ LOC@ RR @vers@ionE Ĉ[^_]ÍsEs}\$DD$@sD$*tQ<.tAx[^_]ÉȅyET$ ( T$D$\($^E[^_]Åt<.1[^_]UWVS0VE荰EEEE$PlPHH8|$ x|$x|$@ D$L$T$ ؕD$D$4$ ~ Eƀ0[^_]UWVS u Gt-D$4$Ŏu?E tE [^_]Ë?D$D$4$ukV0-DPtMrD$ ED$4$JKҋMyE8m1Ɂ]1VUWVS+0ul\ Gt-D$4$Սu?E tE [^_]Ë?D$|D$4$ukV0-DPtM肴D$ ED$4$Z[ҋMyE8m1Ɂ]1VUWVS;@u D$4$譎FFy ;F|/} t)P}D$4$衎[^_]Ét$E$襝USEM QQy ;Q|< tZ[]ÉL$$W[]UWVSrwEu E$\EEEEED$4$ÍF0u ǀED$4$2}D$4$贍[^_]UWVSmRPƠ8uWV@tWufFuFuFf~@tJD$4$`lj4$$R[^_]ÉV@ut"Fu먉F룉4$hfF@먋FuxUVS&+Ơ8Fu t$ -XD$ D$ED$4$[^]UVSƠ8Fu tE D$ D$ED$4$[^]UVSÉƠ8Fu wtED$ E D$ED$4$2[^]UVS,7<Ơ8Fu *tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$,[^]ÉED$4$;EUVSíƠ8Fu t2ED$ED$ED$ E D$ED$4$[^]ÉED$4$EU6?8U]U!8U]USED$8$[]UVSƠ8Fu t$ED$ED$ E D$ED$4$[^]USy~8$[]UVSRWƠ8Fu Et2ED$ED$ED$ E D$ED$4$[^]ÉED$4$rEUVS Ơ8Fu t9ED$ED$ED$ED$ E D$ED$4$ [^]ÉED$4$EUSfkED$ED$ E D$ED$8$[]UVS#(Ơ8Fu t4$[^]JD$$dUSD$  D$ED$8$[]fffffffUWVS ÆE8tj׉ƅt|$4$2Qt@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$E2T$ D$D$x)$-EE룤u9sftuu_SfӋ]KUWVS0E׉΋UU܋U؋U$cEM9L9MyAE荃EEuuE9D$E$st4$ME+x4$MyuE$EȪE؉Eu܉00[^_]ËuE$Exu)y9uωE)T$ $T$D$x)$ؤE1UWVS$Y^]Uϋu M MUL$T$ L$U‰T$$EEdËUv‹9EuC9@@EJ}B$[^_]Ë]t*]t .]{<|.B]9Z.EM9s;D$U썂2D$ D$D$x)$-Eډ)؋ux$[^_]ÿ뛉댋]썃ED$ x$D$D$x)$뷋]臨EE}8UWVS(}Â]Ӌ}u UUS9)ÃEM-U썉2M u2D$ED$ D$D$Ex)$EJBs1([^_]É4$Ex%([^_]Ë]wEEUWVS+mrEuE(M,} M0t8xU1҉}$tt$$JNNƀ?E4$lDžU4T$|$E$Fƅ9s9D$2D$ D$D$x)$-7)U4E$NjE$|$D$4D$ D$dD$$VJNj $‹>|$ $}Mtq}whM 򋽤;qt#t<.)z<7|0.M$qU$AD$T$L$BD$ D$dD$<$/I‹$9ќ|0-f @)ȉ~ DžƋȉD$D$<$<9u׋)$$|o|$ $1ɺ0yf; F01x JDNu.9uҋ‹)‹<$9VƋt)xE+1Ġ+[^_]Á}e}$# M$aU$[=VE4$)x2D$$1ɺA.:f; @tE4$X~벍D$D$$U yƋt)9\D$ $D$D$%x)$Wn}$<$wWD$QD$ D$dD$<$+E‹4$t$D$ }$4$fN~F$$T$|$L$D$D$ D$dD$$RD‹ $$ 9*4$3 $D$|$ D$dD$$C‹ $$Z4$$+D$|$ D$dD$<$dC‹ $4$PD$QD$ D$dD$<$C‹4$_t$D$$U b)D$ *@t$L$$94)51E)0~0 $09&4$a‹$Ly}$<$WIL$T$D$D$ D$dD$4$nA‹$E$HD$ *@t$L$<$2'M)(1E)0~0 $,b09`(4$ ‹$y*D$Qt$ D$dD$$D@‹ $GGD$t$ D$dD$$?‹ $DzG$D$t$ D$dD$4$?‹$&wG9D$|$ D$dD$$?$dy$Fƅmlj$2}u9$wM$)a|$D$ $U <$N|$T$ $<$WD$Qt$ D$dD$<$i=‹$D$t$ D$dD$$=‹ $qGD$t$ D$dD$4$<‹$']99D$|$ D$dD$$K<$y9;$kEƉ9$!yV}+}$Q<|$D$$U Z<$|$L$$U <$T)ƒ=эa;}$}4|$ t$D$$.4$9s?D$2D$ D$D$x)$-։)׉}4GD$D$ D$dD$4$9‹$IG9Q$Dž1%pƀu1$Dž |$D$ D$dD$$9‹ $^QP9N#$ 6@t$D$E$$S24$Ë$k}$L}4|$ t$D$$譪4$e9s?D$2D$ D$D$x)$-E$ VUUU)ȃ=l$)}$fr@<h  }$ZD$Qt$ D$dD$$6‹ $BxGGD$t$ D$dD$$6‹ $!GD$t$ D$dD$4$F6‹$GG<}4|$ t$D$$膨4$>9s?D$2D$ D$D$x)$-։)׉}49)=G$)B}$"4$F$$QD$t$|$ޜD$ D$2D$@4$~4‹<$|$D$^}$c<$AWD$QD$ D$dD$4$3‹<$P|$D$$U Q<$0|$L$$}$}4|$ t$D$$.@t$$=D$D$$U ) 1z9t؉4$nD$D$ D$dD$$K2‹ $yED$dD$ D$dD$<$1‹$R|$t$$U J<$-F$t 4$p4$eD$D$4$4$|9E4s3D$2D$ D$D$x)$->&D$D$$U `9zF09\Gt1Gt`$D$D$ D$dD$$/‹ $LuP~F$B=  $)u|$t$$U <$Q4$~$XD$D$ D$dD$$.‹ $<$|~$D$T$ D$dD$$.‹ $s<$fF $F $D$|$D$ޜD$ D$dD$<$-<$G$|RT$D$t$D$ D$(D$4$"-‹$}U$r VUUU)ʉЃ=p $)-^E$XaD$AD$D$BD$ D$dD$<$^,$}$fR<$0G$"D$t$D$ D$2D$@4$+‹$']4$9lj4$$lj$k$T}lj<$L|$D$$U xt9H\D$ $D$D$Ex)$<x}$a=t9M $i)_}3$.x$YG GGDž====Dž$Tlj9zw>9Gt1Gt`$D$D$ D$dD$$'‹ $4juP5G GGG GG GGƅ=G GGG GfDž==ƅ=W GGW GW GGW G$,Dž====fDž==e)aRD$ @t$E$D$$ y 1E)0~0 $309 4$o‹$yD$%D$ D$dD$4$$‹$p?2‹9@Dž@DžDDžHDžL@)‰t(19rE4D$ T$t$$˕$}n9s3D$2D$ D$D$x)$-)U49V<$ |$t$b|$OD$ D$dD$<$"‹$s7D9D$|$ D$dD$$! $yD$ @t$L$<$8  P1E)0~0 $K09f4$)l‹$yI)a 4$lj$V|$AYD$ D$dD$<$ Nj$‹\T$ $1ɺi$ B4$Nj$u4t$D$<$Dž9s3D$2D$ D$D$x)$-)u4t$$1ɺ`4$ ?$裿Nj 4$u4t$D$<$Dž9s3D$2D$ D$D$x)$-)u4t$$1ɺ]4$<$蠾Nj4$u4t$D$<$Dž9s3D$2D$ D$D$x)$-)u4t$$1ɺZ4$ Ɯ5$虽<$u4t$|$$9s3D$2D$ D$D$x)$-lj)Ɖu44$МUt$$1ɺm24$ Ӝ $М_<D$D$$U i}$M$a=O$U:L$ @t$T$$ …4$ȉ;D$D$$U 9Ћ$|"yWM$=/E$Ha=E$Ha=$=]a=}4|$ t$D$$螋4$Vd9s?D$2D$ D$D$x)$-։)׉}4$)~'$МD$D$ D$dD$<$$ :k$=D]|79$=]i$=]avD$ @t$L$$1E)0~0 $094$a‹$y)a$=T];aD$=D$L$BD$ D$d1ɉL$<$‹$sp$ќwUWVS8蟲ǠE  U8u)E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]UM8E#ʌʐ]UWVSбվu}'|EtG9E r'Gf|t+E D$<$@y]o([^_]9} r+Ey;}uExT$ $T$D$l)$iE뵋E9E r1UWVSEEu} lj~P9rCffVP9r1PffV 9r1Xff\V t9s]n(?1ۉ}D^ fu61ɉLu}9uF$F(F,1[^_]ÉD$ \$ED$<$XxUWVS#Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$uF,F,^(NMD$]\$ D$ED$$]良7F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~GF$gF(F,b lM]k]k(UWVS Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$F,F,^(NM]T$D$\$ D$ED$$]臻;F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9ErgMF,F(F(T~ 9~GF$hF(F,ciN]i]i(ffUWVS蝫Eu)M} OV~^m M0ȈE<ƒ?ك}Ou荶,%ULWm ]0وM<O ]O?9E]U\]\U]TT} uU u ;E}[^_]} Oσ*$ˉM[MrUWVSin}u 'MYf0x}~E~p1M ɃT 7  ҃{T 7SƒuM9}{C.봋]9|Mȃ[^_]ÍH rȃ[^_]ÉET$ p%T$D$g*$ZME#gp̙ UWVQZu̙ o^_]ø1(1 ÐUWVS\ϋMM8uM1t$D$ED$ D$2D$M $MQƃM9r,ML$$$<7M)11}U+u\[^_]øUWVS jsEE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EE >u}: w( ]u#M EÉ$Sr?E}~=Ut3}0-,-w\DAtu܋E Ƌ})x [^_]9u]䍃#D$ %D$D$e,*$cXÍM U$WEM E$DxgEEM E$HEmx>EM EÉ$MMCxEM UWVS16u4$!MH9MX} slu^uVt}} Tр:.utgz\t,р:.tU ƒ.} 1[^_]Ãt=z\tפftu?u&xU 몋E Pf} \(qUWVS!E 8E1D$|$E$xFD$T$$zxT$<$z4U+u [^_]fffffffUVSbgEuUMx#L$ T$t$$<x9s[^]ÉL$T$$%[^]fffffffUWVS utcEt\E $F&ljD$4$'u?|$4$#u%džt$|$E$D [^_]É4$#f\ZUWVS _dutcEt\E $%ljD$4$V'u?|$4$"u%džt$|$E$ [^_]É4$"YUWVS ϛԨu t\E$+%ljD$4$&u?|$4$f"u%džt$|$E$  [^_]É4$!CYUVS GLuD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVSߚu} tAv-u3D$4$$tD$4$`%F1[^_]kXUSsxEU tttu P1[]&XUWVS).}u t' t:@trt0 wvONuIW[^_]D$<$ $tD$<$y$wFw71[^_]D$<$#tD$<$<$71UWVSej}u tPD$<$#tD$$D$,\ZЃL$|P/~ȃ9~D$$)D$,ND$(\$,eED$8D$< D$P!L$8iDI4N\$tD$t$|4$8bD$|8(D$tـ\$`D$XD$XD$XD$(D$0D$8D$< D$P݄$\$`.D$(FT$H)‹D$<ЉD$PD$X~T$D D$XD$P/bD$P؉ƒtL$tV(݄$4ݜ$D$P-otj݄$D$t&1ҋ\$Ptut ݜ$؅ D$P݄$ݜ$|$Xu DŽ$\$t>M"݄$\$`$n݄$\$`t$TFD$`ƒߍFXj‰D$|@H0tT$TD$</[|$PT$8T$H 8t|$PT$8}D$hD$|D$,$x D$D$5$<$\$t$$t$ $D$|$$$\$t݄$\$`t$ptD$|L$DD$`\$`D$`e[^_]Ë|$PȉD$|t^t$HD$PD$0JЃ w(D$PL$8\$| CD$|SJЃ vD$8D$H-0t ˃L$|0t)ÍCD$PBσ\$|BЉD$8D$PD$0\$TD$H|$8\$,Nq$$\$t D$`$ D$h$ D$8$ D$T$ \$P0D$tـ܌$T$`ݜ$D$d\$t @"݄$\$`\$HuD$P$%k)~&U1҉$4DŽ$pD$Pj؋D$tـ\$HL$H\$LـOD$,D$H$%u=D$0[D$H#$$T$P=܄$ݜ$m1ҋD$tW(C$D$\$td&D$4$$ $$$1D$XD$\𿃼$us$ue|$Pt%=/D$D$T$\$tD$T4D$hD$D$T$\$t1D$XD$\࿋|$P$$\$tL$X܄$ݜ$$C $/$%= D$Txu xD$D$T$\$tE D$T|$h|$$N$ځ$|$P3'p$\$tnD$`$bD$h$VD$8$JD$T$>$v|$0$T$Pܬ$ٞwq؋$ݜ$!$1D$XD$\?6$%=+|$\)‰T$\K)!؉$^$DŽ$M9D$0tS$$|$PtN%=w@k)9t:D$0ut$HSD$H#$u΁tz%$1ۉ$$D$Hqݜ$$DŽ$DŽ$$hD$,LDŽ$1ɉ$t'4$*$D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USuÒEM t.9t*?D$ d'D$D$p(+$,[]US1u6M E%t.9t*?D$ d'D$D$p(+$,[]UEt t]ËE ]1} ]UStÙUE ~;u;t5?D$ d'D$D$p(+$+[]ǂ[]Ãwǂ[]US tEU tt 1[]1UWVSsπ$ pEtc@@x1D$D$4$EW1u E[^_]A184$x218EE[^_]UWVS.s3uthF~O9tHNM 1[^_]ÉU0ED$|$E$蠙U0u=FUF맍]D$ 'D$D$ZT+$*i|UWVSrrw}t;t-M tWt1$w;wr$w<$w[^_]UWVSr}tJWt7E1U9}t#E4E D$4$!u߉[^_]1[^_]Í]D$ t'D$D$T+$)UWVSqÈ~E@EEE19ut|E%D$t|$ 811YD$DD$8f-uix. fLD$:$(1flmUWVS\Yf׉u UuU8E1Dn} t>M1U+y \[^_]$(V 9ƉyfQffQ 9>f4ED$D$ T$t$ $X@ u1$ЅD 9MPPHDžPGO9=uDž Dž)D$t$ D$D$$XWDž@ u4$Ѕw8L8 9v<$ZfG$ZNj$YЋ9f}}$} )Q t$$D$t$ L$D$$VDž@  99uQ 04$=$ZC{GvT'tO<$NNjE$N$O|$t$D$ D$%D$$%b1t9s;)d}dDž1 019tl!9hu狍Ƌf4JuZtJ9}A9p@ ‰))9~V׋2$X<))9zrtft1mDt$$*x9P ]u,04$tx99v8Љ΃tft4$b=ȉB9}_D$ L(D$D$0,$b nD$ L(D$D$0,$* cD$|$ L$D$$P…s@ 899EP04$=+Ɖ<$P)9| t$ D$(D$$%]4$p)9T$T$<$q8f<$Ѕ%WDž$RT 1q΋9 GƋȉfpfJ2r 9t H0f9ًF9}랉t$ FD$|$ L$D$$M…@ 9-<$P9D$|$4$o1r@ yyy )ʉ (D$ $ O‰p<$%O\/D$|$4$n01911)fR9s<04$L2)׃ (D$$MljUWVS$MKRXu}5EGBt $[^_]øEB $ HE!= DžD$ED$ED$ D$ED$<$gE…xkF D$FD$FD$ D$|$E$MEEE$P<$ Et;$[^_]øE9E$O<$F tD$ X(D$D$0,$BE$fOF UWVS@IVMu8‹E1kFB FBPƋ}ۉ\$D$ D$)D$4$~HƋ9s < tW< tS< 9sz~D$ $9H< u땸1$F@ "m)փ (D$$TCtƉKD004$@9]‹tft‰)‰ODžNtftR :)944$@9o‹fBf 8mDž1 D$ (D$D$^0,$3P$D9%f)փ (D$$@%Ɖt$Ddf\UWVS`->2KE‰Eu8E1FE D$ .u‰t$L$E$}žEE4$ML$ML$D$ t$ED$ $t`E$ CE@ U+`[^_]ÉM $bM>ʍEbMUEƋE$Bu녍D$ ((D$D$0,$2[UWVS(<÷IuE>FE苳 }teUE<$kML$ML$D$ |$UT$4$ެt,E$AE@ ([^_]Í뙋MUEƋE$At([^_]Í $t: DD$ (D$D$ 0,$ nUWVS;ÊHƋEtvF u>ED$ ED$ED$E $E1lj4$[^_]ËED$ ED$ED$E $EDžt뼍oD$ (D$D$0,$1[E1UWVS:ǮGt@ËED$ ED$ED$E$ًU EfƉ$[^_]ËE1[^_]UWVS05::GE}u  t/10[^_]Ã} uyMMUUUUu|$M L$D$LD$ўD$ YD$ D$E$&iuE0[^_]Ã} tRa8t{bPWPtD@ 7 E #:T$ l(T$D$0,$OEx{UWVSX8E}E EЋEEEE8EƋE1$(51 E؍EEȉMԉ}܉<$=D$D$ D$D$E܉$iDžE؉D$<$譬ƅtEȉD$|$$ MЋIt9pMЋI t9^Mԉ}UEă< t< tM܋E؉D$4$&MPE tJ< < E}9yE؉D$$ЫtPuϋEЋUĉP MH}MHAMQM)ω}9}ЉG)ʋ}9nt1ɉU؋}U9rU؋}ЋO E)׉UA4$@9‹}؃UЋu؉2Ɖuԋu)ƉűEEE6tftuЋVuȋMԉ 2M)ẼEE؋}9SE؍UȋU܋4u4$@9Ern‹}ԃrjwt%ỦϋU)׃E (D$$7t 8E܋U Mԉ}M܋E$:E܉$:!E1uU+|X[^_]ËEȉD$|$$!Kt@ EĉỦ $iŰEωM[fPEЋPEEE$:E܉$:E>fuE̋E_M#Mԉ $9EEfbD:z1E܉E8US3Ë@6D$D$@ D$ D$ ED$E D$E$[]US035@6D$D$ @ D$ D$E$g[]UWVS2?D6)tDÉt$ D$@ D$ $ًU EƉ$2[^_]1[^_]UVSk2p? tpǃ ǃ ǃ ǃ ǃ 5D$D$ @ D$ D$ $,Ɖ[^]Í $eY t55fUWVS01ö>ƅ0-8DGty]]ԉ]]]܉U؀0tv\G0 1 4H\Gu6.E]9tEprBDGu10[^_]Ã0 vNȃD$|$$Umr9jUЃ}Mt9u }U9P}91:u}zEt }_}RM)ыE U U$UJuE+|UEČ[^_]u\ǾP}t u}tdPu9shx)‹|9rSt$D$u4$IJuE1E‰xEEjPu9 1`)x,6D$ ET$D$I<$UExUt7H)D$ t$D$<$uJ:fE6L$ H)t$D$<$E룃}=:UrlUWVS/&43U-`7qD$E$膾E@(t/}}tt,[^_]Ãu[^_]É<$ E [^_]ÉЃtE륍D$ *D$D$-$E }D$ *D$D$-$R}!<$ E 10UD$$tNjE 8Ut E?*D$̑$ 1UWVSu} t tJD$(#|$4$ [^_]ÍD$ )D$D$?-$u}D$ )D$D$@-$ӼUWVS[`}u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]ÍD$ )D$D$W-$ۻ,ŸD$ )D$D$X-$詻UWVS.3}u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]ÍD$ )D$D${-$论,D$ )D$D$|-$|UWVSu} tt@} u[^_]rD$ )D$D$-$uŸD$ )D$D$-$UWVSsxu} tt@} u[^_]D$ )D$D$-$苹uD$ )D$D$-$]UWVS u} tt@} u[^_]VD$ )D$D$-$uŸD$ )D$D$-$ϸUWVSW\ u} tt@} u[^_]D$ )D$D$-$ouD$ )D$D$-$AUVS uED$t$ ED$E D$E$~>.t[^][^]USw| ED$ED$ ED$E D$E$B[]UWVS6; uE D$E$t })x[^_]9u<-D$ +D$D$\-$?E)UVSEPtY.J.tQ.t&.tPÃ߃Aubv-0 [^]ÉÃ߃AvXЃ wrÉȅu[^]û.HvHw@B.̃v XЃ v-u(rÉȉdJ[0 v1nUE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]US$) E D$E$[]US E D$E$[]US E$r[]USñ E$@[] 8U| E MXp7]UEf]UE]UEfU f]UEȋU ]fffffffUWVS( u}E EEGE؋U L,uу<9M E9syQ.tf@t|E E9sT@AuwuFcO} o9](([^_]"E E1ɍL,EM[<U|$M $}Ut~UM)ȍ<FD$ $}UUM)ȍE(\.uЋM)ȃE%E}9}EM؈vM؅<.U܃uwUD$]E$|UEE})C~x9F0-}ȋ?DG~ruE9E9EEEE1ȉU}f]tEE:UD$ED$ED$ ED$E D$E$y]UWVSDE܋EEpu؋EmE@u8uEU1Ã@;؍sL`uʋE EEEEȋ} EEEċEQuE;EM}ԉ‹EỦ]}?wxEËu)?fpхt@}E]Љˁ?@ ‹EЍpхuEEuEuŨ;U]M}ԈM]\MEFFEE]ro+E d9] [fEp}1EpBf9utBt&M]܍D$ ,+D$D$-$*MUWVS$ƭE8E1D$D$|$ ED$E D$E$t>ED$D$<$&tE+uЁ$[^_]ú/UWVS$E MU8E1D$ D$|$E$t-T$L$ ED$D$<$cU+u $[^_]É.US]E M9r 9s9su[][]UWVS EU} E9slUP0ك@t$tNt<]败([^_]9sAAu@u;!E!29rUUX9r1[^_]ËE؃EȉӋUUWVSUVuE t*X?w#9r6 )ЍXt9Aхu)[^_]É[^_]É֤()[^_]UWVSEEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]s uU270:ۅt9u1[^_]Ë] [^_]Ë](1[^_]UWVS u}E9E |2&6D$D$$ umtF;Gt1 [^_]ø [^_]UWVSDŽU2E uuW1[^_]É?wZ9rBZML$ ML$)D$D2$x(9E~9}ljr[^_]É(뗉բƢ?UWVSEU t_Z1?w%9r8D)ӍV[t9хuލF[^_]Ék[^_]ÉT(F[^_]øUSOTE D$E$k []UVS$)uD$D$$tD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]UWVS,ƓuE܉U؅Ot A"}܉MGEML$$]ߎu]NjM-+E0 EEډU1709~Kt$EU9)ߋE^SЀ vSW9U؅ttFE܋E؋u܉0,[^_]ErEJ0AkL$X\$\1ҹ1)ӉL$H\$LD$@.D$ D$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$ ׋D$XT$\19|ID$XT$\D$HT$LD$XT$\m1뷸n1뮁lL$X\$\n9>|$0L$X\$\L$X\$\1҃D$HT$LD$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$@.)׋D$XT$\n9}8D$XT$\D$HT$LD$XT$\ m1미n1릉$D$PD$@.D$8t$X|$\؃!|$\֋T$\ƸQ)ƃt$X|$\)i)\i(\ø)\ykddڋt$X|$\)׋T$\i)\iD$X(\ø)\d$XQ֣p=T$L9ø ףD$LD$H\$XD$0 |$8-9R9~&)уD$P t1ҍR9ڀ|$Pt$$D$XT$\D$XT$\ƋD$XT$\9L$X$uD$t;ÉD$(t$,EaŃ\$(t$,D$t;D$PD$T1$D$HD$dD$8D$tD$0t$X|$\9}Éщ\$dL$hD$HD$ ED$D$8D$D$D$D$`Љ/T$0D$H]D$dT$h\$\1Ӊߋ\$X1 t$P|$T11 7D$PT$T|$X9Ɖ׉ӋD$\D$dT$h D$XT$\D$PT$Tt$X|$\1Ӌt$P|$T1ڋ\$X9؉ӋL$\D$XT$\T$HD$XT$\D$0D$(D$,bT$4L$8\$;`\$T$4L$8\$$@+7Љʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$11ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0>$@L$ @D$ D$49t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Lщ€|$?ED$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G D$ 9tG +t$\$49t$ \$ ^T\$]\$UWVS }썙]| uu [^_]Ë}|:dNu쉼uMTډ ?-00tċu! [^_]UWVStgl\$XT$T˅. 0xt$\|$`IXPL$d\$<É s {9 l$dyD$<D$dD$<D$ t$lt$D$QD$ D$\T$`$T$\$X \D$\T$`E.‹D$T|$T:)؍))׉|$d)À\$l|$<ljύ))É\$$t$D$:D$ D$\T$`$T$\$Xp[D$dT$ht$lt7k9)ʍJ)Љ)))șD$dT$hi"D$dT$ht$l7_u)Љ))щL$\D$X.D$(iT$h)\iD$d(\ )\d$dQ\D$dFEVED$ ED$ED$<$HƅL@U܋M;WW+EỦ9‰FA1EdF1Xn]؉E܋؉ }<$11ƅE؍(/F(EỦ9sUWVSP\$|ljD$xT$pL$P8D$TƋ$L1fBZ<:\$t\$X4\$x0>D$DD$\$|$ljt$ȃ|$dw|$H1 ڃ9t$xuD$hT$l|$HyD$hT$l\$tCL$\qY؋T$p\D$HTT$8D$h9ËD$l!΋D$HD$\L$pD$hT$lDT\$d߃D$tD$t\$x9D$D#|$t$D$p>11ۉD$x":tt$p>t$x9Kp9|ѿBG|$xkfat&Dߍ$D$xD$|D$xD$P{D$D$x$\$|1[\$| H8T$4<L$@kD$0. \$X))D$Ft>8t$|$pG$D$\t$pD$`k XPD$H1$$D$P\$xD$X($\$HL$`t$t ;C suyt$tD$tT$hFP~L\$t9\\$h}4=}H\$t\\$h\\$PL$x ;>VD$\9]\$x|$dD$d|$pdF$ tftD$dËD$pXT$`D$x$\$|1ËT$`<|$`1>|$t @ϋt$xs&tftt$`D$x D$hu+uċ\$|8f1D$ht$t IlPӉȉnu6u\$xD$p@f$ $ f |$pdNeND$@1ɉL$8~$D$xUWVS萁Õ\$dD$tT$pω<<FD$tp@u1e[^_]Ãt>u)D$lJD$ht$t|$hwǍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdP`tftߤ1eD@t$p`Pp@D$HD$pf@D$`<9PHЅu>u)Ӊ\$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$ttftt$l0e[^_]~~1D$HD$`*t -~0 wËL$`)ˉ\$LL$LY\$4\$X\D$x-D$|"D$d$|$$58,,$|$8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$d.D$D\$@t$8ti)\‰(\= ף|$D4)D$XT$\9D$Tt$PtD$XL$\t뺨1ɋt$pD$dtlD$TD$P11D$Hy,;T$|| ,;_D$pD$TD$P|$pwt$dD$xD$T>7> 9iFuD$pD؉D$X1\$Pt$p>iF>kFuL$T\$X)ىL\dFuډT$X|$d9u\$PD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pX dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0ɨ뀋|$xT$|1{2D$Xf ndPt$pdPePeP@f2|$pdNeNT$hfM|$pdNeNT$h"fQyT$4\$\$@t$8D$XL$\D$DD$d.D$8L$\$0t$,ri)\P(\wf= ףt$8)D$XT$\p:σ|$@p/|$T9׋t$P}D$X\$\L$@t3빉L$\$0t$,D$,|$,9|$|$D$(D$d.$\$t$i)\P(\= ף$)D$0\$@D$d9)؋L$09ȋL$d؋\$(T$DЙD$XT$\D$8T$<D$ D$8T$CD$(D$DșD$XT$\D$8T$<‹t$FD$(șt$9Ћt$H}D$,D$Dt$0D$XT$\D$XT$\puD$DD$,9}bL$T$$D$@L$T$D$dD$03UL$@D$drD$0;L$dJ\$t$pD$(Fu=|$plFpFdFhFG\$\$@t$Dt$8t$)=D$pf@D$,:D$,D$p1҉PyUWVS=v>}ƅӀ:tyɉ‰Džt;:1ɉUF E荈M1= ||9}~z>dN$]#=v޿T[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]ËE~퍖dNE荄dNNjE.9tUD$4$]|Uu_ɉ1DžuUWVStNjX U$"=EU~|$l $$ 5}# ,/dž _y>u EX [^_]ÅxE P$RpÉ 2(/dž 1뒋WZytىugb1ɍA /dN}D$|$l $UVSsl4$ C uƃ 4$B[^]UWVSrEuM V~6hFhF1P9u dN9ut [^_]Ë]g01[^_]UWVSlrmUM Z~/dFdFP9u09ut[^_]É0[^_]UVSrl4$A<$话4$A[^]UVSq~l4$A14$A[^]USqÌ~<$D[]qUWVSkq`~$RZnt6ÉǹUu [^_]ÉE$v.U1USp~E$v[]UED$ D$E D$E$1]UWVSpò}l<$@<$\, D$ D$ED$ $Ɖ<$Z@[^_]UWVS=pB}l<$.@X u<$E D$ D$ED$ $ZƉ<$?[^_]USo|E $11ҋE3t (/P([]USoÑ|[, $11ҋEt (/P([]UVSLoQ|u , $1ɉEt t,/P([^]Í(/UVS o|] E$1ɉڋEdt t,/P([^]Í(/UWVSnó{lD$$><$Y t1$m_EgƉ׋D$$Y>[^_]$1ɍ%_E/ƉUSn{ME tEm_[]$E1ɍ%_$[]USmzME t@ tEm_[]$cE1ɍ%_$[]pUEt@ E]UWVSXmMz]} tC }1ɍ%_[^_]UVS0mz]D$CD$CD$ C D$CD$CD$C$D$(D$D$$D$$1ɍ%_L$xLL$ L$KL$ KL$K L$KL$KL$KL$ KL$$K L$(K$L$,K(0[^]UWVS]u } IXP ;r B}y[^_]ÍIlP)׉[^_]UWVS kxu} lD$$;X t[ t$RXPL$ ;p H}yD$$; [^_]ËL$RlP)Ӎ<$*\UWVSET$RuXP$M ] ;H pDyE U $\$ ;A yyƉ;u ]|o9u ] $\$ ;A qyƉ9u ]|͋M ]11 1ڃ[^_]ÉƉ;u ]}# $\$ ;A y}'yϋM ]11 1)ڃ[^_]Í [ulPƉ)뗍 [ulPƉ)J [ulPƉ)RUlPE UUWVSiñvlD$ $9X t< tOUM T$L$$Ɖ׋D$ $_9[^_]Í<$C uu} UWVSi v}u tstC,-t(TSNLKf9t)ȃ[^_]1[^_]ÍD$ 0/D$D$BX.$!둍D$ 0/D$D$AX.$ ^US]hbup u#$l tЋE$$UWVShue=t:F$V FtD$$W(4$kmuƃ[^_]UWVSgôt}ƃp $dtCƉxtD$<$'E FEF e1[^_]ÃUWVS9g>tuE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍyD$ ]U*`3mUT$UT$ -D$E D$E$]UED$ED$ ED$E D$E$]UWVS_lD$ -FX$(F`F`y ;Fp|4} t.FXPVX}D$FX$[^_]ÍFXD$E$US7_@/$0UWVSYúf}t5D$<$#w fD$<$1[^_]Í0D$ /D$D$;`/$ffffUWVS1Y6fu 4$!9EU9s 9ru׃s$u8u:Ѓ[^_]Í 9rU9tՉ׃ru$u,tftƤЃ[^_] zfUS XÅeE9ErD$E D$E$蝺 []Ԟf!̀rS[De[UWVS!X&eu F0u ǀFFF tHNtA})xT9VnHM9VtnF t tc[^_]É4$N})y9u/D$ /D$D$W/$+Vr4$t늉4$uS0D$ /D$D$</$_ fffUWVSVcӉʋ} MM tau!ƒuމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]B{} x|1utv҉)Ѓ0CUtʋE9ut OsECExtE1뙸)0KыEÿEX0C[^_]UWVSxU}bljօt:Fu1F[^_]Ét$<$fFF[^_]Í0D$ 2D$D$/$n UWVS TaUM9 ?p9s΃ttUUED$t$E$y{MU)UD$D$$E}E01 [^_]ÉUE4ED$t$E${MuUEU JHJHJ H JHJHJHRPVU0U$vY0`UWVSLSý`ljT$ L$L$,11 rL$$D$(D$ D$D$L$uct_GЃ%uD$wPZw0/1ҍTPЃFHЃ v$uЉT$…L$t$$|$9|$  |$bD$D$tZFT$| |$t$L$8w%01L$1L$ 9<΃t$  9D$uʋt$L$9t4$X1e[^_]Ët$6뼋L$1L$ 9<qt$ 붋L$1L$ 9<IL$ 랋L$ t$ ~64|t$ t$ xL$1L$ 9<y|$ ]t$뽋L$1|$ ?<L$ y|$ 6t$ t$6t$ t$ t$ .t$6<t$ t$ L$D$D@$zNL$L$-~D$|$UUUED$;D$(i D$9D$sD$D$$L$D$ AD$L$D$|$UUUD$;D$(_D$9D$sD$D$$L$D$ AD$'L$D$K|$UUU D$;D$(D$9D$D$$L$D$ AD$L$D$|$UUUT D$;D$(BL$(T$$D$(OHЃ  1t$|PЃpЃ vt$L$<$|$UUUD$;D$(rL$(T$$D$~D$9D$sD$D$$L$D$ AD$L$~*K PЉ FPЃ vD$|$UUU D$;D$(D$9D$ D$$L$D$ AD$ED$fD$|$UUUD$;D$(rL$(T$$D$iD$9D$sD$D$$L$ D$ AD$D$ D$L$L$D$tL|$UUU{ D$;D$(D$9D$ D$$L$D$ AD$9|$UUU D$;D$(D$9D$D$$L$D$ AD$L$ |$UUU D$;D$(ID$9D$TD$$L$D$ AD$D$@࿀ D$|$UUU D$;D$(D$9D$eD$$L$D$ AD$,L$FD$D$i|$UUU D$;D$(L$(T$$D$@D$L|$UUUKD$;D$(qD$9D$sD$D$$L$ D$ AD$oD$D$f|$UUUP D$;D$(D$9D$sD$D$$L$ D$ AD$|$UUU! D$;D$(cD$9D$sD$D$$L$D$ AD$|$UUU D$;D$(D$9D$sD$D$$L$D$ AD$oD$|$UUU D$;D$(L$(T$$D$*|$UUU D$;D$(fL$(T$$D$]L뾉D$vL$|$UUU D$;D$(rL$(T$$D$tD$9D$sD$D$$L$D$ AD$oL$@D$D$D$D$0D$LL$(T$$D$L$(T$$D$oL$(T$$D$PL$(T$$D$1cL$(T$$D$+pL$(T$$D$QL$(T$$D$2UUU? ;|$(rL$(T$$9|$s|$D$$D$ t$1D$|$UUU D$;D$(rL$(T$$D$=D$9D$sD$D$$L$D$ AD$D$ |$UUUD$;D$(D$9D$sD$D$$L$ D$ AD$DD$ |$UUUD$;D$(HD$9D$sD$D$$L$D$ AD$D$ |$UUU{D$;D$(RL$(T$$D$8|L$(T$$D$]L$(T$$D$>9.t&14$]Lf"L$(T$$D$}L$(T$$D$uD$  |$UUUD$;D$(rL$(T$$D$DD$9D$sD$D$$L$ D$ AD$D$a|$UUUD$;D$(D$9D$sD$D$$L$D$ AD$KD$|$UUUD$;D$(nD$9D$sD$D$$L$D$ AD$D$[|$UUU"D$;D$(rL$(T$$D$)u<$fnt$1PL$(T$$D$PW|$UUUD$;D$(`D$9D$sD$D$$L$D$ AD$6|$UUURD$;D$(L$(T$$D$rD$|$UUUD$;D$(rL$(T$$D$0D$9D$sD$D$$L$D$ AD$|$UUUD$;D$( L$(T$$D$(L$D$$9$DI L$D$$9$'IL$D$$9$ IL$D$$9$HD$@tb|$UUUD$;D$(rL$(T$$D${D$9D$sD$D$$L$D$ AD$vD$ |$UUUD$;D$(rL$(T$$D$ D$9D$sD$D$$L$D$ AD$L$(T$$D$^L$D$$9$GL$D$$9$GL$D$$9r$GeL$D$$9U$GHVJЃ |$1tBЃD$D$JЃ v$q|$UUUD$;D$(rL$(T$$D$yD$9D$sD$D$$L$D$ AD$L$(T$$D$-L$(T$$D$xlL$(T$$D$ ML$(T$$D$.L$D$$9$JFL$D$$9$-FL$D$$9$FL$D$$9$EL$D$$9$EUUUwF;t$(rL$(T$$w9t$st$D$$D$ t$L$D$$9?$kE2$|$1댋L$D$$9$=EL$D$$9$ EL$D$$9$EL$D$$9$DL$D$$9$D4$DL$D$$9r$DeL$D$$9U$DHL$D$$98$dD+L$D$$9$GDL$D$$9$*DL$D$$9$ DL$D$$9$CL$D$$9$CL$D$$9$C}L$D$$9m$C`L$D$$9P$|CC|$UUUwTD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$D$$9$CL$D$$9$BL$D$$9$BL$D$$9~$BqL$D$$9a$BTL$D$$9D$pB7L$D$$9'$SBUWVSP<I$]$} |$Dut$L}|$P8D$4Nj$L1'D$L'$@0u ǀƄ$D$D$$BD$0$G wf DŽ$D$PD$$$$$DŽ$DŽ$|$L$D$lDŽ$$D$HD$,D$xDŽ$$D$<$D$8$8-$%t >u$)؅$*$$A$$$j$$~Ƅ$Ƅ$FDŽ$DŽ$DŽ$FZ $1ዴ$4$$J+@F f B$fx0\$L<$$DŽ$DŽ$D$$$$D$$8$$ǁPǁTǁXy 1B<,<tft$F f$f$Ff$F$F,$FD$$L$$DŽ$DŽ$DŽ$D$PD$ D$LD$D$DD$$$$Z5$@$fH @1ۍFЍPwFЃ v$>$FZ$/$Ƅ$$$DŽ$1ҍ$$D$|D$`D$TD$XD$h$t$$؋$9}$D$\s'$$u$$)tB$\$8F$$S$f$$tJƄ$0$t$<3C$$V$O$ǀ'|$|)υ$$$;Kȉ$$W$$$$t$$)-t$\$ZDŽ$$$$8$2\$ltD$l$$u;$$@ @ft DŽ$t$(9t$$2;\$4$L+=$e[^_]9.t&S$$K$$r$D$h$_)D$\$${$$j*[,ۼ$D$h$T$$T$$T$ |$\|$D$$$$CDžl6$)D$HD$lt$$9<$${D$lv6<$w$$$tƄ$-$D$X=$$߃Gm|$h-($t$X\$\ É$r$D$xt D$Xf)$y DŽ$D$l$D$|D$`D$TD$h$k$D$h$D*D$\$FD$h$D$\$a}/X$3D$hP$$=$$$_$$"a. ,ۼ$$D$$D$$D$$D$T$ <$$>"$$$~|$\$ C#-vL$$$$$1۾ $$$$$$st$\$ 5$+[R$$Ƅ$1ۋ$?D$`$$ D$`$|$\$D$`$D$|$$$$$st$\$ !+[R$$ $$$y$$.,$[$$$$$DŽ$$Ƅ$1҉$$Ƅ$ $t$D4$$35@$4$5@D$x$H@87$|Ѓ01 Z0 4Jу0 vꋔ$$9+$N-v$$$ މ$$Ƅ$+ލW7*a4FЉ1҃ /PwFЃ v뉔$$$$$W$ 0!) $H$p$$$_\$\w*1҉$$$ǁ$Ƅ$x% ǁ$3D$`Ƅ$$p$/$ $$B%$$t A+$D$|$PD$|$y DŽ$D$\$D$|$$$1D$`D$TD$XD$h $ $$$$D$|$+$)$@$D$|$$$$$t$D$$<$$')$9~$Ƅ$$1p$$$$$$$D$|D$lt$$0$($@$$$^*$$$$$$'‰D$l*$$$L 3 t$Dt$$LD$ $D$$D$$'2/L$lD$|$$E$@⿀ $n$[$$$4$$$$$K$$L$ 3 $'$ I|$D|$ T$D$$4$$c0.$y DŽ$$$W$ $N$$$5$$$#$$3$$$$ʃT$\  &#ʍRR$$$$$ D$` $$3RƄ$D$x@|$h$h|$lt$H|$|$)t$X9~~@$$7_؉$$V$$y1ۋ|$X)߅|$X$|$x$ $\$0$$$3C$$Q$$$\$|$)$9~~@$$7_؉$$V$$y1ۋ$)߅$*$$$ A$$vω$4$$$륋$$)߅$&$$L$@$ ~UA$$vӉ$$$$$L$@$~$$$|$|)υ$$~$L$|$ ~UA$$vӉ$A$$$$L$|$~$$$ $$;$S$N$*$^$$\$0$$$7Gp$$X $D$HA$$^ $\$H)ޅ$|$,y$$Y$S$t$($$T$@L$ $T$( ~W1A$$vӋT$@$@$$$$L$ T$($2։Z؉$T$($I $$^L$@$$&$$$L$@gL$@$$s$$$L$@~$$:$$$$T!$$$ ~U1A$$vӉڋ$&$$$$$3{$$$$I$$$F$$W$$$ $tB$t$07G$$Q$$$$\$l|$H߉|$|$$$3C$$8$$$$$$ݔ$D$h$T$$T$$T$|$\|$ D$$$/ǁ$'DŽ$$|$X L$\9l)L$\D$\L$zL$|$$ $$$L$|,$$~$$B$$$$$$$wT$ 3T$D$^/$$'D$l8N$$`rx$$$$D$\$DŽ$D$|D$`D$TD$Xc$$|$||$\$$PT$xT$$T$ $T$\$$D$`e$)~Td$$D$|9}$D$|$D$`D$TD$XD$h$9$u$$1۾ $$ $‹$ǁ|$X$DŽ$DŽ$$PD$xD$T$ D$XD$\$$$$K$)$D$|D$\$$$ `~UA$$vӉ$($$$q$$?o$ $@$  $RD$`$ D$`DŽ$DŽ$ $ $ M$[D$`y \$`Ƅ$-$$$1۾ $b $ID$`,$? $[D$` Ƅ$$11DŽ$DŽ$$$G$$$s$$$$$p$\$h$$t$`l$`t$h2B$$K$dt$xt$|$)9~΅~9$r$$K$Q\$x y1)E$\$TCL$`C$|$|$9h$\$$$ ~U:B$$vӉ$ $$$$2Z؉$$t$x$$$$ql$xl$T.$$`D$x$$ȃ$|$||$\$$1h$$$$qD$|$$>1$$$-$$\$x L$@$$~$$$$L$@$h$$$A$$vω$Z$$$륅 |$hD$h$$7D$ 3D$D$4/$$0D$ 3D$D$3/$D$\$$$D$@$ǁ|$X$$ :$Pu`$3$$$$ $u$)ȉ$D$|:$$|$|0 u䉴$|$|$` )$D$|$$$Ƅ$-$ $D$@$%D$X$$R$D$\$$$$$ DŽ$$P|$|D$xD$T|$($\$`t$d$$ T$|$$ʁы$)уș׉L$`T$d$$)ii̍D$hȿƉ׋D$hljD$p%D$tD$pT$tyD$pT$tT$pD$`1L$`\$d|$|W0G$$D$XD$T<9 $$9~D$|PD$@GD$TxtD$T\$`t$d$$DŽ$V$|$()ы$D$|;$RD$`$BDŽ$DŽ$$$DŽ$$$~$$$L$@$$3$$$L$@ $ [ݔ$$D$$D$$D$$D$ T$$$/Dž%$)D$H$yD$HD$\$uƄ$D$lt$$~<$$AVD$l<$$R$$$Q$$[$$$J$$I$$ $@R$ z$ID$`$@h$ $ID$`$$ $R$$$ D$`$@$$$ $I$$$$\ $ $0$$$ƶP$$$$$葶$$$$@|$ 8  $ID$` $D$\D$h$+L$X$ $R׉$4)0ȉуcڋ$s0O9$T)ډщ$$ǃ> tft$$)ЉD$,D$\\$, $$y DŽ$D$l$D$\$D$|D$`D$TD$X(D$P( D$PD$PD$Pn$`8o$Ƅ$1%t$x<1\$X$1<9)FuދD$\$03$@0)ً$D$|$^s$$$v$$$\$Xt$xȉL$T|$`$$D$l$D$|D$h$؃|$||$\$$1۾ UD$\$$3$$$̉)1ҋ$$$)iiщƉσ$0$O$$DŽ$$OD$|$P|$h'D$HD$\D$HD$\D$h$1\$P\$PUWVSá}D$<$ED$ E D$ -D$<$豺D$<$[^_]UWVS9>}D$<$諏ED$ ED$E D$<$QD$<$襏[^_]ffffUWVSƉ׉Mphtt[t@[^_]ËUuD>ttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVS}ED$E D$EE$ą3E܋|\$D$D$D$D$%-uMAU$T$ 7ƅXT$ DV 9‰T$ s )HFL$D$$ND$ NT$99sH\$T$9rڃ9uT$9Ѓ9uU@]} ;tL$E$UE tE C9rwN9ue[^_]ËD$%-uMEED$E D$$6Ɖe[^_]ËED$E D$$6Ɖe[^_]ËED$E D$Ƥ$~6Ɖe[^_]úT$U~ t^E|tEXrUWVS,).}m|$D$%U <$p3m܋||$D$$%-BuM7U$T$=5ƅNT$DV9‰T$s )HFL$D$$菂D$VL$ 99sB\$L$9nك9uL$9ȃ9uUB]} ;tL$%ɋE$UE$tE$C9ruN9ue[^_]D$$%-@uMEED$E$D$$-4Ɖe[^_]ËED$E$D$$3Ɖe[^_]ËED$E$D$Ƥ$3Ɖe[^_]ú$L$U~t^E|tE\pUWVS`tyE(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$&¿3፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$ 4$.U:ue[^_]ø랸뗸1ffffffUWVSxnst&j=E= =D$TEU D$HT$Lu 1ҋE%=D$HT$XzD$T~D$TD$pD$ D$tD$D$X$ D$DD$pD$PD$\% ?D$X\$`t$`D$$t$`D$dD$`أ܋܃݃T$`L$`|$nD$n fD$ll$lT$hl$n؋|$P)׉T$h<V(\$X,D$(D$4D$hljD$@D$,} <$00D$`D$tD$ D$PEExD$0|$@t$0L$$ 3t$4$ wD$8xD$0L$4ȅt~9 ))D$4)NjD$,tXT$0D$D$8$zxD$8"T$DT$$vD$XT$D$sD$XD$D$nvD$XD$h }~D$0t |$TD$,D$h   )ƒ& <)t$LE'E D$E D$$.D$`D$`e[^_]D$( D$4L$hD$h)D$4މt$,D$@D$h} }~1|$Tƃ}B }}}D$0UD$@‰T$ MDD$P$-D$`O}F|$T;|$PwHL$t |$@ V(D$@ƋE D$HD$`P|$P|$nD$n fD$l9 ؋Ƀl$l\$hl$nL$h‰L$XL$Xv ɃL$hɉD$hH0Jڞzu؋D$D$AqD$`9D$@}U E 0D$`e[^_]ËD$,D$D$D$XuD$DD$`D$`e[^_]Ë|$P|$t2} x )D$`D$dl$`\$`t$`D$d-D$$D$TD$T1|$TD$TDD$T@)捊 ym1}} }t=ED$0T$hD$()ȉD$41D$0EED$ D$P_D$hzIl$h?ED$E D$Ƥ$*D$`D$`e[^_]úT$4ׅMt$(vT$PD$0t$`L$D%D$D$ $oD$XD$ $L$h+0FL$hQu y 9|$P‰L$D1ɉT$hD$Tt@L$TD$D$D$tD$D|$X|$$uL$T6|$`94 vP9t|$8L$8=D$`0D$E D$$)D$`|$PwuD$t(.D$0L$@V(ȃƉDD$XD$t"W(T$t Ƀ ɃuT$\$8D$8T$ D$PD$4D$,T|$8D$`D$4t$PD0D$(t$DD$XD$4$a'D$,0L$hT$8T$4$rD$P|$D$X$r…@ fT$T$04$WrD$DT$0$jD$Dy}T$HL$T T$PN~}~L$TT$ht$D~HD$4$pD$D1t$Xt$$qT$hV9zT$,1t$4FD$hD$X$iD$h L$8tt$89tD$h4$iD$hƉ|$8D$8$iF(MZD$PD$D$D$X$djD$XD$D$D$pD$`p1D$@D$X$!iD$8lD$hD$D$X$^mD$X86+D$p[T$XBD$j¸ )6D$XD$D$D$;pnl$@D$D$ D$D$iD$DL$0D$ D$P8D$0~)T$4D$HD$`DD$8|$nD$n fD$lt$0l$lT$Hl$nd$HT$H0qٞىt$Ht$0T$Hكڞ.D$XT$\D$HT$LD$tx |$@t$4D$0D$8W(D$Xr D$D$D$8$mD$81fu T$hvx0t|$8L$8 t$8F$e…Fz tftD$$mDžYD$PD$4HL$PD$h9L$("D$D$ 4$`gƅ`D$8D$D$ 9D$8$.gD$8,D$D$ <$ gDž D$PD$4D$8L$؃\$HD$HT$LD$-@D$D$8أD$|؋t$`D$XD$8EЉD$@A$feD$Px}ND$H D$P=N)ȉD$41D$(D$HiD$LZOD$,DD$@V(ƒD$X T$T$L$T$HL$L?W(\$81tD$8 \$8uT$D$8T$0t}D$`D$D$D$t$!PD$tD$D$h$V|D$lP1D$DD$d T$`D$t$ND$HT$`L$`A|$49g)lj|$t|$8D$`)DŽ$D$\D$D$t$RD$t}t$tFD$zPƋD$dD$\rD$0=P}ST$LD$4D$tD$8ЉD$8|$PE@9E  D$8D$LD$\D$0D$`u؋\$TKD$tD$HEЉD$DT$lD$d)D$8D$LD$,‹|$4)T$\t$`$t$LD$tL$8Ήt$8D$4t$tt$D$H$YQD$H#L$hL$$OD$tL$h $LD$tD$h)t$4t$D$H$ SD$H+L$l95vB<9tD$< |$PE@9E D$8D$LD$d|$HG$KKWx q tftD$$IRD$d~D$<؋t$lL$dD$D$h$RD$hL$tL$$SuL$dfD$hx,D$<D$DD$l1D$< ezfu D$tSD$dƒ80tND$<؃\$TD$TT$XD$$-@D$(D$<أD$$wi؋D$8XVH؄tJuU tu ؃[^_]11US蘼ÝEHP$C[]UWVSD]fEċ] CE}9G{}ELM܋uűUDE0EH1EЉE9uEEEEEgEU؉Ӊ1ۉMԉ]؋1ۉEE+M]+M]؃EEN9}s] }uAG9Es0uV+E)‰؍M9t~[]UVSjoMtLCUE)Љ)ƍ)ED$E$~1[^]UVS$utTEE E ED$D$ED$ t$D$E$؃$[^]ÍoD$ 5D$D$;0$nfffffffUWVSQVUBJt@9stЃ[^_]ËJ;J}ABDЃ[^_]ËBU$<tËUJ<}x r s$EtfEtE$<EHuuMx r mfmUWVS0TY։T$$L$ T$(T$ T$,T$$GNjD$()ЉD$(D$,~M5t5}}u tOuT$E 1wM tL$,D$D$D$$@9~[)Ήt$D$,9 GuP1L$ |$T$E$7E 0<$;e[^_]ËD$$@9t$봉T$D$<$ 8D$D$(D$<$8T$T$<$NjT$у(L$T$GD$J=L$9ȋT$lt$u GD$T$D$<$e8D$,HL$,D$ T$L$$IL$t$E {T$$#DƋD$D$<$7ET$$D$,t$D$$p $9ƋT$D$(T$D$<$6D$D$D$(D$<$y7L$,T$T$$D$,Eep"GD$,1T$$1T$D$<$G6D$D$(D$<$7T$61L$D$L$,vT$؉D$<$?DžL$,D$D$T$=t$t$#LɉU )ȉD$t~T$$#DƋD$D$<$P6ET$$t1T$$<$NjD$,`T$$L$,D$ D$,PT$L$L$$<$5D$T$L$$UUBJL@9s t]UWVSư˽u} G9FVt]F9sGz q s7u/u(UE$]UBEUE다fuuJ z Mq ffUWVS<&E 8Ex0E }Uxx}؉EԋE@EA…uA…t v0uAE)Ɖ9ME܉pE)E؉p$] )ƋE 9m1E ]9XE pE9)9E @ E؉$]S ]A"P0[^_]Ë](EbNF10[^_]ʋu< ǀ0^0tʋu<ɉMEJE?$]j E@@E}؉8E @}]@"b?)։Ut$E؉$]DžUt(N}#bUt$E؉$]puU3]K 8 t 9u~2U)49t$W0T$D$ $Du1[^_]Í~ u u 9}t$O0L$D$ $u뺋}}z1HUWVS0}Æ}u D$(D$<$\$ D$ T$$D$T$D$,D$4$c\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVSx|EM]E TsCD9sϥ9r)؃L9s&)D$D$ $]7 [^_]UVSEPXM 9} u#9r1[^]Í~M t09tݸ[^]UVS{·l0)ˉލ, u썊a)ˉލ, u썊A)ˉލ, u[^]UWVSU} EZ]9BB[^_]ÍBEuLMuttb )E^M9uUM ЉFCU9rߋUM})}Lt% 9bE9rE})} E)B>[^_]ÉB$MUVS!z&UBJT19r & 9st9sEE$Ɖ[^]ffffUWVS yƆDp7} w+L M4tetB-$G2E$yvƋEFEFuFF [^_]úMUEL )ȉE w|-$G"t-$F|UWVSxíut"F w"Dp7u&L 4[^_]É4$~[^_]-$UFN?L 4tU$cF[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɉu}u܋EDEd}EUƉ׉1u}D9Mlj t"E9C~$E}|C؃[^_]É؃[^_]ËC$2tKSx s stftE$]u2uʉE$Efx s UE=w5=w=w=?v=]1x@u ]Ã]Ã]U$7t UP@]UWVSM CFM9r}ыU܋]9rB+M uUEPE$E$[^_]å9sܥ9rչUWVS}u F_)u)ODT9s290tۃ[^_]UWVS0u] C~)u:NDT9x9t] sމÿx1F$E؅3x F~}ЍUȍtu܍suStuquԉu}11Ẻ] E]EEK1ۋ@1))ڃ1EEʉHM9MrÉu}E̋] {}̉)ك9 }ω}uΉuu9]Mu}EA1)EU1USE9r׋EM܃})}ωuʋ}) t}؉GE؃0[^_]$UE؅t@@E؃0[^_]ù9u9ur }ω1UWVSEx|$Pt~^$2 )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS $ƅtc] %t D$ED$uDD$$&T$V ~tbM5)NjE8e[^_]ÍD$$T$tI ) |$T$~V~u-2MD$=)딋|$UEM Q tJu]UWVSyl~yutD$E $wDžD$D$4$e4ptt ʃ9t*xD$4$t|E%=at`fx ttpu ffx fp@3P$7P,–P(wP Ĕ[^_]H)1Ĕ[^_]ÍD$ 8D$D$E1$#)1(O1USjwE UD$T$ D$E$[]UWVSjwutFD$4$-nx$P8D$4$6[^_]É4$Aڍ0D$ ,8D$D$=<1$"UVS3j8wut&nxP[^]É4$[^]Í0D$ 8D$D$I<1$>"ffUWVSivu\1$!fUWVShæuuf~ D$4$F0ǀǀ F 1F t V$ЅxF F0tN@9t $mF0$mF0ǀǀD$4$FFF [^_]ÿF tF$Fmp4$_D0D$ @8D$D$8|1$D% fff̀rS[Dt[UVS"g'tut8F0u ǀ4$uAnP[^]Í0D$ H8D$D$;1$뜸fffffUVSf×sut%V 1f t[^]É4$)[^]Í0D$ P8D$D$;1$UWVS&f+su'`7FF <ufJ.t&fF FF uwFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $ kF0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$S,e=<1ɋ8tBD$D$ N|$\$4$I y8t6D$D$ ~D$L$4$W8t6D$D$ VL$\$4$W8t6D$D$ V\$D$4$w?O8t6D$D$ NT$D$4$3_8t6D$D$ ^D$L$4$W8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$ku7O1$[^_]Ë@O58,UVS 7]tE[^],[^]UWVSQ^} D$$RƅǀM]8bL$ ED$|$]$"mF8FF F FFFF4- ~D1 󫍾󫍕xT$E$豃]~^ $]F]Um]StV4EHt }Gu]Stt LV1v4s$≕@DDDHN F$D$ D$ IL$4$葷BF0F(LN,NV<~$Q9~s~]WEP IT$4$0}M1Q\$E$KT$ ML$|$}<$$ ÉX TUMQ D$t$$ËVnNNFVnNNFV n N N F V nNNFVnNNFVnNNFVnNNFVnNN F V!n"N#N$F$V%n&N'N(F(V)n*N+N,F,V-n.N/N0F0V1n2N3N4F4V5n6N7N8F8V9n:N;N<F<V=n>N?N@F@VAnBNCFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Z1=x>alV]D$ <$ ;F@7NF(șdž‰Dž=N V DDTNꉖD$ T$D$8$]EP D$4$0}4dž$$$VG>pTXPx H X%Pp[^_]ÿO$j4$WO81Ë-ftT$ ML$|$}<$48녋%8" 8F8FF F FFFF4- ~D1 󫍾1$F~ jM<811! 8ED$4$Bdž08!81UWVS$GTuF(x~(V0!UN9F9MUD$N $HMUF($N 9} TDTDF F,9sF0 F,|$}|$4$蠸$[^_]ÉUUE$DEEtlE܋UT$ML$E$ME)UЉL$D$$M $6LEUVU(_US]ED$U $ #C,9C(}#C0[]fffUVS 2F7SEpFtD$D$$F u  [^]UWVSERE0LHPH THxP@X~t=i`TIX=DHD$$$GFƅǀXHdž$$AljFXDt dž wGGG dG G*5GGE UtAtCFt$It$ 4$I1 XxD$ ED$E D$E$XE EuM L dždž QXPtt!ЋPDPP9X1XA1T=+ff]fXD$ L$D$$ 4D$D$$Rfxuu fx!D$D$$E t @E@t Ey [^_]=1DžT1pDžPDžLqDžXDžTcpPDžXZT t$ T$„T$$D$$ 8D$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$D$PT$$XxD$$( X%=3D$`D$$)q` =b1щX`abcddefghhijkllmnoppqrsttuvw `b1uYduPh=w=u8t_u+X Љ lpOX qpFT¡T$ p8T$D$)2$TUWVS$}=ÂJEpFtD$D$$FUED$E D$4$MiDžEtwD$D$ED$D$ D$|$4$ !@uFЃ$[^_]ÉED$D$$CUЃ$[^_]D$D$$Ѓ$[^_]ZUWVS]<bIuE U VfFFVVfFFVV f F F V V fFFfFFfFF=*F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\N"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]ÍۡD$ |8D$D$b02$F xUWVS :%GuE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\NɉHɉH@tH ɉH H ɉH "B9uȋF wۡD$ |8D$D$b02$F ƒv1UWVS(7DEpFtD$D$$QFE  D$D$$譺Eb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$蒼$u 1([^_]UWVS6C}wFtD$D$$,FD$<$tr$'tcFt$;t$;t$;E4$;<$;E$[^_]øUS 5BE9ErD$E D$E$ []M|UEtu]11ɍT9r]1]fUVS5BUE X81rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS44öAu|E@Et M 9H 1MEEEEEEMP}GA у@0fuft utpfu{Uzu@G GGBPWxG8GBWO ME9Oft DAfEtD$D$ E܉D$L$4$VEE@Ex#} EHU ꋀEUEMƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$3E.E@ D$$3UBct MMU Q AUuth}OAMOMW:D$UT$D$ M L$D$E$}E4[^_]Ë}GMOUW:D$ML$D$ U T$D$E$赓E ]M؉0fufE@E܃!‹EHM<E0E@}IE@wD$ 8D$D$T2$|Ex QD$щT$ |$D$E$* E@E܉413'U܍D$ 8D$D$T2$OUB$k5USEP M TH}[]UWVS}/<E}9UNFt%O L$D$$]UF$4FA4$]4E9t-F uFtUt NuM u6E9u1[^_]D$L$ D$FD$<$]萔tUSUE @@ @HKYXBP[]ffffffUWVS A.F;}ED$E @D$E$t7ƅt|$$t [^_]84$8UWVSD-:uE 8‹E1lt$D$ D$D$<$+=5DžDžDžDžD$D$$<$$ƃtI<$D$D$4$tntD$4$itSD$D$$6E+uqD[^_]Í܆$>X<8D$D$$4$8?rUWVSl, 9E EċEE8EEEpFtD$D$$QF #}&Et&u}U+rl[^_]ËEċP}O9 E&D$D$$\DžFfN @EW)‰UEċ@UB 9EGfFED$EĉD$4$LJbfdž~ f}EF(EċP}O9E}9rY|$ED$4$赉EEEEȉEE@EME؉EEċ@E9s]|$EĉD$4$\:EEEEȉEEċ@EME@Eă9EЉEJ}.D$FD$$蛬DžFfEEGdžD$|$$謮ẺD$EĉD$4$%UljEjEf}}?}EEEċPMQ GO)MJ9MsLED$T$UT$ML$ EĉD$|$4$<}  1=f9Ms(UɋU)ɉL$DWD$DW$_UfGG)fGUfDWMċAE@BEB AD$D$$U UBD$D$MċUQ$F(tu 9Fcu4WwGu"f}udžfdžD$|$$Ҭ  YEED$ |$EĉD$4$91D$|$$腬aD$|$$b>E>}GD$D$4$hR1E=B҃9=FED$EĉD$4$聃~ f}t f}f~ }fFf;EfFdžG=w~҃E9džEfmMUۡD$ 8D$D$b02$MU?eUčۡD$ 8D$D$b02$UMUMۡD$ 8D$D$b02${UMkffUWVS0$1EUE@(tEpLB< _Gx ZU)ىL$D$$]Ćf}Ufz|rrEXft)ۍLZ]f9sf]f9u]t^JWf+Eft" F]Ff9sf9ufjE@(u 10[^_]èuE9PuP9Us݃UfBыM:9yI;MMA(  UEfEUED$D$D$D$ D$ED$E$]y~UYDMUD D$E$]較tՋUMOMUG D$E$]菃t_MUUE]䍋ۡL$ 8L$D$b02 $UEkE 1Et8UUEfEED$E D$E$]qUB=wbF9EEu!BB=^ƃ9EUEfE^EH(U]䍃ۡD$ 8D$D$b02$ƃ9EUzUUEfEED$E D$E$]~UE,2BLU1ۉ\$D$E$]UƅEfEED$E D$E$~UE@(EUUB(1ɉL$t$$]KUEMAEfAUUEfEEE D$D$D$D$ D$ED$E$]{UUD$D$E$]VƅE@U=UUEfEED$E D$E$]|Ut]U1D$t$E$]9UU]䍃ۡD$ 8D$D$b02$UjE@(E|EH(EH(]䍃ۡD$ 8D$D$b02$xUU1҉T$t$E$]}UUWVS +}u FuIFu 1 [^_]D$D$$ӡtYVPD$D$$ D$D$$蛡t!VPD$D$$գ|{UWVS0&++ljU܃,E싗E9BD$BUD$$ƅUBfEHMTFEDtU D$<$N~UF=w?uj>t$<$ut$<$;0[^_]ÉU썃ۡD$ 8D$D$b02$~UE EF )‰T$L$Eȉ$(EfEfFEDFfENUBft?ЍDVEȉMU؉uuMf9sfUf9uMU؋uԍLQF=f+Eft2Auu}}Af9sf9uu}fnD$t$$襡E܃8tRE܉D$<$t#fFfFF 묋E܉D$<$WnD$D$$51QD$t$$1UM䍃ۡD$ 8D$D$b02$UMUWVS@8=(}EpFtD$D$$螠F pt>tȃ@[^_]F(tިȃ@[^_]1EE䍃ۡE؍8EԉuED$E D$E$FƅEM}$f9t$E D$<$hwFD$ ED$E D$<$ E@  V=vE܉UE؉D$ EԉD$D$b02 $1E܋Uf9b~E@M=HfNfTf}܉u |$t$E$v,GD$ ED$t$E$GGHfuIfGE@=UEOfO`D$FD$$Dž@=FD$ |$D$4$G=@MD$|$$ҝMYD$ED$$话4=jU 1ɉȃ@[^_]ÉM썃ۡD$ 8D$D$b02$MKD$|$$"띍ۡD$ 8D$D$b02$D$ED$E$ڜNuG}1f;}uD$|$$蘜FEčMML$D$4$ CN9|fEۡ}Ѝ8}̉ωщ>9RAEȅ,D$L$M<$F,EE9NjM@9ED$L$M$ʛEE9ƋMTFD$FD$$6FEQvMԉE؋EЉD$ ẺD$D$b02$MԋEAۡD$ 8D$D$b02$D$ED$$hD$T$$ӚD$FD$$`Dž5ۡD$ 8D$D$b02$AF8@xf}܋98}fxXDy|8f@D$L$$D$|$$蒗1jmЃ}uf}D$L$$躙D$EȉD$$G!VFۡD$ 8D$D$b02$9/}suuD$D$$(e5D$L$<$ED$EĉD$4$h?[F,E׉J9OMUD$|$$蓘U싲1M91D$T$U4$bEM9΋U;EFD$FD$$ɕ…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$${D$ED$$Dž@=wU܍ۡD$ 8D$D$b02$UBU`fU܉1D$|$U$1҉T$ED$U$oDžUA։ffffff1̀ffff ̀rS[[UVSut5D$D$ D$ED$4$Ot6E[^]ÍD$ 8D$D$5|2$럸fffffffUWVS>CUE pu8lE1ptEuAx=EGu4Ѐ:U)hx9׉drD$/$t)1lU+Ĭ[^_]Ëdr 9d`%$>F 9dgƀ>Xt։`dD$ h)D$|$`$Jpd9r9>/utD$$d"B/|%=@dt~{8u)сS?hD$ 8D$D$C2$hM+X\pD$E  D$\$8Xh9Ƌ` 9d)@u08p9hD$d$输u6Et)D$\$@JltD$\$@.89d`iSfffffffUWVS ùEu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfRfUVS   4$3D$$D$F $? [^]UWVS }$W$W#1$WD$$D$<$x?t$<$> [^_]USW \ $x[]US,1 6EEVEEED$D$ED$ ED$D$E$t}u E,[]ø,[]US ñ $[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EU܉EEE̋UUUUĉM؋EEȋMMЉ}MUE te kE2-byEnd 3Eexpau֋Uĉ|]11 É]1uM1EMEu1]1 M1ΉMˉ]1uԋM1]1 Ήu1U1ىu؋uU1M1 }11Ήu11 Ɖu1UډU1ЉUE]؍E11 4u11E1]؋Eԍ8M1щM1 :]1؉]1ωE̋E}NjU1]1 1Ӊ]1m}uuUċ|UexpaUnd 3SUԁ2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C(8w68)|>)1ɃtfTȪLB@t@L>))t 19r\$4$)ߺ81tfff녪gf uhuW6ЃE1U U9rU6DfFf\7Ef렉ȪUWVSӉMp x$?tn@)։u|(9uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$G W$@9ue?Mt)ʍx(5tftM1H X$[^_]Ã}?$x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S+B,hB0kAB4كB8y!~B<[zP1uUuFu-u%BHBLB@BD[_]êftэt&f볪UWVSDz \uFPEVẺUЋFV EԉU؋FVEUFVTXF V$N(^,M]N0^4x|N8^<`d^PP:}܃L}쉽HEĉUH]ux|]ċuȉ]u]u]ĉuȋ]ԋu؉]u]̋uЉ]ԉu؉ẺUЋE HE @GEU$T$\ Ɖ׋PSE EċUȉEUMċ]ȉEU11ډEUMċ]ȉEU11ڋ]3{Mыx|!ω}M!Ήuu}]!ىMu!MM]3M3]`dEUű}Љ11ڋM̋]Љ11ډ`dEԋU3E3UM̋]Љ!Ɖp!։tEԋU؉ƋM]!Ήh!ډlpt3h3l`dTXu}M]PE}܋M]TXx|`d9LE܉UEPpp)|>Q1tft:7~Qo1uDuQ1s^tft\$4$;ߺp1uwuh"t䪃ުn.f0uGu8rуM1ɉUU9rUif둪ofUWVS ÉT$ʋp@xD)L$|P9L$t$KD$-D$/|$41s@{Ds@{DsCHSLTT$T$T$CPD$$T$D$,CPD$B|$D$؃D$T$ |$ָL$F&tftT$D$D$$is@{Ds@{D9T$rCHSLꀋD$9wT$ ovjBL$D$1T$L$L$$C@SDC@SD9ƉыL$rCHSL逋D$9uT$t<Ѝ{Pt$tft1C@SDC@SDsCHSLe[^_]frЋt$ru^zfD$u[u@L$D$tCP{QBffl$L$L$BKUMt U E]UWVS } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E"]UWVSgl } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUUʋE ]fffffffUVS诳ô EDžDž<|<s,>z DE5N ?=' ==D$D$D$D$ D$t$$&D$D$D$ 0D$T$4$tp0[^]=t*=uy늸۸ [^]ÍHúSu,t돃DuD$b$oo̸ XNDd :0&iDžDžDž D$D$D$ 0D$D$$蓻 D$D$ 04$T$pmz1vpDžDžDžD$D$D$ 0D$D$$yPD$D$D$ 0D$T$4$n0[^]ødj낺FsGdD$D$D$D$ D$t$$"`&C0D$$0D$$h ~ m ^O@E3D$+*)(&%DžDžRDžDžm G6D$D$D$D$ D$t$$ /D$D$D$D$ D$t$$O D$D$D$D$ D$t$$ D$D$D$D$ D$t$o$BB DžDž DžD$D$D$ 0D$D$$-t0 ><S,BD$D$D$D$ D$t$ޢ$1D$D$D$D$ D$t$Ƣ$Qup3fED$D$EЉD$ D$D$?$賰u}u tTE E E t UWVS  x<$4tt V6uԫc$Et+輫t V6u<$sE [^_]蒫t V6uD$<${sE [^_]US$in t$[]EEED$D$ED$ D$D$E$It u2D$ @D$D$A03$9] mUWVS踤ý E U}0@DFƅtIFEM 9GJUD$F D$ $UBUtRFE VJE}9OT$T T$$GF]CE1[^_]ËM!@`B~ :MtEuVMQlj9~ MQT$L$ MQT$lj|$E$u;E]넍GD$|$ BD$F D$E$UME!@~ `UD$ $[tljGUL$$:tMVJ}OUWVSϢԯ uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9rt% 9t 8t)؃[^_]ËE)[^_]UWVS]E xS9sHы0t/}U x9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS ^g E}E pE0EEE90EuNEU9sщL$MFD$E$]=D$t$$x&M)Mt2MVD$T$$]#ƅu [^_]1 [^_]ÉUt$E$]ТEt͋]E0U=UWVS(fk E }}8}xEEE3UHD$D$E$%U)MMuE؉D$E$ƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$$1([^_]ø([^_]UWVSDI }E pD$D$$U"tW@ u^JM"D$ED$$$"t&M)΋PUD$<$b9ur1[^_]ø[^_]D$D$$1$fffffff̀rS[Ä [̀rS[d [US CH EU D$T$D$ED$ED$ ED$E D$E$a []fffffS[ [.&f̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVS % tMƋuA~8t:F4@9s3`V8F4@9r$lF8[^_]ÉUWVS訜 E}}u8ENjE1txF8t1ɋ}E+wȁĘ[^_]ËF4E@E$]CF88]E F4F0E|U1E} OxD$`|D$}|$ F8D$L$$]UF8)UV4V0]UD$ D$`T$ $~4V81}׍ @rPu B8~8BX]9uE~t$]耠F8]R9Ëtt]X8 t5UF8M]kX8F8$YX8F8M$]nF8tgD$`|T$|$ D$xD$E$duUN8]Wt?]W{]xUWVS<̙Ѧ EE M8‹E1%;E = 9ƅDƅdHD$$ BƅC8DžD > BD$4$)D$ |$t$$Ƅ=D)VD$D$$W>Ɖ׉Ug 8X9;-D$BD$d$诺D$D$$菺 {tD$D$$Ot T"U+ <[^_]Á}@ Džh1Dždd <$=D$`D$D$ t$D$$1~ 9WǸ։UD$ D$`T$ $!9_Q((1ɋx9zz11ɋ)Y99vЋu@8RщT9PuQ(9P(\n$tD$D$$訶t RR etD$dD$ $>tUt=6tftt\1Džp8H41`9t9F@FD$$Bu9;dt9FD$FD$$覵F D$ t$D$訴 tD$t$ $o9eu d3D$BD$d$ٴD$D$$@p8/tD$D$$蘳tOBDž.D$BD$d4$ 89:y``9_$Q}d$>4$9HN8 t릃O4H4W0P0W8׉P8|tP ILP`9uM$=|tD$DD$$t_M?I‹uB8`9r勅9s$4`9u닅$}'$<gt{LtD$D$ $诰D$!<$`Nj@8@P1f^$;FU$;=D$S;,tLtD$D$ $m+_t΋$:iUWVSř <$ZE D$ ED$ED$E$MU EƉ<$Z[^_]US ch EU BJ  D$T$$ []UVS  utEىM)E}|$t$lj$UED$}|$4$UE<ML$|$E$UED$\$<$UED$\$E$UmED$|$E$UM܉]ZGu]E؋} 8MED$ED$ ED$E1uD$E$uMED$ED$ ED$1uD$E)ȉ$@ƋE]XQu]E)ًU)+U9xNuUT$ML$E$UUT$ED$E$UEEML$ED$4$Uut$ED$<$UuML$\$<$UML$\$}<$UU܉u 0sHuuʅ#ML$ED$E$U(EEED$|$E$UDu:}"MT3T$ @T$D$lt3$%:E aE T$ @T$D$mt3$9E 7Uqz UT$|hD$ ED$E D$E$]fUVS 27 EU M9Mr/9r 4 9r$9fu49rL$T$$ [^]mfffffUWVS$р֍ lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$BAM1 ЋMu`EUD$ T$L$FD$$L;u<tVT$VT$$$Ѐf1$[^_]=UWVS Ƌ; rEu =[t6CuudKStqPCS t[P ؃[^_]ËD$$誀Åt@C؃[^_]Éډiu1V룃T UWVS u xD$4$E%=D$($ Džts@@@9uE ED$D$ EЋUԉ$T$U?EČ[^_]@<1Č[^_]UEU U U$]UVS)~ ]ts tWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D -D$ D$%D$3$ U D$E D$E$]UWVS.}3 E HMxPpt)rP@t3B E$菂1[^_]ÃMt P@u͋MAUWVS,|ÿ }u ;VЃEljE@uyts;puXY LADTPPX Z O@H PWEuH@,[^_]ÉKE苏M1҉E܉UL$D$ $T$<1 ЋME܋UD$ T$ED$AMD$$vH9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA,[^_]É\ LoD i81o81~BEH M]8O1WUE PMt ʈP1]UVS@zE ut PtH J H $u4$1[^]UWVSy uu #[tCtډu[^_]Ë$A[^_]fVSD$ L$t 8trtl@͉ .&vލ1΁ €t8u.t(8u!t8ut 8uHu1[^UVS y U Et7Mt.ZYutD$D$ $E [^]UWVS xî } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Ku#ED$E$E܃ [^_]ËE+E15TEfH @jUWVS(wׄ E܋})u UE XBE@ S]KE] :}Z]ru}_]ϋUfBfBKMʋE9s‰EЋutftE])XEUEUE @E)Ћ] Ct8E@ MY ]ϋUlu>}~}uC1([^_]É؁vD$|$$х~~)ËM IM)‹E PtEH,Pu>^E$]AE@ 9E\$ED$E@$EP,…EfH @HE1E‹]9sڋE@][}9Os9~‰ÉϋutftU]$]Uq)UU)UE @E)Ћ] CE[UJЃtUMEED$D$ }<$]e)EE9xsNMʋE9sBȋutftUE}8$])}UEHE9m1)yD$ED$E@$EP,…K)EMu9EPp)׋E 86p9rD$$]>v]+SSUSCslj;C ЉϋutftE)P)UKUE$]1ɋU-[;Q]؋usStft]E)C=EE\D1$. *Í0D$ @D$D$G3$*u ]܍8D$ @D$D$H3$*yfvBvBfvEfXfvEf]>/i]+/ VUWVS0q5~ utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]0D$ $@D$D$V3$([UWVSppu} utLD$4$F t$4$D$4$[^_]. Ơ-4$@$[>lj4$?[^_]ffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSn{ u`7t`F t4VtGF uuQFF1[^_]FF؉Fu(VfF u4$.t&;1뮋V0 t~@9t $sV0F FV륍0D$ 0@D$D$<4$\&DfffUWVSmz u}E Fft[xT$$<xEE%1= ‰UtIM VL=u*9F(uČ[^_]E Č[^_]ËE 千0D$ @D$D$,4$V%E 4DD$ @D$D$,4$!% TD$ @D$D$,4$$UWVS|tlyy u8E1F t)fF FCFFE+O|[^_]ÍED$ED$4$0EF u 9vEE$ik`8O FUEFEuE f F vFft$t܋E f F Rߍ0D$ AD$D$|,4$#FfJD$ gD$D$@U$U U$EFD$ AD$D$,4$h"2p$辕XtUWVSiv Ɖ׋@0$7F0PEb;9EED$$;F0Pt$T$8$8F0PuD$E$f;V0U:U쉂PF0ǀTu Xt$87[^_]ǀX\D$$;F0NjF0TXtXUhu MDp7u]1҉]UWVShÇu uDp78u [^_]ËF0$6F0P:V09t'Pt($V6[^_]ÃT1݉U9UPV0ǂT1UVSgt uDp7u[^]ËF0$5F0Tt$5[^]ǀP8$ 7F0Uigrt MU Dp7u]É]sUVS?gDt uDp7u[^]ËF0$H5F0U t XtTt/$5[^]D$\$8F0ǀP8$B6F0UVS8fäs 8E1EȉD$E$KU+u 8[^]fffffff̀rS[Ds [UVS"f's u tt$D$t,@E$[^]ÍD$ AD$D$9P4$5UWVS4er D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"(#D$#ED$ t$|$D$($v D$$"8"L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]I"MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍D$ AD$D$Kh$(L$(=D$ AD$D$Mh$E"UWVSmcnp EU uM] $\$M] -}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVSbóo u} 9vtGFfuUT$|$$)xFP^T[^_]ff [^_]ÍD$ PAD$D$Cx4$덍wD$ PAD$D$Ax4$X9vVD$ PAD$D$Bx4$%'UWVSaïn u} 9vV Ft5ft\D$ D$D$$!Ѓt<V FfV fuUT$|$$_'[^_]ø8V F뱍D$ DAD$D$Vx4$2@wD$ DAD$D$Tx4$9vD$ DAD$D$Ux4$;UVSL`Qm u9vu`FftAȋED$ E UD$T$ $M!уN tFPVTfN [^]ù뻀fN [^]ÍD$ }1thcX|$ D$t$E D$L$T$ $7D$D$4$5D$t$$&AljUED$ D$E D$E$4UWVS8GÌT Eu}8E1>'cXT$ t$D$E D$D$|$ $7D$D$$u(u~5E+8[^_]:|$D$ D$D$4$D$t$$ t,JH󥋅D$ a7D$D$$3T:Aǃe$q…1A<+wLKuىD9u˃u뷃z럃b뇃Jl謋UED$ D$E D$E$R]UVSwN# t$ED$EȉD$4$UxE<[^]EӸ<[^].UVS<7Dw@ D̍ED$EȉD$4$x E<[^]ø<[^]USCéP :UT$$K[]{CP -f̀ffff7̀rS[TP [>̀rS[4P [USCP D$`D$ ED$E D$E$[]USBO ED$ ED$E D$E$+[]ff.&&$D$4̀D$̀fffffffT̀rS[TO [PS[=O [USBO Dp7u 8[]&[]f̀rS[N [USAN $1[]UVSAáN t [^]É4$ ^uD1f1ø11GAPN 1øUWVS<(A-N  tse}1f1҉9r׃uF E̋ E fE؋ EЋE D$D$(Ẻ$U<[^_]f4…u"uB=f t4t$wuыB =uًB ΋B Ë t2 9s"8u +x 9rt {dƃ Uȍ|7D$ KD$D$X7$)UȋB7uD$ KD$D$X7$ UWVSg?pL D$,]\$`u }|$<]\$08D$Ë$1  D$`D$HD$ D$(D$,MD$D$<<%t2/D$(\$`|$H9s CD$`D$<D$<<%u΋D$1t$`@D$\ۉ\$PӉډÍ@L$LL$0\$0\$0D$Xu}D$X@tv1D$;\$0\$0D$Xu_D$X@tX1\$0\$0D$XuD$X@t 111D$;)1D$\D$`D$ EtK-E1ۋEx@Eƃxf t<$U ÃXsEEuʉ؃[^_]ÍD$ MD$D$:7$xfffffffH:JuUStu Zf9Xt 1[]1Zf9XuZ9XXJR9Pt ʋA9CuA9CuA 9C u1UWVSXy0~= ƉE8E1,Fu#E+X[^_]D$ D$ D$D$ t$E D$$ uL$ =D$D$t$ D$D$ -$+FD$sD$4$SEDž?DžDžDžDžDžDžDžƅ:uUWVS E @<<EX E EEP1E E逃9Ѐzuȋ}38w؋xux uxuxt4x}}?9xuE@}9GuE@9GuE@ 9G u [^_]ËEp ~NE 8E1ɉ€xu]tڋ1wRt] ;St9u1 [^_]UWVS8-ù: EME8‹E1Affy  D$D$ |$D$ $A-xu4~9rg4$0fV$0;u u;EuD$$蓎dU+u8[^_]ø1*sUWVS<~,Ã9 EM uU8U1ҍx Pf9 9px(qff9t1f҉m4~94$^/fV$L/L$L$ D$t$$t}tmD$D$ |$D$ $a+]E+u0Ё<[^_]Ëqx(ljqL$qUWVSQ*7 h9q dqA8LƋE1D$<$-Gw ^P $Pu atZ -pXt$ D$D$ѫ$Zt$ h@D$D$<$Ww hx\f9w1~t bTtjDžL$L$$~ut Љ9x CPf@@Px Wf Nj@GGG1Džt<Ǎ L LL$LL(LL,Lzfz9t&ǹ BHHH fWDž\E<$3fLJWp ~p1fDŽBDŽ|:t&t:1t:qt:q|:y 9uf@@ODž@<Dž`DžH -XXW GlDžtlDxtЉ@<< DžP$t ЉoGah@p|l@\ t4F<<SDžtGD$ pt$|D$$l9r0Ga0<$-1ttl9G eHH9G1$0\m`<Dž*hL$L$dL$ L$L$4$ЃBw<$90fLU+eY[^_]aËlF<.Dž1l@<cDžPf7H担tt ƍx$D$ t$t$$T$T$T$T$T$T$ $ -XTdDžD$L$D$ D$|$$P |7f90ua tVXt$ D$D$$螨t$ ȋ9~D$|$$ Dž`x$D$D$D$D$D$D$ $/XC)ʍ‹fDž@D$D$$-*8" 0Gw0<$,u&L$$vOD$ |$|pD$4$ N@u a QTt$ D$D$ެD$ D$D$$Ct@Gk <$+Dž`qD$t$D$ pD$|T$$op9wD$$l<$#+ua ' -PXT$ D$D$ʬ$fT$ D$ D$D$D$ t$PD$$~Ut$ tD$7D$ -X$<$pk8d0@ M0$*tߋjD$D$$FetG -XD$ D$D$$tDžDžPG -BXD$ D$ D$$裣Dž\Dž`D$t$$Gt0GR$)D$ Dǃ<$a(Dž@(Dž`$(D$ CD$D$ -$GGGG+t .n0G0b4R u6d@t* <$R'Dž\Dž`Dž`N`!!4 t5 -BXD$ 9~D$dD$<$G\<$&tDž*L$t$dL$ hNL$L$ $Ѓ.&<$&`VWd@WO -BXD$ D$D$!$2G`D$D$ -BX$M$%D$ D$D$ -$Ji\OHuttЉDD@<.<mDžDžpxW<$$D$D$PD@$_vD$DD$$\D$ $D$D$4$&pD$|L$4$D$D$$‹p9DžfDžd)ff҉T$t$$%@ 0G0<$"@6xk<$"Džd$t9Gf\dfx‰)fftg҉T$|$$̉#@ 0G$W"D$ Krx|df9Gu a & -pXt$ D$D$T$ڛt$ 9~ȉD$dD$<$J -PXT$ D$D$$vT$ 9~D$dD$<$$6!D$ qD$D$ -$dff -$5 \L=$ D$ D$D$ -$ʷD$$|j<$rdHf+f)fffv҉T$t$$DžT$t$$5xDDu<$Y? -XD$ D$D$!$Dž@<@8MDž -XT$ D$"D$ 8$豘T$ 9~ȉD$dD$<$+  -XD$ D$D$ $=MDž]WS@0G$D$ Y+t .A40G]$D$ GG<$Dž@(@t$D $J<$Rv80@1<$D$ D$D$ -$U<$fD$ q뿋D$8D$ -BX$ͳff̀rS[ [UEU UP]UEU MHUP]UWVMu}u }E E=ɚ;~ -ʚ;1yA^_]UVSUEu M ]+M]9|) ZB[^])ʚ; ZB[^]UEU +EU uE+Ex]ø]É]UVS  uED$$uuEEFEF [^]D$E$SAx(E EUVN [^]FF [^]UVS Z _ uED$$uuEEFEF [^]D$E$@x(E EUVN [^]FF [^]USMEE UQY[]UVSMuMb)E UQY[^]ffUWVSLN S }E E8‹E1|%W`D$$D$ D$D$D$ED$ED$ D$D$<$ ƅIu G$@ED$D$ t$D$<$XƅZWу @ 1 $ED$ ED$D$$˫ED$D$ D$t$<$ ƅ~QG D$D$D$D$D$ T$t$<$ƅGD$<$ E+RL[^_]ËD$<$` ‹Pu@fffuGtwp fHfHff$at$ɉL$ T$D$08$\PtGtftPD$<$ K$#h$D$<$_ D$<$M D$<$; NOUWVS,ç }U ME8E1GED$ED$ L$T$`8$PL$T$ D$D$$ȧ=E D$D$ED$ ED$T$<$fU+,[^_]Åx$蚵=wttH|.uT$L$ D$D$$UD$T$`8$8qD$<$ 9MUWVS( E E8‹EE@ I<$f2&T$$舫E0-D$ D$D$4$@ DA@tD$4$guDJ@utSFNu tDJ@tEpt$|$<$v7$ʜ$踜1U+u ([^_]KUWVSL7< }u E8E1D$<$m11Ҁ.փu9rMd9G GDGDDžDž\x.uED$D$ED$ED$ D$D$<$zU+L[^_]DžD$ D$D$<$dt9^G#GDGD}1DžED$D$ED$ED$ D$D$<$+GGDGD1DžDžDžDž.UT$T$UT$ML$ D$D$<$t~8=^G1҃‹Otth uAED$D$ED$ED$ D$D$<$RtD$<$IED$D$ED$ED$ D$D$<$PG tD$<$낀xbV1@<t 1ut$t$ut$ ut$D$<$moGDGDDž0ED$D$ED$ED$ D$D$<$)Dž;D$<$eDžDžDžFfffUWVSl u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt[l[^_]ËE$EE$ML$D$ ED$@-D$8$U($},~r EEML$D$ E,D$t$E$FjƉt$E$oEEFD$ $WU(fBMЉU(E,) }|$}|$ D$t$E$Ɖt$$ FD$E$FD$$FD$$ U(fB )Ѕ9}ET$ MT$D$8$ EHE H E, 9/B B U(D$E$,U(BD$E$U(BD$$U(BD$E $E U(t5BEE ϋus3tftuu )fB fBl[^_]ÃuuBzE fUWVS Ô U }E@4E)Ѓ FD$$)FD$E=h$VfFE@ uN1T$$F D$$ G fffG )~ [^_]ø둨u+9u1 [^_]Í$žU *U$謾U뿸UWVSuz M uU E@}ω}EE‰EPE)96UB9E'9}}|$4$GD$u4$W׋u$sxuXuQ}׉+u9ED$4$^+E~[^_]äft.t&9}u1[^_]uvkUح$]UM 9}y8D$ MD$D$=8$jJ^MAyEpfhfffUWVS(ö ljUM܋EGlE8u䍃EE썃E< t< tD$ED$4$耨D$ED$4$aD$ ED$4$B/D$5D$4$ G2$ܻu< tt < u>:([^_]ÍF$~d ʈdGtD$$a닍F$E~GjD$ $,SD$ ;D$4$9tD$ D$4$uEO F $~GGD$"$諘D$pD$4$踦tjD$HD$4$蚦uXO@E܉D$ED$9$BOWL$T$8$#yO >D$OD$4$$t*D$ RD$4$ugOD$D$4$Хu O@D$5D$4$覥u OD$^D$4$|uZUm D$4$Xƒ?v?T$U؉t$E$|EUƄD$fD$4$uZE D$4$ƒ?v?T$U؉t$E($c|EUƄ(D$ oD$4$茤 D$zD$4$gu OWD$+*D$4$=5g)UVST $@Xt<|xEEE%EEEEMD$D$D$ D$ED$t$=}tT[^]UVS27 Et4D$E$'EEFEFЉT$L@$mLt׋$ˆL,D$ $L)&D$M7D$4$/ D$.4$HmD$D`$HDǀtǀxDž0Dž(<9$蓩D@Dt$D~DD$4$cu덃$T< tt< uDž0<4,LTDD|$@$0l<NFVe9xDw@ut;u㈕$<,t$$C<$t]TDLD 44 $4,LTDDDLD<ȅy_%=tdwL$,D$ $股L{;$1!$tDž0pvLusL@DDu|uc'z*D$D$J1ɉfLu LVfqUD$E$#]UWVSX>C }u hl3 3 t;D$<$t  F FX[^_]Ë 9puttl|E*9EttIMD$D$ED$ D$D$t$OkBt  F F1X[^_]UWVSU E@ E~tE~mEX1&<1|1t_Bꀃ9E~E9Et=}ù{u֋ KJKJK J uv uꀃ9EE[^_]Ë OJOJO J uv uf̀rS[d [UWVSd>C TD$$]@$DžDžDžDžDžx@ N L$T$ VT$D$$艧\T$$w@ 9@ωփsUtfth@ lj)#Pd덋ptŋ t|$$vuf떋P04$@9‹(tft‰)@0DžuY tftlj)@4#tF4$R@9r1‹rf$Vu@ $ś1d[^_]‹);Wh@ 1ffi$,t00P@~~ <9V) 9kVʉ)ȉQ1ҋ?tftH<@ lj)99h΃r뀍oD$ MD$D$d9$}x@ $r4$U@9>‹ytft‰)‰DžHtftR<lj)944$w@9`‹yUff^f# PD$ZumuTk@ $f+ f넋$xp@ 6UVS ƀ7t$pw[^]ÍD$$}[^]UVSü ƀ7t$o[^]U U]UVSkp ut$v[^]ÍD$$B}[^]UVS$ ut$Yo[^]UWVS u}t5W¸t[^_]ËF [^_]ÍD$ ND$D$|d9$UWVSns }uENH NHD$$<|ƅu!yH L$UT$@$ tEG D$GD$ GD$D$4$u4$*nG [^_]É4$ n[^_]ËG [^_]ÍD$ MD$D$d9$֎UWVS [` EC88  -:)lj}싓 u2E D$ $  [^_]Ít$E$lt$ $lt{ t1= ;txED$D$[luًED$ڮD$ED$ VD$9D$$8 [^_]Í9D$ED$ VD$9D$$ [^_]ÍͮD$ pND$D$9$EED$SUWVS ý ''w} )ƉT$U$tn  UT$ $tG  D 1 [^_]ÿ'y qUWVS( LJ LJ LJ  11ҍ VEE5 )Ћ  ڍAw ,ND>ЉD>]T>ӉT>lVMHL>@CD> C kTLTE֋ xzt =w ;NEt =w ;N tH~k LJ yM !؉ MeM썇v$  MLJ  M싗 1ɍN]MEUtwM<9ErMtu艷 Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>lV TLU;D> rU7UsD>HL>PD>HL> HU7Ë ; eLQH P H HLJ U MULJ D>UMD>ЉD>]T>lV T]ف9NLQLJ 롋 LJ LJ D>ЉD>]T>lVoMU -E8E䍇 $UMD$1ۀ} ËE)؉D$ VD$9D$$UMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@6UM^D>E싟 ]X] É %LJ LQ f gUUxz Mt ; r tXLQ H P H HU Ћ]!LJ  $$ffUWVS0MV EЋ( u䋸0 }9EZuԍLYLWu썰 Xu؍Yu̍YEE]]EfD t1P}艗4 P0  8 5R}苗D < D$ $D < 돋$ uЋ Eԋu؋  À8 u }胇9u}U8 0 - E苐  -X U苂< }]苃 D$ D$ D$ $rL0 8 >E苀 P[^_]ø]苃 $K $Er…MtO1E0-},-E7LEDXtE7<$]~rƒ9r̉E8R1KU}8 MԈ }ԋ$ EU}ԉ+ E8 ЋD U< }Uċ:O,4 OŰU苂0 U9E2\9ËU)Ӊ]W(EUȉ0 ( XND]荃D$$&!_E艘4  G,+UU]ȋU̍<Q9uUċ:,^MO uquF_ u؉G D$ $]Gt/U艂0 Uċ:MO u#O)ȉƋ_uGE荀:1uȉMȁ vE W18 M苹D < MċKщˋMD9UUċ]苃 $ WUuUȋ]苃 $hUE苸D }< M<4 ЋAE̅+}苇 $4 D < <EU‰ŰY9Q MỦ4 @D@Eȉ EăU2ŰEȋUЉEu艆0 EȋU}̋UUu艾0 fEЋ }ԋUM‰T$Uȉ$]MAYۋUBA ,Eǀ4 GEU<A,E苀4 E]~C]苃 $Xf]}8B} $}苇 D$ EȉD$D$D < UP$?a4 tU苚D < <AEE苐D U< }<4 Mč[^]-6 %       Uպ U]U轺 U ]U襺 U ]萺  U| U ]UWVSfg < u"$D uމ4$LJ< LJLJD LJ@ LJ0 LJ, LJ( LJ LJ 1[^_]US费ù E$趶[]US葹Ö E D$E$輻[]USgl E$[]øUS>C D$ED$D$ VD$;D$$[]UVS ut,D$4$XQff D$4$lQ[^]Í0D$ d[D$D$5;$pfffUVS rw EpFtD$D$$=F!u  [^] vUWVS  uM.D$ ED$E D$E$腉Te>EDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$aqDžH V€ʀ UTPtD$ D$D$T$WыU !ȃP{vltat0<$T$Dt01[^_]À Vt t0<$L  PxD$T$OP^E E DžTED$D$ D$D$$oDžt HƁ ZLsAs0E/s0 m GJj G|:G `a G ] G`_ Gk GD$D$L$8PLPP LЃHtfD$PD$L$:H  D$ $PP D$돉Lq8PLen  P6D$T$NGP@ ƒ@ uc bb fffUWVS聳Æ }EpFtD$D$$8F p[  D$4$u_  t$ur  T$U4$Džu=U9B0E pp[^_]1UD$D$4$Mt̀N(UV$ED$E D$ T$L$M4$ !@MukF[^_]ËX[^_]F(V$tߋ9F(F$PD$D$$+7[^_]UWVS腱dž EpFtD$D$$6FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$C !@MuFЃ[^_]úЃ[^_]ÉED$D$$6UЃ[^_]ÉLnUWVS$OT }9EUEEEE;E MmG$Eu݋M…tUL$D$<$?UUD$ ED$}|$4$8u7}UcE;E sQ $[^_]Ɉ뤸$[^_]ÉT$$t㉇1UWVS( uE䋆EMM܉;E E苷EHMU$CƃUtY9Euȋ})lj}苊U|$$诰U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$6u@EE9E 1([^_]D$ ED$ED$4$6l([^_]UWVS(聭 EU9}] E苊;M 9EE܋E9t<)t29ut&M\$U\$$] =MUD$ E܉D$L$M$U]5M9M Ut%E9s.E9hw1([^_]Á ([^_]É\$<$蔮DžUt([^_]UWVS( EE] ;M sf]]9suE19r 9t[:u)ÈU]D$ E܉D$L$ME$]4uEFM9M Uu]1([^_]É)맋E ([^_]ø([^_]UWVS2; EU EpLB< D ?ZU )ىL$D$$]* f}U fz|rrE Xft)ۍLZu0f9sfuf09uut^JLB)wmft" F]Ff9sf9ufjE1[^_]ÉMU GD$E$] U M̉EU ]썋nL$ [L$D$; $+bEU UEU ]썋nL$ [L$D$; $aEU U E]썋ۡL$ [L$D$b < $aU EUWVS.3 D$T$$tb@D$T$U4$DžUu D$T$$h.[^_]D$T$$H.[^_]ÿUWVS 藨Ü }EpFtD$D$$-Ftt88f [^_]ËE t9sF [^_]F(t‹tF$Pun$ 1 [^_]Ãtރ [^_]UWVSDƧ˴ }wFtD$D$$/-F}   8CuD$4$D$ D$D$$nH F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$l;EtD[^_]ËMN$tD$ D$D$$G!уtD$T$$7;u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ_EE$D$ ẺD$EȉD$<$W3EԉEE؉ED$EĉD$$k‹E؃9tD$<${mD[^_]UWVS[` u~GtD$D$$*GD$4$G uUEu@t*$:]uU|$ $ztUx?UWVS  EE,E}1EED$ED$$]%ƅ@ @=fU1 9M rTVÃf;EuUMUfY]][]]}tH}t8MNDF,D$t$$]'E!D$DFD$ljU]荃ۡD$ [D$D$b <$ZU ]{_E}E9}twu})D$D$$]&9utAFD$FD$$]\$tVTP‹}u뙋u]^}8 [^_]ËEpE )}fG w [^_]fffffffUWVS$ƶ uƉЉfMy} ~ϋX9U)ω\$D$M$]EfC 1U~U 93;DD"=. fLD$ E D$ƉD$$]`ËE XKMǍDUfTTQf[MfTftEff9؃0[^_]Ã9u}ԋGDC$GDM_=ƋC 9Ex}؍Oȅy¸} E PS$u}+D@=D$1]܍>fEEԉEf}eMfyvDTQ9.ED$E$E@EMU EHfEEf;E}f]fD M)lj}]U)؉EE|$L$E$]C9E U5]f{vDTS9szED$E$E@EMUEEHfEEf;9]tED$E$1MUEUԋMf9MsFfED$E D$uF D$t$ ED$ED$E$]ruOEEtE@EEEt5@EEESpEE@ =ufufČ[^_]fEEEE]D$ \D$D$8<$ AMt !EEfEE:M]D$ [D$D$S8<$@MgUWVS$ Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$]ED$$Eu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$PR…t EME$EPEwD$ |$UDBD$4$Q tʋ@f8 $dž mDUWVS,uz uE xEFEEEE@ETGփ>VMM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$UU)UEftfDuf)tGfLGM yITGփVuJҋu9sM DG)fET$U܋UT$7$qU)UUPMf WfЍL)΁M wdftGuftGfWL$E$E*DEfEfDU܍nD$ @\D$D$y<$<M UaM nD$ @\D$D$<$<M VuM DGƃ=Fu!nu䍳@\uDG)fET$UUT$7$U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUt[u9s‰9E8Eu;p)E9pEfDN,[^_]1,[^_]fE D$E$E tˋxLUED$ E܉D$D$<$:UED$ E܉D$D$<$:nD$ @\D$D$<$:;D$ @\D$D$e<$Y:E@EnD$ @\D$D$k<$!: D$ @\D$D$b<$9FE)UWVSjs EE @u E1Oft{DPND$ t$D$E$]fLƅt|$E$FfUH]uYfwfuf|Pu E]M IM1M AKEfE@ =\)ځɋ]fTKMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfAfAF^[^_]ÍD)wMfTAhU]썃nD$ 0\D$D$<$8E@ ] UfTK=UWVSÈ U EzMq uf+4GMM9U t$ED$DM$8u)uD$ U T$MDD$E$4J…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$袲Uu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVSI~R Eu} 'D$ D$DJD$4$]YItDPfzuft,ˍ< fD$ t$MDD$<$H aLJ(@f8u$LJ 1;D$ t$DHD$<$G…@ fEB@fE1fEE$#MAE9F ED$EFD$$OM1U)fUN fMD$ t$MDD$<$ G…ZM_LJ $LJ(14r9UWVS(w{| E։Mz@ =uW)ЉEN MMȉEGfEt$趀ED$$A|UE D$ED$ D$t$$E9F ED$GFD$}E$E([^_]D$ t$DGD$E$E…t#M L$M $MEEvE8UVSu]ED$E$1ɋU Ct1[^]øUWVS(y܆ uD$E$1ɉE/D$ED$E$3EED$E$M fA fJE @EEE@E;EEHppfEHuwj/V1ZYtp%t0MPVZYMu}] EEAe[^_]Vh "hU "h-;UWVS]u 6+_h$"VS o tfuLp7-ۋ=P-)u=-u h$"Zt- -$"hj5-5- @u5-h$"jch Xu4'h$"jAMUW6ZYMtUBk `%u6h$"jVKSWh%PUWVS] 3 h5!#jwh5!#Sum@t h("P-DP-Zu-w$1--`%5-`%jjP4- y 5---=0 -v-u h("j-u#--("-`%-`%-%H%hPR4- yT-P-%H%hP5-ң- - y5-hUW$jl---u--u-HR-uj-D--9ӡ--s-tá--t----- -tG- -t/-%h=`u; - ----%-RP5--P -t h("jh`-`h۫j%hj%1=-=-=--hh0 -P0 -V5--- t (-,- -$-9щss -- u15-5-5--P$ u15-5-Z- rPPhUW$WY[-u5j5-5-5--P  t5-hUW$XZ -------K-]-]-] --9Uu/9Eu*--ڣ-- -$-6esEUӣ-- --(-,--t1----j1=-=-XsE--EUMtH-L-EU-uRR ----=u=u=ۣu -t=- -9ȋ--s")1=-󪡘----- -t j[Z-5- tH -1=-󪡘---- - -)։-5- u-=-ujPY@u$8th("5--PZ@u h#j\|jxUWVSX ] 3zh5!#jpp h,"SuLg G-$%\-1L-(-X-T-1L-(-@P-z-L-1=(-YH-J15L-(-3D-$@-1ɉ L-(-<-8-4-0-,-=$-th?,"=Lp7tu hd,"jz1nuou-j,P{YZFt@jVBf$-^Zu ht,"W8pj,WGZYt x>1>A!Ph,"h-Y jEP-4-=T-t t9h,"Buu/ H-t'h-"&=H-thG-"<-P-jW~X -ZYu hn-"y;O\-=D-t11X=$-uمtՋ=8-jWXY[^t' 9=\-tЃ=D-t ]tlj,ti ȉ=8-\t 1Z01C PtjZP0Pt 1B" -~h u)Vc_Zu h-"j x15 -DRPוZYyƅu(3%=`uƅu3i - PVY_= -i =@-t9PVYZt=0-Vh-"}=D-t%" r=0-ugh6$3h-" QWu =0-u7h6$V3h-" G= -=0-u3hUW$|XZ=X-t4011Dž8hha)%PV ,-5X-8i - 192t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t =T-u1&T- -=X-t50"; -si C1e[^_]USEEE EE0 [1҃vU|r҉-UEh1"RPj_ tvpt.Et?SuF-Ƀstxu0-볡Lp7---Ph`%h- jEP-EE)ЉEEt9E8-u/-EH~P-)EEEHEj@!1ۉ$:ZuYhxjXZjjY[hjXZh -Yt1h-h1"hXZh1"HYh?j[X-Et^E8tTE0T4YtEEj0YZyjZ,E8!tYEh0h-Z @Et9h-h1"ngYXE8tj/Zuh1"GXx*-tPhUW$Y[hx-"Xy"=-th-h#h- uY=-=-h-h1"fZYh1"cG1ۉ$Z&f%,-1-냋-| thr/"(GXf%,-^1-$x(4x-PRR tt 1j1ɉ -h-h1" f[Xh1"F1$d=-ujpjZuh-5-h2"h-h-h#h- h-h1"eY[jaZn=-ujBh-5-h2"h-~UWVSXu} 7nhˢ"膆YZu2" fuLp7h2"WV-[ utt P-)NvVE8}W\ZE1% tAB9EsEUPQMWr UuMt6QWh2"jYoփ빅u Wh2"AE@t1j URPyE ;F|E8tEph2"joE1~PS^YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmWT UWEffEERhm+fEEERhmW 1!EPhm8@W x E%6Sho"j%nf9tfuPh2"EPsh3"KU1"cUK U83"RU Uuuuuuh<3"U$uuuuuh\3"9uhz3", uh3"XZQURPW x%uSh3" ,URPW yShUW$j3mPh3"jjBUWVShu E1E1ۃ}~F8-tEh4"B_th4"PbZYu -h4"_th4"P8ZYu h4"{Xjh4"h4"֝!|EP=uh5"d0`E_t<1ɉMMMMMMJh 5"{Lp7PuZYh+5"jkEhQ5"WE)PWE @}w}c}6to)}4E뷋Ed$H%}8tEKwn뎡Lp7Eh'5"5Lp7VEXZjLp7E]EQEEP-P-}uCP-Eu]SP-4>tj@uY[t8P}t Uxu)NjMMU9rxtEE xt}t1ۋtP:Z\tS8RXIEt'U)RPSMwSÃ~t C}u"h'5"h$EZYu ha5""}uEEuh-WuuEpEP茔uZ yj=-y h|5"}tLjuVjhSJy h5"oXjVjh5-#y h5"oXh'5"親juVjpSjVjw5-,uy1ɉM̉MЉMԉM_1%H>v  DGu΍EPEPj$ =-t}t.D1}tE܈jEP4%/ GuEy ht"jhVh~f5-;Vh~fS/SMUEWQ}u j uXZjzUE 0ja(mUVSEU J -uc1E1ۋ4%Vh.G#uU-H-Y^yhx-j *XZx-Px- Cu 1e[^]ÍL$qUWVSQxq1%.%. %.$%.,%.8%.%.4%.(%. %.DžDžDž1|h ]"V9R @I&/0$%S'$(%1!-!-!-s!-d %.jP5Lp7 :uy5Lp7hw\"!-%. $.$%.8%. %.%.0%.14%4%h\"XC u,%.w(%.l%.Lp7j/SaY_Džu ;C3@;tGt@:t%t@tj/[ZÅt8@tYte@t3t5@tij/iZYDžt+{tQt@tUt/{t@t)tG|h\"O%.Ph%.h%.h%.h\"5Lp7[uLp7<t h\"jzc=%.u%.fPh@%.PhD%.h\"5Lp7~!Lp7<u@%.D%.9sh\"뉅 @%.Lp7j/SY_t6PS_Zu#Lp7%=@u !-Lp7?,.4%.!-!-Lp7<%.}5Lp7$+!-[=~ PZPh]"jBbP-)ѡ %.=$%.t 8%. 4%. ,%. %.tW=%.t t$h@]"4t=,%.t=%.uhr]"=%.t=!-uh]"I$.u !-iDžtDžxjjVjjtS`V@t,#IYtjjVPjS:V@t=!-!-=$.u/RP5_Zu%=u $.%. 8%. 4%.1 ,%.t1=<%.!-=$.uRjhh .PR4!-y'3 8uh .h]"'.Fƒt<t~'.wދN1ۉ ).).F 1ڣ).).>'.5).11h).@Ph).j N). ).É).).@u"hZ"h).1ɉ ).[Ѓ<tπtʊt ȃ<uuutW119).).7).t19ƃƉDžDžf=<'.'.'.t P1#DžDžPŃw 1҃.1҉B'.t. Ҁ'.t"HuF'.1҉sBu ).).19}Et3t*pu!1ӉBDžDž,%.= %.t u$!-9).Ph^" %. %.tO %.5!-=%.|1RP1RPLh^",Zt=$.$.;8u h_"UX$.Ƌ@V=!-RPSQ(Pvvv Wh!_"G [j XX%.1jhjjjщ¸c_"X%.T%.1jhjjjщ¸}_"T%.(P%.1jj?jjjщ¸_"kP%. h_"qO=!-Ijjjjj1ɉ=!-$tj !-_h ).ƀ).$-#h ). ZY ).t ).1tFh ).h_"6[^h_"h_"%h -jdh ).6hR"ۋuw1ۉ4%. %.u!-=8%.= %.!-uFÃ= %.uMh#`":YtpjhO`"wXZؙjjjjjщڸ{`"zh_"tt Sh`"5^_1>'.@u >'.%. ,%. 4%.1=%.$.Džt~ Džh`"'.Y=tk jhjjjщ¸`"ƒti¶ f'.j).DP\=XZh`")Fjh$a"'. 11B'.tJ?tEWh2"F'.1ҋΉT 9u9u @u'.1;=). ).؀tet\Ph2"= ).1Ӌ Ɖ\ 9u9uGtDžDž19~JCWShDa"މD 9u9uG뮋y1RPjjjʉٸUa"sTƉV?f=<'.?'.%t%u ù19rGD8'.G'.%.11ۀt,'.t#u;u u@ $ut'.u돋5).).19}{.tK;tFȉC219u9t'.A뢡,%. 8%. 4%. %.= %.uYhia"^=,%.th$. L$.t ha"[h b"7YtM$.3@$.)2$.~ hEb"Z@$.~ hdb"xXfj񋅀Ɖ1ƃu h^"ϡ'.11;'.ÍPPZYx+=w;)uvX%.=T%.5P%.jStPY 1eY[^_]aUWVS}] 1ɉ1Dž1hr"SW7 rfq1stwz1҉j P5Lp7ZLp7 8t :tPh|r"&78"[N5Lp7hr"jvKDž-DžP-)OtvjhP6P2.Ãy2 h).hedAP y hr"=J*.$9 $@fJ*.1ɋXu uXhr"ajh).hx-;K  tȸor"u5!#Phr"ZYDžfH*.h).NfH*.h).-k~PSyhs">jGu"PhwdS h$s"XS 1e[^_]US] 3SuUS] 3SuNUS] 3SuUWVS}1ɉ@j/E 0N[^+.t@E +.w ~ Ph"0XZ1 $11<8,(Dž4h_"u W:4à A6$%Dž,jhjjhLp7y"/8jhjjjLp7Ձ"//.jhjjjLp7"f//./.AjhjjjLp7w%4/ $jhjjjLp7"//.`jhjjjLp7>#$.ƃt @5Lp7h"{.Y[Lp7/.jhjjhLp7#$./.jhjjhLp7$[./.jhjjhLp7"1./.jjjcjjLp7$$ .!-jjjjjjLp7"-/.I@PhjjjLp7$-/. jjjjjLp7("-4Lp71҉j PS-P< 8u 8t Sh<"h~"< )Sh<"hF"j FDž8Dž(P-)Ovy.< t5<@t<t#=/.u0@/.PDP5/.W5+.ȗ@u5+.h%jTC u00h"*XZ@,t*uLq5!-/.1/.h%RZYtRh%00h1")t5!- /.@t[5!-@t/.1/. /.,t-h%P/.ZYt4#tș;s <u9ʋ<Dž<@rL@< uA9ʺs19ʹs hK"jAhv"XDž< 8u^%= t5+.hă"ZY1801RVf4щ‰*8X<5/.5/.5/.$ 45/.5/.85/.5/.5!-PVSDÃ@(tb.S UWVS1~}9Dž ~1}}}~~~11hE p VHSh"DRP@Shޗ"$hd`\XTSh"購H 119t T@ܸ5!#t#PVShM"f=@.~yh'"PX1 =TRPhh"*G u"j 8Xt-h'"_ 9rj YShm"XZh"~Ph&r@ ~̕~z"uXl"~";jjY_)$1;@.@.}k=@.thx-h"XZh"Nj蓻x^_=@.thx-h#"Y[hjjhH%'W=@.thx-h<"\XZjj+^_=@.thx-hS"2Y[hjjhH%Ph"=jRXZ=@.t0=@.thx-ho"^_hjjhH%jh"Y[.h":w譾h"ejnjh"jAjXZhVsV thZRPVWOu u @.=!-tWEZhөRPWNt(hWs_W uXpjX=@.toj蓧UWVS] }C{.S{.jhh{.jP.@u@8u$jhh{.j5{..@u5{.hUW$j${.{.h{.hQ@5.w *-y@*-{.t1MPRU)ZY UMu܃ SEPQj蛦"@*-uRPh"j2$v"UWVSXu] 3{(_tjPh"j#Lp7.h"SV6 Dtb$&..Ѕ..̅.ą..{ȅ.l.].N.?P-9*=.t̅. ȅ.u ȅ.=Ѕ.t=.th"*=̅.t,=ȅ.t#fC"=.t%Ph "跧h*4EP)h,"S+ u$1ۉ..EU؅.܅.ڀ;+u[CK0-DJPk<..EU؅.܅.Y}Qȋ=0-DOt Bu/<:0RU蠺ZUBBBBh0"EP賛1Sc  $d&0k SDЍ~=Pd80k SDkd-lGS0k KT ЉGW0k SDωG0k SDЉG 0k SDЉG0k SDЉGWҜ؅.܅._u u(+EU..y h3"j Fh#P=Y[u~tO.t5PZ)ǃv%.t CRU6S6mUӃ f @.h -.)PS躥 t!;t .sC.uf. h.蘸[.. .th؅._MPhH"脫 h\"}Y.u]/PZt $t.jjjz0 =.u6cuhj"nj虡tPhy"j胡/j jh!>"] ,;..| (5. .9Ȼ&} VG9ƉS}M)Mt1jjs s*M9ȃM} |&uXSi&t,;C|X(s^C t"=ȅ.u!!>"=̅.t"=.t"h.5.Sh"jjh"=ą.th"j'=Ѕ.t3hhh"(ƃ xjh"PVSh"jQh.0.h&"Bj.h.j hH"[=ȅ.u=̅."" ""EE=.t Eh"E=.t k"=.t n"=.t w"=.t #=.t #6$ .PtPH1ɉ h{":jEPS 0Shq"j 0Sh""$ jjXZj&UWVS@u} E@h"WVg tTHth wT$`&ЁȀπÀ5Lp7+-X뫡Lp7|+-1ɉM똋P-)HtZ&4jVhق"茵 tVhق"hW %j h..jVXZy VhUW$j| ]1uȉuԉufE5+-]S?SjWHyh"^jhyt Wߦ y8th"95|+-hCt W趦 yh"}tjjI'Y[t h"j1҉UUUUčEPXUWVS8]u 1E6XhC"VS x`At$M.ăa$,& ...+-2 #덡Lp7.!.v .k.`.U.JP-)Ӄ=.t=.t& . .t&= .utu@=.u7.+=.u =.t#u=.u. +-x-U1..hXUu hQ"j6=.tEPWjj11ҍE?1.tjh*"P蓨[Xu5.hUW$j1ɉ .jjh.jVÃt;tMLSZV{X"4~FMsLK1=.e[^_]UWVSE pd.EX1=\.h"xPZYu \.'h "P衲ZYu T.jݛ..yMnh4] K9m5d.h "PBu .(`"=.tU #P_tPDX~5+u!zt~Kh%WZYt WCuCt C\h"]H._t8u%h"DH.PZYt H.>#h"D.P\Y_t D."1=X.tjh"_Z~Pvj-K =.u&jrPYujj=.t. T.ujh"UXZuj0bj^_=.uh#5S-蜰Y[uZ:~jh"Ujl]5.wĊZtjP]谈l.p.Bu@tD.t.6u΃=x.t$H~ 1x.=8.u @.= .~jh'"gSTj rO j@Ok藨j\UWVS]u 6b$l.uGh.$t.p.h'#P| uT.VS6[^~qj蟘Y1uhf(#j9~!vu0.h(#VS u%/~k |Љ=X.vhz(#EXZšP-)Kutm0-DPu^SȬ_=vhh(#hSh . ;tCp. .5X.h(#j ]S9h@j}h@jqh@jeh@jY Sũ^u h&#jn@uh&#jhx-h(#) u W-d.޽h"Ĵ[=L.t"5\W- Yt5\W-h(#jqt Ph(#j=L.u5\W-Zu€= .t8jj5. y h(#*Pj5. xh.j@.. @.%L.%@.%D.f`.. f^.X.ϯh.&h.&h.u&h1jҷY(#=T.tM(#PhUW$謝qVx.^_C6f=\X-t jB衏[ԮE8W-ut覲Eڃ=T.u*t{8,X-u1f=X-X-< t< uG< t< uMjEP5. f=Y-{5!#} u"P_8W-u.EE5W-P蛯ZYf=X-tCۡ0-t (-fEjEP5.V f=Y-uEP}Xmhe#jUWVS E 0̦.W1.T.h+-#&Y[t *-#43-#hI-#&ZtTMBugLp78tpjRPo :uS1ҋ .buV.. .ht.#u uà uC$J&5Lp7ha-#..먃 .륃 .뜃 .듺{-#Lp7E낃 .vLp7u#h~-#h$K&h0W .h-#S^_À;1h-#SZYƿ@K&t&VRS- u <2t&h·%S^_SPh-#蒓 . G.O3u8=eRh-# 8=tRh-#RY[\3h·%S^ZƋtt ug(S趦YS@ZhǾ"4jPS^‹ 3 9r(<,tuxG .QRh-#SV7h.#萒辽u5Lp7uh<.#hK&hKh,#訯1k$ .t!VPZYu ..yGhK.#VhN.# j\Lp7 .I=P-u). u聾~=.u,PܚY@u h.#j .#裾..Z!Ãt~@K&t%Ft!á.0Rh.#]  s.0h.#>XZ s.0h.#%_Xt Sh/#[^j uh-/#tthQ/#ݐjE uC.3hR]ǃ u R3ho"xPhPZ tlj=..t $#1 &:%.hPW諽. uR5.h/#j8 h.PjZY@u5.h/#.t&h.P_u_.05.h/#j .=.t8.8th.PY.u$߃8u5.h/#jx =.uh 0#h4K&h0hjs軼T. u sh%0#hX.P膎_Z@u shD0#`.%=tE.Bt,=@t she0#\5T.(T.Y sh0#7CP..5.h0#]._Ztpp 0h0#@ .uB`.%5!#=@u,#-#uP.u-#RPh0# .t Ph1#ܔY[..th.P Z-#8th.P_$-##Nu@u h.1#jh.P^o"u RhX1#(.%=u5.c[@u5.hv1#@-5.»Y@u 5.h1#T.tP衻Z@u5P.h1#j^jzUWVS}u 1ۃ~^;-tP-11ɉ<8Dž4h=#VW2 it1҉4Y-t+:t!;B uBuLp7B뵃Pr5σitot8DuFDž<늅u Lp7{Sh8$h=#_ cDž8Tucdx1jSVxCtjjj9ǃuh%VhiP踒 @u h7=#jW YY-7tvFtjNt^HuTItBQIWZ.0QHXɋ0u hF=#jW돃넃8tV4t<tj]UWVS$u] 3_h5!#jU hA#SV3 Btb$DM&jj5Lp7l.|..p....s|.dx.Up.t.vBeR0G.f"$M&H $N&a...G.1..a.1. .?.1.1."..1..1=.....P-)Ӄ.=.t*thB#. . .tbh C#jt3=.||=.t=||)=.||| Dž|4` .j .P Cx<hSh]-k=v ShMC#<h]-Y]-]-X/tK]-]-1h jXZ=.t.Ph]-,x/uP]-@]-= ]-wPh]-Y_@u\8Uxt)o%=@xtbK=.u=.t. .t P6rP6_Z@u6hUW$jh%=@t /t 1ɉt4h]-h_C#j . .tDžt Džtt$P蒒ZPvЀ8/uj|V>x 1lpupCpQh]-^Zh]-CHfuFs KPsho"G~pDžlpxmXu$wfushuC#~Y[ftf tt)]-C,-]-=~TSh]-hC#} o{DsC(huTttCpj/Vv:YZpt)xph">PYZphp>h)8/t z/t/Bс]-vPh]-hC#} VPRpp]- ]-= ]-vx/uP]-@ߋp=.xt Ph]-) Ph]-^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh]-hC#L|CP@% =@B%=@t,M1@ush]-hC#1Jp΁@tpw `~||t {DPSZY/sH . .u&fNush/D#F{Y^jSx*f5.V..lhOD#hDN&h6tCPph]-説^X=.h]-shI"} E%=@t.%fuL=.u%.H..yhwD#hj/W6YZtxh%WG_Zu^h5!#VS @uiP-)Ãu]p0薩ZY@u jj{je;LtEPtIFu'/h"G#VSt w~fw$LN&1// /1////1 / /t/e/VP-4)Ã= /t/-=/t,/=1=/=/u /1ɉ /ttu#H%V1ɋP|=/xt)SW}YZuE%=u dSWXZt WhUW$jE%=@9t ÃSt]UWVSu 6h5!#jjЉÁp1thl%Vus tVmtDžtptc5Lp7ȋXu5Lp7hB#jhWMpW 딡P-7hUW$ߋ^Xt!DžtpS]ZY_yɾߋuڋtV-rUWVS}] 3,h5!#j" hI#SW tUit)ft5huP/σvu?/1//15//뗡P-)ǃ4j>s/h# j =/tuϋVPFTtP2l pY[uNj|%=@luh2lQà =lv2hI#jltx/tlƄ/CGh>W ZD>8/u 9tH@j/W,0ZYtPRdՆY dvWhI# sXZ"@PRl: t DžphfppUWVS@] 3 У0-SuN]Sj9uEUEUSjR^_Sj9ZYuEUEUSj.^_Sj9ZYuEUEUSj _XSj`9Y^uEUEUSjXZhCi#z0ԣ01=أ0=ܣ0=0ԣ0P]1E؍}ȹEZ uVSj=xVSj- x"}ujVj y}tVSj xjVj y}tVSj˓ xjVj踓 y{}tVSj蠓 xjVj荓 yP}tEVSj n y1jVj[ yVSjI x茖y y0hKi#0j ^=e-tUjhH%e-[^y hki#0j赖0 #=e-u=xe-t @hЦ"Yt8u`."V躃ZÅt @|/tCP̣0_uhi#j@0ZYtlj؍Pȣ0/h/*h{: jie- t! ttBGuB@9=/t hi#j=e-ue- t 00e[^_]UWVS]u 6ch5!#jY 1hJT$VS5 tLtPt9P-t辕hMv#._8/u|hs#P3XY^ukhh#S"X_ZuZPSY^@tHxPhH%i_Z@t2|9u;xuM9 u;EtjjhDY^uj SӖhx-.cXZ-@t h("j j%kUWVS}] 3$h5!#j 1hJt#SW ft]/WPtwR)d0벃vtbit6rtxu{Ĥ0ܤ01ؤ0p1ܤ0ؤ0ZԤ0K̤0<Ȥ0-P-9=ܤ0zu8QuthTt##lXt0؋Ht ʉA?jjФ0[ܤ0 ؤ0u t1=Ȥ0t =Ĥ0t@jPWǃ uhtt#C =ܤ0t.u)WXCHHf $T&PDs 6Psho"j%=ܤ0tC ?ƒuts Psho"j0k=ܤ0^KPSCHjSW[C 1ɉK +C  Cu>S=ܤ0tCHSftYwifu`KPC蟑us+Z=ܤ0u&shUW$0Y[R%蟍8XC=Ԥ0us襾ZuH1舒tm=ܤ0ta8VS8?HE8r5̤0 0$10sRX 8t hB#jWZ[hxVSZYu8=Ȥ0tCj4PSho"2i0_u=Ȥ0EE%=@uB=0uSht#h0Y[묃=ܤ0t'E%=u,SB=ܤ0u=tىډ֏uh=@uS]=Ԥ0u SZtXt1=ܤ0uShUW$^Ƌ8 踋8?誋8u=̤0SȐX501e1e[^_]UVS@jj虈^X1EĉEȉEEjEPj gpP¸9u 9E0j j]Y[0H 0jB0$5!#jZYh#Vg-1ۉ]$h 0m^Zԥ0tt3Hu:0.\0X01|0E (00ԥ0t.U=f-v=X0i`.=ԥ0tEPEX1Х0̥0tA:g-HyPqXg-H J hg-X谱EHmإ0 0\0X0 EPDXu uWXZu u߶Y[}um=g-t,Eh#A^E=0u PEuE=f-u}rEjL@^=f-'7=0uh"L[uY&jh #PjwFÃP%A$CY|=Vg-uL=0uCEPC$#Zu EPRDX8tEPW$@XEd01ۀ=ng-t$=|0uEPCX|0ng-u'j4HY&^XC̈́RPQZY=ng-=|04f-d050h"d$g-XUWVSpE 0Quh5!#jG1ۉ]T- 1P-] ;E9h#WֈZYEW[w_9Euph#Su tZftatDeuI렃gu=j5Lp7ΐEZYz5Lp7hUW$jb^P-E ]SubZYy h#yEPhBt @ui y h#@X}Whht@ui y hʔ#XEPht@ui y hՔ#Xt$FvE 8uVEPuWS\S^1ɉMME 8URu VfYZURV YZuURV[^ZuoE 00-DPt"VťPS{VS֜E9jh#Vv uVSEZYVhב#a:E E}tSjuq y h"j}t WhgtuJh y h#Xj^UWVSu 6rh5!#jeس0 xoܳ011ɉhdt`p11ۉljhh-h#Vu譽lRtf(LtntMH1һ뮃PthtPdtXfuyDž`뇃vuhDžds=Lp7hDžpYMDžt@Džh1 P-E)t 4Hubupt uY00t00pt$t*tt h#j t)00>=ܳ0tzj:W`KYZt@0j.W,YZlt!h0W*_Z@lu BC>t0<#uy$0h0WH*ZY@u ۉ 8xPWZY@u WhB#j=ܳ0tE0E0jSVǃ 1uhB#>pu jSW W许X CHHf wg$8p&s 3Psho"/^Džl=s Psho"^ttDžl Džl0ht)KPt;Qu0t;Au A<50RslЃ t"`ushUW$Y[dsZـ8t hB#jZVwZUWVSu +f40H0謙 00 ʈ00D0p00 ʈ00@010%0f60<0h+-#[th#Y r&t7GtPSrYZu ShA#WhR#j;1h#Vu A6$p&l0%0\0 h0d0X0=Lp7h"W]qYZuh`#WEqYZ;*=Lp7.j j5Lp7Uǃ u~8"u 5Lp7hc#D=D0j j5Lp7Uǃ t =H0~8"u5Lp7h|#jj j5Lp7lUǃ ue~8"t=05Lp7h#뺸Y5Lp7Z@u^PAT0I@0=1@04`0(P0 9tt؉ 0v jhΟ#uh# <0tt h #j000ǃ;=@0u/;D0u"40;H0u109rt1= h-d0h0  h-P-=T0tP U)4uE=\0t=X0?X04=X0tt  1Ljhh 0PQ軧PLy h 0t=h0uJLxPPWZYLu&%=ud0h0w($q&J\0P^JP>hЦ"^u`."h2#Php)%hSP]S褬ǃuShUW$Y[hr"PPXZthWʈh 0h0VT50h0V VpTX1\`dDžXhVXPj范 Džy0z8#tjVjjht"dj艛_jVj>PSPxh"Nƃu5#SVhT%TPBTu h 5"jjPh"h $h $ÃuVYSxTP^Z9ujVj藂TH h*"V`LY_uVhUW$\XZ0e׋H󫋅LLRXtPDžu Vi[eh?#m\hx-J$-H$-ZYyh -TX -P -0 t+@t( $-y h -S_ -P -Ѓ߃NPԩ^ JP@= 0u  0 =0u 0 Ph0| Y[J}l0L0P=L0X=`0t 0,h 0h0hx-G 50h0hx-h0wZxdh*"v^[_uvhUW$j(1JPhmdP h#jm^~WYu WhМ#P0eȺ0t jSR @ h0ZIPuWPUWVSjj]Sjjh z&@u h#j:uѵYtjjSPjh z&@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQkMQhUW$]YU1G맅u) -yhx-j _XZx-Px- 1e[^_]UWVS ƅ]-ƅ_1ۉ(0,0(0150040001= 0$0 01h,#u u< ycPtJTtgxPl$@z& 0뫃 0q 0 e 0Y 0M5Lp7$0Ye5Lp7>Vj:V]=[Zuh#SH00t)XV3fZYXu C[Ӊ00=(0t h?,"jLp7tuhd,"1Ҁnuxouh-h·%PcG^_t5!#(0*֋=Lp7u 0i5!#Lp7 0Otrhz&Ph #h-ZjsM^]0 0t00t 0P-M Tu)tP1ۉXhn h6m 50ROXRrRhu#RL6eZYTLSMjjLRPV9X}XTPT0VhPȅà uj/S ZYuShق"hW %hSYTVXu"VXu9S^ty2LhVHà LVhUW$juhyG"LRdZYh#LRcZYSh=#jjhVjSǃu Vh^#j$h@0hzd@PT uW4|X0`PhedAWT @uVho#W|V]aH__9~Vh#(NE XhW h00hU h(0h00L h(0ZXUh`v-h`0輹hv-hh0譹h`0۹hh0ѹhL] h0覹 hW hp0膹h6] hx0蓹h0͹hp0訹hx0ԹUVS8y hF$PYh<$%VZy h^$6Xjh $5J[^]Qu[jjhp$ u=jh/$IXY9$u/$jh=$hu$Ph!"h $3j 7jSPj @t-Et Phy$莽^Xjh $IZYtj _^h$ij N^ w-q jj hp jjjj j jjjhp 0jjjjh p jjhp EEEE jjjjjjjj j j jjjuV8jVjg1EEEEEEjSj]jSj]$jij}ijviEE EjjEPEPjEPƒ$Buy^80 w-te[^]UWVS]} DžhDžT1L11PXDžDNu h$WS躠 u~fFt/RkDžPgS$&5Lp7DYu5Lp7h$XuLp78#t5Lp7蕀Zu[ j dR@P莾 d:uY_Ct Ph$>XZj =XF 뚅\\8rqv`\jP׉\@Y_xuhSuUS] 3>Su1 US] 3>SuUVSu] 3h>X] ue[^] UVSu] 3D>X] ue[^]"UWVSX] 1P0NhH$PC_Zu.CthG$P;BZYt$=`0tM`0$1Dž1VSuw @ B4s$ع&Dž=Lp7h"WAZYu 0h`#WwAZYt'h-hL$ܛ\0_XhX0=P0QP0B=Lp7h$WAZYuT0GjjjjjLp7#,Lx-qjjhjhLp7>#$,D0P5Lp7h$"Lp70jjjjjLp7"L,P0jjhjjLp7#$",(0jjhjhLp7#$+<0jjhjjLp7#$+80jjhjjLp7$$+$0bjjhjjLp7$+@0;=Lp7=`0tFWpYu0-DPuWh$j輤@Wem@jjhjjc$$+Dx-jjhjjLp7$*@x-jjhjjLp7$$*00ujjjcjjLp7$$*Hx-QjjhjjLp7${*,0*=Lp7=`0t.jh 0h`x-W]u hv"X P=]Gh$WQ>YZu40Xh%W1>_Zu 1ɉ 40:h$h$hT%Q=Lp7hy$W=YZu 0h"W=YZu 0Wh)$Djj5Lp7̬ 5Lp7h?$PhjhjLp7$B)H0L0=Lp7WTsZu0-DPuWhM$@=W k_+=Lp7=0j:W[ZYuj/WMZYth]$ ?u h$j 0P-=Lx-=P0u=`0P0p1󫍅l 0AuVE)Ћ`0)DžMDž>=0qh$5r@ 0jxlP5 0phH$K@uph$"0@th$, jr HM1󫍝`4󫋅 =D0u D0tJL0 H0P|[^@=D0H0L0s=X0u;H0L0}hRR @uh $PE$ZY@uh$=X0h0VK[à uVho"j袟Ph0PEw ujhh0jPOsyh0h4$!P#^_@tڋ%=`uh0hF$1=X0jjh0QQ yh0hk$jP}Y[uh0h~$jh0hق"{8 0t#0VRW9^ZtN xRjVhق"+8 u ƃrVW8YZuSh0h$j=0u@0`PP50h0U`@uh0h&1=0 0=D0uD0 h$Ytc uh0h$h#S7ZYu&0uh#S7^_t t Dž0?=0thk"hl%S7Y[thps"h0h&Džt'D0RP5L05H0%HH0L05H0=L019|Y<@ t D0SQRPG  5H0=L019| h$t5 H0L09sSQRPh$jtdD0 H0ˋL0%H0RPM @u+5L05H0h< $j裛'0P_Z@uhW $蓡[^ ^}-VjjhjhLp7>#$^0P5Lp7h$jjjjjjLp7"]0jjhjhLp7#$]0jjhjhLp7$]0jjhjjLp7$$Z]0ujjjcjjLp7$$9]}-TjjhjjLp7$]00PhjhjLp7$\00Lp708h+$DžDž}P-)Ӄ=0u 0Kt]14`E =0u 01=0u;00}hPE @uh $SS[_@uh$=0.#jhh0jfyh0h4$SZY@t=0jjh0Dƃ yh0hk$djP6q[_uh0h~$;Dž0jh0hق"+ u Dž0xxjWhق"+ u ƃrW[,ZYtWRF,Y_uSh0h$ 뀍`PPjh0v@uh0hԿ& =0u0u h$j t] uh0h$u7hM%P+_ZDž0t hs"h0h &j襐Dž0t(01RP5050;000019؋|i<@ t" 01SQRP; 0019| h$t5 009sSQRPh$j蘏tM00 0mRPV @u'5050h< $jm1$0PVtY[@uhW $fXZ 5$j迊j|P5Lp7 |:uy 5Lp7h[5$릣<2 3 33t hy5$@3Lp73j3@u 3 3A 35j|P5Lp7œÃ |8uy5Lp7h5$h5$j赉 3 3 3@j|P5Lp7 d |8ud5Lp7h5$`j|P5Lp7 |:u Pv5Lp7h5$#w. 3jj3Lp7b# 3 jj3Lp75$CrYX|P5Lp72XZ|8u5Lp7h5$3Džh3(2z&u$u (2M(2{G,2z?tٗt h86$G(2v蹗t hT6$'=<2~蝗t h6$ ٽrfr fp(2٭p߽X٭rX\22߭X%٭p۝X٭rX 2 ݝ(uu h6${3%=u h6$' X@2t<2У@2`Hu 9P-t Np9}hh335!#Kp3%Y^=u 3 3 u33f33u388ht,3hu ~ 3 1~ 353= 3Wm$3Zu Wh6$j3@30-t DKt@9t)Ѓ ~hx-53h7$j蠅EMQMQMQMQMQMQMQMQMQMQMQMQMQMQMQPh@7$RƋ33H19}L2@91B3uQhq7$_9~32Ph1"CZYj Xtn9} 2F's423xt&jSjh5 3U@u h}7$X3t&jSjh5 3&@u h7$躊X3t&jSjh53@u h}7$苊X3t&jSjh53@u h7$\X3 t-f`2b23c2D2g2t'D2ƀ`2')ˆa2ƀb2D2( D22)ȣ2`2jSjj5 3&y hD4$g2D2@dB3f@fJwuJB  3J 3J s*EjEPj j5 3y h7$wt)jwPj j5 3`y h7$3tTjh3j j5 30y7h7$q s'jh3j j5 3y h8$D353SPh3h38$ jhd-hh5 3yd--d-hP8$jhd-hh5 3qhj~'1ɉ 3 3 3 3 3 3 33EnEĀ1ۉ]]]]jEPj((hnj'm^_19<2~h2j4rCXZh2j2^_ٞzt,-2݅(=2ݝ01ۉ@D%ݝ@1ɉ04h2j+XZ݅0zt -2݅(=2ܭ0ݝ@@2982}y݅@؞vj22i%s=`-t#3t2q22hvܕ@vq݅@g2%(2vݝh22h݅hܕ@v݅@r joݝh 3EfEjh3j0 @݅hu hs8$S %ٽrfr fp٭p۝h٭rhPjEP`1k (0 '8" Flh4"EEPURj5 35$35 30Ly31'8 kh8$ׄh-_X h2j$3HX[^~9LU83_ kuPLh8$ 4 LX)dHhh@;42 hfX82Hff9u `-22󥸤22 2u202<@0231ɉPT s)hPU@ EʉU1҉UiE'%Uthp U2eݕP22݅P22h-ܝPv ݅Ph-݅P2v2؉ff@352v!`t:(3<02Dž`9Lu@1`Dž<rff@39LHpfu2TPV`dq2PЋL)t&(uH3uS3t63h8$3 u23 t 3h8$XRLh9$ `<Dž`hf@fLffX-)J 3f~4t;KQ@PRh79$3t1h t 1< fX-3uY`uFHphfXfuTPV:$hR:$hj:$ h:$h:$h:$h:$h:$h:$h;$h;$Ph0;$jdh]m_ hU;$dhxc^1ɉPTDž`1ۉ<jdhmZh@<t%w uhc;$<uh;$ht;$ Xh;$Ph;$^_hZaPh;$.jdhl[0hfPfh@fRPh;$ jdh3lYh<$jdh lZh(<$jdhk_h@t <uhW<$hA<$^ Phu<$Y[dha]jdhkZ.h@Ph<$dha^_jdh9k[h<$jdhkYh<$jdhjZh<$gjdhj_vh{%Djdhj^Sh<$!jdhj[0h<$3jdhYjYhPh =$XZ3dhu_HpX<wz<Xx^FLs3`ts)Xh=$XL^"LtkXD- `FLXxFv89~88X`;2uMSh`2L+ u5`t h%=$X8N)XL2`2L󤃽`u!i`h4=$_Dž` h3=$^L].8LtkXDX _뵃`uvh9=$E[i`uPHxhfXfuTPW=$ZYXOFLXLe`t ^hx-Xlb02;@2)3UWVS}À8-uCh"S- ZYuD31uuu'h"S Y[1ۅu@3πh=$u Ws\ t[dw<$&Eσ=D3t 뾁북뮁gEE돡P-19tcM E1WtUPI ZU<RIXXEtPV1h(%V1ED>`tj>hPhUW$j0p}tVS$h"jBp}CPDžuP?A_t $t8=D3tj jh"hWh=$=@3t j jh"gWh=$jOh8j jh"g tVWh=$j'hWh=$jh h5!#h!>"h=$ijjh5!#h!>"h=$h }ujjjjjjjj jjjj jj!@u h=$jojj!ZY@uc8th=$=jG8X}ucj48_j jM!ZY@u$8t+h>$tY2 u h>$uZ W7XVS,#hA>$t 0P-)ƍ3=p3tjjh%{3 >Ejjj"迟3jURh@hP脮 @u hV%sY=3y h%jl;u=33 @ WWsZ) (    mt /  =3t1ɉڸk1ɉMhjXE؉EhjWE܉EhjWEȉEhjWEĉE hjWEEhjWljEhjWEMU ʃ} ʃ} у} хuu hA"E1҉38gtj53_X1ɉME5!#E5!#FEȅ"CEċS:-0BRUqZH3U$H&3"0-30-30-30- 3uj\3[X3L3A91&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸduCEċSEP1ucCEċSEPM̸jECEu/CEċSEP1ɸqjX3uCEċCU,`EuKMċs t^3hw$&]1R3F 3:(3 .03@"83@3 3 3 \3 X3t# 3 333t1\3jjV|1C R3u#EPM̉U8iEXUUuEPM̉URI0^uCh%s2ZY=t3uh_B$htB$hn<%^ 3CHw)=t3uhB$hB$hn<%, 13SEP1ɸhX]ċu3MuhB$5u>au uhB$"3Eġ3}tuȉuthC$jfMu}t }EEă=3uMEȉE10E18`31atctguIEc3Eh3b33@3t33l33333U9sHxt)Ј3t]E؊Hw uF:T80D019r)19r)1ELE؃9sIJ 33tMutHXSVh3 =d3t =P3t3C$ ^3tE}tHpVWS =d3t =P3t(C$]3tE}tHpVWSr =d3t =P3t6C$]3tE}tHpVWS$ =d3t =P3tDC$6]3tE}tHpVWSְ =d3t =P3tUC$\3 tE}tHpVWS舰 =d3t =P3tbC$\`3f`3=d3t!=P3u=3tg]`3^=T3Sh`353  u( 87t \PhA$XZ9~kPhA$Y[]d 83u =3tHO 8t|3 x3 h3 d3PSVs 11ɉډe[^_]9`Wbe[^_]UWVS } bhI$PZY…Uh~"WuZL Ut.at"t=3Lp73뽺붡P-])Åt>um3t&h#S]^_thH$SLZYCt/=3u&43.tujRKuEVhI$h-VhI$h-jt=3u.3hI$WuZK t@OrA3w$&z=3u3먃=3u3듃=3u3{=3u3c=3z3 G383)33 =3"3@33335Lp7}'3X=33=33j=3Lp73h%PY[>3/=3F33)P-E)tH:Eu5=3=3t =3=3]=3t =3=3txt4h#W2YZ!hH$WYZu/ h#WYZ7hH$WYZ"h%W_Z,@JK EjqÀ53jj535353"xt53jj535353w;E53Sjl 0ShUW$jV\3Eo =3mElojEPjCl @u hJ$'bEUuuhJ$ [Jh`RPh2J$]t SX YyE  1SQ%1RPhBJ$ G1=3tXv5j@FXZhj*Y^hj*_Xh5 j*XZh5 j*Y^hj*_XEt7U ESRPà p;3uSojjT*^_jXE j:0Y[t*E 0KZuU ERP _X9jh3Y^uhj)XZhRj )Y[E 0j@V諾_ZÅt @hPWrZ E @1=d3t1ɉ 3 d3ER@PTXZ=d3=|3uu 3ujSVP =|3t 1ۉ371҉T3Phn$53 53FY=|3a뿃jh3eXZhj(Y[hRj (^_e[^_]UWVS}u |hm!"PZYtWhh!"SZYthg!"SZYuT3)~3ltXnuzh{$VWE7 duP3׃Vt1PσwB0-뾃cu3T3L3h&h#h-jh&h#h-ShK{$h-jP-9u*=P3t e^x1aGpptƀ8-utxt t1J=P3t%ex1`pp8uJ5-ƍxPVhZYtn=P3tSuO8uCV.-Dhl$ 2_lhuh 5"JZ1th{$Z2E%=@uVh{$=u e Vh{$ZZYS6:X5H3 UWVSu 6(h5!#j>1ɉ 4 1hd$Vu4 ua`Gt+It2EtHa<$X& 4먁%4뜡Lp7u5!#4 4z4k45Lp7$75Lp7Ph"WC W}Lp71B} 4Lp7u5!#41҉ 4jjjhx-h$/4jjjhx-dh$NX|SPPhځ$h-jjVP-4 4ut p|{>tt|1{|7j5`3hx- t h("jG5$4UWVSP}1ɉMM1hʃ$u W2 t3gt!utGu.Lp7ELp7;uLp7E85P-9t3SZt@E%UMM@uShу$jF1}1ɉM}t EE1}t6h·%EPYZt"8tu h$jFGDʋE 46ZZ@u6hUW$jFhH%Y@ttEPWW_Z@uh $}tuY@u h$jRFtuVZ@uh4$FtVRP2vhUW$jFh#n\Xu $jh$SSTDShUW$jEUWVSu] 0o41t4u4 `4#%1t4hF-£`d4a1X&?t2Gt&W =o4uRho4>"YX RwP=R |4k4|t4t4t4hx<%y[_1҉tu"h-h% :jEDuEl4he%SV 0 txmtW~փpt]rth-h%9jft$Cuht4ht4h%5Lp7{뜡Lp7됡Lp7t4o4txPhp%3b[^uUu;EE|Ch%6Y1t:SdLZt@ <uNtS*Xu 1pjh#hn$u Džp訹Åt脹5-75-7jjVPm4uh-h%WLtL5t45t44[^_5m4Jhhjhjhj 5-7躮x6hh`4aE1ɉMj@x*ljxj@i*Ɖ|tu1 jPt1>XZtu(xH%}u)x%{xth}tjUxY~jRt-XZlN t.^PR[yh9%譂yh!9%t'WRE:RjQjWQ jhI#h99%h99%$<(t h/9%D1ɉ 4 44x-t-4@ftPhht@ ƒ PBt4$Zu h>9%PWQ^y h9%qy hT9%u@U jPPS33hi9%jjmWà xtt148tj8h{9%jP<1Ήș 44)tSP y8tjSh9%j;[11P2ƋЃYtuƉu#8t7u@1҉9t拍9u1 fj(jj `+uSLUWVS1 }~XE Xh?%S^_u h%?%[-hi>%SgZYu#h`&hB%fhB%d 101jEDž`#C% -DžDž$Dž DžDž1((,Dž\EEEEEjj @u1%jj[^@u %jjZY @ux%1$1ƅh%>%t>% Ph&Ru u#^V4M 6?4uƅ뛃Nw$&ft'j{$$&Dž<%`Lp7`Pl)5Lp7jl^X-Àt ˀDžx<%hDž$Dž$Dž$h%h%?%[q ƅDž<%{Dž<%gEH;P-t dSMlME tEpP-U)‰u 0SējjjS證ƃu(h% ;P-!u uPjS҆t%huąn h%?% $h4C%Y;P-u;VSfjjP-u 4Sƃ u uPjSEu0t &hGC%PD@Sw hXC%$LHSlheC%TPS芼 g dh  t u, @ À翉  dhd%@Sd%uvtS=Zv8Sh " ~"t"t5!#hH%PShvC%j+0P褿Eh5!#h5!#h5!#hvC%j+0P}dE9P-u t1h%t0PY hC%HZ@uh<&hC%I[X Duh<&hC% jj H0Sh| jhD&BPB$@uh<&hC%v S膰@YvKRhC% IWRt#v8t hO#S0Pz X'@RhC%HS dhӃdhu,PPP-] 4 dh u-CvPjP-] 47 dh 7Pjj @<8th<&hID%G[XdhuGw8hZD%88 dhh%hhpD%]PZY@u!8thpD%h<&hD%-G hhD%(P[_@u!_8thD%h<&hD%F 0S聯Yt&uSh<&hD%SPhD%FhD%rF1?d%@Z0F(Pjh0jU@u h%u,\(MSh"j\&:@uh<&h,:%FY_A@uh<&hD%?ut$u/>XcPhD%bE ht"E#hhE%h(\,Sh"j\k9@3h<&h,:%SEXZh@S׭_tPh<&h'E%(E .d%h u =uduA%1Ƀu P-} RQ0P` @uh<&h;E%dhǃ ?%u5!# ?%u5!#?%u P-U QWPhǧ%g0W}R@uh<&hME%#1҉h[PŰZY@u h`E%DXWh(j7@uh<&h,:%C_Xu*dhǁ@u dhQP0P'K1҅uHh<&hlE%\4PIZY$u64h|E%KC_X$P$9x uً4hE%‹t x t]@h% hE%PA0Pld% uhE%BY8t tjjM UXZލP0WwHPWFF1d%@tWY8t" t WDZtڋdh@t) y tI߅uGÁt:Áu- hF%P]@0P +t'%@t0PhQj8V0PY|0[_~ tVhjj8vՋd%@u hC%@Xu u0S [hD%0@dh@_dhShhjj,8@Sh j 84@P;$ZYy)h<&hF%@[_ 1ɉ$ 1Dž$d%0uSZ@uh<&h-F%?Y_PSCXZt;t HxtyzP P@XRu1ɉ_VSz _ZtP^G<S+S@ SS; -tP[hƒ@tRt \tBh>F%>h@Yu&j$RP] @uh<&h":%>XZ+:?lhx-bqh$tPRJh<&h$D%7h<&h5D%(%Ѝe[^_]ÍL$qUWVSQ@Y1ɉP441,41,0<48hp~%S@ ,H01$ ' 6% 65Lp7fP41Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @fP4F누0fP4%1҉Lj LP5Lp7٦ƉP 8u!Lp78tL8u ;Ph|%pj LP5Lp70 ~Lp7:t L:t5Lp7h|%4z 6@nw6t?h|%j& 6jhx-1ɉ \- `-d-^_Lp7< 6j LP5Lp70h-Lp7 :t L9t Rh|%j&@=Rh}%Lp74 6 0LP5Lp7術Lp7_Z8tL:t Pv)ݝ O5݅ tjuPh5}%!(%v5Lp7hY}%AٽFfF fD٭D߽ ٭F $\-`-߭ %٭D۝ ٭F d-xy5Lp7h}% uho}%軩d-^ 6S\4t$h}%j LP5Lp7;.8 xLp78tL85Lp7h}%&,% 6 6 6 6 Lp750-tDFu h}%1B卅(R$R RRRRR RRRRRRRRPh@7$Q ZƃH1Ʌ~ )1 6hq7$Y14@9u919~4Ph1"跮GXZj ̭ 6t1DžtDžxDž|Dž:h6Vj5Lp72tP菚Ph}%66rJB6R舚 6@Yj LP5Lp7+p- xLp7:t L:t5Lp7h~%=hh+~% 6% - 6k 6% 6%  6CLP5Lp7Z`4XZL8u5Lp7h5$8LP5Lp7X4_XL8u5Lp7hR~%P-@)Htľ"6j.SY^u S{Z)؉@?wPSPG@Ƅ t@ 0-t ,-fBۍ1V@KjKPV$@SVVdP>$TVh~%j Hd`hSVjSQX 6t=p- h~%贤Xt1DžtDžxDž|Dž:h6VjStPnPhUW$jA6BtÉ4ru h~%6Jr rrQ6 y h%<!6@t"56h6P W t hgN%<1DžDžDž:PtPj<tP|P ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizeoutput block sizeinput block sizeblock countfile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. Explicitly specify beg/end address?The bootselect code is not installed, do you want to install it now?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -An < LFS_MAXNUMSBnblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCAN%8u %4u entire track defective%10u SCIOCDEBUGSCIOCRESETSCBUSIORESETvpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x invalid console name, valid names are:Boot options: timeout %d, flags %x, speed %d, ioaddr %x, console %s console %d keymap %s Patch area in stage1 bootstrap is too small/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20251019135308Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-extproc-parmrk-onlret-cread-parenb-cdtrctsispeed %d baud; ospeed %d baud;lflags %d rows; %d columns; queue = %d; line = %s;-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfoiflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignparoflags-opost-onlcr-ocrnl-oxtabs-onocrcflags-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Read failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %juPri%s GPT at sector %juSecGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableCreating new secondary GPT headerMoving secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]GPT part %lsUnknown %#x %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AFpltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab MBytesGBytesKBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandLPSVEPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVncan't stat: %s%s is a directory%s is not a regular file.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.0_BETAxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initnd_dhcp6_invalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completedelayingmulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: redirecting DHCP6 message to %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Alink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*12aargon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist-B_Tb___a"abE[ZTU@UOUW[n\b^.]vVVYYX2Xfgv\]/seA@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler @  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N60w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-  0@`  0@`  (08@P`p        L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c      prop_string_append_cstringprop_string_create_nocopy_prop_string_rb_compare_nodes_prop_string_rb_compare_keyprop_string_create_formatprop_string_create_cstring_prop_number_externalize_prop_number_allocOMMMMMPMMMPMMMMMMMPMMMyPMpPxO_prop_intern_decode_string_prop_xml_intern_find_tag_prop_dictionary_internalize_continue_prop_dictionary_internalize_body_prop_dictionary_remove_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_free_prop_dictionary_emergency_free_prop_dictionary_iterator_next_object_locked_prop_dict_lookup_prop_dictionary_get_prop_dict_keysym_put_prop_dict_keysym_externalize_prop_dictionary_iterator_reset_locked_prop_dictionary_iterator_next_object_prop_dictionary_externalize_prop_dictionary_equals_prop_data_internalize_decode_prop_data_internalizeprop_data_data_prop_data_externalize_prop_data_equalsABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_bool_internalizefalsetrue_prop_array_internalize_continue_prop_array_internalize_bodyprop_array_remove_prop_array_addprop_array_setprop_array_get_prop_array_free_prop_array_emergency_free_prop_array_iterator_next_object_locked_prop_array_iterator_reset_locked_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_externalize_prop_array_equalsprop_object_equals_with_errorprop_object_release_emergencyprop_object_releaseprop_object_retainۣǣ555555555555555555555555555555555ѣ _prop_extern_append_empty_tag_prop_extern_append_end_tag_prop_extern_append_start_tag_prop_extern_append_encoded_cstring_prop_extern_append_char_prop_stack_pop_prop_stack_push_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_lq====Y============__strsuftollx_heapsort_rpermute_argsgetopt_internal_getopt_longunknown option -- %sunknown option -- %coption doesn't take an argument -- %.*sambiguous option -- %.*soption requires an argument -- %soption requires an argument -- %c_getoptatolatofmemstream_seeksetlinebufsetbuffersetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror_inet6_rth_getaddr_inet6_rth_segments_inet6_rth_reverse_inet6_rth_add_inet6_rth_init_inet6_rthdr_getflags_inet6_rthdr_getaddr_inet6_rthdr_segments_inet6_rthdr_lasthop_inet6_rthdr_add_inet6_rthdr_init_inet6_opt_append_inet6_option_findip6optlen_inet6_option_next_inet6_option_allocinet6_insert_padopt_inet6_option_append_inet6_option_init_inet6_option_space__icheckhost__gethostloop__ivaliduser_sairuserok_saruserokrresvport_af_addrrresvportorcmd_afresrcmdrshrcmdrcmd_afsFIFEEFlElEuElink_addr0123456789abcdef %x:%x:%x:%x:%x:%x %256s _ether_line_ether_hostton_ether_ntohost_ether_aton_ether_ntoa_MD5Data_MD5File0123456789abcdef_MD5End_SHA1Data0123456789abcdef_SHA1End_SHA1Final_SHA1Update_SHA1Init_SHA1Transform_RMD160Data0123456789abcdef_RMD160End_uname_ttyname_r_timesaaaaaaaaaaaaaa;aaaaaaa;aa;acompress_modeaddcmd_getmode_sethostname_pclosepopenve_popen_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_number_globfreeglobextendmatchg_opendirglob3g_statg_Ctocg_lstatglob2globtildecompareglob0globexp2globexp1_glob_getpassfd_getmntinfo_getloadavg@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@_getfsfile_getfsspec : fnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating )"""""""""""""""""""""""""""$d$''))++c+"""L+","", *)&(&k,(,%""""""$d$ ,%%"+d$"(r(n).)p%"'"**p%`*"3*"*%;Zx0Nm<[y1OnJanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_getprotobyname_r_inet_network3NdOOMNNiacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~#$@[\]^`{|}~0123456789ABCDEF0123456789abcdef_fts_children_fts_setfts_build_fts_read_fts_closefts_allocfts_sortfts_statfts_pallocfts_maxarglen_fts_open_closedir~YRKkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortbb@ÿ?insertionsortsetup_mergesort_r_seekdir_unlocked_getdomainname @_strlcpy_strlcat_strncasecmp_setstate_initstate?_getenv_rgetenv__canoverwriteenvvar__freeenvvarmarshal_new_authauthunix_marshalauthunix_validateauthunix_destroy_authunix_create_xdr_authunix_parms_xdr_arrayIIHIIIrejectedaccepted_seterr_reply_xdr_callhdr_xdr_replymsg_xdr_rejected_reply_xdr_accepted_reply_xdr_des_block_xdr_opaque_auth_strtok_rSHTTSSSSSSSSSSSSSrTSSSSSSSTip6_parsenumeric_fileno)&_gethtentgetanswerres_queryNres_querydomainNres_searchN_yphostentip6_str2scopeidget_canonnameget_aistr2numberget_portaddrconfig_getaddrinfo_freeaddrinfogethostby*.getanswer: asked for "%s", got "%s"_getservbyname_r_MD5Final_MD5Update_MD5Init @_vasprintf_l_freeifaddrs"_getifaddrsNBCDB atoiGGGGZ9O.D__dn_count_labels d'@Bʚ; ^   ]i] G! +"\"y"   V)(( f# 6$   %                                           i                                                                                                                                                     T&#addnamecharstr__ns_sprintrrf0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_skiprr__b64_pton__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_inet_nsap_ntoa_inet_nsap_addr__ns_format_ttl[$[$[$[$[$[$[$[$[[[[[[$[$[$[$[$[$[$[$[$[$[$[$[$[$[$[$[$[$[[$[$[$[$[$[$[$[$[$[$[f$[f4ؗҜ<3#I9=D2[%Cod(hz#{zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_find_sl_add‚ւ|‚5_strsep_int_strtoul_l_int__strtoll_lfgetsrewind_yp_gethtbyname_yp_hostent_yp_gethtbyaddr_dns_gethtbyaddrgetanswer_dns_gethtbynamegethostbyaddr_rmap_v4v6_addressmap_v4v6_hostentgethostbyname_internalgethostbyname_rgethostby*.getanswer: asked for "%s", got "%s"0123456789ABCDEF0123456789abcdefinet_pton6inet_pton4_inet_ptoninet_ntop6inet_ntop4_inet_ntop_fseekoisescaped_fparseln__fgetstr_xdr_u_longlong_t_xdr_longlong_t_xdr_u_hyper_xdr_hyper_xdr_u_int64_t_xdr_int64_t_xdr_wrapstring_xdr_string_xdr_union_xdr_netobj_xdr_bytes_xdr_opaque_xdr_enum_xdr_bool_xdr_u_char_xdr_char_xdr_u_int16_t_xdr_int16_t_xdr_u_short_xdr_short_xdr_u_int32_t_xdr_int32_t_xdr_u_long_xdr_long_xdr_u_int_xdr_int__dn_skipnamedn_find__ns_name_unpack2  0123456789_int_strtol_l_vsprintf_l__getdelim_nsdispatch_nsdbtput_nsdbtdump_nsdbtaddsrcc9)))))5)1))1))))))))))))))))88/i/+7 *6.-)))?-)'-)) /.9/, *,+J87))))P9) 9~+7A21) *~+)710>0/3)Q3)C32Q544R4335%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn/usr/share/zoneinfo/-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf͟͟͟͟͟͟͟͟͟gbƢ  llǤIˢ ננ]]]]]]נ ?^} T-¿Ͻiyqn¿ϽTI:A__sprint__sbprintf0123456789ABCDEF0123456789abcdef__vfprintf_unlocked_lC3Te^Wl@ÿ?__fpclassifylQ_strndup_strdup_gethostname[DCCCCCCCCwDwDwDwDwDCCCCCCCCCCCCCCCCCCwDCCCCCCCCCCPCP !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZ2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq@bBCBlBCB{BCeHVHGH8H4D%D]BDDCHtHDDpDaDCvC>EA/EDDDDDDD2G#GFFFCRDCDCCAA@!C:FEEMEGKGAG'AAG;A'A A A@@@@@@@@@@@@@EAA@A@@@@@1A@@@@@@@@@@@@@@@@@@@@@@@@@OAA_getpagesizeqsort_r__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sclose__sseek__swrite__sread_int__strtoimax_lCtolower_ltolowertoupper_ltoupperisxdigit_lisxdigitisupper_lisupperisspace_lisspaceispunct_lispunctisprint_lisprintislower_lislowerisgraph_lisgraphisdigit_lisdigitiscntrl_liscntrlisblank_lisblankisalpha_lisalphaisalnum_lisalnumc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtocs_citrus_NONE_stdenc_mbtowcʭGGGGGGGGGGGGGGGGGGGGGGGGGGGGG?GGGGGGGGGrdl_iterate_phdr_setupzzܹzzzzzzzqz]zzzzzzzzzzzzzzzzzzzzzzzzz+zzwzzzzzzzzzz ݵzzzLݵczJzvezhTzzvz@0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nopt_rdata__res_nmkquery/&_hf_gethtbyaddr_hf_gethtbyname2_hf_gethtbynamek##$#"$J$g$!$$#!4$_nsaddsrctomap]:[=              .D-D-D-////--. .--..;<;53210/-,+*)('&%$#"!  ::::::::::::::::::::::::   9876543210/.-,+*)('&%$#"! :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::DEAE216+-.99+&%/ /E!()*!!# E          clearerrh@Y@h@@h@h@?8Ah@ ANEXTINDEX__rec_dleafNEXTINDEX__free_ovflpage__get_page__add_ovflpagesqueeze_keyputpairugly_split__split_page__delpair__big_split__big_delete__big_insert^i**{^***^NEXTINDEXo!Mo!n!n!6h!&h!g!"%G#.% 3% Z" < (# xl$ # " ,R6$ h]6" fC" $ 5% X6$ ?" % # % L+$ *" # L.# \*%  i" r" # ly% 0o" % " :% >% B%F% <% xJ% $ N%# ׈%% ,%,҈% h܈%hR% V%Z% ^%b% f%o% Xj%Xi!" Xn% XO % s% x% |% % %% %% %% % L<% .% % Y" % % \%  %  % % %  ň%  Ɉ%  ͈% # ш% ֈ%ۈ%% % %%% % 0% 0%0VY$ 0%%`%,"% $%# # $ +% }" /% " 5% " :% " (" " ?% " E% "  K%  "  >%  "  )%  "  0%  7%% ;%A%NK%`'6%!#<!#%v" O%  %P%Y%_%e%i%n%s%z% % % % % %%%%%%X%ĉ%Ή%Չ%W%ډ%%%$%)#%G"$%## %%H%<#$%%#%# %%9"%%$'W#ԕ'9%'%ę'%X'%0'UZ## #ɱ ɱɱ ɱ ɱ ɱ%М%5!#ۜ%gx$%%%%5!#( (`(` ((MFEgntsDFE #W%W%X=VrbmnTSSLSS#|xOx yekdvtcidhz[xww9%W%W%%/##(%atad'ey#loob0¢3((((yaraX{ܦ"$#(%%%%%%ڡ%%% %$%2"0%<%Y%d%%% %% â%͢% %% %ı% %8'"%,%B%8'M%8'X%c%5!#9'#l"=s"Gs"Qs"Zs"as"ps"ws"}s"%s"s"f"s"ll"s"s"s"$s"s"k"A#s"s"s"s"s"s"s"s"s"t"%.v"2v"7v"Jk"?v"Dv"Jv"Pv"Vv"]v"s"dv"hv"$&#s"s"A#nv""tv"#{%%%%H&(S%%%%H&(M%<%a<%UT$i%V%[%`%d%h%m%q%v%z%<%x<%%ґ#%%%%% ("%%%%%?^"<%<%%%%Ī%Ȫ%̪%Ъ%Ԫ%ت%ܪ%%%%%%%%%% %%%% %%%*%/%4%9%>%C%H%M%M%T%^%c%w%%%%%%ī%׫%%%"%%'%1%;%H%\%q%~%%%Ŭ%ݬ%%%%1%D%W%j%}%%%%ɭ%ܭ%%%%*%>%R%f%z%%%%ʮ%ޮ%%%%.%B%V%j%~%%8.(2@P@aa9ba`````Laa9ba`````ydb'5")\%r$A#%v%TKs%E'E'%$F'"%:%PF'tF'F'T%F'n%%%{%r$#%)\%'5")\%'5")\%'5"<(<(<(<(%%%X%%% %%*%%1%%9%B%U%]%j%r% %% %% 5!#5!#%%ɶ%ж%ض%%P"$"$%%%%#%)%8%<%$O%W%Z% l%o% y%% {%xH' %% %%[%%%%з%~$%Է%%%%%%%["e%!%&%3%%%%/%9%<%?%S%H'X%%J#d"]%H'a%H' e%I'!l%p%"%%#%%$z%%%%%&P"%'ܸ%%)%o#*%%+̲#%,%%-*%3%.=%C%/I%N%0S%Z%1b% I'2h%n%3t%%7%%c%%ǹ%m/"̹%ѹ%%%%% %%)%HI'/%5%#%M%$z%b%%%%&o%r%'ܸ%U%(%%)%%%%%%غ%ݺ%%%%%Q^$"%%.%:%>%T%W%f%j%%%"%%%ǻ%λ%%ٻ%%λ%%Q"%m"%%f$r$#%%%r$r$%%r$-C^a(^a(^a(^a(^a(^a(^a( '----%%%%%%%%%%%%%%%%%%% %%%%%%#%'%/%8%>%%D%I%N%U%_%g%p%q$y%|%r%`%%H%5!#5!#5!#5!#5!#5!#5!#5!#5!#%%3#L"%%%%%%)%?%V%h%|%%A"%%%%%%T'%%&%7%U%T'i%x%%%%%%T'%U'% %8U''%D%XU'U%s%%%%xU'%U'%%U'U'%1%K%g%V'4V'%%XV'%%%%%% %!%|V'7%I%[%o%%%%V'%%%%V'!%7%E%X%o%%%%%%%%%%"XT%*؍#*y#&%q#(c #Qr$s; #%0%r$: #%%/^a(^a(^a(H%5!#5!#5!#5!#5!#5!#5!#5!#5!#%$-$-(" d-HD$@"@"@"A"(A"NA"\A"mA"A"A"A"A"OaWL"`L"{L"L"L"%G"5!#G"5!#L"5!# L"L"QI"5!#2%5!#L"L"ˌNL"L"AL"L"_!-b"b"  !ޚ"..##5$y$`$b"5!#b"h"m" "m"J"x"U#"p"""""'%5!#%"5!#b"5!#-")%<$!"5!#"5!#@w%5!#%5!#"5!#eG"5!#L"" "5!#x""%"5!#20""L;"F"!&"%%v"}""""""""""".- (prog_root)`,-  * . ` d f o 04?4sz `--z_##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|@1-  ( ( ) ) 1-boK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ"""""""U%"U%"%"-"%"8"%"?"%"K"%"R"%"]"h"o"%"v"%""%""%""""""""""%""%""%""%""%""%""%""%"'"%"/"%";"$B"L"S"["d"k"r"k"y"""""#""""""""U%""."%""h"&""R""}"""""k"""""*""F"f"n"#"$"""""""L""["[" ?- ?- ?- ?-8?-8?-8?-8?-P?-P?-P?-P?-""    l h b  w  i x X       0  $  k  j [< e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ"""" is not a regular file (use -f to see it) is a directoryB-B- (###e$$ )### #{%f#&"###1<% # # ###$ ##'##3#?#"K#>)%B$V#c#$r#;}# #7# # # ###2#8# ## #(# ##!"#+#9=#G##Q#&{%f\#)h#r#5{#e#:##%##60##4## #+#,#-#.#*##?$+#EH#2#/>#/L#'X#F%e# WmkRkRkYcWbkCkc kG ky wb YMYrWcaS-.Z #{ # #bS-@T.I # #BS-X. #% #cxS-.P #{ #{ #dpS-t. # #pS-A. # #DhS-(J #e`S-|. #+ #? #fXS-L._ #w #FPS-x. # #gHS-. ##+#h@S-h.]#v#i8S-`. J###j0S-2E##J(S-!$.#2#k S-H>GS-HtGKS-.J#o#LS- .##mS-.###nR-"\.###oR-C2#OR-D=#pR-HHPR--I#qR-.H#p##rR-"P.###sR-!p.G#_#SR-!@.|##tR-G#TR-QH#uR-.###VR-JwR-",. #,#]#xR-(rM##XxR-A8.##ypR-d.##zhR-H.'#<#"`R-MN[#~XR-!0.d##?PR-zO#HR-OF##@R-A4.##8R-.# #0R-./#Q#(R-.m## R-(N#R-.# #R-.O0#C#_#R-.O##R-.##Q-$.O##Q-$.$P5#K#Q-.k##Q-!.##Q-!._P##Q-!.##Q-(PJ#Q-!.Y#m#Q-.##Q-.##Q-Q #Q-.#D#Q-.e#y#Q-.##Q-P#Q-!<.##xQ-.$#S#pQ-.|###hQ-.##.#`Q-.?#v############&#5#G# 4$Y#e#o#y############### #D####!#+#%9#K#b$T#d#x##R-###############*#8#!#K##W#\#i##v# (press RETURN) .G& H&H&S-S-S-tags6431#[v"!#!#<<!$P<!#>!#Xt!#p!#ָ|"#$"#C7"#+7"#cV"#.g"#Og"#Ou"#"#s"#.?"##"#b#.#EE*#F"P&#c"a"l#s&#h&#. !"$'(+-.03569:>$A#n%%'#"#9"F%$#t...x...|.p.4.l.H.D.@.<.8.h./etc/phonesV)#"_)#d$h)#X.k)#$w)#<|)#a)#.)#a)#|.)#a.#"~)#a#D.!#9")#d)#T.%a:#\.)#ad.#% )#%)#F%$a)#8.5"a`.)#_$)##")##Q`Y-")#$%)#a'#l.)#O%)#d*#0.*#d*#,.*#d "(.(*#U%&#/*#3*#`#"a#h.=*##/bin/sha7#g7#@Z-Y- =#*=#A>#>#1># E>#[>#sm>#z>#A>#>#B>#>#>#?#C?#4?#I?#X?#mi?#u?#D?#E?#?#d?#?#r@#$@#g?@#FW@#r@#%@#M@#-@#R@#@#a A# A# 3A# MA#d#]-.. a-P ~pd#b{d#j!b#j$cV/"fd#hd#kd#ld#md#od#od#pd#pve#pd#q%r#%u+$t"vn(#we#wx"xxO$x99%zm!"ze#B0#C=$J&e#O0e#P?e#SFe#T$V%VQe#X`e#Z^e#Zie#pe#e#e#e# e#e# e# t!"e#e#e# e#=$e#e# e#(  R     ý a f  e#(< 6   9 7  ý a f 9 /dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin 0}-+?=###%%%}00#aƒ#ʃ#EVЃ#et"F؃#In(#i#L"l#m#C`%n#f##p#b#u$#("-#8#qw$sE#Q#h"v>#VVZ#x@=0g-g-d d#"=W T#P"X d#b#V[ #9$X #b#] ת#4"X # $mX #'+"OX  #"0#i"}W >#,"W ]#S% # ... ...####+####5!###5#5!#Y"#####6$$#T#b#6$##6$Y"#S#8#d#    آ&j#&$j-آ&x#n-\#&dj-&h%n-h%&U#n-U#A%    آ&? #n-#`&Dk-&# E$qB$&+$ l-qB$&1$k- o-&<$k-0o-&S$4l-@o-آ&]$&l-آ&% >$(#&l-آ& '#n-# &m-آ&z$ #n-"#`&Dm-`p-m-`m-آ&E$n-i"0m-آ&L$@n-i"0m-&b$n-qB$&x$n-n-&$Tn-n-&h$n-n-p-`p-p-n-l- m-r-`l- p-o-o-m-@n-`m-n-l-k-Po-Xo-`o-ho-po-&" #n-#& $n-###&D $n-#$#&V% $n-$#$آ&l$p-i"0p-&b2 $"&* $"&" $"&@! #$n-#$& 6$n-#&e' #n-#&$n- $& F$n- F$&& X%n- X%&?& -U%n- -U%AabCdhlNsuvW:w:zآ&$`&r-&6 $n-$&?6 $n-$&5 $n-$&7 $n- $&4 o$n-o$آ&1$@&s-&F$ t-F$&L M$n-M$آ&$&t-&V V$n-V$&aV ]$n- $$&\  $n- $&Z 2 $n-2 $&CZ $n- $&Y I%n-I%&Zo  $n-* $&o Q%n-* Q%&[b ' $n- ' $آ& $n-`&v-آ& $&v-آ&8 $n-+$ &w-q K$w $w $x $v $Nx ^$w $w i"Nu /%u $rw \#w $w $w $w  $w $w S% #  '@@ w"w"u#yG"%$%I#Z%"w")w" /w"6w" >w"Cw"]%@#%Ow"@Zw"...... ...... lost+founddA<:%J>$>$E$>$u%#$C$m% xJ" ʬ$ MC$ xO$ %P>$E$8$kC$^C$A%d#%K%Y>$O##X%f:$#b>$F$ k>$!r>$"y>$#:Q%$>$%>$&G"'>$(#)>$*d>$+>$,>$->$/>$1>$1>$2>$3>$4b$5E^$6U%P"kN$b# $b#L"9$rN$4"3X$X$X$X$ Y$oR$#Y$Y$$&lr%&&Y$&t%&HUU%&bT#&`kN$&=T.Y$&it#&v%&ae2Y$&5| "&r#&,t#&v)%&jd#&f%&h)#&,t$&`7Y$&y$&hY$&hve#&Hd="&b#&bE^$&>uY$&HUfY$&ro0#&itY$& r$&|P%&Y$&\vO$&V\Y$&t%&Ehb"&<%&|Y$&sY$&pY$&Y$&1zc$&HUY$&|b$&>Y$&Yr#&wW$&H#&_"&UY$&z`$&v}rN$&TZ$&|[#&0ap%& S#&s#& Z$&y$&n"&ZbW$&"&@$! %"/$%&Y$q$ jY${$5!#{}abcdDgGhHilnNpPqrs tw xy !:#=(4,4,$$Æ$Ɇ$φ$ֆ$~~~~+0LguX9ùunJ7yB{Uzh|{";~$N~#a~O#t~l%~$~y$}$}$}$~$~$(~e$}o$}?$W}G$j}O$}}X$}] /t_nopړqu߈elm?noӉp qrosx}1}yE}<=И>? $|$|'$ }$ Ēy|SŁmRn|T|ۆ$p|$| $| $7|$J|'$]|$C$֌i$$!D)z_1uŚjOkb˂Hc<#%|l%'| )|-ΗŃtY7`cC͙эЎzfR>{{{{u{K* {4{&'(|)lŏY%@4(֏<%5z]%Oz{%izt%zh%z`%zX%z%zK-`- -ș% -5!#-{5!#`-ӛ5!# @-F{(-S{}-{ - -5!#F -,5!#F-j  `-  --5!#F-oŅ5!#F@-s5!#F-G5!#F`-$  -# -$ -5!#F -L_q5!#F @-NO$ -; --5!#2$-$5!#2$-$5!#2$`-$5!#  -5!# -5!# -5!# `-5!# -x-w-u5!#F@-5!#F-w5!#F-?  -L (-M5!#-5!# -$$)$""%8$#"!D%$=$@$D$N$l$V$i$q$$9$&$@$Y$y$׏$$$$$~^"^" $R"O%$!$$$$W$<$Ȕ$$,$9$#[+"F$e$x$$$$Ж$$$0$n$ؗ$J$$$$&"$$#$$$$O!" % $-"$ $8$H$T$$Κ$ߚ$9$f$$$$$$X$$,$N$@$$$$Ƥ$$$v"$F$ۧ$s$$ $.$=$$$$6$$}$ޫ$ $$b$r$$$$$Ŭ$Ҭ$$ $$ѭ$$$Ʈ$$($_$t$$ɯ$N$J$`$ɱ$-$$$>$$A$($$Ŷ$>$[$η$$$9$$~$¹$!$&$J$n$$$$$غ$$$$$%$3$I$R$g$y$$$$$Ļ$ѻ$߻$$$$$3$E$_${$$4$r$$Ľ$$$$$$$t$ $$ $$$$$$$}#$$$$6$J$f$$$$$$$$ $$"$4$E$W$g$r$$$$$$$G$Q$J$[$#e$r$v${$$$$$$$$$$%$9$;$F$U$j$$$$$$$$$Y$$$$ $$#$8$9K$D$P$d$k$$$$$$$$$$$$$j$7$c$$$$$QN%E$$4"'#$$$$#$8$_$$$$$$>$b$s$~$$$$$$$$$$$ $"$$$$Ƽ#$ $%$9$X$q$$$-$>$l"$$$$$$$P$l$q$$<#$$$$$$$%$9$M$%$p%w%#$#$$D$R$r$~$$$fY"$$$4#$$A8% $1$<$R$$/$$$$ $##5$:$M$Z$`$$$d$q$b# $b#$l$$$O#$p##$7%,$$G$T$`$o$$$$$ $$8$L$}$""$5!#$$W$$4$>$S$d$y$$$$$$$4$$$$$$$$$$$ $$&$$6$$$$$$$:$u$b$$[$$zP%Y" %$$%$$E$n$$$$$$#.$P$`$v$$$$$$$$$$$$0$=$E$4%O$Y$b$s$$$$$$+"$$*$0$7$B$"."I$S$d$t$$$$$$$$$ $$$#+$5$J$[$m$[$$$$$$$$$$$$$*$>$J$T$Y$^$p$$$$$$$Y$#+$$$$$$/$G$X$`$k$$$$$$$$$$$$$#$4$B$M$Z$-#f$s$$$$$$$$=$u$&$s$$$$$$$$$Y$$%%%(%:%z%~%%%ȟ%%%#%u/%g#%%%%%% ftp.%@%ݭ#6% $A%I%%@p$ $V%a%p%|%H$%$" %%%%b%%]$%%~$0%%% %%10%&#'%(%)%*)%+%.1/h%N6>#e?7@mQA %%hB%%hC%%hD $0E %%hF s"hG #hH i$hI5!#v5!#5!#1u1eu%=*%(*%7*%D*%R*%`*%n*%}*%*%*%*%*%*%]Lz\?]y\>LF%W%dA.U H%5!#5!#5!#5!#5!#5!#5!#5!#5!#C%%%%%%W%1^" %%#u% # t|# # % % $% '% % 1% A%Lk"7T$D%H%L%P%_%T%X%"a""\%"`%s"d%F;#h%"l%I"$ p%!%"%#%$%%%&%'ʅ%(ۅ%)%*%+%,%- %-%.!%.~$/%/u#0$1+%2/%35%4:%5("6?%7E%8K%9T%:P%;Z%<i%=u%>%?%@%[~$\%\dž%]܆%^%^%_%_ %`%{%%{8%|F%}R%}#~f%  -dd-ddTdd:dd:dd%+% /% /*#@;%@E*#G%M%S%7$Y%x# $ e% m%@u%@aO$@%@%@%@%`%`%%%#NJ%͊% Ҋ%@֊%ۊ%%G %"#%#%#%#%#%$ %$%$%$%$#%%+%%3%%%%?%%E%&M%&W%&]%'h%'r%'x%(%(%(%)%)%)%*%*ŋ%*ˋ%+֋%+%+%,%, %,%,%-%-$%-%-%.'%.2%.9%/E%/P%/W%6c%;q%;}%0%0%0%1%1%<%<%=Ɍ%=Ԍ%>ˌ%>ތ%?Z$2%2%2%3%3 %3%9%7(%87%:K%4U%4`%4g%5s%5~% %! A%" %# %$ %% %& %' ΍%( ڍ%) %* %. %+  %, %- %/ (%0 5%1 @%2 K%3 X%4 c%5 n%6 x%7 %8 %9 %: %; %< %= ˎ%> Վ%? ߎ% @%!@%"@%#@%$@%%@%&@*%'@4%)@?%*@J%+@V%&`a%'`n%,@{%-@%.@%/@%0@%(`%1@ȏ%2@Տ%3@%)`%4@%5@%6@%7@"%8@0%9@=%:@J%*`W%;@d%<@q%=@~%>@%?@% `%!`%+`%,`̐%"`ِ%#`%-`%$`%.` %/`%%`)%C7%CA%DF%DQ%EW%Ea%Ff%Fq%cw%c%d%d%e%e%#%#%&%&‘%0ё%ߑ%%%%%%%%% %%%%%%,%3%:%E%P%[%h%u%t% x% W%@%@M%`%%%ۊ%%%%%%%%%c( %333333335!#5!#.%J%W%p%8'3333yG"#u#H$T%h"S%UTC3333--vN}33@89㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž33 ---- - 33UU33UU33UU - -7 -w37-x-w37@- -w37-%%%%%ǻ%ǭ%ڭ%%[v"%'%;%O%%%x   @ Bm333333333333333333333333333333333333 3333 D- O( O(0000000000000000 @83333P333333---33 (root)`-C^a(^a(^a(^a(^a(^a(^a( '-----b(d(f(h(-'HKpI/A} DService unavailable" %H%@л6x!oAٻ8R@K`  [BH\4( K %oSyIRҜ)oX +_<ѕ2n]ԅȻm}>s+(G?ˍOd7d {,ur7[R:8_~<Ȟ1<\ya^O"gw<߯ӈݢ"/ww&üWl^fϽH_wl:˽Z3+Vkm2M򬆽}Zpu~[bqPiǢf?eWK[XZONo_}wͮ~{vEQj1 Duw Z(;+u`YI++h`yX%|s8D5t`.ܸP$pc AmmRfW%iLQpFs߉ D49gW:}^x5nbRAk3QV;eE#X\UBm*dTv d~.shstrtab.note.netbsd.ident.note.netbsd.pax.init.text.fini.rodata.tbss.init_array.ctors.dtors.jcr.data.rel.ro.got.got.plt.data.bss.SUNW_ctf ,,/ 5;" A "z\ I,#O,# [ , #b,#i,#n , # {-$ -$  - $  -$ / $$MSGTXTS656 5264 5289 5306 5328 5331 5336 5344 5351 5359 5367 5370 5373 5376 5380 5392 5401 5414 5443 5458 6003 6037 6720 7008 7716 7772 7846 7942 8117 8140 8163 8169 8178 8200 8204 8208 8211 8214 8319 8522 8761 9202 9640 9675 9690 9702 9708 9720 9769 9789 9829 9846 9863 9878 9925 9963 10011 10093 10217 10353 10394 10432 10469 10504 10514 10563 10713 10719 10724 10728 10748 10858 10878 10884 10898 10910 10921 10958 10992 11016 11118 11155 11177 11276 11331 11389 11400 11416 11468 11636 11843 12014 12078 12130 12403 12954 13484 13917 14255 14588 14701 14716 14725 14885 15056 15206 15370 15393 15417 15432 15507 15647 15824 15979 15991 16071 16172 16218 16244 16314 16325 16334 16347 16373 16388 16404 16417 16472 16483 16498 16702 16935 16964 16979 17048 17122 17195 17225 17263 17317 17771 17797 17826 17930 18036 18221 18333 18448 18552 19239 19498 19638 19674 19844 19885 20021 20044 20081 20126 20377 20473 20527 20626 20637 20674 20711 20738 20747 20781 20788 20813 20840 20875 20889 20903 20932 20946 20963 20972 20994 21012 21029 21040 21059 21085 21103 21126 21143 21158 21173 21191 21218 21245 21267 21306 21324 21356 21584 21658 21701 21747 21894 22050 22094 22373 22400 22759 22943 23095 23276 23423 23581 23602 23650 23660 23668 23679 23690 23700 23707 23722 23734 23773 23803 23842 23895 23953 23974 23981 24000 24021 24028 24052 24074 24094 24116 24147 24184 24206 24220 24266 24295 24329 24369 24404 24432 24480 24489 24498 24503 24512 24521 24538 24542 24547 24553 24557 24595 24604 24631 24651 24674 24693 24720 24742 24774 24790 24795 24805 24828 24850 24867 24884 24897 24906 24915 24921 24948 24955 24979 25000 25024 25037 25056 25081 25104 25120 25126 25138 25168 25176 25216 25227 25238 25249 25266 25283 25297 25314 25530 25834 26282 26498 26762 27034 27086 27122 27158 27209 27226 27264 27278 27285 27302 27305 27310 27319 27331 27342 27351 27372 27414 27452 27468 27499 27524 27559 27615 27655 27676 27696 27737 27766 27814 28047 28082 28289 28308 28345 28406 28444 28483 28639 28654 28700 28748 28771 28807 28817 28827 28838 28843 28906 28954 28998 29059 29092 29193 29211 29350 29372 29495 29509 29519 29542 29647 29703 29819 29850 29855 29881 29920 29930 29973 29983 29999 30014 30032 30055 30085 30106 30132 30329 30372 30376 30382 30388 30393 30404 30418 30447 30479 30491 30538 30588 30628 30655 30671 30680 30723 30729 30737 30741 30761 30778 30790 30821 31077 31126 31702 31729 31761 31789 31841 31847 31853 31858 31879 31895 31917 31946 32087 32221 32234 32370 32372 32374 32376 32393 32406 32424 32451 32455 32461 32466 32474 32480 32520 32522 32532 32547 32564 32598 32630 32668 32697 32726 32748 32791 32817 32861 32997 32999 33001 33016 33019 33068 33342 33355 33393 33405 33428 33441 33466 33491 33516 33541 33576 33607 33646 33701 33808 33837 33868 33898 33935 33991 34106 34142 34566 34589 34859 35165 35475 35691 35802 35901 35918 35941 35945 35952 35961 36083 36152 36440 36578 36719 36800 36847 36853 36862 36875 36898 36944 36947 36992 37035 37100 37162 37232 37300 37393 37612 37637 37641 37677 37695 37723 37765 37809 37873 37923 37999 38021 38073 38117 38156 38190 38220 38251 38276 38285 38297 38305 38316 38328 38347 38371 38420 38437 38461 38504 38826 38829 38843 38856 38868 38875 38886 38893 38900 38909 38919 38936 38952 39002 39010 39018 39028 39039 39057 39074 39095 39117 39126 39136 39163 39169 39179 39198 39214 39232 39252 39261 39272 39279 39296 39315 39336 39346 39363 39369 39385 39400 39415 39436 39458 39477 39487 39492 39497 39515 39534 39553 39559 39578 39598 39618 39636 39641 39647 39664 39680 39701 39714 39722 39742 39766 39783 39791 39802 39823 39829 39841 39863 39877 39886 39907 39925 39934 39968 39991 40018 40050 40073 40093 40104 40136 40152 40163 40176 40199 40221 40729 40759 40790 40818 40832 41033 41255 41422 41509 41526 41544 41561 41590 41637 41648 41667 41689 41768 41960 41988 42106 42128 42269 42288 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_BETA. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_BETA ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_BETA ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_BETA InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_BETA ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? TastaturschemadeInstalliere die Tabelle der defekten Blcke ... Mchten Sie normale oder serielle Bootblcke installieren? Normale Bootblcke benutzen die BIOS Konsolenschnittstelle als Konsole (meistens der Monitor und die Tastatur). Serielle Bootblcke benutzen den gewhlten seriellen Anschluss als Konsole. Selektierter Bootblock: BIOS KonsoleSerielle Konsole an com%d mit %d baudUnverndertAuswahl der BootblckeBIOS KonsoleSerielle Konsole an com0Serielle Konsole an com1Serielle Konsole an com2Serielle Konsole an com3Serielle Geschwindigkeit whlen...Vorhandene Bootblcke benutzenInstalliere die Bootblcke auf %s ... Diese Festplatte entspricht der folgenden BIOS Disk: BIOS # Zylinder Kpfe Sektoren Anzahl Sektoren GB ------ -------- ----- -------- --------------- ---- %#6x %8d %5d %8d %13u %3u Das ist die korrekte Geometriedie Geometrie von Hand setzenBenutzen Sie eine dieser FestplattenDiese Festplatte entspricht den folgenden BIOS Disks: BIOS # Zylinder Kpfe Sektoren Anzahl Sektoren GB ------ -------- ----- -------- ---------------- ---- %-1d: %#6x %8d %5d %8d %13u %3u Achtung: sysinst hat festgestellt, dass die von Ihnen ausgewhlte Festplatte einer anderen - dem BIOS bekannten - entspricht; damit sind obige Werte mit hchster Wahrscheinlichkeit korrekt, sollten also nicht verndert werden (die Werte fr Zylinder, Kpfe und Sektoren sind wahrscheinlich 1023, 255 und 63 - dies ist korrekt). Sie sollten nur die Geometrie abndern falls Sie wissen, dass das BIOS falsche Werte liefert. Festplatte auswhlen: Der NetBSD Teil der Festplatte liegt auerhalb der vom BIOS dieser Maschine adressierbaren Bereich. Eventuell knnen Sie von dieser Partition nicht booten. Sind Sie sicher, dass Sie fortfahren mchten? (Antworten Sie mit 'nein' um die Partitionen erneut zu editieren.)Sie haben mehr als ein Betriebssystem auf dieser Festplatte; allerdings ist kein 'bootmenu' (Eintrag fr den NetBSD Bootloader) fr die aktive Partition und/oder der Partition vorhanden, auf die NetBSD installiert werden soll. Wollen Sie die Partition zum Hinzufgen eines 'bootmenu' Eintrages editieren?Sie haben eine erweiterte Partition in das 'bootmenu' eingetragen. Doch scheint Ihr BIOS System den 'read' (Lese-) Befehl fr diese Version des 'bootmenu' Codes nicht zu untersttzen. Sind Sie sicher, dass Sie dennoch fortfahren mchten? (Antworten Sie 'nein' um zum Partitionierungsmen zurck zu gelangen.)Ihre Konfiguration bentigt den NetBSD Bootselect (Bootauswahl) Code, um das zu startende Betriebssystem beim Start des Computers zu whlen. Dieser ist gegenwrtig noch nicht installiert; wollen Sie dies jetzt tun?Der Bootcode im Master Boot Record scheint nicht gltig zu sein. Wollen Sie den NetBSD Bootcode installieren?Wollen Sie den Bootcode im Master Boot Record auf die letzte Version des NetBSD Bootcodes updaten?Kernel (GENERIC)Kernel (GENERIC_KASLR)TypOrdnerBootmenSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivBootmenStandardbootPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition, (S)tandardauswahl$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. cat chgrp chio chmod cp dd df ed ln ls mkdir mt mv pax pwd rcmd rm sh stty sync . ..MAKEDEVMSGTXTS656 5264 5302 5319 5334 5337 5340 5345 5353 5361 5369 5372 5375 5384 5396 5408 5417 5426 5452 5463 6000 6027 6593 6893 7534 7581 7694 7787 7821 7840 7858 7866 7875 7900 7904 7908 7911 7914 8036 8221 8449 8969 9320 9349 9362 9375 9380 9400 9419 9440 9499 9516 9530 9552 9597 9623 9664 9742 9860 9974 10028 10057 10089 10128 10134 10167 10290 10297 10301 10309 10333 10415 10421 10428 10440 10454 10463 10496 10515 10527 10637 10699 10718 10837 10888 10940 10952 10971 11023 11227 11435 11626 11686 11735 12003 12463 13130 13554 13876 14301 14433 14465 14477 14655 14852 15013 15147 15167 15200 15214 15283 15396 15568 15703 15723 15835 15927 15950 15973 16032 16047 16068 16083 16104 16124 16149 16163 16187 16199 16217 16427 16677 16698 16714 16767 16835 16908 16945 16971 17047 17542 17568 17590 17697 17804 18005 18078 18162 18262 18757 18995 19146 19180 19315 19359 19498 19539 19584 19631 19875 20008 20070 20164 20169 20203 20237 20252 20280 20313 20320 20345 20363 20389 20396 20411 20426 20446 20486 20503 20523 20544 20566 20581 20601 20623 20638 20651 20665 20677 20689 20703 20726 20749 20767 20810 20861 20898 21083 21146 21182 21231 21322 21452 21505 21765 21812 22173 22323 22492 22632 22752 22884 22924 22971 22981 22989 22999 23007 23018 23029 23043 23068 23111 23144 23177 23212 23266 23291 23310 23332 23337 23343 23374 23391 23418 23436 23457 23479 23498 23508 23538 23564 23591 23640 23668 23695 23748 23758 23768 23774 23784 23793 23813 23817 23822 23828 23832 23867 23876 23907 23924 23951 23972 23992 24011 24037 24050 24058 24074 24105 24136 24157 24183 24196 24204 24215 24221 24245 24255 24267 24285 24296 24316 24332 24358 24380 24396 24408 24428 24454 24460 24490 24504 24518 24541 24560 24579 24597 24615 24838 25144 25562 25763 26003 26187 26265 26320 26387 26427 26450 26484 26495 26503 26526 26529 26532 26538 26549 26561 26574 26604 26648 26661 26674 26711 26725 26736 26747 26758 26775 26786 26833 26856 26905 27146 27179 27434 27455 27488 27541 27567 27594 27750 27756 27799 27819 27838 27867 27874 27881 27888 27893 27942 27980 28014 28071 28099 28144 28161 28262 28267 28344 28358 28368 28392 28515 28596 28706 28734 28739 28755 28784 28792 28833 28840 28854 28867 28875 28894 28927 28947 28967 29183 29214 29219 29226 29233 29237 29251 29263 29278 29311 29324 29379 29437 29473 29491 29509 29527 29564 29570 29578 29582 29603 29620 29631 29653 29831 29875 30577 30601 30635 30654 30699 30706 30713 30717 30741 30752 30757 30820 30941 31064 31077 31211 31213 31215 31217 31227 31236 31249 31276 31280 31286 31291 31300 31305 31332 31334 31347 31359 31374 31402 31446 31493 31509 31531 31542 31575 31595 31644 31744 31746 31748 31764 31767 31809 32078 32091 32124 32136 32160 32178 32201 32224 32247 32270 32291 32317 32359 32413 32516 32543 32573 32598 32623 32680 32789 32822 33195 33210 33450 33701 34014 34168 34286 34406 34423 34446 34451 34457 34466 34575 34634 34885 35026 35153 35221 35258 35265 35274 35282 35309 35355 35358 35405 35450 35501 35560 35629 35676 35781 35924 35949 35953 35987 36004 36028 36080 36131 36203 36269 36367 36384 36415 36451 36485 36509 36533 36566 36586 36596 36604 36612 36622 36633 36647 36673 36721 36744 36764 36805 37104 37107 37121 37133 37140 37159 37173 37180 37187 37196 37206 37223 37239 37287 37295 37303 37313 37324 37342 37359 37378 37398 37405 37422 37439 37446 37459 37494 37511 37530 37550 37560 37576 37589 37607 37627 37648 37658 37678 37698 37711 37730 37743 37767 37790 37803 37814 37819 37826 37844 37863 37882 37890 37909 37929 37954 37972 37979 37986 37999 38008 38029 38042 38050 38070 38098 38115 38121 38132 38163 38171 38184 38206 38228 38237 38258 38276 38283 38306 38325 38352 38370 38390 38403 38418 38439 38453 38460 38474 38489 38508 39053 39086 39114 39143 39151 39188 39500 39677 39754 39771 39789 39804 39826 39876 39886 39903 39925 39984 40142 40166 40296 40321 40447 40465 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_BETA. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_BETA ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_BETA ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_BETA completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_BETA. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_BETASalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_BETAEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Tipo de tecladoesInstalando la tabla de bloques malos ... Le gustaria instalar el set normal de bootblocks o bootblocks por serie? Bootblocks normal usa el dispositivo de consola de BIOS como consola (normalmente el monitor y teclado). Bootblocks por serie usa el primer puerto serie como consola. Bootblock seleccionado: Consola BIOSPuerto serie en com%D en %d baudSin cambiosSeleccion de bootblocksUsar consola BIOSUsar puerto serie com0Usar puerto serie com1Usar puerto serie com2Usar puerto serie com3Baudios puerto serieUsar bootblocks existenteInstalando bloques de arranque en %s.... Este disco coincide con el siguiente disco de BIOS: BIOS # cilindros cabez sectors sect. totales GB ------ --------- ----- ------- ------------- ---- %#6x %9d %5d %7d %13u %3u Esta es la geometra correctaAjustar geometra a manoUsar uno de estos discosEste disco coincide con los siguientes discos de BIOS: BIOS # cilindros cabez sectors sect totales GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Nota: como sysinst es capaz de concordar unicamente el disco que escoja con un disco conocido por BIOS, los valores anteriores son probablemente correctos, y no deberan ser cambiados (los valores para cilindros, cabezales y sectores son probablemente 1023, 255 y 63 - esto es correcto). Solo debera cambiar la geometra si sabe que su BIOS reporta valores incorrectos. Escoja disco: La parte NetBSD del disco est fuera del rango que la BIOS de su maquina puede acceder. Puede que no sea posible iniciar desde ahi. Est seguro de que quiere hacer eso? (Seleccionando 'no' le devolver al men de edicion de particiones.)Tiene mas de un sistema operativo en el disco, pero no ha especificado un 'menu de arranque' para la particin activa o la particin de NetBSD en la que lo va a instalar. Quiere re-editar la particin para aadir una entrada en el menu de arranque?Ha pedido que una particin extendida sea incluida en el men de arranque. Sin embargo la BIOS de su sistema no parece soportar el comando de lectura usado por esa versin del cdigo del menu de arranque. Est seguro de que quiere hacer eso? (Seleccionando 'no' le devolver al men de edicin de particiones.)Su configuracin requiere el cdigo de bootselect de NetBSD para seleccionar que sistema usar. Actualmente no est instalado, lo quiere instalar ahora?El cdigo de arranque del Master Boot Record no parece ser vlido. Quiere instalar el cdigo de arranque de NetBSD?Quiere actualizar el cdigo de arranque en el Master Boot Record a la ultima versin del cdigo de arranque de NetBSD?Ncleo (GENERIC)Kernel (GENERIC_KASLR)TipoMountBootmenuNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activabootmenupredef.Tipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctiva, bootselect (p)redefinidoConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS656 5264 5300 5317 5332 5336 5340 5345 5356 5362 5368 5371 5374 5377 5381 5393 5405 5415 5445 5457 5888 5915 6491 6851 7536 7597 7675 7770 7810 7832 7850 7856 7865 7891 7895 7899 7902 7905 8027 8212 8440 8969 9387 9416 9429 9442 9449 9469 9488 9511 9554 9574 9593 9616 9660 9689 9730 9796 9908 10022 10076 10105 10137 10176 10182 10215 10293 10299 10303 10308 10349 10486 10496 10504 10523 10537 10546 10578 10619 10632 10757 10815 10834 10953 11009 11061 11072 11088 11127 11377 11549 11721 11776 11811 12062 12467 12767 13036 13397 13577 13896 13916 13929 14118 14262 14458 14592 14612 14645 14664 14765 14920 15108 15295 15315 15394 15492 15530 15553 15643 15664 15687 15706 15730 15760 15804 15837 15860 15872 15890 16158 16477 16508 16543 16607 16682 16752 16783 16813 16905 17396 17426 17443 17583 17724 17921 18040 18187 18354 18912 19208 19389 19434 19597 19651 19786 19822 19882 19932 20223 20332 20389 20486 20491 20526 20561 20576 20600 20633 20638 20663 20679 20702 20709 20726 20741 20760 20792 20796 20816 20834 20846 20859 20877 20901 20919 20938 20965 20992 21004 21025 21055 21085 21110 21143 21178 21216 21469 21538 21593 21654 21772 21931 21985 22246 22297 22673 22828 22972 23112 23220 23405 23435 23478 23488 23496 23506 23518 23539 23548 23554 23586 23628 23664 23702 23739 23787 23811 23823 23837 23845 23853 23882 23899 23928 23949 23972 23981 24000 24012 24056 24094 24121 24165 24193 24220 24273 24284 24295 24302 24312 24321 24355 24359 24364 24370 24374 24409 24419 24449 24472 24501 24523 24545 24567 24594 24606 24618 24637 24671 24704 24725 24749 24762 24774 24787 24793 24819 24829 24840 24864 24874 24894 24914 24931 24957 24981 24994 25014 25048 25055 25084 25107 25130 25146 25161 25176 25191 25205 25393 25698 26129 26320 26555 26743 26785 26835 26889 26937 26959 27000 27011 27019 27043 27047 27051 27060 27071 27082 27097 27128 27174 27187 27200 27230 27244 27256 27268 27280 27298 27321 27366 27389 27449 27701 27728 27990 28008 28035 28084 28114 28145 28277 28284 28333 28356 28380 28409 28417 28427 28435 28440 28493 28542 28582 28648 28681 28725 28748 28849 28854 28931 28945 28955 28979 29102 29183 29293 29321 29326 29342 29371 29379 29420 29428 29442 29455 29463 29482 29515 29535 29555 29771 29802 29822 29828 29835 29839 29854 29873 29899 29908 29920 29974 30032 30067 30086 30103 30115 30150 30156 30164 30168 30189 30206 30217 30242 30420 30474 31165 31184 31219 31249 31295 31301 31308 31312 31336 31352 31358 31433 31583 31702 31715 31783 31785 31787 31789 31799 31812 31829 31856 31860 31866 31871 31880 31885 31912 31914 31927 31939 31954 31982 32026 32073 32089 32111 32122 32155 32175 32224 32324 32326 32328 32344 32347 32398 32720 32736 32767 32787 32823 32840 32856 32872 32888 32904 32926 32971 33019 33070 33189 33216 33241 33261 33290 33344 33469 33502 33728 33752 34034 34317 34591 34778 34902 35027 35044 35067 35072 35078 35083 35186 35238 35484 35645 35800 35871 35924 35931 35949 35956 35983 36033 36036 36079 36125 36180 36239 36308 36355 36460 36603 36628 36632 36666 36683 36721 36774 36814 36890 36955 37049 37070 37108 37148 37184 37208 37231 37270 37300 37307 37316 37324 37332 37346 37362 37390 37442 37459 37480 37524 37866 37870 37885 37896 37904 37923 37935 37942 37949 37958 37968 37985 38001 38055 38063 38071 38081 38092 38110 38127 38143 38161 38168 38186 38203 38210 38220 38251 38270 38289 38309 38319 38338 38351 38371 38391 38412 38422 38441 38460 38470 38487 38501 38524 38548 38561 38571 38576 38580 38598 38617 38636 38641 38660 38680 38705 38720 38724 38731 38741 38750 38771 38785 38793 38813 38839 38856 38864 38875 38906 38911 38924 38946 38961 38970 38991 39009 39018 39062 39086 39113 39128 39145 39159 39190 39214 39245 39252 39266 39281 39300 39845 39878 39906 39935 39943 39980 40292 40469 40546 40563 40581 40596 40618 40668 40678 40695 40717 40776 40934 40958 41088 41113 41239 41257 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_BETA. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_BETA est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_BETA est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_BETA Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_BETAExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Type de clavierfrInstallation de la table des blocs dfectueux ... Voulez-vous installer le programme de dmarrage standard ou sur port srie ? Le programme de dmarrage standard utilise les priphriques dfinis par le BIOS (en gnral le moniteur et le clavier). Le programme de dmarrage sur port srie utilise quant lui le premier port srie. Programme de dmarrage slectionn : Console du BIOSPort srie com%d, baud rate %dPas de modificationSlection du programme de dmarrageConsole du BIOS port srie com0port srie com1port srie com2port srie com3Vitesse du port srieConserver le programme de dmarrage existantInstallation programme de dmarrage sur %s ... Ce disque correspond au disque du BIOS suivant : BIOS # cylindres ttes secteurs nb total de secteurs GB ------ --------- ----- -------- -------------------- ---- %#6x %9d %5d %8d %20u %3u C'est la bonne gomtrieEntrer la gomtrieUtiliser l'un de ces disquesCe disque correspond aux disques du BIOS suivants : BIOS # cylindres ttes secteurs nb total de secteurs GB ------ --------- ----- -------- -------------------- ---- %-1d: %#6x %9d %5d %8d %20u %3u Note: puisque sysinst a pu trouver une correspondance unique entre le disque choisi et un disque connu du BIOS, les valeurs ci-dessus sont probablement correctes. Modifiez-les uniquement si elles sont manifestement fausses. Choisissez un disque : La partition de votre disque rserve NetBSD se trouve en-dehors de l'espace que le BIOS de votre machine peut adresser. L'amorage depuis cette partition ne sera peut-tre pas possible. Voulez-vous rellement faire ceci ? ('Non' vous ramnera au menu d'dition des partitions.)Vous avez plus d'un systme d'exploitation sur ce disque, mais vous n'avez pas spcifi d'entre dans le menu de boot pour la partition active ou la partition NetBSD sur laquelle vous allez installer. Voulez-vous rediter la partition pour ajouter une entre dans le menu de boot ?Vous avez ajout une partition tendue au menu de boot, mais il semble que le BIOS de votre systme ne supporte pas la commande de lecture utilise par cette version du menu de boot. Voulez-vous vraiment faire ceci ? ('non' vous ramnera au menu d'dition des partitions.)Votre configuration ncessite le selecteur de boot de NetBSD pour choisir le systme d'exploitation dmarrer. Il n'est pour l'instant pas install, voulez-vous l'installer maintenant ?Le code d'amorage dans le secteur de boot ne semble pas tre valide. Voulez-vous installer le code d'amorage de NetBSD ?Voulez-vous mettre jour le code d'amorage dans le secteur de boot avec la dernire version du code d'amorage de NetBSD ?Kernel (GENERIC)Kernel (GENERIC_KASLR)TypeMountMenuVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activemenu de dmarragedfautType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (Ac)tive partition, bootselect (d)efaultConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOnMSGTXTS656 5264 5305 5321 5339 5343 5347 5357 5366 5372 5378 5381 5384 5393 5403 5416 5424 5435 5460 5472 5982 6014 6506 6795 7340 7386 7490 7576 7612 7627 7645 7653 7661 7688 7692 7696 7699 7702 7813 7998 8226 8702 9036 9065 9080 9095 9103 9117 9135 9156 9207 9223 9233 9253 9299 9329 9382 9439 9550 9671 9715 9748 9787 9821 9828 9861 9938 9944 9951 9958 9987 10099 10105 10116 10133 10150 10159 10188 10200 10210 10311 10373 10393 10513 10550 10606 10620 10641 10678 10888 11063 11212 11247 11299 11517 11832 12357 12720 13010 13403 13538 13551 13562 13708 13887 14018 14152 14172 14205 14224 14307 14422 14563 14688 14702 14810 14903 14932 14952 15028 15045 15063 15079 15098 15118 15135 15147 15173 15185 15203 15404 15643 15670 15687 15743 15805 15865 15896 15920 15979 16355 16385 16402 16510 16620 16760 16834 16910 16988 17480 17700 17811 17842 17969 18005 18133 18160 18200 18246 18462 18586 18654 18754 18759 18795 18831 18845 18868 18901 18905 18930 18949 18975 18980 18995 19010 19029 19054 19066 19088 19105 19118 19130 19148 19172 19187 19204 19217 19228 19239 19259 19288 19317 19341 19376 19411 19438 19625 19674 19706 19754 19851 19984 20030 20222 20252 20574 20703 20843 20983 21100 21235 21279 21322 21330 21340 21352 21364 21372 21383 21410 21444 21481 21512 21547 21583 21630 21650 21667 21685 21690 21697 21724 21740 21761 21778 21795 21813 21830 21843 21874 21899 21930 21961 21996 22023 22076 22086 22096 22102 22111 22119 22134 22138 22143 22149 22153 22188 22198 22227 22243 22269 22286 22305 22326 22342 22355 22360 22368 22383 22409 22428 22456 22474 22485 22491 22497 22518 22528 22539 22557 22579 22596 22609 22630 22650 22670 22681 22694 22716 22723 22748 22763 22783 22795 22812 22829 22849 22868 23045 23329 23639 23819 24030 24218 24284 24331 24386 24430 24450 24479 24491 24497 24513 24517 24521 24529 24539 24551 24566 24585 24621 24632 24643 24682 24694 24704 24714 24724 24740 24758 24807 24828 24873 25117 25143 25397 25412 25438 25495 25529 25564 25706 25723 25772 25793 25809 25838 25843 25848 25854 25859 25898 25933 25963 26018 26051 26097 26111 26190 26195 26249 26263 26273 26297 26383 26431 26537 26571 26578 26593 26620 26629 26668 26675 26697 26716 26732 26750 26782 26801 26818 26975 27006 27013 27022 27030 27037 27051 27069 27088 27098 27110 27151 27196 27225 27246 27269 27288 27326 27332 27340 27344 27365 27382 27391 27410 27556 27598 28108 28116 28140 28158 28202 28207 28212 28216 28247 28260 28269 28315 28441 28532 28544 28608 28610 28612 28614 28624 28638 28653 28680 28684 28690 28695 28704 28709 28736 28738 28753 28764 28779 28807 28851 28898 28914 28936 28947 28980 29000 29049 29149 29151 29153 29167 29170 29209 29309 29322 29353 29363 29380 29398 29426 29454 29482 29510 29523 29552 29587 29633 29738 29765 29794 29818 29845 29889 30000 30032 30300 30315 30548 30761 31021 31187 31277 31363 31380 31403 31410 31416 31426 31525 31581 31857 31981 32092 32154 32192 32200 32217 32226 32248 32297 32300 32343 32388 32443 32502 32571 32618 32723 32866 32891 32895 32929 32945 32970 33018 33054 33115 33169 33250 33272 33311 33348 33380 33404 33431 33457 33471 33479 33489 33497 33511 33524 33536 33560 33601 33627 33644 33673 33997 34000 34014 34026 34032 34048 34060 34067 34074 34083 34093 34110 34126 34169 34177 34185 34195 34206 34224 34241 34254 34280 34287 34295 34312 34320 34337 34361 34380 34399 34418 34428 34439 34453 34471 34491 34511 34520 34543 34563 34574 34589 34601 34620 34639 34650 34660 34665 34671 34689 34708 34727 34734 34753 34773 34798 34815 34821 34829 34839 34851 34872 34888 34896 34916 34936 34958 34966 34977 35000 35007 35021 35043 35060 35069 35090 35108 35117 35148 35164 35191 35210 35230 35248 35269 35283 35303 35310 35329 35344 35363 35908 35941 35969 35998 36006 36043 36355 36532 36609 36626 36644 36659 36681 36731 36741 36758 36780 36839 36997 37021 37151 37176 37302 37320 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_BETA. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_BETA zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_BETA zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_BETA zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_BETA zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_BETAWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_BETAUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Keyboard typeplInstalowanie tablicy zlych blokow ... Czy chcesz zainstalowac normalne bootbloki, czy te do uzycia z zewn. konsola? Selected bootblock: Konsola BIOSPort szeregowy com%d, %d bodowBez zmianWybor bootblokowUzyj konsoli BIOSUzyj portu szeregowego com0Uzyj portu szeregowego com1Uzyj portu szeregowego com2Uzyj portu szeregowego com3Liczba bodowUzyj istniejacych bootblokowInstalowanie bootblokow na %s.... Ten dysk odpowiada ponizszemu dyskowi BIOS: BIOS # cylindry glowice sektory razem sektory GB ------ -------- ------- ------- ------------- ---- %#6x %8d %7d %7d %13u %3u To jest prawidlowa geometriaUstaw geometrie recznieUzyj jednego z tych dyskowTen dysk odpowiada ponizszym dyskom BIOS: BIOS # cylindry glowice sektory razem sektory GB ------ -------- ------- ------- ------------- ---- %-1d: %6x %8d %7d %7d %13u %3u Notatka: od kiedy sysinst jest w stanie unikalnie rozpoznac dysk, ktory wybrales i powiazac go z dyskiem BIOS, wartosci wyswietlane powyzej sa bardzo prawdopodobnie prawidlowe i nie powinny byc zmieniane. Zmieniaj je tylko wtedy jesli sa naprawde _obrzydliwie_ zle. Wybierz dysk: Czesc NetBSD dysku lezy poza obszarem, ktory BIOS w twojej maszynie moze zaadresowac. Nie mozliwe bedzie bootowanie z tego dysku. Jestes pewien, ze chcesz to zrobic? (Odpowiedz 'nie' zabierze cie spowrotem do menu edycji partycji.)Masz wiecej niz jeden system operacyjny na tym dysku, ale nie zostalo wskazane menu ani dla aktywnej partycji ani dla partycji NetBSD, ktora bedzie zainstalowana. Chcesz zmienic partycje, aby dodac wpis do menu?Wskazane zostalo, ze w menu zostanie zawarta partycja rozszerzona. Nie wyglada na to, ze system BIOS wspiera polecenie odczytu uzywane przez te wersje kodu menu. Czy na pewno chcesz tak zrobic? (Odpowiedz 'nie' przeniesie z powrotem do menu zmiany partycji.)Twoje konfiguracja wymaga kodu rozruchowego NetBSD, aby wybierac, ktorego systemu operacyjnego uzywac. Nie jest on obecnie zainstalowany. Czy zainstalowac go teraz?Kod rozruchowy w MBR nie wyglada na poprawny. Chcesz zainstalowac kod rozruchowy NetBSD?Chcesz uaktualnic kod rozruchowy w MBR do najnowszej wersji kodu rozruchowego NetBSD?Kernel (GENERIC)Kernel (GENERIC_KASLR)RodzajMountWpis menuNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaw menu startowymdomyslnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partition, bootselect (d)efaultKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy #!/bin/sh - # # Generated from: # NetBSD: MAKEDEV.awk,v 1.29 2020/06/13 19:46:23 thorpej Exp # NetBSD: MAKEDEV.tmpl,v 1.237 2025/03/28 18:41:25 riastradh Exp # NetBSD: etc.i386/MAKEDEV.conf,v 1.37 2025/03/28 18:41:26 riastradh Exp # # Copyright (c) 2003,2007,2008 The NetBSD Foundation, Inc. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # ########################################################################### # # # Device "make" file. Valid special arguments: # all makes all known devices, including local devices. # Tries to make the 'standard' number of each type. # init A set of devices that is used for MFS /dev by init. # May be equal to "all". # floppy devices to be put on install floppies # ramdisk devices to be put into INSTALL kernel ramdisks. # std standard devices # local configuration specific devices # lua Lua device # wscons make wscons devices # usbs make USB devices # virtio virtio(4)-related devices # # # NOTE: # # * MAKEDEV is used both as a standalone script (via "sh ./MAKEDEV # all" or similar), and as a function library for MAKEDEV.local (via # "MAKEDEV_AS_LIBRARY=1 . MAKEDEV"). Because of this, the script # should consist almost entirely of function definitions, apart from a # few lines right at the end. # # * MAKEDEV may be executed in an environment that is missing some # common commands. For example, it may be executed from a minimal # system used during installation, or it may be executed early in the # boot sequence before most file systems have been mounted. It may # also be executed in a cross-build environment on a non-NetBSD host. # usage() { cat 1>&2 << _USAGE_ Usage: ${0##*/} [-fMsu] [-m mknod] [-p pax] [-t mtree] special [...] Create listed special devices. Options: -f Force permissions to be updated on existing devices. -M Create memory file system. -m mknod Name of mknod(8) program. [\$TOOL_MKNOD or mknod] -p pax Name of pax(1) program. [\$TOOL_PAX or pax] -s Generate mtree(8) specfile instead of creating devices. -t mtree Name of mtree(8) program. [\$TOOL_MTREE or mtree] -u Don't re-create devices that already exist. _USAGE_ exit 1 } # zeropad width number # display number with a zero (`0') padding of width digits. # zeropad() { case $(($1 - ${#2})) in 5) echo 00000$2;; 4) echo 0000$2;; 3) echo 000$2;; 2) echo 00$2;; 1) echo 0$2;; 0) echo $2;; *) die "bad padding" ;; esac } # hexprint number # display (base10) number as hexadecimal # hexprint() { val="$(($1 + 0))" hex= set -- 0 1 2 3 4 5 6 7 8 9 a b c d e f while [ "$val" -gt 0 ]; do eval hex=\${$(($val % 16 + 1))}\$hex val="$(($val / 16))" done echo "${hex:-0}" } # linecount multiline_string # count the number of lines in the string # linecount() { local IFS=' ' # just a newline, no other white space between the quotes set -- $1 echo $# } # nooutput -12 cmd [args...] # run a command with stdout and/or stderr ignored. # "nooutput -1 cmd" is like "cmd >/dev/null"; # "nooutput -2 cmd" is like "{ cmd ; } 2>/dev/null"; # "nooutput -12 cmd" is like "{ cmd ; } >/dev/null 2>&1"; # except they should work even if /dev/null doesn't [yet] exist. # # The "{...}" wrapper used in cases where stderr is redirected # serves to capture shell error messages such as "cmd: not found". # nooutput() { local flags="$1" ; shift local junk case "$flags" in "-1") junk="$( "$@" )" ;; "-2") ( exec 4>&1 ; junk="$( { "$@" ; } 2>&1 1>&4 )" ) ;; "-12") junk="$( { "$@" ; } 2>&1 )" ;; *) warn "Incorrect use of nooutput" ;; esac } # check_pax path_to_pax # Check whether pax exists and supports the command line options # and input format that we will want to use. # check_pax() { local pax="$1" echo ". type=dir optional" | nooutput -12 "${pax}" -r -w -M -pe . } # check_mtree path_to_mtree # Check whether mtree exists and supports the command line options # and input format that we will want to use. # check_mtree() { local mtree="$1" echo ". type=dir optional" | nooutput -12 "${mtree}" -e -U } # setup args... # Parse command line arguments, exit on error. # Callers should shift $((OPTIND - 1)) afterwards. # setup() { PATH=/sbin:/usr/sbin:/bin:/usr/bin:/rescue : ${HOST_SH:=sh} : ${TOOL_MKNOD:=mknod} : ${TOOL_MTREE:=mtree} : ${TOOL_PAX:=pax} status=0 do_create_mfs=false do_force=false do_mknod=false do_pax=false do_mtree=false do_redirect=false do_specfile=false do_update=false opts= while getopts Mfm:p:st:u ch; do # Note that $opts is only for options passed through to # MAKEDEV.local, not for all options. case ${ch} in M) # "-M" sets do_create_mfs; # "-M -M" is for use from init(8), and sets do_redirect do_redirect=$do_create_mfs do_create_mfs=true ;; f) do_force=true opts="${opts} -f" ;; m) TOOL_MKNOD=${OPTARG} do_mknod=true opts="${opts} -m ${OPTARG}" ;; p) TOOL_PAX="${OPTARG}" if check_pax "${TOOL_PAX}"; then do_pax=true # do not add this to $opts; we will later # add "-s" instead. else warn "Ignored -p option:" \ "${TOOL_PAX} is missing or broken" do_mknod=true fi ;; s) do_specfile=true opts="${opts} -s" ;; t) TOOL_MTREE="${OPTARG}" if check_mtree "${TOOL_MTREE}"; then do_mtree=true # do not add this to $opts; we will later # add "-s" instead. else warn "Ignored -t option:" \ "${TOOL_MTREE} is missing or broken" do_mknod=true fi ;; u) do_update=true opts="${opts} -u" ;; *) usage ;; esac done shift $((${OPTIND} - 1)) [ $# -gt 0 ] || usage u_root="0" u_uucp="66" g_gpio="29" g_kmem="2" g_ntpd="15" g_nvmm="34" g_operator="5" g_wheel="0" dialin=0 dialout=524288 callunit=262144 # only allow read&write for owner by default umask 077 # Set fdesc_mounted=true if the fdesc file system is mounted # on the current directory (typically "/dev"). # Later, this will be used to suppress creation of device nodes # that are supplied by the fdesc file system. # fdesc_mounted=false if [ -d fd ]; then # Parse the output from "mount -u -o nosuchoption .". # We don't parse the output from df(1) because that's # less likely to be available on install media. # # If the current directory is a mount point for the # fdesc file system, then the expected output (whether # or not the current user is root) is: # mount_fdesc: -o suchoption: option not supported. # # If the current directory is not a mount point, then # the expected output is: # mount: .: unknown special file or file system. # # If we are not running on NetBSD, or mount(8) is not # found, then we should get some other error message. # case "$({ LC_ALL=C mount -u -o nosuchoption . ; } 2>&1)" in *mount_fdesc*) fdesc_mounted=true ;; esac fi # do_force requires mknod if $do_force; then if $do_mtree || $do_pax || $do_specfile; then die "-f option works only with mknod" fi do_mknod=true fi # do_force and do_update do not work together if $do_force && $do_update; then die "-f and -u options do not work together" fi # If no explicit method was specified on the command line or # forced above, then use one of mtree, pax, or mknod, in that # order of preference. # # mtree is preferred because it's fast and designed for the # purpose. However, it's unlikely to be available early in the # boot sequence, when init(8) may invoke MAKEDEV(8). # # pax is usually acceptable, and it's likely to be available # early in the boot sequence. However, it's much slower than mtree. # # mknod is just very slow, because the shell has to fork for # each device node. # case ",${do_mtree},,${do_pax},,${do_mknod},,${do_specfile}," in ( ,false,,false,,false,,false, ) if check_mtree "${TOOL_MTREE}"; then do_mtree=true elif check_pax "${TOOL_PAX}"; then do_pax=true else do_mknod=true fi ;; ( *,true,*,true,* ) die "-m, -p, -s, and -t options are mutually exclusive" ;; esac # If we are using mknod, then decide what options to pass it. MKNOD="${TOOL_MKNOD:-mknod} -F netbsd" if $do_mknod; then if $do_force; then MKNOD="${MKNOD} -R" else MKNOD="${MKNOD} -r" fi fi # do_mtree or do_pax internally implies do_specfile. # This happens after checking for mutually-exclusive options. if $do_mtree || $do_pax && ! $do_specfile; then do_specfile=true opts="${opts} -s" fi } # specfile_before # This is called before the bulk of the makedev processing, # if do_specfile is set. # # It simply prints ". type=dir optional", which must be the # first line of the specfile. # specfile_before() { echo ". type=dir optional" } # mtree_after # Output in specfile format is piped into this function. # # It uses mtree to create the devices defined in the specfile. # mtree_after() { nooutput -1 "${TOOL_MTREE}" -e -U } # pax_after # Output in specfile format is piped into this function. # # It uses pax to create the devices defined in the specfile. # pax_after() { # Run pax in an empty directory, so it pays # attention only to the specfile, without being # confused by the existing contents of the target # directory. Without this, pax would complain "file # would overwrite itself" for already-existing # device nodes. tmpdir=./tmp.$$ mkdir "${tmpdir}" || die "can't create temporary directory" cd "${tmpdir}" || die "can't cd to temporary directory" "${TOOL_PAX}" -r -w -M -pe .. pax_status=$? cd .. # back to where we started rmdir "${tmpdir}" return $pax_status } # makedev_main makedev_name args... # Perform most of the work of the main program. makedev_name # is typically "makedev", but may be the name of some other # makedev-like function (if we are invoked from MAKEDEV.local or # some other script). The other args to this function are the # command line args with which the MAKEDEV (or MAKEDEV.local) # script was invoked. # makedev_main() { local makedev="$1" ; shift # Parse command line args setup ${1+"$@"} shift $((${OPTIND}-1)) if $do_create_mfs; then # Count inodes and create mfs file system. # The makedev call merely updates $count_nodes. count_nodes=0 $makedev ${1+"$@"} create_mfs_dev $count_nodes unset count_nodes fi # Set before, middle, and after variables, so we can do # something like "( $before && $middle ) | $after", # except it will have to be more complex so we can capture # the exit status from both sides of the pipe. # if $do_specfile; then before=specfile_before else before=: fi middle='$makedev ${1+"$@"} && (exit $status)' if $do_mtree; then after=mtree_after elif $do_pax ; then after=pax_after else after=cat fi # Actually perform the "{ $before && $middle } | $after" commands. # # We go to some trouble to ensure that, if any of # $before, $middle, or $after fails, then we also # exit with a non-zero status. # # In the block below, fd 3 is a copy of the original stdout, # and fd 4 goes to a subshell that analyses the exit status # status from the other commands. # { exec 3>&1; { { eval "$before" && eval "$middle"; echo $? >&4; } \ | { eval "$after"; echo $? >&4; } \ } 4>&1 1>&3 \ | ( read status1; read status2; case "$status1,$status2" in 0,0) exit 0;; 0,*) exit $status2;; *,*) exit $status1;; esac ) } } # # functions available to create nodes: # # mkdev name [b|c] major minor [mode{=600} [gid{=0} [uid{=0}]]] # create device node `name' with the appropriate permissions # # lndev src target # create a symlink from src to target # # makedir dir mode # create directory with appropriate mode # mkdev() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $1; then return fi if $do_specfile; then case $2 in b) type=block ;; c) type=char ;; esac echo "./$1 type=${type} device=netbsd,$3,$4 mode=${5:-600} gid=${6:-$g_wheel} uid=${7:-$u_root}" else ${MKNOD} -m ${5:-600} -g \#${6:-$g_wheel} -u \#${7:-$u_root} $1 $2 $3 $4 fi } lndev() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $2; then return fi if $do_specfile; then echo "./$2 type=link link=$1 mode=0700 gid=$g_wheel uid=$u_root" else ln -f -s $1 $2 fi } makedir() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $1; then return fi if $do_specfile; then echo "./$1 type=dir mode=$2 gid=$g_wheel uid=$u_root" else nooutput -2 mkdir $1 chmod $2 $1 fi } warn() { echo 1>&2 "$0: $*" status=1 } die() { echo 1>&2 "$0: $*" exit 1 } # makedev special [...] # the main loop # makedev() { for i do case $i in # As of 2005-03-15, the "init" case must not create more than 1024 entries. all_md) makedev std wscons wt0 fd0 fd1 makedev wd0 wd1 wd2 wd3 wd4 wd5 wd6 wd7 makedev sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 makedev flash0 flash1 flash2 flash3 flash4 flash5 flash6 flash7 makedev tty0 tty1 tty2 tty3 makedev st0 st1 ch0 cd0 cd1 mcd0 vnd0 makedev bpf makedev ccd0 md0 random makedev cgd0 cgd1 makedev amr0 iop0 mfi0 mlx0 mly0 dpti0 dpt0 twe0 icp0 makedev ed0 ed1 makedev nvme0 nvme0ns1 nvme0ns2 nvme0ns3 nvme0ns4 makedev nvme1 nvme1ns1 nvme1ns2 nvme1ns3 nvme1ns4 makedev nvme2 nvme2ns1 nvme2ns2 nvme2ns3 nvme2ns4 makedev nvme3 nvme3ns1 nvme3ns2 nvme3ns3 nvme3ns4 makedev raid0 raid1 raid2 raid3 makedev ld0 ld1 ld2 ld3 ld4 ld5 ld6 ld7 makedev xbd0 xbd1 xbd2 xbd3 xen makedev usbs makedev ipty makedev local makedev cfs makedev lpa0 lpa1 lpa2 makedev lpt0 lpt1 lpt2 makedev ss0 uk0 uk1 makedev speaker joy0 joy1 makedev apm makedev cmos makedev audio makedev radio makedev music rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 makedev scsibus0 scsibus1 scsibus2 scsibus3 makedev ses0 ses1 ses2 ses3 makedev sysmon makedev bktr makedev tprof makedev ttyCZ0 ttyCY0 makedev agp0 makedev pci0 pci1 pci2 pci3 pci4 pci5 pci6 pci7 makedev pci8 pci9 pci10 pci11 pci12 pci13 pci14 makedev pci15 pci16 pci17 pci18 pci19 makedev altq makedev cir0 cir1 irframe0 irframe1 makedev dmoverio makedev kttcp makedev io makedev bio makedev acpi smbios efi makedev virtio ;; xen) makedev xenevt xencons xsd_kva ;; floppy) makedev std bpf wt0 fd0 fd1 wd0 wd1 wd2 wd3 sd0 sd1 sd2 sd3 sd4 st0 st1 makedev tty0 tty1 tty2 cd0 cd1 mcd0 ttyv0 opty ld0 ld1 ld2 ld3 ed0 ed1 ;; ramdisk) makedev floppy md0 ;; all) makedev all_md makedev std fd ptm makedev dk0 dk1 dk2 dk3 dk4 dk5 dk6 dk7 makedev dk8 dk9 dk10 dk11 dk12 dk13 dk14 dk15 makedev dk16 dk17 dk18 dk19 dk20 dk21 dk22 dk23 makedev dk24 dk25 dk26 dk27 dk28 dk29 dk30 dk31 makedev ccd0 ccd1 ccd2 ccd3 makedev cgd0 cgd1 cgd2 cgd3 cgd4 cgd5 cgd6 cgd7 makedev fss0 fss1 fss2 fss3 makedev md0 md1 makedev raid0 raid1 raid2 raid3 raid4 raid5 raid6 raid7 makedev vnd0 vnd1 vnd2 vnd3 makedev iscsi0 makedev bpf npf makedev tun0 tun1 tun2 tun3 makedev ipl pf crypto random makedev lockstat clockctl cpuctl makedev atabus0 atabus1 atabus2 atabus3 atabus4 atabus5 atabus6 atabus7 makedev srt0 srt1 srt2 srt3 makedev tap tap0 tap1 tap2 tap3 makedev gpio gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 makedev gpioirq0 gpiopps0 makedev pad pad0 pad1 pad2 pad3 makedev bthub makedev putter makedev drvctl makedev video makedev dtv makedev drm0 drm1 drm2 drm3 makedev altmem makedev zfs makedev lua makedev hdmicec0 makedev dtrace makedev veriexec makedev autofs makedev fw0 fw1 fw2 fw3 makedev ipmi0 makedev qemufwcfg makedev sht3xtemp0 makedev scmd0 makedev local # do this last ;; init) # unless overridden by MD entry, this is equal to 'all' makedev all opty ;; audio) makedev audio0 audio1 audio2 audio3 makedev hdaudio0 hdaudio1 hdaudio2 hdaudio3 lndev sound0 sound lndev audio0 audio lndev mixer0 mixer lndev audioctl0 audioctl ;; emcfan[0-9]*) unit=${i#emcfan} mkdev emcfan$unit c 367 $unit 660 ;; gpio) makedev gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 lndev gpio0 gpio ;; gpioirq) makedev gpioirq0 ;; gpiopps) makedev gpiopps0 lndev gpiopps0 gpiopps ;; lua) makedev lua0 lndev lua0 lua ;; pad) makedev pad0 pad1 pad2 pad3 lndev pad0 pad ;; qemufwcfg) makedev qemufwcfg0 lndev qemufwcfg0 qemufwcfg ;; radio) makedev radio0 radio1 lndev radio0 radio ;; video) makedev video0 video1 video2 video3 ;; dtv) makedev dtv0 dtv1 dtv2 dtv3 ;; iic) makedev iic0 iic1 iic2 iic3 ;; altmem) makedev altmem0 altmem1 ;; ramdisk) makedev floppy md0 ;; sht3xtemp) makedev sht3xtemp0 ;; scmd) makedev scmd0 ;; usbs) makedev usb usb0 usb1 usb2 usb3 usb4 usb5 usb6 usb7 makedev usb8 usb9 usb10 usb11 usb12 usb13 usb14 usb15 makedev uhid0 uhid1 uhid2 uhid3 uhid4 uhid5 makedev uhid6 uhid7 uhid8 uhid9 uhid10 uhid11 makedev uhid12 uhid13 uhid14 uhid15 makedev ulpt0 ulpt1 makedev ttyU0 ttyU1 ttyU2 ttyU3 ttyU4 ttyU5 ttyU6 ttyU7 makedev ttyY0 ttyY1 makedev ttyHS0 makedev utoppy0 utoppy1 makedev ugen0 ugen1 ugen2 ugen3 ;; virtio) makedev ttyVI makedev vio9p0 vio9p1 vio9p2 vio9p3 makedev vio9p4 vio9p5 vio9p6 vio9p7 ;; std) mkdev console c 0 0 600 mkdev constty c 0 1 600 mkdev drum c 4 0 640 $g_kmem mkdev kmem c 2 1 640 $g_kmem mkdev mem c 2 0 640 $g_kmem mkdev null c 2 2 666 mkdev full c 2 11 666 mkdev zero c 2 12 666 mkdev klog c 7 0 600 mkdev ksyms c 101 0 440 $g_kmem mkdev random c 46 0 444 mkdev urandom c 46 1 644 if ! $fdesc_mounted; then mkdev tty c 1 0 666 mkdev stdin c 22 0 666 mkdev stdout c 22 1 666 mkdev stderr c 22 2 666 fi ;; usb) mkdev usb c 55 255 444 ;; usb[0-9]*) unit=${i#usb} usb=usb$unit mkdev usb$unit c 55 $unit ;; uhid[0-9]*) unit=${i#uhid} mkdev uhid$unit c 56 $unit 666 ;; ulpt[0-9]*) unit=${i#ulpt} mkdev ulpt$unit c 57 $unit mkdev ulpn$unit c 57 $(($unit + 64)) ;; utoppy[0-9]*) unit=${i#utoppy} mkdev utoppy$unit c 174 $unit ;; ttyHS[0-9]*) unit=${i#ttyHS} for j in 00 01 02 03 04 05 06 07 08 09 10 do base=$(($unit * 16 + ${j#0})) mkdev ttyHS$unit.$j c 196 $(($base + $dialin )) "" "" $u_uucp mkdev dtyHS$unit.$j c 196 $(($base + $dialout )) "" "" $u_uucp mkdev ctyHS$unit.$j c 196 $(($base + $callunit)) "" "" $u_uucp done ;; ttyY[0-9]*) unit=${i#ttyY} mkdev ttyY$unit c 172 $(($unit + $dialin )) "" "" $u_uucp mkdev dtyY$unit c 172 $(($unit + $dialout )) "" "" $u_uucp mkdev ctyY$unit c 172 $(($unit + $callunit)) "" "" $u_uucp ;; ucom[0-9]*) makedev ttyU${i#ucom} ;; ttyU[0-9]*) unit=${i#ttyU} mkdev ttyU$unit c 66 $(($unit + $dialin )) "" "" $u_uucp mkdev dtyU$unit c 66 $(($unit + $dialout )) "" "" $u_uucp mkdev ctyU$unit c 66 $(($unit + $callunit)) "" "" $u_uucp ;; ugen[0-9]*) unit=${i#ugen} for j in 00 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 do mkdev ugen$unit.$j c 64 $(($unit * 16 + ${j#0})) done ;; umcpmio[0-9]*) unit=${i#umcpmio} mkdev umcpmio${unit}ctl c 366 $unit 660 for j in 0 1 2 do mkdev umcpmio${unit}GP$(($j + 1)) c 366 $(($unit * 3 + 128 + ${j#})) 666 done ;; wscons) makedev ttyE0 ttyE1 ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 makedev ttyF0 ttyF1 ttyF2 ttyF3 ttyF4 ttyF5 ttyF6 ttyF7 makedev ttyG0 ttyG1 ttyG2 ttyG3 ttyG4 ttyG5 ttyG6 ttyG7 makedev ttyH0 ttyH1 ttyH2 ttyH3 ttyH4 ttyH5 ttyH6 ttyH7 makedev wsmouse0 wsmouse1 wsmouse2 wsmouse3 makedev wskbd0 wskbd1 wskbd2 wskbd3 makedev wsmux0 wsmux1 wsmux2 wsmux3 makedev wsmouse wskbd makedev ttyEcfg ttyEstat makedev ttyFcfg ttyFstat makedev ttyGcfg ttyGstat makedev ttyHcfg ttyHstat makedev wsfont ;; wsmouse) mkdev wsmouse c 65 0 ;; wskbd) mkdev wskbd c 65 1 ;; wsmux[0-9]*) unit=${i#wsmux} mkdev wsmux$unit c 65 $unit mkdev wsmuxctl$unit c 65 $(($unit + 128)) 200 ;; xenevt) mkdev xenevt c 141 0 ;; xsd_kva) mkdev xsd_kva c 141 1 ;; xencons) mkdev xencons c 143 0 ;; ttyEstat) mkdev ttyEstat c 47 254 ;; ttyEcfg) mkdev ttyEcfg c 47 255 ;; ttyE[0-9]*) unit=${i#ttyE} mkdev ttyE$unit c 47 $unit ;; ttyFstat) mkdev ttyFstat c 47 510 ;; ttyFcfg) mkdev ttyFcfg c 47 511 ;; ttyF[0-9]*) unit=${i#ttyF} mkdev ttyF$unit c 47 $(($unit + 256)) ;; ttyGstat) mkdev ttyGstat c 47 766 ;; ttyGcfg) mkdev ttyGcfg c 47 767 ;; ttyG[0-9]*) unit=${i#ttyG} mkdev ttyG$unit c 47 $(($unit + 512)) ;; ttyHstat) mkdev ttyHstat c 47 1022 ;; ttyHcfg) mkdev ttyHcfg c 47 1023 ;; ttyH[0-9]*) unit=${i#ttyH} mkdev ttyH$unit c 47 $(($unit + 768)) ;; wsmouse[0-9]*) unit=${i#wsmouse} mkdev wsmouse$unit c 49 $unit ;; wskbd[0-9]*) unit=${i#wskbd} mkdev wskbd$unit c 48 $unit ;; fd) if ! $fdesc_mounted; then # Create the "fd" subdirectory, and devices "fd/0" to "fd/63" makedir fd 755 n=0 while [ $n -lt 64 ] do mkdev fd/$n c 22 $n 666 n=$(($n + 1)) done fi ;; wt[0-9]*) name=wt; unit=${i#wt}; chr=10; blk=3 for sub in $unit $(($unit+8)) $(($unit+16)) do mkdev $name$sub b $blk $(($sub + 0)) 660 $g_operator mkdev n$name$sub b $blk $(($sub + 4)) 660 $g_operator mkdev r$name$sub c $chr $(($sub + 0)) 660 $g_operator mkdev nr$name$sub c $chr $(($sub + 4)) 660 $g_operator done ;; md[0-9]*) makedisk_minimal md ${i#md} 17 24 ;; fss[0-9]*) name=fss; unit=${i#fss}; blk=163; chr=163 mkdev $name$unit b $blk $unit 660 $g_operator mkdev r$name$unit c $chr $unit 660 $g_operator ;; ss[0-9]*) name=ss; unit=${i#ss}; chr=19 mkdev $name$unit c $chr $(($unit * 16 + 0)) 640 $g_operator mkdev n$name$unit c $chr $(($unit * 16 + 1)) 640 $g_operator mkdev en$name$unit c $chr $(($unit * 16 + 3)) 640 $g_operator ;; ccd[0-9]*|cgd[0-9]*|raid[0-9]*|vnd[0-9]*) case $i in ccd*) name=ccd; unit=${i#ccd}; blk=16; chr=18;; cgd*) name=cgd; unit=${i#cgd}; blk=21; chr=93;; raid*) name=raid; unit=${i#raid}; blk=18; chr=62;; vnd*) name=vnd; unit=${i#vnd}; blk=14; chr=41;; esac makedisk_p16high $name $unit $blk $chr ;; sd[0-9]*) name=sd; unit=${i#sd}; blk=4; chr=13 makedisk_p16high $name $unit $blk $chr ;; wd[0-9]*) name=wd; unit=${i#wd}; blk=0; chr=3 makedisk_p16high $name $unit $blk $chr ;; fd[0-9]*) name=fd; unit=${i#fd}; blk=2; chr=9 makedisk_p16high $name $unit $blk $chr ;; ld[0-9]*) name=ld; unit=${i#ld}; blk=19; chr=69 makedisk_p16high $name $unit $blk $chr ;; flash[0-9]*) unit=${i#flash} flash=flash$unit mkdev flash$unit b 199 $unit mkdev rflash$unit c 199 $unit ;; spiflash[0-9]*) unit=${i#spiflash} spiflash=spiflash$unit mkdev spiflash$unit b 208 $unit mkdev rspiflash$unit c 208 $unit ;; altmem[0-9]*) name=altmem; unit=${i#altmem}; blk=182; chr=182 makedisk_p16high $name $unit $blk $chr ;; bio) mkdev bio c 181 0 ;; ed[0-9]*) name=ed; unit=${i#ed}; blk=20; chr=79 makedisk_p16high $name $unit $blk $chr ;; xbd[0-9]*) name=xbd; unit=${i#xbd}; blk=142; chr=142 makedisk_p16high $name $unit $blk $chr ;; dk[0-9]*) name=dk; unit=${i#dk}; blk=168; chr=168 mkdev r$name$unit c $chr $unit 0640 $g_operator mkdev $name$unit b $blk $unit 0640 $g_operator ;; tprof) mkdev tprof c 191 0 ;; ttyCY[0-9]*) # Each unit number creates 32 pairs of {tty,dty} device nodes: # ttyCY0 => device nodes [td]tyCY000 to [td]tyCY031; # ttyCY1 => device nodes [td]tyCY032 to [td]tyCY063; name=tyCY; chr=38; off=32 unit=${i#t${name}} minor=$(($unit * $off)) eminor=$(($minor + $off)) while [ $minor -lt $eminor ] do nminor=000$minor nminor=${nminor#${nminor%???}} mkdev t$name$nminor c $chr $(($minor + $dialin )) "" "" $u_uucp mkdev d$name$nminor c $chr $(($minor + $dialout)) "" "" $u_uucp minor=$(($minor + 1)) done ;; ttyCZ[0-9]*) # Each unit number creates 64 pairs of {tty,dty} device nodes: # ttyCZ0 => device nodes [td]tyCZ0000 to [td]tyCZ0063; # ttyCZ1 => device nodes [td]tyCZ0064 to [td]tyCZ0127; name=tyCZ; chr=73; off=64 unit=${i#t${name}} minor=$(($unit * $off)) eminor=$(($minor + $off)) while [ $minor -lt $eminor ] do nminor=0000$minor nminor=${nminor#${nminor%????}} mkdev t$name$nminor c $chr $(($minor + $dialin )) "" "" $u_uucp mkdev d$name$nminor c $chr $(($minor + $dialout)) "" "" $u_uucp minor=$(($minor + 1)) done ;; tty[0-9]*) unit=${i#tty} ounit=00$unit ounit=${ounit#${ounit%??}} mkdev tty$ounit c 8 $(($unit + $dialin )) "" "" $u_uucp mkdev dty$ounit c 8 $(($unit + $dialout)) "" "" $u_uucp ;; ttyC[0-9]*) # some archs call com_chr ttyC traditionally unit=${i#ttyC}; name=ttyC; dname=dtyC; chr=8 mkdev $name$unit c $chr $(($unit + $dialin )) "" "" $u_uucp mkdev $dname$unit c $chr $(($unit + $dialout)) "" "" $u_uucp ;; opty) # Create 16 device nodes, [pt]typ0 to [pt]typf, # same as "MAKEDEV pty0". for j in 0 1 2 3 4 5 6 7 8 9 a b c d e f do case $j in [0-9]) jn=$j ;; a) jn=10 ;; b) jn=11 ;; c) jn=12 ;; d) jn=13 ;; e) jn=14 ;; f) jn=15 ;; esac mkdev ttyp$j c 5 $jn 666 mkdev ptyp$j c 6 $jn 666 done ;; pty[0-9]*) # Each unit number creates up to 16 pairs of {tty,pty} device nodes: # pty0 => 16 pairs, [tp]typ0 to [tp]typf # pty1 => 16 pairs, [tp]tyq0 to [tp]tyqf # pty16 => 16 pairs, [tp]typg to [tp]typv # pty17 => 16 pairs, [tp]typw to [tp]typL # pty18 => 14 pairs, [tp]typM to [tp]typZ warn "$i: creating BSD style tty nodes with ptyfs is a security issue" class=${i#pty} d1="p q r s t u v w x y z P Q R S T" if [ "$class" -ge 64 ] then warn "$i: pty unit must be between 0 and 63" continue elif [ "$class" -lt 16 ] then # pty[p-zP-T][0-9a-f] offset=0 mult=0 d2="0 1 2 3 4 5 6 7 8 9 a b c d e f" else # pty[p-zP-T][g-zA-Z] class=$(($class - 16)) offset=256 mult=2 d2="g h i j k l m n o p q r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X Y Z" fi start=$(($class * 16)) set -- $d2 nt=$# s1=$(($start / $nt)) set -- $d1 shift $s1 t1=$1 if [ "$t1" = v ]; then warn "$i: pty unit conflicts with console ttyv0 device" continue fi s2=$(($start % ($nt - $s1 * $mult))) set -- $d2 shift $s2 t2=$1 unit=$(($start + $offset - $s1 * $mult)) end=$(($unit + 16)) while [ "$unit" -lt "$end" ] do mkdev tty$t1$t2 c 5 $unit 666 mkdev pty$t1$t2 c 6 $unit 666 shift t2=$1 if [ -z "$t2" ] then break fi unit=$(($unit + 1)) done ;; st[0-9]*) name=st; unit=${i#st}; chr=14; blk=5 mkdev $name$unit b $blk $(($unit * 16 + 0)) 660 $g_operator mkdev n$name$unit b $blk $(($unit * 16 + 1)) 660 $g_operator mkdev e$name$unit b $blk $(($unit * 16 + 2)) 660 $g_operator mkdev en$name$unit b $blk $(($unit * 16 + 3)) 660 $g_operator mkdev r$name$unit c $chr $(($unit * 16 + 0)) 660 $g_operator mkdev nr$name$unit c $chr $(($unit * 16 + 1)) 660 $g_operator mkdev er$name$unit c $chr $(($unit * 16 + 2)) 660 $g_operator mkdev enr$name$unit c $chr $(($unit * 16 + 3)) 660 $g_operator ;; ses[0-9]*|ch[0-9]*|uk[0-9]*) case $i in ch*) name=ch; unit=${i#ch}; chr=17;; uk*) name=uk; unit=${i#uk}; chr=20;; ses*) name=ses; unit=${i#ses}; chr=74;; esac mkdev $name$unit c $chr $unit 640 $g_operator ;; cd[0-9]*) makedisk_minimal cd ${i#cd} 6 15 ;; mcd[0-9]*) makedisk_minimal mcd ${i#mcd} 7 39 ;; lpt[0-9]*|lpa[0-9]*) case $i in lpt*) name=lpt; unit=${i#lpt}; chr=16; flags=0;; lpa*) name=lpa; unit=${i#lpa}; chr=16; flags=128;; esac mkdev $name$unit c $chr $(($unit + $flags)) mkdev lpt${unit}ctl c $chr $(($unit + 256)) ;; bpf) mkdev bpf c 23 0 lndev bpf bpf0 ;; npf) mkdev npf c 198 0 ;; bthub) mkdev bthub c 175 0 ;; tun[0-9]*) unit=${i#tun} mkdev tun$unit c 40 $unit ;; joy[0-9]*) unit=${i#joy} mkdev joy$unit c 26 $unit ;; ipl) mkdev ipl c 44 0 mkdev ipnat c 44 1 mkdev ipstate c 44 2 mkdev ipauth c 44 3 mkdev ipsync c 44 4 mkdev ipscan c 44 5 mkdev iplookup c 44 6 ;; pf) mkdev pf c 161 0 ;; crypto) mkdev crypto c 160 0 666 ;; cmos) mkdev cmos c 88 0 644 ;; speaker) mkdev speaker c 240 0 ;; lockstat) mkdev lockstat c 177 0 ;; cpuctl) mkdev cpuctl c 188 0 666 ;; audio|audio[0-9]*) unit=${i#audio} audio=audio$unit sound=sound$unit mixer=mixer$unit audioctl=audioctl$unit : ${unit:-0} mkdev $sound c 42 $(($unit + 0)) 666 mkdev $audio c 42 $(($unit + 128)) 666 mkdev $mixer c 42 $(($unit + 16)) 666 mkdev $audioctl c 42 $(($unit + 192)) 666 ;; hdaudio[0-9]*) unit=${i#hdaudio} mkdev hdaudio$unit c 195 $unit 644 ;; hdmicec[0-9]*) uint=${i#hdmicec} mkdev hdmicec$unit c 340 $unit 644 ;; gpio[0-9]*) unit=${i#gpio} mkdev gpio$unit c 173 $unit 664 $g_gpio ;; gpioirq[0-9]*) unit=${i#gpioirq} mkdev gpioirq$unit c 365 $unit 444 $g_gpio ;; gpiopps[0-9]*) unit=${i#gpiopps} mkdev gpiopps$unit c 344 $unit 664 $g_gpio ;; lua[0-9]*) unit=${i#lua} mkdev lua$unit c 209 $unit 664 ;; rmidi[0-9]*) unit=${i#rmidi} mkdev rmidi$unit c 58 $unit 666 ;; music|music[0-9]*) unit=${i#music} : ${unit:-0} mkdev music$unit c 59 $(($unit + 0)) 666 mkdev sequencer$unit c 59 $(($unit + 128)) 666 ;; radio|radio[0-9]*) unit=${i#radio} : ${unit:-0} mkdev radio$unit c 87 $unit 666 ;; video|video[0-9]*) unit=${i#video} : ${unit:-0} mkdev video$unit c 193 $unit 666 ;; dtv[0-9]*) unit=${i#dtv} makedir dvb 755 makedir dvb/adapter$unit 755 mkdev dvb/adapter$unit/frontend0 c 200 $(($unit + 0)) 666 mkdev dvb/adapter$unit/demux0 c 200 $(($unit + 16)) 666 mkdev dvb/adapter$unit/dvr0 c 200 $(($unit + 32)) 666 ;; iic[0-9]*) unit=${i#iic} : ${unit:-0} mkdev iic$unit c 201 $unit 600 ;; spi[0-9]*) unit=${i#spi} : ${unit:-0} mkdev spi$unit c 347 $unit 600 ;; amr[0-9]*) unit=${i#amr} mkdev amr$unit c 176 $unit ;; apm) mkdev apm c 21 0 644 mkdev apmctl c 21 8 644 ;; random) mkdev random c 46 0 444 mkdev urandom c 46 1 644 ;; cfs) makedev cfs0 ;; cfs[0-9]*) unit=${i#cfs} mkdev cfs$unit c 60 $unit ;; sysmon) mkdev sysmon c 67 0 644 mkdev watchdog c 67 1 644 mkdev power c 67 2 640 ;; scsibus[0-9]*) unit=${i#scsibus} mkdev scsibus$unit c 61 $unit 644 ;; bktr) makedev bktr0 bktr1 lndev bktr0 bktr lndev tuner0 tuner lndev vbi0 vbi ;; bktr[0-9]*) unit=${i#bktr} mkdev bktr$unit c 71 $(($unit + 0)) 444 mkdev tuner$unit c 71 $(($unit + 16)) 444 mkdev vbi$unit c 71 $(($unit + 32)) 444 ;; io) mkdev io c 2 14 600 ;; iop[0-9]*) unit=${i#iop} mkdev iop$unit c 76 $unit ;; mfi[0-9]*) unit=${i#mfi} mkdev mfi$unit c 205 $unit ;; mlx[0-9]*) unit=${i#mlx} mkdev mlx$unit c 78 $unit ;; mly[0-9]*) unit=${i#mly} mkdev mly$unit c 80 $unit ;; twa[0-9]*) unit=${i#twa} mkdev twa$unit c 187 $unit ;; twe[0-9]*) unit=${i#twe} mkdev twe$unit c 97 $unit ;; icp[0-9]*) unit=${i#icp} mkdev icp$unit c 102 $unit ;; agp[0-9]*) unit=${i#agp} mkdev agp$unit c 82 $unit 644 if [ "$unit" = "0" ]; then lndev agp$unit agpgart fi ;; pci[0-9]*) unit=${i#pci} mkdev pci$unit c 83 $unit 640 ;; dpti[0-9]*) unit=${i#dpti} mkdev dpti$unit c 84 $unit ;; dpt[0-9]*) unit=${i#dpt} mkdev dpt$unit c 96 $unit ;; altq) makedir altq 755 unit=0 for dev in altq cbq wfq afm fifoq red rio localq hfsc cdnr blue priq jobs do mkdev altq/$dev c 77 $unit 644 unit=$(($unit + 1)) done ;; wsfont) mkdev wsfont c 81 0 644 ;; cir[0-9]*) unit=${i#cir} mkdev cir$unit c 86 $unit 666 ;; irframe[0-9]*) unit=${i#irframe} mkdev irframe$unit c 85 $unit ;; pad[0-9]*) unit=${i#pad} mkdev pad$unit c 189 $unit 444 ;; qemufwcfg[0-9]*) unit=${i#qemufwcfg} mkdev qemufwcfg$unit c 342 $unit 660 ;; vio9p[0-9]*) unit=${i#vio9p} mkdev vio9p$unit c 356 $unit 660 ;; fault) mkdev fault c 357 0 ;; clockctl) mkdev clockctl c 89 0 660 $g_ntpd ;; kttcp) mkdev kttcp c 91 0 ;; dmoverio) mkdev dmoverio c 92 0 644 ;; veriexec) mkdev veriexec c 170 0 600 ;; vhci[0-7]*) unit=${i#vhci} mkdev vhci$unit c 355 $unit ;; ttyv[0-9]*) unit=${i#ttyv} mkdev ttyv$unit c 12 $unit ;; # arm, acorn32 mouse-pms[0-9]*|mouse-qms[0-9]*) case $i in mouse-pms*) name=pms ;; mouse-qms*) name=qms ;; esac unit=${i#mouse-${name}} lndev $name$unit mouse ;; ipty) mkdev ttyp0 c 5 0 666 mkdev ttyp1 c 5 1 666 mkdev ptyp0 c 6 0 666 mkdev ptyp1 c 6 1 666 ;; ptm) makedir pts 755 mkdev ptmx c 165 0 666 mkdev ptm c 165 1 666 ;; atabus[0-9]*) unit=${i#atabus} mkdev atabus$unit c 166 $unit 644 ;; drm[0-9]*) unit=${i#drm} unit2=$((unit + 128)) makedir dri 755 mkdev dri/card$unit c 180 $unit 660 mkdev dri/renderD${unit2} c 180 ${unit2} 660 ;; drvctl) mkdev drvctl c 167 0 644 ;; isv) mkdev isv c 192 0 644 ;; tap|tap[0-9]*) unit=${i#tap} case "$unit" in [0-9]*) mkdev tap${unit} c 169 ${unit} 600 ;; "") mkdev tap c 169 0xfffff 600 ;; esac ;; srt[0-9]*) unit=${i#srt} mkdev srt$unit c 179 $unit 600 ;; tpm) mkdev tpm c 204 0 600 ;; dtrace) makedir dtrace 755 mkdev dtrace/dtrace c 207 0 600 ;; fw[0-9]*) unit=${i#fw} for j in 0 1 2 3 do mkdev fw${unit}.${j} c 171 $((${unit} * 256 + ${j})) 660 ${g_operator} mkdev fwmem${unit}.${j} c 171 $((65536 + ${unit} * 256 + ${j})) 660 ${g_operator} done ;; # create putter device and symlinks for all subsystems using it putter) mkdev putter c 178 0 600 mkdev pud c 178 1 600 lndev putter puffs ;; zfs) mkdev zfs c 190 0 600 makedir zpool 755 ;; iscsi[0-9]*) unit=${i#iscsi} mkdev iscsi${unit} c 203 $unit 600 ;; nvme[0-9]*ns[0-9]*) unit=${i#nvme} unit=${unit%ns*} subunit=${i#nvme${unit}ns} if [ 0$subunit -le 0 ] || [ 0$subunit -ge 65536 ]; then warn "bad nsid for $i: $subunit" break fi mkdev nvme${unit}ns$subunit c 341 $(($unit * 65536 + $subunit)) ;; nvme[0-9]*) unit=${i#nvme} mkdev nvme$unit c 341 $(($unit * 65536)) ;; nvmm) mkdev nvmm c 345 0 660 $g_nvmm ;; autofs) mkdev autofs c 343 0 600 ;; kcov) mkdev kcov c 346 0 ;; ipmi[0-9]*) unit=${i#ipmi} mkdev ipmi${unit} c 354 $unit 600 ;; xmm[0-9]) unit=${i#xmm} makedir xmm${unit} 755 mkdev xmm${unit}/rpc c 358 $(($unit * 65536 + 1)) mkdev ttyXMM${unit}0 c 358 $(($unit * 65536 + 2)) mkdev ttyXMM${unit}1 c 358 $(($unit * 65536 + 4)) ;; acpi) mkdev acpi c 359 0 ;; smbios) mkdev smbios c 360 0 ;; efi) mkdev efi c 361 0 660 ;; sht3xtemp[0-9]*) unit=${i#sht3xtemp} mkdev sht3xtemp$unit c 362 $unit 664 ;; scmd[0-9]*) unit=${i#scmd} mkdev scmd$unit c 363 $unit 666 ;; ttyVI[0-9][0-9]) port=${i#ttyVI?} devunit=${i%$port} unit=${devunit#ttyVI} mkdev ttyVI$unit$port c 364 $((16*$unit + $port)) ;; ttyVI) makedev ttyVI00 ttyVI10 ttyVI20 ttyVI30 ;; local) if [ -f "$0.local" ]; then umask 0 if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + \ $(linecount "$("$HOST_SH" "$0.local" $opts -s all)") )) else "$HOST_SH" "$0.local" $opts all fi umask 077 fi ;; *) warn "$i: unknown device" ;; esac done } # three variants of disk partitions - max 8, max 16, max 16 with highpartoffset # hack; only the one used by port is retained in final MAKEDEV script # routine is called as: # makedisk name unit blk chr makedisk_p8() { name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator } makedisk_p12high() { ho=524280 # offset for partition 9 to 11 (same as ...p16high) name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 8 + $ho + 11)) 640 $g_operator } makedisk_p16() { name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 16 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 16 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 16 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 16 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 16 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 16 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 16 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 16 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 16 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 16 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 16 + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 16 + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 16 + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 16 + 11)) 640 $g_operator mkdev ${name}${unit}m b $blk $(($unit * 16 + 12)) 640 $g_operator mkdev ${name}${unit}n b $blk $(($unit * 16 + 13)) 640 $g_operator mkdev ${name}${unit}o b $blk $(($unit * 16 + 14)) 640 $g_operator mkdev ${name}${unit}p b $blk $(($unit * 16 + 15)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 16 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 16 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 16 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 16 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 16 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 16 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 16 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 16 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 16 + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 16 + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 16 + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 16 + 11)) 640 $g_operator mkdev r${name}${unit}m c $chr $(($unit * 16 + 12)) 640 $g_operator mkdev r${name}${unit}n c $chr $(($unit * 16 + 13)) 640 $g_operator mkdev r${name}${unit}o c $chr $(($unit * 16 + 14)) 640 $g_operator mkdev r${name}${unit}p c $chr $(($unit * 16 + 15)) 640 $g_operator } makedisk_p16high() { ho=524280 # offset for partition 9 to 16 name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev ${name}${unit}m b $blk $(($unit * 8 + $ho + 12)) 640 $g_operator mkdev ${name}${unit}n b $blk $(($unit * 8 + $ho + 13)) 640 $g_operator mkdev ${name}${unit}o b $blk $(($unit * 8 + $ho + 14)) 640 $g_operator mkdev ${name}${unit}p b $blk $(($unit * 8 + $ho + 15)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev r${name}${unit}m c $chr $(($unit * 8 + $ho + 12)) 640 $g_operator mkdev r${name}${unit}n c $chr $(($unit * 8 + $ho + 13)) 640 $g_operator mkdev r${name}${unit}o c $chr $(($unit * 8 + $ho + 14)) 640 $g_operator mkdev r${name}${unit}p c $chr $(($unit * 8 + $ho + 15)) 640 $g_operator } # make only the very few basic disk device nodes - 'a' partition # and raw partition makedisk_minimal() { name=$1; unit=$2; blk=$3; chr=$4 doff=8 ro=3 rn=d mkdev ${name}${unit} b $blk $(($unit * $doff + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * $doff + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * $doff + 0)) 640 $g_operator mkdev ${name}${unit}$rn b $blk $(($unit * $doff + $ro)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * $doff + 0)) 640 $g_operator mkdev r${name}${unit}$rn c $chr $(($unit * $doff + $ro)) 640 $g_operator } # create_mfs_dev nodes # Create a memory file system for a given number of device nodes, # and mount it. Attempts to use mount_tmpfs, or falls back to # mount_mfs. # # If do_redirect, then also redirect output to the console. # create_mfs_dev() { ndevnodes=${1-1200} dev_mountpoint=${PWD:-/dev} # Number of inodes is the specified number of device nodes, plus # a margin to allow for extra device nodes created later. ninode=$((ndevnodes * 11 / 10)) # Add 2 reserved inodes (needed for both mfs and tmpfs), and round # up to a multiple of 32 (needed for mfs, not needed for tmpfs). ninode=$(( (ninode + 2 + 31) / 32 * 32 )) # Try tmpfs; if that fails try mfs. # # For tmpfs, allocate 16KB and 512 byte per node. # Actual requirements are much lower, but the size limit # is only intended to avoid accidental writing to /dev. fs_bytes=$((16384 + ninode * 512)) if mount_tmpfs -s $fs_bytes -n $ninode -m 0755 \ -o union tmpfs "$dev_mountpoint" then fstype=tmpfs else # This file system size calculation is exact for mount_mfs(8) # with 512-byte sectors. 40960 bytes (80 blocks) is the # minimum size allowed by mount_mfs. fs_bytes=$((8192 + 2 * 8192 + 4096 + ninode*512 + 8192)) [ "$fs_bytes" -lt 40960 ] && fs_bytes=40960 fs_blocks=$((fs_bytes/512)) if mount_mfs -b 4096 -f 512 -s $fs_blocks -n $ninode -p 0755 \ -o union swap "$dev_mountpoint" then fstype=mfs else die "Failed to create memory file system" fi fi # Our current directory was in the lower file system; change it to # the newly mounted upper file system. cd "$dev_mountpoint" if $do_redirect; then # Redirect stdout and stderr to console ${MKNOD} -m 600 -g 0 -u 0 temp_console c 0 0 exec >temp_console 2>&1 rm temp_console fi echo "Created $fstype $dev_mountpoint" \ "($fs_bytes byte, $ninode inodes)" } # # MAIN: If MAKEDEV_AS_LIBRARY is set, then we are being used as a # function library, so just return. Otherwise, do all the real work. # [ -n "${MAKEDEV_AS_LIBRARY}" ] && return makedev_main makedev ${1+"$@"}  . .. dhcpcd.confgroup master.passwd netconfig protocolsservices# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  ... . .. dhcpcd-hooksdhcpcd-run-hooks  lfs_cleanerd fi done  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl dmesg fdisk fsck fsck_ffs gpt halt ifconfig init mbrlabel mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_lfs  mount_mfs  mount_msdos  mount_nfs  mount_ntfs  mount_tmpfs newfs  newfs_ext2fs  newfs_lfs ping ping6 raidctl reboot restore route rrestore scsictl shutdown slattach swapctl sysctl umount ... ... . .. bin!mdec"sbin#share . .. ftp gunzip gzcat gzip less more progress sed tar `tip! . ..$boot% bootxx_ffsv1& bootxx_ffsv2' bootxx_lfsv2( gptmbr.bin) mbr* mbr_bootsel+\mbr_ext1WVjD$,pD$uLD$9C0ub< u1м|ؿ|PWˀ~RRJ*Ft ~u. uƋu-P^ Z1fluCZRDPBTЃ?Z?H9tGUAZRerUutf. BZRAr|t}=UQufZ ZtL||Error NetBSD MBR bootNo active partitionDisk read errorNo operating systemInvalid CHS read`uaU~Ҷxx%Ȏff|Ѷxuf xvxf ]fмv$f$ ]Q)1 u1USR $Pg^gBoot2 failed: $UEH<]=h[tQZUSRR>ujRX]Uh>h@B))h> UWVS}j,W!Y^tC$tPWe[^_]"SZxvY.h 'h& e[^_]Ã=\[~MQUE>]UjuhU =UtUhUh?XZUS]h*?St ZYu QLhkLSZ ZYth2?SI ZYu Q!h;?S/ ZYtE??](]UWVS ]E o?RuRPhs?j(hRR}RMR}Ru!j:S ^X)؉E'~ h{?SZY9u6E@PShREREE_ a<w1R@ QvƀR9E~T Qоe wv1k E@TLЊUփ0 v9E~Uafw=E11Ҿ]9u"EREE_;tE1e[^_]US ];uF7Rt5R5RPh?RaP5R5Rh?<zj:SZYuEH<]EPhRhREPEPSu͋]j(Sh R R Rh{?S0 9u RR]USEPEPEPEPEPurƒ?uV]h{?S ‹EYY9uPSh?jPh`R_ PEaPuSh?jPh`R=`R]UVSÉsP_VPh? h/1=RPVjS y$5 RSVPh@ h?Xe[^]UVSÉvSh?hS؍e[^]MUSPPu\ 1ۅtg8tbPhAhS*ij/@PcuRh?hS0*%%Cu֋]U`Su1`SZUVSuVZPV y)5 R1VSPh?Re[^]E?e[^]6UWVS]u }\5S"0R QXt"ER5R=RhRhRhRhRWVS,R&A u h@JX `[[t PXh 'h&^_\=\[~Jh@C[1ۋ4%V{PhO@(j`[y1PU< w tF uO6hYthi@OZh@X{1҉%uCWe[^_]TOUWVS]E UEUu}UM ؃Àt,MUW9؋UM} bE1AAMUEUE U][^_].UWVS]u }WEPEPEPEPVCQ=SujP7hSjXjhSMh{?uU_Y9u CQPhAR}ZY9uCQVSD>[^UuhAWBZYu/hAW,ZYthbEWXYu5RuVS< e[^_]UWVSƉU]< uF< t=St8_t V7ZYujVT@EYtu hAZ7uVP;1C ECS uS ‹@ uZ e[^_]UVSƉj:PXY1t#@:t T>u:De[^]UWVS@É։NJt<< t< u1hSR)߃ wƄ=Gj:SZYt=TtS(1ɉHS Dž,10{ 8y4@T%ThP4hIǃ 9C~'Tt3hADXZhB8YtS@(,jO3R$T$BXzTK tt BPTu hIZ,\0~=T4X[ tSTP tLtAPVhBe e[^_]UWVutS1SSS^_]U1ҋE]UE] UE]UE]UWVS ]} ;tNSuԉt hBX :/uB뭍e[^_]UWVSSƉ׉M]GME} P-PSV u R>P; \Yt jP3XZD DCCTS1e[^_]UWVSQu< uF< t Åt"Vh@EZu ;EBe[^_]uVP$;EC1CS uS ‹@uZe[^_]UWVSLUU1ۉj jhVPE =UtjjhU6E ETjj]SL =`S}ľ-C WFE.EE EjMSEP萫 t9Pu܋E E E}P-@$SuW u RPr]+] \Yt jPdXZlS pSjjhdSTDBBu܋EETS &Suu MUEp UIEE1ۉ]5UE̋EEЋEEԋuu_=Qt"E6tSt5Tj PC S1ۅtC@kP }Tu hBVYDSjPTT1҉S=S tjO7ST@PߡTt5Tj PC EUEUEEjjEPB:j8j hSB}tU VEPju]@hC; R1҉1Ue[^_]UWVS uVH ZÅuV_uVh6CD[^P}WjjMԍU؉ u/=QtE C E؉CEԉC1҉S{SS(YSS,Xe[^_]TuUE PuXZUWVSH juZY1ۃhD WP Cvy:ubZZORuT0uECD]CC$>C(tC,jDRP  )9r1VX؍e[^_]US]CD0[]rUWVS,EX]t u1H<H0E <}܉9E}t#}hTC,N (9E֋J1ۉMЉ]ԋJ 1ۉM]J1ۉM]J1ۉMȉ]1ۉ]؋} }Ë} }MЋ]ԃ9ϿriMM}@@u}au؉N1ɉN(9EtDE؋X1]ЉuԋXp]up x$u}pxuȉ}1a@(e[^_]UWVS@]xCACA{ tIMs s |Ps shiCWP,VU MA tSttM@EtSp}1ҋMtS@9~/MUFXFTGV G1҉W \UBYMŃ AMu MAXC@Mj4}WPHjhoCWMuMSEBEUEЉUXuPuAHC@-@PVWFuuVH$UEMAEA EA$EA( q Q h+VPCpQ;1e[^_]US]CtP:C tt P#C t 00[]UWVSHffa$ &u 1ɉ CDž%s %fDžsp pWjjƃ@ Cp pWFPSfC!h&h 'h&Wjjƃt,@ Ch&h 'h&WFPS_Z=tST11tS;H.WRHZt5HKOhKOdK @PRCPà 덅"A@A@A AUAUA AT9UbkpuJVSC1ɉK <39t֋HSKPH SKHtw ttK 1҉S$뷅/AfSfAfA 1q AP PCP S Su u&PSP ZYOjC(fCSS u,C 1C CCPCfCSC SCSCSCSCC=CfC 1`*T"a*T#b*T$=u4@@j@VPyCjhoCVǃi<tO<W01.1҉21ɉE$1"1&1u :@P FCCC CVSR]B@pSP\11jPV!BhtCPhtCPnuhzCPhzCP=uut+jPWA ;jPRnA u  ~{KC VSR$A ӅtxA @A[@ @tJ@uDHQ9tX9u11PG@915SC SC!SC"SC#SC$SC%(1E0e[^_]UWVS,EX }Ծ&3U10Ctxt$.E1TuԍEP1ɋEyYFu܋ẺEȃCpEMT}ԍEPE2ZuvE9Es hC0Gu͉1FE@ppp phCaE@xCtxEX Vihb6SPW2e[^_]UWVSjuhZY1ۃhSPJƒ 18PRxHX ˁ*0ECC0C j0jPC$"C(!C,Kj1W 9u9u9;1hCCPWL 9t hCS )9sAIf w+$&BB BB BBB,H뫋B t @uhCB,t@uh!DESS,ZY-W@X؍e[^_]fO&7%fPfRf1ȣ(%f1Ҍ҉*%f)ff,%f $$ % %%%f$f"%fZfXfP. % "% ؎%,%XPQjYYf0؎%( f"..&%Ȏ؎*%f+&,%UFu]fXfþ&BfFAprot_to_real can't return to X1f(%D$`WÈfÉD$a`t$,fL$(D$0T$$\$8D$4Sf[f%D$a`R[s Àu1Of ȉD$a`fUAfrfU ȉD$a`ֈ}ff؎؃BÈf2ÉD$a`ֈIff؎شHfÉD$a`1ɺO11fa`fa1`f\$a1`1۴f\$a1`1۴fm\$aUSQRVWf1f tȉӝf:}1fȫfЫf_^ZY[]USQRVWEPAMS} -Wf_f fE1_^ZY[]USQRVWf$f_^ZY[]`ffЉD$aUSQRVW}Wf_Ofa%_^ZY[]USQRVWM} lWf_Of&%_^ZY[]USQRVW]@.Of%_^ZY[]USQRVW]Of%_^ZY[]USQRVW]U }Wf_ Of%_^ZY[]USQRVW1ǸOf_Ou_^ZY[]USQRVWU} UWf_Of %_^ZY[]USQRVWPf11r&G$u&o&Of QX_^ZY[]É1`r&&G$ufffЎشfL$aUSVWff\_^[]USVWfT$fL$lĈf31_^[]`Nf\$a`:ffD$a`"ffD$aUVSƉhj0Pk$ 9t;1t-Y t%@Y01ۉ481<$e[^]UVS13Pt $k$u [^]QUVSƸ 迺t'h jP3jS`4t 1ۉ؍e[^]Ã=Ut$Uj(jh`U+jNf O5hO 5dPg5pY`9uu1ɉYx(6<tuGi9u9t#fw@Pfz@ VB Z 9]t#9tuƉ9ű1ɉDy&`VfX1e[^_]UWVS ]u}} {uE1ɉMu}s {$u}E1sDžt(juPuuSo-t} tvE 1҉mE1stMUs0jVjEURPS1-Mt} t5CNjU (QV{EP } u1E Ue[^_]Ujh`'u Uju um W|$wUWVSdX\WdAX \tG tAX\hlX\ptDžh1lzPd .ZYu@d@t4EUptEf=v1Pu*dGd@`Hpt1LLhld0TjPjWVdP+u+j\T]SjShKD`tLDžL뀋EP1Ej\Sj5E 9PuX\EU9u9u5LRPZYu+8k$ދ044WtF$uDDt1ɉ@7F$LPGP,ZYX6@H@9HGKÅG8W<@wDw@щ‰XZu8Dž<DžDB [JPD<B+0LQPaZY0k@H|8@k$044Q8<B%`DUVEUWVS]} ?sBS % AKщS‹9}CC1C*Cu 1ɉKKC1҉StKu {uR$uMfƒt4Pjjjj3tCCC1e[^_]W|$ L$f1_VWt$|$L$f1_^VWt$|$L$f1_^UEtH t u8t u@ t]USEP1VvC؉E ș} X~/} tP@ËM  %E % %˸ @y)ƒ~ PVSujujFP jVjuE e[^_]UVS]@V9DVuYCPk^u1LS\ƃSQZY<u V}) 1}tue[^_]øUVSÉЉʋMstttV N1)ӉȉډV[^]UVSӋpj|jRF CFCF$CFCX1C\1e[^]UWVSEU؋pFE1҉U11҉VN9ȉЃMUEL}E9uwts];E܋E9sMf{t\t8C<w -u hIsX6KPRCPU؍E4f C묉1V\EfEfe[^_]UWVSljU1ڋEs]w ZuXw 9uu Au1ZY[^_]UWVSƉӉMq~EPMQE P1RSjvWe[^_]USË@t lr<[]^rUWVSÉUME%Et}E1ҋu})׉ EUUK;StjNZECu}E)9} s} WusVuҮ})} E %Eu t6EU EU RMUYuP1uUu}u1;u} K;stjZususu= e[^_]UWVS É֋H4:@(1 EU t uu1EUQMQщ‰_ZYu,[4 t Uу tUuʁe[^_]UWVSHlj։:/uF .>j/VYZujVXZ)RVPƄ C hs4 u C Ɖu;JtJu" .=`Z 2=`Zt4 u?G$4n`Zun`Z}G111uG,*9G8_KG0؉9^j `ZX`Z u tC <$@u&@9C 9C ȃ?H1?Ik 1ҋ4.ދ .9t.ft3@ _v fDž?HBuNun11 r~ԃ uϋ9u%2 tZ< uH1Ҋ B9}{ t3.{ u 1ɀ{ ΍1TT@9}T1uƅ单Bu 1 9Åu8W4 t1H%9`Zk1`ZE >8/u;1?GQ؍e[^_]UVSSËBuzB ttBuCd$1$wR9S8ruF܋C4 uH%9sK t11Y[^]UWVSEU<Gjj,Zhj,jPE荥U:G zEP \*J ؍e[^_]UWVS(UԉM؋pV Bue^$)ىM9MsE؉EFEz4 u F E}tBH!ËF(EEE}}uMM1t@H~$61+UEEO9B8Eű}}t x)9}s}EE܅t61ҋMI t1ẺUЋE@01 EUE@,1 1WuԉʉًEZYu~$E܉F(})}11}tU؋])ڋ]ڋ]e[^_]øUWVSƉˉыEv~ t t u#1F$119r F$1ɉN([^_]US@K ,f{ u1[]USӋHA<%?mABB1BBQCXS\Bu@t1҉[]ø0JYUWVSSÉ։ʅ~; uJC11ɍ~/}1< /~9}| ƍD8A9Z[^_]UVSƉˍBc [^]UWVS$ljUMEG}L M)ʉ,I}tEEHRUjV E썘(Uփ E ^1҉,Ih6JeXM؋EtkGURVSuujwPEűE9tSPh8JNe E)Et"dEEEE1 Me[^_]UWVSEUMp IIt<9|8,IH)9}&hE)ȍPuK 11IIEEؙÉ]9]hwJrdYxCShJadXZE@PhJPd[_ t uhL5d1Ƀ}1ҋE Yhp.賞PWhp.ޜt9$I11@=Hu9HhJcZ3hp.WMJ^EXXEI H1)1ɉEXÅuO,IEIE)Ѝˉ IdžI9]} hbJbH)9E}L؍e[^_]USX(It1E11u81BHu퉃$I,I- IǃI[]UWVS8/u0IaËGh0IjPǃI`ǃIDƃ GDžjC|JjdS 0yJBt)֍DžIDžhPS5jhJPjuaǃ Ih`.Ph`.SCh`.؍J I0I`@e[^_]ËIƉe[^_]øUVSыuXtt…uII)ЉI[^]UWVSEU˸_EEpI;I}uȿ׋I)эME/uKI)+I9s9sRU}Pu藜UIU)Ӄ u1Ƀ}tEME^_Ee[^_]ÅttUVS Ӌpj|jRFdMJOFlMJ?FtMJ/ECECECICXC\ 1e[^]øøJRt'USËHt0I^1C1[]ËUWVS8EU]ǻ@1]E@URWhVSjUrPEEE=qjhJGP fE=UHuEfTBËE=v#]E%E%]\EHEPWu1RPjEpQEE9EGO11ӉMĉ]ȉEE8E8/uEEE9fFf]9FEU‰UU 9UtYw ]9u BE݀/t %ƋUBE؉EN]DEFN11ӉMĉ]ȋUfFf]9t %BE9rًE܉E؉UEċUȃEЉU1E1uQEUi[EHEPWhEЋURPjEpQC};Ēu!9u %}uC ECunC!K M؋MMM؋M }t%u ;u )Qw 9u0E@̄u&<.u7x;uU9t(@;t0 vEËE9E9syZjjP蹗Ep1FCF1҉V C F1ɉNUZ \J 8EEEEEEUZEe[^_]UH1҉PdZ1]UWVS΋xW__um9؉ӋU O_ u09؉Ћ}wXHPShRPjpQW9ukÁw)ىW)9sP1W)΃ Wl9} )ƃ}u1 E0e[^_]øUVSƉЉʋ]NtttQYq)։؉Q[^]Éы@B$1҉QQP@AXQ\1øJKtËtUWVSV}) 1}tMe[^_]øUVSƉЉʋ]NtttQYq)։؉Q[^]UVSӋpj|jR讉F CF|CCFVCXS\1e[^]UWVS$EU؋p1҉U11҉V;FFMUE}v];E܋E9sYtKC<w.Eu hILXFUЍKQM>uURPMԋU؍E>C렉1VUE|?E?e[^_]UWVS8E܉UMċXCE3{U芒Ut/U苒!ЉE؋E苈 t w]*M苑!ЉE؋ t w9{}ԉƉ t19uԋKr}t},}$M!ы}}t҉!׉E̙UЋUԋU;u ;k  t4 EE;tvE1E?9Mv)EU9~1t`+MIE܋HEPuԋEXRVjEpQEM9XEMuԋ4t H!EhEUԍPPԆEȉ uWjo 0HE܋HPWRVjEpQuvE̋UЉEME)ljEĉ8s{ [M]U1E+M]9щEr1E)NjEĉ8e[^_]UWVS$EUBEX}ut CHSLC4Ut-E1M1ɉM܋K ,{{hK|E1M1҉U܋KE1։U1Eԋ}EEUԋ}WMUE$9uEtP@@ tkE؉U܋E苸GEHuVWXE؋URPjEpQuvu9XuftSd CJtƀ}9~u} ]ǃǃǃe[^_]USX1҉Pt1tSXFC FF1[]UWVS4lj9FhjPjp FFE@X1҉RhdPu u DžRh 11RPjpӉƒY .x8b ȈX=CptBEvDž!Dž?cV}) 1}tMe[^_]øUVSƉЉʋ]NtttQYq)։؉Q[^]UVSӋpj|jRu~F CF|CCFVCXS\1e[^]UWVS$EU؋p1҉U11҉V;FFMUEi}v];E܋E9sYtKC<w.Eu hIqAXFUЍKQM|uURPMԋU؍E3C렉1VUEC4Et4e[^_]UWVSEUBExE1U؉E䋇E܉ދEEeGމ֋E1wx1ҋO` t1Od t1É֋E싀E]?E@URuw0VSjMqPÃuTE9G0uGE1wxu֋Ex @ǀǀǀ ǀ$؍e[^_]UWVS@ẺUMXCES}8}!lj}MIP tEU싃 E؋$ U9иU}jE@0EЋE9u E9E\EUE؉UEĉUȋE;u E;t| @PP*t 9(~S|P@p|6PPp0Hd t1WVjpRǃSR>t /u DždǍWG1҉P \e[^_]UWVSEUˋptEFV9F }8MUEu(}9sWuucs1>V}) 1}tMe[^_]øUVSƉЉʋ]NtttQYq )։؉Q[^]UVSӋpj|jRrF CFCFCFV CXS\1e[^]UWVS$EU؋p1҉U11҉V;FF MUE}v];E܋E9sYtKC<w@/Eu hI5XFUЍKQM+puURPMԋU؍E'C렉1VUEi(E(e[^_]UWVS$E؉UBExE1UЉEM1ۋGЙ!Ήuԉ!ދGE܉ًEe܉E܉UMșuEGӋE܋UډÉ֋E1wx1ҋO` t1Od t1É֋E싀EG3E@URuw0VSj]sPÃuJE9G0u=E1wxu֋Ex ǀǀǀ؍e[^_]UWVSV}) 1}tMe[^_]øUVSƉЉʋ]NtttQYq)։؉Q[^]UVSӋpj|jRgF CF|CCFVCXS\1e[^]UWVS$EU؋p1҉U11҉V;FFMUEE}v];E܋E9sYtKC<w/Eu hI*XFUЍKQM|euURPMԋU؍E=C렉1VUEEe[^_]UWVSD}] jjjWf$Bu@3j@uVW" u=h KI* R_tPPh @.* hL*^@tDh K* R[tPPh @) hL)Y ROjhoCV4d u&}u hZEdZuSVW8jhoCVc u}uhZEdZuSVW-u EtES+Rh2KVWXZE Re[^_]UVSujVz [ZyAu:KVhA( RZYtPPh @( 0hL(#uu P3ƃ tS 5 RX؍e[^]UWVS}]hjhZd`[ 15d[juƃxPVZY@u}Љ]%MЋU19}9}V& YE@'(08@HPX`hpÅuhDK'VXZ z}1҉vPtPV% t~)DžV^1l1;ppt1< pQt<#u ppҋppttt7<=txtZtyu [Fp`d[tHt(9 ~=`[~ d[d[ ~=`[~ 5\[=[y1҉[95[}1N5[t tt@hjh@S1_ u/>< [h<:BjhvKS^ u&l lL뢉Ѝe[^]UWVSlj֋]ju uPBu=@u:hSL! RZtPUPh @! ?hLm!XuSW] t19Et RhaL뙉Ѝe[^_]UWVSĀEE؋E @]esfHt R{E @<EEuPE P(H,Ex_Z@E)Ɖuu1}E 1҉P P$@(@1ɉH,H6%]؉Ej@Pu iu}?E1Á]UEȃE 1ۉ]E @<9E%A AtE=% U1ɉME1ۉ]u}u}uuWVjV)׋tt(Mu%]PxXZM&uWVqqMU؋E@M{+EUAQtEx1|EUx|uuWVU)׉u}tE@EUÁ]Uċu1E H<9^twt3 t.lE1҃8u9x$tB@9|E @>9t 1FF@SuuvvU؋E@t|EU+EUFV؃1EUG@_uuЋE@%]PuUЋEEƃ E]Xp1UЋEs1sfE @8k8EEuPE P H$EfZY@u1}}ȉ}̉}Љ}EEE @89E>}FrtEu$eEt_ExuF%]؋]CV LunLRPhsL3Kv vvv vU؋E6 @1Ft Eu'cEtZExuF%Mȋ]CFVM9ȉ]sEUF V$EЉUԋE9EȋEEs EЋUԉEȉŰV N$F(9N,s2Et,)PhyLvJF V()RF%]PF V$EUF(V,9EMs/Et&+EUEUԋE9EȋEEs EЋUԉEȉUE8_UEpEȋŨÃ]U1ۉ]]E tEUEUE@UE$EEE @<EEuPE P(H,EZY@E1EUEUE @>f}px@ EEuXE(EuPE^_@dE H>EU+EU}ЉDTE1EU)uuuWVUE@u1ۉ]]EЍp@E P<9E @>9mFtBw t/C}9j h~LEPS t'EЃD8u;x$t A@9rV EuL뤉Ѝe[^_]UWVSÉ׋u j1RQP+Bu=@u:hSL& RZtP Ph @  >hLXVE%PS t19t RhaL뚉Ѝe[^_]UWVSH} EE؋GueLvufHt RG0k(EE̋W uԉEzZ@Eu)E1ɉOG 41ۉ_*%Ej4PWEuԍ03%ẼE 1EG09EFFE=EЁeE EЍ\1u)ӋtuVuĉ%MPlXZN uSU؋E/ZY@&E؋M)؉F EċUЍLى1u)E(Nu1EG0E9EFEċtwt4 t/\E1Ƀ8uU9PtA(U9|G29Et1ɉN /N uSU؋EvYZ@tqE؋M)؉F EăEЃ(iuԋE4%}PuqUԋEEà E}ȉxX1Uz1҉VfG,E@E̋WuЉE8[@]1ɉMȉM1EG,9E9;%CtEu$_EtYExuC%MȋMAKLunLQPhsLAKssU؋E&@1Ct Eu'=Et4ExuC%uuFsE9sus9usuԋKC9s8Et2U)PhyLACK)QC%UP跌UċKC9sEt )9usuEȃ UЋE<EԃE1҉UE t E4EEEEG0k(EtEԋW uЉEl^@YEЋuG2ftvk(UЋX@EEuDE)EuȉڋE"[@G2k(M)ʋMԉTEȃ#uVًUEvZY@u1ۉ]ȉ]̋EԍX(EEG0E9ERG2M98CtBw t/}j h~LEP(J t-Eԃ,8uU;PtA(U9rSEuU)ЉCC1ɉMpL}unLRPhL>KsVUEi@uE@t_{vTSjM܋EZ@}u6}u0}u*jh0EPJ ujEPhlZL 1CE(Et-uЋE%UPu }u hUG)>[UЋE}t UȋEu+UЋEUЋEn}t UȋE]wE%uEE t1҉WG 41ɉO*j4PW~ E%uuG%}FF E%}؍8Uze[^_]UWVSujV_Zx-xPSZYxE%=@S_j/VEXYthЉt)p@l Dž.tBtpVW?KpjWËljhLY_ty5 R$PhLN xPS_Zy5 RPhL E%=@t jPVh@ \1ɉtk@\@\u  R 0t  R-P Jt t hL ZSXe[^_]UWVSSË} u.MEy ƅMu,uQuWhLJ XRQM^ZMuCxEF~ uQWIED t PWGZYy3ލe[^_]USÅu h!E XsC PshL u]ÅtUSÉ؋1, u[]UPhL XZUSMkw @\tu@\H U Q - R[]UM 0Pt 9tQhMj$h\ \UEPuu u UWVSW]E E߉)؋U9u Ge[^_]xtwAwo$0taE e[^_]鶀9sOj誀j 裀j蜀 j 萀^9yP|FYj qZ]wQ`XLUWVS]U CKBBtu2E @1ɉNN NNMEPuV%à tE}uuǃu~tbMt 9u[tC9P~#kEMPMu؁PN (uF@ tVZ1= REEe[^_]UWVSQMAQI w'k@\@\tt8t#IuFV i RkT\X\^ Qщ‰SYeY[^_]UWVSku}@\@\tt9ku1@\1uO utQ@\tGu NjGu‹Gu1@\tWP ku1҉@\Yt Rte[^_]À=\u)U\NP7vj0v\XZUWVS¡\1\t09r tL9sύH@Cu7QsJ\Qv RPhN'Pe[^_]Ë\\U=]u]E Pu5hL)+US1k@\tSXCu]UE PuXZ]á];]sUP]U]W|$wUWVSK(C,1҉S4S0'jK(Rp(P C8 us,C89rVU)RPp91C4C,C0 1^S4)9sVM)QPD9 )tRU)EPs8'9US4봋C4S,9u1C4C09sƉs0랉Ѝe[^_]út'x t!x$tHt;uA-4?1҃‰US]ukS1ɉJ KKKJ tK0B4?1ɉJJBB1ۉZ$Zu9s ЋU)ЉEuuEP1 CtC tVus?C )uu)sD{D^ 1CDC:?Cts}B 1FED0‰E̋K$tytCD;A s HKD}t9uuCtC tVusC )uu}t C$t1x1sDC;?Cts} 1FED0‰E̋K$ty$tCD;A(s HKD}t9uuCtC tVus'C )uu}tH C$t1ɉH$C?1EE{u2Eu؉p }܉xu0}xECO:1ClCE?s`Cl9sN}w%}ME}WMUEՍPSl`:UfTCtmm뫋ClwPSl`:fDCtፃ4CpCPCXPCXPCpPjCtPj EԃtE@bOo1ClCF?CdEChEClE̋U9{PKXЉEEu!Pfp9Es%}MEE@MEEfwm)EE@ClEftCt끍xfuZ9}s%}bMEuvMuEֈm)E}EDCrUmmxft(xl}MEuvMuE9}r؋}MM)AG}MEuvMuE9}r؋} MM)AE1}̍ 9Mr JE@{OCQ?fFtJuKl?{Q?ftuE@Op4CpCPCX {pstRU̍CXPWuVj EԃUtE@O!CpCTC\RC\PWshCdVj\ EԃtE@OCG?} tCH?}}v~E}؉x U܉P}8UPEC@tE@OQ?CLCI?SLtG9Us%}MEE@MEEփЋ}!CDm)UCDCJ?CTE̋K\ЉEċEċ}!U̍ yq9}s%}MEE@MEE<wp 8҉UƉEEċu!UЋu̍ Qq9Ms%}MEE@MEE뱉m)}m)}@tE@PsHCLCK?SLtG9Us%}6MEE@MEEփЋ}!CHm)UCL?}SHEЋ})9sIыE)9K0stE@PC4s8})9s)C,ƋCD9s u)֋CDU9s)SDEЋ}ؤ}9u{Dt)U(CH?}SCDU؈MCH?@ES }w%}MEE@MEEՋEЋu)uFC t8t4U܋})uK{t PRQPRQ CUB0C t1E{u9CtE@?t)R>?t>EOt2CR?+jjjWVPƒ9StCe[^_]US] EuMQB t Z$1҉S0[]UWVSuE^~u {@{S?tACS?C@S<1Ƀv AT SNCl)Flj>FljF{luMS1tC UC NMV~MNUSC??XEEEEe[^_]UEuMQzA?u1z@]UWVSQE }U rhjr(R à t2~8U t2jN(Pr(R ǃ U uSr(R$XZj8Ru hVSENP44E9r 9r)ЋMȉCPFT)ȉCTFp)ЋMȉCptN(Pv8W {8EX1e[^_]UE|¸uE@ǀ]UEOu MIQ } t tQ ]US]¸u1KYC?uQD1ҁL?u +QD[]UEƒuE@4@p)]UWVSĀ1fDE@u1;Etu FfDU@E0EEf|Eu+MuE@Pu@@E4f|}uGuM)BtLU)yt}}fEfTEfLE@fTEԃu1;Et#] CftLUԍYf\Uԋ]fK@9usuu9s}EEMEHt}t?}t}uE}Pv<J}TwEE ;E`;%EEEE1҉UE:E:EEEEEEDž|1E1)؈EEHE]9r 9r)]]]f1E`)EMxMM]]x)ً] ]]YfQ]ًx)uOEtt P]!fL}u]9}W} tu@]Xf@Eu}Eu01Ѓ[^_]UWVSDE@EEEE@]DEЋE@ ]S+M ]]̋][,]ȋ][0]][4]]{8}ԋ{<}{@}{P}ċ{T}{\}KX҉U}w(]SuNMUEwuU}!]čKm)M u fS@[t99}su6MuEuFu֋M!m)}}w)}W}O}7MUE}Mҋu!}4Nm)MvʃU؉ʃ9Us9}?M}}O9rEM}}EMMM׋M!u܊Mm)Uu)u9)9Usu䃾t]CPj})M؃}u#}ȉ}9‰Ǥ9uu9UsOuȋ}}}׋M)9sZˋMˍ 8Ǥ9u9]su)ЋuԉϤ9u(uԉ(Mu΋M9s}‰Ǥ9uƋM)΃vVPVPt@VP})QP΃ǃQPwޅFGGuGNOt@uҋM!Nʋu4]CP]CQ?P@uҋ}!K?? u]COQ?]SM9Ms ]9U])ӋMҋu!}G }9s )ރu)ރ]s]9r])Í]CEPu(CV9u!€tފCFt8t)[^VSD$ L$t 8tft`@͉ ыލ1΁ €t8u.t(8u!t8ut 8uHu1[^V|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊ҋL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_V|$t$ L$uD$^ÃrfftFG@@@@@@@@@@@@_O>@fA@Z@z@@9@*Bq@@yAzP AAI A&A.A%A-A8ACARAaAQA`ArAAHDv0|u!!!!!!!!!!  h$m$r$w$|$$$$$$11.0_BETANetBSD/x86 BIOS Boot5.12 (Sun Oct 19 13:53:08 UTC 2025)),E)8E)CE)NEp)ZE`)eEP)pE@){E0)E )E)E)E(E(E(E(E(E( F(F("Fp(-F`(7FP(AF@(KFHah!IdontNeedEFISFU0eCSFH0eCyD<#*=(mWC 3KOO;Mt?=rGy=iG}`1bOh3qJiX~B4ϳ3Dh&\ M}-|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+AM3iǁ(s*K>;-чH-чH2IчHIчHZIчHIчH\FcFhFrF|FFFFFFFFFAF=FFFF3EaEFAFFFFFFlEG GG(GEcbbbbbbbbbbbbbbbbbbbbbbbbcF JJJJJ!J&J. !.. !USTAR.volsize.USTARFSFJJJJ J&J!J KFJJJJ J&J!J K FJJJJ J&J!J KFJJJJ J&J!J KNetBSDNetBSDc)Md n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler    strtoulcommands are: boot [dev:][filename] [-12acdqsvxz] dev syntax is (hd|fd|cd|raid)[N[x]] or NAME=gpt_label (ex. "hd0a:netbsd.old -s") pkboot [dev:][filename] [-12acdqsvxz] ls [dev:][path] dev [dev:] consdev {pc|{com[0123]|com[0123]kbd|auto}[,{speed}]} root {spec} spec can be disk, e.g. wd0, sd0 or string like wedge:name vesa {modenum|on|off|enabled|disabled|list} menu (reenters boot menu, if defined in boot.cfg) modules {on|off|enabled|disabled} load {path_to_module} multiboot [dev:][filename] [] splash {path_to_image_file} userconf {command} rndseed {path_to_rndseed_file} help|? quit /Exiting... Could not reboot!invalid console device. No menu defined in boot.cfg truncated to %s enableddisabledoffinvalid flag, must be 'enabled' or 'disabled'. ufsNAME=%sNAME=default NAME=%s on %s%d default %s%d%c (invalid)%s:%s%s%d%c:%sbooting %s (howto 0x%x) boot returned %s.gz%s/kernelmultiboot: %s: %s boot.cfgPress return to boot now, any other key for boot menu booting %s - starting in type "?" or "help" for help. Wrong password. pccom0com1com2com3com0kbdcom1kbdcom2kbdcom3kbdautohelp?quitpkbootconsdevrootmenuloadmultibootvesasplashrndseeduserconfonetbsdonetbsd.gznetbsd.oldnetbsd.old.gzonetbsd/kernelonetbsd/kernel.gznetbsd.old/kernelnetbsd.old/kernel.gzdiskhdfdraidcouldn't allocate module %s%s/%s/%s.kmod%s%sLoading %s WARNING: couldn't open %s (%s)i386amd64generic/stand/%s/%d.%d.%d/modules/stand/%s/%d.%d/modulesWARNING: couldn't stat %s WARNING: couldn't allocate module list FAILED WARNING: %d module%s failed to load module name too long couldn't allocate command WARNING: couldn't allocate userconf commands list exec returned/prekern%s is not a multiboot kernel Unexpected ELF class%s %sELF_SM3__SM_%s, Revision %s (from NetBSD %s)multiboot2 info size mismatchStart @ 0x%lx [%ld=0x%lx-0x%lx]... lseek failedread failedUnsupported multiboot address header Unsupported multiboot relocatable header EFI PARTUnexpected raidframe label version , bootmeOut of memory disk cd0 cd0a fd%d fd%da hd%d%llu GB%llu MB NAME=%s( hd%d%c(raidframe raid%d serial %d in NAME=%s size hd%d%c size raid%d%c(%s not found NetBSD RAIDNetBSD FFSNetBSD LFSNetBSD SwapNetBSD ccdNetBSD cgdEFI SystemMBRFreeBSDFreeBSD SwapFreeBSD UFSFreeBSD VinumFreeBSD ZFSMicrosoft ReservedMicrosoft Basic dataMicrosoft LDM metadataMicrosoft LDM dataLinux dataLinux RAIDLinux SwapLinux LVMApple HFSApple UFSBIOS Boot (GRUB)unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660ADOSFILECORELinux Ext2NTFSjfsvinumUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedVBE not available DDC [DDC1] [DDC2]: no EDID information : EDID %dx%d Modes: VBE2none foundVESA[?] 0x%x=%dx%dx%dmode 0x%x invalid mode 0x%x not supported mode 0x%x could not be set WARNING: failed to set VBE mode 0x%x list0xmode %s not supported by firmware invalid flag, must be 'on', 'off', 'list', a display mode, or a VBE mode number %c. %s %s%d. %s Option: [%c]: Option: [%d]: Choose an option; RETURN for default; SPACE to stop countdown. Option %c will be chosen in Option %d will be chosen in promptbootinfo too bigunknown command > com%d seconds. 0 seconds. -%c: unknown flag invalid arguments diskbufp %x diskbuf crosses 64k boundaryufs/ext2fsbad dir entry REGDIRCHRBLKFIFOSOCKLNKmsdosdosfs@Warning, unexpected short transfer %d/%d ustarfs read512block Please remove disk %d, insert disk %d, and press return...Disk is not from the volume set?! %9oustar%99o%12o%8oustarfsCD001cd9660lfsWHTread header failedread header short=0x%lx Could not allocate memory for boot configuration bannertimeoutdefaultvalue:%c clear \\-__,------,___. \\ __,---` %s \\ `---,_. Revision %s \\-,_____,.---` \\ \\ Password: lseek section headersread section headerslseek sectionread section+ [%s%lu+%lu.SUNW_ctf%s%ldls: %s stat: %s no ls support for this file system %d: %.*s (%s) %d: %s (%s) The ls command is not currently supported for %s Unknown error: code %dbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentNot a directoryinvalid file offsetPermission denied1.3.1|/-\heap full (%p+%zu)unknown compression methodunknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check%s: invalid base %d ;&,pTЈq*0HƈܶZldjà}ѥ@ܙNTךkkrss`ss|nA0G*JXJ/Ѷx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f W*))1_WVRVRf* ufZf[fYfgNP 00<0u ^Boot failed (errno xx): t &N jh`)mZYUWVS$P *$*$*h)jh*pƒ e)là *@$*yà *$*D$T$|$7) j$Sjt$t$h*t 11"f$~Uu뀼$BujSjD$T$RPh*WujSD$?P3D$ u$u$w$D$($$D$T$D$T$ <$v $ t 14$Ÿ1|$|$ |$|$D$,1D$0|$(9|$j$Sjt$,t$,h*}1t$$|$@)jD$DPS? C4%ts K$ D$ D$uC D$C$D$|$@ )t$@$jVS t 9u1|$ |$ utC D$C$D$ D$$$9l$$3L$,\$0L$\$ l$D$ D$t D$T$ D$T$ *$*Ãul=WEVt t)=WEVu tࡘ1ң *$*$Vu@ *$*~Ãt$PS3ZY@t$VhSƒ )9u)=Ҷxu1Ā[^_]ËD$L$|$uNuBtt6jt$ PD$T$ *$*RPh*@u1҉ËD$`ffaËD$`faUWVS$\$8l$H|$DD$D$<T$@$T$CtHupKș9 $L$|_CuL$u؃fD$f|$fD$UfD$D$@T$DD$ T$$T$ZuSt$Xt$Ѷx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f W++)1_WVRVRf+ ufZf[fYfgNP 00<0u ^Boot failed (errno xx): t &r jh*oZYUWVS$P@+D+$ +h*jh +pƒ *lÃ@+@D+yÃ@+D+D$T$|$7+ j$Sjt$t$h +t 11"f$~Uu뀼$BujSjD$T$RPh +WujSD$?P5D$ u$u$w$D$($$D$T$D$T$ <$v $ t 14$Ÿ1|$|$ |$|$D$,1D$0|$(9|$j$Sjt$,t$,h +}1t$$|$@*jD$DPSA C4%ts K$ D$ D$uC D$C$D$|$@ *t$@$jVS t 9u1|$ |$ utC D$C$D$ D$$$9l$$3L$,\$0L$\$ l$D$ D$t D$T$ D$T$@+D+Ãul=WEVt *=WEVu tࡘ1ң@+D+$Vu@@+D+~Ãt$PS5ZY@t$VhSƒ *9u*=Ҷxu1Ā[^_]ËD$L$|$uNuBtt6jt$ PD$T$@+D+RPh +@u1҉ËD$`ffaËD$`faUWVS$\$8l$H|$DD$D$<T$@$T$CtHupKș9 $L$|_CuL$u؃fD$f|$fD$UfD$D$@T$DD$ T$$T$ZuSt$Xt$:t'~uf>?tV4fX uftfufff:2BZR}s0״t 00);v堐,;:us ZPf1$ffu?HBbZ1ZRRf.:2BZR2r۠|t}=U3ufZ|Error Fn: diskn0: I`uaUѶx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f W+P+)1_WVRVRf+ ufZf[fYfgNP 00<0u ^Boot failed (errno xx): t &C_jh*ZYUWVS$P++$`+h+jh`+pƒ *lÃ+@+yÃ++D$T$|$7>+ j$Sjt$t$h`+t 11"f$~Uu뀼$BujSjD$T$RPh`+WujSD$?PD$ u$u$w$D$($$D$T$D$T$ <$v $ t 14$Ÿ1|$|$ |$|$D$,1D$0|$(9|$j$Sjt$,t$,h`+}1t$$|$@`*jD$DPS C4%ts K$ D$ D$uC D$C$D$|$@*t$@$jVS, t 9u1|$ |$ utC D$C$D$ D$$$9l$$3L$,\$0L$\$ l$D$ D$t D$T$ D$T$++Ãul=WEVt *=WEVu tࡘ1ң++$Vu@++~Ãt$PSZY@t$VhSƒ *9u*=Ҷxu1Ā[^_]ËD$L$|$uNuBtt6jt$ PD$T$++RPh`+@u1҉ËD$`ffaËD$`faUWVS$\$8l$H|$DD$D$<T$@$T$CtHupKș9 $L$|_CuL$u؃fD$f|$fD$UfD$D$@T$DD$ T$$T$ZuSt$Xt$A닉1S@E f%f=]VYL$@PVT$4P  $9T$,~SE4P`D$$Ht$(Vt$Q|$Oq4 t1WVjD$putSt$T$4R |$,/uD$ T$D$ t$,6\$ 1EE+G+,L$  $D$b $L$D$0[^_]UWVS $׉ˋptFFV9F}9L$T$$u'l$9sUt$W1.V) 1|$ t|$  [^_]VSӋpj|jRqF CF|CCFVCXS\ 1[^SQ\$$kD$ +TًT$=+Zu+$Z[VS1+;uD$@ڋD$ t(F uڸu1҉+[^kD$ +T$+1WVS +1+t19r t<9s׍QICu'L+sL L+B H [^_Ë++VW|$ t$L$1_^wHËL$1H@<uW|$D$ L$WX_VW|$ t$L$Wt 9rNOX_^ZIчHIчH-чH-чHbootset_geometry Can't open /boot /boot load failed Invalid /boot file format NetBSD/x86 lfsv2 Primary Bootstrap EFI PARTlfs+" . .. chroot  installboot wiconfig# . ..,misc, .#.. . ..- db. log/ run0spool- .... .../ ...0 . ..1lock1 .0..