08Dh<  Dh{7t tDh@@<@T 08Dh<  Dh{7t tDh@@<@TU Dht`ADhDhDh$h DhDhDhADhDhDhA.DhDhDhpxADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhmD+DhDhDh (08@HPX`hpx $DhDhDh@HPX`hpxN$>DhDhDhK$=DhDhDh M$XDhDhDh(08@HPX`hFADhDhDhCDhDhDhADhDhDhADhDhDh!DhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh!DhDhDh4!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh B!DhDhDh B!DhDhDh!DhDhDh"!DhDhDh"!DhDhDh"aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh!DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh?\!DhDhDh>\!DhDhDh=\!DhDhDh<\!DhDhDh;\!DhDhDh:\!DhDhDh9\!DhDhDh8\!DhDhDh?\!DhDhDh>\!DhDhDh=\!DhDhDh<\!DhDhDh;\!DhDhDh:\!DhDhDh9\!DhDhDh8\!DhDhDh:\!DhDhDh7\!DhDhDh6\!DhDhDh5\!DhDhDh4\!DhDhDh3\!DhDhDh2\!DhDhDh1\!DhDhDh0\!DhDhDh7\!DhDhDh6\!DhDhDh5\!DhDhDh4\!DhDhDh3\!DhDhDh2\!DhDhDh1\!DhDhDh0\!DhDhDh2\!DhDhDh/\!DhDhDh.\!DhDhDh-\!DhDhDh,\!DhDhDh+\!DhDhDh*\!DhDhDh)\!DhDhDh(\!DhDhDh/\!DhDhDh.\!DhDhDh-\!DhDhDh,\!DhDhDh+\!DhDhDh*\!DhDhDh)\!DhDhDh(\!DhDhDh*\!DhDhDh'\!DhDhDh&\!DhDhDh%\!DhDhDh$\!DhDhDh#\!DhDhDh"\!DhDhDh!\!DhDhDh \!DhDhDh'\!DhDhDh&\!DhDhDh%\!DhDhDh$\!DhDhDh#\!DhDhDh"\!DhDhDh!\!DhDhDh \!DhDhDh"\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh\!DhDhDh \!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh!DhDhDh !DhDhDh!DhDhDh!DhDhDh$!DhDhDh4!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDhaDhDhDhaDhDhDh!DhDhDh!DhDhDh!DhDhDhaDhDhDh aDhDhDhaDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDh?\aDhDhDh>\aDhDhDh=\aDhDhDh<\aDhDhDh;\aDhDhDh:\aDhDhDh9\aDhDhDh8\aDhDhDh?\aDhDhDh>\aDhDhDh=\aDhDhDh<\aDhDhDh;\aDhDhDh:\aDhDhDh9\aDhDhDh8\aDhDhDh:\aDhDhDh7\aDhDhDh6\aDhDhDh5\aDhDhDh4\aDhDhDh3\aDhDhDh2\aDhDhDh1\aDhDhDh0\aDhDhDh7\aDhDhDh6\aDhDhDh5\aDhDhDh4\aDhDhDh3\aDhDhDh2\aDhDhDh1\aDhDhDh0\aDhDhDh2\aDhDhDh/\aDhDhDh.\aDhDhDh-\aDhDhDh,\aDhDhDh+\aDhDhDh*\aDhDhDh)\aDhDhDh(\aDhDhDh/\aDhDhDh.\aDhDhDh-\aDhDhDh,\aDhDhDh+\aDhDhDh*\aDhDhDh)\aDhDhDh(\aDhDhDh*\aDhDhDh'\aDhDhDh&\aDhDhDh%\aDhDhDh$\aDhDhDh#\aDhDhDh"\aDhDhDh!\aDhDhDh \aDhDhDh'\aDhDhDh&\aDhDhDh%\aDhDhDh$\aDhDhDh#\aDhDhDh"\aDhDhDh!\aDhDhDh \aDhDhDh"\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh\aDhDhDh \aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\ !DhDhDhi!DhDhDh!DhDhDh!DhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh!DhDhDh!DhDhDhaDhDhDhaDhDhDh!DhDhDh!DhDhDh!DhDhDh B!DhDhDh B!DhDhDh!DhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh!DhDhDh!DhDhDhaDhDhDh aDhDhDhaDhDhDh aDhDhDhaDhDhDhaDhDhDhDhDhDhbpf!DhDhDh $DhDhDh$DhDhDhn$>DhDhDh$DhDhDh$sDhDhDh$DhDhDhADhDhDhm DhDhDh$DhDhDh $DhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhq߾h$gф/:D!bF(0?dCRڛGԋebs<{g=4e߼HRI8 Fcv_={~!]b<6Dz7fRŎ][!|vD`O;?.~%COx6P)'UZ>(JBa$pם0t5gk>ۿ1~c5v[Kyt `!sϬ27 )3)s;1~|8;s}*^B4{ (G ]hXM^610cqMnHFTq:}T9{\yey~1oZHn:(ulQjal_U!l /+PP DpZhr2,e6R{Q}uK7y-Zݿ$H^%QTFH)%-`R t^KfPN4UY .X]Vj[t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4(4 (SSU LLUNetBSDAPaX NetBSDearmv7hf3D0D 0p@-0PUH2H0@3(1*03/X@ B0`  T00 ~~̱dH0ah%JIH'8LOLT 0I  '(BF5DO-9F 5FT,AF8F4'] (@18P-OFWKO x@eTM+`PIXFCh7(IѸ@`VФ3h>F+`fpywh+iK8F_v "oȿ+aoXF`P;HYFh#Oc+a8K` F_b M)hHF0ZЛB) F_%jhR"!XF_R_60 F_r1hHF pCO F_d1hH>F3h+)FXF_(, I ^I#hZF8FD_( DљƣHe ͔\e Ɣ\ ” Kn:f*oB² *I_CmQeppG\ 0] DJIFFH' '6] Jh3`pGxi -pCF-FK"F)F0F` A @FIF( e KA1 I H! {z"h'pY@xi 4] 0p FFmF@)F0F H1F p[h-ApG#sFF `.=0F_FXDh+J$h#@c`.2Щh0F_(C+I+H O$)KEpD9F.20F_0*Dh-+.IH$,H_F(ѩhH_(ѷ OH)F($ I$H O FH_00+.ri |hK-OhFH_zI _VF(~ЎIHN$x!Fj"F_AF KXph+KJhhCЅK+@Kh+0yH _b0nvI|H0F_+nvKh+FuMmJ tI(F'0;0+ PF2pFđ(F (0OUУh!Hch&#H####&oH## #&o"hH&#H##& Ma!@ B= 0 / '+ 0@0M0aܳгo$0+[ЃK0#0#+`O~KI~K0 #0 {K{H*FA6+h!F۰O6;+`B=)E(0+I+h9FlJlH2lJ2 2:FiK&&,0;gKgJhH #F&fH l)eK0 #cI;+`B*`)]I Z*`B*`)аoаTH&6X h ! #f C 0+$03DK@A!DJDHBAK@B!>Jh/Or_Esy9FXFA^AFFF(FA2RFF F A*FFXF9FAI1FF AFF 2Cq# @! #4!JF+FH&vjrܝE(\?xT`">(.Ez!ŞQT\qz!YF8FA U YF8FA wFFF=FH00+@,0+#H& $ph "40+#wH&\Bw )FA;F1FF ApF FF(FA #3 &R::F9FdH!&$hbMN*hh *h2h *h2 2C# @! #FIH&IKj+ xcQjVr:H !2F+Fx=H&z{+h/NOrWE{X-9FPFA[FAFFF(F@JF[F F @FFPF9FA[F1FF @F1+F H&>QF8FA5 U QF8FA 1FF=FI"+F2F@! HL(z!ğPF!F I V&`9FA6DB ՟pF Mkh*IF*H%*H (Lij˱"!( B$h~IFH%Hj#aj2F!@F>(ۆB Bh\ IF H%H(F.a} Hxcȡ] ({!̡$#J#p? `"J`]4F H K(FF(F@*F + i#U>`|!(}!ȡ] |! }!0~!-OFFFF(H%$&DB { x405BI%H P x ^+\(\  HYF=( 5O500 x00 x00̣0] @ѣ4ڣ8I"@ h#jF ` I\( ۽0+;J`0+;JS`]|!ht@0 KZh B)iBHo |!-GF&MFliPO +iBkic!Ho Fki+Ж+i+$4tki+.,<ki+,i FFMF(Ыi+ #"#AFF8Fb(kiBѾ|!-CFF0HfoL0B̿H F FFB (F()i;F"F@ (-hLF|!KJh30 H-oa9 Ki" 2 #Da Xd |!B Kh30a8Ki@[HoXd |!-CqMԁli p;xY2I +"(7p )(((iiiiiiiiii^.30-.^. LD"0x?.. .@ 300xA2@ (IA#EI "`|CF;3Ah"+=Ho Fs۲20Z-.^.#O3DO3 1HA#,I "`JCF;3Ah"+*..0/li*/YBYA0xB30z*К Xxpb;.0jikh`3k`,i`B,+iBڥO4|! }!Xd #Lc`ci3( ch+F"+b`h!Ѣ`!hch 3 c`x,) ;) +F"+b`F Ѡ` S0x;+`aBу|!! L FF R .F3V˄E5F+/`:5F!|!8F iFp@hPIFH$|H F8##+iaȡ] B <\+9@  N0 ~3h8"#3`3iSIH($HlF?(F 0F9Fc I F,/*/"bU"Zpp3iI" Fw |!| J1h8#@ C`|!F H  %;"@hO1#@;|!'8L`a1da, *1I @B"``3x S0x *ћ+2x.*rx *0300FF0;0S#h E" biF#`B#10;0+#hԛ8FF,F(o|!\ -CFHL#hB07U%B0ЂB"(FF8FhFca1(hAF$#10;0+_ hKMѽ*F9F H0;0+6o#i1F B̿r"((FhBF,8FF0FF;hh+`B]`00Կ#hȿpȿ33D#h  0FtF8FpF |!-GF3Lhc'eaBF"ܯB ݪSOO +J]00F30)F0;0+4#h N'* 0;0##hԛ=6h`i0;F'Fbi@FF+F(o |!-C F*LF FF 0300;0+:#h 2 L#i9B̿h FHF1Fh9F#i5p[9#10;0S hѽo |!-OF^LF'#iB̿H F0FF]ETh {B۷=F0Ou5D30)F(Y0hP;0##hdԚgDJAF10FSe(w0>3fa0(Abi Fo(:#10;0+\ h68ѽ(FF(K+ih;DB:ݳ y IF2 ^@hZIFH$H0;0#h  q0h;0##hԘQF*i8D@+i-hDVo |!ȡ] F-Ljp/1QXibB?+D",(Fw09F30F@hIFH$H50;0+#h  0jp;0+#hԛ2x\*rx6/*6|!ȡ] -G#Ll2CЬH!YF on B;@B0 F5D30)F@&hIFH$H0;0+#h C 0nP;0##hԙ1%@!"p x +8"B@B0.F6D301F4(0b;0##hԚ*Fo@1Q"ZU8x!XBXAt!+@%+n nB"۵F0Oz  D30QF(?o0n;03#h?z?|0!xSU0Yx\)љ[xU5F~B.n BEE.F0FF6D301F(?30n`;03#h?>?@0nZ x1ZU1 [x 'H1n`+DBݳv 1F2 (?0n`;03#h??13Np DBvp{0++1H|!%ȡ] Ȣ=`~!HF'F>aCB!ݳv 1F2 &(?0n`;03#h??1>F+D++Q*>DJ1h8#@ C`'|! KF1x!+ I? /! F< H+  |!,%7KL0x +9IKh0xP1E *DH 30 *!i 0x!+0(0/HP-6u0)F30@$h%IF%H#$H0;0+#h B 0P;0##hԛ# x )"TV(QYxT|!Xd Rcȡ] K-AhL0F E2Pi (x /9!ȲY(AY)><<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<Z<hHqX<Owb<}%E0 F+n*p*l*0 x + JHEE1 3h(o(FaiF(% F+n*p*l*0 x +1  %(`iE0EEaiF(% F+n*#p*l*0 x +1 (#B3caE0EE!)iah)Hv[x320[ HnXd |!x*F(?r% F+n*=p*3l*60 x +L!i (Y(R(3x 1KN!0Fw(@lJ#1O3`J`5E0EE!+СH"1F:3x+Hah)[x320_F(? x!+іH%E0F+n*p*l*0x +ݮ xH":HVEEQ H!i (Ӯg/ G/(F(ɮV/ (  ( F+n*p*l*0 x + 1)F31zE0EEch+?% F+n*p*l*0 x +hQJx+?yPIPH#,sE0EEch+?׮% F+n*p*l*0 x +=22+?JE0EEh 3H$%E0 F+n*p*l* 0 x + 1 Jh8EE`iA( % F+n*3p*l*0 x +1 #B?E0E`~!@<=Ѥ!ȡ] Eh _x(%`3F+n*p* l*03x +9FKE0EEaiF("Fn)p)l)0x +vB(%B0BBaiFf(mu7(fch HNh.$#iB? BuۮB% F+n*p*l*0 x +.1 k0F6H#E0EEaiF(%"Fn)p) l) 0x +BB0BBaiF("Fn)p) l) 0x +جB`B0BBch+?N% F+n*p*l*0 x +2^Kh ]Kh2E0EE#ch+?   F;l; ۲+  x +1+2q/iO5[x320]ch #i`3F(?{% F+n*:p*0l*30 x +U1 !3x2!+ ,H"1F:3x+1+?4&Nh0F(J?J#iB?F#1AE0EEO%.F0xg*M- *=0: *,?P "9F`@80C?@h"+>Hb t'0`~! }!p*"r*#-0x *-[x +*ѥHٻE0x +2H̻E30EE2E#2D#20b30 i`F0;0+#h  ZB (=#b20;0##hԞ-ArIm(~!2C2 xn+Rp+Al+IaiF^(e% F+n*Lp*Bl*E0 x +?1 |!D#!2rCH2Ճ# #2C22 2C2CE0EEaiF(u(ch+?h.#iB?u% F+n*p*l*0 x +˪1 0FӺE0EEch+?:% F+n*p* l*0 x +E0EEߢx!Q)300 O5%x320Z:F(?!ich C73 F+n*=p*3l*60 x +W!3x2!+ ВH"1F:3x+1+?;NHI#W/F0Fb(K#iB# 9(?E0EE1+?12+,q(o$ch+?  F;l; ۲+  x +gHai `D(0x1;+"Fn)6p),l)/0x +ҩVKhh#iDBFV?&QI "OM`(`@80?h"+IH.`B0BB%E0 F+n*p*l* 0 x +ch[h4H"EE!ich+?](% F+n*$p*l*0 x +` 00|2+fHyE0EEai `DF(Mh"F» H2oC`~!|v/0 }!BD@'HS+"]pG!x^+0x]+0x]+ +[+Dx.۲+ JBF/F])ѢB F ) F o-GFP,F#xB +.eJ BS@B4O.F6D;h1F3;`P(7?hK,IF,H"v+H;h;;`)Kh [+\+ 4F( Ht&0Fcx +HF H;hJ`;;`+Khԛ,a*F0F>K"rU@h+)F0F #G(}!ȡ] |!|! }!!,Jphx (*H# ( (L01'H0 Y`[x +ЃBMF pL0Kh۹vK&0)F`Kh8(J@'0B00a 0(?4h IF H" H }!ߢ!ť!!ȡ] -O_N`L3hZ2`Yx%)"h5\O%|3hxKEX EF۵F;hOxD3;`AFHP?hDKIFKH"pKH;h;;`HKh xIE33`CHt h  N;h;;`+0ԙ3hZ2`x"h +SU*3hx*P;3`B@B'O.F6D;h1F3;`(;h;;`+!Khԛ#h"`ZU\+'3h5Z2`x"h + 0oKh+jXX(Н0D< +?Y 0#` 0]FO }!Ѐ!(}!ȡ] |!,~!0~!\ # MF `F`*hx /J`##` (+hx *кB3+`+hx1)?$I "`(h0`@80? h"+H4`og*3+`# }!Ѐ!-OMFNF/h*hh0B"ۜB@BO&F6D:h1F2:`/(;h`;;`+yKhKԛN+i"U=:x&*^  Bܤ KFSE*iH۪ Eȿ#FD  {2hYF22`>h]IF]H"]H23h;3`+o FSKh  3h;3`+JKhԙD\3PT\*Yzx 1)S0:BOX E ܤ KFE*i5ܫ Eȿ#D/O q:h2:`>&h&IF&H"&H;h;;`;h;;`+KhԟՒD\3PTFB@B2h'F7D22`9FN(?Z3hp;3`; Kh?j?l +iU44Ѐ!(}!|!ȡ] -O} FF#/(Kh#!i #"#i"# AF(@2FMF`h7Bf  E?`IDq(i 2 >hIFH"H : Kh ( : *xKhԙ0+ # " F>(i!F0D>N JF F[hK>o HF }  E!IDq(i 2 { ( : *TKhԛ0+# " F(i!F0DNF> 2D!x)7DAK? h  EO QFOq1 Di2 53KH>h/0IF0H"Z/Hs0;0+?RC#" !FD(? 0;0;Kh?4?6/ 2CH:Q Kh+# "9F Fx(i:F!F0D> J+i# K hKE &`S`9Ho h0 `T:FFb >!hFH(+Ji +hO 3+`0FF+h;+`+"Kh A "hFB+h;+`+Khԛ&h  XFF$F(:F1F0F( |!(}!|!Ѐ!|!|!-O[O[N;h3h3sh3VH^oSL#hRK"`T R $0(F30(<+ # # | FOl E ^AKh .3h0sh;`s`0;0+a7KhV  R2 ܾ' `FSXSP ;Dhh0 KhXhhh`X`KhhXh`X` hY` ; =?a [|!<!4~!,~!|!|!(}!-A &M2; Y J#+`Kh`JhZ`\ Y/ D+`hThhB F FKDF#F!|!<|!-CF LFFh"hB#hO bh8F P#50Fh`0Z"`d1  "`(|(Н IF H" H2`h !ȡ] >0IFFH! !] -O]NF FF3h˹IrhK* FG()FH  ;pCO>D#`o `Ob)F9oB>4?# FY>(pCOгhS FY(pCO3hkh[+x/+2(FYH)F FY(@B3h+@ހ!F(F=(8H"F)F `z(#FyJtOa!HotOb!F `9l `F(OakJ `!, `Y(fH)F/!(F勉/! FG9F@F=FX3i+@׀si+XOX8F:VIX"F!(0;0+@F,F88F (0F'F o3i+@si+shoc)FF[ #FY6P oEE(.#=( ]`YPF(ѼB&.#=N ]`YD((NqBBRBB= ]`ZF)F>: ]c ]`JF!F>. ]c 3i+Ksi+u!F(FY(Mi+T ]WX2-dL"#kG#cchCU3B+ ;hS"##\0.+ѻi3k B8F +ˀmsEsBs 8i B8FBs h0B_Ѫj BF7H0ҲCBF#  A h+ii)Vi&J !! X i(j)P+j J !! d XF<\ BFPF 9F(FF Fk+)њ!jHF!&#sc!g)^X"-GFhF I L :(IjF Y 0 J`#3Y#ah'%O JFAF0FCfюKbml C"mCЊHhrK`m3 id#eBaoCC  Co C@M#hE+c)@c(@G#*j+[+Z oKc`l+@rcm+@ph+@n"miKiI* F*F#c.e0F`i#d1G+HO|WdotO #ã`#d#3`ce3m3Oe`#3ced&#`#3cedO3e#"2#Od>`O ## 0#cf%E#c#cE #"cdff#cdf###`#!ht@DV ħe!z x#`#Oa' 1#'cbb#cb#b#a##d##b##g#cg#cd#f#g#g##a#0##0#cdE@= +IF+H!  E$I8FXj+[b#hA*ѢEEK#n Km KK+++KK#n Km KKKKKI c] @!Sgaffee!g%ffequMyuH8FKh<jFHD\ D8!̧8FKh<jFH D\ D8!̧l\m!J@A DOb!FXC=hIFH! mBh@AiJ ##TH KJhhC F Kh F!FH ”Χ] ܧ!!\!K\hjHY7HFY3!”hplKJhhCKAh˱K "!!JCS!b:0I H 6pKNhK*FKhU(OsAq;F F0Fp@X !(!i$!(!2F)Ff!FFH F.(Fp!Ėf”-CðF;"!%F< ""!<&DBҦ!FBFF@"sD(FCB "? h"!4D<0CE"? :-O FNF-h!F(FW^(<h+𐀝H"F)Ff'# FXlF(h (FXd H)FTI"FH O{h;{`+D8F+?FB'8F;3i+! FX>( FXTF((FX2F(h){K|J )FF9FZ9FFxvI !CFnH ;hZ:` {h;{`+ fH+fC ( Yr;hZ:`x (sh+"F)F_H 0 FXx FpCOW(VH!FrX(FXF)FQHfpCO@F(FW0@a FW(EH!F@FWH8si{3O F!@FW x)F4pa'Fa(@FW&8FiZF8FWE !F+Hr FX((H!Fh3h Jz+0#HFQF##3`A #( ##F*FA1 I H! {z Y@!{FP] \ l?_ 9F@F202H!F @FW 0 @ˌ$ˎaF8FW'H!F8FW`<h+!H!F#@c8FWH!F58FW H<h-+5!FH8FWn!F(FWFH)Fdsh+?w"F)F Hp!F(FFj"sFhFFFW( I L5K(F`I!FUWW&W"p罱W F!LWWW#"F1F0F( I!W F)FLWX-AMCL'ch+nFAIhjF#%3u`W(<\;Jh(FDhOBW(MKca #k`S0O0jpCObi BI_'@IhWLp##a0`+@:K:Jh`:J` #!#a*`*@1Kh1K.`O8#"#h9j??<h+$##aY pD//EKh.A2FHFQF:pC9K# !#a*`+c##XЁ!!d."!ȩlu0m8@|!!/%/^;NOFOA1`Q F CF"FHFQF:"qhC[ѻ4`O S3`/6h/o03/P$KOB`OF"K`*?W0GRYBJOS` GQPBOR GQPBIOR+ ` )OS)`Kh(ORO ! KMi+ Lch+ݠhOBiFW<(`` MЁ!X#LcbKi #"#h9d F <Jh O0h*&(XЁ!b Ki* I UO0h(K JIhhGЁ!."!FFF$*F1F8FWD-D F,FFFF$*F1F8FWD-D F,FpFM Flh,Nh1i)FWJ#s`hB`3` FpW#s`l`D-Kh+,I -<,()I"FH4>$Kq"hBFB8 I O0*(>0+I HOq$&H!FiGL#(  W) !FH J`Y !!ƱL/"-OO 8M$8H+hFFh9FYFE$кXO;XF -I (L)Kh+(I(I FO $@F+hAF#H[jGF0+hiRIJF$HF4 k!F@FG(HFKh+II j*hi!k HG("2"L/"!<_!!/!MFHF'p1FH鈹h/##p-K)FJ O0 MK0Fu")F9x/#X;9FK JE|#p 笈!ٲ!hF;`+ VhZ` "ppG-OMO3F+h( (+hjG(+h kKhFF+7рL4 F# FF( F((O3uKh F# F(.@΀nI" VkKh  (ڨ Fp(оbK4+`O"FV*(;8ZJh P ;+! FyKHIH#y/+ 8KH9JIFH4^/ F FEKh+ F(0K@J+hZFKF F(O +;hIB FlG(UC F(2? F(: FF('! F(!#y/+ 8H9FIFH4KBFHKFlKd0[:&Jh ,;hjGI" V2 aU#AW(L/"!!!0] \ ."-O/( /[M+hlG(+hjG(( SKhF[QKhV:OJh MKhùMNT+hjGII" U (ڷ ++hIB FlG(8KSA F(0KS# F(+Kh+*HV((O;h C#HVv갹:h0B`CXRhBAKBA FG(! F(+H+KBL/"."Ƴ@/"!."h!(hK"`>J(F232;Kh+:z(90+?R̐0+?K.Kh#0B&HU((00;"KBAKBA%KH4+> +<;+ P( H.P."6T|@/"!."!!!."."!8/"!."0/"(/"/" /"x"FU( :8Jh PJCFh y 8F  (+:^S2J8h _O92BA BCX0)sAF8FD(O9HFYBCX0BB RICF(  UT( :SJ8h BBBR ICF(/"x!<d¶pL-jMN)h hl( #haDa2Br2p 3h#b (ۄK"O0`x!L/"."P-A  3N2BOtqF FDaaPеh*F#F80FU0뀻Oy$# -w'.BCX0)s0F-w6Kh /CY 92J#h @I#* .32C O0 /Bw0F*F(WJ0h 1cE D-gw*BCX0)sۘT4B I."<x!-AFDL- #*s&%' h0B@!DAq#h!Fi*F96F+Da0B BA*I  (%K"O7`#Kh#hB+Da'8Fua(26DBr2#h2FF9F3DaKhYi)0F#z)(0"hBDa܈x!."L/"8 Li#hB ٥i!*9*Kah8@X8x!-AFO FL- C,=iB1F,F&DF"F9-F#DaO0x!-CFdFO-v C,8hOyBv 0O,FF"FF9F#D,0f %FO0焺x!-GBC̰FFQXVh 1F"hF9:"pF FFT p2F)F FT^(Kh5j9|J#Fh O0."i FTHhKh5P9b#FJ@h e."-GFxFF/+O80O/ (FO /!5F(EЀiF(FTF`@(Fl0/##piF(FTp@@O0&Kh#:F1F(F!(FT(iF(FT`(FAqa#jF(F`O&O0/"-GFh#x/+ 2Mhh(1I"v#k`O09 "G@AU0U6H9#h#J3h N3h E$'0`!h;FBF1,(90C@$8F<>( K$h5x4 JQF 4`D-"."/"-AF FFFFTt(@.Kh (BBBB#I2F O0pCOI F8Jh FT(90J#Fh 6 FT(/ !F0FT(9 F(/J3FAF T(9>J3Fh 08`AF ^F( J#h&F`FJ7F`!FKJO(FAѽKhKhZQJ)+@K`(P @=" hz(;S =q==================================================q ====![====a==q!=k=o===========!%=)O=`2K(` 0I $0@` 9+K*Khx-*)JYx#``#%K"$K%J`$K$K$KKh+"H(̀K"`"K` 0K"`J#`J`J`."."/"BV ."] |!t'! /"!'(@ch+{a4;i3;aII60(}i4DIHF6"(BIHF(@JF>Iv| EFO vF(Ѻ%(Fc.IHF6&h+?bJF*IL(FQ4/"t'."@/"!m$/">.",/"/"!ؾξľ."/"D/"0] ."-"L/"pI6@;i@FO 3;a}}I"@F6j꨹;i3;a%(FO !F@F#a")F@F(#VjK#FPyi"(F4(#!(7F ;W[]%hXI(F6<(c`h(?4!(ǭ>FRI6*(Oeh-?Ю47FQF(F6KI(FFP*Fph(!{(ڣ>IHF6p=I"HF6 ! !HF7N 0Fe(?![(0FYF(QF(F60F%t0+*F7F4!(FF%Kgz;`"J!FO KF(FbAFL3I@J `K`K3@C‚:hIH"LMO.@I0;0+򢂰1 N\ X0] ."n] (z*πGEAKN{Z`{)/5;~  &)W"FFK(`? I _7K"F`K"F`KFhK`K"F `KJ`K"F@`K"F`K"Fv`KFvh(ԮNKHh<#/Ffa*Тe_  ) {J!`zJ`0`vJ`wJ`" sJ`sIFfdKhB(FVmK"FV`kK"FF`iK"FF`zF6wT"0aKL#F`K`F6d  \I\I\H#[IXHL#XIUHTIVHuAKUJUUK"F&`@PK(q LIKIOrF&%HK"F`)KFH0h50O30FF(;I V.Kh ((F5K"F`3K"Fv`1I ;ɻ/K"+KFfKh>(Ff|!H/"D/"t'!@/"!'/" G 0.L/"ؽV 8."Khh`pG-"8KhK ILhMh8 KHh5Z@#!F(F8-"L/"_] ."61F"2`FO[?-0*-5,B.[-+̼Ex"!- F4x]/4ѥ!EBEAB;xK"Jh*O0/+7` +,*1 F+Cx*++9F7 x+#2F F(?/А-ѐ о]мEEؿ"E"D/"FhDx/+5CF(@o IM.hv#y/+ cy.##q.9I #+`.h  5C!F*F(S4+;+ CA@F(Э CA '8F4aF8F0j#h;#` I:F =I# +x##a ;x{!F8F(%2I:F =/&a*c* C*M* &iFm*&iF$I;F { FX#iC#a#И0@F(IBF#iC"aBA I;FBF P F-g#ca Kh` ``hTa2nJP/"-CFK FFh@=4W! Fѹ I  h(BBѽ@F#eG$`/"J Lch !@;``( IO0`/"iCK-OF_h/ZX4+K84+FB0CP@ShPF4BW!F\F LF#BEBB) i, mF( \ `U##ca9G&@ ) F^I zO0!h @@B0f4+ ## 4i;a+i h0; F8 `/""K-AF\hS8$*-4+);+&B0CX@0F4 T!@U 5#EBiBB F+ѽ h0 FA`/"K-A\h&T4OV_]/Fi8h8F-ѦBѽ`/"Lhs!LGP/`0I O0JKh S BB L h)K`05$#h Jh ) hQ `/"."." Lh !@ `( IO0`/" L#h !@= `( IxO0`/"CP" 09@ @B-O[NF3h+B C PO0B0C XPF0CEBCO#CFGFF(Eh+:0AP"F(@BBX"(SZN (IhxaB C`E`B0CP>BEB<i  BE""C("FBE/ X##h a` I *I  ##`/"s Li !@=a( IO0`/"-CNiñ%O F@Gi\Yd### hj5B`/"-OF-F'K0@=HF4X! FSFYEHEBBЛj+0 F `v(H%@ FI O`/"-AFKFFFiԱ@=F4T!@jBEBBB(FO0` h F `/" pGF!KMFFh{x/+ iF 8I*F  MF( FI*F(Fn `XI*F  F M@x3`## ##07Kiab`."Ne`/"-AMNOilcha3h cjh h\;h C #3### h Kh!j h h+ F(i`/"/"@)s¿@9@@!F$%FB["B8F5D1F F4FpP%5 D-OFHM@,}ЀFLGRXk1F@FT @FL$O #hB-Фi, F(q#"#3)_2FAFBLU&`##0S' aC'@;#3#BB 5 Jh #O0 M2FkB5J2FAF4(B`CXShBA  5 Jh  F`5JI w`/"-CF*KFh7)I8F] @"W F5 !F(70FF `p(F ``0G(@h,!h0F4(fh(F1F4(0F(F``( I O0LF0F FI`/"'ToF KFFh h@"T @T!h(F4l0ah:F(F00`h`/"pF%)O0BB4.3O-..O -HTHTB DEt039TSBD6# F"D0!5%CO0 p T\TlFF0OpB DB0[(DDK@,-A]\FO. * F7J#hBD",x/+61JkF@  & (EO0 ]+]** .& CDl+F]3D,?*D+FV7`\&JkF@   (JkF@   u(ڹ JkF@   fXd pFh FF*F3e-p@(e"PQF0F h#(F#`3`pF  FI O`!KhOp!pGO`/"0#L#`\3щhY`ah3!`!`h(̿  0O0 /"8FxO08I"3Kȹh2"` I"FOqF(F O0"`4-ANOtdFȱ%h1F(F3dh 9F F3xI#F*F P K J I JO00;+I#F*FK"`#7-[/"-AFFOq0F(O0BB! FU4S #840K;+dK@A@A ` @]K "dFBH]"F (lQ"F<tI" !@|??Dy`" !2B`BPBPBK`PBpBK`PR hK`B 8 &2)1)(4*1y/)CCC"(4#$84K+!ٖ(4/5)#4(4C C(43y/+3#3q `/"CC$"8$K) # #4T0}hYBBU`!BCC(4BCxhX!YBP`B!B /"/"-CXŰF4;+: 9("((Kh;%(FETI( TI(TI(TI(I(`mB#Io-OW}F4+1!+"РFXkc.BݭK[h+:.d>FD5F6й/ѥ++JѢIBF;+F( KB L' F"H\ L h8 h0v@pG/"pL,FO0p KZh*!Ft(& !(F.U0 p/"3S[K"`KJhhCL#h+I j##`KI Hh)F HjI X0@pG."/"."."] ."8!HOtI"M(`PI F"h` 8(h" FO Kh+ JIO0|/"@/" s FSkK"`KJhhCM+h+I #+`KIHhbH1F, F(IF HT I p@pG."/"."."0] ."] ,4dIFH0 ,2] ̰HRF$ FLx/+I(I F(iF FOv0H&Op0&BB*BBDH=Jh3`pG/"4IFH d] -AF>OFF|ẖ+ Jkxl<+=+/ Bkxl|+#F Kkxl&+#F Dkxl=+!#F = jx+*k' 5jx-*k( /) -% +# )$ '#F $#F !,FF  Xd 0"f0"0"0"FKHh0",Ks[hM.h+`K.`0FH"xK*F3"` F1F F3hx3h3IxJ\ HL3(F!Fp0"<"NLf_pFFF#- _iXfm {6E'.2~ t=HR;HO(ѳ??6H ,1FFp1CC3DAa?  @ !CC@?   XA@XCABq BA !BABqBB  BB @@P@Y@CC-OFFt %*F F,U G9F, &*FFH## ;FG1FF,CMFDFF F(F!F0""K𵍰#FF#s,F F;F2FF F(F!F (Р +\9FF F/. TF F F FJ!T" 0"H8 FMh)+8)!F0"-OFFFFO O ,v,~,7,:]H,##LFF$,|",9FHF0#+F F PH:'+عtLH  QD E'G+E)0h+F F'6JOO3#FG70h" n## kK #%#;F1FFHFbC $$##y;F1FFHFQCCn/', JO4$'F$G!E"H0"-OFFFF8##F1+FF F @+ FF m;FBF0FF F  <E - h+28'0F1@0F@F(`9" dq}0" KYh)@"H @Hg0"D8L$(M(FF0&Khh#%HܲL, g"MhhH /kh#H)L h "hhhS#S V hCh;C`+ "hhY` "p h #hX 2h F HhZ`89"0"-G FfN2hS#S5,FT_I@F1F(\I@F1F(@%F'O E\,@/Yx0)^С\ز({+yxxxxzjxlnxxxxxxxpxxxrxtxv F0hCh;C`+f k2hhY`pCFFK,+hk0hCh;C`+U V2hhY` "pU;+Ѻ 0hCh;C`+M A2hhY` "p0h 2h0A#$I S3AF$ xF10(B0јF$$ $ $ $ $ $F$hZ`hZ`%FO ^'F[hZ` (,F)HF FhBhB< + #O;h+@"Kh"I"H Q{h#zhIH JH2F)F 0,IH > FIFH 62DF,L hCh;C`+ "hhY` " Hp@ {hZ`0"1"”JFh>!`v0"FK aXi0XaO0 F0"K\i"a"FiF aDDM@ Kh3 K60 F! 2@ 20"7"Kh "` 1"RK` 1"FS[2)Fh FF FF22F)Fh FFO0R FFO0 FSK2!Fh@pG8 FF2*F!F8@hO0R]pG FFO0 JF0 H ! J DHBѲBPh20"8KhpG0"pFM|F h( ")FMBF hM&``h( "!MCF`hMf`(FpO57MH+hhK"6 N cK\h\-h Kh#F2F(F``hBB $h F09"0">"sF$N Fh+' *<#XC`h(F1F1JF! Fg j` g++@#x6+ cx0+I" F-dhp F0"D=0+<.+(F"pN@0"K"`"apG0"F #h;+h "iF'[h#a iH "iF" FYh)dhhhh a0L%jH*F!U00* bB H!U0 J#jhy`q j0 jK#b0"f Fh+уhch@Kh"hh3>"h-GF!>O0FO5F;h3;`hFsh@F+gF4K\b;h;;`#2Kh h1`h#hhF( -(FMb2hAF"Hrh@Fah:";h;;`#0 -!!(F +M<! {`h!- PM.$h`h!(FM$+[0"0"0"-C FOF^0Pc!N!h)3_{lCP rJSb$qKh +πlKXj(ʀ,ǀ `hAF^0hh, `h!^0sjhC$&`h!^0+h+sj+SKh L)F Fje)F F@YEKh 0)F Fp0 &`h!Z^0+h+sj+h,Xtb4Kh AF F/Kh AF FN*Kh AF F%Kh "ioK"Zb`h!JSj[ Sb`h!KZj*"Kh Fv")F F H K H s +0"(<" :"-GF!K!(Ft&hbl` @EF ~K^bױ ^0khD(F& 0+!F<"0"x(-GH(Mh7%L $K & hh0*x  0;Jp0+k +0+xF;F=F +{#hF K(FjlKXjK"Zb0"7"-AF!LF&i3ahh!%^0hh+#i;#a+ #`+ "i:"a*#`ifb;a;+fj*hcj * +Ѩhhfj++0"-GF4GLF^`fj  oh/[ `i3a/h)i0+/7K7Nh0S 5H h 0hCh;C`+= j2hhY`="pxh 0hCh;C`+0 Y2hhY` "p0h 7"yhh hAF^ fj"h;+#i;#a+`?h"QF8FhhhZ`hZ`+#i;#a+`ifb;al0"="|<"-AFFh`h"0eMh,4h #'hdh3i0F0YhN#dh9F0kj|hj^ R"h *9F0kjkbvh#F0"<"-GFhF2h J 0chSYKZMhZK0hp WH 9TH .SH (hCh;C`+3 }*hhY` "p(h [JM.+h+`%! F&RF!FF(=.HFANM#sb+h;+`+5нIF(h " 'hZ` ~((+h;+`#.Kh h! `hGl+h;+`{. .'!Kh+нGKh+k+h;+`pb#Kh 0+Уh+Kh K0h a H ^KGh Ҽ="<"0"0"0"OKpȰhh##IK0۱hñGK &GMhGK0h !DH h BH =Kh !FX5K `:Kh $,5K"ZbHp!F(h2F `dh /H 'Kh b"K!hv)L !#h3#`K`h #h;#` LXh#h 3#`K` #h;#`+ H Kh +Kh+Kh+0"="<"0"0"0")0"#O23##KF F^0+=(;N3h33`x(H!(F")FFK0`h L<! |!(F L2`#`3h;3`#Kh s" 𽔿0"10"K-Ch$3 KM!hbKh,`iK`[`hh(@N%#i F*F3`dh,"N'`hm`h4#ih3`(m# `+m 00+h`qK60KlKi3 +¿S< hK0+T +'cN,@$hx0+x0+1YKh+@3[h+NUJ!h3`[h Z@# ( JHdhi F:F)Fxdh h2 Yhh`@Kh9K0h ^d='O eh9F(F-@F`h sCh;C`+D hY`5Fp{(F ^$h,N $,X#Nh0h-[Ch;C`+_ 2hhY` "pKh WCh;C`+ hY` "phZ`hZ`>"<"0"="<" :"0"1="GM(hCh;C`+ l*hhY` "p`h $hhZ`"F)F 2mh( $hZ`#x04K eh:F1F(F05$h -KB%C FF;VF˼-ѐ- рx8 Kp(%F (  m0 +YD#x0x0+?Ȯ;+ JB?JB? $Jy*x03+ (x)9) KB@3hF3Qx-(Hx(-(ъx*Fh# C + фK"Z`h`@"` C O3~Kk }K!h+ (@jwK+`vKh3B@L h +Y\#x0xiL9!`` gJh#c3`eK"`#dJ`dJ` bbKhS#S G`b WK` [K\J`\K\J` # pYK`MK"Z`* cЁ3@ BKB@5+ @KhQ`hR`"`+@[!\mCK&0++ѽx0C[hh;Kh"`"-KbLGF)(= )K` 0K`$Kj*Ob@F F  o(~C&K`&Kh+fcc1 Jh;h`3 FFH}Kh+MF+(6Kh++J bLs$0"0">"9"9" t'V ="0"0"B0"+ KKXjhKBh +` K  j^ C #F L#cb +@ `b}K"`|Kh+?,(tKj;L! rJ`rKh+h W!jN FA &5F"+h `#`Os ^L;3`3`#h3#`]Kh`\I h &#h;#`#TKh +!(-RKh+&  IK!`JK`JK`EK` >K`?L& F+h#` 5Kh +` cz X6J`6J`h1K`)LB &i3az.H & !Ji ;ah L3` K F`K`K`K`+h #`K`Jh;`S Kh*""GKXj  0"1"0"0"0"9"="0"0"<"="TFKh+ # BJBBJBAK!h`#8 "Lj+ ! !h [jS Kj FBB,`h)F $h + `L `p ClOB H ~0"GJ="0"0"1"0"sKipG0"KhpG0"JFpG0"KȃpG0"K""pG0"( FHh H0! KiBF)"hxc*""! u0"JF+PiSapG0"K/!0hF3,  FLH!FpCOH!FOH!FL(PCO (F"!FF(%F(F)0>"p%LN(Feb3hhñ3hh!FU&c(Ffii3caifa-`jp0"9"(L HhbFai)ipcj i9B̿""`F""a" 0" pG pG-CHY> (r9F 0 FkAFFfIFFahWI"F Hh   FFFK0Fh/ 9)F0FT K`K` F0,`9"1"-OFhFF/V* F%&:FF;+D@F /\D0B+#!J F-hS`I*FF H1"" -AF F*tL$>Kh3"1FhFFKah5H 8F A2H 2H )0H1F z.Lk hCh;C`+C %"hhY`*"p hCh;C`+9 "hhY` "p4)MH o1FH +h`h3+` !FhF+h;+`;H Z WHKh+H1FhZ`hZ`>"”0"0"8FL h0*xxB%+`h8)F/(48FL h@x+xB)F/`h84p K "0%h I:0Q;+г(,۝rh0 1"-CFL%dd#h3#`|-#h;#`Kh˱C0[ChB h;`8h(5+0F0"0" 1"0"K-AFhO6Bt%3xF+BQ:*(l<:+5:)lM+h+r.` F.`F*%*q H9F(.F,F,Fs$>"09-A&MX+h3+`|.+h;+`˹KhA0+ #h`h;`  F(2H(tCE?p?-0h*?e0h*?_0Y!F8FL#h3#`!0F6F *O   "h:"`*Jh*?  O )  >"80G90"B0"1"-O$&F'FFFFO H`F(1   !H ;C3CvK &O h7FFFFh+@oK|BUnL h i#h[kH% (Fb=-R%HHGHHGGGGGGGGGGHHHGHH#O O O '&$OSк)Vл,!FPF5J/0KRFXFh3+4н 03C,? &Kh+/I h `?d!XF(а0+R##IIOI_I,н 03!XF!P P%F,\9" 1"f1">"0p FN!3h33`0F+ +@h +#kh`krhc`3h;3`3Khp@p0"0"0LFF#h3#`#0 K>00 ](F#h;#`;Kh#0@00"0"!@0+@h t -OOM FFFGF(FX!hM xc+7CWIЍHp(v(V('O&&/<ЅH+hh+97F+h*`h,l F cHc&H`H]!Fa.+h'*`haH' t~'9"ȡ'7>"=DI_tT-OaLFaMF#hF(h#h` .؀.:.) .c/.*TI h: `*OkF *Q"NNNNNNNNMMBJ z>N(v3h33` hxs8H F"O &/*ј0/+ QF"pJPF@Fj,/K :* Ҳ * 2h:2`**hQ)`2h:2`* *hQ)`ZFB*` B*`1"7" j-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`C3h;3`+;h+"#caFh[aaNOcihHhBȿ`XhB"3h33`ci3h;3`+;h+W1"0"0"1"7Fx F!+$Kh0 0@+*+ Khh"E;S/ x* 0; +/`# "` F F/Vh+x =+T Kh-+x+KhBۛhD9)A+. *FqBF*FO B1 5D;+J :* Ҳ * : "+ &: [@ "F1"0"0"0"j7"EK-OF[i FK G`kh`h`>KF&ZhVh0 0;DE #x+ D`F xɲ)K `(F~&)AO 0D`lh `h`aTF E#x+$Ё+@F  F+00H+*령 F@F+"p H+LEF(TFF &F1">"X1" M L Nhhha#hh3#`#ho`;#`+3h+31"0"0"8F-n0D)FF =KjD``b81") FOF{;2F6h#9F`F0FFahhh.D( 5`.F*h,`#FFF4`&F#h+%`F! ʿh1-OO FFF[غ*Tк?#xGк #x+4#xSE4T& غ\#x+4!xCx$ x۲+?b+ cx;@" 4#x+ #x+4Ax#xQЙB4+4;Cx+*+Ё+*xҲ*?+[+ѠFF8F?*И 4*4"xB)Ё*FbxBИ 4B{x+ѮAx!)^)5у[x.-?l]-!)^)&ц##x+ +cO x;xɲ)@+?J[+5FZ:)5F[;F>F#HI(F(ШBqx)ѱx)ШB)x?JQ\ BB # pF K .F;]+[E?,7F4`5BЕ  85qE8+\+ F)x-)&ix])#Ё)\)5 k"# ( #6 (ؿO 5BO 5F0+?ٮOFDFf-OFF F"#x*+6?+4[+=cx!+^+ѣxx./](@[($Xx:($Xx^](/(3x:+ѳc(ўx+/+3F:(ћx]+竱/+"(3x/( P3狱x(ف+4#x/+:4"TL+FfjxxҲ*ف(1 x+ 1B`j`j)J2(EL $BICBx/+E#<F($0B/#<#x+5&kCFF xɲ)ف(F08F ./#<x F1xҲ*ف( F+F+AEӯHH& 3(F/+*/#!F<8FF(Z{.*Ѻ. "@F(.(F$31"̧0"FpFx3ɲ )F &x<p,XpxQ-ً,p+F F,F+pFF$M$N`hF;C+j`h`#F$h+b*+?+[+3h/j33`kjK-NoO`hbahhjhj#kb3h;3`# Kh +jB"`8h8`Fh(1"0"0"8FM8+j`h`x,b$h1"-CFxF0۲ +عB1"FO FxV*F !F.VFU*ѽ>L .++*- F!xB`   =) ЁB MB*FF !.(F+D%++2F5!Ff-Gvtv F FO#00F !( 6F0и/ N F-#<=O3h;3`+K|7" *-OF#xF-+ F +@򉀣! *|L[?+v@+0; +m.6# "`0F F.,h+^x =+Y.@!Khj-gNMLx+E\ ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xpqK&qMԡhBK yc0fO;0+;hZ:`"yp6bK_Lh!h& `^K^K^KC;`#yp@-VKhOJ!bh,KMW;+x+1+hGN;+`+3hZ2`"p+h;+`+3hZ2`"p;h++h;N;+`+d3hZ2`"pC3`#pC3`#p.N=x+0 ;+ +h;+`+3hZ2`"p+h;+`+S3hY1`xp\C3`#pUZB2`xp+h;+`+ S3hY1`xpx+ћ:ZB2`xp0C3`#pm9"j7"1"7"0"9"KZhVhK3xKhW+*?  ̀-ʀ|x:h*?.@A)-x*ДIP h: `* Qp :* : * Q!p : *J P xpB "pQAxp1ɲ )9)Ko~H p9)DAK0xp x):h*?.?}x :*RIL h: `*, Q!p ,: *$ Qp;=A!p5KC0 xp谶'B "pB pB p4+KhB/hF>S&0C#`#pZB"`xpd3۲ +3h;3`++hZ*`p3h;3`+S+hY)`xpx+C+`#pZB*`xpN'M>"9"7"1"j-OF; (CxJ\ O O =!@F*M 3G ОKJ.h[hh<Ѻ _$O &@F.hKFh@ @@ "" h@*"b@F f~K.hh}K@,'0@+!*+Ъ+rH9BFx+к#HHF R, $FO h49`)-)hH(` p ;ܹ 3O̿F"DO  D @ЀMK)hhD)`LI hD `xDJHKA`pEKF?JDFRF@FLDkO ;Lt$[FА'[FF$O @*-Jh*@B@"(--{++++ K  9) 9))ho~H(` p9) )hH(`\A)`!pUA)`f1"="7"9"j * "h:"`**hQ)`"h:"`* *hQ)`j#B*`B*`\$#"~)hFU(`*["FiL8F!;x+@78F4*@",8FCB[x+@*B$7,tX0;0+70Z "pF ( uC_/0+  F) њ)ښ@)њ =*O(`hI h: `B Q!p'|B "p [I h: `* Q!pTI h2 ``B "pNI h: `* Q !pJB "p( QB): &/7I h: `* Q!pB "p,L+1ɲ ) !h9!`)H p h8 `(D@ )p *A!pD@Hh1`f  F)@"F *F@h h F>"<"7"1"Kh8`(C0kpᮚ ~*ܮ=)+?֮#)F FC0B pTF7"-CF;KFf0 "8L)FhO6Oa05J(#`4Kh;`ih`3;hfCT;h3;` `p#hp;;`++#hZ"` h0  F$AF#j"`+ i)F#j"`i*qh `s`C#`ik #jG`` b1"7"<"1""FsKhK@0𻽐-OOq5L&h02O;h;;`+FP#hZ"`"pP0F5D(F0 h"K(FhF F #h2D"`:hD;`+ `!J hO!h F+F+*ѹ"3D0FYF#h@F=+D#`;h[;` |C#`#p1"7"<"H-O*(NF(O !!FiFF7V;h3;`0`KahUDи*HF")F3h 5`;h;`3h"p#x+H*FI   Ja H KFJF9v1"7"ȡ$-OFrO+,FFi9V 9! 0308``K,ah5DNDM ,|,!,FO B ;h"pRF)F0F(fфй44tO BӔRF)F0F|(K#FНB ,* *Fx)22B8FtBRF!F0FZ(AbЕB <+ +Fx)33B8FRF!F0F=(#x+44BӉ,Fuc:h=C3D;`>00B t;?;h<`0;0+ c;`##p;h;;`030%C;`#p1"7"-CFLFx7h!p'ha0ga#`Kh00;0B#hZ"`p0 h"1FFK FC#`p1"7"-AF-LFA,Hn hCh;C`+&"hhY`&O"pB"HAFW hCh;C`+"hhY`&O"pB hZ`W&6+DhZ`W& hCh;C`+ "hhY`6hZ`Tw\HH>HB>KhpGhB`4 Kh) Khj3c1 i@ pGh(h pG pG1"4Kh2`Zh:Z`pG1"-AFMFlF+h3+`0j  0j`bKZhB`h`h$hB`g+h;+`KKh3A$0"1"0"4K-AhN,j3h'i33`@F+`D< + +KhiCah#`K$5bhZ`h`h`#hEob#``O02;i+j#h;#`+chZb`x-Vh+3h-Jh#+JF!HFHS"!HFH(@F3h"`Za2hchQiWa Dc`F)F+: * Тh:`* H`"`h!`:`*;#`+#+p#.x+p K03`h Kh.po41"}` L#h;#`+chZb`xB#h;#`+ڽ@71"8 L J#hh`hRhaabhZ`#h`O3 ``#3a41"FLFI#h3#`"!(FHN3hh(7hi`#O`Oa K"``#s`#h;#`3Kh@?0"Mp41"0"F-N!F3h33`H)H)FMHxpCO)"# F*C!" FH(F I$( FHH)F#" F#*C FHH)F F>BH H9Fp3h;3`# Kh +0"0"FLF#h3#` . O(F}`+ K^`#h;#`8``3Kh@0"1"40"pNM4h+hh3+`(2iD#j˹#h F3`=3h Jh`i`i[hQ`s`+h;+`KKh3p@tp40"1"0"KhpG4pFNM3hB ЫBѬBH~p41"8ML+hB841"8FPM+hh(+h`84KhB`pG<%Jh%LcC$LehB5F"E p B2eF b`) )$O30 bhU%b)Ldp/0"Fbhc` 6"5rO<FSMhB%RKhRL(i hC]OH!HD `0 hKI `? hz(`GHrFK"N '8F*7/8FH `0HhB! ^! 8! 5O3! /H9hB H<0-h"F*H 9h h0;-h"F$HH|hB 0FH0-h"Fh h0-xh"F h! O3#`! ! `6"7"<%v7"@dF0+gH3K3Hh3KaYC1)1N% !Ow3h33`B 0B(&K)Hh&KaYC103[h? ѻB5!0-h(Ќ_FH ;OpO5'Qh сBU`p;3h;3`3 Kh@6"5rO0"0"8FM+hB+`Ћ;@! F[+h;+`3Kh8@r80"0"-OFFF 0hI FO;ؐ3QHBݪ IFPhShBE_  ++ +E 90+ і0+k0FЀ FW0#00CEooKpHhpKr@hZCB_G_'B "-"fJ!+.Fh aJ !0XFXF+D  Q=XIXF@O + !FDech;c`+ F#h7/"`!FOH( o# X+" "=J!O#7J!XF5J!XF(OsB  "YFL0XF+D(H@=ch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#hFZ"` "p:FYF F76"<5rO/&0Fp@ճ DPh PU4mh-(FB! p$& F +; CC+OrB 0-OFFGKHH[h x%+c PFPFCAH+%@JQhB!h"D0ӱ Fkx+Ъx2-+%+++3K $i ,-HO)F'KZhSD(K!(Hh3000+ kxp?+YF8F>L4F69FPFU(((F&VKC;Ԕ Z) "R,B4HH$<,K6";[-G/N0HD3ic.M/O+h!hP0F#+H+HJ!1h OA%H2O yC10CE!Ch;C`+#Z hY` "p F+hh"[h*`+ HF 1hZ`6"9"5rOzj&';MF(F03;D+7Hj(p(g(&'$0Khh[h .H!F`+Kh+KAYC1*H$ FF.)9$H0#N#O0B# cC0F4Xc8hCh;C`+9h0 hB̿ # #P`p;! KCX0hB̿ # #Q`4F9"6"5rO^Ki !T(@B6"JiH#;pG2 pG pG6"KF60 Kh Khy Kh KZC200hIټ FpG7"6"5rO-GFKM+i+G?_#+a@F;@DO;h3;`(YOhpFkh",`!O O0D"F93k`;h;;`#3Kh 0O! F;h3;`/K0;#0#63Os0h0n. pC;h;;`#Kh  F0 F40Ok QFF,#F"EPF2B03 *4t6"0"0"FJJFFhKF F'-)d` FCKCJ` FAK`/N-?K60+I!F !F !F `-5K60+2KN00˹GF1F G+K1Fh0,(h@RF$H0h!F !F K603-K"a-!F f!F bv FpGrH)FGD8 IH0+/,Т7"0"6"6"<d̚ FF JN js0+ ""BO0Gֿ"F甿-OFFF #`iL AFHFFh ,h+#h+(F-$0PF300"B.00OKh+OK60+@DE@"P"sGK!Fh0;0+BKh+0ñ !0##FB C )I*#00?#ЬE?O|dE,O4T`$@8`F? OsE!2 O~EtEѐ@D@T`#*#!0DEѲP"y0C0z(<"7"0"6"0""-GF F F " F(0KN0O &@0B(ڽ'JN *3$N0h2FGB4hGF F0 ,h@j"FHwO0C0C0 F64Д0ոД0#0*F!F8F甿<d6"$!M(F&` M,+hhё xH| l(p(Z($$$ lK6 "0 D@N0h+h!7hh "FF8Fs+h*`[h+!F?9"”-O%NOF0FF`t-N0۱$en,p,H=hO Khh+-@0+M#KO &h>GջF'^F[Qhh+,O #1"9| *@@\F#"(FF(kH)F#!(FgH)F0++ F  8h8A2B̦!@FXSKF( [, З *!8F F% F(F1hGK60+8Fx ^B4 s O O z@$("0@#!0F0F5ѾB=Ж0+0F>\F;;i#("F3JAF(FS) 50b0+\FF'Ԁ 0+R0FԀ0+8F 9"9"$:6"0 ;!KCX!J  0+0F-??"AF(FJ CF+Ж0+0FTpFGf5N3h33`F 01K)Fh0+fh@RF*HO!F 0+ %K&JhSC JRhB! F! F%0+ Fj3h;3`#Kh (Fp-OsB 0 5OsB-(F+%0"<d6"5rO0"1Ki0H0F -H%+H&1+O0B#(M(hCh;C`+&*hhY` "p!Kh00+h&OrFH8F51rhZ`M F+h3+`c F,+h;+`F# Kh h F6"jz”&<d0"0"H`Khh@}9" FHQ h@p8L0C1"B ۓPUP-H(F#ca823 6"F #-C!F Fo%0.@F+:F* ؀* =*{-آ"۲+N&#:*&S" Yōˍoٌ}mDK)">+w++ \*э \"zx#*ѮzxF5K /CFF@Fx0? /CCBЁ""Ȁ)K /CF&KOaO#}"{x +Ѹ!K$"""I JICF%:") }*Ix/ј K$"K""+FP.?M"#>;G|^vyD~6"hr-AOFF,ni+k%h-*7]sEO(( &&XUM"hBJ!(F#h;+h+}HC`h!{HzHh.F`h!vHh%`h!rHrHqHdhhoO=޹ch˱mH hh!+h8F-hfH`h!udH dh5F`H`h!dSHz[Hwh!YhSLHmVHjh!LGHbQHQH]`h!?@HUMHRh!4;HJHHHHHHCh@FH=`h!DHDH4chCNCOh.=H+,h ?H!h0Fh!#h + @F8Fmhh3H}h!vh!rYhr.M"-M"-M" ,M" ,M"+M" J!Yh!V%HR%HP6"TSp||T pF N F=! FnchKdh0F)F Fc0Fydh,ppFN5KFa6 N0+ 2$$!aDi+ <."+*UZpp"pp$i"p6"-AF)KFFFh+A*C%KN0+:P!F FF. Kd F0!F FF.FKd0 Y!KCPO3C`#r܀/9F܀ FAFF.Kd.Kd-O7"<-AFFF$VCFЀF:F1F(FA+&hFHF:F(F1F F-OF-l@ #0NN>MKXO ZhKIKhh 3H30KE"QFhFFp[0+-#x+:"FF2x),/*76 FF(""B#rڿ z%L F%L; hCh;C`+5"hhY` "p"##  65S] :+хL#hBK*Fh F+#cU=FKh+FI FNhZ`06"X="l=""7"0(6"1"-CF3L&0 6/O?U(FBA(K!h[ %H/#HF^0B(1.ܔ^0+P60+Д.0+H6Q(( _B-ѽ(Д^p/ J>FhKBKA9F`Hx@6"(<"px+P(L!#h3#`F(#h;#`+B"Kh+>нp@KhS{!#h;#`+M@Ĺ&F z O t0;#0#0p@`&#0@,#$0p0"0"8!LF#h3#`F( !#h;#`S 8@H)FKKh+0"0"8F F@-`h; 8H%H8F)00)FFX F8L&M#hBڶ+h7FOw83+`bhFpC+`+h;+`#Kh +hh3+``#h#`+h;+`#Kh 8F0"0"0I " F7BJhh` D`KZh`hhB``Kh`ZhX`apG7"pFMN+h3+`ph#hBchh`h3` K`+h;+`[ KhCp@]hs` p0"7"0" Li#h3#`KZ`#h;#`3Kh@90"7"0"-G*L+Oj;h3;`3OIEk%3B-3h)0Fc`ch `#h```D00%`hB ;h;;`KhӱGhh"DRi(FJFQFF*"#h`+D#`0"0"7" J0 h3` KhD`h `h;`#Kh pG0"0"8L%h}#hJh[;(D`87"pMN,h3hh+hh3` Dp7"J hh`#D`J[`7"-A$&FU{+@>`oCBH), D4C hp$r5UFF-8F ApG, 4S l)F@FDh(F)xF-OK"O&M` #8F/F0Kh+hH>p,r,d,+hx.h#(:8&0F#!HxKHN(F ^J#Fh2`O" # FV(F5$N@2h22`F{N ;܁O 3hDE#pH"F1h"(hpNU(@ V F#\\+ӹ #FF (ѝ# >+KKEйIF&0xPHIF&*xB/LHh:`*F[FF;/?zDHh:`*[FFnF h?g72h_:2`* [FF OQ{F Ohh2h`:72`OiF 9!I(h)^F:2`*XF0$J#5h2`Er@3h33`p"(h" " 1"9"9"X7"&|(?@F&v/? "1F-A%|L FF(@030F:FF60;0#pKh oKhh,|-u^r#,F0;4kDw" ,x4kDx" , O <^r#0+F3jDw!<3jDx!3xkDOHF,\r# 05kDw",5kDx",@H #<;L hd#h[8H&0F%d4H9F#x0; +#!FF x0:ղ--H!F'/_(#*ћ&H!F0 F30Fx0;0*hp!FFHCF(F0;0# Kh CEXKh+ 0"9"}$Cc0"-O'؂f$=F@FF(1Ē0+:0B6ќKh2-8%/ODFW <+sђL h#h[ՏH&,0FS.a.H.EE'4F [hHo-I@F%)((@FF !;0Բ ,ٛvHAFT?z sHAFC 3Cz O0oAZF(Bq ӫG w iFFX0l*8hF_HiF FJW<,FW YHH) oCE?0MH !PF 7^oBE? BH !PFH) 7, FAF(FF FXFF7,# FAF(|FF FXFFO4oGDFGF ЩHG G iFE>(*hF!HM 0+ "zK`cGoCB?HSHG # F9F(,F FHAH!F9":6"/V :*# p;;+pG8?  pG+B pG7#Fx0; + "(zB xZCO5ABAH!FH!F0x0; +?+ pG pG8F(FFI(F|︱I"F(Fv, I(FCP+x0; +(F8 8  KqUy]"FFgy24Bl*Dq𽔿8LM6N+xñv@EE*EE`,pEKI"F(FH8@86"t -C FMMF(l)>KH,FJNJIHH#h3y@F#y\4IF74/BL hCh;C`+"hhY`=N$=O " p)h9y@F* 2F:F45,ѽhZ`1H+N0O؀yyB*h\@F45,$L hCh;C`+ U"hhY` "p*y8FhZ`)I)0hF F4y4,Ѽ $&U6A8F) !F0FC 6.K:F H],(VfnD$L| KF $yBѽ@0(KHY\8Fych=U h8@.,8-AF T 0F0+р'======e=====;=$9==========X=7V='F?'O MF0 +0  OEѫ (@H_'(#Р0/0+-^_'(@T^0300h Q_,K] ;+#h;#`#;#hEF;#`Z0n0+0_ OF#hEF;#`#U?;+`(H\('H\(!'{l7"hn1"1"jx8H?('U'V'TA+7Ya+WP/-٥XCo}H#h +F"ho2"` ?b? Eɲ )#h!;#`!hF9!`+?0"`* b Bɲ )#h!;#`!h9!`p?Eɲ )]!h1!`!Yp#h;#`H"` b 2Bɲ )#h!;#`!h9!`pA?Ҳ *Z"h 2"`Xp#h;#`Epɲ )U!h1!`!Qp"h:"`;5oK"`*b BBɲ )#h!;#`!h9!`1pAҲ *Z"h 2"`Xp#h;#`pA۲ +S#h 3#`Pp"h:"`pR-j"`b bBɲ )#h!;#`!h9!`pBBɲ )Y!h 1!`Xp#h;#`3 pCҲ *J"h 2"`Hp!h9!`p ' '''\(B? (0300h ' ' ?'3D[#h;#`#;#hEF;#`{d|E #hEF;#`\#;/V ( 0300k2cshZ:\(`(}(ۉ˱I²#h \; 9) #`#;#hEF;#`+%$("(ћ+#h";#`CF+"h:"`\" Fqh)EF#`#;#h;#` #M3DB*#h;#`#;0FChFF`"EFZ*ۉ+?t0FChFhqKB#hEF;#`#3D12#h;#`p[ #h0F;#`#0F0F]IChFF`"Z#h;#`# [0F#h;#`#F0@F((F@u((@fr#h;#`#F;sh[#h ";3DۉS0F'n#h;F#`(FpIFU#h;3D23Dc#hEF;#`{sh:<)(F.@F&rh;EFK0F5#h;#`#;pF #h;#`#AF0F3Dۉ+S?sh HhB0FHcFjnlhHB#0FH݉M0F0 Hc#h;#`+DۜK[hsh+C'<+=+:#x X#xF+D Fh0BF`ڊKhBȿ`>/D,$>(H#+`00F`]b0 a)F Ff(V0@Fbbi00Fa0 0O2`+hKhB`>/O4<(>(3&(3#+`'|(#&(##+`#'+` `0 (j]`a0j-("`$t`##+` F#)F#h{(3=J\V{/#`OO ;3Kh#h3#`$i#(Fld}(F*K\ 'Hh00XM}(F/FO MK]hOh:`*E{5K*\Fh:`*O=eEF+@Ӏ%/Ā:/a#/mOn ;6"fXd 7"6"^HIF0pFCp_O PF0 (h:`* {sKFР0 *٧kF :`pgKFO V="cKF+F`H$]KO ]KZH9F$WK(h:`*@{h:`*4O {OshZ  I JJ)OhJI@ C ST0F ChFډځO;IZ`FFOVB  }/ h#':`* O {FO FC ST?'(rhhJB0F#`#pIChFF`"Z#`$#p7#h"";#`Bp0F J!ChF`"ف9"7"njh-G0h $i4&F0h *h4D`h3 0 khhZBZA F Fkh`Fh+0"F!i1K"QF0ij``Kxl(OK0h!kKKP0 GK h  C BK h #F (P8K:M$!F`6K`+`"F3IY*hj; )3,I)Mi!   2#KFK$Kh K`K K`K`+Fa0K`K  K` K` Kh+!# KK0"0"xl0"G-GM"+ha# (%*hSi3Sa(v"dd|+h[j;` O F F``` 0 Y`( +hi* M  +h F ;Fp` 3`" Zi2Za +hi+ # #F` `` ` : (+hji8XH^ #`F+hik`a+hi *j*NIi&(+ #`IK`#`C`+hkai``:*Zi2Za+hk0` (!1`c`+hiZ* ;nF+ +h"a(( ! & `0F[& F*h #`Fkk` j+hk``/.h3i +Ii&XIO0O +hi*" "ak #FJ;F+hi++hi * ! x_|kS+hFn( +hi*! vk 3a3+h"`aW(Р +! b ( #3`+hE &F` #```! +ha, (0*hSi3Sa#;`%#h+ #4F` K0F ( +*h8FSi3SaF F+h[j;`E甿-AF?MO$+h+h (k8`F+hi(Oi )\j4`&)G2B±Zi2ZaO (#`F+h`k`a%O F+hh:h0FZcH0Fh/!#FH*h##`;hk#a+h``^c FYi1Ya*)O0x8v-A"%0aW(< Si3Sa~FK( "#F# F`F` &FFd``4`0(>F##` Si3SaM VF0FL5(є0+H;x8!M*hQaa` +h$`(*h Si3Sa+hh+hiHhH8 Fx"FUpGChBhKFhpGCh hhBpGh:"F FFFch```v`FhFBZ(!H)!K7ih8FBȿ`%<F F9F F B!"FF(B! '8! '4!F'0! ',!F '(1i*F FCP1KXh8 pG:"F FF)OBFBѰB0FBPK FhB`)F0FBB, 'h*F1FFH FB2H#F*F1F-AFDh FOt`{h;{`-- FDFh(FBh+Fh(:"pF N L5h#h(F3#`+h(F3`#h;#`3Khp@-p:"0"0"8F Kh\- F!$heh$h,8h(B-h:"KpFh FB`hB`BFB#"!F(FAB '(h(FB0F~!FFH Fp8$Mkh +ܿ3k`kh@ , !bFBl(+hB(`BvK2Kb , $`8dgfff:"pFNh +JhBh !(FB> KhB`B(FBD Fp'h+ h +"!(F,FB 'h+:"6"8F Fj(KEh``8:" KFS 0hhB` F@CFF:"JFhpGhBh:"-CFOhFF;h -;`ܿ#KUh;+݀K@i!0FB&tK$`'L!Fh1FFpH40FBmKhB`-iK0+𫀬B{"!B!  FBiOr@!0FBhYKV0+5i!0FBZCFOr@!iFB80'h FBr'`FK"`'!hf1FFEHpCO FBX'#`&iOr@aiOr@ !h.=0FE0F`@ *F1FF/H - .0s# 0;h;;`#(Kh n'O)F0F "F(h'h*F!FF(FBEFF3BO#)F F('vh)FF H)! FB0"1"K0""pF F FXO0p !FFH1! FBAF-'4h! FBBF -'(h!FFHH@H@`p-OF"FFCFD#O"I2F8h J!K!N-FF3h8h[%I"F8hIOhB BFYFhC8hIF EFQFz,h+$ 6-$8 !MFhBC Ѫh* b ! FBE KhB`8 !R FBA " ! FBB" ! FBCHl:"8F KhhBVhFhBch)FGhB`8:"-OF F C 0 #C`FxKh``ؑ 0tKtJ`0sKqJ`pKhhBnKhB`3h F;+hB FF8 f!FFbH! FBh(&hF@ FEB(` FBf Ffr+xh!FuF(x! FB@8(0300 +AK! Fh0BF2B CF]&h* * *0&h!FF2H ! FB &h*"! FB BP"!(FB &~h* 2P*F!F8F0;0#Kh +$030BF0Fvh B(:"6"6"0"0"-O&JMFOFL#f`+`:F FFA L}M+hB|L h#hX@òs+v+tH.`O oI0FFX,СW@FF@FF000+x+@F%(0B@0B+ѫh+Ъh FIm+H!FH!F#h*ch;c`+ F#hZ"`-"p I FL FT8F&"K,hh hJh*31+/K"`&z`8*Qh)Rhx*,h*hx*!" D" K60+,KhK` :"0"0"F" F@I F0 F(O0FP0J#FH ! |HHT,<"FYCh;C`++#hZ"` "pN%O(F1FF F -?- !FH@X!F8FT!%ch5;c`+ F#hZ"` "p”-C$MFO+h3+` #;`+h;+` KhC}X0;3hx#0h(40" :"0" Jhp2FX h x3  :"F`NF3h+_Kh% [h+x+%%,Eі,2 ,$,,32+l++E$+JKN0HK6 ʹGJh02BK60+32+K++%!2+>++7I%32+JjF! F&0+,--%! F&80&DR-! F<#>,33)&#`"iF A %%F%KN R,--ѵ*ٓ60+|+?zBvb #@R CB< :"7"9"(-OF F!ѤIh%ehI(F%0I(F%(@Àkxp4p+F(@ŀHO #(GehI(F%`HK!hpO PFI(F%F(lэNLkh #h3#`hh!i`g#h;#` 'Kh+!8F#h;#`#~Kh 7@/#3`(uO$&FZh[hxm,@qH$0FF@F6@.jHjN$kh{khxc0Fhh FF@F4@,ц&W(3$%FPYOX -V-%^hf,OSH$y(FF8F5@-,HHj4'9I h%F8/P% ''/6.?.԰<ԐO T(?:v?(Fp5K"h5IhYO .%/?a,F %(F4wF8FR ,HF4F0F4hF@FC ,]H,FW/Kh h^(%h+x-+kx+%.?ծ4 "žD :"0"0"/:%'/O D0+?z)HsD'H0C%H0FF#H (()-h030% OZhXhDP!0Fx0;0+9 Kh+?40030-(FFȡ:0"-AFK"`d%N-,ѽA{Yhx3h33`cYBYA+3h;3`#Kh p5 :"0"0"$:"pF LF#2 ,D2;+!(F&#2p :"KXmh+(x+ pG pG :"-C' L N131#rQ3@+1;1qUh-hFX2(FAFF(F+hF :"0"K@ 8 !*pG :"8F M\2B ! ! ! \B8 :"Ͱ#IK`"b!*8X"*42d"AKAJd2`K ! *&#`" AA!FA+P "@S  CC :"0"0"0""K Y :"8F I'!F F" `]8 8BOrOA l8 M Lh#h3#` #`k`#h;#`3Kh8@80"0"-AFF F*F1F@FA-D'7 /`%h+O0%FhFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+`hc`` `+h;+`+Kh+y3 Mh+hq`F3+`thc``0D `<"0"0"8E F?C K[iB F8@ch;c`+ F#h*xY!`p8KiܿKYiֿFHP!FR]pGKRi]pG Osp FFR& ;+Ap0Bd#<p@pG-G F'!F!8sx+[I0F:3\ch;c`+ F#h!F0FZ"`""pXch;c`+ F #hZ"`""p3x[HI0Ff7\0FzF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0F F(ch;c`+ F{#hZ"`'"p'=FlKYi5L FG@AFxr+ HH:h-Ah h2xh+xB,K=!0FhKh0!=!F(F!@B!'F=++x;/0;0 =*+O%p=F)F0FAAF/F5F&Fp7"ChL!2hJh F & F <"_FxB #` O^8\ 4F[=B|] *`f-A("l DF: 0('kFF?0F'`T;+Yhh)0X[-jh++iC(FG `4-hhD;<"Fx#@HIF F$TBNO#x3H!F@'+8Fe,F'! F!F H!F"F0F7h”-AFiFhFFKBh՘GF,մhF HAFH9FOF40=+sh-H F8hCh;C`+:hhY` "p8hCh;C`+ :hhY`,phZ`hZ`-OF+LFF0; #0n% E"K)F!v@=* Xk.qhղB FIA%`56h;FT ZFJ<"<"C/ B=*Ѱ@ pG=* pG pG-AFFF F;;JU$ F=+@`'!O$H7` KDi,hB Ѡh*FAF.7`'F$h<"<"IKFy F!XDiF0FF(nChZ `0Fk#t!;Hg`j0F@Y5O:h2:`iRsq Ch!F00DGkh`ѨhA*ikh2R"*a L##k`D#k`khH$$TCKFBB0 ;h;;`ùKh@QE $ TG5Fh``𽔿0"<"0"Kǰh!Kh~@ K` K`G]K`"K`@0"0"-AFF=!F BFH'G(FcBF+$t="+*U"Zp&41F(X'`(FA 0F#D;Kǰh!@#K`G]K`0"8@0L0`FR KH-F40 I"#`0 KBF8@H<"t (O!0> h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp"( ] 9"9"1"6"pF MF+h3+`T+h;+`sKh[p@`h1F7$hp0"0"sM,hLH0h `#;0p@;h 0Fx0Fh"``tkh#0Cc`h#a`5p<"%O-ѽ@ch"h2`Ԡhcch F]4h,5[ՠhch#@c``&F<""FF BhiC՘G(h3DhFKFh(F"F!FeFرCh2CiՐGph4D gh)F8F:0=!8F!D F$hh0"-C' h=F #xr+&&@FOp:Khh#*F1F FCn(p('% . F&'-*Khh,0 h(F! F c\=+   2FIF F(Ch7 3C߹F#C`Ch#C` H"Fy%ChH"Fp% Fv(H!F9"is" FFFChX)> I h2 `#c`Jh;`#Kh pHh2`)! DRx I"0F|^ch#c`chCb`ћԠh*"h F`$ 0"0"-ANO|@ #heh0m:h@Fh$h Fh+Ѩh!"i:@hh0DGkhԨhhk`h`#i+a<"t-AOMGFFF(F(F`VK'h=U Fv, e, f,&x,O''OGFC/(hAF*C9"(ܽ@(H" -CFX FT030;x-+F!|xHM(h*hGI$0t`3`0`;0+w?Kh+sC"8FF=!8F!DF8F%A"h##3a%8FBehBh`BB`"B0iC02aC`B*@*% #c`h\=+8FZ% rKB 1\=+ 1#30!8Fpch+Cc`t0"="0"<"8F F8`h)FC$h8H0N(x(I($(F ( M+h*`hH8DDM$!F>9"P hxxpG hFxxPxKxpGsF$# "` FFF$h{$h"+ jfC2s3H!FBxr H!F Khx21 R3B(F1FpXd ̰ FiF@ L& F@(6BB8BԿ  BA ̰ FiF@ L& F@(6BB8B  BA ̰ FiF@l L& F@d(&BB*BB  F F@ I#\Ch @iBѤ5j@B!F@ؿ%hFF(F@8W 3jB8FFxCx-*xKK"I#`8x K " I#+K" I# I#(H \LT0Fx F!+Cx+x8 '0(F(𔀰0+@P- - - F! x@ @ x8 -iF F@(E @(=-` _#)/5_M_AEI___V[!hF<!!p@O  p@Op@_p@Op@_p@@Op@ O  @ +s @B@ +x(+ #x)+kxbxCO0 UO0RpFFFF(𙀰0+@𔀰0;+{ "+:IWep)F F#@ @ )F F#8 )F F# )F F#(Կ  FF(F FBB  FF(FFBB FF(F FBA FF(F FBA FF(F FBA FF(F FBA)F F)F F)F F0cx#x!+ )F0F(  p(++x)+kx 0xkO08 FF$I h#~X="IT%#v HRD%-011 chx@ 8c`h(0\xx!+ (  (+x)+Sx+H FH!Kh FKhHI3Fh 1"h7 "F"NxJoECAoBAI"F 0-OF F I,khf/x-*@Zxl*bI*-*(FXF(@vJ(F0h320[^F(@>7.mI8h#.>7̑=ȡOU;x%+y8FF(@)h`HO>@FOs*њx*LНYI(F#F((F F(;hB(Fx.ќKJ#xh320Z FZ(Fȿu F+h(?sBK9Fh.(F0(FF ;I*F a9H 26HPhx+I$w F0n$# "`8F"dBxڹOBoBB?IH:FYpF$h)I!FXF?<0 *h?IFQFHO,,O!XF?&IXd FL ȡ$UP0`"K#J"h!KhK$`+wKO2`K`KS[L$(F #h3#` KA"!:#h;#`#Kh 8@տLx3(0" 6"0"8<"0"0pG8F F8+h)F`h3+`$hpF&N F,G#h*h6 D*`+?!!!!!!&!!!&&++;;;;;88;;66h)Fhh)Fp@ȿh"kh3Dk`h)Fh)Fh)Fh"tkh3Dk`dh i)Fh)FpFHh;FOK,J`pFF@h1J h2 *D `+2 22222622$044<"Jhh3`pGpG(>"FOMhZ`x .(hCh;C`+*hhY`p`(hCh;C`+*hhY`phZ`hZ`(>"-AFKFFx, [,',QT,",KSH!FRK"aB\+Q# {{{{  {{E  {{{{{{{ {{{ { { {I $8F4p7,/,$+x/F50;ٲ)تBFE,$"K59F$F;X< գa$(W;BDѨFGEGFHK/F"a\$A(7;0; HAFK"a$ $ $ $ $ $(>"Xd b}FFF,F `\(аG.jxc*$JiCsa0*!J5 hxF3 27)؝B0A,FM*ѫx-+x,@G%F^+ F;?+@C^* F :FF(>"Xd KIhKh˿1"p FxFSLHcihr##ap x{MBFHiihH[`#+a#h"(NsihH"F)FFHK#3a(>" .SMhh.13`#"`0FJ3xh320F ki2Fh"Xd b"FFFFp8F"9FBFfM"FHhki#+a.НBM"FHhki(>".Mhh,53`#x"+'+! F@#F"` F!#x++FF-+J3h20[ ki"Fh H#+a8F1F F'>F(>"Xd -CFFF"L@- H9F%k##a9F H2F&D,D#Hu(>"@>"-O#N(F F3aeKhS#S7`h%!VعOO:F!F(FC ќKh-  L(X4#FS+`sa,FkfKhBh+щE4\. " FMKFhCh;C`+ |KhhY`$ phZ`%.kx%+ѬrKhCh;C`+ nKhhY`%FphZ`kI F#\'*+7F;x.+{x|*+z7F^H)F8F\IO6DXI F'O4{xxOxp غW غ%9Aڲ*KKH)FX +R#AAAA+R#AiAAA2LF\2HF!0F\(ɁFO\ ps#;ppuaF1F"F(F(>"<`V "@(()Q ,(.&*Sb FXp'(\("(0 Y>o p Ff n r t v O\ OM ( ^#? F ;HpaF-#(@@^#a e a!F(F=F{pKihL h"h0@(#I SxL`xdO `oI"df PTFd(x!#Ls#;ps `~H#F2F)F0tL"xI#n`:hvHsCF2F)FpHaCF"FBF)FkHKl"Fc!(FrcCF"F1FOsBF1FnZJhh(!3`eBF!F^AFF1FUF(Fj"FF(FQFZse"F1FAJFCF1F;aJFCF!F20h(6 x"+'+!jFFX0+6L"QF(F#s)e!"F1F #*# `0h0  hYOO BFKF1FaBFKF!Fr c"F1F(FBFKF1F(FfBFKF!F(FN.ɭB,ƭ$Ki pH'(>",>"”VXd hh?h"-C kh0F 5#D|8d8-OFF:!LI zL0HHAFF(x+=!`F =I"F X#;IF(F<c5I F!(]`i0I F!;`-I F!(I+I(F{bl&I F!(8`o2QF F!{`I F!(I(Fb 61h) x[E F!(sh;+ I(Fsh;Dt3h+w N`^8Lt#K0#M0#P0Cl# CCCdk#cc#bpGj#ABrC##bpG"r#lBl`3CCdB3cK@CcCCd#c#bpG$@ hh>ľ#dBj80]F@k##cfF@k##cdFjhK#I>#b#`t"pFFH>! G[vZcXcT dR`dNBHeF f 8,">F(F>.#bpU\F@kZF8(#bF@kLF8#bf dH>i80p@FH>\Tj >kBRBckBcBl"rBbBd"bpGjF@#80#l#SC@s#d#b I>r(I ]tI >`(I nt I >P(I ot h"phF F+x-+5 ##bKI # ȱhԢj* H)F$3h2`[hccH)FCh FG pPdFFFF)h9%x--41hF F!Hh9h!9`kh C ;` 5 F!8:h--sh "C68 FhJh@(F b8J8(F$( JD(FT(J<(F<(XL8FL#h# ##`e`8>") F2Bh:*J!HH JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJHT>">"pFM.h6FihH0(`p!DH. H& H!F"0H!F+hD>"" ”-CFFFF<F(F!FBF+H.F lhHbԐH'ԏHaԍH#ԌHՊHbՉH+sHՃHcՂHՀH{Hv,}Hqg|Hl!zHgyHbwH]"uH,hsHQrHLbpHG'oHBmH=clH8 jH3iH.+eH$cHbH``H"^Hlh\H [HYHO@VHTHh!@@s+JK_G0F.򋂢BHAH ?Hb>HLpHqHFLoHpH@LnHoH:d!mH5mH2lH/lHhkHo3F"4,? )HNHaHaH`HXHWHWHh.VHVHVH@THTHSHSHg}` ! )(0/76>=DCKJRQ[Zcbkjrqy ('L:H;H</39H7!L8H8H1cL7H7H+L6H6H%L5H5H5K?F.h0H/L0O&h>0F5,Hch F 4\3F:Fd!n.zh\:zBBF !\{h8FO 4\BF !FHDL ,$^\ 7&68"xIFHD @] K IK( FIH. *>"r] sFF"# "`#x#+4 FVF"h#I"F x+I3F"F (Fp”8Fx;#+MI F`8(Ѓh`>" hh>FFFF "!F(F0`02hB" "4h"++x#hx(иB K0h30@ O O Xd  H Kh! "CF"h"+I FD>"T H KXh! "CF"h"+I h Fs>"pFLh h#i{B H@F IB F FBFH"#%a#p>"48FL!h!I*F (F  K"y`YaR`"(Z`bya ""`н8@ 48h>"0Fh FxC H)F\ K #`0O3!H)F#`>"-O%}F/F& 0+2H)F. j#@FOr  0)H)F0F } F"JU#B 0+H)F y *$((#( F  E,9/FB 0+ H*F)D@FG(݆BF FF<_>""h+ + + H]=E+HH]=kHH ApG7 FMjj*I I IfkjB B I"F "FI 0>"D"8Fx 8 I#\%+5#I#T(FF(\+ " L J N O8FT; T8F1+F1FBFh] 9-CFhFx;H1FK +`/O7/!Hx/)\0`0\CFT0P DD+`H1F>"%>""-GFcIdHl좈bH*aKbIbIH#^j_IZHZj]IXHT"k\IUHPkZISHJbkYIPHF#akJCBUJUIKH:TJH0aoRIFH0OJJ0+OIAH(KJL0#LI=H GJN0#II9HCJ#m#FI6H?JcmDI2H Ā'0B *I (HG=lU<+BaAFHFU"&i-OO} JF#wIORuN3j(Fpb sH9FO HF O}+mH9FOFF FmEUd$EFFOJ*OI#JZJ K2EB2UJsj qDBOrhIF!뉛hBNIB,QaBDCCh1hCKB$CKBDF]FK ;KB%;KBщ9JB6KB5H"F+FQFH*2[iB 3j+-H"F+F6*2h3(3j+%H"F+FQF$1+?QhH:FQFEP1;:h,hOrHF!#1JH%HD">":}WEVVEWb|@"0] ?F FFN%"h*o`0o0 !F(F#5+ { JsjqDB I"F 8I(F!F >"D">"8F IK(O2 F!8@FE"/K[i+ O2Or8 @>"{F HF  >"-O$N4M%FOS-3 @1\(I 5 #pI \F+:!@F(H)F&4F#I ;PF чI@F 8(?FI@F 0(u888;x+B0wI@F (OFWFOsBFAFHF(+iHJF)FeI"8FpZ (IF"(ѧ j8FNAF8F CIF8F CQF8FCLH:F)F4II@F XHOO:L ?20+?-E?*"F@F8P)FXFj4@F7e3I@F(iB.H)FPi0$0 &I@F f("#H"I@F Z" H I@F RF(GO3F8F 2H;FBF)F3e>"G SK{>"H>">>"I@F FhO3F8F(se}|I@F FhO3F8F(3fisI@F FhO3F8Fq(eUjI@F FpO3F8F](ye@aI@F _I@F x"O3F8FC(_sf&VI@F 耹"OsF8F.(Jp0LI@F FxOsF8F(4r0BI@F lFxOsF8F(t08I@F VFxOsF8F(v0.I@F @FpO3F8F(g$I@F *FpO3F8F(ݮg a+ؘ0+HBF)FiBHBF)F/"H#BF)F/=JNYcp{)FĂX CE ,?~)F~E?qIHF80 Fp## ;6@FJ 0h320[@#@FF5 H)Ff4!+򅀄K :H)FV4HB  4M[;+FfF )FAF (oHkJ FJ0 O 0+C;ڲ*?Ĭ+?R#Y7%0Y7%0%07%0Y7%0%07%0%0%0%0Y7EIHF *F"#EHBF)FDH#o)Fe  KE?(?v)FVKE?e)FF0ODB?(?W)F7B?t)F(B>b)FODB?W(?.)FB?KY)FD KB Xd >">">"Ks&S[}>"1F  :F8H8(Fp6 I(F J K"1F(FS$4B II$Kh@<!#`O08F&L5+">"/sedArdAsF)L*K(0Fb0#05+>5 I2F(Fs( h+ h+H #5sI(FX(HKH]`(F5 p J I(F@( H2F>"WEVfdmdq:>"gdFHBOr L F@>"KJIXhD"mdF1 BpG3+P@FQ JOa F x (( ! Fb( @pG#pO0 \ 8 L M!hA 8@`H<ܻh(F 4krmLKhFJ!h)FI(ݝ0c+ C+S+ H:s+##` m#d"k0MIFhFF( ݝ0Y+ F(H M0!F(FA(HKFHhL|D"0] mI#F"hFM("iF F m8FMFJ(F>K!F(Fh8@0] |@"|D" hhmIFFjF0H mkB If (ݝ1Y+cFHBrdA'S*Fgj zF JOazzgzGz z T]j7 FFRFF+x$+kx+_(FRBUxT)GB))HQ (;Kh+IФk#"FtC##A8C++R#====#>===>=>=====I=->cڲ*HHO0F0zg ` Q0 zg    @d"~mLKhFJah)FI (ݝ0n+y+#c` m#Hd" Kn:f*oB (КmQeppGI<\ 0] -GFF"F )F# F-I 9F+H V HBFE 4"K$")F8F!FH NFhDFhO FQFS)`D0FzME0FFB6 &/F E  Y<0] -OF MH FFJH!FqOAF+(#W# ZB𢁰IF(I"HbO [ }I";F7C("8F2F)F FtMtN)F  Ah1F(kHX  (eH 砀0aM^Nj)FB=h1Fx(YH,bWMQNj)FC$h1F`(NHbLMEN"k)FG h1FF(DH#cBM8N)FkAh1F.(9Hc7M,Nbk)FBـh1F('Hcc,MNk)FxCh1F(Hc MNJ )F^G(?1F(5H|@"0] 9dw\N.Sr(6J04M4N)FL AYp1F(,HJL0*M'NN )FB?p1F|(!H0N0MN"m)FC&h1Fb(H#eMNbm)F0( 1FJ( Hce M?\_-OMFH0IAW(ЮM.h.Oѝ0+@G0`+@BP`0B:0|VaB  `03Fh3SsEbF”FO0 `I"+(# nGBxI `rȹI""HO0Fd1FFJ@kh+ FG 5}JO R `(=ѠDh  F  `QFC?hx4+\ѝ4`+XىB4`0BQSa;RX[hDkB]H a  " aWHy0x|X  FIF  `A?"(CХjkO F [F a??@H a a"# F)kB7H aO2B{ kAB{-H a"1FN0(K:F(H!Fh>&K[h+?ʮ"O%FO3& B Z B02F;h!F@F%#D65H~ M9LW6Ln=L|D"0] d"dh F0:*F`ڍiBhQ`p0pG0; FNIF F*KKLILIS" KI" FGI" F!FEHmCH!FmAH!Fm[>H!F!F j;I Ffj9I F`*k8I F\k6I FVjk5I FRk3I FLH 1I FFJ /I F@L -I F:N +I F4*m*I F0jm(I F*!F'HRp#Q-;FX!O\5V/9F FB!FH8 F@;񀽥د)?NajzT-OFOFX 0F+a)cбk)`,[FFFYFF>PFYFdJ@! ` rjhkF*jFFF"PFFUJ@!XFVSI:F Fz*{ F!*NKOIOInn+{;ڲ*j+hLgLggagLggVggggLjhCI:FBKhk{11?I FJk)_hh;IF F@hhkBA!F+ }kjhKX DDv1IB F*X 0hhDkB2!F+ d*H!F)O;뉪hk{11$Ih Fk{11 IhI FJIk!F* !F k~)!F* !F )O;)د  ?%v8I\nF FF & I H!F0B F@;!2F;F)F F6pG@pG8Fh`Ȉ؀R[B@[(R[B@[шj FlFbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXeTXEXTBElRuBD3l#J1C 1 f# 1 `# Q XC Q Rh"C B8Q 2BC Q "Fh KB F# F0Or FWEVJFhB ѳ JhB!F@оBѳF!WEV>" KFhS# F0Ort@"(B(Br۠BA O0 I LMNFF HH I HpT+  FvIF(mM (h:0pI , hpC_lJlImH   2D0OS4(hYF:0VF&0SD0 0+Oq ~SFر#FF7F2FSrcFih2FQH~HI(h:03jh( ( }F!( F>Ǽǜ@tF6L hhha@BFih3H@ؐؠ,?2#.H̰##ih.g#BA$h{"CSr(h~2F;F??ihH6GHFOrAF(h: HXFPPFnd"wd+xd [1G] j0] H(-A FIh",(4I" !i. " (/I""`h:xFFh'Ivh"+ jfC2s3!I .Ib"`hxFFhIRh"+ѷ??I*VMI,(h:|0#h jh I HX6Ogd"ydk.-CFFM$OY!IBF @Fh48Fh1FG hC:p LMDOch`hBFz `0bh Ind" JFRh I^d"k.(7 FMh I(F I(F( K Ih:0 h 0d"wd(7 FMI(h:0 hihH0d"d@>IFFH ] -OFF# HF F 3!E "  (I(FJF:0%I O }(IJF(F:t0SE K ,F$B$}IH  BEHIF<OG#2F(FQD4O Dk7!p FF x,KB7+KB@}SB F&IF T$KBc#3B FP FJK( FFp@: F~p@F FH: FLFFH Fp@} FF H Fzp)Ftcidyararbmn J1HLhDD"!AFh"F*LqO0,ѕq@p8D``?`. h `h%Ch-<` hh##DBO0 q@p8D``?`.2@ D8h"K !*03(pGh"-AFKFF銁FFAF@3BF  #hHgI0F:3\2 +$+Rx *`IZ h1 V-+! "VHLF F0FXIF FUI0FTIBF0FRIBF0F萳II0F33\ +VAHv#>I8Dg2FHPDT6KOYh\"DCDSODF F\2TDUXDXR$X2[DFX2dFX2dFFD B t EA *FH #F$UFLF(F!F ]FQh"\ k"\ Z: Xd ^b"keisLQ Hch;c`+ F FN(F (0I 2#hZ"`xch;c`+0F #hZ"`x +% YXBXAp@pG\ Z-OF0NFhB.I uhO DDkB tRF#F??O0rhh9FO:\`9shBRFh#F??`B=Or9F DJ?K?H)ؿF1J1Fd<h}"F+F8HZD1*+2+ 0+b.J9F+H < F)F02XCF/F3FZFQF H$1F6"F+F.2Cw#2rh"a[а?\MK {@#;*"kJU#BR*T=K2+s #F;Nҝ>0)+6J1F6HZ0)+_1J1F2HXE#.I/K/H*ȿ F(J1F,HIF#K2+?"JU#B!KJ1F"H!HK2+'*KJ1FHx)! |FI KYF"#KJ1FH\HF|h"?5X>N(-AFAMF4bN (B1-h F5NE 5Nm1F*F+3HA9޺1H1*F1F/H1*F1F+HG71*F1F'H1!1F$H@sD*F1*F1FH1*F1F?H1!1FH@sD*F1*F1FH1H*F?1FA9h"5? 0AS-OF-4cE(~ F30B@0FO A+ x FI "jP жH f #QFXF& " *q@ pd `CW@Xr*@ۀBuFJ%FT@lJ%FJ+?ZFB@X2[BBB2F F)F0@#x h"-GBVLF42yTHSO%SN42)F8F)F"5#0Fa-42##jIHIO%@i42B+yP(FFBH42+m!>HFG8?i+:H)F8Fh(F&hOE*E&F F0F!42+@FN(F&hVDF F!0F5!H8"FH.iBHG8g(F$h}E$F F F!GܺFHH"#)Fh"XUMh"i *C C}F!O"OF F0H9F }\" FI" F#f\"! FK2+h+#9FeH#"i#BBh#iBK9Rh"[#0N0LB d2C-I8(+H,+J !0(H"#B d2CI8(H2 FiB1o"hAE"0H)FROu-h@"0 H#h5;D\h"mdh"0r"Fi,/iI FHI F I FNh4h<Khñohhv,F h9F( Kh+Fh0h9FF( F$TX0"xF FFLF8F `0F#`kh````4l`-AFhF FF0F F5)FJ3F)FF@D<`FF[-G]Ki L h)Fv(dhIpK# Kiѹ Oph +`JOa `0F#h`+hc$h !F*h O@&4%h$` ;9FNF(D%C$ ]`pKi QnKrJ hrHBF*pN0FS%"BE 8F`?,J  {e{a Sh+ Sh` Bv(FF0+-+ =!HFE$B4#4;E$4FGH  {${! 8Li 8&븹 a88C 6Hi/k 8'Ki[0L 0M*F@A 4@#h 4@jh+T?+bh+!H 4AF( 3H 4AFH 4AH 4A S Fh(%H0"\d"`l||h h O ?* ](?#OrB?|eFHK"KpG$"KhpG$"KhpG$"LR F!F  X] -GFFF5ILch!hHhS!hH 9F0Ft-PF{FHch{ 6chSL$h!FFH $",, R]pG R]pGHR]pG R} -Gm(FiFAH$@8,B>H5F(F mr@20F9F7\%CRRaAU5LAFHF6BѕA0  O"A0T谱akO BH   0BIFPF  e0Fz@Fz(Fzm3H1F%h ik)F@923D f*H)F'HAFcjCbceBF"HjAFclF e opBBdeH2F@sB KR#@r[OsBOr[ HT1"#!e#ef$ly@F F hzF$H#k%"h8FZC+Fj"h#kSCBBH0FzP R1F8F6#hCk8F!"l!"kZC+FD"h#kSCBB HR1F8F6#hC0Fz"(Fd5sFFlFh" B$c+`,h,n3f p o3g,mB  KJ Fl H@2F} I 0O3 +`K -GFXFh FF (Fz8`8H)F` h#@F UV*F3FBB HI8hzm@F"h9hZC6dm"hSCB .-O$D FFp7m?8Fzr FXsH9F(Fzt$ F :F!Fbsi*xlBkxhѨx@(dOpBx)?)j $;op@B7x)y ,y, ly,Ѭy,,Z( (y(hy(Ѩy()yOHyiy)yxxJIII $lOrB2opBB0O 3mKE+(Fz@FOzOpB op@BЩx3H0Ix0Hx+Iy$/lOpO :B   op@BW+QF@0F`JFCF0F7H JFQFC QF`0FJF3m[EDٺx0F73QFH ZFCD  |CAaFH KH FpGHpGHpG-OFF FFO 'P0BHF )jE!2K P@F 3F8 2 6H9FZF5I ع#I 745  F9FZFF)H)I #j+b#%I2F(+j#bF F!H9FI2F (I 3F9FsBFFHI (I2F(#H FBF9Ft I (I2F> Pbu<XmpF$+mBpkhBыYl`Q`-AFF IFFRF0*F1F8F  IF *F;mB4X*O30`-G"mFFBO %;mBHFHj j 3FO]hBZ`0V 0+ٜB؈b21QhB ёh,F" FX,$٣B b 2 F)FF-HCF*F1F8FI 5RhB)2F,$BH"F)F BF)FHH#F)FCF*F1F8FSIRFF  :mB!chSE =RF1F8FH"I e`tX,R-OFm hF FF_C8FyF@eH9F]&0F:F!#lfFci!ipp+pOsBopCB m!O|opNB7&FFhCEz(Fz+p!pj`OsBopCB &&l!FPF"r((Fzo&2F(FIFHFzbOlX `bEO)rEn2f2 px3lf"Cl1n2fFkFn2f1  Bp3D`n2fI2 3,mPFh"#h+[FYEBH&g:F)FPF6B-GF` FFF&'#mB #k+kY5!lJq0F$0B' 0# 3+!,0( 9FPFV;F*F!FHFCF+ 6Id0:F)F FF7nB"F-H3-I M!lFhK#mB1n+ X+$J)nHc!FHFC!lJ"mB(+ X+'"mB + X+'#mBn'JH I "m#B/w'iX #d3>3MhO? OBڼB`\&knx05"-OF7аFF_C1 ;D,3mBB  1Drh5nPFU3h#BF+FB@E:FPF6B#E#BFPF+FB@E H Hi ;:FPF6HBB$Yx"-OFFFVF+q/+/H+I EpBlJB@FJAIF1bRF+F`( AB-#B  HH ; 2"-A#NF/'e 3c~@F+FB5FAF|F$h,F ?",+F"K OpyBh %pG"-OhF F /Eл@ф m[E@̈́$O3%F'F C D07 *3 X0`3v 3F #  BBСHl cO3=FsBD00+ @[#  BByH(1Osp 63rx*E*gHF FlHlI (G(1" AF#(11 $(?sE1 "BDDD(1%DD#DspC(1D KK@!JJKH +II((1C(1 D 3{+@rxQN 2- =F FOr!PF{ ;+K; # !  ( ! ( ! #KB"HOe ;F/FF[+?@HA-@;F /FF3{ BB%/ ' :F/FF'x:ahr""Or!b2{ g3F^ϘBOp0# ()D {Qh)!h'-?ӮHF#"AFO32 +FC%:;Op3-=F qz ). D3sqzDs 3 \ D O D (9Op/@opBL[B_r}CC}Cc_i`/ uOrQFO00\-@ހO3 ^R`C@ހfFHLI f(K5wDDvDL opC@FBuuu_#_^5-@2P B6hB`+R`ñ+FHI +( DD#D 0wwsw`IF(@-_ 1BŁHFFHI F(\ 1_v_ 3wL opCB~1su1u 1F۲CR/DBڲ B?5- ;F/FF-'+0\-?PZF2#AF  +FVC?2 E/1B?*HDD$O1 ;F 1B皹MIt00h+?9|FFHb#*P0B[X3 3+ChB?[X^F8HX_F5H=^"3I SF(#spDDDh 3 <_FX)FF&H/F$H$I 0 PDDwopCwDuw5wvL BOuuu`D+ڮ--D+ѮD,F2cI(AP-;/h_ӱHFFHI DD_D7wvopCL Buwu%D !BmHFF{HyI F 0 1D/F}FqHOrpP( x jH Ch55Sh03h0d BkF^HQ^I k(?Y_%d`DBY@FO3DQ_`5'%FJK 5B$DO RP0[E?DZ =FHF#!O31AF +FC!D00ӹ \ BBΫ ]#K*F5B«$D$@n khd0]C`Bc`+FFHI (?DD`+ uwwD+ -w P>, K b   "y -C F#Fi?NOAEF@FxF08HAF HFxF(8Fy1HIFH8Fy@Fy+HbOr!clСk)#mB"H3 X( +!ShB khC`5 !縹H"I H5F(F mr@20F9F5%C F4(W(΀x-T`XX.`56(h5FO`_ph!4z&phOr@!4nF.#KERE a(Xp%t#3 F\(ڧ-O ""`=J3F!P"!4:PIF5"( h+ F64R6P+I F5hh F4>&'I F5(x3$## F ]`h5xxO4x -Xhx-5x,ۻ-5pz   F F@FpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h``lwhd   lm(d  lcd`p`lSd mO(e`mKhemGemCeQ BC p`"54S+BE+8#FBT#!A#38 FFHB<68F F#T#E#34+g fXX\\|q|pccWFgfWFcbaXXSBBczgfp j $d$(^(,X,cW|FvH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3C OsE0F)Fe %`O"j;h]kUC0Fh 2O [br 2PF MTKh*F"QKhFBiYQF[ӈ[Ӏ# 0 #Rcs #*sO 9DO F#cF #爈$oO`FFhF0 Cѽ0[0ch F@ИGF8%J0hC Cѽ0[0*F2FiFF k0NDT#9hOR 0iLKih 0iFi# 0\ FF @""H"h"l"H"p"t"MFFFFH(!F(FF 3F:F@AT v-tK#BAH!F(FF( z I Kp@OFH M("    7 FF0𵗰FFFX"!FhFv#H0K7## Khk`h hiF F o`o)d"(-OFq FFF𨀩K#Bq𠀸u𚀐EuX"!F&#0Kx68Kh-~`h!h"KOyBFKF.C:O{-lBFKF K PFYFk F9@$;F @2F@Ag 0F9F5pKFMF&FP0  @@!C! (x ں0F3U30RhC0 t o:!`o6"VBFKF K (FYFkGFWF 3U#0+##C8 VF C300 Oi" Oz2H m  $ K F%JK H    J JF! Bq A 8 @@l D 6("d"@""j bb Jnp DFk fjf! Bq  JFAFKCi+@ i% < k6BiF*@ %i* oIc0D0 DBa# 0 P  @$C C^I h)REq 85L @5DAF CiF+AMI"iMH AFKKh{KHF# 0! 0kZ#!# (F "F\8J3IhFD5H(3K,K0hOxOj%i  a@a8 K"`7j 4F$ b an`@]f d" "2 @"> "|"-OFFFFBB4(Fq Fb "##0 0 [kZ##F uKhuK)h 'O@gp :F?4p(F8))FOs#Or"6 B0eK@ Fh *F0F F[KhF0ZkBiFr F)F$%F F)FjQF"i\FK(hi iIk DE" :Kh+Os#{+Cx!F z"#F8F"HFQF$*KhD0FAFdx+0FAF]x+"F+F8F)F FeAFhh0FI)FF FD0)Fp F=x+x)FF F2AFG0F-C3C0FAFF@l0hPwdt"@"h"d""-OlMF F!X"Fv)F FI@@F>pCKHOF^ F)F0+U0[2C ##; lM2HH3C1FC3CO2C@! !H0#X0K0F PhhFi##J2CqыHH(щK"`oPoH0cL0" !zO#?F FRH !ȱvJh3`0tHP"#nH(ѮS  !F@}8yPXFQFT0 + PO^p@OHSHtRH(`" !L0#P?f H ![C"#f#X0IFK(FhS"!`(C"@S f #3FF 2p(O zEغ $'O'N(M;h1h(hB7d1v+hk#H: F87A?62O`^&0X5X6B?BV`+h;h(`d3;`3h*hY1`B#@""""""d"8F K Fh KhS" H*F#F#BBh8""pN3hKMh,hC;+hB 0hv5(hv2#+`3`pT v*"""K"h pG"-OFH0$ FF+F ChGFXF $ K*jF(@.t0k{0k_oCFOzFB!pI1JFSF#BAK(FhKh+>ѻB"iR# B#33JC " Di  E# 0oK!Fh!jhmKBmKhRoBJܸEKۣiO #aO aHih Q;@hC!OaX(FYJXKTHihȱ ! Q+)  hIoYEIK!FhA+HI`FJF@Jih)BS8QhPAѕH0+bV _;K" @@A`##6H A4H(FGt(JhFa )H(J!`S((jo[(FGFТi"a2FKF(FTa Oi 6O #L"d"T""|"@drx"-O\$] hF F`+# `v F(0CpL_ Op$(5BOpq ۸Hh<*qۣF2C *n+)F" .)FOr :kU(Aq%jFFF3B2FZ0@΀+ȀKh8u8@@uD%BrlIm@r ' G BC'bHp+P@/2+/zK"G@A`##uHGtH(@0F+0khCOiHhK"`56 -_Khk#b0+ 4.k #O sCOzaw)t4PwєH0+-w{KK"G@A`##h&H&J1;A11H0+   #o!F(F!Kh˱IOr(FRD#p@H(;h+ I" K`  P""d"""|"0F FH#r !F(Fx) )HK+0#p#K-OhPF F x+$%F F)F $%؂&#Bu8#BB F)F0#ZFXFJFO hR Bs>V! .8 &^E(^F0FuFH F)FxF+4EYh6!S FBĀXhu|K F)Fh C `gFvI ,\5Bii(YCL|hġLsȱPFM08F FcK h*+_KzhB#B\HAFYK 2YHUK" zh F)FB5zm 0 #ACq#@ C 0;j;;b4$;4L3B2$ h:`OR8Khf1Kh#Fa# 0pCOг O?гO#3pi3aO  #34+?|!K9Fhs#3pKh8OO8Fw F)F qKFXFwC"ц#3p""Tt"U )ؤ"p""d"("P"H" OxD#e8>J0  Xm   +HH AFXF-O[ @POh!#'J13A1y#Kh+?>3sp8{b(н Oxd80[m   +H HAF8a8baXFO[+KPf"h"-O\FKFPh# d0I#F\Bii&ACCshCsPF0 F qKh+0+mKbhB#BjH1F$X"!fK@F9F8UcKhF+@h`h\mX(F ##X0+UKh+SIOr(FZ@F9FJ#pX0+ #  PDJ1;A11,Rbh@F9K9FB05um O-ACq#k\#kT#j3#b4$34L3B)L$hi2`OR#Kihy0iFui%H P P0+?@ !F?7ohohnV I"h眤"TP"U LEd"""H"p"ؤ"""t"-OFoKFFnJhhmkypI~! OO` r!O|[B{B{  $XED XC=A ,uڎIP `EKhk 41FX$/ #h~H7k#h|H0`#hyH)#hwH"i3#hsHhqHt k"1 DB 2 ###hDT@OzsRF  E [Cs+FAl "#d!  #RF+F KF:FLHzch+# 2ChcRC#R@ 0, br4Z0 J H DJz80^Cf!8FD-JpF a` #RH#iSHN%i-@ #l+<H N%l-@ ~0"oy$HfRgJHch+r%%d%aedl(FhORfhnHononFn#p00#0 %ShjBOt#0#z0+(H'K"`l+?i#h$H0"HP(?YHx #B"IH1(?E#hH0. ;#0FR-h:#0FL-hA@ht5>"̧d-OFH0v+zF3*sɀ*j8F1FF bJv_J1\A +q@#YHMYKh+sXHLO@F+jNKh+TMH2FKFrN kBBS;B2FKh;pO#DH( 0?OF+O+h^kOy0FIF"9hHH)F#o0 QOsIq)FF^'Kh32F)HKF"#'H\#Hpj(@gpKh+\IOr5+h^kOy0FIF(""""|""|"P""""t"0d"0Oв_U5A0 -w(F @߀K G1O h(q X@ F(?tJ13A1`TX(H s(@:K`HH(@7 $  O+EцJh*AqI2;)r:Ңn*7ЀJ jhI# hd xH wKhS #vHUi#4 2FF(00ó U^Kh(5+:By5cJh<.y.+L02CDIEGu -w8 '%) 5G-fn+(IEu0+Bo9kC3WD۱0C##K:Kh+? QFT#WF5HQ*0;#WF F,HQF|2  jo  ñ40C## Kh+?d  T*OFHzVQ*0;# 4FF FH2  ""|"@l"X"t"""5]t``Kh``O@V F ##p#_Jh3` Sp03KhOsBFBOrF g`g-zK 0 00+C`hLhPmAFkM F ##H0w0+K+hdKh+EmXCC5[H#YHXK"`#p| osL`onP`nJMK"hB#OpCeF @ +hCKhZkSVsC3eDe)uѠn9umF4(4KF3N`p O h#H0# kKDF=2hi U +m85@$@5DAqlRm@q # C AC7 0PѺEњk0@FGՍ8"<"l"P"`""|"t""BB#eH1Kh;H20FH0+?"#####ػ H (8fI""""K!-OO LMN"hjB3Qk0HHDDLTOO EpBu_X"!K% K K 0$jB_K`0>\Bii!xCNFWi NwIhNrKEr1 F F*FFB@Np 3BN  -#F*FE9hCBs 4EBT0!FkCFmJ\5B0{#3hlLCs F0i@F dKhdKh*k+kbKh.nx@&`O;h0,YFFd hCj+FYIJFXH#;`VKh+|UKx+xTO0BR3BF5sbF1BAr2DTb)X ?FKhC5@$@C!BBO "F3F>Hii%BC0@z+ AFi0@/H)F0B\0CDOF0"J"7Hq(6J"h*@8F $HFOr;h(I;#0#0'J;hhCѽ0[0#Jpy7'3#7DB<#hHJHM(?BF F0|Hl"("h"y|",t")d"H(?䮠_!FWTF0F:8FMBF F024F3B2nC;C#P tFFy3#DBE.#hkHH0 %~Hc23B2zKhyH;b#{b0JF F &oH(c23B2iKhhH&6#h   !F8F JF F h U5OsO sT#rOr!*gK" 'h*H`:XрPkO< 84Av8F6@vBq{O j[E|u ")F (\DKh3c  b2HS#1I*c(*F*F2ήBB 3FB#00OR$K%Lhi V#Kih)"KhiF%i# 0 =#G#)FFABGr3AG  pel"""H"p"t"D"KhGj9FFd [F2FIpHJ#` H # 3\Bii+ACC FhNCs0FO i(FK h*+𙀊Kh[KjhB#BІHYF`0+~H# 0KhK 0CK`hC~KhCv}Kh wK\e . jKB `p+~CN2F0d`hNs  @"C@;CAF8d *<$ AC BsUKhVh/@耔 *;j;E +?g:h)Fi`8h6O  # 3\Bii+yCC Fh8OnCs8FO{i2HYF1Kh{iK.Il(aK!h0in Kh#i0J\B J&\%KhP(KhB8" ] Tؤ""t"p"U 2"H"""T"d""Rp"|8 "`"P"KNhKiKh  , \5Bii+sCL Fh~nnLs  @" C@C j";$5+ݡk0Ffj#B("jB("0*kB"/𔀪oB(F!aKB 냚\K!B @W0+L53QK5`' IF 0CEXػHKB CxBp;@KB CxBp;&Bz75K nWFOh;j";E餉~iF80D02#I;Fm9F0FxK+!3OJ;BKF"@X\CZT6Gx.wH2F;FT"TH""U D"/FFG BLr \B ԃIBF O   C 23GkBBpщ3+C`n2JB S 2C JBFЂPF`npXF9FT"#JC9F LF @803(0$5+#n &\CTkDJzP5XC@ +Ћ DnIB c[X\!AA#@ F#J$5+ݝn'O 1D2;F0oBK$%BFQ# 2A# $2(PBr22Br22 Br22 Br2O L3" 1F F(98JhYF5HXhsh;Fh/I* (gЈ"0F,N +KORih )Kih'KhiFid# 0"Kh+G (FN 0F# 0  8 7+CFOL O Y+$BFQ#0A#U "H""p"t"p"ؤ"}K`)F 퐹yKB jhBTimI qIV(QЂ(FnN jKjhBThm@B  x0F# 0aKx+@[KB@𪀙DjhB5qmI h(?mUI@C(?fMKjhB5pm@B AJCK`CE CkhCE5sm[]9"6B؀&:HkhBCEvs+n[CE c]9'6O 5r'IkhCE mF[];A  9DH7/ѻ\&HO 5r'IkhCE mF[];A  9D H7/Ѷ @UK`r|"U ؤ" "sT4-O 8F8F$Bӽ!F@Fg  HF_E 4tRM+h %@񜀓C9rS60RhC/HO;h+oGKHHS$+hDN)hORDi L=KihH5F(F mr@20F9F-|%CKh *2H8F0*GJ `GJ`e(@JDKh#hC0CY-I|2F(F h0;H)F0;8H)FAOs5IP3I(2H)F.X-H)Fh*H)F4&H)F#H)Fp/H!H)F\"T"" X"!@""!*!x"@"""""C!F(@]IiK h7B'ЌKh+MHH (AO3O29F F ?@Fpp# 0h (F"zH0+gxH(i#[ ܁rH0+ppH(r#[kkH0+xcH({#[B/":*/*@^H0+XH(@# F#qcqziFBRORH};h+@IH|(@iKHr0+#O #rcrr@F 00I =HV0+#"ct"t@F000# 0y1H<0+?O2O3! F n#@F00 # 0gH0+?x7'i#8F;q{q# 0o7T ""!"x""X"LBAL(/(d(((("("(z%FH;h+?Ri# F#qcq# 0>K"`=Kh=K) OrOb`08H`-h7L 5s6 #"''pY+ɲ.kp03B"!p",H@S)H<#x%!@(Fn%K!`F(Fn#K`,  "HJ#p`J`JZ!)?HHJ+FHZ BH"8#J( """@")~"|":)""f)%Kh IpCO س_гOг_ KhK PBOг@OH t"")F5Kh5H4I0FF 1Jlx0Kh+/H1F.K p -KxxC ,H1F (Kx+(O(M1F8Fx'H :kh;k`+"HIJ ,kh;k`+(F (y, Y,+hZ*`x竉ջ+hZ*`x +Y,n,N,")@"T")"")v\ 0] pF KFFh H2F+F!FVHg vp")@3KOp-A$-`0K`0Khk9Fo-H-KOaaOp @ao(%K9F%NaO @ @af%( F( n9FFOpoF(,(Fn3h4Ean`+`5`]`O 0aѽ,+ѠF""")ؤ""("-OFBKFFh ;"D;&BKF7H"FK!@F2Hj'=FB "FKF@FF(8F AFFKs# B)K(FhIsB) 3D@OsF FF H70DD#H x"* *7*t"-OFFF8PZ3ZFDZEK"`H2FCF$HE O+/b9FJs# dB F HsH0DD@"F*L*x"-CFMi Fu3K i3Oh2I#B9F0H#i%0F Pea#i*KBE)O,F.F:kL3B 0F#*FIFHF8hkH$L4aCCsAn  @"C CH@IFhK0#*FIFHF;h4kD;hPBx"x**H""T"t" 0}pG-AFIO hIn ;h 5C"3;`#CBBK!Fh H{h2F3{`+Fih\e`a""T"X"-A F MF I,hBdhBHd`  G C!BB$hiF F2 F`Z`+he`#`\`i,`Ca(""*pF FF!X"hFhFe p FhF)#  H0+ 2 Kh[ H##`  HF H(##` H3"*”**pF N Mi3h)h "Kh32hi(hp@p""t"K"`pG8"8FL FTBA H Kh Kh # T0BXhH8("*""-OFF FFFBB ѣ3C F@IO+HFAFx;+6I:F(FT"YF'pEEOHp7$)KFhiFW8(F )F;FF 2/"G,B'F3C #0b9F(FO+K1F FFK6iF%?#?;p<#4C0̧n M,"\%[K-CB}F F@𩀐0+)U h#O`n(`(hOHOb!F LKhLHKJL5h*8IN3OOx3h)hFOHhF Wq:F3hIFHF|iF"2 E[!;3h)hFm(h:FiFWp3h)hF`020204#k$ \3#j$ 4$bj04#8$j<@$ DH$OR#0L 5L53 #P50"0#"# }T+"=+P"t"F F\#IB?ѓ); WpLE40b  WqPEPE@@@ @ Or]K+wOr]KpGT-A0Kh+@CJ`L h(ڢKhA+񎸠IKx+<ПKh+8ОM+h+QНHtKhKhKh+Oі0+KFOPgMOR1FiKih0FkKh1F0FgiI h# 0RM& hO)FiMn? h)Fin8}h B9iB!H~H((+h+Ф T)F hi6n(FnEFpJ#]M`oJ`+h+EaO;h0?\N3h+5hH+h+59hSM#OR0ci #X4SKih8FQKh9F8FiqCI h# 03hKPHOH((`MKh#MHLK6M"`OR8Kih9Kih0F7Kh1F0Fi=)I h# 0hkB$I1 Kax!SaEs#@ @܀ B@Ȁ FAF\5!FHBii)XCAqzKhPFvNAsI;h@F BpKh+3h+mK B#BiHIF;h FO vs\H h CTZJ0B   `O@D]E  " MHO~2[Br28hL3 kB]0;02;B220n;0AO3AF39MOR9hip6Kih8FB3h9F8F?i&/H ` F `O  I0%D3BD 3h+?T:hAFL$0 $[$04[4 0b $[ 0 F"0"D"T"t"P"U  "H"p"ؤ"KpFF @P%8 m8 H=CiB iT%0PFaD%@ ap|"@, KKi i@P"0B@"@FiBa|"KFh 5p KBBB BB    "^F(-OFq X GFFFA(=XF1F(7KhNh[iSE"QFy`h1[A1C3i[iKE K"IFh^0a3i!RA!!A!"""pG-OFFkKMpF$S"0[\OC kBܽ#DJ4K'F[$ S$0kBB 'DX$@@HDH$[R78Fn*#\(   [@²\@BZ @² @²IH\,Fn*%\@ Z\"B  [\"\ACIH{ĸ\,Fn*"TX"@ \# T[""IHPԸ\,Fn*"TX" \C T[""IH&\,-GF F $(In IF&n*F +Ow\O ʿCCwTIF o$uQF E(FH! @TFDEB< `F N~8\"@aFqE:ܬIF2B:FU"D.E"U&E&, U$IF{xE$4IFF!B1Ri"-G}FFFFJFF(dI2F R(bI@F&4(F(D]I*F@F*0h+XHIFO0 }kk6j`j`+k#akkca#@0#bB0cbklb"/{FI:F@F*0t@I*F@F*0:@IJF >IfQF8"F F"F:I0F8I0F` 6I0FZ4I0FT2I0FNh"F0I0FB,?F.I00F@"!8FHF*:0' 0ByBOЪ# (5D*#*#0w "F a#( x,d@edA,zd@-,,-,,,,--Am%OcFF)FFxvCF*FF@FF F)PM0:`12(F mF-G] F  .%FFFP*B0`pC_x/!0FCxr+#`dJcOaT!T`FUEB+,F.#. Ft``*nF(U0pCODTsh|JOa(F(Fu`F,%&. F*(.> F)(W(΀m-T` PX.`*.(h5FO`_ph!)r&phOr@!)fF.#KERE a(Xp%t#3 FT(ڧ-O ""`=J3F!H"!)2PIF*( h+ F6)J.P+I F*hh F)6&'I F)(m+$## F ]`h)mmO4m  -Xhm-)p,ۻ-)hz   F F@FKh @pGt"KhpGt"-OF8KFFF@F9F5KhkOz"FSF Ew ܀7$$ 48FFO`aq# 0ZY(F]CHKhCH# # #'@#U h*۰mK@FBHi0[Y]CU He( K` ~""_-"z%|"u-|""Kh )ϿpGt"-OFF FUBv 0kBOst8 0(F!Fk L @Fi *FIF#FGB " -#FF#$BB*" [EF F *F#F0kB [i+H ^E " ^EBi"a Po^FF Fi#a-"-OmP` F"C FFF(<F?FF7WEE#љBB*#2FHcKhHd HP(K` -"z%|"-AOB F !*NFF3h+Os#FC(F"#M+hkBSi3@F9F3hCKix)h" i"aOR Li. Kih3hiFi# 0t""~"H"p"-GFiFFPF F;PKhwF8F FFHJHIK` GKhFKhk2+FiRF0F" i"aJPF F9Hؠ0kBOstC0(F!Fk iD#8F#`" HFe K (F#!F#"CE i"a*F8F#F0kB[i+ H$ d"-|"t"" .|">.KJ-OLFOKF#h I rOS5QhPnxS+0;O #h9FH#Kh+@̀~H(@ɀ#h9FzH#uKh+uH#hO#hrH# #hFpAO#heH##:F[Kh+\H#h/"HF#]!h kBZi*?O #hKD #hS50RhCGH9FO?Kh+gDHN h1F #h"#F"#hkBZi*}6Hi4K5H4KFhByB Py0B҈3B)H9F#i#avH?EvH(>K "` H(dH(j"djV."y.../  /t"^FF^.|" ~"}Kh+6b2F &ltK`FtK B!rLO3 h 8F J(рE ?ā# BGi#a !h. (F k !O 0 lVK!"J&YE 6Z&`O 1 @ 0 8F(H 0 +O +F#k4FF:J2  B0Q" \AO2H 2Khñ1H0 kұZC8F0kB;(H'H(%K` 3h(Jq iD  0kSCAqBO  i#a`4J [i+ FQFd""9b?/"z%W/|""LK(-OKMFJLKKKNF#h#A@GJFJh"#F_#hkB\iD;H)FZ ~9Ji%p FE ؀ؐBi#aERF8F  (:S$4#1F@F### %0H&#8F### ?PPF( K` j"jd~"" /"/|"dr/"/8M+h %4JLBH#h 8H( ##CH +h# #C H #h+( "^F"/@// )%pG-GFvFFFIF(F:F3F F8FO`f# TD&O` FB`۽#D# 6P I-G%@F4FFFF F! N0_ H#J ## `:F!q F !F  @mH# :^F: F^p FFFr2Fk2Fd2F]2FVppFF F((*Fmep-AATB A ҅BAӃ Bt ҅BA E|   Akk@P!ABBh-OFiFFF%󅰃@B:K@J19J:H diiBvFF"jF bhB# ( XFG XCFCpPF ]DD#i  (XF@XC!FC)FPFbh7FYGBvF>FV0\C0i!@BK@}1JH 6cEvF5FdF=F|qE$ 5FF EF BuF5F0lC0pF%+K@,1JH ;ch BhZ`Bh`l#kYk(bk5B#K@21Jpa0C0w0jFKh[Hjl# Fb#`k3K@!JH j k@l"0w0C0jF3K@AJH N@mlu F@lp0C0-OF-FF# -Nе?9+$+F $<<_<O1F 0Fl5P`hT@ h3DP0 0O OshBihPFBB$H& FiA B43BFOL IAQ PFI,qBB K@ 1 J"0LBAW01C0&1d1ɻNBAW1x1ܻAFPF6I  #k`40`@0  R#`H`B#803800O/FOs hBji&0FBB47BFOL Y AQ PFI80+K@1J|;80h BhZ`Bh`lL6I HO$PFF^PFPFXFO a01-GO CiFF j3K@FQJH O0$kFF+kS(p_kkCE0Fl F#1F(F#JFQF(#IF0F#RFF(?h0C0-AFCi&F@jF3KOVaJH 1F FY K@aQJ:FCF(F (, F$0C01-CFCi& F@jFF3K@qQJH p1F(FQK@sQJ4DI "FKF8F(#AF8F#kF2F(F(F0)C01K-sCFh F N3hBF HKFBF0hKF!F p"T"1K-sCFh F N3hBF HKFBF0hKF!FD p"X"2KMxQHN$O+hmB(hPHH( (hN2hR[m8FS4Rh4" "C2"2x2@L h@j ( hS##` "7FHh(j,)F0 F "8F FKhñmJh K@"h`B #BB  8@n d"t""pKsh;+oKԿO@bO`b`lM+h Et`) gHcgHt(W a)7)5aHR^Hc(^HX)h]LOR 5i#s 5#d3#a3UKihXSKhiFTi# 0#$F !$p#x3.h e3#F FCH!PAH:H)h9LOR 5i#s 5#d3B3Kih1KhiFi$*K" *hd3+7Y)7ؒayK+.HH(?j!HL)h#ORa3d3iKihKhiFi$] K" + FpHF"""2@22H"p"t" "3:3R3I"@ $#-OF 3FKF F  h3SB/F=FѴO:FIF0FCF ѰO;hB$@F(]# F#O3 #??FFS k@ft-h- a-7b-$НI FXi +R#}s}s}}s}s}s}s}s}s}}} F0 FAF Fn FD#AFF ;hBЫ F k ##F8mBqI2F F(F7.q F F7 hI2F F1F F F' 6mBmB]I F7FF F 0 F0TI+s$$# # FFHI# F FAI X F:FcF2SEB FB22B;B2 28$"XF Fd0?o1F FFFFcF2SEB FB00[@;@0 08$"XFY F<0?AJCF!PFG#I F%###rSF2*$l3V @y33333#4TH4-CF jF FF&PNEBF)F F*F!FkCc8FC2F)F F6 k#c#-OOF FF 3:F1F FXB јKhB4ЗI mb(#A(%L(АI k kO0c(i( (F0(F (FC#H4pCO O ,FF F  h! FDF2C,mI FWB"ѴkI8(0 +`b \ $vF( Fj WHUI F'.8FkkQI3x/+0F3FNJNI(#$jFHI0F!'  FDIs0F''0F# DRF#F HBPE(Fj5%(F2F)F'B-CF$4Fh'!UJF+F BHEO01jBF'@E48FC4#R>]pG3FS[ dhk)FF F'0@pGF04[ Hr ]pG-O!FFFWF@qI(FO0'nI"耹&ih a F\B 4+gIJF;F(F Fj 2$XF $) F (F#Fh0+4+#(FRIYF$m4B +#(FKI@FjQ+ 6AV "#DI(F#CJn#AJ(F>Ie#"B#"(F#JF;F4(?~VO##F(F# F(?f>C@ cVcmXFDp b6Bvb $*J![Fi(FI"(Fi#(?*{a7#mBؾ'F>7J7S7w77777”7-O!FFFQF0oI FO0!JU#B4+hI2F;F F(Fj #pFA\)#32*V6+)YI"# Fy#"S F###"#m((Fj] ԫ4+II2F;F F{4+DI"# FpBI2F;F FD#"S F##2F;F9(xs0s+ P [ /I2F;F FEр$* ,! FQ$I,0*+rO FOG(?Aha3` JY FFHFQF F0$>78$8|8B8U8r88-GFF OaFjF8yԉH1F$#Tet@E#!$4###F840FOcuF31FOb FqI FC&j FlI~ Fjda'0gIH4$$pCO(ВbI$B' 0^I$4#]I FHU2C=YIb'0VIU2C.TIdF4Os$4U2$tCc:F#@FIF BC EI:F F #`EFdU#$t@FIF:F &(Fq FFF F F4Ir4CBF0IKF F2F+F F0?_"# F#'0?Q"# FBF?Gȱ! Fбj#R вBs F0?0 F2e#޾8898d@89d@9/9E9t99F4BB* I',0 I Fz4 I"F F@'Sd@99!F1(I FG ! F$  I! F! F4I4j+:X:}:-AF jFjF&1YCh&ae FAF a(F0I(FO09F(F0I0F::$ʿ$ Ŀ9!+OտOs Fp!Ap!AOaOq!pGjXm j0pG$4jjPm0pG $4jjPm0pG-O FyF(C #MF $!IF0F $2FI&(H FFEF;h#h+FNEIO0 ZFW&06H#hSCFvW%02FAFPF5#hlME %::] :^a$$#Q l8a#*N FsF7hI;O08Fj(2h I(F,#*#s2hI t':;(;-OFF# h*Fs FOUڋj k#*s #@ BO0 0F(0FF (Fi+Wi/TУj BP(sBBD(sBB8?0F9F0F! XFH"QF@FG0F09F0F"QFG0F0ck0Fi I 80$!m#jFJiFXF (-i"AFXF(8;FFFFO0"1FG Fi0 4"1FjG Fd0 FzkIk H;-CF F uFCI5O0F$d#HFAF2F RCIJFCF F2F#8F)F BFFCFFI:F+F/upFaFR;f;;-OKF Fx 'Ih|F8FO O !F[ l`   I"F0FO7D#C C#I RFt';FN$O3i4V+)F8FN,;-O FF F"IFF!K    C!x*FH' & )FF F.*F F(KEWJ!vH x K*FI(F F*F F F $;-OF FF F)B G C -I FFHI:F FOi#"# F#RFCF@ F I:F0Fi =<'==F=-O!FHFF}XI FO6F0FAF ! FlF(#" F uPFFцI$3J7O#B3u 0E E sH[CsREz9B: F9i oIWEzMF9WFYhI=OOO FG770$HFiF]I#"# F# PFiTIr4SI O3 h Jh \"2$h F!RGs !h YJ2  8 0?D$4!  BAbEPP jO "T 1P ZE +#2FCF! F0? F4jW#SFhI F10?  4$$j j  $j$$a===== >J7)>+K0FhB)I !0@e%HU#)$#H$$U# hF FHH*! F0H"O0!0jHh #H #HJ8!hF;iFH!mH V V?a?r??????T?@ F$"8F-OP#lFC FMKF   BF9F0FfCF+4BJhB0AJ(FL*oТa+"+ hh h`hh4K{2IHF "렱1IHFFx/IJF(F-I iyO0)LO`ic`&I(FifTE F#F@2!N裉ZFIJF(FhTE Fx$ ! @H(p~(F0x(F%@V t'4\ <3@I@FF (!FFiX#vT3#3FHCjji F@i-ODFF.,#h  J Bq %  J  FABsD€@F.1SF^I$isiEBEEx(- @ F.QI@Fa%F#bcbั(-IKS -HI@FFKGKS%0{(CJ asF 0 QF(Y bCb#EB aiAYaea&`a`k#M pBB!iMa%a2a iQF2[BB k2ciaCahaeaCi,aa a(FI@F4[ I@F%(F@:AHVA@rA@-OF, u/"F+FYF C"F+FKF;hCD "F+FAFC "F+FHF8hC D t/Zлi+@:hzh*rzR LB{q[ k 2 ^ b S BzZۦBzV SO,u "F+F0FQFCECjQD O3OjC WF8F ,u"F+FrFC "FC 0F+FIFbi  i F F?irF-O iFFFFS sIO4&F!R_ oIi nIF2F[ 8+i;a+i_a(FFF F1FSFAFZF  hEEТExVI"F3FHF2hF22b63C+i;a+i_a(FTFXFQFC  ZFF SF F1Ff#Bv,F i8h!yhc F^ -IHFh8aW-ha2b22F2xBstIHFGi IfBq Ia# (hf hhAC+i;a_a(F%FAAAAArAA!BLBiBpGipG Fi(FpG-A|pEnEBEsځi! FiW ФEC Eu  c0n𵋰F$ !FF8(F IO0 J !v(  FrA< IF4K"F IH$ I H M NU40F, I簓C8C] rCl~CUC*"* IqO0**    C *8F FF +6&( *+!#% 8 : *"+J@!HK FI*F1      JR#0 O0C$"D-O2OCFF@JI0F%F(FhFJB BCI0F Fh j'FP#F!ECE4+8I*F#0F#(F$$Fذ O FF0KE Fh * BCB8%134+ݗ0"+7!J@!!H K IJF0F IF 0FGC 8H#)F0j$XC"jJ0B;B2 25  7[#0?DWEVSDsDC$"~D-O FFF#O BF9F0FBFqKhB(F !(F F2C&hI(F3 p, A,f,cI {F F s,# (F<0O #j'(Fg#a??4Fjz 0p4+ݚ0"EIQ2BBDK0BIJF(F *J=*?=I#@ BP8   (F0(F0!@"v0F #0FAF(F|0?(I(F~2*%J@!%Hz#K**(+ I(FhKc:F#(FrFK 8H#1F#sD?C3 s6  $AV DXlDX8DCd"D5D-AF)OHhFO NON F)FHI2F FO0 F0I2F FI;F2F0(F=<SS T-GF F07-4 d1HOF1j$$j d0j#h(F##&##.a#(a F0I:F FO03F FOhF FIKF:F0F<*T=GT)-OFjI OGFF F!o@cI FO0! Fa! F[!  FU! FO$" 4;QI4`OI4+@("#!j#BB EIF FCjBBѠ#!f F043 43"#! 4! FF(OO O "# FC )I*F3F! F0{O "# FFIkAFOr pJU#*F13F#" F#yF F0I FG I F C(ыgT~TTTV6k6}6UPKOF FF M    :F1F(F:CF KhB J#iF F iF F0I LUTUV (KSB@pG$#-O F FF   BF9F0FCFJwKhBX+s F+'`i+Ui+RaBBL # F# #??FF1 F I FiE 6i2EB [  лz  #C %-I Fh/hx :F1F F CFv??FF2BB2 A:B; F 0 F0?x F# I#JFV $4<<UUUU-OgFW#F FO#JF1F(FC ѡKhBРI q( s("F Fa0O0O# F#"#??FFEA6U#I FW#$$GaHEq s*F|I3F F! FF [ uI Fj! F oI! FkI4! Fjj Sj !  F 4(_I F4hh BBѸUI F Zj2QI B fEzKI*F3FtF" EI8 Ez FF3 aEz;I} B A0-vCڸ;=F*F3F! FL0?! F jOf)(@#I F,-v BA ڸI F1I F, )II F-vګV PbVyVV+:VVW$(WYWWW^V+F> I"\>HJ!>m>Hm#8$!HH #RH |]XXX\?”TtvXXXZX Kn:f*oB (КmQeppGI$\ 0] 𵽰 FFBg( :,468jKH=@$L>CHHz1kF  !AJ@Hd=>H`:H=HZ8:H:H:H2C3HH6HF#jT!p RD EB10),H+J,I( F)H=@$'Hh $!8m#jFAiF!HJ!#FJH1+є1+HoFH=@$XR6TXXXYY$Y2YIRF@F(Q# F*I # F(I許 # F%Ipm#8$!e0K!FPF*`@FPF$I F(  5L!F(FKB F(Fff#?,`6``m[T_X` `0] -OF-FMF'JFAF0FF3 ѤKhBУI =OF+i+ѝKh'c! F$dSPI F=! F(! F8I! FpI(FK((FFZF I#aIHI$$#8~I F8F{I8F4F(xI.(O2#B8 FsIPFqI PF($ YFYFF@5gI PF( #FP FaIO@Ff2F@FIF;8FaUIc;C3 (NI (СF(?}@@@FFx@F$hfF(HFI6rBD(IBDHF(rIBDHFz(IBDHFp(rIBDHFh(|IBDHF^(rxIBDHFV(uIBDHFL(rqIBDHFP(rnIBDHFF(1++ٿʱ O31ȿOs1Ur_IBDHF((?r[IBDHF(Bs$$AF"2$4BP F(?HFFHF$$3FUCR??@BI"!0n5I0F(?7( F7Io6I0F(?$ (0I$0F(?-I&0F(?*I(0F(?'I0F *$"n I0F`(?E<ISF F-eaR65_wa[_`4_@_N_^_g_r_____a`_X` `a$:"@DnF$*FAD"fBFT$4!??PI$JFAD"DE$1F@F\%FRFFJCF8 hQhO35 $0 600 40ˌ"## IF P0#T0B)FX@F<3F$$z??%In$$AF"$4B)F@F0`H0L0 $4 !F?? I:$$AF"$4BaJ7abpF" FhF!ah"hFphh3SB"FF B J I IjF"CI B $p@b'iLb!!pF-PF!Ұ#.2### C## #@# 0"K,"'K(K)K*K+K,1F(F Rpi@\bihb!itbPFxhFM ]KKpFx +cHJhx Bxm5@C~0@I @@Bd>H A i(DА *=#@;@B7УhW iF/Hh`i# Bx3@CD0$I @@B*#H AiOa J#qH  pFH1Fh`i# Bx3@C0 I @@BH A6ѧO67"x"bbbbbbsF J I\I "(FF$*pah(F6ph[x+ F*h`h $hbRrCh/hB(F"]-OFFC BFxJxI z(F9FsJtIFbh hrQFhhloI(F(9П lI(FF(HiI(FFFfI(FFFbI (FF(1Ѣn# (F0%NJUISI (Fl(0+ѡn)|"l0F"0onJIF#  ***ѻ YF[ kױ:I9IRF (AF4I 09F=C"l0Fn"~혹"l0F!n"x0bnl)lckB(F4*h1+#o˱!F(FG0mI, "l0F!n"N0k0Fm"D0m}@bbFbbbc”Scc7cic-AFF$ F8FXFȹ F1FF8FF0 FP(FAF Fd((FF((FI]-AFFIjFFF+ CFO0&8FF(А"!F"9FpxI0F"0н #FI@F*0pciF0 F@ FF>F0P#`O0BFD?#8F"FF(FB2(! FFFF0*#`O0\BF?#8Fh"FF(F2(! FjFI@#`O0]pF.IjFFz(,K!,J,H<,I F82FŔ1)9XBaA;@!XF8FI0FlF(FL`I Fĕ!: IFF0FPF F0-O0pCxcccci0,MP IFC  0 7" Oa2J p.M#x7# OaM 2Jp#xc ,M0!F(F| Fb0D!F(Fr FX0DicddpIF"F l(KV!JH| FlFvFh3SB"FF IjF(Fx0I pc,dciNdF"!hFlIjF FVC&iIFjFp0KOaJH0I F;C!0)PBaA:@ I F0$0O0 &C}dcdiisF FIjFCF0F$(0K@QJH FFI x1F JI  I(F(J I Fe pdcdddbd7 F F0J II(F<F0 K@A J H0 F I KF80ce edbb7 F F0J I0 I I(FF0 K@1J HZI F80c*eb edpIF@O5#`(F$pE@-I l(FeJFIF I+F0F0 I J IjF0FT$FI Fe8DeJe_exeie𵉰IF8#`O0 F0Fe FI "FI3F8FZ0 I  I8F%V0I Fe(FjeeieFPCHHH]2e 𵅰  mIF"0I 0eFI`I(F"n0I2%OBȿB Fe  1F8F45xi ee#f”sFFMF` 1F FQ0I*F | FC( p `jvi p FIjFF*0K@fAJH!F(F0O0 p2*^BbB;B2@ @e !F(F I FF(F`C CLfcdj8FMICF(F$<0 K@1 J H) FWI e 8F eddjF IF8&#`O0" F0IH Rf”H [f IFjF0 K@A J HD I FM0H &fcdif IFjFZ0 K@A J H I F#0H &fcdifI#jF3I .%]ie FI~F0K@1JHI F.8e edbF08 (٣a*أWA*أ=f#`O0P IC C #0I ]ieرL ! !V> J H` "FLIH2ff$FF J Im!HONL!(>FHxKI"F(;FH3F|Klƹm!HfJKIDD(F"F Hf(F` ^sh(FG6hffff] gA`pGA`pGA`pGA`pGJF `l `dpGJF `Qm `SepGJF `m `epGJF `Ql `SdpGJF aQn `3SfpG8FFH0v#`O080 +$ A;+f#M(Fn>(\ #,T CK \"JFnpG BЀi-OTOK @@ DP!Ox0GI 2(DIHD@E FTF,0gYI l:!#pUJOaoxp#x۹:##pOadp#JJo~#x+!FPF F0D!FPF F0DchAF(FG$h7I0F !06I 6He 4LH0s(F(0K1I0HAF(FH0I0{@ƀ`@,ǀh"AF(FGi"9FJo\I0IJ0FD!0@єIJK) FFi@bBiPiiii~iijiijijjjj"zki6i*ijj9NV#9H`#Jd#R2I3HX#R/I.Hh#R+I)H}j#R'HZ#&Hob#Jf#RIH_\#RIHU^#RIHK TP@,?;ch(FG$h0"AF(FG ]!kk(k$z2k=kUk`k-OF FF` )F F0?I:F dFF@9J 9I FJF4I FȐ1KO0 F@FH 'YF8FP퐻YFPFHP IZF F@ K0hՙL0hԙM0hՙN0CO06[AF F F (-h. IhhFOHrOIKB LHfII@) DM:HR )h)0?HJ m (K F0GdhBьE3h1IB""h.K(F-H @F5+KW/B3(FmFPF @F 8hIF ~#6B 5#'Fd %``b@b8i(i pp#p*p>pnEpRpt$lpvpVpp FFF(`P1F"F0F(h.` F ~ #`O0h p F-AFFFF<d#`O0 Rri)FF@F0 Fgl`𵥰FF*FF8D#`O0%#+~!z(F* #ji!F8F0h Vc`-GF FFF #`&jfBFaC2s3F#Bw#BA "#h"+O0(F9FF #j1FPF=0h@FIs`FhRPD 4D-MOFFFFFE h8 cF0$hj`O0FFļļĜ40 40 0 0 pj(86hkbbd-OFF# `#`O07ih)@9jh)@ IhF(@F"@FF( I^i,KFD/!0FF#;P% C #5#  YF0FF(@ i*p,@O;0FdvmК`@Fc`F(2FQF  ``AF(FjF(FdU?xziCFIF90?oi+/,,YF0FF(@oJ3FoI D(^Q(?^K "!-5>\--7U#`0FO;d-)UI@F(OrYB?Q)?) A^ [X\0 X eO " F Fxr(00FdXպ0F(OsX0| X Y*.##0FdO;!"#`O;$ 8FF !YPO;+?2kDҲ^ x X0:,;+?w*lDx ?FF#Lppa- W<+۲C# FA-7<0< ,`!?[x1@F(Fd+$JI 8i"FL( F,JI F& sh05dd-AFFFF@F(x#`O0@F(Fl #ji!F8F0h Vc`-OPF%FFFC  GpW;F:F!FXF5g`9hYFhFKFG F5\ F00K+- FB #`O0(  +-#` -GF FFF#`O0:Dj#!ia00sIFPF8 0h($h0-+ PF(( iIaiybh*=C$70h( 0h(H #ZFF)F0F0ck xk`i+a2I Fh#F qFF$ !FFcE8K`T7`FF !FFc/(KeDa7$-AFFF`i0FFB hcaac cF0`ixO05i`ahcaac~-AFF (!FFcF K"1F`FC/:Fa0 Fc_$ F%w,-CF F ,!FFcFFK")F5FC$/2Fb  ;F0 Fc1O HF4-OF!FFFFFE8hO  B "`O0tO  :hO  EJTC<`(hY+ "Fh(FF[FeFG(eh!F  4*h[F(F"FG(eh!F4-G%FFFFE(Fh_h'ig1F hS1FFGFPFk  4|*h"t[hG pGh00O0 BjF*#cbdiL Fj0O0`h$h0jF+##bdj| F h2#Ah+0O0`k$h08F FcC`ciE``a#`a#t F8@O08pư&IF%IF0FF`"I`""H#`O0Fp(FF FxxFBI Or!hF)F/*("!F/&*(" IjF0F0 HF&q-qX4q:qJioqIH 躈] q1K!-AmxFOrB8< h1`W>v4CK5Td Xd q'r r)F Fx0+Kh#FB"FH)F@ JCxh320x+H&6OBb\20 V@# H]8F 6Xd 8rTd @rpP( FC C (7#`%(Fp"#, ۴O,F!(F.!A\"T`cF(2F K"#F FFCF I 8FFI"(Fm*F1F F@ oDbbpF FF!"hFjF)F F$p-O<]FF ?J?I  {CF9J;Ip05J8IOr!")Fؠ46 <]ah(F@F 0+ћ0YF +""OC 0IF8F L0IH$h 3CEњ0Mhx[c@C(ѝ41+ KM I HFb@bNr]rDr8trix"pFHx FCF h++ &pI D"!hF$"1FhFm"x!F*(" IjF(F0 h1+h/+Hb|r irKx;@FHn7"rF FF Fgh(F9Fz$hhKxB8F( IH޿] rP A F FFCF I I"4( J+yh320[ I"F0F0O0 O0rrXd :i"F0J IIjF F8#`O0 I F0z0I | rr9is"F0J IbI F8#`O0 "TxKI FB($0 I F50I 8 @bsr9is"C0н0]#HJsspGh JB ~BB I H JBFpG JB I H HpG HpG HpGPPIsnPPOsVsDs[shJB~BBrB I H JBFpG JB I H HpG HpG HpG HpGDsnOsdsIsVs[s-O EDFFFF(FBBF)F8FDF' 9^). I2F8F.#P=$/DYFOD nE  c  ءEK<h;Q8FOؽF$@rIF0I DI  F0KOqJH0 F ICF Hl F$ils|scsisPI FC   C #C J I I F0I .ysisIFjF0KOqJHI F0 I  I F0 I scsilsis-ACI OsF0?J ?I?H # #$C c #c>@0O3 1I(FA0Q.I h-H "P8"@*JxhY2 R'Bx:*$0$'0;D#DAFP#`O0` 4 ,x+I $2F!(#F"3a+Ѧ @y t ti8Qt(tXd 1t#I F:0JI FIhjF I F00I -yatttitIH¼] t-AF-PI°2"F0:69Ԛ9o &&PI .(F$ !( * , . 0 u0𦀝l * pI d&&&lHl m."hI(F#`0,0нb0+aH_I(F#`00нb0+xZHVI(F #`0 0нb@)BkQHMI(FI#`00нb@)B`IHP$GI(FF( * , . 0 0(+L ;I(F0@ƀ8I(F06I(F0 3I" F(@OsB-HlB*Kx+?{(Hv&Kx+&H#Kx+$HTKx+!HL HH#6I,2(F:.2>02$+*q0/H28i(iGuquixuuuui8iiiu0"uuuuuu),.,C0C**+-H xh300[Kx:+* 'H": &H!F&$'i)@F.?<74/?7, HimH;H 6,HF HOsB H /Xd tuuu(uv0 I$jF%DED D D0I(F F0i8QtP  IjFM C0I ]it IF 0 KOq J Hl I Fw0I 4ycsi v-AFFFHF FFEO< V”-O=P I C # D0.OsH0(ڍI (H0'+ @.F##"F(2D !<~(BF'-|K.|H|KFzKzKzKzKzK(!0!!"FV ꩈkԣ2*O |3 SjJ$;2+Fo  O1 BnzqyOa F]IE#\KD pKDOIqDOc1DOCDOPDOSqDOB1DA&k&pCK)F@H|!0D"0 +v + D '+?o =/ #QJL 33~@B4@B'JأgvA6B$رO &f13?,!!@C;2%2^A$1B٣zcTc2 2PS;I"JoB1FKiv,ww1w5w9w>wtvIJ"Cw0"#x*+؀H+1ٛ *f;'+mLkmQSkkkkkkkkkUkkkkkkkkkkkkkkkWY[]_acegi+R# G   Y2+(+fx0+𣁛 +#HJ+F cxR!IFH*cx 3D 0+ЙI0+ЗIgx&HĂI7B> ]PFW6"8JFI0+СxH0+#y'FIOHxxcxN;``6vFEݸyyy(yDBPF7FHF0+СxpH.0nJB .r؛0+jH!F{hI^H0+?scHFF`H_IF8'>ZI_F>F  CD ۲+e7(PHj^PF  9FJH\JKF0h?KBsBPDJEK`EF@H6F 9>I@J@J@JBѣys>I'H40+?"zy:H*+v5IH"0+?!z 1H0OܐĠ<,6*HOJFRFWFEv\vnwtw$vv”wwwwP4xwww,vIvwDsn2v?vPwww xjs}wwwPNvCIDH0+?oa ?H FFx  IFf(K!JH ! FIxcs  IFH(K!JH ! FRxc s0" F!" 2H  0@ƽ"!(F( ObiF F~( H F  0@񩽝0+ѝ0+ѽ0i+[xux0IFjFvBF H F%00I (F$(F7ixx  IF`0 K@A J H8 I! F+0I j xc,sx  IF80 KOq J H ! F0I B Gyc6sxK"`pGdpG O4S+2h @pGSBDSA"DJ Rbb]pGFbFH FJh+` " Rbb ]pG Rbb]pGK[h" ##!##3b0HO0] "F! HV! FLC H!F Lj0H!F 0p(eK%[hӱBF! #*F#!+Fb50!FXH@$  % U U| FvFHFLH~JH$"F DDDK"DIEH4CHAIBH  >HB=H"!O0(" 6" 24Hp3N5`"O0CVh+!3h+" " 0hB+OsB H! FH4h,+OrB+ + O333*H ".d~Hl q%d_-y7%SKh#0@pG;>+#`Y T! "D! 0"H!"a4FI Ja) MF(` IH!Da([ k`0h`y">pV M IFF(F )FHHI"F(F ] nyy`z h7(0TK ! CC !B K`!03 CBKK `@Uj(0TKH!0CC !B K`!03 CBKK `@Uj(0A#!@C%BF#CL`BK`!0K `@Uj(A#ȲC/F۲L`BK`!K `@Uj(ACS_FL`BK`!K `@Uj(ACCOFL`BK`!K `@Uj(A!CCcoF#CL`BK`!K `@Uj(pACS_FL`BK`!p(ьheI!CS C_FI` !B۲I`BKK `@Um{{jK"#IR@h]p-AF!'FBO@F`)FF()FD(77 FhF]I*Fkv(Fan `0FkJ-A F xn+Kxo+4'k:L%FAF80FaL(F'x!Fn+ Cxo+0a(=F a(чn`lIFFH6 2$] -O]F S 4E3Fh S 3 S)FF3Fn HQFP#@.1FqI0F 8 ` h+@𩀟I(Fp(@𢀝Io(@G>՘IMՖIGyՔIAՒI;KB 8A(F0 Nd!@ k` h+𽀇I" F(@𵀄I T `hO@ $4{I 4.F(@`uNB$hhU`"`sh+@lH4ȑ  '0HFS'7B rh+FWI `[IF.H `Q S3h+?`!vpOER FI"HF #Z"(FFQF FFFOR@##" #>#? F!(h_ IF HH#`O0B B@}o 砆*"-GF FFFEIP#m`D3OqB BORD %J%Ih0`J<DOsPFD4.{<#`O0 G K yO O AF!L @aPEq $'FVFF FB&4F_FVFFXGGCh(FFFFagXFFIH砆?8pG-AN} x FF!F@FOr(Fv)F(OpF"F4$4MN^D#I:F0F #CFh N}( .0F N}A L!D ĕ0FH "-G["F FFGH@!0FEP#pAIC (Fh kF ꠱`)FF8H :!0FJ5FF3H RiĐĠO3GOGFO'k/0+i+O':FQFCFBF1F?iN0+FimDDcd/iib``ca ph6faa #ai#saд"ȀU"#-H@# I  gz ]IFH ̂] -OPF$NC FFC  'FFC#`D`yJ`yJ`yJIFBC tKh[ +g8(S CBBBBB#C1CQCBBBmCB%D0hO#F0hh#F0h02hTI `###OI0hhNI Ph"JIPF(  PF3x!CIRF ( ?IRF z ##n7I"PF  PF#x0IRF -IRF-z ڀ' PF202h%I0hO F9ObY!67ph7D07Ir4a,b-t' t'V 05H:|PVB=8 d(#!FH0I"F [#H#H#H ]F H ]F H H 8 h Hh HNT`m}ʄ7" FF<xB(I#F*F 0|F]&( FI@ݿhF]( FI@Ϳhj"FBx (I"F  }8F FH I"F #x/+ !FH:)FH8@8"}8}R}pG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h`~`lwhd t  lm(d j lcd``p`lSd mO(e`mKhemGemCeQ BC p`"54S+BE+8#FBT#!A#38 FF 8F F#T#E#34+gfXX\\|q|pccWFgfWFcbaXXSBBczgfp j $d$(^(,X,TcWLFFH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"v!KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3y)^#JJp>s!tYh_I F>v1hXk2b&0F =GD0ZpLJFNI 2@UD[BL @r[ CSfd04 @#F#"_h # +u#}+ZJJOzr>vhSC   F*Isd3ddd#s11hXkPFh2@UL[DUBr[ CSR 2Nn   L Jk@L#FD0FPD""kp2_B@Ѐ;۲#O &@;FKh3A@񳀎O"F;F !xOzr OAh SCD0@0H0L0O30{C?Fh2@UDl[B @r[ CSR 2h Xn  @C. A #F焹""TL"-OF-!FND- Gc #s#Kh+PЬKh/LѫK4hh\C#0 O;A"E@B%D@8F)FXEFA"O18F?F@)F F1A"8FnAF@,OQOp]MF`(OR!O1Op]a(zLO2! #h+@O3,5sKhsKh4)qH h)mH kOkJh9hhcZcK BhH hYkK BcH h2hYkB_Hz hk_ZHORn hk?UHO2` h BOHV MK h;h0BSB@\3ؿFDK8F\sEXhm++#$5kAkW8uSBdO|OKB!(Fs#1 )kI :O1X"D"P"""PTX"Jd"p"}ґ+Vh"`""+O,%x#<#(5#0Kh+?#0FV KXh+]9FHW3s3v7Ol {甹"H"BK yf#"XC C!hB <4XC)8$󖂲OsӽHP hORK'1h`k\5###k'd gO3s84bgcb<#cd#Xs0"7L5P5gh 7OsPBFAAqn*FAqAFP0`Q)FD0FncoO|p&k8D`(D a.x ADO >NvAYC 79DA4E0%D8$<4BsxH vKhvK 08$<Fx 8Pkw(@DAF8&MFT*FOsPF9F$&8aBA*FPF9Fa#O3sUHAF#&F0$-BOCȿOؿ#1L 3KALq*O 3BCBsBL @`p  XK#KCXC3G/3GOCGsG0 PlAG#x(F1OpK3@,@pIDLs\B8F/('Bv8'F "T<x""x:FOKJ<*F Aq@EC5jBXSBOg"PTt"h!%ZkRhaH4PkR3bisb@bb@5lc@_OSfKhcKheKheKh0cXTcOs0HUP0h40PYF @ 0Dpbij8d\`"l""P"^F"D"T"X"H"P"O`v_Kh+]I# hX)hOPObhObxibQKhyihh0+xiOr!Wp0+FH0+yhCMj0:4D\Bi"iBCDFhInDr  @#"C@!CF2.Jl -K-IfC>(?ѽJ0+P# 0*F+D;#G.hO`1F~ F)1FOPSOb= "FvF(mOb:)hOP:[# P#""L"-TN\ ht@+hjxL#FhjB@MH 8<O{0GF  "KQEA\%FI +B%a`D%4<`DK B D p0C_CKBuۑH( h!i iK$I{`ȿ`  h{a`Ŀ@;g)2@Ӏ"2x0t[SEgx#  eH;fpI h;3  #f`0fAH {fBdHR% 1ihj Db-O FXDh[Ei@ʀJhnREvq nJFh$%* ݠi "@nG\:CBTi i2aAJh*Md czhRETzmR 1B zhREP%PCm@P%* @=0d F~00r FPC!@:Z2:R8  D * , :BYF 9`#{eO3eK礹"0] TZU P"YhJB5smxBpijYh:bJB5smxBpij;bhkX0@i3DOO Qk1Qc1FBi򭀚B"Dhdn&hikQi3DB@򳀎B2hi$5+O2fj $jNE3h#jzkF=h!jjPn1Rk!b!Whj!Zk`bh`iik _OW8D3h+aihi9D#hqNkDci 0o+F(#h\%@7cNBii%rCAFhdAq   C #1C OK\%BNN3h+5 PhOBvrn 1@iBj2Bb5ShnKEvqnZFh$5+ ݡi #@n\CTi i3a.Kh+Gd{hKET{mS 2C {hKEP5mXC@+4dFQF"2QFFXC@;Z3;R80  DU L"TTH"P I Sk3SciZiBZhBvsn6B UiSj3SbnO nD#1FoE +?$B FP#1@#  +KFOL O +$eB3FP#`6@#`B @I 8 z @J k08`x`0@OFFEͮfiE>D(Fp6 @F `i#kDBhgK`f\B ii%YC FFkk id Fv F   ,C1CDF k+GKh+@82D?n. >3h=I=K*FF 6I2"\Bii%HCBFhqFBrxn  @B #:C@'H2 DDB?)3h+hj;[KhsHr+ Khs D #|:x* ȹ Kh I U TP"ȔҔD"הRLghcgOKh+30304040JkhSC#oBIOb`i?Mfib!`N+hh1F9Kh7K\5h0+WpOr!41KhjCF:Fp+h+hiZkFBhPnHtL  Rk'@Ci1CQjcjB+h#hFZk h!jj1Pn!bRk!:!k`izhiYkIt D-+*""PL"T"8 X"-G}FFFFJFbF(dI2F (bI@F&(F(D]I*F@Ft02h+XHIFO0 }kk6j`j`+k#akkca#@0#bB0cbklb/{FI:F@FB0t@I*F@F<0:@IJF >IQF8"F F^"F:I0Fp8I0F 6I0F4I0F2I0Fh"F0I0FB,?.I00F"!8F.HF0' 0BgrBOЪ# (5D*#*#0f "F a#( x,d@edA,zd@-,,-,,,,--Am%OcFF)FFgCF*FF@FF FM0:`12(F mF8F F I"F #x/+ !FH)FH8@м8"}8}R} pG-GFvFFFIF(F:F3FF8FO`f#TD&O` FB`۽#D# 6P I-G%@F4FFFF F!B0_ H#J ## `:F!q F !F  @mH# :^F: F^p FFFr2Fk2Fd2F]2FVppFF F((*Fmep-AATB A ҅BAӃ Bt ҅BA E|   -OFFFXF"# " `0F xFPx(PI3F*F m,3a,M,%A,!JI+Fb< ,P$}||||=}|||}|}BBJ IEܽ"""ٕ5K-CFhM+^Ѱo[0M@@ini6D^C@f+N FOIF'K#BFx=$JkihSCB@6B3 4IF FBD68FbAF MCObkFAFfJhѱhUh] 0B@B 21h%M P FkFOb)Fn Mܽ"""""-GFpLFFPF[IF lJ lIR j;CE# !f06O҉J "# #_I]J6XhRF+F@!kxZ  "#VI#RJ Ckp06&Xh+F@aF 06KDډ:ځ#i;#ajO 6SCBw?JBIg>SFG700F9F FF$&F 0(0A  6    J J &+FHFQF$&0F9F"KlV㱴X AF0F60pC O&+FQFpfHF(FG[𒺀"((`:F3BEC FCh`"8Fd-AF7N0 0FB FZRF"F+F@!*3j*FBF[ (F[E x2(*] #!3+BD +\C J I$" C+T06&h+F@qF (F[ 06pi D:zB2h;`"=-Oǰ F!FOFKKh(@SC;J1#,0I (%"# #O0H0Nd00 @$LPA!aP #T0KX0R3I *F+FHKh-=(F(3I"""Ȗ"!Ku"""QSNp""2H")FdL # V0423*<\`8O7 @F Bs 8F388FA#Bc!FrBXB(8F&\`Kh8FZF0I[:F! 0OFGF1d0 FF \0 0 0(0 ;; CEFyMvyN3h+#1 B2SrI h AqIoHRgJ+jjhlHZC H 6" O3HA FD(B]I+6 s@FP8C0 0CE$F  @ )4 DFO)0<D)2 D   PF@F(6E؀ԑ0+ݬl3kn F`.@ۀhKh+@>7D?4BaH]Kl2[n Fг 0ObPDTIUZ@m O* %(F&0HD~H6 PF 03CKh8+F!HD!:H9MRF6;B0O [3 , cEO(DO1'KO O !  \ CT"F 2 *C  0.J#3Pf$&B06D&hSFID  !i"#. 78"T"ܽ"0] "ؽ"*jkiIH3#K/FD8DE?0+f>6𺀳Kh+𯀲H/ NKh.@3Ll;m#n!H\O@ "! (( F zDx06kC 3"z#06x%s(( &GFB&~('KN@! 6{2Bu# "Z"!lK#nA#3'4/5Dx0v!znH 3"&#x0#@%((@PaIaH$1FO@wF 'O1F" z%dHx0: 3"zt1FP 1ZC"1 DO1BAanDJDIcP(9%C x, 4. 60 2 56J7IGO v@F ZF-J0I6@FZFh 6*FB,Ӵ0 &DBO%#B@FZ53FRF@!0FZ#"%l+ǮJIF% 5B& JI Ȕܽ"Ҕ"T"cΚT(֙ ci"3 #F%BB"!CFRF !6"DD~`n F1#BHJII jO H#cD D2F%05d?K"q!E=I=H=I!F7I9H6Gp!HF7RF8IFXFvXKFRF@!2p'*K@&9F'"#ciDfOb"IZp[ %O)(F&00DH6fiHF 6@KhU9F+FBF0DHDrG/ݾTJc{הT"""-G}FFFFJF^F(dI2F (bI@F&(F(D]I*F@Fp0.h+XHIFO0 }kk6j`j`+k#akkca#@0#bB0cbklb/{FI:F@F>0t@I*F@F80:@IJF >IQF8"F FZ"F:I0Fl8I0F 6I0F4I0F2I0Fh"F0I0FB,?.I00F"!8F*HF0' 0BenBOЪ# (5D*#*#0d "F a#( x,d@edA,zd@-,,-,,,,--Am%OcFF)FFeCF*FF@FF FM0:`12(F mF-AFF."`8FF F$h3,x[x+&ICF:F S-"F-G= -S%9%C/Cg= +dDTv0F!FDT$D46DICF:F% I L ONF HL I Htch5"x9F0F4@- :l]] E-AFFFFO)F F^BqۆBxI+F"F -G}FFFFJFF(dI2F (bI@F&(F(D]I*F@F0Vh+XHIF"O0 }kk6j`j`+k#akkca#@0#bB0cbklb/{FI:F@Ff0t@I*F@F`0:@IJF >IQF8"F F"F:I0F8I0F 6I0F4I0F2I0Fh"F0I0FB,?.I00F"!8FRHF0' 0BeBOЪ# (5D*#*#0d4 "FD a#( x,d@edA,zd@-,,-,,,,--Am%OcFF)FFeCF*FF@FF FM0:`12(F mF0# M xj,h214 F;*O"p $T3 +0Pd K"`pGT#1FHO0?FH ĝ֝-OF-h"!F}L `0$#hchh #icii-#j$0j#k'ck80 ck@0B0D0F0G0l,L0)#m T0!+ iH@#*KF(bHC9 ^H2COr@c**F3 UH$Zc"QI "(NHb "#h!LF(GHIF3 f ?H@hh+hpC_HCD7H7I"PFXpF_]yrUBUA "AFjPF6AEHFDP H$%QF8F4(<FѰ2C.# #2BB!FHO00TTh?”$JPJ)F0?EG+bG_G+R 02HC+F@Cd DT%?&Ow+F@Bd DT#!GRI*OF=x$!#B H&@4 ,] #H<ػ#л 5HYF # HXd T|՞g;;#OC;+yH"F?@%^+sHF6B'HJK +F/!f hJOa@>(?E!"F3[fF(hpCOvF"F8F1FfC ѧBvCBuLH? #?@Ga>Cp=g .FBs-FKD]9F[FOs jxDND-:@phC DSE𜀻@0!F89F 1DND5Os]C .DBJOq*WBKBBHq O3#p!F @sXCP!F0Os礟?ʟHt͠ >*9КB8 JBU۹OsB ѰH"BK KKOq>B*bЕBl٦H)FOqBКBѣHB(]O O >@Os@@a XT= "s !FOD O`OPD~F>:"O GI c@q#Oscf&F=- =  Dй?AzH!FO@P(8 B,>>O 9F0F?@r O @ "BB s#m &"Or #\J 0"G+>JF*?0F8" # FBsOHU O f= bC& IA& E OD5AKOuFB3((F0 0## CHf# RF(# IA  #QFE(FE)H@u# @sOrFB#(s c + # +#  @sOrFHZF#B 1 H91DӺ3wMġN&hHhK) FF*FdHVFB++##B ;Dvѳ?O OB :FnHڹGF"F!(Fp л @߀KOqBӀCEJBӀE@_K+`SS 31O3z3 r+s ks+ +tktt t+uku#!+ka+b Hkb#bIb(1+,1k$)#01b1d3ih3/0'78F# xMKF*FzBF  OEcrH qH8qK" pOaX`2+F@"D3`2 ! ;jhCWI`S .ձ@ +ih{:+Aqi`h hZBFOrEHq;F*F2 @>N {2W (#谦f2ADIQE23YDB2*H1F ԣ@ &! { F BPEV ;j`pDcF:F&|X#<#"""(##Mb#] ###x#h#ɚ;T#6eH H; jhP [B( ;D Hj`B03;KBj` D;$#ɚ;6e-GFFFF ` q jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B  0  /9FFH&0F 8#X#-CF#M -FF(F@ h+HCF:F1FHHIFh?  ?H !!h S0+h< IC+@@X#K#i#o#w#]  K Lh K*FI#FFH <$0֣] MIFF(F I"F(F I"F(F I"F(F I"F(F ] ڤ2ޥ;pF FF+ * *x *##pp\* Cx+IH(F;'*"*+;.F;B+I5FHr] r FKhhSIC h\B Kh ( !h(OOCOC`O0\$$p$FFFP;F0O`#S`O? F`,HF+Jh`)Kh[#h(I; h\B#(FÈ #*##ty*%!%!-#h)9h21 RX^# #=#ctIH ###%#0h!(/#@#Xd p$\$$] hhнFMNO FT+hh *3h[S9hO  A L#"`c`y b2 Fp$\$$$ K : *B ( QppGI\ ] F:IFF(8I" F6I(F(FF FDB 0I1H~ N#x/+ (I)I!F(F+F)F xZ'O/)p,+Fxr1/*+FK/,FK\"FF/))2*Zx.*1FFFF2*9F Fx`\ j4$$ IF (? @P?}g(єI BHFq A/k IF ( @-ÈԆI BK# IF F( F#zKhyK"`1, ~uIF d(ܮqKrJrIrKgHrK rK rK rK rK rKrKrKrKrKrKrKrKrKrK JoIF 0F( @kF(?PKhcheI; h\Bխ`Kh+h+?έ @F(r)F @Y/E @ @B  CX&#)FS"#FB 33>Ih7>I_F*3;D3Q+FQ FAF8^F3#CCBQ#TY 5 F( F@ hCWF(JI#HTS]F.] mCe\$$|Ω/Fe(Jl`L$p$gfff @(I BH^FJ C @@A,FF]F.SѦI F(FWHy0[;hI; h\B՝Kh;h+ IHF(ИIHF( I# 0yBDoObJFIHzFHF"F9FHF26FK"1F(F1bEw8FQ 8bFB8F (  ( 7O  SE=3E6cKhr:FdI[H" y D C 2 QIF8Cw 2 DKEFI 6e  +?Fr*Q"MՋHF۱hHFRF[F(FLFCJKh+0FjѴ0XCY F)F)F F&C&cy+ F8I*FF8H\ HRF(F[FÈFCÀ*Kh+0FHF F_*I+F2Fr!NHFHFHRF(F[FF8C3h+?W  B  B 2h*?B FHF+F"F2$-G\$E0] iv] 0Z+I F.by*(Ocy+9F F" F F.i,RF[F(FzF/ F{K(Fjb[FbbRFdFKh+?M I+FFHBI*FH0F I+FF H˭ $\$0] ] *7K-Gh6I6H6O$܀&#Bv1K2N2Oj F1F4FCy++Ic h\Bjx-е00;(FIFFPF6(F(Fi,j mjcy+Ѵ0I Fk3h; Ff9FFH F Fmip$0] b$ $\$|$K-AhIHM ,j&GF4.,jM#j$M8FV FFcF5I0HXF$0I2F0H/I2F-H,I2F*H*I*(9FO F M yJDoObI:FHFFF@B8F"h8F#e 1Fr<$] ,-AmFx/*p$O&AFF8x+0F!8$ F m3iFH(FFF(yB02F)F|(&h<$̧8iP F8`"iFF,F F8$Fh F@U־K-OhIH 0R+ ьKOaH##KJhL4#+ шHIHO񳼆I`H hVzIF{H~IbxH烉'J3FI H0F^p$0] -$.H$ͱ.T] jӳ4$Gh`$<$d$h$-AFmFFFFF(@H:F#F=Or@a0F09I2F9Hh8HhV/5IF3HZ m*i0NԀFq2hmiF-0F, F* o/F0FOg:F0KIHm#&hUIFH 0:F F0KI Hm#vhU IFe皴] <$$Ĵd$(   ;L4#+ `"# `0#x#+ H"#@H.PF FFK#BqH"F+FqO F)Fzh;hES"qbC"` Khvj O#BB9F0Fvj$$\$ BijB ћibpGiBтiapGF+I/PpF F K#Bq Nrhd3hS"p#BB@j $$PpF FK#BqH*F#FN(F!Frh83hS"03*F#FHp@`ZjBB `p$F$P$m-A!mF 'FkF@FFkFk/..p h)Ff@i,$ F m.$j8/!FF$ F8#p(F/##pF(Cy+H)F燵FL/'6*yB H!Fn F)h F !5B|.h.A## (IF0F.2.h2C,F!I0F N8#KI*3F7"(hI(h)hH0+h[I JJ$0] $] h$XϺۺx-OF\ŰF FNF0# F~HIDLF\E#hEӫzKhCyJzKzIuHLEF0pI 4E#y+:pJOq8Fyj0S#ykJjI#hhaH.#..2by"h`y1A:KR#D@F:F!y\J0/SKhZIOHf#hDy"h`y1A:KR#D(F:F!yOJy"h`y1A:KR#D(F:F!yFJ#y+ EI8FpBI8F(60+/I>HP.. .ѢyF(F2B2"D5J y@F1A1!Db0J0#y+yF(F2B2"D)J...ly!(F2B2"DvJ y@F1A1!D4J0hy!(F2B2"DJ0] y\$0 /@Ļ׻lQ\p$Kh(K[h pG0$-O(L F#h +9M'h/7 z")$+РKh+'F>Fp`Kh35K(@Kh+)IHTIH|#0HKxR+jЎK0+e9+7щK(FIJKKK*H)FRNh)F0FL(Fz `Oa0ԝ4 + `B3)FxH.')FvH& `YFtNO )B  1F bKF(FlI `  )F fFF'80B )#@C9  2FYI(F)FVHVJVI(F(F `Oa0  LI `4 + aBH8AH Dbh"I?H>K ***8I:H:Kh9H 1I6Hm6I.H#3I+H !O*RF\ch!PF#(hT:&IFHfI#RFOshV?? 3 9FHIOb8Df$0] 0p$s$ƾ] $t$r2@Z$P$\$qKFhM+@iNl"BjKBBИB MeMhCdKhdIdH#` Fs(\Kh+ hg ``hc``h_`h[` iW a`iS`aiOaiKa D nf   k8 c`k4`ck0ck,cl(dl$d xx|||!hMK+T$T$p$0] hFhF(? Nk#BaBMhCKhIH4#`Nk#}yqn f "`"$Z$&T& R N JFB>Ob! F#`22`20caa 0#$00&00  2 d22Or0fKa4#ca0C@S #`K-a_Kh*Fд$ & +7 [x3\#=#caiNl#B#i2|3 2ch2h2#k2k2#dcccf?H#h+=J+#h+:J;I;H#R8I7H5I 5Ko@!2N#A1C$9) 8:'I)H$I(H(I"H9-;B#IHI ^"h*N*>* COccI]HbK|3h:`)^IQHp]HY\O58FZJ;59;99;9h3`AHIQH|PHx#h۱KKNJhNk#)FKI9Or#9#Q :D3s93hAKxt+>K=K&6H]q 0F%B#OaH#KJH0i5I Fq%ÈmFI^ FC WFhF hR Fo `| q FDFhFv mpFCy+I2 F/KhF@R(C@FhR*F Ip@F H Kh3*FIp@H pd$ ] p$0] -A/!F0D'O/?/+0F'pF`0FB#h0F+F?FC뀄FCy+I#jI F F# CKhF( hR-"F I@F H Kh3"F I@H+Bd$ ] p$b0] FCy+I~ F# CuKhF( hR"F I@F Hb Kh3"FI@HXrd$ ] p$0] FCy+I> F# C5KhF( RhR"F I@F H" Kh3"FI@Hd$] p$0] -CFx2LF.+ FFCx/+!h-H 2F )I;F h-A!h%H9!h#H#J h"IJk hIJ/I hxJI hrJI hjJiI hd!h #h[I XJJh$¨!(1:AHI "R-ANODFF8h "F(I 0 +;#0B#H+pwH!Fs %RrpmFFlF! F#xE*Oa&H)FPNF (`O0#xF+K"Z` mpA+ FF DB< +#<H!F*I " %RFF FF K!FFhF FBI 1F(F@ %R𵅰XOL`OI |NI hLILH`KI ^&P aGI#ih6F(Цh@!0FJ(a#p?Kqh?+C0`h*F:H#9K3FF `(FR(.*4K%hpOOpCco h6%AOq h6#"! h." h!& hC ZҲ7 *_+-+H1FR .FAOq(c %VԁbXd %#P$ 0ðFFFJOqK" FZ`*FC0, %Lbh*IH#c` %4z𵉰 FJ!FhFjH"iF F DB8hbq:I pO%7R %p F JF FhF!,5x--# `PFhFM FJ.!HPFhFM C J.#(FIF@F$kF@F4 ,у0]  %” %KFk+%x)ГH@?xK)Hh!Hdx;+ C+++}HF}J}H<|Ihah@i!iwH,! * tKL*F`ih oI硈nHኡd++% hH"!B eH@=cHcHcHcH"aHaH"`H "^H h+f+ٝ501 040TH3020j;+ @ =01 0 <0GH ;0:09080706050403020j+#5H##硈#H))*Hx,Ht+H#!i)Hl)Ih-(Hd'Ij&&H^$I jhx % *<{9FSaflti"*4(V_-O$bMFF!FF(l,` 0F*F9F&r""##!"FD D dQ4BOI0FJpQ(FKIF!DQ(FI>DkCDH+hBH[p~! -LchCc`(P(OC (&K(ofH`FbF!P`#F Bыp#Sp(OpC@O`O?Ӱ`0CЃ+ò+ oO3F %FHbKIFH. *,@] -OFFFJ F0##0#`/C0{+  ,.0/+ /-ЛH5hh FI+ptF(os;A/ L0!F 3L03F uhhhuiO5i+prи"t!"(F kFF+0 _ `F)T5CH""a آW!A آ7!A{'9FB%{"a)آW+0ϲ /FFB+0_ FF3Bp[+p aF)آWF!)F F  O /! F2F([/Aр FL0"C)Fh1FO A/#0 FAF(; FB( FOh F(EЃhkp#@Fh  FAFlh F( F/ h)FF FAFh/L0+о Fj0 FdCѶlf %I"F F8FL h)F2`h84TCy ˆry**0D@`@ COqJH`He0%"KF"HKK]ym(F((H ȿIHIIX0 J #Fh4" Hp 0BBLK70 !" rF Fh.! F( I0(p!h)OrHH0I0%0%f0Dhy$,8 F,J#Oq*H1Kh3$4 F $D! FOfh-Oc-B%OqJHIHOrH0-! Oq H J|OqJHp0%fKQ!pF+EsID.&"x Zp+p D p*ݬB"HppF0%0%"KsFhF HOq"`먹H.!>ꀱAOrHJ#xkIOrHBHpK"!ex- - FJ+FOq H`h1Fp@ Fp@q0%f0%Dx,,x J#FOqHH@@K0%R-AFFa)F0F,F F HA ?*F+!FHA 3F"F!FHA +”R-O$FF FF"F"#!DOG QBII@F(GHPvFFF!DQl(=I,F:HjDE(FOQah9Sy BNx[HԔy0B y1F !L3x`s;C3D10 ) #hH#"! Ah JHFI n; f+ X1 ^#D#`mZe "ph $\ # ]#!"]-OF!MO 4 FFFF,)DV\*5O `.F#"2K!F@վ?IFH 6] HtFBMMF.hs+`6(@a@Y#Bw+p )I .H!*p!h"HF( I  4 F!F <,w,j K IF K K K K K H( ",o,,,,,O,] 7>MI,hF FL"h"ch I(h(hh3`0@pGF#%,8FLرVh+;+J"2C#FhP8@IFH2C#h 2C .hPIFH-8%%,F-AF("F"0FAFP|0  I FPgF(FAF0FUP^0 FAP]K1+K9FHZhIO@[ B j8FV#5 6AF -%/?>-!-AFLMF F11[/1 Q-0/1#/׹=K>HZhQ- "!F0FA6K"!F0FA A/2HQ-+3+!+ "F1F`e&Hax/7$HA >_ H/Hd1F "F@ F_H"F1F0#%aHH_HH@ A %/0] F#K-a-\XoR-[-?0 J F)h]K3`pGL2]KhH\%f--AFALm1+?HJ Z=!JPOC #Os3`Os   F8FT0 9F#h+ mX"AFOc3`OsK5R# (o@# `#*s3FP0 vhPFH,+ Hh#C-H~%---F-GF:LFF11[/1Q--/1/ѽǹ,K,HZhLQ- AF0FGAF0F$K"G /!H4Q-0#xutsCE/ѽGH 1ixHF)1+PF2FAF HG `%/0] F#a-w+--AFKNFF3h!F#,?DI FȹO2oC##C@FP 0*Ѵ@ 8"` F8B /H"F)F3h+ x+th+#F1+#j!# CoBB?#)F8F,j2CoCB?#)F#8F)FJ #8F#J)F #8F%---OFbNFF3h!FA'O,P . PFPr0RH)Ft%@F X FTF P IH"F)F^3h+ j@F @FXFZ@F 6h+.PFGP60Ѵ@ a'F1+Ѵj2OC#)FHF,j2C$#)F#HFPF !J SFd! )FFHF,8F ! J ;Fd!")F FHF`%.+.H.K-C8KMt}wBEO!/!!AF(F0H)F C JF)FD2F0( 8F#$+FH*-L$%B  H!F|A ݽ]@Ft6%r./0] F#.w+0% FF#SP0 0*I"F KjC+F F]1 H!F2H(.%F#.-OFCF+F FY K]h!F*FF HZ)HTHN.%//pF F&#fP~0 p*I"F ~Mj C3F F=1+K!FHZh1+ORV#H.%//-OFFhhKh۱#gH# Tp (%^U(F OFH HO6(%6OIF3 F(" D8F P0 - FOO !H(;B+HIBF BBO%F@F&j#C[#(")F Z E9K !8J(5CF^F P( D    B()ܱS g0%E%%SgE%%SgE%%SgE%%SgE%1FPF,#HF########%/.P30/F#-CF`"*x FAF/#JH#jP(FO2FP a#O3%F%9FHFUO0 J F#CO2B0I2F 0/#C#C  #"F1F%IhjC!F0F3FBF!u# #5BܻO`1H1F~+ OD#)F8F5nB @Fd/.%PF#:030!0FF%#UO0 0*I"F KjC+F FO1H!F$ zH zgzg+z;g+;; ;S0+.%F#D0-OFjNMFF3h!FOZ ,o F F _J _ID TRF4!pO FHFXIO FOS AC818F hO0BѴ@ / M"@FRCFxh"*@IBF Ex*;IBFEx(Ѳ?S  T# CYFD# dF#F1+Ѵ j2O CKFOR(F,j2C Q#1OR(Fs)F0:F)FF @<0h8FO P0F")F"FF @<0h FOyp%8 n`T0e0-OFMFF FLz@F PFI(Fn #O :I(Fd(7I(F\ #O 3I(FR(1H*F1F{0I8FHFع-0RF(FB &H*F1Fbx+h+!I8F&F(W-?g RF(FBFF0H*F1F=12111226dO72׊<21A2;_2L}2%x+h+CoBJ BOs A1I8F(]-? +FD3x*?a)DP!M1N1N1N1N1N1N NN1N1N1N1N1NNN1N7N1N1N%N1N=N+NDDDdDdDtD$DTyH1F"p"vH:F1FOOO+7qA<"`8FBgH*F1Fqx*(h*o@BABOA`XL TDdL # @ˀ@PJQH1FB"`8FBKH*F1F3x*h*+q %pa\LDd HL+# 8FL%0 0BDd1H*F1F48F"`8F^B(H*F1Fx+h+gGL#DdXL# +#H1F L}K H1F%ո?w-JrDd -@𖀸% H1F22 3׊3*3H33331A4и -d%3@cp#LH1F +\%3hМI0F(dxJ#0FP908CDtD @p "(PAB (B#+D0@(Fo E#`##`##FN_0IhND1FFyH$и-- sH1F-и-p#.!1F ")F0FOr"`"pOs#aK\]J8 p01Fh#CYK1FYH"#4qSI"0F(okz=+ HJ8 Bg $1,DJH $P44OC Ow # FOs+`;K8 : < > 0!FX"AFZXp4KXS,YoC,`#2F+`c+FN02hN!FF$Hlh#CXI H;+JJ"I"0F (aѫz=+ J8 BYO D=!@FF @FqOO  41\4(4%xw4444404dv 4+H##4K ( Or @F0Or # Kd04/ )F H)FqO!jxBj=#<I"0FF(+z=+?aJ8 B&1.D+WHɻ h#4$ CF{D@0! F1 yHHPFCF豆hN- NjIFoHh"FmILp0 G#0#T"@ F*,F@B@Ӏ(ЀVH!Fh0 ! F0O T'&JF F??h"+ hN=!FF>HBx;H!F-0+-++.##;3" #S1FN%0 Ϲ Q2 &C '##&0##XFh+@,<,+,#I@F##I@FX%4115&50%O5F=5$ '#F,I@F# &#FX#&I@F###MF(IHFAFFN0G (FqON h+*FHF I## I"FHF3F #CF l%1MIFF(F|I"F(FxI"F(FrI"F(FnI"F(FhI"F(FdI"F(F^I"F(FZ I"F(FT P] /P^}8FKhIFpF CF H)Fl` 8"F)F $J*FFH%"mFFOahFWF I"F hF m”pmFFFOa&W*8H!F& mp&iF D(ZH!F.H!F&M2C&h k`+h  &2F (”Bg%mFFOahFW8 H!F mKh  hiF h(”%F-H'MFdF(/  p,iI F(I F(+*hOa FW H!F|I#(i4 f FvIhJ FsIh@X 0FhoI8F( kI(,!(FF " ," FU`I  F+x3ZHb(FM^WK@WJ @E @LF *VIF(F(jKF"FO FIHtB]GH!F2XEJ @EK@ *G(F(P"FO F;HR4+ @ (6H!F'- F (E pC%FC K IFP ?%IF ?.ѷF%FI#F'FHrI#F'FHh ץ”1dP<] \%-O'OchF9FFY,CF!p2F2HxIAQ2, Y2AQFOI " V<:FF#H` # 'sFK F!v05IY@>p`dBmJ"\?v "rJ![CSOI"00Ъ J pJ[CS!02FH V<H` HGQ@FOyRFKFRFKF1FF F*FFH*+kOK*^kFV++5OjO O 3F!0?ZbJS!0?M,Oc b[CS0?:jHHJQ`OxJFCF.JFCF1FFh(,JFc CFIAQF`1F;FUH| +yOE*I^+FV+QGOO O RF3F!b0?OK#bCS!0FR0?ڮ) ` c JPF[CS!>0?Ʈ FYF>A (F8-JjA1 *H! `  $ FYF"OxA (F-:FA1 c hCF! IAQ`  OK!:FCFAQ`:FCF1FPF| J HY@JPjhIFH4 0] -AF$LFF4c`!X H\ T@CD=D-۸1F `ع;`|x HbOa;`V.@J I=DH%?”8FL!hQK*FIhKO2`(FL蘱4xH( "!h Hh J` J`8hah* HPM%%\%X%T% ZKhSK"IhC H!pM%PM%!%-OF MF0+<p/6F-M-I3FBF(h^(hObXF (%K"%I(h`#FH8F MFJ0h320n+?+!a+'p+q+K"I(h`"F$I"F(h#0)h# H0> I#F(h"F PM%h%#Td n3V{M%xM%\ -A N3h Kh M! L#'h+`!`c'`#3`h%pM%M%xM% K$` Kh F K Jh+#`H!JM%TM%tM%%"%-GFF걬L "@< T1'h27 \ bE!T(HiN/z.F+L>H+F@<O"ch27p<B7h7 pESѐB٢\+ZbE.F"p$+P2F!C K   xx(<#~H+p,FK@:zм[\aм$@>Zxh7py@50*@w@</*R+bbET2*$( \(*XxB)3x2x(3_x0/ٓdEЧ1T$|Dl,7D$|O Ep0hD@H,3B#A$ F8@K(н8@ J Kx1h I#+`hH 8%4R%%PM%.@ KO2`](( JiF(HYh(K"%;S%𵅰8l/KO2`(,J()K )I$`^!F'H"M%N%O"F(FP IK`hz#x +`+h+h!F(!F0Fi)h(K"`);h+K h`h+h3+` K`%h%d!%SpM%%M%@KO2`](+JiF (+HYh( Hh( K" JiF(%emu%[-GF hFVI&xpHDD F\PPKhPKPHhGŻ6KKO2`GO%H@ݹ*й-)hF F(F:H#(Y6KO2` FGK4I F3K3O(F F%1HLF#BF3!F-K8F,ѱ(H;F FOp.%HFx#K*F(FF FKF|#r)FF;R#3KBF!F8FMUKBF8Fs%PM%%}R/|-A@MKO2`(X+HJ(C;R#!B#?Itxx|+ (9Hf($6Ih\5K6I` !F3H^/M$1N1O+h+;B3h۹ 'K"`BK&J(ѓh#3KH,;FR$ `F )hKh{K"`h+h3+`K4%0h%d!%tM%|vR/pM%M%pFm@ O4;K` mp! FR$ F4&,!  /H`/K/!(FF F`AOb&(Khk'N F1hF1hh;`+ R-#KJ FhH!FFK O2`!F hZ ` "p" Fz 2B1F $1F c H%V_R%PM%dM%0# 088KO2`0(5JiF;+1HYh((D.K/Hh+,HF!F)HF F !F Fh--h+HhF!FHF F!F FL-KO2`h+Hh!Fd F!F F.%&PM%.>IQ\tM%p(LO3#`нp@ K NMh 3xKL3x+)h Hp@JI(h##`p%%%PM%dp(LO3#`нp@ʿ N M3xK3x+)h Hp@JI(h##`p%%PM%.@KO2`]((JiF(HYh( Kh Kh# K Hh HYh(K"%M%PM%%@]KO2`]((JiFt(HYh( Kh Kh# K Hh HYhs(K"%M%PM%)%-Am FFFObhFXBo$B HiFH( V$ObhFBObAFhF4K"` m”%@ KO2`](JiF(!H%2@ KO2`](JiF(!H%Hb@KO2`](+ JiF(+ HJiF(%;h8 L%h0e KO2`8#B#`H%`IhHM%%z8C L+%hA KO2`8#B#`Hv%`IhHpM%%8 L%h0 KO2`8#B#`HT%`IhHNM%%81KO2`Kh+H3@%tM%81 KO2` L#h!F #h!F %tM%!F #0(KO2` Lh!F H FT!F FHF(%\p8=KO2`p(:J(Xh F33K4Hh/K1Hhz,K.Hh.H!(,I ^F {[z{'Khd K&Hh Fm)F H!N"I0FFP0F41D0F " FhZAOh8GKJ h;#`=)F %ZPM%"%mftM%%%JKK`%%JKK`(R%(% FOF(O3;`(N#3`KHh3h3h"Ih H33`;`, K"ph"@HK%%PM%B%|%(7&L %M#%H+`%Kh+h#`0 O3(,+M !J##`(h`KhFK? + F !,`F#H#pOb)h? +Ob!F H JiFx(%%OPM%dM%TM%|%|%Z($Jh+ ##`!J`!Kh9!JF(%O3J`LhI FK pK"`KJ`KhKI>KhI FK0 K` K` KhI FK(J#`J`KhJM%M%PM%(%b!KJh+K#K"`K`M%M%%M%KJh+K#zK"`K`M%M%%M%8F F)F F8@ۿJKZK`%%JKKK`%%(-GF FFB(wO0(nhBI0FKZ(F@I0FKT(B>I0FKN(&,;Шh,9h%! P!F KF5%,K+K`+Kh.%)K)K`QF 0IF , &&%OOd%JKHhhIJh+ FI6.%KK`Kh+J KHhhIJh+ FI2M%M%M%M%M%PM%("HK`%0KO2`H( Kh Kh# K Hh H( K"`# Jp J`%NM%PM%S~%%%s F(KO2`pKNh31hHp@(Lhh ")xjjhI0h#0hRF H Ip@ʺ%%PM%o%8L%h07KO2`8H##`n%`M%%-A@O3NJ`LO;h+KKLHhj(9+HKh#DKGHh\$8h "DNYh`*;hSAJ`"@Lc hchEE3%;Mch;c`+L(F (Nch;c`+O(F (E1JiF(ѨZabi2`+c` FCK%Hh#hZ"`x(p (;h"bhBZ:`"f#5a,Z=#+p5#hZ"`x +Ѱ0KHhu#hZ"`x +%@S%PM%M%+Lg%LW%\ gLg%08^O3J`0((Jv(!Xh#??F FIZhKhf-t##%;PM%08 O3J`0((JiF8(!XhO??Kh]h I*FF F"+s##%;PM%0KO2`(ѽ@H@IhH %O2K F@H2I@h1|PM%-A@O30(( JiF(XhF(HHF`xK*F(F.F0F*D4 FF"F)FF"FI8F@"F1F8F<8F8F#0Jz0FJwM0%-O@E(KO2`(($J\(!HF(7xK*F FOF0r|#N!FLF;J#)F;`#` H#KRh(FJL%;%%M%(pF FO3J`phI0FJXI0FJI0FJ($hhoBFJh3*hI$IJ`h ` h I#% PM% R%R%6-AFFFEF8K:FIAh@hJ#c`0Fn JhF``B=H"hIAh俽PM%aM%w-AO2M*`((AMbhAF4*:F "0hr#h+#+`LNO "%PM%(NO3 F3`н@Hh OF0jh8h I@@hJ##c`"hI8h.#3`%PM%a8 L%h0 KO2`8 Kh3 K Hh8@H##`%`M%%%PM%8CL+%hKO2`8Kh3 KHh8@ݿ#B#` H%`IhHM%%%PM% 8L* F%hKO2`8Jh2KHh8@(OIh"` H%`hHM%%%PM%CK-OMXaVKO2` M(JiFk(ВK$M/FEяKrhIhb)Fph "54IOBOT#w&h$;iB+FF+21 TzLF+x˹#p0hhCFdoKqHhNhK`;iB5$+ \+Qkx5;+x+5jxP1@'#O "eF0jx P1@:B  FBS+S+`Di*5B B FS&S&JDO;H+"@BJ^bS8F@hI(#c`h=(F!F(FhI#`8FKF FFh(< :F)F0F ` #h+I#h+ ;\ :Ҳ*A  Hx *3P #`TR%e0x#OFx !p%).Cxc=hZ5`&Ղx" 5P 7!W![nO۲  7!W!D0RѲ0!0!0Xd -GF FFFoI nI"(b P#`#0+/!PFx(@PFIF@!(Flh'P+\K"`{6:!FX({+up:!(FDF(mF#;+x%` "8F0;x#BOsBn?H3FJF9F.=I"0F(# `#8I"0F # `獱(hF `hh``hh`+#`w*H2FIF^@F FO0 G8F:FQFFh+3`b+x%`h++Khgh;hH+8` 8F`` K O~R%M%ͧM%h;`+ڊiB ( hZ `ppG-OL I"$O3FD D@Dn(@I (F0 x x{H)F$ 6# F L (mO 4Л0+I,%x-/! F'BF@𛀹@}IJF8|Kh.@Ѐ7FyJh0*!F0JObF `8 c;# Ā gK!h`[cK``Kh+@Ӏ`JYF`HBFx+;!F(YIIXI FIWI FIUH0gTH*F!F*aO ##pmO (F#@!F 8IKK`| :!(?O#;oG4N F%F6h.>4F7Fg'p>FaF{(F%Kh.7FO Q6h%F.й%F'F&FE6h.йѠFO &x6!I F&DFFO DFFF/x/?&I(Fv'%F,F/F.F <̧M%tM%M%nkDR%d+XF(?#8PF,.}/#x+@OObYF ` c4# 00+#x+|KKhvIIJHp zDF/! F FF# F;-1+x+.9I `Ob>C c5N5O A3LOb%h#`3h+70I ` c%`#Kh "!AB(H(56M~I>T0*M FRNOS0FPD-UXT143x+;mH #x+lI FI(iH*3A3A 3A"3A$*+AG3FA3x[-!-TKh0Fh((OKhS%%%x-JH(/!TH0N%%JBK`(ANAK  ?K: hC%##-@7K8J(8I`Q**(5H!*4@#:#(K&L2C*##0)($Ht`#Kh[#KhO7FF üL(I hK h#RK hI OR`%%M%!%%M%%`gM% R%PM%NOr!F0FK`,3,SMH\,KJ`,+,x+𧀏HL(Vx+S~O: /F F.FI/FF(&-уH3x+YFfF0FEFӨ1F DxF(8FIs -?Ԯ +dqJ2C,oH".+ "0+.x+HEе& F,8%! FJ`H!F#O2X3(FWZWl1AYI0?sZ3 WSxCY#xcQI F8PH)FWY FIWMYM+h#`MPP&0*Ne1f e C Ih2KhTD1$#H5J8Ih7I(FOR(F3Kh3H*F1K(F1J1Irh9F(F6h*,J ,K) FF)I(F*$+OA,mѺr-KNPM%EM%@S%Lg%%hM%lM%)R%M%Q%% R%0N=nx#џI*F*0OќH2 2јKh+ЗKHh &-ГN%FNKhK2FI4hIRF8F-ІKhñK2FIhI*F8F%NIRF8F-,пI*F8F~M c*&$(h,7*h7FF5f(H ! Fz(08 "58xF;kJ3h20X@59FO7%FF `J4!Fh8(@4+c[I6665 "zWK)5x+#((ȁ<,?j FH"eJI6h(IHI6b(6x*+Cx6/*ZxX6**+36x+=J2C;Hh9 "2  9x-+09 "6$F B x99 " F9&I6(IPu6FC } y { ~ (?bO3}x+[uD:TbM%PM%$bwXd %ʭ% I6 6TF!I6(mИI6HI6F(YѓH#,@ۀ&0FHT-@Ā+?+뀉J%hB%I(@䀅K+++@ZK#RN??JEs ??@wI??1Bs,qKh+@#!K"3"kI6JjI6EF(?$HF$aI62(ю!ܻ?.nZH1FD FH0FH=r*د#@ +xKNHFI! C\KHKJ2+ HHL0FH(F~;K@1Eh$ѫMA)FSFp!.0FH#(FH55K*F5Ih# FHz+M(F]!+K*F,Ih~*H, F FH_ %H%x|+! < I%0+++:%H1#%8ltM%0] %%M%X%%PM%3Fs|K)KHhB??I`H` BB%H"%I(+++%%IK)I I Kh*K@aJHKB HvKyLhl vK uKh3Ox O3O0",MhM* hHո#"#` # 2BF^Hh"+,"##`SKXH "3##x *;*QI#POH3##x* *,',0;0K=J" D!  #<#"<#Bq<###<#<#*s<#"B AO<#*VF(O*F8"+@ր"+XKh+@*F(H>+DPM%%v|80Aϗ R%q%%M%M%7Jb\%M%J<1A1<#c# <#+pzF:FC h(#(]E%H]?DD}Khs|Kh[|KwOhBr-F"+?Bd,?>sKhKrM'9FHDH2[FbJ@;t bp+r (# bKh^KHx"+?,?ݮ$'$%ZM*MVHVI TH},?IKh+DK(sDJhFJhBOtA?K h]# Y +X)?KB&:#??!F\2:#b`#)+G+%\0 (K:hR-IF FK#*s (KQ) K zJ!L2BBA߮ ܾ zھ tؾ n־M%%M%PM%M%@BM%%%b80%%*)+1 K%hB3M4R1>A(#(HD#($#$H=#$&#&H6#&'#'H/#'! m++)+G%+%H#%M%s" F"IF( I" F@#FF FpI FFXI" F(I2#F MHX Fp@]h++x+I" FF(r𵅰#!2H\鈱0Kh++!F3(I 'I 'O'M'NB Kh+3!Fh:!R#(+hB #+`!R#[4hdI F8#x|+ FHc#3`+¿33K>I0hS$ 0hIF @+`OQF K ,@N(Kh*?$-vЮ&Kh+\,,@߀)&KB:$',@π"J h20[ջ OKh*+zѻ(d$Kh*j.$.j3'%!%R%HS%M%R%PM%LS%w$R%|'-%Xd DS%{Kh{Kh .#XF,.,d,л-2rK"`3)lKhlKhs.. XFrwiKiIhdKhbKXFhe.@`H0 !h3`>+.$/_F$+p CE8\#$+p$$hZ` ?`?6 IKh+5/.?'?DJ h20Z,?M,?6d,?AN3h+]:Kh+?XGT1/O5K"`%IF 4QF 02h@BB *L#hk*KE йٹй? G 1k"KE кٺк? G0+(d$0, ѻ)?eKB'd,($VPM%%%%M%Xd M%$R%'%!'-%-A!N 4hdH@KO2` FApGO I#;` AFF0hh1hH0h"KI@F"`B@ J;hF;--k G)F DS%%'%b$R%-OPLdM"FF#FiC C C #K x2 (hG?FBFxH9FwKO2` dM6 4OrYi FV@tBFiH9FfKO2`09F # %S!i@CiFP\I@B.YI*F0F(0Ki3THTI3Fhh!`hfOH2FPi0i"ici[ (FK((F#"ii9Hj#i$662F;I(F3` 0 8HBF9F/K(FO2`k3h(66+ #"!F#(F*I(F)L*I*N `(F#h0``'H h0h(!Kh3K Ih )($"Oq(FOrOq(F(-%M%%nPM%EW8-%HS%|DS%FM%Z%-OMO#LMfj#юO;hO:7 hC$9"!( `zHp~K"`"9!n( `wHX MtKh#"Oq97+mKh+wlKlHh" hO3#`hKh[ܡ03dJԱh0O2 _H+0F(( 0YKh;+QKWHh#0TH0+(ѕ97+6GKNHhEKMJNIh0+EKh;+ٸ#FI ' EH   h(2K>Hh hlO3#`#;`'0Kh *+'K5Hhu 4I0H c>(K-Hha,K1h Os87h0CcCC2yB"<7R:'&BWKHh7M%M%'%,R%lR%M%PM%M%R%%LS%ȡ()% 0BP.%xtM%M%M%0 Bh0Bc B^Kˆ(0[:78'#|I h#(zK hI hO3#`97+ #"!# h ;hc"Oq0fH8'aI h(aHaKh#"Oq hPUI h#F 0UH! h87(PH:h97*+P 0+?PO  IEKh+=00+7і , <  # !1'@C`FT5Kh5JhO2`[F'2H!?-K*`F3(+0C#097+ѕ;7'H:7?7>7='<0F+?(;h3#O;`KJIh0+?ڭч?$":` (-%H.%M%R%(M%M%R%HXPM%LS%ȡtM%M%SKFSLh h/1F@:F!BF@! h|0#h9FDO#0BKh+ؿ<#Aq!!   t#9s Ozs"!"rCDh+h#+'H'K(6 hFAF h+h#+H# h,*F!8F'`0Н90+ #"!#8FB h1F&( Hz hO3 #`M%M%MbR%'%o-AFgO gI#;`eKhF&*𺀽*aMd``K`Nh1h"`*h`) Or+3`YN|s|ˆ6sˆpMKNIh$!$!`KKh(!(!`IKh,!,!`FKh0!0!`DKh4!4!`AKh8!8!`?KhKh+?m KBh!???[!# ##N0JpK hQmI*FF Fn:jH( hHfO2C,$ "#B(&F Sh;S`+ B? (4F#Bv# "#(IOo hY`x43 $ FS9h# 8hr#hAs##2Br3B2 Sh;S`+" F ,+ [-\ Z Rh +gK [ j hY`x cDJ13A1` Sh;S`+& hAF ,N ,2- L8%M%M%M%80PM%n%M% hY`x$H#$I@B hA K h# HLI hj!hH "I 6Kh+?# |  )! $ +?* G% Z%M%PM%nݹ$R%pGKHh$PM% 81KO2` L" hFv( HVKO2 @`^ %HS%F&IFF FF"BF'8FL hF F8)FE(4 L#hK H I 0 `#hOaHhK*FHHE%jLE%dL4S H I 04OaHhK*FHHE%PI%F H! FFhαF,FEмB20!FF"*Կ8FO0h-OFF9I@FFd, Ԑ<,3O ,,N,K-J ,M)F+IF((hH F! FOƿ 8 z+F F5WPFCFISFBFSFBFYFhf "PFh0FGCh " F IHE%h?I08x!*$*(*+FxF2 , ,,Q("*&F%x",5& ,)&3K%"((x%K!*F0"8("("8(\,\x3$K8(3x,",%K3K(88+ #8#8#8HE%8LK (8 K8#8`$8jFF $838HE%%h%𵅰MLNN(8{IFixF#GIjDH#OB1F(ڂ0)$8+ 8hhlCF 6H(8Kh;`+  hZ ` "p)H'HCz3,8#H)h "#8F08 8$hh`G48+zsh;`+ڊiB hZ `"phKB?tI kI g HE%%\ QipGFI Z I"F R@h L#h3 `KhBP#hXBXAPM%KJ-OFhh-CC˰O!v2ah8t#as:< vA0 8 򎁵@PF1FA0 Q0 F F 33C@wKJOq h2J{IEFPFIFPFJK 0DFJ[FFqDOaaPFOaaFPFF q0DJ[FzD #HO0hZ`xMc& p`nCh;C`+!CР + (,(\( `nCh;C`+B> hZ`xhZ`x)F`hv4% % FOF9FD.!0FF!FDFp9F0F*F|]d F$$%-OFLFF#x{I FMhf`2h+ВH!F m@+&.!#1&(+0K(F8+p +VCS (}KhFF(&F;+N!RuG58jH5 ++3hn^ bI(иaIȱknD( YHYHhnTO0~A(0+IHknB(DHrEH}G(0+8H=Kh[hnChZ`x ( (hnCh;C`+D1K2Hh (̰)*K,Hh"+OQCT xT(IhnCh;C`+|A#IK"HhhZ`x h 3@ B""p (1)=J$pri2`5M%%%2"K}TM%PM%Lg%Xd @S%hnBh:B`*&BѩhQ`x!J`"qhKBKHhshnCh;C`+ "C p (0~ B 30@hY`x Z< O#p4IHFLW%Lg%PM%%KhF;sI FDxI" FhK"`320[K"Z`I FDK"`I FD K"a I FD(K"ZaXd @ %FPRh;`+ڊiB ( hZ `ppG׽@KANh5hO33`>H(6ѕI""\TB02*p K J9{BcP#F)жtM%%%%% pGFFFF1F8FF鐹 ,o#`J"` J"`O08FC\ *F"T,##`>BNsh;s`+ H ( K#`o#`3hZ2`x +0|\ -CF OFF8F~CsFBFH !IBFaB #H9D;U$BKI J K(hhhhB+`  2`%\ hM%lM%PM%-GmFFFF _ & #cIF@C@FP}I@BzI2F(FyKh+6И FqhBi.F2i Fi0%#! bh1@C1ii0eI `@Bf a`aHO0 m"! F*BFYI+FYH@! F0TH*F|RO#0;h+ !t29h[Br2JFAF F0ih$+7O ;h+=! `TX4`$ t#9s Ozs""r!CDZh+Vh#+LhA+?|"H*FO20"OqA F0;*& #2F! F0I+F] L(<#`n0R%s1R%6Mb8F F=)F F8@Ǽp FF I FFhI F#x 0FpH)F 6;LfFB< I"F T|I H F0I"F :I "I *"𵛰#FFF03 FKhB#HB#H(F(KۊLNKh8FfF(FbD4 F~"F9FFI"F0Fx"F)F0FtBzH(U(ԀwH#h*F0h+>sI#rHP"M(5oKoI0hnKO2`%B#< F!F FrBx#< F!F FbBh(FYIt h8~SHXF F+ F!F F<KHfF(F!F(F.,,BH2F F F!F F x+?n8H<F(F!F(F,^/K`/KhIQ\%TM%tM%Lg%x@S%%hM%lM%%%78m;KO2`09M+h;9K9Ih9Kh(7JiF|*3L"hr3J+hh1KhxS/I `.J+hёhPh(#hK)Kh3$K(IhKhX&I "&H$,`T$K "$I%H`%K`L$K "$I$H`D#K "#I$H`>#K "#I#H`6"K"`"Kh+"FXh%tM%%uPM%M%M%Q%M%M%\%X%%T% %%% 4%0%n%%M%KFh# @P"O aC   tS!F H $ F hFM%S-AFR4[O4 #` FApG%h!9N$0#05OF1h[Br23h+6!  t#9s Ozs"!"rCh+h#+O4B: <#`"(F( # h+h#+DBDR%MbhpGjpGCjC#"!h$ ]!0! B\ F #`Cb&F0!0FBJF2F!`Fb(F#ObOq(F FpFh h`iB`hB FB -OFFFF0+ ![Br2fC,j,;дBii8F(4F6"F+j+bi#DaOzz.5AF(h2FBA!h+<h#+7hbh+B"hi"F9F#,baFr0*h##(j#b Fh#+ !FB(*h# 0O 0+3! t#9sJ  ""r!Ch+h#+|hO2(r Kh,0 IF Fh<#`b6DDZMbPM%GR%ShFFF{O`A``0H #`#b.Oc`jKj;bhB5B=ah*F0FD4#sUh+D`p3" #FF`j#j3#i+&0F~#ibhY!aTh%iB m`h5)FBY(0 +}FFFF1F8FFjK,o#bK#` K#`O08FC\ *F"T,##`>B" +FF0 + K#`#ob|pG!!H%K!Z0K<13H1hGpG%0"Kðh#Kh;Kh,@ C|L !F!F yH! ! tHqJ1 qHqI !<hGlKlLh!h!eKkH(FL谹`MxA@+2dLxk#ZK1hG+l^H4xx,+x#Z"p1!h[hG(33MMMI(hFhKNCO"FOq(FH F)hEH DHo1Fx8x + F~=H_3(FZ"p(6M)Fxk8x + F`0H@3x;x,+x +x#Z"pMJ1h[hG F:3 FK!FFh 3 & & &%t0 &D5 &F &XRol&K! `l & InK"`Ud &w!KH`h &% Kn:f*oB (КmQeppGIý\ 0] -CFM O"(hl1+`&O  "(h: 0s FF H>I"(hul&0&d &&HH! !  CF3ИBH.! ! F !F K/!LA F`A" F I HL I !FIHBI0] bK"sLXhIv1N[P+x;(Fr)FFphfI"phbK "h0n+HppH &0 P &X & HP"iF Khs K\A F@(H!FHHlF&0F K!hf FjH!F(HxB ` & K|Al#x[ FK!FFh ~ 0l& K7FLA/! F*HAJ# F+F0!F0F pFx# + + `F+FKl , ,њB10kSFB10x*p-GFMFF|   *h8jh4Fh.!FH$FY$ aKaI"ht h " # 0" h d*h 0* ""@ +SJ! RHBQI $0$F FF0ӹ "80+ 0 !O1F0 +*/d"FB6HL5K<1C B2Ha-1J! 6/K"&IXh1F . mX(ѝ * * *pK<1#4H!FJ[ERFEHK"`}l&&h &H &X & & &%q30B &P &/0Ű*HOr0n &HE0j"H*"HOrFM ! FI RKk)F H(݄B!F& 3 H FYiq0K-OFL"FFXhI&I ` J!0FR}K}I"h}=(RyKhyKl1+N" tMOFFFO ch;c`+@ F0+H .gK1 /?(@ F FF< ZI<1+@XK"TIXhVJ! d~ #hZ"`x0+(ѵ1+F Cѳ(Ʋ (1 # & ; (>+ѵ,1+  - & +е1+?~<1+.HAFTl1+?n#0@!K"h^ J!K0 0b+h* "" @Bё BY fHXdHHdH &E &X & &l&0P & &/&Bl &d &p°9HOr F(@6K"6IXh! ! 1J! F/K0I"h%,H&F+K<1C z(Ha'K""IXh%J! ! ! Bp FZFFF(݅BK!hv )F )F }Hx(FYH & &X & &0P & &l&p°;HOrxF(@8K"8IXh*! F! B3J! F1K2I"hR.%.H&F-K<1C *Haa)K"$IXh'J! d! ! Bp FFF(݅BL)F h! h P)F )F H(FDYH & &X & &0P & &l&0MF(hI FJCchCc`!(h J! 0#ch#cl& &0 MF(h I FtHC3(h! 0#3l&7HOriF(a4LhF:cy#cq0K"0IXh<1 #10D#00#01 1 #11KHi1#!1K`1# 12 #2 23Ht@HH 0H &jsd &("LI h b hI"@l&{t zt F,!@ 8F F 8)FG( 0MGI M0(AHT?JOaF;KLA:K,F v 2J!F Ft C -H$ 'IObFBѝ 03 +IH,HIHoIK`!Dx *#Cp H{B8  0V_&]  - = %IHP"-HDOr@!L$( ` IH@@ HOriF H@KhF!hkh &] p &o 00P"MI HLHQC+H M0@(55Or@!H M0@j JOa5hF J)FhF M0 & % o   8'P"IHFй HI(8@ I H5 M"FlFl1+Kh8@8 &]  0l&pP"m I!Hl MHQYBF*H mp@t+mIFF8H1F mp@J5l!jJOahFL IjF F mp J & %  0   IH P] X -O( K&ĒO~OO45F`OS`;`KO JPAFёJNh U)ڀIW *щIH8PFt+"`+ F+L"9+/+0; "6>`a;+W\c WyO8E+0+їP+rKrIh(F\(oI(FT({(FmINF(kIfK@F@(gI ^K"cIh F(haI" F(c FYI&F(?lZIQKHJh`dOKhWK`#]0 TIIK/!PFvMNIRFNHBG oB###"#"FFF8` (?/ @I(?K"`$統=I-%'J#O1`9J`9Jp$$O4 O5 2IS"PF ,J`+K,I *I (I &I ;h$J !$H#H(N!IQK & &TV  &] t'NTX~ρ< &l &d & &p&0,&2&(I"(K2``p0&I&H!5-"H#Hb c\B\A#J1#<1K Blh#13h8hSh:h IHK$[h[ rI 3h#8h9( &p&B0] NT0d &L&bH!@,&6I s(2H#`1Khk -Kh+P 0h &Kx+ !!#K`"L h(HZK"`Kh+!F h+O3#`KxCC L! h I h"! O0I+& &p&l&” t -AFaM+h+j@_HF^I ]H\J x/)7>cYI"F>2VNDV)ySN3hCSI2F>0OS3`ONPI2FOO>0Oc3`LN3h+f#3`;h+@HI"F xGKP``BO;h+):hCK`"CK`CK`"w:"I>:h#3`*(8Kh`KhI"F& &$ &a & &+ & & &( &CuI:">`sK8 `0spKh)ր0h(8hN@ iK:"iI`>gK" fI:">bK"l!bI:">]K"`_I:">YK"`[I:">TK"!WI:">}OK",!SI:">sJK"iEK"_@K"!GI:">U;K"!CI:">K6K"!/I:">A1K"!:I:">78K"p8I:">.(K" "4Kh 3J`3Kh 3J`3Kh2Hm2Kh1Hg1Kh0Ha0Kh/H[/L/I"F>.I0##`,L"F>+I0##`)L"F>0 ##` /8d & & &\0`3dhXL^BTlp&ox & & &r &t &v| &cp &zl &~h & &MIFF(FI"F(F ] JhI : R&t HCh;C`+0C hZ`xK[h+ ##@\ &L! %H`F )F(&~J! &J! 8&0)MF (I#`! !H!F hLDch;c`+ FB"p  KhXBXA0#hZ"`x (pB3 &=1”\ 9FJpGB pG pGKu^&\'+)"HpBIxF{YpF1 x,*F@2kZp FI*F^!?!+d&( K @0^"ed""f"HpG(? "de"&d&FHLMNO < <Kh2ùlF0F  <T< "*"F8F 40&0 MFl!F}!F}@#SC@rp"CCI 2C32""b"$ !b#sCcl! 0#c&0pMkh FB j(^h+ HH#x+Dq2;p@Hʿp& BK7nM0FKhIJ*xb Bl " FBjx ԝF H@ FhG 0) 50|&”pF,L-M1 x[@v0F\A$I F#k`p!I F#k`FPI F@I F0I F8I"FH\H#!FN$M+4,B+! F!#!0&T N$] q&K1#Kh4 0x &K"LXh!FK!F"@h4X & &P &p°#M "(h&F0 +M##p1빴B"#1y#0K "XhRBpB*(h ";Kh( I0FK`n#y#0#1P &0X &x &vJ 0[ `pG0!m 2VN! ,TI TO(RI %"3h#0;h# 0O2!hF4(ݽ0FL"0h!F"( #xS+W+B+L08hOb  O@ %Kh+(F +Kh+!!FE"F 1+0+к b"F!Zx @+|)84E x ^+ xh:`* hZ `piB (0H &5l& &&0x &8F L hF F8)FV(Рh )FN(40 #KCBAv@  F F@y! H@'y;+&!0h&)F0FP0F?|(Fb`H#y#P#qcyCcqhB`+x !;#B`+x"{FAL#h;!+@NX#h"+"`.h0F#hD+y `;+O4NGNNNX3n;3f+2oB۳mZe "p9F v 0{'I0 ` n; f+ oB ۋmZe!"p)hHX1! XH1Fh#h3#`6F#h)FD#`0h `1FH#h"+#H#`@˼ H1Fh#h3#`(H| &\ ”~pFF; B"BF*pp\+ ^+Bx@:Ӳ F;Cx0ֲ.Fx0:ֲ. ۲2x(ИBSxJx0:Բ,-CF9I(=7O ! FF6=! FpF(9#p FF(Oy5["(FFHFn4F`y! F4#h+L#h+H>##`LAF F(FF)F?! F0pp F\F@y!nh(F#x!+ ` FJ!F!F8F2$| &~0ɂM$L%F h\1Oa!JhF IhF,FXNO"F@1hFh F u0#u0 M#y՞`#y4BT<hD<3hiF8Fj !hF#phF30; &EpF FFy[ FF(F pI0F* F|F!F ɂs$MNI"(h  (h1F:I"(h2I(h".<H Fp(*I(h("$0!H\X HO!V( HK!P( l&f@@xt yt D &0!I$ K,3CLF0 0KjK "h FPPB +! ]4B > &0l&H!H,0@g &"%L&I h #I" h! h| ?@ ! h|I" hFH}0(3(HZHX I hhI h", h!|I" hV hl&xt yt f@0F(g=K<1FF2" ;$k . ;$ F& $.$ ?1 ) $; ?% ) $  $. $J 8#ogJ(?H !g"F3+;846:@@*9999: &":<:W:]:*<и?ɮ2F O36HUO5F i<'2H2H2H1H%2F#nF B%H O3F]JzD+ $i+ظ?H hBH;2 $d+ hB H; 2 +q Hs:::::::;1;W;-OF O0 >lFO0>gFtHtJP &hQhC +F   "OsjI8#iK& o h   mFp`H4F8F?9(F?6FO6FFFn0F&FFFO2)FXF?PHO4O8F?(F?F 0FQFH4PH ùO2 9F?H-HF9F m Jz rF !l(5H58F?(F? !lv()F XFR 5C BH+FO2 m H J3O1(FC#OcC#_")FXF( H48FH?(F?t9XW:k;n;;;-CFHFF 0DHb#&o` FO3d??e" F ??4Hw$&F8C0H;F.HBFFH;CLG@@p@BgGG/9!KBv+&C4Oc!FXCgzs!J kD I, ,."H,H)FCc4F@d@pDtv K#;;; <<0] mXp ~(HpCOK ""[h;K#F9,p$.F"F)F jCh$D K2F F!#,HH &<"<3<-OFx]-+Cx+,FOO F(D00h++ F FPD0>GFHKh ]O}v! ]!F2Fh DFH)Fc@F ]O>#pCOрH!FnO@W)F F !FuH9l(F*8(FnH!F(,vOb!FpCOF8F8Fn 0B>1Ff퀹0F{"(F(0!F TH 0 CQH!F PH#"(F# 00Or@!8Fr(F,F p;H9F&0KRF#(FO6F1F(F4F(FFt1H.0Fj.H?? 8F'H!F=*)!8F&AF"H9FPH9FPl#EE #ZFHSF(F48F F+ FBF"H!FX &S<b<t<<<<9<<<<"=G= 0[#Mv#JOah#Fo hvhp20Dv 0vOr@!CFHvH%P)F0FM0F 0+(F0H FH!FX/=\ <=FF+ * *pGF xx B0 \ܱ3\ %FA%F/ 3A/ a,٣A( 3(FO0KOh`Z` KhK Kh3 K"`   FZ &I&D&\ H! A >>8F!D)FF{ F8Jh3`pG &8Fh#x-+4`o8F " F (+hBO0O0KpFh+NuhŹ ! F Fh` Fz!0I"F`shu`+`hh!Fnhp-hFJ@!hFhFr &!1>F@}Kh# F@O0 &8F F@Kh+)F F8@ɹ8 &FFF1F(` +`#` 1F8F `(H1F `K%?Fs(x08 Kh+ F@ &𵙰)OF-J+x+G9F(Fd(!0J1F(F^> 0FM FkhB F!!l` 0KhB!pG &K!i Xii &-A F xFx9 KF!a F M' J)j/`^lJ F)j/`^d+hCE4F &M-AFgNsjB$b/X("#b #z!wb kc<#c{ot=؆(h)K(b!(X2(YН0b03c0sc#s#xC#$0#0 0"0n(5K"8@ؖ(:(/K"-,K"'O;ذ_4ذo-аo$K "_!K "aO'а?'аOK"KK"K"K"K"K"K "K " K " K" K"K"<ĕI &Bk'W&7 (IjF'LH%'Hx(1Ч b0P+#b HhH"(#jK b`#j+ܿ##bűfHS0(nfn+ܿP#f0H( H;f H(ht@ &>>>>>6%K((8(  #&) 1((2 H]HHHHHHHH(#H(#Hl0p#Cp # &?? ? ??????? &𵇰HNL@ 0`H#`K(FF_(H#`z#` HpHkHfHa aH]HXH  p(ĿK"ȿ`KHxKpHM(F+FH<(F+FH< |H{K(FzHx8FX->L. (%{x-;۲L+JWVpQCFZx.+CF#X.`"`# o FXI8HO1@yiF F(())H޿K[Mb)) H޿ K[M 1)HP)H9????B8FFF((F!8@չx ++!(F#x++4 F8@8 L H! * !% ! !#` &9BKhCCH@ `pG8"MFF  "!F "!F KhKpo FPF`8 "!F &,I& KhCJ Kh4@ӹI F@XI& &FKhX@0x F@ &FF#XBXAKhH K! ? &-CFFFFr B??(H!C dO0 2??0 H!( (FBH!H)FE<,eT$oIGCH!DBLE4B<d-"F"C???@@!ebKhB233BpGH&8CMF+h3H! ,`80@-O#N3h+ "OAq:hB 2R*DwO2`(%HYF (ZF Kh("$J&I&e@H& & \I&%&@p@pKh+{Kh(v*?siO 1)D`hZFO dCg0+pKh+?? f &pW& KhsBC kIAA@ApGO0FpGH&L#hO0!C#hAqD"kB2"cC !2A !"H&8L#h+Jha hnO3#`L h=h##`8hC@3S Sh>Eli $ #S``=A0hB#+b6ki  (i08h,@O3a='K!F<`h@»H& &Kh@@ipGH&0F hDHh8#hBC!B 0ZR@hBQT20BS -OF1MȀ$Đw?[+K!F(FZB"Ob+B..+A0; + "##O O  AHF!  >B@F!  5K;+#c+$3x0;2 ($$T&T&@@pFFxM)h! F hlhM)hY6H1F r 5 F@hnkh "` p 5@FFFFرK1A?+x2*+!kxcxSn!8(,F ;^+#x*+ cx[s+d+УkKBKA4;`4`n!(F,FuSBSA##T& I=HFH H H H ,MNO#x+KуKH!4!!8!!FKxb?BKxx?|cCCKxx|3Cx?C|`Kx@rx|C y?Cx|2CKxBy|SCJy?Cx|Cx|2C4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`pT&KpFhh)ݔB ,`pB <)#FBF;)FF x&B F4FF T&FI I F I Fh Kh+ I F8   &&I&FI I F I Fh Kh+ I F8   &&I&J пò\pGT&(FIHylH( @F0ӲHJ !~H#FT!p ! FpH#FX!(Os4$(FK!F"pA&AT&FIU8I FP8  & @DcB ѡ"c+ !@%cXBXApG pG pG*-A FF F|FF<`@0FrF(F ȹ(F2F0FO1 J)F((F( $$$&FHFHI*FQFI"0FJFxHI*FAF*F0F I@8I*F4F8F<, FOF!F1F9FFF0F8FHiFpI FN阱 I FHp F8@}(F8@ (8TF=naF-O F F2F(( pCO5I FF FpD+& &sL8xhFK (h2DBF(F8 83D 8 8x[ p;B8[x+hF+ 8& &pLXB"8^]k. KO2b 8B x@ p 0F& K8x &8 L#x%X8O2pKb 8 & pFM F(F@sBD p(+BB KO2bh@ xU;;;& 7F% xX!*F F (0K$ `pG&-CF xFF+7KhlhB)! F0Fkh%`c``l`h 1F@F^Pch@F0; F;LFh1FL(#h`HI&FF"FFpGL$XKjB"!F$8"a& K-OƲhFL8(h+Z($8+Z!](b*O(h088#h88+;#8H1FO +"+(F +08Y#DB0(h((7 #80&9(.ѠxJ!kBA(F(F(C+tz#=)pXde(#48&#48(؜#48f#488x8x +#488B< + 8Br< +?m:7#488Z#488x+?R#48J#48#48!#48 8#488B< +8B(< +#8B< +#48n#488x + 8x +8x#8$h#48V;T&&$& Khj*(b(5 /FB RFHFAF(ѵ`N"HAFxH8x+?48(@΀8 ;#88Ar8xF EyKEFEF-q8)/ sH#48F!8FFD8x+F )cIdN405!FE)oѺ*0xxFBшEFO x O Eث.F (ЈEFٺ ERF0F( 1D!6E F@+; +p; +R#ŅՅ5 +R#߅7+E+Z/+ѫiFl#+b)ip@Rhq`p@ #x%F4++ ++L h;+x #`(F `Ax"+ixp@x"+i@xKh+p@ ^x!+hj; FhbKh+ohjIHp@Kh+b I Kh.YF(<1FHp@̽8$& & &F?FFpFKFFX`0F)F Fp@8$&NKMi@4@F/#s`c(Frj(Fm Hi, , K!F`@|HZH8$&=n#F$&#m#p+LhH7#c`*h&H6hZ$H0h"H*h^ H$hHhHN%h A+F2F! 5-ѣh HK"`pL##L H H8$&FFGGG'G-G5G$&x6!Kh@ KXhi8 pG8$&COppGKiFH]1 8G!F KhD```8$&Kph\#xK%;.FM%B p]&>#x5 &!F VJ#`hD` `Fh8$&DF F-G#_Le&-]O`]Kh3s[;`O ch 0 C QKhO0*#hOGo ( hP @Kh0k}P6Khܠ0  1+^[ 8#@ch7+?OCOS#;+?Je(EjH")F @ (? hFP0I#" f0+?8e&2+rzJ`#*ssKh K"! i2+riJ`#*s"! i[#*s#"#YKh+ #*s "#*s"##"JK"FhyGK"Fh#*s#"#h=Kh+*#*s$ #*s"##M"!#*s=(Kh+"!j$Kh  5F 2+r;`Kh+ "8hFG2+r;` "8hFU e &G>@I&pI&@I&#N*s#"##3`gci+#c 2e+rd;Ck+#d"##ck i*(q (q+ci+ yKh?SqHwnKh+ #}"l hK`blgK`lgK`(?mx bKhC`#*s#"##YKhCB`h`#*s"##g)!i {8hCsh&LCC`#*s"##F!i Z`h&s#CsFPBPA d+K.Hh`*K"dh`)Kbdh`d(Kh+@?&J &Ih#Kh+@5 ۭN0hpIFH.0hHIFJ#I h"ZKh! `0H! I&  &@&&I&H& I&?> & G=nGG$ m# &H#*s"## i(?{H0r#H*sKK H!#*s"## i(?J#H*sKK#*s"## i FFH#*s"## i FFHv0F( ???Kh#*s"## iA(?H!L?|Kh0F0F90F#&abE-F(?1F"#a#hIF fKhKfJfHgIh.F0F޻dH!`IF F( -e& %P -??.O1(F!t#QIF> F(u - -?p(F0]#FIF F(^ - -?YB(FaR3Kh+9IF% F(B - -.%(FF(6&J% &I(Ph`.%#(IFx#*s%K`%JhBOvv6!i[`K"` h+߿Khs[2 H@G?/H@HSH_HI&oH &# &$ m#HGG|HHHHHlI&@&&%& &#*sK`J#ih Dh+߿Khs[2K"`K`chi+?ϩ|0F I#"(F+¹Kh+?#clI&@&& &lI&Kh0pGT&8FF ^$r!F(F8-OFFFFhD%FG E[եB< +5#+p-PF>2F!F3($B!+JhZBB8FZB,<++*)HF.FBFIF4(FzQHF9HF:FIFEK# T&hZ`F`XxpG-GFIE6?h +43pF#xp+3pc!B" *+*F`xETDFhDEEF=?0F+;M&FHpF FFR ! 98+hD`4D(``` pO0-MFOO O $ò0 *;p&  `Sh 4O07F e 00;+ (ݝ0;+ A-@,A, Kh+B C Kh+C B 0m+KhB# K"`DI&8 &%&-AFFFO d +2F5B$hxxBI)]Xx](g(B 5=`@(/+ '%@,A,,e  Kh+ C B Kh+C B K!h;B# 6K"`D( [d(f(Ѧ縱Zxg*F;+xF0*/*r32i DI&8 &%&L h`hhh@$& FFH(ڽ@!Hp$&H FFH(ڽ@!H\$&H-GFVKh''8F9F(FqF(F4O7!9F("#(F2?? F92F!F(FF(FOsKEE F9 S  #xCcxM+ѣx++xG+ <<+1F FvJ=nI&K$& J & &J&I& & & &@&& (I&W& &  F~FбFXDZEF, *F I"0:!0JE!F7K  @.KhN &Ki0H!, @H$& F@U &F xpG%*Zx%*33s*0@0pGL#h#H ` hK#`$&KK-G!Fd Od O FFsh;s`+ 0F (F'#8F#p3hZ2`x - 2BOI !HF~9FFup8FGF8@F<[CHHK(FK4Q-AF"!DUK"xxBFI4F#x##8F3p xBcxB4;;>FFF#x+5*FAF F,D;;  ! -OF8&F'FF,K,JFq%!8FFF/3'p-x7BxB&-&KJ(/D&O 6 F!(FKJ)FxC KxF0F9F FIFu,D0;F  ! KFHF FF0I F@8F`F(F\!D4 F KJ!F;FF(F8I0FF0F8 FKCa-AFFF %(Fx+&F0F"!D4 F8F( K!F JCFf/!(FN((F8tpx/FH!F"@OF-AFЀF4F%?s!hFF?C(F#p#+ %+ѧBcx%+#KhB cx#+HD<#+5<%+#+ѷBrx#*F Fu FD%+ ѷB rx%*Jh,#*;,%* & &-CŰF E$"#(F??Or(F1F(p5lB,Կ  0K)b()F4*F!a0+F F8*F0F8F(4T&I&-A08KhF+]6Kx*F,F(Q2H$FA0K(F@FF FDq6!(F)%K)F$Jx$KxCFF68F8MSE0F0D߹I"FP0FVF0F88_8FPF8Fb+x[(F8+ F:FAF4 F,F8 &=nKK! K  KFKh#! F3F!FJF(FcF^)FFF F4F88F8(F8 F$ &KF Il`I Ff8I Fb@  =n?>JmF iF F"0 F m@|hFy mHK-OFhFF3EKhO0BH=FбFxFF3|*-* F(Fx(F 9H!7I F($C FF(FFXFQFD4 F-*F[F!FFDXF8ZPFqFPF8S-й *е@ "c F ((Fp(O3H;`F F4P H<`(F<F(FN#x+ F8dI& & HL=nJ*K-AFh F.IO0%HF(?(!H1FA(FF FF8FrF(FnF0FjDD4!D F!F+F:FF0F8(F8@FF@F8, FA &0L:LiF$( p@CXBXA'] 0FL#hx(F !0S)FFuFI Fu iF(F((FF F'0$hpCO(F!*0.)FFu I$I&  0 F ((#" F#PpKFh FiFKbBBKbBBѴ??BA &p  &$&$&HpGF DB F,C/*FFO`4KhB Cн@  I& KBBB Kh@չ@$&I&8Kh 8&??o??F FBB   L&X i0A(q4 Kh"`,pG$&-OBO;h+$AKh+y$%F&FPF܀@󥀸DFEF F)FJ00hC׀??@ЀzKh+@ˀyKyJhhC@Ā#0 ?? 'qKh+PpK FpIh hC@sC)!O1)FE F)FYF F/|0XKh;BBB  F)FO EcoBBw F)F30N'O kHKhCF(^DKh+(AKh+@H@ F)F??F FQ!Fc(G!F\(@"K h9S(?7PF??%Kh+ !( " !OT# 08K hC K"O0`ON_48 &I& &H&I&H&H&%&L&hI&\ mL I&$& KiS Kh( Kh+Kh8pG pGBppG$&I&I&8 &-GFF FB(4KhB#3Kh.Կ&&??.Kh+-KhCBOqu1 FO3"F+F&"KhCѹF  F)F:??F FѸOEAO0Ge F)F".F8 & I&H&%&hI&-OFFFf'p  X FO`o??F F>!KhùOK h9"(#"F@F+F,FLO {F F (op??0$%FF FL&8 &W&-AF FFP??F F &AO0>C*F#F8Fh8 MFF+hB(hBԿ  8??48 &K(FFhB pG` K(FFPhB pG` F @F޿8F(M+hB F(`#IS``#hB Jhh;`7h7 F8@7Zi:Zah8 &` %&KhpG%&-AF F"@FDE/8F78! F0F`0F #BEF#wa#a 3+h 5`\`ki,`3ca#hCE'J Fh3`Bh8F<0F4F@F.B8F7 F@F70F^`$hZi2Zah%&` hpGhpG@ipG Ʉ 0 FȄ#wpGpGi DapGipGipGapGcpGkpG8F@k FB7Nec8@kpG-OF FgFF:й7`O #!2F1@F;FIF^F-Ѐ= !FO??# ZF0QF#F(FBF x#"(F2QF2F;F3FXF(> \F< * -O FF  ?? O4%F F)F Kh+sѮK FIh hCEs) O1!)F F)FF F F)F{(ѡNFF3h MB (M @FIF\W@FIFFF\OFBw>DF (f 8CBCA$O4%Fp .q@FF F +H{Kh.I&EN(wKhCѝ8i 0m2F;FF6G(iKh{ к  6G ( ( 6:gw ҉#(е  7F euE[RKhCVBO am 0F"+9F!,@FIF`( BKhk[E FF@FIFFJh? au . .)F F ( ( ( (F F'H&%&L&W&@&&hI&I&pI&I&I&?? au/ Kh[ . . +F FF# 0W^I&7F F/pKh*Կ""#(F!F#20"@&&-OFF.y#O3  $Kh+ѡKh@BOqy( FO32FKFKhCpi(ѓKh><Fwu , ,ьL0i#hf ( (0 L#hX (QCAm([ O8 FZ # CF?yjKh rcE (FUF!@t`KhC@_Kzh+~#j{o0B8Fao LF KI h)'KK"` :# F"l(+O;h;BTO0 khI "3k`#`"QF 눹:FOa(8Fh MqI",nI"8!h!hg hI"(@Fk=.-!.*<.Ц ^+)#` 0ZH>.Zx=*ј+&Zx=*ј-& "FFELIMHZx=*ј!JJ 3F<.T+.W-.[ki"=.kiYКB""*?x(?uFFF; +L#+ѓ+<\+# p3x+ *=!0FF(SІBQ,+*M  Jx(f!hkiBԿ""kiB̿""kiB""JBJAH@ԵI %&1 =nCMMMMM?MZM !B!F43x +=+ !h"0FCx=+:I;H!h !!F !!F3x + !h0FFxFFk . .#0#hhhFHIFHOd IHIF3(PF`x*!h_i!hx(?:!!FO?M+NN\ MK!B(¿Z`i`D`pG(%&K T@ wYc(%&JF XB0(O0pGX F JhBJhZBJhBKh&&&&-C!LOH8F6!F8F6F6@0F6| (hBF0FO(FIFHF6fh6c ep(%&FO FF0BhU;iC$`((%&8FJi]a FFF F8@P(%& JFhp`e  Z  O0pG,I&8Kh+Lm!P M 80 L (8"!"!I&(%&?.QHLK0HK0!O`!`O`Oc0 aHH H H H#06Q(%&bGQXQ%&%&%&%&%&(  pGK8pG(%&8#Lca#F0biaB$H%`U8 :UU@UPQ H H~ H{ HxP8hT#iiC"Pi3(%&%&%&%&%&%&-CF, F0+3FF>J0hC*0+8F1F5P[ #jFhFF2N%3hBOnF%BQ! <,K `'>F(F!Ff%KOb!0+ L!M +hB! K0??ЍBt JBAJOq+ $! 5 @Q5$I&8I&(%&4I&xI&hI&KhKhKh+Kh3pGhI&4I&I&8I&p LeiiBcia0#`p#iS%0+h0FY]5(%&(F FF0@7Kh#F(bO4 F1Kh (A(: F,Ni($$+2io@G;D)FR#8iD3iS'D(F1(гi (F*'хBJhABJhBJhD$(!F0F2iC;)FR#r(СKhoT&(%&&&&&-OLgF FF0??)1+@Ae#1ih+@O1uFiPF+ÿC!i3#ȿQ#0)F:F%)^r0F9FOG(HCD#??вBADg#1-%O kKh+oѸ| O  1B 8#??08g+xHFFFEr 1Bs SKh 1C1+#1F!O HD^ #C ZE  Ѣ1+\1+ј ! "g/  "S#h(F  Y/KhDE F0"!]60B#H & ")F-H_2BZF#aiBܣiN a0 1PBl1h" =}h\T!iQ"2A#3(%&I&$I& &%&LI&-AFF FF2Kh+ 8")Fg( Kh0D(FKhDB I&(%& &8FF*F#FOHq8 8-AF MF$x$1B  2F;F $4D&& O?h/ # F!O8 I&Ki(!h,!pG(%&K(!a,!`pG(%&(FK8  (%&(F HK!F8  (%& ( ! #3` Ch F) h\) \B\A` h+J\B[$)3`\+#C`O3` F( F(;pF FF!*F FU#hBF0F(p-GFFLFF P*01;0#10#0(1F(FF((JF!0Fx 01[h PH JF!0F`F(05GHN0q}0 ` K)F0L 1B qHF 1BFۣimNh0kN+D*FO1B ([^H3`05#01.}\Kh*[Kh):BF;FIF Gi+*_i+I`iBhD @%i@8U 0BF;F N8 g*9)/)`hO1DcFhBO1aW!iFi2FQ (FS< #h(#`#*) " F*()$+05F-aIhi h\iB"iR#PF_.2ѫE(BF;FIF0FnO3060 CE(%&%&%&%&@%&%&H&I&T&I&E .dCKh+BJh*)CBF;FIF 8_.hEF _(E0FPihD1FF(,I0"h01+0݂B4A!Fd"N2F)F (v<,~I;Q#B;8AKh+?c.`0+0F`0FBF;F ! Kh+JF)F0FH&I&X l\&&T&5FTLFFh - (#! -MJKh+IJhʹù0+ #g0 " F0$+i $p(&W&-CF;TF FFF??.0BEF#p JCc`Kx8HH?V=nPI&LI&CV08(H!K"`pG[V &(Kh pGDI&0L#h++ `@I&0 L#h+HiF#V##`8I&lV0 L#h+HiF#@##`4I&V0 Khs Kh[??ѽ@(I& &(0 x J^+pKxp]KxEiFH Vp()0$NM4`,` x,+ I#H!F0`x,* I3H!(` pK! J FhKhH I&I&"VVWW(0Z09$?+GK`0R++D+++BHiF0e *'*-03EZ+-+%У1* ;Cr+d+W+^+w+@@@p@`@@p@P KhQE#0 TDF!PDK!DN!DR!DW!!BH H )!BH-#0 piF I&7WRWKhSKh+Kh(Կ  pG pGI&I& I&Kh(KJhhDpGI&8 & I&FxFFEHiF,F F^!D8`FO!xi;hK\)cxS4;;$)#+p.0F(eWTI&xBh+h FHJ*!~H]*!JHtH&WWLIF F FH&W(hS  pG(h ЀipGHpG6o(C H?RKl8 pGH&KliFHH]H&eWFh FFx-+0''x0; +,##`O0- HiF "1F(,-H ##`/@BWW-OFpNlȱh+ +Ci G#d Bl"iF ` FFx*\x-(W/$( (٠ ۲)F(+(#3e3#F F(#x++Dġ3`s F39(/(z$ 0 Fa O O F F,F,HVn(0+Xx-(3+(@3% FO@!a O O xF=*ూh**5H=J3h;+"F23+'H'H2U`ci!F G,n6[ 2-ѻ;#;#[xd0x +iRF (x+"QF%H&WW(XH& &𵇰@#@FF FwHW-hY qH煹 nHoqAx  h;+@e_bi*@h+5F-bi--l!i h[ `*`%h.gУh`*M%1[ `*C%-bi- ->!i h;#;#[1;#;#[+1H!l---!bi+#i`#`bi%H!Rbi* Gbi*- Gy-vh+ӱ#ih+H!#i!h3T# +#iih!+-tv#iihK"`lWXfXXXXX%&FhFF xF0; +#O F xF10:ײ / "+.`<##`,##`O0.HiF+ܿ3 PC3WKhKh(   pGI&H& H: K"` L#x#i h`h!ciFG$4YH& FHx FpGBЁh ;B$0 -O$,M#FF'FF*xb+A#`O XFnh~$5O 1hRF@Fv, A8(ټ- IEIE 0h7FF#F@DBDAhպvhO # `+?h` H(&(ĿK`Rk  pGYKhXH`UK" "`"VRKhBPKhoo ]WHJ#DIhB `G #13BKhBKh+AKh:K1+2!P.0 :J&0h"oO293KxB ,JohC`&K"`+Jh**J#`!Kh{X 13 1+ J 1(h+?gh#+?aO0~ KhB?y(K"!qonI&I&W&W&(&\I& L& I&H!I&hFb]Frh3F(FxF0Ft!D4 FJ+F!FF8Fk.F3(I"FHHbkJ&-CFGF"F;FD;F"F)DeEu&ICBA4 A#d"#]7 L2EE0@B! K22JKXChF0]Mb@BK IhT "FXh`BK"` K&%&FK\` K$""$]pGK&8FM K*hB+h FZ*`p"K$8 O&K&KshK"`pND FFB-4Z4(FW&%&K&D)-C FFF@BaAH Oy#02FKFF F FS `F--8F-#<!Fo^lk˿-AFDppFF# 09F#F -(-0F-",!Fo4lk-OFF FO O O :F;0 )٣a)أWBc#C#F`CK A)أ7 O0O1-OFFFO O %BF;0 )٣a)أWBszCFC5CA)أ7 O0-O%FFFFO BF;0 )٣a)أWBs#3C#FC5CA)أ7 O0-AF F$x F%(_^4;FXxn(+c(/d(%(Ns(x("Uk3FF ;CF "U iFhFzhFD #jFx FFF (CFFFFF fO`29F0F(FK FHEK"$K& ( Ђ*KAս@8o!JpF 4 F3 4]@)F F]p@ ǽKh YO`K)F FhEDHKhR K44DhBp@޿"K`kK&XI&& & &%&KJo]?}k7F F0)F F0@KxJ)FJF FN0 kk8F F)F F5F Kh+޿K"`Q, F8 3 &%&F'KQFFh+!Щ! "K!Fh!K:h"[ CBF4F0F2(H!)O4)!wF ##F!FFB $(h (h2.` F(F2I&0W& &kFh h2##`@ pG-OFFF(V_MFDbPKPDE pO3`+`&F"#FQF xѢA 2ҲEшBЙE!13B ,`3`#s`k`#KV#U# B 3+4+!F: "B"6  :  +!dp F9/ۘE3B#s!``) F#  /F"@ E"\E"@ F"23F*FI&HpGkB Kh8p@Kh8KhpGKh88 &O& KpFh F K.2hOؿ"F.CTp8 &O&Kp FhFKJ)hOOؿ#DD!Dؿ"ep8 &O&K!hK"rh8 &O& KphCBq Kh#BO0RoBThqXp3O&8 & KhB $32D*t0 O&K h98 &K)phڋK$O6h9K&h<U1 [h??1` U1 [h??#pB1DO&8 &NM2hkhB#,hhF! F20!0h3hk`F(`^??S;D3B`p 8 &O&K(h( BF8pG8 &F"YxX:)ء.)F?)\)љx)И2*pG:pGFpGpFj M+hFBF(1F(4"Fn*`"UpO&H68F M??,+h;Bܽ8@4 Fy88 & #jFhF] "iFhF]8Fx FP+ b;۲+DB"cxj+B+ b+#+`m+ t+ 4(` F8oO0oKhKI&8HKMhK;* F F p M(`ph`p`8;H&O&D; -CFMx..`;'#xC+hBГHH :+8 %+'.+𪀍0 p?+ \+cx+𜀍0F# 0#VxF ظK ظBۀD FFtL,S(qIIIIIIIIIIIIIIIIIII'5YAGGIIIIYIIIIIII(hB  X@0 9Kh+4=6Kh5I83Kh+?sC -Kh+?g??]0(Կ  2(KhZ???Ay(q9C?5m(q.LC(a(!KhO& O&?@&& &=nI& &#HBF6?tS(======O===================Ois==)==?u====9===)h"B Fр+`"p??, #rCjKh(qfKfJhh E8a:T0A??TP !n8aX(qNK8hLKhLKhKKhqHKhlEKheF@F1nq;KhXgP5BA*s(q8aH(wsFF??F F*sHFAF \-PFF?{BA*sqF F5 9 ()"" Hw HuKh*(tQ@&& I&8 & & &kH,Kh8 Kh Khd -U K KXhXK"`I&H&O&  &Kh  FhhH %i-5`dBsh,vBs- FF FdBsDh,`%dBsۄh, (F`h h\hZPhB S``Y``` `!``#hZhB `S``L`` `!``F@h1# Fc`@pFDhcBv! p0!F0Fk#3kh&``[`l`ch0 hYa` p&,`-AFFF Fi&K`h%K``@h(< `F/B$#J`hXBXA@KBF1F`#F(F( `h1X#c`(FA )F``n :F!1(#1=e`O0I&0W&-AFh F^ iPBp 3PBrڰjBrh"jE|/ۚBj#EEW## MFŔfFBA۲hjBPBABPBEhCEEP8Fhp`Fa `a`#ka.`Ɣ)hѹia3iSQBB8F3i`F` a`5aKi+ hXhB hFBTi4 FHaPa"ZahBсB8Fmh+h"8FZa"h[hBJa ѽAJhBћhB8FhAxKhXhq@ h8 0W&-CF FlT# GrE#hbhYBѱEZGs2CB#AiF@FEchZGs#  4HW&-OؠFFFh+Y2h*VLO0i[/:!BO$a!*F9F*F9FI@000 y_9FO$b2h*Fl3hBB4 0"#2"F( F0W&K""`ZapG0W&FKh 1Mj>#bKh&b FM??5 FWd4;h;BO$$&0W&&8 &2K-Og??W-J h,KhQh #O޹&Kh %,F0;B(C2O F??FF@F[Es ۱??ІBw XFQF F%DFx&$&8 &pFh\ KDD  p`1 F14F0W&HHW&8F L 58@ $i!8@Hj[ b0W&kHpW&8F Fy 8H*F#Fd(#BA pW&-OFF #K2h KhKh_YF FKhFKhBOrr 3OxFAF[FF??+: 2?? K3%F^F # Kh@ 2?? 8J՜BF{MںK4+Hȿ4 FYFĿ34B#SFF3H??K8+:_??FF33S??FF'6sV  B s 6 K ).SFF;hLFFO FHFQF'GFEKhk-mBoJFSFAF FYF(@6Kh39KhU 6Kh 55K5Jhh+l4I h)k+F*F1Kh+E)FFF 20FFKm-O(lH#"!2b(Zz KqV+JEE &8 &I&I& I&W&I&I&0W&H&H&I&I&E*)+А)&hb"!HLEK{ iH00MFVFLFF??ЌB{ #B{p-i-l ; +TKh+ KqV 2F(X+H!*E% FBJ[YF`R#` Kv##FEv FYFS(PO Ku##F}Eu ڱE+K `"*K` 5E0V0S5 K# 7+!+! JFWCH7'FFR#` Kv8FAFEvکEO7F7x5FFO3pW&H&@&&%&8F F H*F#F(#Bt(F!F8TipW&8F F H*F#F(2Bt(F!F8S]hB4FFpW&FF#;`&Kh %K#??"LEt ۵??0ЖBu,F FHp F FHy(е??#BAڀj(/#;` Kh++Kj+OphI&xHW&H&0W&pFF +xKm,K"eK`p%i F F0X,F! #2F)F3F`a#( Fp@0@Km#a0W&%&Km8  0W&-OFKFF Fk[k(?`OEFv+F FCF&B3ѥK??䀸??ЀEx,(LKhC HxFFF??JIFBF5( #8FF6FO7 E|E|򿀌Buۀ}KhCBOpuӀeFFF??ЏBA9FBueډFFjOh&F&A&oF&F c# #JF F)F# CF( #?? Bs򢀲BAF#??ГEzڻzXFQFh#XFFQF??F Fe8KcZcO BsVzFFOs??Bu8'KhCBOru1eF KhC HxBuOpFڜBueFtFeFO F\F]FtFeF2O F\F]F,FF;O F\F]F5FFFFc#;h0W&%&Xc(?\#F??FF?qE0!T??o^F F(FO1!FU 0"KbKh+ѽ@0W&H&8!KFhbF M#"F(( Kh+ѫj  8O0 0W&H&L#iKh#`Hvh@0W&I&4W&-OFF  x+LGG8Lh{@ՒH!8FяHO9HF M+h+ЉKh l+h+ѣj#bW#bk(6и@O??F Ff#CF FnMF ##(<(lLmN#h2hC 1#b#h+3h+cKh+ ѸaKh>0F{+ F ѸYKh8@FkVKhF9`#FF F4??06B7O4%FE`@??FF(Ѻ?W8Kh+7Kh 8H!C&FF F??Ѹ&4F5F0FF F FO;#O2)FO3LFx#h+Kh+? { ?? ZF#h+ Kh+?B@E 0W&kkH&hI&I&8 &I&l IJhC`Kh@ͻ!4W&I& IpJhC`Kh@Q4W&I& 6 IR J!FhC`-Kh@4W&I&FбI 4KI h+!*I &! "I@ TF !F ! !F !F4 &Q4!44-K-Ah,SСO`'! D}}(F)F )F !I  tK"`bNM/h3hCE+hB +hJ3s[`C K"` Kh#A W&Q4%& &8 & &`I&-CFKFFhHFp)FFFHFVp3+] +@F9F! W&-A!F FFF0FH!D|1F`mn#wa F(F4!Dh)FamZ8 M,hB K""`8#hS``0i0 F0  W&-OFYMMhWIF0k.RLPF#` F2FOa8FFx0F~h++hHF#`#c` M;x!+BF9FPF(0 + +XFFx+F )!pqx+!FyFHFFkh`C``hh`3`ZZxx^*3FaEм ,$*O3!!pF\2(d      4l:lAlGl=nFF Fi( ( (H!@AyH!H!MlZlsl;K-Oh{FT F1FO$ !hаFF0 F1F UFF5G??#H!O4&F Kh+JFCF(F9FKh+ "F3F8 F1F!2F7QF #F93F"FPF/PF/+LFFFW&lI&I&W& IF%4(F O* 4ChBаh43F%: W&  IF%4(F O* 4C^hBаh<3F%: W&  KhpGW&KXhpGW&Khh pGW& wx8H!"( !(lK`W&pG pG L" h ]0 ( +#(FW&)ѲOs` )+ #)O1BA #3`pGFh/#3`#C`pGCh#h;C`\pGO0pGhpG7!TRcA(!Q 8 0 F2 FB$*OsOO F F!le!hk!hF)bh( h/&`#Ya`TpFFF$B9]0F4"B`-AFF#FD DR@F!FBB BF8F #FD8  F(@(7(/(? pG8+)08pGa+)W8)78-AFhFF`x* """D?(F4BF ?(+ =pF hsFFx ha;+!# %')"!F@ p ""##p4 4`+` # # # # #-A[ \-GKGJHIhh ~ -1EO[&x+[+[-upCx^+00KpLx]+0;x)>])!pCx0a+[+\+TѐL[40 p!F3)K)J,Ihh[)ѣ.ɲ)GFcpFDF]cE 04FKJIhhFE0; F;n0 # p!F\BpF pB#0 pnpFi&i&NoJ FpFhF F+""p0 JIHh hd4 F"F)Fp@ڸ *26@Xd i&i&-GF>K I  %I CF FxJFAF0Fp1Q(V1K1Fh0Kh/I"F+F }\,ZxU38Zpx[,[$[%x[,[,ؤ./ * [-<[+%F], Zp3--[-,B 8, e `O\)O: `,,2 `48H8 \ px0ҲH@hBjKhJjIhhB ,,8)P8 xp8)Q8\!p )YKXJ[Ihhm;+I+#0'p+"w+Mi+1h8)x+?o310\i28)DKBJGIhhWO #089389Hl 8 "8 8F`h"+,/K-J3Ihh-89@;891h48I8)x S38)x T"4pBKJ"Ihh 310X28) )Q8x+ FKh [Or@ a F`0?8IMxkjiSaԹ#xFa&i&i&8qi&xjiSa1h;+?Z1 R;+ F&miMhQhaOp #haF@30 \+чKJIhh 8"HF)F\0KJIhh X8"AFK2hx0#320[ # FF.Fh ! }jKkJmIhhZ # FF.AЅB`KaJdIhhFcKh+1#T3 c hxѹ1hF;+?Z1 R;+}+?JKJJPIhh*h3`*` "!F%,"!(F.r0+F#cU5 c ( x* !.\F"U! }x(h, !.NF x ( )h xT JD *hBD*`!TOH  +!Q JF @ )hBFPD(0@ x ]i&i&0^a -G^$N!FO|`V[p4,Kh+ XCK`Kh0K`h;hHF:hiV(FUF.W&i&`r&r&(r&$r&i&8F F#`KTh``8 F "B`FJQh`CKS` KphNmh (F(h1FF(Ch;C`+ ھ`C !F~ F phZ`x Fi&-AFSLFF"j*8*\%(Fcj.3`bZh*XhFIcjb h CI}jh%#c%bh!?J@H2>M(>Ikcj%c%hcej9F@FFj3b+ј #*ј n*a.j @3`cjjhcbFjcm:x#*Zxn*"a@F:F!*7 ce#pj3b#3`EFxB *+!:Fceej""b)hhBab?jpj3b.#p"ceBpi&”i&Lmchh Ch;C`+ڽCСm hZ`x@ i&-OFL Fm#hhkchI |KJeX3eK"c#f#cfLMmCh;C`+ڽ@BСm^ImmCF@"k I|xhZ`xmHE p` (;нp0۱~H}I k쀱zI kXyHp4rH H#p0p4m@@EнXmH~!k(F#e`gHp##fbn#hڹ[h#`#h+hch c+(!k ZK F ZIZK|#cfchxObOHahMHObo"k NI|!kOb(!kOb `(}xFF `}BJSFOa(Fo(F0m@Eн8I(Fe(?BB &m C h%fb(I ke( !kH#aK\#f瘱nD< + E ;F`n0F*Fj 3b @ i&\ ƣƔn&j&”j&)2[Q;Ės|0] F-, I"F |D F @F. I"F |08F F-(I+F"F | 8F N F0h.)F# Fn~F;F)FF0` Fnt0hr&])M)O&khB&Kh@>$Kh\h+5Xh.I"FF | #*hsCX+6h!;h@hI@hF(OR#F!hFF F;h!hF 3 ]r&i&j&"sFMF(h#I |`+i" h libF2H( h^IF |h p r&-CFALAO2DF[ij2B AjbiDba"p&--\-Jx8h 0@0՘ \*&*Fij2B AjbiDba[i2aAF!"iOR Jh??R??i-j2*DB aj)DbiDba"iFR *F1Di*DF+Dr&Xd FBhFAiF*DFSBAAai a `/*F1F#c`D2D"e`ZU-OԲ#L0H!3#cKh-c#d. h¹h+@ހak!k@h(@k~.k~-hh*3h+@k~rhB++~=;>+R#dXXXXXX[XX[\XXXXX^X^XXXXXXXXXXXXXXXX)[5bq[[XX[ \'\XX3\XU^X^7_a__)bXX;bbbX5b"`+v_+ bk"!kph=8 +ph0PBPAk~xhh)UQh BO`"`"dD+ Ah k~B?<%hi~h*Zh0B0`*[h+#d h+ bk2F!k@hk~(?+@h0xBxA(lbhB! hYCZd# `fh #"h!sC(i6Px``f`r&Dr&Y&i&#! 1h˹K(ihlKkhC ѐM!bk k+hxk)h -xl+I(k+ek5&kj !0F#cA0Fbc2c#yH%#xIvH"## tH#qIrH"#kK(ihd#kgOȑck:hiKB<#03 eHPxC 0s# _I  t(ѽ*0+0"!&C06B9hRH9h$ 69h 2;h[KKh h+h.aFI"FF |~ --FP "!x \O +8K6hB9h2H9h$ 9h &CDF-FF-&Kh2FB9h&HpKBF!VDh+>F-BF8H"K9hhBHVFP6HIK\8hi&i&Dr&dr&0] ħht@@j&" <JOhB9h&H |K+{IhSEDx DvKkhC rN!bk k3hk1h TmH!  #c4hIfH#"dH!(&k+![N!bk k3hk+?1h $k+ x !28F4F8kcc#c !bk8F0k# .?ccc>KkhC 9M!bk k+hk)h UlbhB! hYCZd `fh "#h!rCki'khjiRhB i %K $Ih|ck9FHF#F(#aFkibk3к#i !@Ѐ#i!kHhz#ki8Fj#ihZ9D# @i&i&Dr&i&,r&O KihVhBB ЮH#9Fhki8FjZ"i2BBPDO hF`ڝN H 00<Ϩ H<jaki[hcO!rk0k;hk9h oih(Z!}Jh C`BpyH9D#"#iO J1CDhF"9FHF#F(fR9FdHYBB2A!#Dh #"9FHF}( !k+;i3Or@ a8a0kihKI |ki ivskBki"DIil(?~h+?f#`mi@k+]ki3 (iOr@ aha0*i hiHckB.I"hi@(?>"m"*I#*H)N 0 <Ϯ 0<6Ɯk+ 4?J&kh*&f3xp(p71B*#"1F!r&,r&i&”dr&Dr&a 3x0; 2DBҺ #"1Hp#"H"! R BE10Fr7BF!HRj(1O1S 0Dx0 h0<ǜΨ H<h x0h0vK Ihm|r&i&dr&Kh#"I#Hh`~{) RihY&dr&pF FO6Bp#~w+{+s+ciiB(cih I {cia$h`iC"ifa!h`i”-CFFFnF ,uFBI {#`@Kh`O>I8F \`X.U(FC-aZh`B GFFFg`F;!+!У<Ѳ) *=<h(I*F {DC`hYChChC:+h+ ;x+Ч`#0hBC`.ch+f`:!HFF(#;0B+  HFH a>pr&8F!Khı`h )F|(7h+4 *3!K"i0SBSA3h(F8K"i0B##K"i0BԿ## K"i0B̿##K"i0B##$hr&Bk'"0FMFrI*F {iF 0 I {ObiF FP F M0” K : * B² *I QppG\ ] I0;0+ B0Z "ppG1 p\  2L!Fh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@𒽜s&KphkiAK4( t fx.($x hp|p~pqY}p, F F ɲv!ҲZu"`p's&Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`ps&`p'-A4L#hZi5#2JhҹkC#h.J![ikM,N%,O3hB-%Kh#"hRi( "J!M#"hRi, J!M#"hRi40~HA r#h[im)FOh J!M#h! J5[iM9F@F>+`p's&fs&] -8FH`3I  I0"FHJJHOqXM, F8 !(F#p+x3,IHL\ ] 6r&KsX%H( tF"Hx?+Cx۱0MFN! FO0 Fp/!hD Fx^(ЀhFS+ !F0F F!F(Fh#`! {vty\IFHd `] KD |<0BєB4KFIHLKh[i1cxB [x;IH@5K,IH,؄@I@F Hw,I H"F I@Hks&] `p' 2IFH ] 7F Fd"` F#xxF0F:*FIF Fp@\F)G 6:F=!JOq5;##Di@J@ JOqJ@IHXJ3K@ FOqJ2J@h IK,OqF\&Z&[&Y&fw&v&2F)K159A#JOq5;##Di@tJOqJ@IH~XJ3K@ FOqJ2J@J@K!h+ ""KOqF&&&f&&:& &F )N#'=AEhOq"K:""Di@J@ JOqJ@ JOqJ@IHXJ3K@ 6FOqJ2J@J@K!h+ ""&&\&9&<&&f&&:& &8F)81hOq5;##Di8@J@r!h@"hI 3#2Oq@ Fh@B8&f)  JOqis J@ JOqJ@ JOqpG&<&\&9&<&)  JOqiL K!hJ@K!h+ ""pG&0&:& &) JOqi(JOqJ@ JOqpG&\&9&<&)  JOqi J@ J@  JOqJ@ JOqpG&d&;&\&9&<&) J@ iJOqJ@ JOqpG;&\&9&<&)) aJOqiJ@ J@i!pG&<&&)) aJOqiJ@J@r!pG&d&& `pG# K`pG H`pG H`pG `pG# `pG `pG# `pG# `pG `pG `pG# `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG `pG# `pG# `pG `pG# `pG# `pG `pG# `pG# `pG# `pG `pG# `pG H`pGK $` Fz&K $` Fz&I"Op \&I"@ :& K`  &I"@ { 9&I"Opo <&I"Opc \&I"@ W 9&I"@K :& K`  &I"Op5 <& h+#`pGI"Op# <&I"Op \&I"@  9&I"e  &I"q  d&IOb@r  &I"Op &I"@  <& F N0h)q? @N!O0$ h"F|A0h)h;F" F&-AFh Fpchc@ihF(!0F``&0Bܽi7Y)ihpi BY!6ǿFi7N j8iD j@n##biEi@f#a%KF@"iOձ)<DDN<#c\2B5<3*- ! b@Q! \@Q!@ U@R! O@R!@ H@S! B@S!@ ;IH ] 8!L#h+87(6=`=:IrpI"! IO098O0@:M(hB``(hB!`(h7@ !`* ap J0C/B<##` 8  t&j' -OF,򖃟KhB@iS$@,#! +@Os>Ej#i FG#k FGi+@F P1O ##X  2HFx*@&F&`3i*0B@3O F;FB2FF !0F# _(0FBFF #-omBBF 0 QI KhXFEݼݴDѠ %u@ DB"R!(>X=I0 xIhQ8I8H#F"7KBF.&(^F,J  hE&>.(J)Ih2F'HSF iO  HhX5 BF  0E? ѣ Oc -Uh-um8DKF*FYFD*a= I;F QDB t&] N ~  !6xIHO1i9 iO1@#մ YFKF*F8DD bE@!jKhDH F!0D3BۚI i@S(F(FIF+FF+ E60h@7~"F]K0h@+F"!0h@"!0hJ80hG0h<003x(ʁq(Ɓ>(2d(0<(EI *  u(PE аڰo|`D(/;K[h;OE`jO F@SB+x+0K[h;D=EB0+?  [R#s"ri7x(c?a80Bi[??z(`(x(8 (8orD(?ɮS eSj'] Xd j' t&Td +?ɮR#S߉e1ڰ?(?ͮ?<(->( ("C0hBo `p3D7D pB8FBֿ1ؿ OаBc@00ozwF.?@W&e Nj(F8FiXh *i3D]`3@F>@FD@F?0ht&KiS 0YpGt&(KhBiS pG pGt&-OFFF*$PB*3F $ FD!>m PPO U$()Ky.FFh.=320[ Ը 7I .F=DF>>.=320[b8d-nT ѹRFIF8F8F~FBnb"D<"##[#C RF9F#;U8F O*¹KERFIFFt&!Xd ] FMh౨`AF0FADC4+hB F)Fdhh*F"##8Ft&F M(hAKiO3+`" FFFBFO0p#"#pN#FaF (` FR,hc I F 0b d/ t&!@u#BpF M+hZЀ N2jB 0r0iB,hD Fplhd/ t&Lh6"##t&KhNt&KhDt&wFUk F1F*F p@pGSK!F*lF @pG R]pGF F@FH”u@FHٿ”-C 0FFFX F8F ZIF*#"F!c+FeL-OFFF@AFA-F'&*)FF(FFxCB 5'D3DB%F''+x+DB,''?dtd  O !(VѸ*FO.ؿAFܿvv[Eȿ3FCF(;+Fi@IBF%F5F*v9F# F6!FPFCPF? FD>(F? F?0D FCFF !KFhC8@F F8?F F?"F F6 FF< sC`F F8F0F8~ F`?F0F?]!j't&L   𵅰F F FS{9F*"F!c+F L-C 0FFFX F8F IF*"F!c+FLSK!F*F @pGI8MhAFhA D8t& 7hFLJHt TjF!+IFF+H F)k x9FhFv #Hb(`.0F1FFF FF( УD9FXFN =*L9F FB ID FJF!F&T@F<  ȡ] @D<0Q# -O#M`F FnF(?0FF 5 "AF(F4(h #`9FhFfIFhFf@)FhFf !F+h+5B'iF +ڀY!#]" yF(@Ѐ lF(@ɀ    ^!F^ 0!F }(,`6nMF!F(h0(!F e(h!0(!F ZbKh+  ! N lB+h"$!(6F*hX TI2 W(j+h)A=(a (\ (?uU!) F(LBp"6B(&B5/F.FB>$(OpB>ӷBS(F)vS)"BE$4U"B2Yk)"BE$4p3U"B2U& 0(F)KE6V h0G(kՃnczRnhR1 [h 4W (&&|&”( FObF IOb Ob `I `Ob  (  ` I#F"F DDDD!FR a W禘 FObhFIObhFrObiF Ob I d ` `iF )  ]0P$ C FK ` F$ GF* Fɲ(;L#h$*!P*hѓ)ѹOp0*]h0CG0#h$h0G#h$ (>(9"H+(4!H&Fx XKMhF"F!F(hH(h60(hFiF #_"Z! rp! gH HG HD#0&&j'j'P$C "K ` c F~ F Fɲ((#Kh*!$AFiF 8S#`"!F FM#0&&-OFOE 3x3FxF3 **O0F pO [E ZDD6  B5OL`D %)c Fx* * .Kh#F+*21 P#F)ЊB " F$ B $B5@5H`\(x+aF1 + Kh#F10IԑFBcc*ѻi :F)FG(?{3P,hC) UhPziS)LXd 7hFL%hhFIF  h h##` 0IH `xI(FhFIF(F hh)1 J IF[ K&|ʘژpi KFh "FIF(Fp@ KF &"4&7hF#L|%hhF` IF(F hr h,##` 0IH4F `XhFFIF(F hXKh[fh)JIF[ Zh) IF H 4&v &09] sF5M F(h5!(hAv(h=:E i!F ?@2 _?2@j X!F ?@"1F!H4\@Z H?a 4E(h@r!"bC(hBF0IH x!4Gh(h7F F7Z(h>F F>" FFH FE Fpj'”R] ^-OF- F F1"1.0Ā1&O ŗO:FMI+h뱤I*FF*h*ѠIPFI*F+h+I*FKh\KhXCFp(@ *F!H1!(FfE0+?. p0,* OrB ` Fۙ4&$&b0#"2%K!" S#1 #IO3e I H Kh H )F5 F 0@q@9 ] 4& -OrFF(S+!` (HO0#0iOpG9I(xF6Kh(5J(5I0I(qF(O OW 8F(VF(= F;Ѹ:{Bػ(F(M#0(F9F(!F(6 Fh?F# FUѸV> Kh J( I40F&qNO6qH4&X?9P-OF'RK !F.@ZI"F w'-6)F !0FF0Ft5 FOAF(FI2FID3F@FI0FpB x%+@+*!:0+x'+5<*++/!PFF(@րPFFF@F,C XF8(@ȀT'0EPF(XF,I(F7.5x-D'P<2}I (F4(0#(0*0P#*0oŀrM.hd"0FG&(hE  !FKFFgHhC?@ -(F\N@(F(F@,3hBF !F >*3h/𾀝BѸPH>? >?@E$@@ƀ3hB@EH> >E?HCh;C`+򴀸<3hB(F= @0h50h?Oh3`IEP TC<%F(*U H F($8FWЬ.(/ OpG0ð@Fx0c.!F0H"C0"[HH"!F-M rF B:%@u"FS1F#u S5O3U,FFOz t O3+`& )F`+hX4 0F( 6]Kh `rX3C\縚4&֚] $Xd :v&,&U3H©~F(@9IV$(?5OrF3J#x Fm1J#w Fg!F:(\8# \8-@Ɓ@%J#y FM,!J#z FDIF(>/%fOC`?:v&VXd ̧ivx&|sXȀ(VK XJ\IF(@R\8VJ C\8("QH'NH !#pKJ ("HH'qEH !r#pAKx+\8C\8>J (":Hl'R0s7J ("1HZ'@.H !@#p0+\8C\8(H!0 %h\8C\8%$^,FE[z&{&vtԛכ :v&4 $y&&;u&IF *Kh0B\310[#F9JOq@F$a(hkh0(`8sk` FWF'+~DjD3l*F:\ )FsO #O$F@"020FFKh*@"`oO6>!F0F(x>Fq10F,1L#$p &j'\ 9 &”+K(hh0(@̀(? +?+h$!hR+hM!JCF48F,K"B`D B@ªOsM$#&F B5Kh+?hªOs$Kh/EK"!Fh#T }1(`0U (h""0"!FvHL/h 1Q$,"01(,48 1R8R# $)h1(1)\L $R ,10pF (LO,148 R $)? h\?EA !?O P O O  X!HFn+h@F$1hJ[CS!n/KhP*h-I2Q H $1hh+h$1hFXhKF ! L PO : YF O30(0+@_@(?-$h0G$G&X&(&&&4&f(( K@pGsXBXApG pGB-O L  O30##h*!*@𼁓)Q-@ЙJOa3 `8I `"T`Op(𤁐I b 6!H0#hJOa3BJHBFHK!\ B!F8F p"F}K h@ht8hCE'p"Yh#Xahgk Ct/rj*o:h8F3OcxBkG(Y;hO "8FoBkFOcG;h"8Fx bkOcGcm!@++;+Fx+𸀳t+#m@̀*ȀAI c F%/nB(tcn#5J!b3IP)I1Mcn#0J!TmC!-JLb#nC!)JBbm+$J%I+ F$I"lYI M Jm;"n*SCJ!IM IIMI&ḑ4P=CˤRY`t6;gڤ&(I'M(IE(I'M'I>m&J'K'M)FF%I1!/&%#mAF##e/9#m5-?24 FB"F(FF(?%#F)B" ''櫥 Ĥ-OM+h*aNHetIHEF.IF0FN7hG$+hI3F8Fv脹 1hH!F  FI(h)q/x0)F y|bꜩHFbI F|HF`OH4>FER8F% xM+x!(FSvI F_uI F[tI FW+x#nJ FqIP#pH#F"(@FjJBshJiI F7hHgHgH+xeHeHdI " F B zYFb(Fb8F%Op!FEF8F%.NI*F FF}Op  [ 0jhC j+km+k +m7hBa+hk x"#h#2OcxBFkG(CF# +~ km +X +\Q#xl&| 4&9Tp&ҧ.4:CJЦ"Х+{O 8KFLIPF()mHIFlGH@FJGM2FH0FCH 0F?HFBF F:H0F5F FF 2I1F0I$c%Kذ(F!IPF8O KF5k `Ob K FIKkh[ +RBIcC FIHO kpKFrO hKFl#j NJp̧ߥڥ^֥2Wt  d-OF|M,@g,&̂UFU+AF064,ѪJI"6v!60F$wF0O4 F MԂLH Hh`HK(lcc H,eTDO  ZIZFIZFKIZF;~Ka``~Ia~K ;84vKDKA#2##Fh h$)kh+Gkz+6 $8F ] A0,!$ X`(32h#F", `$)B@#3$!)hQ3B3 h0G4#BR$#jhBуj+kz $'R$jh0G4#B $(&U8; YFCz۹P4 @4`j[P3pB3BhF0G4Bؽ@$$&F$F'F%FshB F9F 3hjFS5IhhlG(FG50 cpG-CFFh F%F'OUxxOcG  #h bU1Fx FoOcG(I c 9@ "hKXBXApGbJF PT!ڂpG&0 `pG hhW8F M0i(DX0 10`a18&POFt peh/-!1-~ a0-`A %i41.nUuF`02140.55FeFC# `K0`# aKa𽠃&u0w}F F:OrFD ЉdETAD !LLAPAi#F IF(FAȹ0)2BdFK*"" F:L!:M&h9 1') D aD!DB @  #<1L P D T PaFH0FLLFHFFB8NFD8FHF`&;&8&\&`9&|& O3n( K! J H K KJ! HK ]\&b8&;&9&|&J#3!+ pG\ pG&J#3 + \FpG&J #;!pKD 1C 1pG&&0Q#0Xh K) !ؑ D !&KD 1C 1pG& v} r:OH%A=L"F Fb FL7Kh(#F6J!x | "|!1Hu/I < r#H"+K !(FU)K #2 #"1#)F (Fr!  }O)Fbz0FO32(Fr! x:J!JH"F T J&& Qh; ԫFH0iMxzX8F1FJȱ0FF@8F#J!xj| V1H|!"udOs K( i, F7 F@* &h; !F@< "iF O3]iF O3]hFh#hXh"## 8FLch/+ !h)(F z84l; JK( FF<&8&-O/IFЀ`,O-NȠO =Fİ(F>"FQF HFr(82h[F I %O (KO F FKI"FS%@XF(ѝ0Py+[D0a#0030 0&`&:& &-OF-FF$L$$!F0FF)"xF({$!0F@=FF,;3x+h1F(F`,0FDEE_6K@5J6H2   "a> V+сE Z  ; $!>F "XF a F V*KEҤ1F(F"F,D FZ#P)F`(F%$!XFF,p8F 7@N-AFFF!FF#XFAFn8F)F"F;FG(F# FA#й-pC F-$!&oHO ꘱D " Fa V+хB p$! FFHS+]pG]FHS+]pG}@n Op F'4/puF6IFFt@q }I~H}I~L F`& +;+=(x8 [@o ~rIoHlqI+) O3+DkO;x+jN3x+#x+hI `` `b,xdI b#F(F" c`I2F;F_Kh.!\L@m ZSB'wSA2F7O3eUH ( h+ CJ9F0F7۹JHQn塀GJHK)FGIF FF(F`@ =J8Kh2F!OpO3"3H' %+3N3x+?X2O;x+?S#x+?O"I ``T `b(K bI(F%I c2F;F u(1F*FI lI b f `F(F`&&ì&d&Hz&h; Rf&<&#l>M iFH!hF IjF  M]bM iFH!hFp IjF  M]osx%8% q+ #X H $ N` }0F%<IT  p K|+H"|+K`HK`HK`HK`HK`H K`&&&&\]&&& F!F cK@h&p#-P!}  V"3 ! #HZHعpCOVH"xRI"SHRRISH"N }pOr! LM !"F@A"@AaC"(ۄB?K@'!>J?H>I")i 88K"p O3l(?(@ )(I,H_|(*Kh+!n M%H@%N"$2`B\`t#!Cl 1@33O3JCF tm F F t!Q\&8&9&|& &@N&`&0&-OFdðFF0qF0IHh.h0FkF0FA#FDJ!`F!Fwl0F۹,;Jh3` *F!!F F"@0F"=$(hGF( FC+JSh3S`XF4kh+%I #ICF F0F0F"Jh3`I !F}I 0;Kh#I FjhKD !B !/Ji3a:&ҭ&ڭ”+ &P&8&7FCh F+ + HJ#)F F#40JI2+ FV̧`-Oװ@FHF$KhHLPJ%N)FD  Sh/+S!`M#Ģ nh/.V8F`h+@ր!i"hB@р  }L/@ـ1iI SHH 蹌HA0鰹 0BBІHH&8I 2IHhP3D 1+1%2+h+J  1+Dchh c9F(FI( 7=c``1kK!h;6?)h#a ODaI"h`K b ** PK3D !B !ci3ca5U*$`iAFBF.FOi61+0 h Fr` mp Fh PNF F'A "F1F(FXB yC ha`"/ ` h"I |d FIzd@ M%OcF)FF-HCF*FF;F0F MF F"-` M FIedAh D#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕPlp"b pO3 0pGo 0pGpLkP, ыk+#p+##,ыk+-N#" $#+Ѵ 2 #B+#V#1Bт灂 F3"+@p+P F !j +Ah#hhhkGb0#h hh[kGbjlhbbkZeke$* - pB) тB3 !B)!V!(F1")N!#!"Oq" @Kk+ ыk+#pG+ ##+ + г ++#3###jF F h *!ac#hchhkGb0#h hh[kGbjlhbbkZeke  :*K"ac@# 00pGhp!-OFh!:FF&Op hhBؠh!#h`hc`"KhOh1FlGch$#B$Сh ZEPEъl2  kѾJmE jBp"8Fc6p73,&-OFNk FO YE ܵ0+ۙBݪiRgԽiO  hb *Z.BZ  Y.AY 'IB&IB&IBг0+#KB$jh+ѫi"h;DhCE hhaihnG(!p ih;D"kQZ"Z KB0Fv(Ѣlm#ehJEREIBѪ3  "  !C " $ > h-OjFOFF;h 8`p#h_D;k.ջk3+єK6h#n\hniB8$FOpFlJFCFI@8F-*hKBiDs C#s1.chBҹkO hhlG(*hxKPBѪi 0ѡhYD k@CS  iK h#:F#:F HFQF FCF :F  OA v9a r2 hF[Dm +vsh+o(03Opx00 qp0 @BFx;Fh[DkOpBFx;F h#0hmFKho3BFYDkDdFkG8Fz)K B,ٝpI x)  ##Ii-<#a(F3 4  p iIBxL-#F  ' I #-K`&&*d&Tl-CFLFF0+@@O:O 0BOp*0B@0BOp0BOp0BG 0BH 0BI 0BJ 0B@0BOpx0B@j0B+hhhZjBE-030iSJ/1kkSh_JB_JB^JB@]Kh1ZKGh#0aj X\&0BhGIBGIBFIB HIB GK GIiCf/O/MS' M { } () Op"0 5I)@@l)Kh)Kh#t0 'Ii-.KhKh#^0hIBѫjpi @   I#F:F0F-IB#ѫlpim@`&" $ > &&!C   hIB ѫlpim@cIB ѫlm0 _Ii^IBѫln0[IB-ѫl[ns@i`@xTI2F#F(FRJ!Oph!JIF0 i-(F!Y *K0 AIi-|ll>Ii-tll;Ii-lll_8Ii-dll5Ii-\ll2Ii-Tll/Ii-LllZ,Ii-Dll)IiC0&JBѫl30hP!+FS+hhdBFiiG+h "hhjSFJB` , , }# ıͱԱ" !C -C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hYI#hai*Fhho3FGh"İh F0GO1#Op"3#' hh0G D𵋰Fl$"(F1# S"#FO1Kh#F)F+Zpl4'x'I F蠹#+v+m#+e 20 R, F FF///#" "+v!F!FTlmCeXd 0 F%Kl J !"O1 #Op3+F`l`dXf(F 0-C% F!!vF(nOp8N%` `@a a@#b b$-!+#Y#/+Q`7 5!Op #QF3"+@O$-D `K@!JH#"2 !JM 3"2#%"1#!F9AF(F F!  \A Q @Kk-C+F ыk+1Fi +++г +! F()O`FW !w5(aE ˅Op `@ a@ bOpK"!F0#M 2J3"2# "#1F(F F!DA# }  -O F h%`h+Fp&(B-h!O O  #3!0Fj#h!h !8Fjt-@P"F,#hhh0P"F,p#h8hx#hhFXhrF@@iBFg,!+FA B ZEL ! @ P CM"hCJF lC I"h !=JFHFb- >"h !8JFPFVD 3F@.F8F(8 F@F,O-̿FO ZFFD,3ؿ#3D r  -! "F ,2F0P!"U FJ. *kJ !g(H Ah"3k@PGHe&`&=xR-OF- FKh < $PF:(ցPFKlhg !8F LF(ǁ/F:ݔKFO`2 B A#KwE$݉KtEAF 0*h2p"pbD  2@Db \b $FOs 3Q$=O3:F<@u!C@eKCA#1#1F#.99[0F ^#"(h"#"h0G?F/(h"QF"hlGO8 6dFė#$" % G ;B2G # F9Fng  SS D@ D8S(D D()hS D< D D2@O@F U X-OFӰFFF?ӲGӲ_G":" :_ :O<:): `!" &O EJ$$#2F'(#@F DDG_#)F<0F FSF "F "*! 7[F6OK 8FK!D|$D<8Fw\ #F aORO3Oq~#-A F aklO@Zkeh9FBu9FOOzsCCBu#XCBuOS FA@MOCOC@Ci-AF FñhhmG+hihF@ *OD hB*?н*khp!h `+h1`i h wF (D1FF@q  E0#s K`ca3c# FA 61D: $c;a2 -Oϰ FF"!(Pph/! WET0+ + ##3WEO3 Rj FHKh O#F@ =P `eFžžŞ @T0+ + 4žŞ pWEO# 0*F|HYj#B%FWE80HFlG(?@F +`32 05HF0lGO2F hh 11  0"G(F #!###"#hFhkG"eOp "JF$t X @żŜO % #SS ?!F=T 6!FU .!F.L-A<SkI3F:F,8FP0FM(FJ@FG_K%h5 + s+FXK h#fYJ!-&+x+"RI*F#O1& "F#B )F(Bkx+@)x`)@ B#h0a9 FlG(062!F"###h F0GWk;CF"F3 DCv@F1FfEv jBAFVF2CCEFA8  JI\` a6J!_[Fz( I\N#F &&N' cI aKh#F F]It16XKG0h#F F&SI`QKVh#|F F8FMIR&7IK!hObFHZ=IFB"F!쀻 F7L7H2F)F h4I3F*F` h@90Na)H1Fh+I*FF[ 7!F F }QFB:B (F)FFFHFF(0=+BBJ!D|V F L0 h(IH,I hdZi4& Vi”F0 FQ#0h0T#0NOraO8h0 I2F8h.2F I H!F(F0 @9Na)4&K^v3KpF F2#K#dFhFF,ж0@;U#0(Ѷ0OrU#0 a Op(Ѷ0 OrU#0apP K"` z&-A°'F F"9F>8Fl#OO8iF h+ ѵ0OrT#0 aB5+I J9FH3JI (JIHAI 3x#I2F !@M}0@;T#0\&[&&е2Op"8F F0J T#0ha8&R!0pFihiF0F#FIF(Fp@S8F F CXI 0T#0 Ora 8Or_8 F0F Q#1 0I T#0i00OrT#0a 8n @@@Ii_-COr-F!X,lmL%lO&F--9\iK8hhsbM(qeJ9F ;h(4c(n`J  PU,HFZIJFF(F< 4(F((F` @=%dh02(Y@9#a5-6KJ ,KIPJH@L&GFch+K+Dh65HKE<4(>K`@5!<( F(?~a4|2J9FF 'F-J +F OsOs(Ѿ#K$Lh:V"F h=| h* h:J#@K2JF&!JF"!o2F'9FF FC ػ&&ȶ[&\&&&j'j'=R R 4&-AF1HFK0I.NF(94h<@F=+IF FZ%H5F&H(4 K#J H$0h8*FI>0h"I(FF(F@ /F HHPI*F F F6JF VV|4&f*Vi!!npG pG-O%,F FB ``.=-;1 DBt  C Ey Ew # C Ey t7BBt h.6`g Gg@@51Kh"0pG&-OFF Ey #MF FTFF*#gs#"#.w2F;F F)FCsG2E;F F2F)FveBu4F=F2IO Bu EHF 0FObsE5BA   E  K<K<3BE.FwsG2E;F F2F)FeBu4F=F\М *X *TS OC BBFBzAیBu2Bu 8Bs TJ.wsG2E;F F2F)FeBu=F4FBul4E eEBr   a0%##"#U#( (F)F 0rpGFBh IK F@N8p FF/!(F$FH(F2FFй5Djx`*ٴa:BaBp034O0"H0Z * F("HF" 0FM+h'(`r#BA#-hhB##" F  gh B 4#+a\)3B 0 &#`FFFBܔK#`ppB,+$Opx ` !tb!PBBt %`E%1h;` 532H8OrPF!0r #P`08-A$N'MV;! F, F)`F"*/`FFѽB&Kh H&X&-CFF FE0F*$+F"Fpp'B2B43Eܸ@a4 ؼkh J   Fih JkhJJ甸F0K@QJH@h F@ؽaC8FMh WB# 2Bز8 J#3"+ K"h KhB (4Bx2F&&&-CFFF0'J0'I F@ DM7hQ7I+:+ #;0a+I(F[#0#0#00 ++ ї(F0#KCI0(F7;B̿II<CTnXd Ĺɹ|ܹ'8jzC[@B8FM+h'(`# IBs IBsڣh@"Ob#r#8"&@8-OOfq-FF$M PT\F%Oc)Ft (CF F $M_I0( F0FO1QEFu RF F\Fy!`  X4%F'F+O+  e``` Fo0CE&0F?IP (sд *)#XPBB+[37B܏0;h+` #0h3`5  +,1+01#1#0F# Fx"HFJ 0HFBFs C( 2Brڄ[b2 F:edA-OFVF Ofq gF({OX"t 3+ #O0!FF 3+#O0!FPFcf#fSCfK#`VcaV`` F IH"bYx#0 F9sh3`#0CFmFFF+Kg!JH`mKh!JnKi!JCnKj!JnKk! J}CJh`haOȿO| <DTnh-OF Fh"F Ki i S ###X@O9 7Y GYEw"- -r#UC0mG(F9F6g W g]bR B FFA2 WKErFFFF@ GKErڳ b 0&z0O FCE ;JhBcӺ@{OX  h ٸI>*) O1[ jpj D"kx[@ pD(0h3`2Br[b2HF*ѱZF B#1#F&-OFFD0F#Kh O phlG(pFk0hK-lFĕ#0h0hho#G$bBBOq1 phjFlG(𵑰%F F.F hB-5џ#hh #hFXh*F!F@ FF(F#h1F FlG h* 5* ڛA####6-#h*?0#iF FGp#hh#hFXh*F!FOp#h09F FG%𵋰%F F0FF8F K"O1g#S 3BFHc](F 𽜳d-CD" FF! ! #@-F(}TLFŔ 4@Ŕ@F0lGHKPhTxO3FFC     h[kF FG7Kh Th#Bs *F#F#"0 G(J # 1F###Os""K"K6#2O3"#AF0F< # F.0F10[ h0G0 !8Fh;3O0## E &&l gk  Fk#K hh0G@@0  Fǰ(0 h8hkGF@iYh"&'#h"O1h3#h]0s#hhlG0Fa G-GF FD"! #!00h[j HFF(?:IP"0P7HYj"F#B55Mĕ 0E0QF@FlG Os"(K1F&K6#2#JF#AF 0FS `32 F?0FBp0s hB h@ G /q(8F O0h[ [ E u |E l gk -OF-FhF0G#h FlGWKhTx/xO7FFF@!hkVF[ Fx F2"0 G(FwP C C ## ###hi[k* "!"G#h"0 FGCFR#h FlGF(J#hi*G F#G? ##(#hkG#h" F0G0)  #hE0 0# 8   # Fx#" VG(%(FO &K-OFh#(1+@ +h3K@AJHi.فJh\(FOJ#O~OxO FqJ>F"(O2)CF@I $h 8+hd @ O Xh 0hFph&J#! @FdO@B#!HFd~ȡ 1FOp  2s )rH0$1hh0$1hXhzPO #C +h " $ & ( * 0+I"YHOq`!Y`@aUHYaUHh(Y22RI b@b#@u3133o O3GF CKb0F0FQ+++@&7F,(FG(##z05K" O4 F-+h9F(FlGp2C !#h;+67hB~@U 8Kh)HJ(FF @~+h0+!(FG\B\A&kD,&x&n o 08RAl Il &Ql ل;l 4&+?!(FUhO#hh0Kh@!Cb@!$ 0F&+OE&O$!(F((?(zaR hR4 Ch(FQ$4 YhB0Fprd 24Bb$$"&-O+հFOs K!O2h FF@! FF@@F;O HFU! F (@8F*K hS"+ 0BY+Nі(1+fO Pf,AR#d `E"qYO ".JKCS!B FdFOpRFIO FG W @,>*5H@~J` C 0+0G( 3 rK hB-#O%FO6O @BiG O ,UFO6 S6FOpL(1D!O !SIHF ! Fd@od0!FXFFHF 0F #D 3D FFYFFXXFO ! IFFXHF 1F  X0F, F B*K@Q*J*H F#"AF23*F33#O3AFBQ R#FEѺ F8F@F s?0FTF[ & &Yl D,-CMF FtH!/# 0oIOb F ixfx[bgJOaF F!'/! F|x@B"8BFx8/* F"Zp$(ڼh(FvOb1F FoӼ?#&F0FFpC O(?Ѽ>#`*@20F(*0/+ *OaBFF F(*Ob FPO0F(*Ob1F@oOa Fo2(#x/+0 fx&v  FF*3;DDoFIOb Fo*Ob Fo}(F( ڼph(Fj`/(F F M̧Op!H F@(  O F! "iF| ( F .?@ B-OFFFxF(?иO&(Fy.0(Fw,8FC+ I" FF(#FRFYFD0H7[3FIHFKO7dԻ-GJmH/"F@怜H(jH(e(@߀HObF(:(F($I( _(@(F(чI(ObF `I( bIF I(ObF `{I( bvIF qI(tIF F(@qI(nIF(FF(@kHObF `bI(|_I bF(FF(@THObF `SI(c!F `VIF(XPIF(FF(oPHuObTTF `GI(<FX; `JFOa cN `0 b;FQF S5 -$!@+0F Jm(($0I( ObF `P `FX(I(I b$F(F#HObF(4I( `DHI(F F$J cI(?NVbq#,6BE  `pG# `pG# `pG# `pG# `pG0ii,!F@BdDKh#J!(FK,h6 7 f!P"FFH F 0&N&&-O@F# 2 C bh[0C#kHգk31 %k[0 o S @Kh#KJFJ!.# +@2O3 Khy %[8hkh0G8# %Op O3c{hBپh fk3 ! 0BO1c50@F lG 0#BE1cmѹ ! [BxIiI FKF#!qJ# S #! hI IFm KF# # eK P "O10 ##.+ "PFXnXKFFx+ >@@%+@e(qң%CBCA #;08hhlGFF2YC^Cf3I2.D FKFBFPF1Ff#kD##c;0۱P [ chBAO Op E@΀#kC#cUEFNFPШBqFF#k [ chP!cC# mBfF 8FKPf`LO3 F2h)z#;&f&Xd DK ;PFhAKh,!<1uFFPFj(R#*s ##R @+>1I@FV(8F E,IOp94Op E يk2S Jh0BE b C J`2J k4D#;0.B-v 00 (h 3  k"c$&&`̧-CFFjShBgp&h~C#0!k(q ےYdhjJAhnhJ!hR\h[mM,?_JdD &!4h4Dj+H@gWJ(!F P$h2DkY񓀓kZ=# # JI&(F)# AJ &!7K@F!Fh#9J#k 5J(!"~j$m@x+JCF  УnOp\hk&J#F`kh[o+h3Dh3Dm\@PJ(!CF Fh@$B!FkkJИG(+#q@#o&mtfy) Feh#p&FFB9(E+O+ F, P!%J#F "Hc* !HY- JF!hJF. KJ!H)hkԉk1#2 ++ P"F  , R&E&Bh!-A2Fjj5 ;NO FB=9HO@P"Z5"a3Ja@b2Jb1"c1Jc#hg2g hhCE$#OpE0 Fgj(ۡji j /k2p50L"BlhjFAFlGHFGkX IhgFF3ъ E M -OF4FFFO p' E6ѹlp'q(a0IF:F30 Fi1 x#"6kih hb####ice+je8@ii D hjB6* Ѩi@x1Hk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  fK-Oh FF8F$ (th! XF#F(ZI #[E$5FOsO H0t@uO5"AF@GKA#2ZF##k@FnKEiqhj1 EF(`qhOp b  h04(Psh` DAFzrh!F  pPZFIF FH & # #ccFf8Ff3hcc0F[ 0sh3s`,O03PY8FF8FB &) -CF FOp 0@W"O1+OkD/ #3m0 /+ "/#0eh'B?ij F(ahp'hq(bhP`!bsa:FE O5F"hFBcc"b "" VZch F3c`(Fh 0Op;!Fm(Fk|7&P-OFF#FFC &`   2Br ڵ iiI BB{ [b B p!```0KhOIO(rq'#Op B qj(Hm3oO3##K'!hO3E򐀳j+@,O WFh3hRE&l0FGp#E٢hZDk3tM1|(u0A 1mI#+:*@'3+#h Y˱E@p XC;k2:XYh2:PAY`!2A!-y'W 0ByE@PB<[a L#G Pp#SCFhC(DPP`p#hO3BDjVccPQmA3hmkGhhCDb!hhjCDBZm**kB cj+HhXhAPQCQ`hah , *B;F7#* IFȱIFH S)r T R"T "X *,&@E&&Ģ`7jhBh 9FlG(h+++# 9Fj#Fa'l QF0FGh+ 2Br  [ BB{ #FQF0F9  e#E-yV2f#F"803W 0 3BU @G 0 2VfEW 0 E@p!ACxyX@hYB FOfE@.:E7 !(q1p#hKD S 0 _C8h8FAFDhBzF}HjC p Z`chB8;B7APQ#GFPC2 DBBq򡀫Brڧh W G BfF X 0yhzD A Ez 8k8RL Ez 1bhBhB@p a +FBDH0Q`q )s!#HS`;kH #;ckCc##ByG 0 G PEp pBBлk3 2S9kfF0p7F F_PB4 a D#Tp"H TC"FDDFhCDH``H -O%-FLhF(Fp& #B#-u(Dp!_F(npFO p70E"ӤDPԧK$\CBTХK@]QJH03nJk՛k35Sh0pBp" FDnc#k)գk3&ѧpO p4 p" F,n.lhS8IhhlG0##W<[hEp4  p7`0! @wKh;Ol&hlG BBO3 H$F0BpBG5p'e[e+X u T B2E # F)FZeJ 2+r JBrv[H0br` %Op 0By (`+ sO3 3.@ O 0E1 'Opp#sCk?0F6 XkJ[:FL(XFhlG0DkX2jFF-z ;B2]J #(FQFj -H ,F607?H0m۶Gܽ,& pGD;kYkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504L3h0FlG FFA#0BJp"0k3t+kqjhY+rj 1h b0F2"0G(R##ihY#BqF F#3hjkGa"km!Fam#bmcb+nbknb3h0`a0FGCF#3hF"F0FlG+kcC +c#WG3J2GSFBF(F9F g 043t2[ BB sp#p k3@#k@𬀞@񭀣n+lZhEhS8Ihhl"G(S8 hh"G( h   bhX b2"0G(9,FĖ##)F"h0GFHH*FhlG#d D ;B2D #0F!FJ d ' hRB   o" dhDXB2"0G(  05bhX+r h     b2"0G(9##ahX#BqF F#0jhkGacmam*bmjb"nbbnbha+?^j+?Z#mC"e"~*?RC#eMo h    [B3 fhDXC#"0G(xk3r#knщXbh)rh  +dhhBO5l)F.G5.BB0BB0ih'kjGacmam3bmsb#nbcnbpah0+u"1FGBF2F)FhlG0cccm[j+#mC"e"~C#e706B~#p O4BP$Op 0BP p$p2 [b2VF#CElp!0F'Fp#F O1F BkO Op Ej' GE$p'0Be;P1FFG "3c0.!FXFlG(2!`.| Bk5Q)Qhq EwEicd4z300B@XQhCВk263cp3C(  kCKkB k  +hB Pp"  vk3h.9FlG0 72d0##3hb.##5ce6e7p4XFEcXJhC Ћk3Pp"x4JpF$M(h%(h5j+`h!0FbO6 Fb%KOqUKF#1 #c#FHP0jRBbڠj(Fb p#!F00$jj0 Vj') 5 &-OFM-(h)1$a#.@X .@S(!3F1FF( 5(h#0Q##"#GF(+h$A+h"0FT#GF4F&FhB8)h@1<1@1V2HChR# V#V#(@5,O NO  ! bzJ#!b!vJ#8Fb#h*hhO& O% 2 #hFXh ! [FPFL+h #hh#hFXhZF! SF' EYH#hh#hXh" ##P" # #0IKO #$"`GJ!GHY`"aEJhYa"b(CJYb ٠j0"c?JYc # 3@u3@73o O3CF 0Kb0F0Fe.?+k+hTjV##0h0G.@vW!h@#EE@0 FG:F3F !F:F3F F)a4h&&p408R9 G &O W ? ل#h 1F FlGP$%#h+  6 L&.:.h!F #h F`lG"  FG( ####&#!'#FB=&BYO1F;#h F0GO0>1:F3F FGmh+?jfK@aeJfHr# g!F#2F;F, 2F;FY !FqFp3l!#bFfFE@#EF(h "({э 7j+QFF6p4 lkC dhlG(p# ^CC "hk@KFG"3Dld!jp6,3j,,Tm,(vۏBvh?ThF By 3p2p$ \ChDl8Gh C"hk`#G"#DmBe|!@F0"0#0$ 0(?k #"3nTḨܽn_W 7FF&+l$jFinhlGH2F[B285B&` h #*s|+ pG pG-OFhF-FhFh (IF F@? i{m%IF#n+#J!iOp@A ifcnFn+J!|i@B n+J!pi@C #o+ J!diOp@E i:coF @JVZdTFOpFF"FhFj.3&4@LD)O`T# 40Vp8#*hsC"D lٱD3IDP *hIF BD(@Ё@"YF8F)h@"8FAD68.+h#Dj+ ݌J1FB@"+h#Dj+ ݅J!B@"+h#Dk+ ~J!B@"x+hB #DwI3F(@FOaYOx+h#DCCDXBh)r@"!C<!XeJ+ n#y#t@"B@+hCl!#DCDX\J+ n#y#^@"B*+hC8!CD#DXRK*[FQJJ@"B+hC|!#DCDXJJ+ n#y#4@"B)h("D\RAJ!"B@")h \R9J!B@"+hx"3C`#DX+ 0J!B@"Ox+h#DCdCDX+%J!@"B+hChCD#DX+ J!B@"+hx"3Cp#DX+5J!)&&o¾ؾ߾TB@"^Ox+h#DCtCDX+:J!|@"BH+hCxCD#DX+ 2J!hB@"4+hx"!#D3`S3##&JR@"B+h"IB#D 3UD6 x .+h"#D_Q1Z`Fl&082B`R/C23&x2(qBxlB K/D4B }$+5 -CǰF FNF@b@ #FJ!IKF"F(F#G "!!{ JCS!OH"`I"FHV<#YC-GFSF}dkWX;+π#L1s@I"Fi F}G𞻔|1Op@3hx-чIT\3h9F0FlGx1{S'0cxSOpOF  F yJ!F`###F0#"9F20F"2#G(@phI""1F dI"""R"ik#h+? xXI&`@FhBd0i;jS"9F&"QF,7EbjHI0F$@ !j# ##FFi0F F}@ i2F  F#h+Тh/I&{iv@  2F(F1 @ D###h+#lki@& }IF F F}Gk!Jckh#lFal$hlG#H## bsRp|v~”FO#h+?t5J!N`Y̠D W<["9FO놨"QF 87E`Q/L#1 Fx1GEѸ!0F!a!J! @. iBF +#*sJ!"!Fx"Ob##@##gUd!@ FIڹJrF!##`# 3O3#cUnd!@ FI𼹭pF5Mʰ F+hX @u! "!)"0B(`0+J :@F(h!F Jp4#"CO1#O pj(@5$J! d#"O1 F 3# ( (`j,@6$#k0@7$##`O0E TpAMO3 F FkjX @u! "!("0hb0 +^!BHNTZ.K"hj!FZ` p)K" +cb@ ! #i@$J! #"O1 F 3# <( 8(`ciOti@$i@$#j @$##`O0E &T-OF$K%FhF (  +F J!XF#"O1@F+F-0HF5##3F:F&(q YC0D1&f&00Ű +&(06Cpdjv|1#"@F O1#?K1h#,!<@G O0 k[ c E0Kk[ Kc81#"Op#O1mX@I%'J!#"O1(F3#Z(T `m\@J% n`@K%Kn[ KfnhOunl@M% o[ȿ# gKo[ Kg &T00 FŰ +K/7MUa #"SO1#OpG#{/+ ")FPJ!(F(F48 D{/+#s E01[ 11+AJt@! h,!<O01[ 11+ 1[ 1 1+1+$1u@"$(J!:#"O1 F3#((` 1+1+(1u@#$ 1+1+,1uO t 1+?~1+y01u@%$# `nA&T-OmNFF(FkIFTO [ |EF ` $?Qh{@ himB 4F*FTI8F" Ophi1mBFC '1cIJDhGJ!(Fh@ idBf"FF@ hi\1mBF+ S3F1[ 1s G2J!F(Fbh@ idB 1K13$1!'J(FLhOpidB 1K13(1!J(F:h@ idB 1K13,1!J(F&h@ idB 1K1301! J(Fh@ idB&&N”TH-O#-F Fװ!J03`OO >h>H1FSKhs̲̒03D[hkK/F6B8h(𰀐}1a3;hB@>`0F$P|h0G$}1 }aC #0x"3D2CQX)RCPQXBh)rI D!3JO;h+BѸ7  #0 Dy1S %1@,"U (1O81""0;h[0Op;`[OrAFV x 3+fO1"(у}!1F1B11Y,O-L>hO<<i.@3:F!Q2B?Khs0)F F3`v7N  ά3h)F F0g,KhӱOr##6,K 0TF#ά3h)F F0I#Khs0)F F3`7P@0B P3I`OqB PK`Kh+3W&(&& &LH&& &X&q 8HtHPi*O3 `+P`)1;#ca3<$q?hO #Fc$@hSE%lQFGջ ##$GF  +_+ݻ'"i3i$1) 6`#Ec09FXFlG(7 0Bؗ+i_+i+ `"/PcO02h-GxFtFF$O3`)hB@ F#"nhF\iXB32DBCFRF!`0B8a.<` 4w(&-CFDh,FiF&F'FPhjFTlGh#Bs ,FFX04,Elkj+ܫJIh+#+`(h FF;+<c3 c g \&.]K-O}h# }M$(h D(+h!J#DhIfFx)IH0KhI* I O X*h|I0F"DSi#NxI0FJ,#)h !DP0+3ИX.F0 YDSPTJhOFoF#G*h'"DDZDmho#ImGZIF0F  0VI0FO ,#)h !DP0+6ИX0+2F0 QDS^PTKhOO FoF#G*h'"DDRDmho#ImG3IF0F  0*h0F/I"DSjj#+I0F*I 0F +h%I#D hCT+h!I#DhF 8+h I#Dh0X+h I#Dh(+h"#DZ`dO&x&|ο] 4&ܹȡ:Rh}ChF{+D#*s##` hJ0I h+ &~K-Oݰh+ˀ$O6%FF D(tKh/@s-𫀻x$1hB4Y&FHF:0dJ! 0 DDKFp_K 'D_J) FFSN1+^ "Dh)zUI shIFlG F  F$hKEqXК0+QF S DI*F1h!D l+$(hOoIlF#G1h!D l$h"  o#IlG3h'I #DhED3h#Dl!2!MF((h(?mIh F0(h(?cI"F]кQFHF(hB# 0O(&4&='&&^&$1pF FF phBx1x1S%0FxAD%8 !x(PJ C $1I 0# K #3K K ]  @&} M h J+ IO2 K JKj]@& } M 00X>J`k;+إhݱ1{"2Kh+6=I "Fx:Ny1h0;Jh hB41'D"$#h7'7P#o8G3h,J+DP! 3uqoѽ$Kh"#I`"K"zh0:A^hFhBa"#`mX`2,3BP!Jkj""0cBчO0&&.&<&&.]x&;-AF$AF,)h' I"F 8(8ou.]F-OOR-FN!PL] ` l+ЊOI\;h+@OL;hCOq m8`O4;h+@({O0+@xK"O O`O1XaO|a `mK  1Ox a`fK`H X`1acIXa`;hJw 3Ha`PYI`S03ap0"`d a*FF'd@sEK1FR"DKDKK#2#OpAF1`h+O0 ]Oa (@8`=H! (L8`IJq 8`(KG`! 2F a0F0Fh+Kh$1+Kh+Г|!jOpK (!FT1E &&&&&\& &@&&|& - &(&x&<&&&FKh3"FI@P ¼&F p$a3F2F1F\F(fR##"# G(K$hR@BrR &k+K@mQJH\hH-GF F%@V)@U*Eܽi+XKE ѣk+ѣhh{#{5SEѣk+ѣh|1 F$1{CpFPM    Fȱk$Q!1D$hikO2 FF\J#|1`p((FK(Fh)FhF"iF FXhiF6hF*FhF(&-AF-PR$(*,.0F8O60F2($A#h F0G#hi" F"#GF@#h F0G$a4F#h FlGP     FFVXK "hCD8"G(P"!hgc F 3"c0G(# F # ##"#h0GBF#h F'>FO8lG!21n!F$8$"(F$hB/WFFE.K@Q-J.H #hk+G#h 1F FlG`BѸ?F76#h 9F FlGB BBѶ?>F7hBs!1O2F(F/ J#|1`'O6HH&-G}FFFFJFcdF(dI2F c(bI@F&F(F(D]I*F@Fv0Ѷ4h+XHIFO0 }kk6j`j`+k#akkca#@0#bB0cbklbO/{FI:F@FD0t@I*F@F>0:@IJF c>IMQF8"F F`"F:I0FFr8I0FF 6I0FF4I0FF2I0FFh"F0I0FB,?F.I00FF"!8F0HF0' 0B tBOЪ# (5D*#*#0 "F" a#( x,d@edA,zd@-,,-,,,,--Am%OcFF)FF CF*FF@FF FM0:`12(F mFO`pG-OFFE ,# uT:E; C "FPF+FYF k E{RF[F"F+FkBs7\bEsbFFx!Oii@1l a!ZEs B +k#1kEA@ F a9Ex#71 H C,ubF8E9C "F@F+FIF>i EyBFKF"F+F J EEIBADrEs 6Bs:EAZA,u8E9C "F@F+FIFi EyBFKF"F+FZEsi2Cj EzFFؐe0%##"#U#( (F)F 0k#pGB30pGD0+D0pG0%k#F (B05#lB C##d@,hEjB %jjCX@Bl"d 0 pG& L<'B3##`36hh(h%&pF0K@aJHk=`h Fp@0[`ha`(F5FH(FBh I F@ZpFk%O5(FpD1Fn( 1Fh(@5CFVK@JHiF} H! #F(K`8FX0+V #8#c3#dff# c`VD0`` FLH(H8 FkF# B@3hXjB jBCXD`"x 8-OF1LFFcB[[#ۨI 00FO9)k#FDD0+<Ѫk*3МI kh I X ] "0 hHh( C23?(CF 0#D0lkNlc ,k,k|O,@ (FKFxkh1F #p FEF# 9B%3@B1*F1 hh*F)-*#p(@B l   %*FFhXjB jBCXF"hF1FhFiFD1*F FX -AFh&F3F20h+CATk ukBuF6  EkkEkBLkt ڸ @"  EkkEkBTkt +`` FFFFĕeF#0 0F ##"###H%@(`O0hkB-@{ # BsO#F -K+` F00*F!FC0 B(;i h3`2[b 20C03k+УB " 0 -AFkFF#F\B +i!@3Aȹ2 BBC! F$Kh;` B0#0"!F04:F#AF0#(0C02[b!a F!)FA+BBL0,&pFhV#kFB ОB % K` p(F3P-0й#c04#)Ft(h;`2[B 20(FSFh  " FF(-OFd]RF ЋK@JHPKh#KOqJ P IfF(@ɀKhx J (@H! F(|IP 4vI P(UFFF&`` oIX +CjI(K C  <0k@08Px+Ц,3F F  "!Q6FCF@W,6..Н`0#OI"" "!QF "!Q (CIl@ k=I^8 C  v +?s5I "4鸱! F + sWHF d] kD0`"1FcPcE0 [[  (EP#C0@ 03 0&@K(&&Y$YYK5$ 0, !X0  0 0$050#D0Oc:0pFϹ=I(Fw`#\C FF0F (FHFe;hZk(F #xF`2pb2;hk+@0I(F(4FFCE0Ak(2kBBk*2kBB !F0Bc"4$|dKh Kh8 &&{ {S{{zzSzzӈhJ\ ][-CFhF F ڈ z Zz ۉ0sxs+sxl+O&F"iF8Fp#*F FTCjF)F FD'F"iF@Frh#*F F8B7/67.(L-G 2 FFxPE #`,0.0〝00#r10cr20 00 7"I*F 6 5  3 1  . e ( ѝ0 00**+8ONF9FH0#c˅  O0[(LpFpL&"F@!hF6hF4G. p(L-OF8 zFF By&O P-X(ХMBMADqD BGлB?8DB> M EBF2FBtO  s0;PI RFF+ +*!ER@BN+J+4  B*Z BTٻѓF"Oq F(IFO H++%Ѕ+23# DC# D<2D2## Fp@"!O0U#1oU1 ,MO F-ACF=K@1F82B #111111111+h1F8^aq4Bѫi+J`BF2+2224+h43B(2+ѐ!-O,mFO !!FOc  O4 F ,mmI (0s@"!R Or!F 2K13^K@!^J^H u"h[&pkppqkqq25*ѶJU#O[OJ(&2Y 2FHFMn(B,HFT6+P6+XFP&SCFFF@3E(FO(?hp1?ApXD8FF@3E(FO(?1hq?Aq0FF@FYF2F#)FHF 2F MFBBp Or(D02F)FHFMF(FOrBVE?wO4wd@wPFR5K@ AJHN)FFFjCK@AJ Bq#`4+F@ @0/PC-AWN G$EO6FEt qi ` B xc p D6E 4Jh` /&,&-OFFFFFΙ Ė4KB"2 #qFA\aEz3()8B,S2*K;`'8FD3B"+*" vFF4]\ ,FEF03+) БB /@j8`Fb t 2FC F#IFiBs4F# CpCEU3&1A\I )ИE36.BF Bu1*+O8AO   ơ2 )iB8F F HEo/?W2KS&!{#F2ƑD1  NE~ Ѐ C EyĀ2*  и#\) * 3+ K@Ta J H1B| /?Op$&JP (B y93ZFq;F!D `F(?Ю2ĂH  @EHFvD"06D&0B1E!Kp"!(F2EO32A"\. (2*K@laJt+DADAEOAڨ/?f@a P-O FFFFĕ{iJѫB O0!SB<ХJ$4 O4 K@JHD2B#O5FF s\-F2* 4%+$+,Ѹ@K0()SD41 ! +oc^Esp C BAahh C B s ڸ?q@8BT F2 Q!D#RCB вBA By#Oq F(_Ѹ?BPKh!  CBpՁ!FBQ-=v"CF1F]@B0(FYF8ZDPF< tw#y{B?0*+"*@p4Bi @ |JU"!"!"+;#(FF"CCF By8cC v 1F2CF]@B(FB&P,&UB (FIFi By F2"D A1@B ue1vCF1F7]@Bv(F\2B2E sOq 8FJU#1#1F22r-ٸ?)Osn-ٸ? @e1"BqF"2 D(&KEv$+v,# 4ZFF F1F.f\Ev\F&F#9DF@ BOq ڿcCs 44"qCFl <@B F< *K p"!A#\a BrPFD3+PF 1qB?zQ0q#U  - ЎB?i03+1 y"i 1Bp '?Q@ -AFFxFkN(H4 )F0F%(+,O0:FP!P# Fz^CF+"KO2h#RZEs FF"FQFXF0*F,kCEE@30BFFF@13h0F`!"d!*Fp#FGP@T&-GFKFFFO<hRL5E8AOr`FFo-?, Cb#@2?$%BFF;`3hP@@ 8?l]  L#h3 `KhBM(#hXBXA,F 7'0%lF!FF 0#iF336(O0 ]-OF-3LN˰ ! F*##!8FJ0!2@ aia hB>j #BEs җ&MFM+h[3 ќI  +hCK+`(ВI M:Kh+J )!VEJ;+{I@FIF_:z A FYF( `JA1 q(D! {:#sd+d#F(yKhtK*"-:Dh * qKqI (DqSmJ[ lJDkH#BFIFFB|+@#!q aJ0 X1Dhbh8t#as:@ _@KA0 (q8 b۵ _A0 Q0 f$ z/CSO"q,I 2 8Jd!q X)KD(qjJw; +{۵@Eq L%JO ~! % 3BR _+#d F4FFY@.A7'7'7'7'7'i6 C?7' 7'm7'Q?Pmnn%n.z 5J9F(FD+ q0JD/K "FhC*N&a_A FYF_#KA0 ! p {jB?rOaa0FFJ9F(FOaa0Fx Fh 8`-GFF3,7#` AB#+p0F,FFO: E#(F#pERF! F;j4|FOF%P1FF;۱-+:+ +Bx9h03 10210Ա%#`(Fx+4"!b 5Xd p F!FCF !F*FF0F2Bѱ7#`O4 FppF F@aFCF)F2FF F,F Fp FiFC# #&-CFFO4h,:=h ! F*FFF*F Fx"F=`xF2 + ++ +#+;+#F!x\*33 "*с#*)p FFMHiFfC0 M]xCFFFRlF !F 2Cѣh+"1F FB,-%(Fp8F$`(F0Ѱh8O08 F-AF FFI" FCF j"! FP/OcpLK/FеLK%F"F2h!J+F$0F L5L%F#FKJK00B?rnznBjn|}FpFCBCAGF F ~ F&0 F pO4 1F0h2ù! F0ж 1 p 4"-" Fh"F j08F1h2[Z`bh`eiUi F8@𭾡h"+h jhZ`jh`hh(F+h jhZ`jh`hh(F-AmF FFO#xK4=-Ѹ.&I&H *F! F,X# I`!H; mݰ7#I`H,CFK *F",#h3`BF9Fd0 Hh+аh#+8FgFQnnnm@2FiFhCF H FHO0 m( FiFy Q@#BpFF F1H1IJհHeih1hIE#!R""H^0ѰXh +аTh9+IH Fp2Z`jh`#+`#jk``ci%bsh"Kh0 IHm Գ Fp@վa Fu0nR%Rn; npF$ FFuF#FaB?aFB?`2bC``p+pFF FF&I'H5 Fj#^AF3"!>B1@! F60)"! F0C"@! F(0F!F(F"hK0I HpHH F:Rn; n F" F"sOsFF FB*F"K0IHOs)F2F FCF" K0IHp= JRn= 8FMO5O3p1'0%J(F8FO31 1 CF FFCF   Fl0 FnO4 F)-GFm FF$ݰ7#`O0 mX&PFB o QF6LFB"FiF$&FFFF:#`O0i\! FhhBFhB#h+2ñZ`bh`h`h1F(,Ѡh Fh+,*bB2F9Fh*ihca##`i&a2c``aKh; FH!@vXRL1pFSo@ES0+(#P1T1So@EU0+%#X1d1So@EY0+"#h1RulR->p+DP#L1;L1+DP#T1;T1+DP#yd1;d1(F,52;2b.bb(F,5p2;p2pb.lNlb7F# FFFOF(:H1F! FD12N33@S,B@C,BS,B2C, FBS,BBC,)FBS,BC,S#N#0@_0) FFIHq"(0аp#`H!@)" K0IH@oRneB n) FF$I$Hq"v(0а,#`Hj!@G1+ڰ7#||(#"1 KO0IH@9RneD nCoOrF!Qo0H"H RohF81!IHP03 F F033S< lKI FJ@+F)-o#o%op!FbI\#jF[FH"p1+5o033FS< F@ B(FCF!@t13t1c+H!d"K!#=oD )7F F2I2H`#|DtC*Hm%!)F0@D(1D1B0|18\ "T_`HMQ-I n; f+X1 "K70I H0@!mZe "pRn0] \ eB n8!F HCFѽ8@ I H)F0H)F F8@+aFz<Sop FFFQ kH0I F3 Br K F-)FF"#FFz##b03 "r 81@?!p@pcozo[oF<1FCS<1x1[hh#j11Q0C=CEUH PA\A ! Fhh#j Fdh-CFPqj44T<D#SD<T2X#C#D2qCCD0+3D&0 HF(F5FIF(F/AF@T FAؾ Hgppp#op>Sp%opFQ ;Fxbjl" F@klp+hF=03P=Cj4"!81 033S<ݱcj030; F0 H"A! Fl0H Fp@i%FSSFl F@-OF-hFFO 8,V)@F,UE  EUE#j+ЩE< F 2F)F F3( FE)#j+0 FI32p2F)F F033S<BFKF F FK F dhp-A FN6ZG!(FW(,"0>I>H(< ((>(D9H)F(S(5J6I6H@=03H2JO1I.H0M+x+#+p81:F3F FAF#+p#JF%IHt#JF#I'Hl!J"IHf F{D!\1)FH1x JI HPxv"!O0gt(mlSnWq9qGqpOqpp8'qqq!q(q1qF F$I$HN", :AFH3!<1IH2,,PO3,1( I# H<1H!F}SnqqqjFa!b#j3 F F@?-CFFF*xFF0#`O4jC JH{II F2S`h F$`T FxJ`O2iF\F;H!FFVO4#`8h(U8FiF0F xIFFj# )H3cjkb> > ***2 jF9F0F+j(F$2{`h`#c`x1Zh``"Z`#j%Fz`IFH F"# F-2+`h`z`qqSrr-C "FAOq|0NIOH #%LH0Ob5OzqF(FF)F@F7ѯh7+Яh +:H)FW# FF01H  x1hݹ5h%0Fxp/R"BJє>p/%j-Tф>P**F1FA"B+є>pB8-**F1Fj(#j+<#9F*h AFFH)F<#0F[AFFH5F#j+H ;F'FjS>0#j+ф>P.Ю5FFSk.rrr-OhFFIF Ff8I"@F OI FZH00A FN!FBI FJF(𯀘I FB(d0C0 S&6,0DB F F(ҀFO EG$1FHF LF0F~NKFJ4`8FL}J{KAAO6h81FCC81#x1h/[ "(@x1h/n81#C81$&S*  F"FFHFD F< # ;k( N(4(6($U(IIp( x( n(O I IYAQO $FF;j FPFS+8  E۱E "F9F uBDh;jhPFS+j8  E۱E"F9F@FV081#C81O0 F0կ4#` SXmзB T(FJF!FDx1? *P Frs ss,s5sV TJs(FS*0  E+P5R F*F[# [c f KDc`> F*x> FD8p1pFFcHJsF(p1tAt&p?J!?H Dh+8I9H (6Hw$p>02H ]3hx1hll1+,HQ"1FF>0 dh%H @&Fl11F+""p#FF(C  "!,jDF IOr(F0I Hl1+?|zz 0T{8{z{d{Kh*hQ`X`pG 8'hpG-CF FFF0&K@G%J&H#KOq JK@#BѮ#`O0h`''`okg`<`lc4Fb{pT{0KO$qJH #eT0{T{0K@!JH #T0{T{ pG pG0K@1JHdCd {T{PFFC 'K@# 0%K@Y1%J%H'$DDkB 2FiF 0O0 kS$0;>+ٮf#`4Z R( CB(<$DDkB k"S$04i[ {T{X! FH 0 F $ F"F#4B ?"a"FB(?b"FB0?#bc#es,=%hE+h.hRHh ЈB0jhZ``(F o5FBjhcZ`jh`C`h;`b`b`l W#UU0hXj k#V0p@pG2+Z`Bh` <"a2+Z`Bh` 1b2+Z`Bh` &bcO1F F@ -CFFmN'T0۹3h;3`Xh#l+alGcK@AcJcHjh+ my F}h+h*A2cZ`jh`0G#+`ckk``ecb.#oB#KFmFU0lVp+5lKE"IF_jh l"h2hh?QhkY`Qh `!i`Q` `"aF7ha`a0@ |HB ,U CF*FhlICF+5oh+?ih@B?\cmW0S0;YHB  5 BqX0G AqAa*-?) 8'{T{F HFIF Bc4 FF] -AF#OmFF43OaCF2FAF iFF F m4((@- ICFH2FF4BF1F(F $4F ] R]pGM FFF83F*FOahhFr8F IjFF F$` Mk.R]pG R]pG R`]pG R]pG RD]pG R]pG R(]pG Ru]pG R ]pGKpG4F K0 pG4F pmObiFCF ( lN|#`O4 F mpMI4d4F KpG4F @L  4Խ@ ʻ4F 8FMOcH")F_4O % %ծ")F 4*V#`O08 4F ] F $ F 3 Fi h F@ JF rO31ChO31 F@%ѽpF FF!"hFJ "hFd+hIjFCн0C$ B I#(hjF0O0 $p iiCjFl3`022 C3pG pG-AF>PMV#O5`(F-ٮ~7#">FF"CF"=2ѝ0>0F#C0<#& F HQ> 1F FF(є> *1FL$|h F {dhhspGh F dh#DFB +"*+ ,F$p FF #/x+F" F( "1F(F(:!(FtF(\oB0# !# "Lc;`O0p3p")Fb!Kh.F;#Z1 R4#oB# "0F # c3px.+i+#oB0#! "`cO3cc O3c:+}Xd 0 FF1$hd#`(Ff0$E ( F0i+dh𵇰hF F' h۱ah(FhSx+ai2 ich01!0F*F $hh(8#` iB@hx1hpGCj@hF"!hF "hF hI#jFLC$~i-OٰF F#!Orl OC cF8H1'8FY#0 Fu0ѕH!8F W 0[x+gF(_عHQF$TJ|U||i+yҲ*"#+  *> 0D81%JB (F_0"HQF++,йIRF  $$+# #(FK(d(FizsdD(FJ0#P0lcd,b(F#k`{h`d`5}`@||-AFF - i#\x!hD2#` FRzh* - -*FhF( ""052i%BD!DB,D#iBdhF0O0 I" 0I" 0O0 04 %#F3S 2AҲ %D"0 !CS!"bC!S^!a"2CS^!A""CS)""C,0-AFF FF0H(FTAF0F H F 1h"(F1^HH F 8F 3hFZ2`@#pT!-AF FF x+#3`#` /!FFh1F(FtpH)FO0F! "@F# # " HAF$!F (1F(Ftb(/#;p,0h  `||-OFFFFF+x"+ 8<"+@ :5@/x'#;'#0UE~E$9F*x+F\*@Zx5x*/UEs1FE&7F$F+x\+Q,@5-)F F(F ѭO77#`8F,@E)F FF7F$3n (76666G666K]1FF,E6E#;E`", #DE$6FE+x\+jxx*{9F+F7FFm*0*Nb**,pѪEع7,иE##p #, #" 3Jhx 0 Ѝ xU0J 0+!UEӮ"UE 6Eg+x\+;U  3" `F*FF20 ؓB F0+?l"!,( F7F+g$(7Fm?'Xd XFxF2 + +pG+FpGXxCx + +pG?FpG-OFhFFF$F(FHO=!4FP@IBF@H FO #O F-IѪF F @FF( "(F^(U@*@"Z`8F E `8F6F0F  8F E #0U 01FDdU 0SD  U*p/=!8FBF!F8F<(O @FF(HuT }pFh% i#jBi% fjUjB `j # 3p, `5, `5-OF1;FFF+m w   | ? + X +Zm=Fq % 9       M W a m w   4'-?(FF{ *F!([" 1]~(N7 Z' @# 0FoFh$+Fh 4- #%40C0 )-40HmKhB !#*FFFG #1HCO0 i(#*F!F0x#I( ]#1w@@y-0"p)F450C#0*Fp#!EѐIH!(.*юH4T<"##Dp40C#Cc0)lQI(F#l1I(F#l1I(Fй#l1~}}~$~9>~r~~~~)F8FF(?`p HV)FpxtN40C0E-41# 2>I(Fx(4# 23I(Fl(4 # 2(I(Fb(ФI(F\ 4 H)F!40#0 40CS0m0*F #!FFѐH40 S#cC#040CS0ݻ40#0ӻ40#c0ɻ40C30-<1?3vO:041F8FBFKFZ(ݬ0BF1FKF8FZ(Ϭ#P4S-<1?3xO 04gAF08FJF3FZ(JFAF3F8FZ(PO:JF3FAF8FZ(p43FJFAFZ}-B=!(F4H03I "F(FVF4O0p#0#0 :F(@0#sC0 I "(F,F4p:F(?I"(FF4p:FT"~~~~~~~~ I"(F鐱I"(F`I"(F0I"(F([w4!)p")F8FFHO  :FF [0 #0 RFIFO0 #0F0=F(? 4  82F9F(?_pJF)FWI"(Fv(Bw4!p")F@ :F!0?b0FF(?[ O(B =4 862F9F(?pBF)Fq tI"(F,(rI"(F&/?? D"##" F8FI 4+?cH9FbI "(F`H)F幷0p)FR 1͹ *F(/!(FlO3 4"1](?ש7 @#  'C` *Fg(©/!(F>O3 4" 1](? 7 @#  'C`s-o40?iX*FpX^40CS0T40# C0HHù40C0;40#011* 9S\fkz40C 040# 02_@@!00##C0# 2RORC `C GsP0#S0#T0O3V0OS^0Ѹ4#0ʸ-ƀ<1?¨2#4S470'(?h+H)F-4$ C(F($(H-81 33S<ԱH?" F(F  I [`40C30d#*F!}( (Or(rcrH)FX40CC0B40#C0840#0.40C0$40#040C042#B"Cc2#-rHQF 40#C04{t#``-к$H4{t4{t4{tXHG-hUH?$ (4(FFQH)F?"p F (F I8 FFH)FpF0(FF#;:!(F6Fб" +o@!HF FI F1H0H=!(FF,I(F F08FFF0&HԿFF&"I(F F(E8FFVFF(8HI(F Fh8FFtF(O6&TN#IfyʀӀI(F vFp8FFKF:FHmI(F aFp8FFv6F%FHXI(F LPFOщH)F&O  OЄKBфH&v1@H/@Ѐ}H)F|I(F FFyI(F FvvI(F FVsI(F FpI(F FfmI(F (kI(F FhI(F FeI(F FbI(F F _I(F F@\I(F F6xYI(F F&pVI(F FSI(F FFf^OI(F FLI(F FFNII(F F&FFI(F F&>CI(F Ff6@I(F |FV.=I(F tF&:H)FD!hz1,"\:(x1HN8F 8F-F#p*I(F GF8(FXF(FVT[.@Kf׊ߊbiow~ʊÊϊMCgTY +hB@kh+=  ,5EфFO %h#j"`,"3 36 @FAFFF0F~0!ܪ >;`7(F2Fк&`"-?H4P7#P740CC040#3040C#C 040##0-?(F@h2+~H)F⼃hh2Ѽ40C0Ǽ40##0-?(FF(#;F|I(F8WIHwI(F vI(FDeGY.>qI0F0oI0F(~IC2S$e40Cs0t40#c0j42#BCs2#^40CS0T-?P0# 0*F!iCMHl4 >40C0440#0*40C@0 -??" F(F 4 H +>-H)F-??" F(F 4 H +>H)F-??" F(F 4 Hb +>ʫH)Fһ ` ށ؁6-OLFF &FOY 0@6n.<1H [j+Ѻ HOLD'BFj(F8OT}m-OF FFF+G%K"`Q33S,S<yH<10FTJZFKHBFO ""J)F8Fh"FK(Fm22 p!A@ A2 FYPFO V JsTt'Is-AF F)4 1+W1+ax1+]"9F0F$   $ |0g47+Y0 r8g<7+Y8 h@gD7+Y@ ^HgL7+YH T( P(FA K I 1Y7(F @' ;1Y7(F 2'"F8Fj"F(Km T"0F,6p47;470F,6f<7;<70F,6\D7;D70F,6RL7;L7-O=FF I UF(HO4O IU#BCcE##"-/#0O3`P7CP7jN#[BU bBXSB"U*OH2@"r(K;!JHCx+Ъ/#`  s\~(KQ!J HCx+Ъ/#`  s\~( K}! J HCxc+@h@ h/#`  s\~( K! J HCxS+@hCXBXAH/#` s\~( K! J HCx[+@hKXBXA(/#` s\~"?-AFF F1K@{JH^"KOqJCx p$ +сyQC1FJ FZ0 F@yF"F8DA:3F"F)hxAW]~0K@JH!KOqJCxJxB xxB("F+ :#*("@DDۿ#Ň]~чpF(&K!&J'HCx+Ch+O1 ,"@:@B Ъ~#O4` Fpv/#FN3x+P!FC C #0#3p(F K@'J0ps]~08'݇FCx F+ #pN ")F D\7xG 0/#`O0 F#3pBKOqJHn7p08'&]~0 K@ J HZ!KOqJOs hC`s4]~8LMT8(F@]-BF F$Q050! QF DDQl1KO 1OhB%/K'/LO hB4 QJ" `V)hF Q̳`O0W;;>+٪#`4Y  Q@,CA@+٪~#`7Y  Q@,CA@<,TT$T(T3FRCFO4 F0@pG)F ~d0F FFjOV?  *F9F FC$FF F&B<K!J +*ѣBx*K!JHb6 {Bq"Z.({z<FC{B"`)C+mp]*>-O {FAFF,@qpHF(3h81Y@;I:F F^008FIȐ(I8FF I8FFI8FFI8FFI8FF`I8FF0I8F%+@ɀ3h81Zڀ FI3 Z<[LJJ 0l+JI+ FI F0𘀲l FI0𐀖P F}I0rj FzI00FwIF F0uЖP0soOr!Q0mI F0_Жx0+@3h8!PAȁcIh3hx1@^I F0=ZFYFhpF(@ӀFD!FXF~0*DI8F(@ހZ<@\@OAJ F~8 IHgHKII(FF Fk0 DIF Fb0AHO4%2>I  FQ0;Kl*?(8I FD0!-?#@6 1+@Y Fz F[CF@R%H'J"'Ix F0^ 0+Bh糈-o%o#opq[oވNNp!*\?Hl]ň@]҈K4XF F(?jBa"FhE T FxI 20?Q"YFtJ FrI0EqI8F(|oI8F(vmI8F(pkI8F(jiI8F(?fI8F(`-?`K`J)FFF^I Fl0? \I:F Fd0?0F%(F>0h!%(F?OBQI FM0?-? 0+?0+? FEI2F0?Ю F@I3!A06O:F5O3J8I F0ѵ3hx1hG%*2I F 0ѧ8F%(Fh F*I2F0? F%I!0ъ-9F F50? 1ZY*ѦO%CF@F(?k F' l-o%o#opPYdt8F h(FCF F8@78FFF:*=lb"P$#lc $0۱Ziʱle1F(F0O4 ,(J (J ,( F( J1F(FO40$//$4罈%o#opFIE<;NB H #`O0p"1F F4 Fp F0D瘉0] FhF1AT1F:F(FAF:H F8I"8FV8!F@!0H #;FD^BF(I)H}a$.3i y0Fp06I Hj6h(" Fbf0 ѩh+IHV# O#I"FHS(OsBg I"FF H$]]k.ى]ΉFxxk$KF &F;F+Z[X#` &F *ѽB Њ $ Fp%D #x+.+I F<(I F6(I " F(0.! F(#p Fq07A8F F'-@ chX@Hch>Hch0F (@(ѩV#`O0(яBѩ"#|Qjx C   B)F+* FBDPHE٩7# F#O. 9D ;B@BE٩#O [FFFD,B ",+F+##p-OFF FFF%CB*뱻,ةR7#`O0TKO X\YF\  x1Fp@ILy"F1hF xiFlF(Fpy.x1hf#>0B*2F!F(mh !FEi!F(F(ѨH`D/#0 K@!J H!K@!J@ x܋xgFh FFԨ#`O0Cx+Ё)F1x+x:G0А"! Fth Fcg9FhZ#h Kx+ыyoC@ghX+kgx`e h8h0F"L9Fx+Ш#Ix$`e(#-AFxFvuE5|2xEAFx29FD:xFF.8x2F!D|2 +D|2%O0PF F !F"D   C"9F I @@= ,٨D7#`O4 F/ "F(F>i pG pG pG/J0FQhhz pFO00"%I" F3#OBOq#0IH?#@"Oq#0IH- #""!0 H"! (`0 IH\0g'5H8FQ(hC0(F/#x18@&8pF>`ư FBШO5#`(FFpOr!hF "hFOCOS02F)FD`#hjFIOsh> *FDn#hIjFOshiiF=`LT  X( g1 KOq J HKh++P@B O0fgCjFlCXBXApGQ FhBF#cgD#Q00PF" FhFM    jF I,B + ")F FoCXBXA 0 8i(0PFT ["!C C4"!FNI +0 :i-CF<]F1K@!JHKm#KO2q~J}K@!yJOb!8 F#pHF1p31caso`#`-F=hB`hC`FHFxsmXihC`hC `hC`h/Cso`oDCc`2#j"cC#b#cchP .]5xB Xh1FB ORXC X`*Fsmi"0-W=E5.Dh /N /F 5ǜhY 1F(F:F/K?G7=Dh F 5Ϭh 1F(FXo2F>F65D*"!F0O0 <]Cv%IFop(F:F/?G7=D''&Æg-C&FF"#Fb!#6"!0bD0F F/.F!F0FF(PF!0 ѨZh +(FO0,F.DBxB ҨF#`(FO0##DBӣh@/ "F8F  F Hi "*IF@FfEHF#D5Fgp FIiPF"hFQ kM     h-Os000h "i 0 I@#jF0Fp-Ii@ih)|2F CC#0C |2""!x2V-C]6FObA  (н BШ#`O00+ѝ0++ˀ++w*<+6(FP0@뀨phV8O0+)*+:96սxF(н 9> :0Н0+ ajѐ" "nIl0нX0bj FlBKx+++vKh #Zx* [h# #Zx* [h#P 4" C !FF     zOsX0;hFI0}ѧh+Чh1+>I>H0+';"(F#Fx*0;+ O1 !(F ]*xZF(?m: d FN8F F(?8@/ݮ:B0+ͮ xpM N0 D F!l#F0+Ѷii@gv KF#!3 Fg+  pG+#`$`&V#` F+ F#` F$`V#`FF+I"5O0pGg-G%FF )FF"j! F(;#``3I4H8``0ܐ+FJF !>QF5&``0ѧh+`hB%IjF0 нP-ѽ0cH `hC0 F/$' " >I`h 0I`h0AF FG(I`h0 a`( F.@qB@lBpBfB@-OhFFFO#`eihM"i`hCF+FhsD Fh2RJEFeFhai rDB- B hFYF(F!hB`YFJF0F25iUD%DciaB!hC`?HF"O9!jFID]gBh-AFذF+("L5FŔ x"hш4(O3jF!8F,I#6#`O0X4("O31F,#8F"gB0h%-O5P*PI iF @$P#"@h 0! FF@hh F@!Fw0O0! Fn0I`h0O0 ~B FVű.اV#`  `(Fmx` hB٧D"#(F#;`BhhB9`3,1@pGpG8h!DB xD`@@C8F0[+D-OFF *ا#DKB ЧV#`O@F$F#F&F"FB  `+dAFFF˼Uмl QF, lBБ Eؼ4ѻxFE\DB!F#(DFAFFDZF+2Fѧx#`cSc FFF0[8+x #pO0 FFF0E8+h #`O0 FFF0/H+h ` O0@mShYhm#e@!nK h nO3#f03F$i F@"8F0P33S<-Ր>0+)D&0ke#hx1h8B0YmkmB Rh>0+  H8@ 2033S<ԛ6hepF F OqF0`X+ha K0#h+0#pOpp@B0 0cSc-OFŰFpFȰFgF3 ѭH O0E HOs: S<VOq KF(d0 `ñ*.h( B "JBћh ћh`#+p(0> kpS+ *p6#@R,h#k q"?qgҀ(+TS,sh`jH $@D,IDB. .d9h0щhB @2C0$00#)@tF@5$p$DB..<0ӹ(1+@c#;`#-0;Op#F狱<0s,@B6#p#q<0 0.Ѩ+8##p#cp0KS BB 4.R.C.њ 5+M0+<Ш+@ 3##p#cp0+@rF7#;0" F2,3"RER:O 07,34'bE@t 5cFcScF 53B+#; %1 Fq2 5.D..GS<ը+@2##p#cp04D<}S(? S,  ҲќBМP  .ѡ:*DEp  ,3}2x,B&ТBFS( S,#Ҳ|BАPB .ѡ:*DE>  ,3V;0W0Ԩ+@'9##p#cp4 D$ 4˱Y 3B M#; $1 F 12b 43D(1x3B=#;( F x2J(1x3D.@..􀮗W0Z:F!; 2F+(o!0BbpQ##pa 2PF Cp#p#q .y..CW03 2081Ի~՗Z0Ѩ*@"FP!cpF3 2˱3Bs:<#;1 " F 12 2.DOs@~+UQ#p#p# q4< #<S`6pI(p*"(1Zp(> 0>! A}jF*@# FHHO0-o؍h#p] `FFi0/H.KBBABF!Ѧh+&Hi '8F ] i H"Fk(hBC!Fk(FJ H(h81E[ 5# #F0P F0`H"FD\ k.h8#F$ Fpx+pF(2F)F#U-OFɰFTI@FRFF(d(hZFQFF(mХ1F`F@EH,0FIO_Or3Fm0FV6#RF[F(hv4# RF[F 5FU T0#0,0+A.@ѝ0-N=@#+JOq8F ,:I$ICF*FHFQhIF(HIOλ$IICF*FFHF1 F~;hNdIICF*F`HFNI`5hQ'@:J1]-OF$M F$NFUb FO, ,62B&p%B&F, ѽ0FV V,XB3BѱFV ,Y,PFBFHF5,6#T ,@FT,52F0Fhjr*-OFFئ#`) FB1F z0 B O #DBҦ"#1F z0O0*O!FZF\DICFIFF0F@0T IQFF0F40uq*F Mئ#` & FS (ћ(O hI9FF(F03)F+ z"F@Az0O0 M I(F0^#` zt04  31]aS0[#h( +D(8D 0-OF+`h@p_0՗o0IF0h#FK IF0hy#F(НK+Aئ#`T0@$P0RIF0h#F(GC "E=0FF(U;  89F-(4$B77W<0h0  oHW%DKhow2oOV]9  c-AF@F` "hJ(h+F"!A66V<%w! *^!F #(hAi;(Fcik`jH F&H(F:F!(FD(h+F"!'gh'`iwciV,Haiw#bR(Fi#3(FcbV#"b#F#A=AF(Fcfh0-OFpPFF{(<5 0#՜J{mH#2F!FxBFhPMO O8xB3Zh*Kl[@+(@#OzrdO`^zsD F4(5 0yJzzH{zgjz {m#xB3Zh*mK{n+$*F F($<и?1cJP#h(^J \ " *" "*F  0zNH  F 0p FMF(a2FQF0`#kr>K"6ka(h(FE#+phOp@#+r"!h(FOaOsBF*FkmwF(F6'&H ]h4+/1+#h81I FP h#F"!PFOxH :PFp hKF!7+ԐڐizDCDC(P]9J!Q Fp&P>`5 h#F"1Fh0 $7S : h1FKq2 r H1FF H F@sHC1FJJ bԐ8 PFHh# F3d8@J!&- 8FP+h;+h#F J!?hjHj FH;# F+`=# Fd8@89 ȑJ! p PF1FHS1Fk*kH hJ#!+`#F#c Fd0p@32!a"2- J! FP`6h_# 3F F(C0H #h81T,I Fd@L6 F2F9FH#h812  H@9F F!G2F9F 2F9F(a F0K@!JH  #hf+` (ah F F#$| F@PY`i !h0Ch0"*-CF` F hhiBrjBX0F(h3Y {ȀGjIFF&H hiMі@0 F)F" FKF!%#F"!I FdN2#C"#[ [C#h!-(F h"!K%p] 0Fh812>#F!Phih" F# F+`# F 0iZЛO*` FQG FH F 0@E8F0P3 FFȹ HI Fd8@ (aH F8@ 28P8 PF Hv Flh0 FCh0#d8@J!U -CFph7X<@N233C23 ,FFѧHC["Ka0ѠIHN<1 23ѝI" 0(F0їH C0@ &qdh]fXc(FC7v2C(FCܽ33C. (Fh a3i2F(FyIFh BiX< X,r2CCi#3h*6$#i(F1F#@0ci1F((FFHF`a hJF~#i!ffah0Ch0(h"hQK B#3h+E(FCBHX<#k3(hiRF(р&?? "k arEv 4H $h#3cb#cckDcckDc0KE0@,#h+p##`7dX<C (FA8H CXl?v3C`jG F Hli n0cScp0+?]h+?Y0KE2`jG FH(F(h+F2F!cX<2CД@ r K(h !Y(FC7(hK9  8 0FP33S<Hh0Ch0# Fd8@H FI hiZS{p@t#hc03qr C ]KpGbn"h0BI]Kdp-OF0PFFF# x+@HhkmBCF:F1F F'Oe> **(#j+;7 cE85# 2F h;Fe0;#0 ?0"Fx;33FII e" ^"\" B2BG FHQ#Rh Bł30|H 'O+h+wI3F"Fx (+tI3F"Fx#O L pB:F h1FU@dI3F"Fx HP3+ѹR60X6#2F h;F0VI3F"Fx3FTI"F x$1F h:FF@F LH\0F+h +#h81FI F^ hi& h!AK*m+m##+e'[<+<##F 0B"1F:F h06+7#3+[RԹ@3iO #I3F"F x:F h1FFH HF4V3i+h;3@3i;3@I3F"FxF缓ӓ 5($] bul#2F h;F8(+h3+!J+h+х@3ikb0kd#c3FDI"F xu+iBh8FF`( **XF0XH IFdCFRF)F FEdhb-OF FFFB DI DH+F O-! F*F-i'x@*dbz*a`B[.VBR T' $ RF½((B0DB?ӽ& O:h1F F"H2T'½0KhP #i"POS 0ʊ !PF(FFXFXG F H% !DHF:ip)`]F FmIHh#`hBBiF F0AF3hCH  I(F ]phiF(F1`.m,ink.-A"hh3F AHuh- xhF *FAF H0+1h;*FAm+1h;*FAi0!]PF FO PX`` C   a` X`` Ba`O0YaIHl0n "FDC HO !] 0 Fin FFh F!8F@|ie`ibh_([ FX,hx1h K |DO32Bп:O324#38 h*[h7FP50j000>1(R<,C#B<#+ +RoynXxXCXg[)F0FbB1(F^8( hF(?f")FZ!FHFIF|)F"00bF!F0Dkx+ (F8 PFFF0FbFxBQF8FC8< $B")F+  ЙB"9F瑹hBC,PF<" F+H FF(?Co<CCgiFO3iF8# Fvdg11X"!0Fb0FHIF0FbrIF+ME9F0F%"!bF(9Fb\Y穖i \Ȑ?z0`j3S,hBC,PF<"R FH#cTpF0+K@!*J+HAi )H 1L)F ;CFѣFh1+УBh+У<h+ У8h+iiJH 1qki hܱhhB#hhhBaiPah{Y`bh F`5knB#h0kf0FpQ`Fi.k.8F@L dF H0 F8#0i-GFFFFF8?H$ F10 hHh;hhB!` F"9F(FF(M4 #F(;hEa`#a#a 0`0#a8h FFoJ F!PFkjKMFF+FRF9FH{!F j0ѣvh+ IHi Fi#i##`shc``t`iunIhF@0 aiA3OP3S,S<RSBBДh0;`n(h!l(F&0F(h!$"gn1F4رhjBijB  "H1F"(FFH Jk(1F(F#k,(h+п0"Xfh ?hcjBF8Fu#!h0ff(h#h+ѡl(FL(hzz0 hpGiBa-OFFFVFJx0#`F(F#")F8FF"и(2hhB!*`Q`ch`+h;3!F UF FO޻б3h+BѹC0#ai#a+h;3!F O24 F(HO~*hGa`2h`"a` B``3h`(hFNF0h F J! ~hBѸiu0-GFh O Աi'h.hx@! RF4CF0F3#3 h`0'(`0 #`O0p#`Kh#xF p40p#x:+bF;+^1`v\+x310[:+,F88'Xd pF :(NxF_3B ,:*ДBBxC@*F -@,:* :,p(FK`pGHJ pFFN/F *|(:(pBFB k+2:*|*FO0-O4M\4!++dєL&h.`X0F(Xdh`FP #`o8F 4M41F,D?<cKh/dF'I="(Fn(YFxF32:*FO<\4 3 F(ڀ?À<@F;_FO`)F(c#((FO7!+)#"#" 'FFF,FE(ObQF"+ZУh(Fz`k"Og#  VF; +/Y<'o:++O \++ + +O ':+ѹLF;BY(Fad(F+?&!FF'CDF#O2 O"p+x+#+?~X(F(v4 ;FT(а? 5F:#'=88'HJ FxF3:*ћF  <:+:# 0  B*@F De)F@F92o / #`DDDFB 1F (F=TJFYFPFN DEFaK`B(F(FoF`qon## FO3=]Lh#` a``a88'-GmaL#FF#i!ahsx&p#h+6Тh*3"`o' e&F;/*lh[F(@h(@ ё`.p\#iEIh`(O0 mh[Fйh(Ѓ@ё#i`"a]h(FQF(F`(Dl*faxDE1@:(#(ai1<\+#ca,\*"ba:*#*pkpoF+"@FpO3:F}F+=h\*?o+gDla|*:*+88'Xd 8F F)F F8@'F="F(d (@𫀣r #`o F^+cx:++:pyь0Fd(n0F\+cx:+o+mУ0 4#˼B0 З0 ۲T+1A+٣B, \$  )   ) ) ) ) ) ) )  ) ) )  )  #b_ّ # # ##:# #Fd"FFd#/A:*в+O4p(F8` #`o F;p L(Fd(FFd#FO4pF#"Xx0+CxX+00$$8"0޲ .١a+ءWB 2 $A+ء7 *`pO0#L`h#`w IH``8 P8'-CFCLFF#hk JybhOa>Hv 0 ##`  !HF`hCh;C`+ڑP (0hZ`x +AFhFv&(-&1F(AFhFvAF,hFv( "v(x+0B+K"F47Gtx,(  pC+"BJ" ` (* F pC+P8'x;'X8'K[h;"FFe(HF( P8'x?'F:K 8GP8' 8%L`h%`e`8P8'F "F! 0K87F ,HP8'x?'8+FO*` Ȅ ,`8 F !F" K87F ,HP8'x?'-OFFFFȿ`O̿OO8m0@F4`hBh [(QF (LE!FIFB LEE$0O8U B0 pG pGpGpG pG pG-GF-FTOFF;h8cPDzhPFv@ #;`  !PF0xhCh;C`+ڑ (0hZ`x +#FAF hF v `-&1F(AFhFvAF``hFv( "vL(x+Ѡ`EAFhFv( "v6(x+`hFIva(IhFv|(IhFvv(IhFvna(?|IhFvf b(?t IhFv^`b(?l:!(e l?'#L`h#`vv IH``8 ?'  K[h L"OcFF0 80( ?'?'F KFFF[h["+FFFgH %`(  `?'FK 8D?' 8%L`h%`Ve`8?'-AF FFF #F*F! gK84F P @?'JOc0] ?'-AF FFFD #F)F" gK84F P @?'JOc0] ?'8@P@@@ @@0pG-A4F N# u(F !'F09+F% +O8FhhpGHiSipGpG-O FFAFG@?F@D&WKOz hZhFAFDCA9FCD QӢB ӴOغ_=#cC ?XFiFFFC'FFFF9FF 0F1FF (F)FF F!F@F O30F FA Cc"BFܱB)FZ0ѢX@"h_LKh KIGKz #F0LJ C'-AFNh3б3i( v3iwi@FB8GD8FlB` TF0 i"FD$!FF(DC'8? M$?i*j#DBiDa8 F( C'𵇰FM$0+DLEKEH&hFFG&hAKCJCIDHG&CJCK%)FAIBJ/z( F@HAI&h/F?HG*>J?K))F=I=J(p( F;H@VvN6L4HJEBiFizHjOiC(D#@S@a j30B P#@JjOi*DC "@b@E! +a3-OKMD+lD(#XC00F(yEI0`.h$4FO bkB"O(xO 2( DB(O(xO 2( D*lDB.8F@FIFH`t 1F04(F4IF`^k01F+k4F30~F4IF`H201FDjkF#D4@ dF KhK IFG+z klhC'jLJ jp$NjulB(hpU$0LE$4C'K[lhpGC'-OMoLHP-@b !"#&@F#,#Sr0#bObAF(3 `aZHO3d&C`UMGF\??6.. OH`F(#0'm&/A9*t ssssss&s,6ssss?GsTs_esksqssssssssssss"s(.ssss;AsNs[asgsm##r##&0##%0#lkh2B;k`kh+3#$0#h+;`lh:B3h+;`lh:B3#'0##(0y##)0s##*0m#0# 0KQFG]C'-LJ >N.$0;H:M&h2BO`@hfe`cc@cl#cA9!dYe@e#jhi@ca"fY#bf!a2*B"f1fn@c`'0CH "#3tI&H` (Ig`H` j`F`d  Mj1F.(`(#H0 !# LJ >p(j8D'PD'KH0 pGC'K h pGC'-AF4LFoB70B3 0BѪBpB0B hBр`"1F(F'BF(`cia@F`ciD1F(FJ0ѡH@"iFh_<KhKjFIG#z ciBF(ci`aHAC'LJ PD'-GF9OFF=il @#i@"#aO3D  0 0&0"nB 030Da`{nBO jHiDaVaciiB !F@F`i!F@Fca`TiB#ia{h!F0`v&0K,yi,@yi FGC'0$BKlD0v44C'KpiB l@.j&DBЛ@DhXipi@l`LiC'Jpil  @@@"iuBeO4 D0Da bTiDap2C'-AF_O;iB lCh@% /DB{У@Dh!BFZ! F2{j2Ѹ%FKD00@*iC !P+a@i Cakii3kaB-:hB##;`i)F0FAO1K#/03 ,KO0CCX AF+8)F`z+9hB=`BKi+8`:8)FA[P@*FZ! *F!Fl`tFFl`H%0#"iZ!h0@#`C'j-CF>MkiBki3DB*n1F F(Hh3/$ F"F `F/"9FHFh`9FFHF`0p;`oB0B F"1FFGF v+i@FB<p-O FF(@gM'B,ؕ)@,KhKIFGѕ(0+@O ODcB@EȀ.hBٴB khB9FFi '" E,##𦀻EihKBzl'1FF( 8)i l1b@3E%RD@4%0+Cѕ*0#:F! F<`%RK'0CTH "#9L(F C8De@ E  ";Nl@ %03:F!3*0+,!niE8F_+iEK(FDFH0FF0p;`K)@KhKIF : Ѧ   D 9FHH_% BF*0+BFZ%^LF[ %ZC'LJ >p8D'𵅰FFh/N(U=FeCі(0,8/6Ж)@,I(Kh'K'IFGdD +9F(FBshB)FdF(*F!L'0CH "#5` F%(FF(Ж%)oB0B*F% #`C'LJ  >p-OF4 FA(0#^&@$/8F0BFn\ B@ҐB FO ((FO3CZ (O33BXF`Bo ٣S@  ј%0+ЬB*8Z!7 )|0B0B!  O2H_FF/H_`0" 8FSFdCF&HIF_h FFh0B?o*Fp IFH_V%0[B Ҫ0Z!,.c*0+ЬBbp! #`h)0+KhXKIFG FF>pLJ 8D'MC'F K'0CH "#3, F@6C'>pܹpGpGpGHpG\J HpG\J K0h3pGXd K0h3pGXd K0h3ppGXd K0h3pGXd K0h3pGXd K0h3pGXd K0h3pGXd K0h3`pGXd K0h3 pGXd K0h3@pGXd K0h3pGXd K0h3ppGXd 9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpGa ȼhF;+`ڌiB (]K h\ `p]KpGipFN$V4(F` Fp4 , kK +K[hG pGkF0 S pG0pG(h9!HBpGXK0h30o O0 pGXd @FFR;BpGFpGF FK0h3pGTd K0h3pGPd 7Fx M K*Fh@I+F"FHj0L%F纱] (9 xH+ pG pGHpGJ JK3( FFpG0;+AA- 3,۲ ٚBГBO0 , 2ҲB+F0-OhF3hCs`,q(FO #"!&qh B  X( 9"&0DD 4"FPFDD ` ;ѹ і.` 3 -6$`O0.9,7KFXhB4`3,-$`#\C Y ++$02lкB@F(:F@-OEҠ #`1k-*`$xKhBKhS HpG=Ld KhBKhS HpG8W pGpG pG F H I FsHrh IFHI t@Hi] ,R]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBР#` I)F`J!Fh 'EhFhBӹh "` J"x46@d(T`x10: (Xd dD'FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00\]h;iP!0xCC@! pGh`K3pGdD'8FCi FB "iQ6F( F !F8 hpFFFS2Bңi5C"iYaB#Pp3#S(K}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhFi i$HP&`S/B2`jB2bBѢikR:DD#iQ-AFZSBF FSA'0ip0iF FG2BҔtu(F)4YB7x\*CZx|*@0iF FGhKiBѣh #`t0+u 1R"B0XB`x\(]Xx|(Z32#`x|*xBoiF FG3)YBxB[xBBx|(632#`*=*7ѝ0+3c Fi DOAA3OAi Fi FSRi"OA F3\Z*ѝ *ЙB! F+  FiRiOA FdD'UiFFAi)DXi#ii+Da8F-AF FFFhiû/$ݷ.󮀰F#3D+(+++)Y.ݶ@)F F?FFOݸ &&F#FFa2+FROA FCF" FiOA FRBi)F FR"OA F6i" F9"OA FA(V+FrOA F8iiOA FRi)F FR"OA F i" F9"OA Fi2F FGhiF+'2OAR+F F6iOARFF)F F.?>FHFFi F!AF&N FF3h+#OsB-#@\ CTkK52hh*!Oq30B#@"\C#TKh30B#@b\CcTj"j1P 8F !@pjbZb Pa Td Pd -AFs*hBPBxB Tx], N ,8x(`!(FA "F9F@FT8@FdB0y6!J #BFӃh #`K31BґBx[)Yx.)3 F#`2B ӣh #` K3"`xYBx.*Zx]*3#`dD' HJh0')б` pG pGFpGXd pFN$V4)F4 p , )KS<GFpGF(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(6a Td Pd -OFhBhOkB"I(FbFPOA Fa#h3#`"|I(FPFO A#j@"hh1Pt( ! FO##j@"h`i`!(F#jiD#c2Bx^)3#`#c#hB x]*3)F F#`C-*\Nt1Bx]* XB-*@ׁ[x]+ `)F F(2BXh+KK3U-*@ȁ ! F3#`Bأh #`f#hx-+]+ѣh #`f;Kh"hBx300 W/ ! F#Bӣh #`f2BHYBEx:*BZx]*?3#`2"`:F '|F(l FQF)F F70:+#OsBij"(j1P !kj(bZjb h #`fMdD'Xd a 3#`Bأh #`f#hx-+]+ѣh #`f=! F)FF Fb#Bӣh #`f2B YBx=*Zx]*?xh+#x-*@ZB@Yx])"`-& FFWE0+5WEݣh #`f0+#OsB ںE׮:F7)F F?3#`Eɮik"(k1P !kk(c #p3kcQF8F(ݣh #`SK3O YF8F{( QFXFu()F F  эZ"`x]+h+:k>#jiBkxCkp;K Fh/8+9*j+Ckk+@kj+=k+:ѫj?4AF FY#jjg(k@>(j7D@"!(FB"jh;`#`W i\A B2F0#jO@Q FhO0[*Zx:*?@=*?Ϯ F1BF:F)F FBdD'a j FpFi(KI h1!I h10Be F#`]#0#0 c` se pIOQ F p@۹Xd Td Pd -CFi `\ и[@HVB+xChBӃh #`K3"h@)S#`xBxE𶀸Dڸn"jOA Fl]d -*Fb2B YBx\*[x)+)"\! F -OA Fid*Fo6BtZBqx\*nZx)*kѝ%`BUٛx^3ܸ"ڸ"Vt<+_Т0O`Q F*FDVVt, F1*FOA F6#j"Zdq/Тh"o(Q!@{E ! FZ#jifh#` c`[KBV@ O Q>"OA F"O Ah #`KK3!! F ih"+ #`@Kh3* FVB$XBXA0*+"Ѣi;F F52OA%`i FOAi F;F2OAiOA FkB+x\+kx{+5 F%`1BF0x,*-Z"`B1J[xh320Z) FBFݢh "` J"*F9F F2BYBx\)Yx})3#`S+FdD'^ ]Xd Os!`#hB YBx\([x}+ ! F!6h #`K3ܸ*?K.?hGdD'h^`Fxi?)πء$ڲ * +^) [)Ҁ\)Ҁh+ {)|)!ChBӃh #`K3"jOA Fl^d .2Fb2Bx)+o)! FE .OA Fid2F2Bӣh+FБK3Z"`x)+!0Bx*.@?*@3#`1hK*53i+FOA F2RiOA FRi)F FR\"OA Fi" F9P"OA#`! FP"OQi#j!jBbZj2Zb"OQZ#jjBbj2b !ji Gh` C`UKgO Q F8ChBӃh #`IK3#hZ"`x<) >) РoX Fe"OA"O A!h:K)+*3@𩀢iOA+F F2RGiOAR "`${*ZB,H[xh^0@"`h$K*t3,+Уh #`KZ"`c`h*#` F2BFx,*@Z"`J[xh320Z@ FBFݢh "` J"2F)F F 2Btx})q3#`?dD'^ ]Xd 3#`)+*Тi+FOA F2RiOA FR}iOA+F2 FRiOAR Fm "` "`+*O 3`?X"**1BTx*(?*{*JZBFJ[xh320[= ! F7?*?{*?e3FOs3#`#hBx}) ! Fh #`K3Xd dD'+-GFFFJ ЇhBCL nF KB s "FF'!W%0 F)FP" GDu BO" H)FI+FK%HuPO5" " R""tpOa!hF)#a+DaY#B #}K32BC"OahF"KaaaO``( !hF]c`)@ch FFF !cPFP{xC@_->س_!سo𔀳_kB)Fc#k!cO1ZhFx2*F)FhF_rг _kB@)c#kF D)F#c)1% OسOسOтFOMгOOG9سOeFPF'xGhxCO5гO2гOk#jC#b-?!@`c(@!(FF(@🀠c`kX#cc+k#0O $pB OгOpkB0)Fc#k!c[)F#cxGok]O3#c`h"F08Oг@OTUUAM KA !A P dD'-F5x))D)e)D_F!c_hbcX+xG_+B%s"T}AFk+"ME##`#ld`s`Oe#3`#j[!hF:0FPt[rC_Bjk@!0;X!(F*c8FWj#:@#3B<+FbFG"0Bj\E:3Ҡ Z\B B2W# B$ P#AE@#@#W#03ELLBӫBB8W" 8F\,k+?n3PxAOбO бo+?_#jC#bYB8F; F(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(6a Td Pd 8FK Fh+#OsB \k AX@8k˱ K4(Fh3( K(Fh3x8 8@pa Td Pd -OF-FF FBԀ2hShS% xCO9س _س_ހ__𥀳`_𣁥L F@_𫀳O𞀳O ā!سOρOiS' B@ˁ?0O:س OM(O𑀳O OOÁOѲh)xIh0FO  SQBF!FsSFqF(ѳh+D8O@O3iB"xS10 _*2Fi++h  h  EKj)bk*8k?_DEw;xR#0+e=   BZљB! @(!DD#DF7#k+E8F' RFYF(耸cl+? ' RFF(83HFF |D [\#0R B,?qEM[FSEF8x3 xBkB8F  (ѺE~0Fzcl+C 3 l0. +?L 3l"B\ blcC\ ZFعFYEh 2 F(\F w(и?y ¸Oq1Or2?f $@E( 6  =F(EJ2lX#3 ZFN+0( >F%& &&pGpG pG ~ pGpG pGpG8#MF`+x %`8Oq(FY( pD'7FM+xD 0(%`pD'Fhx[@(/! F`8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!HHHpE' (  pG pGO-MP8`SJM+; D 6"` `0!P P3P0 p* 0p lp@ lp@  tp@@@dl lll PblP`Ѝl00@pŸO-1MM @PD 0< "( _p C.F D`pYh;@D8 (@z0Sn pȱp đ`  ᰱ00$ %0!`4t0p@ !0 0SP 50S Rql001ݍЍjl0S 0K0S R8 Pp 08D<4! @P 0 00Z  0-0h,R gHT1ݍЍWpo o `o n n n 0@-M 0P Pp Pp@ P l Ѝ00 0Ѝ0@Ѝ0A-@@0s- PP0P 0%p` ``0`0kppX`p k``0`0k 00p@-@PCM2 /[P4 @@apPB ` T@k000ht2 6 C>@F0F 00 P4D@@`0S VS00 SCލpx@@0Sgk@0P\0\ @0  P@1:{k?00@uk00j j p@-MQM@P4SY TE /[PB QP0s* [fPtQa P0`s$pH @ @0aqp? H Kp8 ۍЍp-0si/%@@00p +eVj@P0 @0 A P@1: k?00 p 04k0#S @j@j@,p@ j00x`0$ X$i ,i @-rP`O-$p(W,P0-S`@/U'Y1 ? dZ0 0dP :[#J P?5#I x@t4 2px 2BzhPY@rUZ0[%J @-DM@ P- j jBp m>BR* p=Q p>m>BR cP P rp~dP Q X dP  pp0S00S drdpE~edP Q<\dP { $r$p*}RdP QqpFdP Qbp@0sSL qpp5dP pQ 0R`0 la`+n!dPD `Q .S0 0SQ0 a`EndP) `QA0.Se00b0SX0}0SO猀cP Qs00   $dc tb tb |,b b HHA-@PU 7UP7UP!A`FFqP ``P 0!Eq1pP 02PO-Ml0 Pp0+ C+ pe p0P㜏㘟|  t0P0 SD[1S 0q!S1=S 0q!S10! R Zq[" X1S 0q!SA001 S'R:p& t  Z0VPt < SJ `.Q  oVyf !0C3Sz1*$s_Ylkq:nmzY\Eg:p}hT\T t0L]qap0PPA(* 3!R̂ \ A 0! Rx ^t0R p <t 0 V1Pt <SC q|o Ѝ  ` 000@<,ADt0 @1CPt0P  t    %[ '[9 P /R  q RZ+  ^x S:pW t0@P0t0 t;0 1<65XPp@0,^0 <P0  0=R  @D%0h0@< D  ^Pp$0Sʀ@"Dx@ D Pʟ !0\VpeS @0 SD P\0sD `0d [@0 000P0S,0@0,0N @` H(00(0C$0Sʀ@"x:@0P06@P0L dSl0 D`00d D0DD 0$0@0$0 0@0 0@(0$S v<Pp=Q j \ LH LXR@0Dh@0 SV<\QH@L^ @0D h@ 0R?AP  $h@` &0P 0@0?D00H0?L00 v> 0`0 ?d000P0?T00H0?L00/X0\ 00 0$ Rʀ@Q"2"2B S"2"2@0 2 0S,"00x2}$0S"@xr@00l@2/0 S  *($\0<Q0 0=R$ $ @%0c Lh0000?_ .: 6S ^00\$0/,>! 0E  0E $ $Â!2c 0R,,"΃0,!/#1    (  ͌ ( $ 00SP0 0T '`^b0@P0^@2/0 S *P0 0<R$0c h0000 9^ ,:6S \00^$0/.>! 0E ! 0E 0%!E!2c 8P \?H/)L 1!̀/0,0S$00#0S >  0 $  .1A0H L h0E 0C00000S P0 0  V BQ 0_  C00 00S \0 0#+;  +; f= =M S= =O0vo O-Mp`4bK@00bW00 V- 0< PL   ?0P o 0PP@v> 01? 1000?0 0@  0?0;`: < 0K2[!4+4`0000  000V :0x0P_ 0TPR dPP4`P0S R~ R z R v 0 0E 0AS q ?@$p'@TpET0}Np0A q0b萝 0PvD HJ0 0I0!|l00R0S1x0R00  C0 (0,' $ QP0 @ "4@RS0S S  xr@p X Z 0S0Y|0[x0 Rwt̰ [[<80>C0: :J0p0t 0p@`P V x0S apt000@@Dp x0@0Pe l  0 0 ^0 0 0 R1 R?Y0 0 0#/!!  . /J㪐 B 0S!0(0S00#0S>0 Av.@ B Q PS000S Q0/ 0%)$B@C "!!b0C0!Ϡ \0U͠ @`<!0S @D>! B^ ?  0$oqp9 p@8phb_#00_0S9@̰p.x @p̰[#< 0 "2#@T 0_0 Q  s!P _T00_0S ͠ @<!_00@p_T00_T0044@-@ aBpTGL00P 0 0R/P/ /$t> h>  DP 0 H Sp@-`P P 0@ #  TQp Pp /Ă= = H  P/j.0 0# /P/0x000@-PP Lo>O@ 0" P0 0܁A-@P @`pP@0% P PPA-`X@@P jNpP@0& P PPA-`X@@DP H@pP@0& vP PP脀O- M` rpP8 찟`萟 PP P oN@ & MP P0S Y Ѝz ,/@ W X D0p0S6 A-PpQ `@Q P@D 0DB(000S  z@- M`ppPP( S^  00S@ H^0"S" 0p000S0 7/ Ѝ4^0"S1Ds\0pT000S @ Ѝ1Ds$ Y0yD yC @-@ @O-`P MU PP2S1pPK P@N P K <10`0@P6 0nS# =NPP00Q Q tP  K@^ B"  0\Q 0 000oS@d000S kip Ѝ4 ^[Y3 w O-BMM@p]X 0 0SP:MPP $ SPr00V0P0 C `KP@@j&0 PPp 0P0  0PPp pX@P$ \zРD 0 dQ`k`V` pP V r| 08XP 3@PP0 PpS Q P] 00BލЍP/U ` P p@\0SS  :HPBލЍ 0H0H 00PPp?  G\ P00 0Hh!0 0 0\D 00 0HtP`\0   ek^00!\ 00 0GPP{\ 00 0GPPo\\ 00 0GPdA tA Pؔ 8@ > $> > > \> T> = = = -M 0  PЍ -M 0  PЍ >-M  0  PЍ ?-M00 0 hKPЍP< --U( 0P    0/ 00 }}p@-PFGU@p[,,0 ? P  5/p|; p@-PFU@p[,,0 ? P  5/p\|; @-@P 0003/|x; @-D@P 0003/{8; p@-PU?o@20S 0 003/pt{: p@-P`UV00P00@Sp$ 0P5/p{: p@-PU?o@20S 0 003/pzp: p@-P`@Pp`[((0  @p@/`zD: p@-P@P p 0 003/pz: -@- M  vp@(0$003/ Ѝ@ Ѝ/y9 @-vp@0003/hy9 O-$M`Pؤ@ 0 0?P0Sp$ЍZ0 (P@@4/$Ѝx8 O-$M`Pؤ@ 0 00Sp$ЍZ0 (P@@4/$Ѝx8 !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////<8 (8 9 8 8 8 8 8 8 8 p8 `8 L8 48 8 8 7 @8 7 7 7 7 7 l7 X7 D7 47 7 7 7 6 6 6 d7 $0(- C^ 0C$Q :$0S 537$$05 0;A, 0 0#  $0 0@-@$ MP05A05#05!0%0% P$00$0Ѝ0$0Q  S,0 5,37$050$0/S 5<37 $050 0$0/0S/, p@-R@pP$(ASp0$ R05>37$ 5 $ !PpO-0@DMPT؆p 000 \0   C N \0 \%3j?F$0. Y,0 @S 5#37 ,05Q0,0m,0 S 57,05 50,0S R0#0C R00CT,@DЍ%3j8G$0P$p 0\T@d 0S1 `@@0 SS( S R 0C#@ Y0 00 P, Q0Ç0,  0, 0 PX@0S80S ,0 S 5>37,050,0 @Q , 0R0537, 5 05 , RS #0C 0S 0C 0S 0C`V  FV")VU*0FSQONMLKJIHGFEDCBA?><;:98765bV1 ?R/0S, 0 b32 B012 00@l 0 00Q,  P0Ç0,  0, 0Q @RfV ?R0@SQ  b@S9 B88  C# 0c1#00FV 0, Q05 705 5,5, 00 RQ05= 3 7 ,50,P}@f %:u0@$0@@@0TS`VP=0FfR?o20S00:FFRoQP Q P=V, Q05`705,5,Q,0 P,00,0Q  2@ Rj 0Sg [@@  0P[ @  ?RQ0@SN b9 B88Y00@F 00Y-M0 0 Ѝp@-MP`@0 0 4/ЍpG-PRM[  `Tp{PCa@/GP @1< 0p00p. Ѝ80S&  0< 0 p00pmW0S0< 000@ pp\W0Sx TW0S X 0 @< DW00@W000 | 0) 0S T, L) + (@- @MЍO-EM MpX@`PFp+aB tY0P@&T 0 hY@0PTx 0  Q`, B  BVEލ ЍV00V00\ * @-`@M pPQP% /X RP$  rR$   0@ P@ rR  Ph 0 @Ѝ0 Ѝ@0rS V 0 H* ) 8P A-`@#4p 0P/S /XP @0p S 0 S < |Up@-IMM@`PP bp 0: S X0 0wp IލЍpSVO00@IލЍpKV00`% p@-IMM@`PP 7p 0: S X0 0Lp IލЍp(VO00@IލЍp V00w -M 0  PЍ 0P 8 Q  8 //p@-@P P`P  PP u GP  p@*PPp-404-0 M  0 ЍЍ/ 0P --M  Ѝ Ѝ// -- MNP8 00  0 ЍЍ/00-@- M@NP  Ѝ@Ѝ/O-`Pq,Mp;  RP$ Ppp @P$PX P@ @ 0 PX N ,Ѝ000:Q!0P00,Ѝ<p@-(MP` @k& (Ѝp0 0 ꤿ0p@-@`PPNpp p@<0< 0p@-(M0P @`D& (ЍpT0Hp@-P@0 @  0`)Npp p@m00@-,MP@Np  @&8 \,Ѝ0\p@-PT0 (M@ 0`Np  @& C(Ѝpd0C-PP@,M@/ ` p`FV`R V `@0@ %T M ,Ѝ00 0:200,Ѝ<p@-(MP` @% (Ѝp0 0 Լ0p@-@`PMpp p@<0< 0p@-(M0P @`% (Ѝp脼0Hp@-P@0 @  0`uMpp p@y000@-,MP@gMp  @g%8 h,Ѝ0\p@-PT0 (M@ 0`NMp  @N% O(Ѝp蔻0 P $ Q80 8@-M80@08 Ѝ880/LL0000 0<Q 80880Ѝ/0lP/p@-@0@00S 000 XI t PP `00]B/L00p@KP,E\0  O-PPMt3 0 0 @D ` p@ P P00U tpp0 0C) Y 1ATT00  RF LD@D T\:[ 2 0000~`K L V00 W7 1ATT 0`Fs 0Ry |L 0e 0 B_0SH hL0Ѝ V0  0 J WL 0 @0pHX<0S3 03 @Lw 0 B(@ 0 B`F   B,LtZ 0 B  BL 0 z L 0 0S B 0 0 b00ꈹ 0 0 00p@-@PKpp p@0RS00 /H0H0p@-@  @PKpp p@ꄵ040 Q00 0R00 /$0p@-`@PKpT T   p@php@-P X @ 00`KpTT  p@p舴0O-P!M k 1D`00 S,0H?@@QZp L 10$+10[?Pup , PPDEQ|`0Ap2 @[0S8 0? P PP@[u  ,0 0 L00GC1  00 0P,0@Ѝ Q0 00~40D0D 0@-00 @T @P80@080@-@P @P80@080-M0 Ѝ-M0 ЍO-PiMOȡ@̑ر Qp`P P?`K͌V PT?K͌U P?F͌(Z P>F͌(Y P>C͌ 1S PD>JB͌81S P=̌[ ~P=^B͌ 0`3@@@ 0S7800PH0`@P@P @P@P@P@P@P@P@(@P@PP@(P@Ppx@PqP'( @Q78 x00C40S000C,0h0PD 00Hp(0LP@ (0a P[ ,0` 0` 0[ k V2 p @T   @T,0[ 00 p @daXh@0 0p@pTP' W 0 V `0 1S@ ,00 0 A1S D 0|0 0?piߍ00X,,P࠳0A Q X,@<00@ P$8 Z&  B  @R=     pW  PpqW0,PZ  p,匰$ [ !p0@ @pP X 0@0 @RP8<0\(04 0(0R"DHpLP@1H00PXPPL$P0P0 001P0,0P00T0JX0`P `<@@(p08`0P0J0DXKD0T0p`,  @  V f`p[0@0 PU0 PU0V,  @ Pܠ就ZP 0@PJP U ` [p0 @X @X0 0SX , \ @@ , XH0 p0尡_D0|H 0 o>p` p  0W  0Hp `  0V p 0G` P  0U `H P  0Z I P  0Y JЁJ P  0X Kq Pp  0W L^ P  0[ M,00@P0(p08`<@,  B U+@@0, P  , 0T0H 1ʙ D@  |=p+P0(p08`<@0@4  P ! , @PB BZ [ Tb0p㸀`, 0(P0 08@ < DX\V f!`pX3@ 0 P U  @PU 0V,  @ P封[P0 @PP U `0Xp8@(P0@<DX\Y2Z$< ,0pPC`@ U*4 @,0@1  ,Y0 0H 1 DP  | =p}pP`@@0 0 0R> $0SF 0P,00U 0e1$0PS7 0H @ @  Z  @ Z , @ $0Q1B/P`P\P/ Z   `P 0,0 SS,0 P 0`0C 00 `, U# 0 0 B 0!0`S:  0 P 0 0 @ T @T0,00 0 @0,!,0R0@0 @1P``P$P Z  P`$` 0SC 04 ,01 X 0h1 0S3 0 L0 P @ 0T0p00 @YT0 ,00 P @T 0Q1V@` @0P T  0`,0 S\,0 @00C00, Y# 0 0 B0!0@SG  0T 0 0 PU P U0,000 P0|,0Q0PPa-@ p @`pg0P: W  0 `@ 5 0 0R080000SO-`YMq0tcSA P T3? 00K͌0 0u0S3?HPK͌0H0v0S2?p`F͌(0p0t0S{t2?@F͌(00w0So(2?pC͌ 00y0Sc1耍?B͌8 00{0SW1? ̌ 011s0SK1?81NB͌ 0810 @Yߍ 00u0Sl HPv0Sw p`t0S @xw0S pqy0S 耍 j{0S  c1s0S N [<@-M@ @ 04@P$( ,ЍX0@-M@ @ 04@P$( ,cЍ0`0` 0 R/DDQ @Q$00?H/ᰖ0|$T0P0/ D @  R #@ R 00?H/8|$0P08 A-D   R'P?HU0`@S,p10 0D C  \(  @U@U #@ R 00/Е|$0 00Ĕ0tP h H ?30 R - D#@ DR<0@ 0D//ᤔ|$O-PL4M  0pS4ЍPD0L |c0! 09|@Pa 0`D0ZP`@0PZ0 TVP V@|`@`9P! ?3 R #@ R< Dp H0L |" 00( 29_9`P0S R,@PR @P0 9 R0`SQ4ЍT `@000  0`Pu @|`|$0 00^갑0`0` 0p@-0PU 0@S PIpp萑0p@-@P 0PS P2pp0P0% H -? \| 0DR0 0 0R S0@ 00\R  /̐|$0 00 0 0 0 /&O-,M|R@x2P0`0Vx `":\\ XrX L"LŸ DD 8"吢 唒圂0 00$0 00000 00$0T0  C10l01 0m010p0npp 0@z0匲 0吲0唲0圲0$TX\`lmn ! 1Q0o'0 0 0 0 u,Ѝ|00 0000h000`0\0X0X0T0P0L0H0D0 @000ď ( hd0C-pP✂M@ wPP t2j+;0@@ #B*@ @0&`@2 0C @@A3PU C pP pK 0p R\ @B0 @@@N(P9 0 @@@C(P.  p* #p& p0 @0(P  &h000S :3S ЍP ZBT2T@ TPЍh0S0?pPb " A-Z`ppP YB&2S@ T000 R A膶 A 偶41[0@-0tM,@ CS:DkE{] RoBKC[#00:0A+80_00o0 kA{A<0 K [ + A56Q㏊B R 1 R 0S8Ѝ0Q 0 0 0Dpl0A Q Ѝ0 '###|<>*!f><^v@0l 0 S/G-MTȤPpk @+(@YT($p 0CS0Sl3XPH$H :k{K[+; @0H`80@ &p % % % %!<%8!%,!#`!#"%("$%P"4%x",%"%" #~ $@!#!#!d""e"#-fh@#`"jlh# nkp{#rKt[v+x;z |:p R 0S (@0800S \ЍQ 82 0 0C '~l J @@\  0(PU(p00Ѝ>A@J@ < ^v#x:'~#{ #xH#up-r-o`_l|iofpcr`y]zZ{W@|Th}Qv +,-.`afghijklmnopqrstuvwxyz{|}d; | XL@A-'n\PP p  @ 0^(PU 0(`O-M`6 6006006000Jҽp−00SVF  p ,p PP_ > p?P4S S SV0SpPr 0@p   $ `00 4S 0 0 40 s0 0bR$ 4S4 0P%00Ѝp PP 4P4 $0$ s 00bR 4000P ?21 R R0  ;0r $Q B q 0 ; 0cpP/4 S S040S% 4 000r0  cR$`S ,4051E `v prd0  ; 03 p PP4P0uP0PcRT T4Sz0y$0P s 00bR4S 000V0SYpP 0@  ` $A `00 4S 2 0 yS 2051E ` pJ p 0$ "P0 s0 0bR40 ;0pA P= pi 40 s0 0bR4 4$R2P0$0$ 0Cr?o  aR2$$1E00#?c p p 0pU 4 00 TP0uP0PcR TTe40 s0 0bR41E00#?c0`00$AR r  `R$ $ Q 0 0 0 4 00 40 s0 0bR 440`00T0! P004mPT`.T.H.-`*l) ( 0  ;  0@āC/<'O-@PTDM4P0+ 8 `$Qi w :Q|#R3Z 300S 8 pM0@ C0S0:3S X00P00 ! 0*`00<00z ( 0 00v0p@-@P<ppp@D0D0p@-@  @P<ppp@pv0A-PW<P @pT $T`0 @@TPp00<V>2P@P@P@X@-@=P @=P %<P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o" O-P0M(fS`pvpJP [T0ʍ p 0rr I"Rp 3S(0$00 0 :PK nT9P e 0XS\%$ PT 02P<50 4504S0300SR p0SO 4SI 4S 0d/、 @V㌑T2p" =PT 00@p2Z LQU  P  P 垌P ᑽᎽoY=t3@x2 P\ 00@x2X>3@|2  Po 00@|2gЍH5S4S 4S0?o20 hD $@$ <% p 0$0(0eX <P Y <P Z <Pp2?;~0p220PX0 0rr H"Rp1XF  j<P]Z<3@x2Z  `<Px2?;~0x2V  V<Px278x2Y K<P<3@|2Z B<P|2?;~0|2V} 8<P|278|2t1S0- 4S)xL%R&nZVO  <PJx2.#@|"78x2WY~ZA />3@B|2LZV+  <P&x278x2>3@|24p2Z0@p2VZ[ ?C>3@|2*P  ᑼ>3@|2P >3@|2t`   0 00`m00- $ Tx Xl l  \pT 0t 0x|" RRm L804  P X0 0//lO- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-匑\ Q |pPl0@`P QV00` aP2 _ /0M CR0200pP00 ;P ?0P ;  Bⰰ +!;`帰 就帱0 B`y5Pt0@0 <00K0& kp 0  A-@PW9Pp Pp@p `EPE`0 |2U @0 o 2@ p@-\`P@T 0S1 RT0S@@P0SKp@VG-l@`pS0 ST0S"Q0S 0ST0A-0M`@@ᗹP+ _ /0@M CS@j0 @ 0K~"  2 0QU 8 P*#* _@WۍරrFLd X - LM  R  ʂ0   ЍhgX0 Q0H00S :\@- &o/g0 0p@-P0S :@#RA# #p ` 0:P #c#p# B&%0:#!BA##fT0 P-0M 00S ʃ0  > Ѝe804  P T0 0//dep@-PႺ|``p@0@ >0SP0P0:3S 8 L40 0r0 :#pe O- Mppl3 dS0`P\0 *`B'WX p p PT p   r  `R  00/"1 R# @0S S9 SW0C S p2051E `opx  @U ` Ѝ R k  P   Ѝgp P ` Ѝ0 r 1 `R R   S7J @y ` 0  S $q 1lR Q   Ѝ>p   B/oq"`Rm0E00#?c Ѝ 0T0 P00-4  pd088 H G-@P$c$3`pZ 80$ RG V ʌ3S23SmX " R ,8 l0 000:p=!0\ S0 0 Q/p@-@Pp80pPU,Q (00C 0PS0\@Tp"80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p (@L0pTЍA-PPM Q@`Q00?`FV`V` ,p (@L0pqTЍP/\ , 0 B0/\//A-M`V,P@p (@L0pETЍA-M`V,P@p (@L0p+TЍ@-PP M Q@6`pV00Ӣ?/`FV`V` W 0 @pLT Ѝ(1@ RR( RR T 0 p@-`V,@a Q(0P0C0 ^ S0Vp(, 0R S0/0@-P0PU,Q (0@0C 0PS0 U^00@-P0\0P", 0 BP 0 PU0,Q (0@0C 0PS0 U0\0O-0 lM4P1*YCTb ,P@QC8 @$^;RC 0p0P00@0 0  0Q-PCp4S-`=0@PP# @ p) ,(4,  [ 0* 3, 0 4 lЍB 09lЍO/O-0:$M $t00  PU $ `,@Ta 0 `P ݮ W):0`SI   0~@PH$Ѝ@`00S S9 S0PV!W(0004S$ЍO>0 @0S G 0W B20RP  pGP0V 0pG P *1W  P0@ G`QO-M00P0SH3 `3S,[*Y> @00! 0@ @00@ v+TP0 { p @` P @0S  0 `PPEЍ` D UP 00 C40/Ѝ @0 3 P0  0 /400 000S :P /h1L0 H0 0S :-P /$1400 000S :P /0L0 H0 0S :-P /0400 000S :P /(0H@- @@\ ʌP 0 @x/0 0@-0@T J 3$S B0pQ F8@.P ) @/804 000S :P U/.X PT 00 R0S *P@04//.000 000S :P M/P.L0L 000S :P @-<p @/.0 0A-0`V* Z 3$SP! #Rp@4S@pp3Tw A#B0tQ 7A--,0@- @  @^,000 000S :P o/,00O-` MX$ p P 0 ቬp @ႪP  0 P}p@ 0 #@  Ѝ@\,P  P /p@-JP x3S P`4`0P֫3Vѫ  0s3 S00 0P 2 $R 0X0S H03 20X #$04p03pp<p@-jP 43S @P4P0@⒫3Sp@蚞A-`PX JSU"X p3 @R S$ S'X 0lAQ0, X0p ,0\ 1B0010L10|10 A0 XP3PSSpP4PStpp3Upp@-@P X0P:"C0T0XppG- Ԁ\.P@p  `P LTL VW PT WV  H000S8 0ᦫ0 0 0(|O-( \ @pxP`7PPP0 C CC0qP( P@@V gP P0` @ CP0 @ C\0! 0`0SZ03@800-`D'|0@-?S0Pp   0 P0X( @`b& p@`^  0000 &<A-@PQP% ~pW0!  0S0U,S000 R   R   R  P V><48`T `TX *P Q Sp QW02l%p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S B03@0SpX@ '(@ 8Q0@0ppp@-@PXa`R X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  03@0S L000080S@078@0pGp "D0D 0 0S P@ ?# Q@080// 0$0Q 00/D 0$0Q 00x/ 0X0X0p@-@R ` 7 #@8(P?cpp0h0Qd 00 R X@078@08Q@@//x00 0000 00,0p@-P`0`0@T X0:20T1S@0?;@0\<000080S@078@0|p0P Q@0?30R@080//Rf/R/p@-PS @ `@?PppRP X @0*7"8@0 8 R #@( @ //P@/0p@-@Px`P` X0:20T1S@0?;@0H8000080S@078@0p0 0000TP PR  R ! R! R! R (!R !R 8!R !R  R/L1S/l0 0000TP$ PR  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/p@-Px% @@0 0p@ 0p@-P@g% p@p0 Ql0p@-@ 0P00R ^ p@I% p@40L0L0p@- @ P$pp2% p@0p@-P@$pp#% p@p@-P | @ 00`$ppT0 T ^ @ p@$@0p@-`@P$ppT T  R @ p@$@Rp@-P@00S ^ p@v$ p@oO-`, D | 0P0q00Yp  B PY 0  0CIL0 SP 1 ЍTYS00CS``STZ0JS` ZPZ0 P0C"Zp|0 000@-@P`Pp0^0C (,, 00^00@UP 0S 0@//P 0S 0@//P/P/P/P /P/P/O-PP! + 1СD0 , 0S 1H``?c`@ p0 @s'W#갑@W0 8| 0 0p@ P @0@00C W|0 00L0X ?o 2 R0S P 01 //ت-(^,0R0^Q!R@!1 O-MA0@0S3, @ P `p0S! S#A 00 `0C``P  (0R0 (000C0T0 02/p 0P@S(  Ѝl (0A-S$p4@`P(0P@SQ Qa ppQ p 0p(0p(0S/p@-0P`@. (0@SpP0@-0^ 0 @ 0 Q@RO- M@`P VTppD0S  00C(000@0 B T0@ 0S `%,0 R@p @ⴀD R`Dp `|bp Ѝ@0 S RQ Ѝ,P ,0ܞ0P `00V  ppG , B(p!B, A0 T`  `  0Dp4౞P , 00@Hp`4 0Tp `0Du@U   PB  0SQ 0 0$ PC 00\R =@U 0 BQ 0C R G-@Ph 0pS: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R00 0U1Q0/P00` 0S 0 0V(W ѳ`F`V`0XPU0P`W`V``0 @p 0 $p0PEPUP 0 0PD Q P/$ $\/ P/A-`PAPQ@P1p0$ VY 10 0 QV$ F 0R U EQpL @10 0 QV$ F 0R U E?p:   0F  Q SC$ 0R U E)p$ 0*$` P0`00BTP @T 80@Tp` 0U0 A-PP0P`00pQ0 0S:@$0P mH00@T 0WP, 0S) 0@- \%@T \8x ƌ8 t ,0@0@PU 0P0U00 S0/0?o2?=X?A-P$@`V0S4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P 0 Q0@ B( `p0,0,0CA@1` ;0S( X @- 0B 08SE?080$ 8R  R 00S0!R$R R d1S80080080 O-`QMRDp0[}!PPx ሰ P,q ћP@0d W4) H0X?@S < ``@ `F0+; 008+;B H0|0$T`7 P \ l0 @8*BCЍ㝛P4. ٚP( :"R! 0 RH0SI 0p V0 0 @@  ʨOЍ 20 .,P(A-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,BPP D00cD0C 0R p$`!b00P@0RЍPЍd@-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ`@HP `JU@p_WNVPED 0    PI L1D00S*Y p$`(D0@p`0S00,0UD000@UpC0@aCY Ѝ00H00H0t  P PEP` V IIP ЍP @|$ 0@-@P0M0 t l 0  B/o"  lPP ;Ѝ0PЍ00H@- @  0M0 KЍP-00 Q08SM$ 03ЍP8 /-M 0  0N NLN ЍO-QP 0<000DL00 0SC @<000h0S80@0805 L00 R08d>P( 0@y0, 0!0s0 PT# L0 #@@  t@T,0Q0@t@T4000SL0 RR 00S0,t 0T` LLH DR4  , !$  Q$  P  r Q , R  , ,!$ 0  R 40pT@D0|c00 ^p 0SL01H@400 0,0000,00 0Yd0Y 00S 0` S0F 0RW4000,000㓉(0#I0CYJڸP0<0/o"0L0S0 R d 0YP@l00P.P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Xp 0 0S 0 @V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s H  H R 000S9 80 T8( 0`V 00P0 0C S80 @T@0D  LL l80L\ɟ`Vuq8( 00S;0 5# X0:h2( 8@g0` 034 0 P00P,  p u'00S  @G p` 1P11qW87r4'40 !<00 00S 0 5# X0:h2`40V @ 03@0S f6( 0pQA0A 00C06dP 0 S/ PP& 11 1R@Y RRQ 0  X %(0 R 00S0 0p!|5`F0PAp`P@ 00#?3 1pGW1aFbP `p?0<000L00jP 0P0P00'X X0}P0H0T L0 R y080  400 mL (4 0 p`dЍ80i 0aP TD<00 RW 0 R PP!YR   gY $R\  0E0 0pT  0E  <000$R ( 3@ L000S2( 0<000h0S0C  0 0Yx 4000Vgpg`  %L00 R d1SdЍ40 80@080B1P00C\L0 ^A0SB YX1( 0, QA@`.4`! ,\@XP pp@XP HP0@, QJ   4p@,@ APWp@PT ``h{{ |@v- H- tsLjipi8hgl`PTp P0 @`, AV@ TqL@DPP " X @   \`Q  ABQcP P4 BQR p @ p  ,@ 0$8  R p p P p , [!, !`u @@`[m P0 p RPh   $  Q p$,@P08 P LPA\L00 0`, Iy# @A]0,  \* `@0040 b00C80&0 @00C40i0 pPWzp  P,0`  BQ W G 4  DP @ \p 40@ pIY L00I D |%p0TpP:W W0P@ v@DT 0GpG00GD@h00: 40 0Rpp,@0A0W,000C0P 0p00 p0E,0 P0Ua U R R  W R R"R10 S0@a 0 R@8$ LD`P@@@D ,@T \E$ P `0B8 B0 B0 00C 0U40P P0,0a0 00Rh400,@P d1S ( ,7@ k <000!R 7Q R dP  P@ ``E 0E00p 0E  <000P*88(  &<0 00D0,0 0000Sv 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S< ` T9( @ 0  `g@ 0 `C0` <000tW + 0 U<`? 0 0LtP6Pj <00p eU YʕbH5Sp@TL 0$`P@@U= 8#8PP `$=Hp@-P@0 @  0`pp p@*dy0H0H0p@-@  @Ppp p@y000@- 0Pp/ `00p@SL,0L .W @0*S /SR@@00@@@@0 00C@@0`` xO-SMБD@ HP 0S p` @ 0Z A 4/  Z8 $Z <RD!  . R !!! >E P   @0 0~00  HPr 00 R0S0 0?$P4/ZWЍ H\r 00 R0S@0刀0pP4/pWwZhZQ" @-@M R ! R "R pP^  0 0@aЍ /@-0QM   S S PpP$@4R @ 7Ѝu00- M %Ѝ+@0<< -M Ѝ=<:s876543210/.-,+*)('&%$#"! 8 0 S| 00PЍiR%@0 0 `fv`  00S1.R0S*R 0 Sg@0 S[0@0%0dR% @00@  d 0 S20 @0r 0  0 0J0 St00@ s0000  00000 0.0 S0[0@%  0 @  %# 0 Sr[@0 % @0  00%+ %#F0 0@kP0 0 @ r 00  C C0000< @0D@00T0 S\R Z I00 S#0$,  ;o/  000S0\S 0 S00 C0 pRQPp@-@PM0P`0S PS   0 00Ph 0 Q00QH  < x0 Ѝp0j""!p!A-M0@HSD!00@0p0S= `50   1N;AƒKa1#bP0 P  8 g=M%02#cQP 0 pW$P@PW 0fSPЍЍ 0 ЍiMA-M0@HSD!00@0p0S= `0 U  k<7@ƒCa0#b1 ! 3>C120BQ;0P pW$P@PT 0nS(PЍЍ0"ЍPhLO-M0@S!0 0  0000S, Phqb*cEz 0 pƏ⊡ - ?DB%.b CĠ #W =W =pP[ 0000pUPQ  XW   RRl`byPP U ,00 mW  m0SU $@(0  "K%ᚂ!b  P嚃!2c 0P 0 02#c00P0 pX00$0PB0P,=p@H@Y 0S`@Ⲁ }md `p`tm [Y00\Ѝy$p4K(0 ,(k@C3>C lᐡb  ! 120B P0Q p@00K$p℡ (0 (-8 ?T p -000 Tk@@0A@?SX>T0 p0A0Ds=Q=S9|7I_hm}^0S -00X.00  X@ E0l@! D0 Cr 2;0X'T OP͍ R'R ͍T0   R'R'Rp@p@I@`VuP` 00040uP, 00000V0R 1X!RL 0BS11ऀI PB=&@DQ1VTxvutqqomlkjihgfedcb^][ZYXWVUTSRQPOMLKJIHGFEDCBA@>=<;:987654321/.-,+*)('&%$#"t1S 0C11ऀ, R 3@ RX*P  0Yp 40P040OU7 =@!1ऀ0100L1S 0C-11PSU #,Q!*P  4 P@6AT @D=AA0@a DrQA DR3@D1@ڕ#0S ?R ;RH p0S %S0 0@a0Ds RA0DS13 DOS !01000@Sl00l0 0St00t0QU PE=@Q1P *OU?=-!1P@ Q @10Ds R-1!ORTP=@1p=1 !T!R   B!!0 @RS^  ?R ;R QeR p0SP %S0 00     00C2"0OQh0͍}SS  0S}S}S@p@r1S 0C1XX   R!#@,Q*P  0Jp 40040@N, 40,qߍ! 1K00PQU PEQ1- @@OU=-0@0@P1Q %-1 1OS00@ uP 400@,T 2 tP 400,X ᐢ(XPPÐ@oᨂPX ۾@|yvQA@pQA#QU PE!TQ1- @OoBT 2 tPT 400,Sq000 j0 0.e 0 n`00@^xW00T&@D0Q0VT1/.-'*(&%$#"! w dR<*@00N!@DOo0B00@000- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/A-pQM@P 0S! XB sP &`V! v00* V U{ ``ЍjpPU00c ``U ໮% 0 0 R Ux ୮U`৮P0S U,  hDrfp 0S R s0r (0 000SU00P |f  p0(0 P pf  p00P^U<X0T( l D  t 0R@-M  H0S@  Ѝ0A-pPP U) p@T`V 0PS |@P0D]V  P oA-PR pQ 00 @`R P0 C C0CP ZP (&T0 ES  rP  0 000Q 0  R0 R  P U Eq0V Q ^`̇QP 0S  0 S o W0C  s0_S0S  0 S  RQV0C s0SPUE P 0$XGPG " X$@ : 02 0nP< sPJ fPW P00R00V0S   qQ :%qP N@!qPJ9qPL2$ PP r$Pr qP$!W  P P ?V00S    0SP V PC-@xaMt!P`p 0݃ P 000S; PЍ`P P 0 :p R 0S 0PP  PP004PrЍ 0 P @`+` P *`P<4 TO-M Mp0:S*0:SS@ 0PS:S``#E PXP  1;0  0dAiP 0P:S  ۍ Ѝ@ ۍ Ѝ ŸC-P M@M`ptP# 0/SC P/P 0 ۍЍC0P ! p P,tl0P 0S/S pP 7qX 0qX P 0 ۍЍC0 PۍЍ p 0XqYW P0L 0 $ۍЍ404 0 $ | \ D @ ԧ  G-p`@P  ^0@(qT  TP `@P@d @P PU   0!G,,-@- M@@00 Ѝ@ Ѝ/E Ѝ@ Ѝ/ 0p@-S @0  p0000  P 0 p@-@ppp@pp p0p@c 0p@-PS@:pS pP!p$o @-Q @fRQ ^nR sRQ 0  \ A- @X p`fS@X P0@P0@nS sS@X@@ 0 0S00@PA-P# P 00`p`0,SS00 0\,\@CnP  | x`p`@< G-pL@`Pi P9pWS*nUJ sUA fUH0D Y#R< @ uoPF H0D@p H0@0H0=H0nUp@0 H P4 sUC fU; L00L0@P@ XP00W 0 0,00 Cn 0S000 0 @ QH0 $H00H0H0@ HH0@, ( H0@0H0H0, 0H0$PH00H0괒 ` , O- MP OZ p@ HpY ` A`(080H0mP- 0@   Z0p@   @Y`@  00@Y V0S@P0@ Ѝ0 0@- 0 @S* 0\ Q \R 00\ Q  @00 RER\\x  :Q  R00\8A-`0p @PPUR WnP!0 V0 00pp   0  0 0PDmO-@P0 $M 0fP pn`pV`300 `Uu n P  p n|PP <\Pm0P n00$Ѝ 0 n}n,`$0V p C,  PY P PR 0S00kPL `V00[nLpD0W@ @ CL 7 fS+ 00   `P pW P`0nS sS Y `` 00 n$Ѝ$00__P}ꤛ A-P0p @``VR! gmPA0 `0 00P 000*f[`FPPl0A-P p@`WR 7mP0 ` 00P 00 0P*lO-TMD0D $00, 0kL;040`P | |@P00PP/ 00YPT SP.O?PPlP  !P2 U 00T 0#$,1P p. 0p0#1(00S% ( .S  ROS= = @P 0 0pPu< <00Q4 Q 0/ R$,P6m TЍ# PP9 @ p@t ,0 S Q0S Q0TS 0 Q000`00,P+X ,ol0S&pl % @0@Sm 5p@tP00 000 000f0 PW ,pp@W 0 W   `i  )\W  R[Y!%P^WPk p@W  0 0C/S Ru  0P ,p\0G| RE G/R{yxwvutsrqponmlkjihgfedcba`_\[XWVUTtRrPON}~pW@ W(&40p  @ p00@%40  6 p`|00 L^L00S P P^ 0 Z 0SJ t 0[ 0 00 0000n07pp`j  00 P 0R  S 0Q p`       $ 00 /t 0 S00P?W{ p0<80@PP 00Lℓ^0 4  T800pLS<@PWppp`2 0 0  000s0]P ,pBP p@tu p@t: ,0 Sd Q0S ] Q'+PbTP $P40  O[ 0 H,p ;P00F P p@t0L <00QH Q 0C R 0  \^ 0?P$ 0 L0 0 0S00P 0 E0  D ' 00 0 P  p<@P4h2  ؐ \ ؐ x t  P/$P0 00 ////d@0@-M@D0 CP k<7@hLBCNCl0#b 2 "0#AB@C1dPЍ0@1P00&>//?@-M@ 0 -8 ?p@-0M`P02@P 0ЍpE]0 0  B0S Q20ЍpT1!0G-@Pa0P05 0 p4 pS002,0`PP0  |p`Q  MWPepEȄQ  BW| 0 ȇ0H00@#8p@-@P iii i$i,ii,00!R  ! 001/001P//| @--`@@ X0@00s@ H PJI HH @!Pp@- @-G7@@(M `PRmY=miQ|cP5+@|a!~nU+@ lx\ rB'o2bwSRQPO)VLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " U a  !00 (ЍpP P # U0  0: 0U5!00 P ~Pt D# U0 0 0"dP 0SC n!00 cP00200U 0 KP 0Sh U!00 cP00|20U 0 a  /PM  cP00i,20U 0Z 0"P 0S '!00 cP00SU 0 " P   rcP00Zʈ10U 0 !="?7D",JP  ZcP00,U 0 " LcP0000U 0"?7L"P :0S !00 2cP00ʔ00U 0"?7L"P  0S !00 G$!P < L @ 0 h  < cP00$00U 0"?7L"P 0S !00 cP00ʈ00U 0S 0"iP 0S s!00 cP00600 0a U  MP\  cP00$ʔ300U 0 ;P 0S E!00 cP004300U 0 "P 0S ,!00 cP0020U 0"?7L"P w0SI !00 ocP00p20U 0"?7D"P  \cP00e(20U 0U"?7L"P J0SQ !00 BcP0010U 0"?7D"P  /cP00|100U 0 [ P 0S} !00 cP00# 100U 0 m P 0S !00 cP0000U 0"?7L"~P 0SB !00 cP00`00uU 0 fP)  ؁ d    ~ 4~ 0 ~ ~ | T| { | <| { cP00400U 0"?7D">P 0S H!00 cP00ʘ00U 0y"?7L"$P 0Sn .!00 cP00?00U 0/"?7D" P<  xcP00D10U 0"?7D"P  ecP00Lʌ10U 00" P T0S "00 LcP0010U 00"c P ;0S "00 3cP00^L20*0 0Ra U  P  cP00p30U 0"?7L"P  0S !00 cP00 30U 0"?7L"P 0S  !00 cP00#ʨ20U 0"?7L"iP 0S s!00 cP00D20U 0"?7D"OP  cP0010U 00" =P 0S G"00 cP00ʜ10U 00" $P 0S ."00 cP00<100U 0!    P z0S !00 rcP0000U 0"?7D"P `0S !00 XcP00 p000U 0d P F0S !00 >z Lz y dz z x y x Pw w tv 8v u |u u cP00000U 0"?7L"P 0S" !00 cP00ʔU 0 "T P  cP0000U 00"8 P 0S "00 cP00810U 0y"?7L"gP 0S q!00 cP00ʜ10U 00" NP 0St X"00 AP 0S K!00 20 a U ;"00 x30p30h30U 0?G"&'"00 430,30TU 0?O""00 s20U 0?G"4"00 e20%0Uj!00 X20[20rU 0?G""00 GX20P20U 0?O")!00 620U 0?G"i"00 (10Z10jU 0?O"!00 10t10U 0?O"!00 p10h10`10`U 0?O"!00 ,10$10U 0?G"3!00 00$U 0?G"lv"00 00]00U 0?O"e!00 00x00t hu Lu tt t   4O R 0 S. o+7N<$PI@'Np LA0P R $ R  R S /0?0P  ,AA40q@aRA- 3 8S1R  -P@. 0` S ($ R +3/PP P4?p@8p0`P $0(3/p@  $ 4  (0 0```0 P 0S $0S 0S P? @4@P/Q Q@ \@!< < /<0C//?O- 4M00,00P 0S0 `0V0  ?/P00{p=?0U[ 0PEt@T7p0pp@>?00SA )0??000CS?0S 0@7sN?0 QP?0 C0(0 S@p0(0g( ;?O2`5?0U 0PEt@Tw0pS =0%T0PEt@TU C0 ` 0,0 SP0\$ @Dʈ7~+D?q@D0D 0B $0Sp0  0p7?@06'8w<#0#Y 020JK?HL0.0DSB?0i @p  |2060q @DS30P0;T0X0CG?0 C 3q@D07~D@N s Pl0{1r0ರ^l[0PEt@[UR!B"0$ 8 S 0l0S>0X p0P0tXp0  P 20 :@j l200@p 0O?0( (pd,20E?l 0T[l0PEt@[fU0 C00St 0 0000 ~$1岐T*Ul $Ug PEt@1岐^ 7sQ0D @C7{D7~D@NqKI?L0e$0SW$   0c@6?p0 (rt0p+@P7~@DL 0@Dⲷ'q"@p |O N O M K J 0L J 0F?l00`P 000/ S  bP00S  ) &0S R?0P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000 @P`^1@0SS/Q  < 02!0C 0  S"$0M< @0 QG Q0c  B Rp#p2W S Q6 00S/Sa @0 < 0@0S2!< 0l0^pP\ G R R 0c ^  R S R 00S  0Spl0Sp0p0C0pp*x 000 0P,0C4p??0x p0 0 0 30 Ѝl0Spl0@@@PP 0S $0S 0S P?,A4 BR/A/Q /@o/A-5PXPv@ 0(+`3/PPs 8pWF ( 0(3/pP00@a  0 Q    +P04 S:oSS0C0P0T00C0T0p0W0Cp1 (0 8#8pPp00Cp0@0 0 Q    +P04 S*p00Cpp$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-R|MP  80 @ 0 C 0xT0SC0p@X0s\pW0-p  p0 |Ѝ0`\`V30sBJP:P0u;J XS1ZP05 0Xs00R 0xPS0RSCP RT@!T0!01 00P200 0! P0S|Ѝ0W0P0S |Ѝ0@ ?o2,0%R00S020(0@0$00($0,0@?o 200040C0 0000p@ 0SP3:^N $ %30!`P3P'( %!<: 80C1 ( RP@00F#3 0Sx $Q Br $ARVJ  ` V  \ F C 0 Z(  V F*x $R AR  BR ^: 0 Q  R`, %Q  RZ  ! LAS4 @@  010(0! 0, 0( $0X O-p04M0C000 CPU?PU@PUA0PUAPR@oPP 0C R R0 PR \:0S@\!f!glU!1^  RX  p\h$X  p\h, Rl R O- M`؟ 0P0\QpY 0@SQ QKW0 S  RE R  R( (pQBWR BQP"S6Qt0S R: 0S S > 02#03/0@S0P P0W W0S0(0 Ѝ0Sp>00000 S *S0SWq00Q R60@SP20 W0Sq S00U0 00#400 03 0  0#400  0 O0S0c0?o20 Ѝ0 0S&+B(l0S0 B8@ B0 #22c0# 0l0S q000 R0e9S 60 0t0 0  R ,00S0Q01$ QP0 R1 2 00 00 0#400 00 00 S0 S 00R01 00 00 R  00 0#400, R E  Q ! 0P B R PE [ P ! X*H ]0 ,0 SR B000 0 0 0 0 0 S0 S 00R01 q00 3 R}0ES IS; [S3 gS3 #0S0Ck0Wi  2RC0SS@ S  00 # #8 00#"0  0 ,  Q R I   R'   0P P0S0  0 P,0SQ4: R 00, R  R [  $ R  9$ 0P P0S0  0 P,0SQ: R00 B000 B000,0S+  Rg00 0 B000,0g  S  0Qf R00 00#40w0q00N0SZt 6l8&`6 &!6ƅ909&tl0QIt0l0" Yt0SWe :W㴖H 6SX \0l S B8 0 l0\000SFK\ R8 C0 l0\000S90 Zt0(l 8`R B  ^C 6&!6ƅ6ƅ909&6Rt0l 0Ct0 l S$t0 SW S Sl 8`0  W 0S0 B000 ^ ^  [ [ [ [ [ [ [ KPo᫲[@ ``S`051:P&0@ƅs04!ƅ0 0!1001  &6`Rt0l 0C` t0l z\0S B80 l0\0-00S=r#  #800#"0 00_ꄪT 0+00i*W6F &RA \ R80l0 C0@0,0g 50 0 005 B0 00L0D!C0C  st0S*l0\06\0l S B8 0 l0\000S201\ R80l0 C<:86420A-`pPSq@PG Q00V0SH81 0P1 : (0sQ Q P00 00000 |0 `ap" 0S$t l00\ R6S S L0D C0 C060P5#0Sppp0p@-@.PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV00PpPO-M`pH0S@DL 08Q1S00PP 0 0S $0Sx wpVoV`F0HSx0FSRt WrZpFYo᫲[iV @(& `4/@Pn  J@0`A4 ,P*   L @  ` B (6/, ` 8(6/L ` @(6/j 0 D(3/80S6! ( @ R% D PR! 00C60p删$0ЍOxv `fh00$0X(0 xЍ",0  000!ꌖ-M 0 @ЍA-P=PUPn`0@0 0 Q    & 0(3/@PR &@z 0, (P3/ 0, 8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 , @@ L DD &!0 0C&006 0&;> 0$0;/ O-Q$M R0   0S!q"$!`Pß@P p`0+0*) `@$z0`&@!y0v0 qp0Pt0A1:SuPPQ "9SuPQ(6SuPQp'P5S>3uPs01+@$ "@QP`0.,Ÿ  "rQ"$ Ÿ! ! q R!   "  "rQ"$  ++ { R+! @$ $rQ"$ S4\@`Q@DPQT`&Qv`a"$&P%uPa PQ"d& Q,| &, "r a Q,d& QP%uPQ&T%,| a Q%d& "r Q&T%,| !%$"C0S 0!^q"$!$Ѝ LÁ!`AV1c/@pt  | P $ C-PRp cmN P  0!\00#@B .P @N1R C 0 @$' C-PRp cmN P  0!\00#@B .P @N1R C 0 @$', @-@P |p S]Np`@` 0!đQ00#B  T @-@P |p S]Np`@` 0!đQ00#B   00@- S]N^00# @L   0RG- pe Q RLuRnq@W-@He_V @0@0\\ 0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 R 0ɃP 7ᕓi΃7nP"R 0Q ?Yq00H/II7c ? Y?II^NNPV=H10C>@@ P $B0R pR 0`RpR`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0 R`0 0@0@0C 00 Q q00H 'ᑒi7n/0R#@-qHp@#/Ǡ @ V  CJQ-{ O0pG֒\0 P4 @ B^S 2ʵσv p X`^ 0`!`P4[ ఐ`G&f B&S`p 0   ]pWPQ=000?10 K`P02  `;I`;Tt !GXTT;0 X0\s0~060v000 `k%[`P`+ZGp 0`K< 0K⳾0 F 0 p@R 0 q0CR Y> 0 BV0 00000C05 `FR  = 0@N @0 0T00 0SQ R 800S@BC0 R 00Q<ЍP  =p`w\ / !02NX1@[ @೰6:#6\Y I 0 pA-P@`QT0R`PE+~P p0T S#|T` 000U0 S@S |jT00 T-`0R V1|T0000` S +-T000 0`0T00 0``0O-M@T00R!+Z+8ʀP c W ~㸐|㸀iQ6s0 `IP000P#406`0cXfx0Z㼊PḀeY6Ps0`PE000`#406P0cXx0AUVq`U0uPPPP0`#406Pc0CQ6T T0P[Q p@`DQoob`V Qf0W Q@z㷀+}hpY6`Hs0000#406`0cW3sp VfPE0Tv`wppp`0p#406`c 0CUVP6AP0[Ѝp尀 phYp6`s0`H000#406`0cWsw0 Vf[ PEpTf0v````0p#406`c 0CUVP6 P0jP0e觮  P`6e@pE SC0t@0P@@@0PP#406@c0Vdv@Q@645P0V/0P2 `fP, ATq6`f0P0pAT6qv`fpP0bv`wp>ʀO-f6M⼖S0 #`P  #  # #  #  A @b9 Ts0@ Bp000@p#4060c^~00἖&R @ P$ p฀n9 Zs0 N0 00#4 060cXx0qX xq@DphWt@>挥s0pH000p#4060cTCt0 BR@@@CAԕBԅApಐpiX>s0I000#4060cWsw0 0@༖^ hD B@n Tr 9s0=@Np000@p#4060cR#r0&0R἖f b ^9 s0@P B0``00@#4PP06c Qq0&0Ѝ0἖=0἖9 0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4j>0C&&0t`A-@ s0`P Q!r  pp "$  a AS2s 6  u0U0U$0Q  00  0 000*0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 S0q0@PP0#4@@06c 0C\| S600@PP0@@@#406 0CS6 S0ظ0@@6 0C606@PP@@!PPƂ0O-Q0  MR@, R 0p&]P+(+0O p ! RDAQ j  &!R:P3 "[y6 S9p3 s0000 #406 c 0CPp 66 O.V G.0 0R0 0xS0  0LS4j>X0C&&, Ѝ O  \ P+R +R ,RE R  Q ,^ &]R3 "[jP ЍOPj 0p\ R3 "[&0 Zp:s00 00 "$ 缦0j JP3s0 Z㼦,N(r :s0s00 00#40缦0j JR#r0{ Z㼦:s0s00 00#40缦0j JR3s0 A Z㼦r :s s00 00#40缦0j JR#r 0 NΌ⼦  Z*r   "$ 缦 j JPp \ ἦ "   P3 "[A r :s0cq#0r  ` h :Q0@-!DƓPV ƓPV @Ɠ@F !6@o0ƓAQDƃ<  Ì!!ܕ"܅  ( 0S A-@pP `0 C 0@9-TUT @,'P r&/@- M@Pp*`P `奸 P    5-p : @P Ѝ @@ Ѝ@ Ѝ@:T  Ѝp@-P{*@P @@tp 00p@-@j*0P 0d000׾ 00Ծp@-MP`V*@P P @O 000,p {:PЍp踾Ps:U PЍp0p@-S P@ `0 Co0@,T 0 p&y1r1FP@p%0p@-S P@ `0 CJ0@w,Tu 0 pj&t3i4FP@p%0S p@- `@P0 C%0@R,T @Opp/0S p@- P@`0 C 0@7,Tp.&y1r1FP@,p/l%0S p@- P@`0 C0@,Tp &t3i4FP@p/H%0@- M@ P ,p  @P Ѝ0@ Ѝ0@ Ѝ00@- M@ P +p y!r!F@P Ѝ0ӽ@ Ѝ0ν@ Ѝ00@- M@ P +p t#i$Fp@P Ѝ0跽@ Ѝ0貽@ Ѝ0- M Ѝ- MtiFx Ѝp@-@P%t3i4FPPpp@-@P%l?o2FP p00pp@-P`y@P  0@$p@-@c@ @-@]@ @-@W@5 @-@Q@N @-@K@g @-@E@w @-@?@ @-@9@ @-@3@ @-@-@ @-@'@ @-@!@ @-@@@-@@&@-@@;@-@ @K@-@@`@-@@u@-@@@-@@p@-P` @P  A0@/$pp@-P` @P  /0@$pp@-P` @P  0@ $pp@-P` @P   0@#pp@-P`0P @P  0@#pp@-P`} @P  0@#pp@-P`k @P  0@#pp@-P`Y @P  0@#pp@-P`G @P  0@#pp@-P`0P3 @P  0@#pp@-P`7 @P  0@w#pp@-P`% @P  w0@e#pp@-P` @P  e0@S#pp@-P` @P  S0@A#pp@-P`0P @P  ?0@-#pp@-P` @P  -0@#pp@-P` @P  0@ #pp@-P` @P   0@"pp@-P` @P  0@"pp@-P`0P @P  0@"pp@-P{@#g>t3GP pA0P 0pp@-P`@P  0@"pp@-P`@P  0@"pp@-`PF@K#aaFP pP U pp@-P`}@P  0@s"pp@-P`@P  s0@a"pA-P @#g>t3GP pA5`P  P `6p@-P@"g>t3GP p0P 0pp@-P`@@P  20@ "pp@-P`4@P  !0@"p@-@R 0@"p@-@ P"l?o2FP p00pp@-P`@P   0@!pp@-P@P "!0@!p@-@ @" @-@ @9 @-@ @P @-@ @i @-@ @ @-@ @ @-@ @ @-@} @ @-@w @ @-@q @ @-@k @ @-@e @ @-@_ @, @-@Y @A @-@S @V @-@M @f @-@G @{ @-@A @ @-@; @ @-@5 @ p@-P`@P  O 0@J!p0p@-P@P  0@9!pp@-P`@P  , 0@'!p0p@-P@P d 0@!pp@-P`@P   0@!p0p@-P@P A 0@ pp@-P`@P  0@ p0p@-Py@P  0@ pp@-P`0Pf@P  0@ pp@-P0PS@P 0@ pp@-P`B@P  0@ p0p@-P0@P 0@ pp@-P`@P  z0@u p0p@-P @P 0@d pp@-P`@P  W0@R p0p@-P@P 0@A pp@-P`@P  40@/ p0p@-P@P l0@ pp@-P`0P@P  0@ pp@-P0P@P F0@pp@-P`@P  0@p p@-P@P #0@pp@-P`@P  0@p p@-Pq@P 0@pp@-P``@P  0@p p@-PN@P 0@pp@-P`=@P  0@}p p@-P+@P 0@lpp@-P`0P@P  ]0@Xpp@-P0P@P 0@Fpp@-P`@P  90@4p p@-P@P q0@#pp@-P`@P  0@p p@-P@P N0@pp@-P`@P  0@p p@-P@P +0@pp@-P`@P  0@p p@-Py@P 0@pp@-P`0Pf@P  0@pp@-P0PS@P 0@pp@-Pg@Cg>t3GP p0P 0pp@-P`@P  v0@qpp@-P@P 0@bpp@-P`v@P  V0@Qpp@-Pf@P 0@Bpp@-`P@aaFP pP U pp@-P`"@P  0@pp@-P`2@P   0@pp@-P @P C0@pp@-P @P 20@pA-P@g>t3GP Ip0`P  `P `>2p@-P@ug>t3GP p60P 0pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@tp@-@Q 0@j@-@R e0@`p@-@0 P 11p@PP#0S  #p[#0@- @@"ZD80P 0R @-P Q o//P ϰ0t 0 @-eh @-P Q @躰@ f<0< 0 P( g$0$ 0 G뤛 d0 h  0S p@- X@P`@@PpP p@ ( .|.A-P`p[# /@P  P` `pph"$P` _" 1W" `110.p@-P @`_PpP p@@- `/@P $ T0 0 0 -A-pP M/@P"  A0 0 0 叮P."P 00#0 0 P 0S S R/P/ R0/  @-@ @\hV0p@-S(M- @  S  P i?` `YP rP (ЍpX  (ЍpP@  J?(0$ $0 ฯ@!Ԣ8 @- @b-@-$@@` @- M`@pP P0P!s* 000 Ѝұ0"S@- M@PpDZ` `$qp  000 Ѝ賱0"S 00 S 0 P :\03#/S 0 P \0///A-Pa`i@P {(+pP  nԫ@P f-W@Z, M(0( 0 8pĊ  00 S 0 P :\03#/S 0 P \0///-M 0  Ѝ-M 0  {Ѝ0@-M@P0  @0nЍ00@-M@P0  @0aЍ0@-@P ,0 0 0RP /P/0 0 0R / 00 !S R!* R0:/ - ^0 : 0P0*  R*/@@/ / P $0 0 0R //P $0 0 0R //P $0 0 0R //P $0 0 0R //tP/`0 0 0R / 0   \ /!s00/S :<P/`0 0 0R / 0 ɓ \ /!s00/ S :P/h0 0 0R / ! R0* /0- ^04 TP/h0 0 0R / ! R0* /0- ^04 P/D0 0 0R / 0  R /\P/h0 0 0R / ! R0* /0- ^04 P/`0 0 0R / 0   \ /!s00/S :P/`0 0 0R / 0 ɓ \ /!s00/ S :P/h0 0 0R / ! R0* /0- ^04 P/D0 0 0R / 0  R /$P/X0 0 0R / 0  S /!s00/ S :P/X0 0 0R / 0 S /!s00/S :`P/X0 0 0R / 0 0 S /1/R /P/X0 0 0R / 0 0 S /1/R /P/D0 0 0R / 0 R/ /P/X0 0 0R / 0 0 S /1/R /P/X0 0 0R / 0  S /!s00/ S :XP/X0 0 0R / 0 S /!s00/S :P/X0 0 0R / 0 0 S /1/R /P/D0 0 0R / 0 R/ / P H0-0/o 0"^ R  R/P/L \ /  JQ\/`P/L \ /  JQ\/P/P \ / Q/S/Q\/P/P \ / Q/S/Q\/<0PS@-M ppP ` F Ѝ@( RP +B 0R xR#  P 0S t P Ѝ P PS \O-MM(@P p$`D1000000  00[ Q`$ 0`;/0 `+ 0S Mߍ .P 03/P 00$ 0:/P 000  0SMߍĐp@-@0@02APLs07LUa`L~0 0LWLP V~u0|0 ^P0ppO-KM PpO03@0 0 @@@$@@@(@0 0Cs0S[30 0Cs0S[G 0fSI W"S_ [Sz 2 0 @3/P 0`00S 0  0Ls0SR3 /SU p,p`0 S S   S S/S >S S 0 S S FU  RxP0/S4 0(00>S7 S> 0S 0Cs0S` /`/OR3 0As0SQ ` 0 S S/ S- (S 0 S S%`FV0S pW0(00>S`0   $ 00 0  S =S`B`0"S0S   0"R R  "RC$ >R|0 r G-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R@" tR Ѝ mR8 pR oR sR ;R@' ;R@< tR ;R@>P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮fk]\"R /R@S00S@Ѝ!1 0   0 8Po 0 +r  R7* R0f* \Rc  uR_ #PZ p  RU*6+IP0%0R"R    H       SP Y/ Yy  ͕ 0  YY#*-"-   )& o ܄O-@-`p 0Gs0S OQ3p 0Gs0SQ#YWS S @0  R%@ 0S>S 0 @>SSS @@ @pP (0SP  R @'%W' W0S@@W@%5PV `EP @P D :P0SԂ؂|̹1G-`-M⑊^#@PZ ,ppQ 7pQ 0PH h```SI# 0 p ^PPu5   p `$Ѝ0p :PPu  000 (p$`$Ao/A-PP #P`p @"@Pj$@@"@P p40,p0P4080<0   @-u@ @-$@@x zw@-@@O-4@T ,p dP @Dp@Ѥ@T `P煑Q@0< <0 PZ PZ P|$g | @-R 0P< P 4Q ,  D )@0@ 0 ཥ, (0( 0 ഥlf p|8|Hf ||p@-M@4 00R0SP,0SER 1`V- P` 0 0zP 40, 0C40P% &`ЍpS' R#^#Ѝp Z0 0D lp yl0l 0D cX cT0T 0D Z@ i<0< 0D Q(e {ze |zd {zd P{zA-@`,p"PP W 0 !ᒦ,P0`H#,P0`C-`0M@SPpD  mP.#00Ѝ!0 QP ,0ST !0 GP ,0S(0S0 0 0'P 0S>0S0"S0:S  0}S "S000"S P  P d @@ 0P ", (0( 0\ তPyķԶ b !kPK @, <0P` 04 <0x<0 ! L,0P ᵠYP {, x 2t0t 0F/` W\0\ 0,xH D0D 0 o,l|] 4sHsX] u$s4] tsp@-@PP=0S L  Q<0  0p@. 0 0K/C\ rPrp@-@P 0`0V PP p l0 0 0@S<0  0pPp( $0$ 0K/H8,[ qq0O-S M@PR z`40SM x `yP@ Ѝ\P pP 00 0Sq 200PX 0S. @0R*  P# [` "P 0 P 0S 'P' X H` ЍO@P 0  03/P  40R 1#PP 0 0U/N 00C 0P |`<@zd `0` 0U/iL H0H 0]/`T PY mLo<Y pnX pn@-`@0,S<SSW  0 0 6hPX onPG-V `p0VSV@P8 404 S `  S` E000!,0 000,00$ 00, ,0P ?o 2@ \0S0S P`P :  404 SS`  `D !@0@ 0c/̡, 7(0( 0c/áLV ntlV nPlG-PS @- Y`' T 1p 0R  F D 004 00R% TP 3 0S 0 Gad 1`0` 0i/0,S, (0( 0F/oxU mDk4U kkA-@P-& 0 0R!p;4P 40S P,0aP0#   8 ,0040U:8 408 0P 4  Q@-P80080/$p@-P@80080p@p@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P00S@#:p@Xp@-P@@pA-PP 0 0R4p`40S @40S ,0@ PW `A-@P 0`0VpP0S P @T @ <0< 0]/@@mQ igA-`P /o0P0"Q@@T @0R pR \@P @T G@ 0 0]/WXP hf0P \@- ^ 400\@/ 0 0F/8XP f$f0P @-ox@ T\ @\400\@/ 0 0F/O ,fe@-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0Rp@ S*,P$1 B!ᎈ400C40<00<0r p h ud0d 0s/ȟP vL0L 0s/࿟8 w404 0s/ඟxN eddtN f@dPN fd P/4?o 2 R0S/0@ S/0P D- ?o2 ^0S 0 SO /P/0 0@0R/`P/0 0@0R/4 P H0-0/o@0"^ R  R" / 0S /A-`@PpP (0Sp 0P  pA `0 `QO-0S@9 0@S7  ` P. X8qPp@j P d P ^ P HPX0UUUB#1 !0@<  ?,BI PO 0s 0 ܞX% X@0Pp#r 1yP7 0 03/P0  40R 1#|P' `P 00C 0\P  @ꀐ pG \ X0X 0 8 404 0 ٘(8)5 TG4M5 JM40S 0C40/ 0 0 @-鿘@5 ML0p@-S \  Q @PPp i0 0 4 KLp@-@P 0`0VPp0S R<0  0p@cD @0@ 0 x, w(0( 0 o 4 QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPUt p0 J#QQ Px, (0( 0 ଓ<;;8;" p2X: 0S p@-P@ @Pp 0Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ #0 0@ :! 080p@-S+@PPU Q PpQp<|Pp/uP PQ mP Q>p@d Q0 0`  /70p@-SG@`PU Q Q EP<@Pp PU Q 4P QPU Q 'P QpPQ P Q/P >p@  c0 0| ঒ X.@6A-PP4 0Q`pp XpW*$@P&  P N 0VC p` 8/PP`<``Q# PP P 0S $P P PPL H P P 0  \5p@-P@PP  Pၔ0@;|@p xw011/@-@$Mp`PP P1S$80 02P m C$ЍP 800p`P10  @80A4 40 $0B 0 ܑ3 3 4 3@-@^ P ^%QRS  T00QNRS"  TŒ 00 Z0 0  @32G-@R(MP00Q P 0 ` p Pl `}0T?o20S00(Ѝp`0 20 0000000 0 00Q0/0 0000000 0 00P0/ 0-2/    S-0 2/     Sp@-@P(MP`/ 0S, R00$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  V P0V00(Ѝp@ R 0S V000PQ0 @0/@-@p00T030405V@-@T @-@T000 000S/@-ђt000 000S/@-蠶t000 000S/@-㱒`t000 000S/@-㡒 t000 000S/@-㑒t000 000S/@-げ蠵t000 000S/@-q`t000 000S/@-a t000 000S/@-Qt000 000S/@-A蠴t @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^ \#qLq q0 02#/p0 00#/p0 02#/|p0S@-@1/00/T0T0p@-@ P`0S Pppˑt/@-‘-@-+000 000S/@-㱑`tAo//p0@-@ MP  vHP Ѝ00; 0 * *p@-@M  wDP pЍ$0; 0 sl* *p0@-P M@ T T T  0 Ѝ0 H@ Ѝ00: 0 J) *p@-@ ^B @08 0 4p) )p@-@PP [$@Dp07 0 3\ )p@-@PP (Pp07 0 D3 )p@-@PP $Pp07 0 2 p)@-@PM  +,Y>,0 m DЍ0; 0 َx2p )@-@P ( 07 0 Ȏ(428 (@-@P $ 07 0 ඎ$1 (R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@& P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pᔉ8U5U5E03#0@3#C#!@11@  /  Sjp@-PQ@ : Sv P Sd0 V Sb0?0 !-0r-w0-0 R0[ 7RJ @Rx00 0r -  w -   R< R7 Rx 0  r-w- R. R( R0 R  x 00pRs  ! Rs0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- A0a0-009 0 <ulc( #O-P4A@:  pPA PA  MpP% 00` 0@T' 8P0=S AP` AT BX ! ԇD0>@ @0  00L. "C-PMTT"PP2LB 0D@$PTPf PppX`\0  CXlPԎpk  ͎p` $`m n   ip[ p0 0S8P ǿ  0唇 0 ㌇ P! @00Ds \a0DSW0DA0DS"70DWUX: QP S \ P"000T9 W. 0 p 0U00S 0pS 0F0 Ѝ0S U @0` 0 0R00  Ѝ 㙉 㙙 p噉I㙙A p XR 0AA B PR W `@@0?< <0 PWp pn| 0M0 00Ѝ5h2O-PMp 0GW"S00` 0t@=P-TPe +T@`0> ǿ  0dž 0 㿆 P! @00Ds \a0DSW0DA0DS"70DWUX: QP S \ FP"000T9 W. 0 p 0U00S 0pS 0F0 Ѝ0S U @0` 0 0R00  Ѝ 㙉 㙙 p噉I㙙A p XR 0AA B PR W `@@0?< <0 ࿊PWp pnX 0M0 00Ѝ542O-M`P8@@P07 0 Ł --M  GЍ Ѝ/ -- M0 0G ЍЍ/0P0@-$M R\ P@0S$  S"E}  B0!0 00 02$Ѝ004}L0 @0 P 50S$  8Rd!,P 4000S$/00//h4ŸC-PLR 44p p嫆P2 PD0 p B p PP!@T Cn`4 P8T勆P=}P @T@0S  y p0 0 <8 30!ݍ\00ҐLD @0@ 0 *t44Xs3|3 $,O-@$FM`4 M Q0琴t0d40㘤 T V [ ZX (d 0H00;PP0S 0H PW 0 P(00PfP w$@Py;Pt$kWk ,2Pk(b,`3fP $XW ,T 7c X#P3 0 d4 30Fލ Ѝ, 0P30 |P||Ph / ᛃP@ @W  D0Yj Yt "0  7t p v0TT lP$$ _ "y2 0TB!z1 0~V9!{1 0~[0!_1 0~&0$0S〡 / ,p! 0 P  6H1D!0  @ 6 1!0  @ 6  @ 6 />) 'rqd d| D    ` 4   h @-PL!`PH1M @00007 p ;T T& }/00@ 0 0 0 302ЍU0000 @U@P002P0?s00U00PL H0H 0( ~DP@P( ml \( @-@P  @ ~0 0< } O-MMP㴲!"  2,$00|404(0 ,0S 0S 0S $0Sy @@`P4@0P   ~p- P8p2x`00380 L@P!  P00S! 0=S0`S"`V`X`V `ሀfP0#S 4PU0 <800C800 @x000004P @P x 4 كP 0 d P$ j<$ j8k,k0PhPHfPd < D   Ph(0S800C80  0<0PPp`8p 0 c x x0X0P@5P5XP0 0Pھ5 40xC  0PU(0Py0Se Sc Px } P}x v$Pvx o P< R10l"2 0 |4 30ݍЍ0@~\ 0h 0 N@ <=(0807<0 S  NP 8pW (0`^0 *0 <    `Ps Po P`{l#p3p H 0S|{#3 0H I| 0Sl#3 H 0=|b#3 0H 3|,0SP#3 H 0'|FN~0S ,,0D8pX*d&C-` "p2TM PPp@0t0L00A VJ WS X\ t!,@ Ͽ |0A x0P 00 C0 qPLQ PA,@K@=i@0 @娌 !0 0 L0 306TЍ 0 P 0{V 0 P 0{W 0 P 0{X |0| P 0{Pc@ P"&xcd#pb ` 4l @ d-M]ЍO-Ph"`d2\M @P p0焠刐0T00W U` Vi Xr 4" w p0 P 0  C0 ͌Pc0Q ,  hDP 0S 0 @H!01 0 T0 30C\Ѝ u0  )@ i0 \ 0zU j0 \ 0zV k0 \ 0zX l0 \ 0zP娋@ \g%` _  t H T x-MCЍO-M $4 0 02000&rX [ 0S Go0 0-0P lPd 1 S S   #@ # S\  000 S SP S0 R R R R @ B RQS 0S1 @+S7 -S[QUp @Un0S 0S 0  k00_op`R0+S4 -SF RwPPUpwV WPRh5 Pp S 0QUp @U40S\ QO 0 6000+S_opR0S @S0 #PP "_opR0S @S!0 PP`  _op`RU< ! 1 0 2 30:ߍvPPpPp p~ S! @FJ F d 0 d 0yt p0p d 0y[T 1P0P d 0|y$]]$lZ\ 4 @ $O-P#@3M MpP`0080r T{ X 2U 0&N M.0A 0;PY 0SV P +fl+}f( 0  0  0$ PP @PRP3H0: ST 10!P 6 5  !1 0 8 30_ލЍ P 0 @QPP * 4T100SP<104!010 t 0xT!1 t 0xXz 0 t 0xp4 ,P \0S  S 0000H0000  @PH# Y(4W`0  $0h < X<A-@P0M`p, V5 W> P 0 B  P @T@T 0 pPP K0Ѝ @EP0Ѝ| x0x 0PxV\ ]X0X 0ExW< ^808 0:xX <, X -$M0l L` !Π@ 0 (0 0 0 30$Ѝ"TS-$Ml0L ` !ΠA K0 (0 0 0 30$Ѝ"hS0SO- PP`w p Bx@0   00Bq PpaBQWpBABQ7pB R0 S1 0A0CS: 0 $S'""  0DSRQ0 / S ,*@D0 TT@0 T: 000 0 ~wD[00T0S  [?0*00}| |0 fw00D\0CX X0 Zw }@0`< <0 Pw 4 x ܴ XO- l1@0`@? ` R<T !4*4.0q0 ,p( ??p?0 SP#20Q *00\*0V0 R* Q *0V000?0R*00t?RPp1?p# x R ? Q*:  T: 4 $ @-PL@ MH0`@p400 0v@ ЍNh@-@PM  0 0 T0 H  @Ѝ$03 0 v@ 0@-@P(M" $0 0 0 0 0 h<P d0 $0 $(, (Ѝ( B$0$ 0 kv$p Xp@-`P0M@P& T/ U8 ,0 0(0 (0 $000P*<P00 04(8, $< 00Ѝp 0 0 /vTt p0p 0 $vUT P0P 0 v@x 0 hT <( x0"02 O-P0TM`0L00v Vj 80  00 0 0 ! CiPPO @p 0 p@P< 0+S+0S((P,0(0 $0 00P0 $T,$,0S1 0 0 L0 30*TЍ0  9P TP1w00h Yd0d 0D uL XH0H 0D |u~ K,Jܭ  !1 O-IM0p010qWW PPN x@` 80 `@P; 0+S+0S(_P  0   rP   0S#1 0 0 1 30Iߍ P BrP13w00< 808 0T t$IH x0/"2 0@-@P0\MP0T00 U @֐ <2_.p@00@ +JM 0  231 +456789:;< =>?  ! "#$ %&' ()* +,-. 0/0+ ; Ep d0 0 T0 30\Ѝ0!PPv004, ,0 Ntj(Gx E\ !1 @-@P0FM Mp0d40. `ȏ!PPd@!؏+ P Kv@Gv R@(d \0 0 d4 30Fލ Ѝ0 N,0, 0 tDC, l@-P pP0dM `00\00 @{ ᒏX P0 0 \0 30 dЍ0 h,0, 0( sn@CB`  8 8@-M8@ 4@+a0 ЍH 0P1Spp// 0 0@-PP0M@000& T MP0 ^#2 0L00(0p d0 0 0 30Ѝ0)@P00F, ,0 js B |A dG-p!@1M ࠐ0 U040$eiP&0E W07pPUo0 ;u0+ @P   lU0 U SuP OuTP Iu@Eu@  rx p0 0 4 30܍ 0tkQEpxP|`@?- M 0 Ѝ@-P pP0dM `00\00 @ 2X P0 0 \0 30 dЍ0 ,0, 0$ re?>t 8 80 O-@Q0M0008 80S `>d@@P  @0\80dl: >b@`'9:E`@  `&-L@` 'h@ l "H`4O <!  -fapP,(5_͌b! Dptp& 7|!x 9l '8*. p"pp' p`@$;`,P%` (  `&}`am8 )  " gq-9* $@!@@$ @fa01.' +)$Mb!.p &7 dA(,  0" P%͌9n `* ! o`P%(, *_ᜀ!4$` Pl(P .8  "**!+P.$_p'+**뿠`ꯠ p' p'$`篠pp@ p- 7@$ " *(O0 +ꯠ"뿠, ) `)0` *"`/4)뿠 *( 韠/`,, ( ( *( `菠 p'af! p'  杉 p'`(`& `&珠`&p! pio` `"``&p'` $p͌P%P%nP% P) P0 P% 00(P &,`@$l@$ "P`@$ "oO . ` "P, ;>F @@P%@ (@ P-.a.P P%M b! P %P! ,P%,dA쟠 * P͌ P P௠" nP] p$!( p'l+ p.+$ p'  eQ $@ ,p!-@$p +@$p, @$p'`뿠O@(@@@ @(pM'p%.p'.b!$, ,p ' p, p ,pϠ( P,pP dA],p,,pϠp ",ppn} $ $   eQ͌ "( " "/  . "@ gq  " @ " "@% @$l/     @.- .. @'@$`,A@$P@$P@$P,P%b!O@@`&@p@$PM`& P`&P` `& P P(`n ,],,`,`"`&dAϠ  ( `(` (.͌ )eQ`) $0 "0菠@0 *!  "!0 "ml!⏠ %  "fa04`= , /H,)$P@+韠 +@ +@ (믠 % ,c1,$PaA쿠   (`͌%4P!!_PPP`P P& `. .lQ$   0&0` 0# 0#Ϡ0 a00@0&@ ,`,=O @nA, $&` ͌ c1P&4P` P ,`Pl PP& ` !!``͌`nPP@P `].` .`.l @ 0@͌p'@0p' `p'0@00@@eQ@ 0&$`M0#la  (p0p0#pp p } dA  4͌?))()gppP (P( p( p]菠 4pl `(eq`& `&  Po,``PP@P*@ ]*@@ @n@$ `*+M ( (ePoP菠 $ P 佋P*  p,(,p' P%  P%  p' (! b*LdA`$`<`00͌`4`0`) `&k0_00`=.`.(`. `$ `& l `(`&`& P+柂`P%@@P0`( c1P`& P`&p,Mo``, `n`pp0#͌0#dA `&0.= .lP @$@$c1 @,M,n0#,P͌0#dA0.= .l$ @$@$c1 `&@(P,M,n P0#͌0#dAP0.= .l @$ @$c1 0@,M,nP0#͌`&0#4dA0 .= .ol` @$ @$Dp @-`XTHc1L@ 0#0#\`80m  P`   Ct00 0 30ЍT0P P0 m80SL400 00 mC+Գt سH @-@P +;0   *DC< 808 0 m #EgܺvT2ԏ 0A-PPp`7 W+ 100.!؁0% "0 0%0?S@@h n0hS@H"p ` # *0V@@p`F AnH D0D 0 m, (0( 0 m긎 ȱ <!1 p@-PP0M@0 00@ TI  0QX+ ;MdiDithTh&$  0~? S a`4` 0~? S  ~U E "0 0R1<30 0 0 0 30Ѝpx t0t 0( "mTX T0T 0( m P)Աȍ H( ذx L 0 0@-PP0M@000& T MP0 ^#2 0L00(0p d0 0 0 30Ѝ0)6@P00F, ,0 lk'| & G-p!M@1M ࠐ0 (U050,e|P&0F W08APUo0 ;u0+ b@P   TU0 U 2nPlnTP n@bn@  q x0 0 5 30܍Ѝ 0dQGPppP|``&L%- M 0 Ѝ@-P pP0lM `00d00 @# /X P0 0 d0 30 lЍ0 ,0, 0$ !l$D$P (ܬ  13L @0+/ #EgܺvT2O-MH@@P  @0\;\ 0EH  @ @ , p.`dK p' pLl̆  zP "P% (n+PhPdP !lˠ ``'H`&P` PPTg{P%hP(@ b+l@Zh@@@$` @X\a&)Ifk靇pPt e[, .` pȂ`p  n "dK p)d((i茆`Xp|p lˠ! p.p'np`` PPhP%{P`(`&l`b+\hj `@@a@$@' g{ L& +,e[ pfktl̂kh|  dK "  .` L* lˠ!xp+(akh`ppp PPb+P%P p.p'npeY|T``x@0@@a@$ 0@`(`&dʌ` )@hk0' i`@0#e[ , $1 Mg  Pe9g W*0@-P M0@ 1  @ cR c  B  T  E0P,̠,ĠD 80 0 0 30` Ѝ0@fmh p Q- 00 R. xB@-d m@4  R  *4 8/| x0 S\ R `0S Р@- dI@ 4 *8/0xB /+S# /S/--M  <Ѝ Ѝ/0  0c <cA-@PM`  `Pp0 pp *pY Z ,0pp  pM P ,0pp  pA F ,0pp  p& P 20p  B@RQ 1 ! \' +0̠ p`Ѝ#g0 S sD0<@ @0 d ̎l 8@-P\P"0S- -S?@0 0000 ` 5 V RP +R@@D!0DSX \P0S +S!@?@!@hxPX ?P L0P00 1 R/@P/!R/ @$0>R0 00//l@-MP `@ pxepPU0D>S 0!3100 0aeЍ>SH 0!3100ke00ge00/-p@-M;e@P@U0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0Z( $ c@LgA-@PpP`V =UB 8X ERR14/.-,+*)('&%$#" VP&2!0` `0p00+Xp -X& =X00+0E0VPpppV-0`0p=+00+000@00(0]$ $0 b00hc lp@-PP@^  0RuSpWSPX0CSE4 *pP0R Q PSPQPQ  0   I0 0+S -Sp0 b0 0 (ba ȅO-LM0xSp _8@(`  mk 0 02d @ +d@T8 P00p00003 0 a0GS\ RI$00+W@ 0-SQ0=W00 0`@ X B R j b\S  "=W  R"   P:0@$Pc & c R $ " 0务@P   s Y# @ T:$Pc@ p c0S$0" @务@DP@ @T 0XX 0 0 0pW ,Wsp`TS `! Z0`$Pfc $ _c R$ "0 `务`FP` `   !` =W +0GY?o20S# Z$P=c `$ 5c0S$0"" ` Ⴁ`FP` `V 0X`0 00X00F `Z$Pc ` c0Sj$0"" ` Ⴁ`FP` ` 0T 000  HR;I?I00 HRD D0 U]@0P R@rN rO-P4M@P\p WyX0S; `00 S 6/000 00!S5+0 0 00!WqW0m Yk X00U7:GS> G1@000`"  0 P(0@`0t85`0$0XX 0SA0`lW A,0 dX`W00V0S ,@P(05#K 0T`X2@ 0 $ $Q T  S #.E!b)L@T(\/H0#"A $1?"!!#: 0`V4Ѝ3+00 00!i3/0 00!bt30$0H\/Ld0L``00|2pST0,@` P !`WP 0V ^ ,@Pw ^[$:6S T00U$0%%>!E!2c(\/H)L0TP%"1 #1O"QX0 "0 0 0$00?S%D P@w`S8 5HT1>O0 0` 0 0T &.60S 0 0 @0P(0\10X00`d(0@t0P`d(0 W  R3@< Ћ >` (>>4==<- M0ˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpF2pP ]P Ѝp|G-pP`= A@0S&A@Q0)쀟\@@\ 7 P p0 R * ሾp0 ှp0 ,0<( (0 N`L($T:\ \:p@-p`pP`P̽@T T0T0 R@@pP00ᵽQ(PA-`Pp@P@᧽0S |@@J R"@`@OP00P0@冽lPx,P@-鿽 00 C-`4MPFH@P 0S|0V ! UpЍ  㕾0P;  =R6 0Q*G B&R&>$#"M = -RpY WꘀqꈀvKSБp0X{FH ՟ 08T`9t77t7^Z:4767p@-P@\ Pp0SpO-BMM3PS0#P03 0 0 0 $  E C+0 ጟPl 40 4w;P# ` @FP 0#S 0000P Y20 $lb@`P 0#S 00P 0xS0xS0S 20 0sS'0wS$0S!10qap`0oP !qhP q!t1 0 4 30QBލЍt100CNP q00FP p 0`Fp+  100P:` 2@P HP`[[ IP000xS0xS0S; t00P_ dIPZ/R6$} }8|55 { , T{D4 ,Jzy p@-d@@0S P Hp@P@P 4 P pHy(y24p@-@P$ P0P 4P GPPIP Pph`h`PLp4 000 0 HLxx13 8,1p@-@P$ P0P 4P PPaIP Pph`h`PL଻p4 000 0 Lww02 P+0p@-0\PP 4P ՞p<`<`zP@~pv40<2X@-@@P00xvO-@P,M|vp0S 0SG 0SL L6P 0` 0U 0C   600{0?SN Sl *S 00 *Q @R50*QLU 00  *QA[SU \S0  0 @ 8Q8 ,Ѝ?[ [2 *[  @[[, \[0S @@0S /Sx .Sxv 0X q 0X/Sn.Z] Q /Q =P  /P P,ЍQ /QT 300 000  ^[![00 $0 00 @ p p /S \S> S -RE S0 U@ ᱠ0]S^$0p Sw ti - 0Xm  0X/Sge @_2U/00 0 /XU0@  0U ᾠ]QQ \Q  @S QU@  Q% @@ "0^ @ x! p[Q  @D1|@!@0 J,1{(!(0 vJ P0 @0`p pC0U0   Z  0 uP/ZY  /<Q /Q[ 000 0 ̢$* *( *@0PP@-@ P NL 0 Q 4Q?o2cP)<)p@-@lP9GP X3GP T00pT 00pL 0 p)(O-Mp!0@  "  p` P 10230Y ߍ%PT 0 `pI  P: [ ;` 0 0P P) @@ 0  Jp@ 0 /P0P S P J">0  "C0 *p@K -RO-Mp!0@  "  p` P 5310230Y ߍPT 0 ظpI  P: [ ;` 0 0P yP) @@ 0  ¸p@ 0 ᧸P0P S P 0J">0  "C0 ᢸp@K -RO-Mp!0@  "  op` P 10230Y ߍPT 0 PpI  P: [ ;` 0 0P P) @@ 0  :p@ 0 P0P S P I">0  "C0 p@J -Rp@-`H@P@ ePpPpPP H p@-`H@P@ PpPpPP p@-`H@P@ APpPpPjP 0 00 Г-H- M0 S0 0 0 0 00 00\100 M\  0S08 00 0 0 30KH Ѝ/}똓-H- M0 S0 0 0 0 00 00\100 M\  0S0 ]8 00 0 0 30KH Ѝ/C봒( -- M0 09+--M  --M  A-PPp`p Q @Q PD@L0 0000Auk$0 0 `Gꈑ t0P R   0//40'07 O-@P0p wBp0 1p    PF1`Iq0@0p0\p⾒2#8"0  !@@t@p005T0AW5 V2H@00p!0 0 40 30<Ѝ 810p!  BPX00X0!h0 0 E="뤐3ggtgpX,ff,`ft8fP~e eeLXeTe8el eDddd|\d0dx\H$|(batah p@-@P> 0S0 @0@0T9  T04 0R/Q T: T% 0 \/RT0C"/QT 0C: B0PU0P!Th00pX@@PP 3F04@@0/S$@@@@a`$`hA-MP`@P0PC D!0Cp0 0 0   ! 0b0C S0;.-,+0)('0%,pF0 0Ɩ0S@` 0S 0SF0"S D6#@0Ѝ T1r0:F00Ѝ$$ n@-@P6 0S/ :@@T3 0T/  0C/Q T% !@# *0P@/S  B3@T@!0 0E  T B3@T@!@@4@0/S @PbTD-DM0  000害p 800S DЍp@-`P*p' P@ y늳p V U phͳUX p` ᾳỳḳV@DQ?o?o 0@-@c^?c(0C^! ^ P@`c5$pC&5'&`c 05D0c 11P!  "0P;:0 /0 @- / 005D 0-0+CP0SD 0@0KE0 0/0E 005D 0-1+CP0SD q@1KE0 p0 Q/ 0E/ !0PQoo A-@@`T?`(@T# T `Pp`6@6&p`376U8`1010S00#!Q00;:00 /0 @- /003D  0+C 0/ A0C0+03D  Q1+C p0 Q/A0C J%@ @-"p A J@ @-p J@ @-p J@ @-pPP `ڱ@-*E00p@-@PP  p@ű01 0 B ?0/R//R/?0S/R/P/R/p@-MPP`V @T x00CЍp :   -+p@`$ P__ 00 R ⽲(_,@-D00 0S@Kd^51Ed 2 Cr0b0aR0cR0A1R 00$I"I B``C/)P( L%@  @ "bQ0"G-@0D \ͬ ̬LP `L,@0L0D QW ^ࠓࠃ Yࠓ^ S\!:O-p(BPPX `= @:PPY  @A-`8 41Mp,0P00S9 @200S ^@#@3@,,C000RP0  x0 0 2 30ߍ@P PP P(P0$0k{{{O-PC 0C,0P(  E Ϡl b0,0 W0 00 000ZW 0  L0 S0pP( 0 0 0GWp0 09P(0P(PW%Sa7 , l,(,0 Wv>C 0C0P(P 00 0!0W0G|6  00P(,0 ,0$I"I/A!b!b0C 0P( ) 0 Br0 S>P(P&Wp , 50 P(W 0 0 0W  =0 P( WhWp 0 ;0P 0 p0 S 00W((Pg0 0P(\c0 , 0SP( 0%!E0?d"c,02#,0 0/ 0 0 000 0, , } ,00C0P(G 00 000 n1, , g W,00C0P( 00 0a, c0 VP(Y(P000nW{ 0d 0 0-0 0>P(/ j  RR 0s$ @p 0 @00v 0`` K0`b 0$I"I/A!b !b C0 0 B H P=US ZSQ- @ ,2P 0B(0 R0Z  R0P P,X %!E!/0#bbK/) P L@"(@bQ: 7 0@bS0#03 \!  !1  B00,0DSd0,0&0 40(00N~0 S(0| ̜ |@̜L@ `YooO`F_O  OG @DV@ 0 40N~ Q@ `(0 P 0(P0 0}pz, H H x X(PP @ ACLCq| \^JS S  00S3P0S| z H/o("PzXaoT(TQQ] ppp@)CQ( 0 B ,##Pp= (' P%!E"ad2c;S,0<2#6MP P(P @ @C>0P( $(0  @ 0 @N,h2P 0B(0y0@~0S{ 00@w0S 0@p r,0p0 0 0P , P(01(000C.$0O 30a\Mc^ @P$` @P$`_   0P , P(0q0(000C.$00 0&# p  0P% , P $ (0(00c$00M0 00Ѝ`f1A-0Q M@HPP PM Q%d1 P01$T G@@ Pp ʵ. R! v` PU  Ѝ0 P0  PgfF ` La `U>T 0 ЍX  0 01w>00G< , xp@E@-0M@ d0P 00Ѝ@-0M@s0P t00Ѝ@-PP@hHEp@-PT!pP10M `@00,00@ U5    P00Q Q Q > 0 0 0 ,0 30%0Ѝp ,H* ,H$ ,HP0;L L0 ;80:4 40 ;ec8cH@ T 0p@-@PP U 0DPp P @pD07@ @0 ;U(08$ $0 ; t G-pP`' X/ Y @37VP0PES  R D PE#0V R  SS0@0D@ D0H@ @0 [;X(0I$ $0 Q; d R@- 0BAs @ Q0C@R <@O-PP┡ Mp U WC 5@PI 7PI  B6p`M 60101S Y7 Ѝ0 60P@5P- 0 0P 50 0 <=00 <l0Dh h0 :5=0080C4 40 :6(`d 8H\ @-RQM V@PЍTT <@Ѝ< 00G-`-p!p1@ MP0M050G ?PR ipJ @\C^ X0p00 t埩0 O۩00 TV8qύ@0ˠ (, 6@P z. P |0 0 5 30ݍЍX0DT T0 C:j<00@e<00]]\@ 00- $  M  Ѝ{,\--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-@PℒMp ` X X00?k0-00P @ P Է00 P ! !  GX\3?OPE x.VP WR Vp[XPVppPW` A `f0`0`pPF P<881 0 09W`00!1 000 ЍC0 P P00 0 Ѝ0 9`޵pP V ׵pP `<0?8 80 h9e[ 0 @-@ M/(0S2 ;-0 (0 pp1/qpP`0)  0 0 PUoR <0PUo/ ЍPPT` 0S  0CPo/F;00P`/@-P M/(0S: ,0 "(0 pp1/qp@`0/  0 0 @ToR <0@Toi/1`V ЍP@T` 0S  0C@o:T00L/:00E/p@-PPE 0eBS5 @Tp E2 Rp00P0 P 0S PcP0匶 00(制 00 儶0 S,P {4P w8P sp@~L0MH H0 80Sp(0K$ $0 u8L p8 @p@-P$@@ᛧ700T 00 !0 0/5,700 Ѝp }l0l /04VP L0L /04XH00| @  0  00  xA-@ R`PPo /.#C=1"#BbQqU? 0S$ RV 10 R RQ 2/!1U 0000( 1/P p $@"0081003/P !p0  $@V00 p00 R (Ұ000P3/P! Up  R  SVp   0S=kP00U h(('|$|,'|A-@ R`P Po / "H0#BbQqU? 0S$ RV 10 R RQ 2/!1U 0 000( 1/P p $@s!00810 03/P !p0  $@HV00 p00 R (A00 0P3/P! Up   R  SVp   0SڰP 00U $&%`%88$p8G-@P PS/`P $rp^t F 00\c</.#C="#2caqV; Y p0PY` $00100S p  \1003/P00H 0 $0(100S100S& p3/  000``0S 000S( 3/000(㜯P`0003/P 0| p 0000S=@P00~00#,#"X"|" "G-@P P.`P $rp ^t F 00\c</ "H#2caqV; Y p0PY` $00100S p C \1003/P00H 0 $0(100S100S& p3/  000``0S 000S( 3/000(P`0003/P 0| p 000$0S㤯P 0$0~00`! 0X $  XSR: G-P0p`00S 3/0Y @IOP ? T0 0 0 0 Y @IOP , TT0 0 H H0 0p`P   /T@SR; G-P0p`00S 3/00 Y @IP T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  /tp4 O-PPM M Q@ \ /\F  ᝡP |-P;/\p @ @1 D\0 _ `P /RR.\'  B Rm/0 FP020E   PѡpU 0: S 9S0/\0Sy@/\` FQ .PQ[ 0t/SW00O Up# 9P&O -  RB 2*/\ \p[ 0/ލ Ѝp` @ @,.00 @f3 [? 0 /    㒭P @UT300 @O3>00 @J3?00 @E300 @@300<300A-@P Q נP`\PpV@P ȠP`V 30"S خ300@p@- PHaM`=  ,4QP00; P; 00^% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P <0 0  2 0 @7p@-@P`P3 V( 0Pp:P@ P0R P:U P0@Sp P P@Rp:UR:Rp@0< <0 U0(0$ $0 L0 ̠ 00/$p@-@PP" U+ PE0R R:Q|Q00Q0S"P0@|R  :RRpT P0P 0 0U4 000 0 0p Ⱦ ,O-M MP |( 0 pl800D40o 0Sx 0S t4!S S(XPP `P  5pP 00S `D R"'  0 00 Pi 0兞0P0s` P `@V 0 S( [T :SZ \S S S 0T:H@DP V@p+ MP P`0 S[1Z@#QQ -Pd6@0`0S0@VXD0A0 0p & 6 0 D4 30cݍ Ѝ:SZ @@DV  00 0S m00@ ␫pP; @d5@00S0 H5p0(`040,$000= Pw 0:RL P0Rt4@<0 0 E0$ 0 3 30Kߍ`P0!P P0C S 4$0@D 0zSnNC~}a{zyxwu1lj|ea`^ [GW000P 0C0PG 0SH00E 00 0 0 0 00S 0  JZ 񏐺m:P0 P 0P0C0S0000D SL*0= $0R $ (p0J p 0, 00A@Q bpzxs T0@p +ZFp80 P @T0C0808  0SAP 0 p0080 80 0CP/ 0T@0 0 0S0G / #RR 0T000C0 p0 / #RR p0T000C0 SP P0004 0@D }1T@!@=$080 + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Z} 8 00C0Sr000@T80MS XRl    0$`0     & $  080   $ 0CP000&}   $   S|@ @pxl& ZʱZ|  }864&40 $Y6&0 $&Py h!P 80lP nP p0 T0C0  SP 00C0S@P0 S0  @ p p,0SP00S[z 00C0S000X0 Si p @ p,0ES[ hP 0@0C0SZ0 S0 M @0 pES p PS[ R,# 0@0C0S0 S000. @+ D  p@ B R W5 @2P 0 p@0C0SZ0000SW +D @AQ 00 R @ pNTI 0Tl@AQ_ 00 R p p@XQ[@AQ  R @ p0,0K겡0=0=$0Z p@ B R 00R@! NR- p@ B R 00R @W (T @ B R 00 R@p )T @ B R 00 R K 0Z @Z(Z 0@0$0pT 0;0: 08$ / n00 500S 80SX000 [ZP 0@0C0S~0 S0  @Z0S B P0[ 0aP0[ 0`(P$@p 0 0 0A ,P0W 0@Xp8p / #RRi  @T B   8 00. 80?03SS' 0@T0C00008000 0SP 8W pA00000P90 S6 0@8pQ*P+0 S( 0@P0 S 0$0 v_T?o20S0 p@0C0S0 S00000C0S0000 S @, p; PZ 0T  B 00 0?@0K! `0p? P p 'PZ 0@DpP 0S%0p 0`(P$@!  (p B@R r 00 Rg00 $8 mm00 P [ 0@005 P]U تt@ 00 @P00P `, 4 ` V   v@P  PP0000@4TP0S 0 @;PG0SD 0@P<0 S9 0p@5PA0 S= PP`8 6P0 S. .J+~P0 S p0 p,@pP0 S PP` `P0 S 0@ 1W @ pt)T R" @t[$ S C8 Sp.2P0 S 0 p@0,08 @-0P :  (p B@R  00 R)(p` P-P0 S(p VP0 S 0 p p@ 0T@3p[\p 0:P 0Pp00Q[ 00`d?00 0@00 ᪝ PS p?0 BC  ]  0 sp> P.[P@DB 0S+T ` [w P'0 S$ 0 p@) p@D00P0T0SpJ0000rp0SpP Z ` 0@00W^[P@D`$0 0 00CT|[ A-@P`p;0 P<@-` MDP@p(8P0 P& ЍDA-@Q(R`Pr v 200S5 0P1S010n C00v`0P! pW@0PA ΛPPZ 0 0 0 C `C0000 Q  Q*RQ0 <008 @    B`0*P$00P0s0 㗚P ;0#B0T0`P P0 " B0 `jpY p@-@P HPp0@-P$L M`T 0S pW 0 7/@P  Ѝ8084 40 0p @ Ѝ܅tX 0M 00 0Ѝ0A-P$LM`pT 0S $X  0 8/@P Ѝ< p808 0 0$@ ЍW P 0M0 00Ѝ0A-P$LM`pT 0S (X  0 8/@P Ѝ< y808 0, n0(@ ЍV <0M0 00Ѝ0A-P$LM`pT 0S 4X  0 8/@P Ѝ< 808 0D 504Z@ ЍU X0M0 00ЍO-M@`Dp@PZ] U? 0ST$ZE 0SB [? 0 ;/0S) $\U 0S H[ 0 ;/@PЍ 0 0 0H@Ѝ0$\ [0 0 0h Jd0d 0h 0D }@0@ \ 0dT H T ЂtS xlS (@- @MvЍ0@-P$L M`T 0S 8pW 0 7/@P Ѝ< 808 0 r08p@ ЍR L0M 00 0Ѝ@-Pp`]t@t0@p@ ἬU  @0 ᖛ$ ⩬ᦩ(np0O-$M`H0 n 0P 0400 0ʿq@Pp00! B b07<  @ BU^PE @ 04BL3@0S i MTRTVMTSQPONMLDCBA@?>=<;:987654310/-,+*)('&%$#!  h^0DS13b0 d 嵙 P 00Ds0S 0S0 S  \00T3`00 01@000@0@PUc*$Ѝ@\ M00 { P- R@ ^^? 0 `0  sP 0J ZS0 - 0J ZS)X1 0000 $Ѝ 0S0 10000) F0' 00CFs0S`0`C F F F F F F F0\  @`\s\0\a\b\t\n\v\f\r  QA-@p`P P=0D! D?o2]R0S d0T"@=0 !1 U U 0 P0 A H A-P@p`ᶘP .T T!0DI1(0D,TS0 Ar_T $0T"@%0 !1 O-`'7WM @P(0無0T1070$010 ?o2V0S Z Y y P㐗0P 0 rpሗ0P0 [0 0 190 P@ @8U1 p00PU`p! X U0 1 #P00? PP P<68&80 PU`p 0pGGq WP1 P! L`:pPG @ 0S4 V L0 G0CSa1  5* 00  R1  X5' 0(0  R1 001 001 001 "001@\001001 d̔ Uc `倡PU^ 0 p9/P00Pᤗ増 堗 垗\$84 0 T1 30Wߍ0SIP/4 $ 0 l㷖P 13z#0 \3#0 3#0 zZ3#0 p| 00(0S 0S,0  =Y 0P00CDp(0<@(0X(0- p`0480@ PN n~:@`0 0>@@\@TL 8@,@ Tn*0 4L3>|8050 W (0$ 42,@0 D0R #<`[[PPYM* < 3000S00Dp P 0SR000ܖږ ؖ8 8PP2,0 Sd1`!`0 P L0 -p `a(0S 0S PP@P4~p20,0]Dp00(0h 00P P0Pp 0JlyhJ yI I Lw H vwG v\vG dvdvG @v\vtG vPdt0E sl@- M@ (t@0@ 80 0P@ 0 30 Ѝt0@- M@,  (00X@ @ 80 0P@ 0 30 Ѝp@-@QM`P0 0 `PЍp0@-@RMP0 0( PtЍ0-M0   dЍ-M $UЍ-M ($FЍ@- M@@  0,D 80 0P@ 0 30 ЍUx@- M@( 0xx  @ D <0 0P@ 0 30 Ѝ'0@-@QMP0 '0$ PЍ0@0@-@RMP0 0$  Ѝ0p@-@Q0M0P`0 0$  `Ѝp脄-M4 0 ЍL-M  Ѝ-M $  tЍ䴃-$M  0 0҅$ЍO-MM9n S`< 9Cp P@0 @\p IBIT`p&p `T" P 0  ST U ᫔ ܍Ѝ  R U  PP 00l@-p@-PP@ D!!!!@0P0 @p0y 0 ,kD< 0kA-`P@P- T6 $0S:0@@T(0  0UA 0S@@! 00( p0S$  0 0 GT| ?x0x 0 <$0S%*`( pοX0S$ L; ,j0j ; (jj@-PPM@`u T~ ,0PXPI00<PY0: S Sr  SЍP P :P 0p"`PA0 `\0`.S0@D`H08< 0L R%0L R!8< \P@D V^0 0U :0Ѝ]0S \040. SЍp $p ЍT :P0P 0 T4 000 0 v 8 ggt8 XgA-pP`P$ V- ,0 `ݑ@P\0X0-  0(0P $0R 0Ǒ@P \0 00X0T P0P 0$ UV4 000 0$ J@7 dfhfX7 @P0S P ,0 p( 505Ҏ@@!@( @ 0%$0 0%$0* @YXT( 4W8W$Pp@-@P T UUp 0 pH "D0D 0p , (0( 0p $ P>, 1(0( 0| K/\# ǿ  0  0   P! @00Ds \a0DSW0DA0DS"70DWUX: QP S \ %P"000T9 W. 0 p 0U00S 0pS 0F0 Ѝ0S U @0` 0 0R00  Ѝ 㙉 㙙 p噉I㙙A p XR 0AA B PR W `@@0?< <0 PWp pn)l )0M0 00Ѝ5갭2@-LMpP` @000xP LЍ`0 OLЍC-P!M1M `0p00<0㽊! @PX t1 0S 㯊P(3 l}  )~P* n6s0@R P $PPP) 0 0 < 30*ލЍ u>i?F㨀R 0 P P0nS?P0S  @5P2P0P(6}(ꢸ'P t@p@-``@P|p  @PpP| Pp@-@P @(0F$ $0 @`2P 4I@-M@  ~p 0: S  |p  JЍ00ЍO-P-$@p,M @l300P0`S?o2`k$100 Pe0P$0@P 0 U  0 *ڊ 0@IPP@ 0 X}pPE P@0S` PU{0 H X*P0`   U1` T 0 A[ UhᡉPPt X`#: 10 001[ 0` @0 0X P @ 0 S 0S[ @Y: 0@D@0@ @p$0,Ѝ0 00 0f$00S$0d`0PP  000 { {pp{  D0@ @0 ` @@T LEp@-P 奊 @T @埊T0 0pp@-@PP U  p@ D0:@ @0 U(0;$ $0 D DDt D/O-pP M@`0& X. @T fP @T P P @ 8/P  00 UWK:P PU@ ЍD0r@ @0 V X(0s$ $0 L C CC\ CO-PLM`@< X TV1 <000$0@ 合P Xe <0Sl 0VP@000p00 Ѝp@-@ PU 00S  RQ QpɅ0P 0  P  pH0H 000S@-@(x0(@xtp@-PPM`% @T@T T0 Q 0SR ``0`P 0 RЍp0i 0  5 7p@-M@P5 `0S$00700 00j  xP( p$ PQ# 0 00CR U 0 S R 0S$0Ѝp 00 `$0P0P 000S@-@(w0(@w脖tA-p`@ PP 0 00S (wP   (w 0S  sP    0S `(w 0S ` t0@-@PMP # P  0P8p@ @Ѝ0w 0 Ss P(0<$ $0 @ h 3``1@- (M0R0$00< 0SQR@ 0SRA!0 0 $0 305(Ѝ@P0@ C  (00 $\0R0$0L0S 0S ( !0$ R0 @P <0 0 $0 30(Ѝ@ꂲP d 00PX@- D  R4 9  Ȓ2h0P@-X  S H@ D 0( @$ \`xLx14xA-`PpP@p U! T 0 F0PU 000\ LL0?H H0 pU00@, ,0 fȑ$"@ 0" 0000S x0m.!D900 /P0  \0\ 0 /48554 0 0A-Qp$_K aNCHO@Q0?H8c` P@R\0 0P 0 pqp@@T p!  P 443(4p@-PD@@ (v0S,000P p@ v 3321A-0@Qp`P`FR  v R%100 UNUd!0` p000 <0 u?UU'U9? 00A0A100 0pP0p0P 0\  B0B10< l0Yh h0 T` u| l3203\224221P2T- `-01@1A-0@PppG@ `< p@ScH XD0D 0 , W(0( 0 P 0 ( \p@-PP@, T Pp bP 0S S`P p@`p0p@/H xD0D 0( , w(0( 0( L &$ Xp@-@PP U  p@bL gH0H 0< U, h(0( 0< ` x40@-PP M@ T# J`P Ѝ0&bP 0Sp0 0OcP L0L 0L uT0 ,0, 0L j,Y t Hp@-PP@! T* 4 `F0S p`P aP _P _P p@_X T0T 0\ 3T8 404 0\ (  l @G-PP@7 T@  R R  `V V  0` 0 00 `V00!`V | 00FS62-)%!  I0 0l T%p堐p 0l  R R 0  ` 00 00 0000 0` \ x\( @-U/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/p@-PQ@`0 V% T ^ 0S^  S 0RR00Ap@@Tpp@0;< <0 A(0:$ $0 8X ,d C-@!P1pP M`0030[ TP A< oYPF `YT 0S `!X1 0 3 30Mߍ(#@@ R R  R +P0 R   : p0Sp % 0 0 |0x x0 d0` `0 D   V$`_@ ` dO-IM,M`X$@PPJ L4 pI 0$000 0S S  $I3$ 0 0 30Iݍ,Ѝ RJ- Ⲱ RW#    J=00h_ Ip# ỿ{0湉 J- 0S 0S? S# UV J=000px J=00Zg O< XP 0Sy 0SI0S  0S0s S0S J=UV0  03?"R #< zJ=P0h0 I<0I I0 I I I C0 P J- 0S-J= 0 SS( S DJ͍0 ?1* 0 0000H0,0ATP @(& 00S_LP P P J=00Z0  WPiJ͍^P` /]]L H O-`x$@t4M Q@p0DH 00010P0CS+H5('&%$#"! DQWX000S R  R RYf|#t3 0 0 30ЍTH30030H 0 D@pЍO{QWX00VT]WX) 0? s0" fpPJTH0S0S " ?s0qDQPTVT00 4"0 ? X: NP 0Sj!0 )T@@O 00!0 piT 1i #)Ypp 0XXPT1 0pY@D 0   T00? YQP쐟0p蠟P0 ppW@D 0f   ևT00? D ˇP|TypdX  ྇pYtXHXXxp  l0G-`!p1FM 0010% P@p *P  RW `P Wv`ov` 0@Sp0 0 0 1 302Fߍ0 0000?10 0 0 0P Y: /r RX 0S P 0 IꂢTSA-@ 0P`p0 | 0P ap@-MP`P@@P@T 0S  R0S @MPPЍpFPPЍpp@-@P ppPPp0@ 0  0. SAA0Cq .S .R Q P -S /S /Q P _S 0 S@-FRB0\R 0R: @PTT 0S`[ DDpW` UZ ^" DPD`V` S`" @@@0T\\ /  R 0 0 0R0C?o20SL`V0^ R 0\ 0R 001 S0 S 0R U ^( D@D0T 0U ^^U ^ D`DPVS` D@D0TS 0R0Sd!0@-$M""0  AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S0S'  R  R R R/S /0S S/@-/ 0  00S S/ /0S//0@-@P M 0S PPx 0P\G@p0S0S 0S  Ѝ0$0n 0 3H @-PPM@p`* T Q Q Ѝ0SS ЍS PPpW0S# S!  0p 0 000S SH0 P 00P 4lp@-PP`@ V T! 0pហPpx t0t 0 VX T0T 0 T8 404 0 긼  ` ltO-MC<0 `:0 0\P0  03/P 0&,`&<808 0 SS0080R0S] % RD(ՖuPUPEG [ 0D*4,$ 0@$0   C 0h\@P0  0 3/P @ 00]P\`\Vy80Sh U$ &<800Sk&<800SD i!`P E0/o"SQ\EoᩒR,0S D0YP@0@C<0D\< Y^8 @0 C00P4 0P00,00,0&S? @d$P4, 0 0 30ݍ4Ѝ\00&<800Sh &<800Sj  E'UR!`X [H^40@[,PH Zs <0pH pZCNPٻh`Ip  pZ2 0 00e lP $@r /r @0S S000 P0S ZpZUK <0LE0S/ "\00}UM UUU- !U U6D !`P!E0oᩒS  R E/o"(10 00S %p[00PD (0R _<0.ARC@@\WD0-%q^0@[Ot00S000/D0zO4 00[`PL0  03/PD Y 0R<0 0 `g0D,<0.RC@\&<80@F`CT (0 `@%aq BB d3?(B  8| L ` 048 <0< 0P (0S\ `0` 0P 0S 0 P 0W 0 P 00  0<(5$%0 5s ,0Sa h/[P ,[)[zO4 0 0xZ`P0 ! ` P mP $4 0R T4 4S Q 4S 4040|~ZP|4040S 0R $R R $R 0`Ǜ#O-SM`$0P4 00D10tmpP pmP P$0Yp 0   C8000SX Z 00!00Z @T 0 .T0@T RuS d! S*0 u DD@Q00 00000000 P*0=S }Z0S Ss St 0S 0 P0s0S eZ00nn%   P 000 P @@PY 0  Phnfn@8"02 0 D1 30Sߍ @S @Rd! S1*.T 0 Pʵ 0 @P30* 00S  P X0 SR rP 0 \@P 0 00S @P `@@ @P P/".PO--S/ M0?0020F 0P ذx☀0" $ `* ,  K I H   Z- 0S0S `  00/? 0 2 30Gߍ0S0SP;0S^01@3> ` .> u/0 `  0`V 0 Q .0 ^ 0S 0F?oP20Q00S0S  00p pW @`P 0S   0?SV CC" 0c6#PpWp @_0 RSS0 0 0u`P<`p0 `0(0$@ pW g:72 G52 0W00S   S  R  R Q ^  ^$ \QRSW PX0S" 0 PsQp l+0 0Si QRe 0pS %0P,0 P , 00 B `!0PpW ,00X ,8 RQ: 00  pP 0 Pp, Pp  00SSpRnkRm \8R P @0 XpP 0$0Y- 0Y'0%05f 0ZX @_0@S 23P(X000$0XP X@T0 5P0(P 000 fP@T 0S S00S0$00$00 `{P @` S T7 U4,$c(4( 0y/c 00?oR20S x 4@,8? I L9ZP1x00x0 g ꅔ `P`$@P P0U 00PgT0PgO-PLMb Yk бPQ0 @P C   `P00PG 0pp R R R0 T@0P p R ((0( %P00 V pW X 00  XppWV$@LЍTT hP0P 0!.ZY4 i000 0!.OPHL ` l4G-XM`@i{P pPP@0 E0     0d{P 40S0- XЍ PP f  0G{P f8<8 /P 4PPR 0 O-"M2*<* 9j=2+X |z j| J3**?J0VA$Kr~A$16zA$0*4*({4~!"r%kz!"1j5r!"7j5 Jva&)C*0V7 8N,̅0  0! B 0%a0(@0#@,0 L7@ @$௏@|O!dE #.2* ㇇Dta& ,80Jlʎ$ !0 FO8 0.00#,0H IFc5p 8` *pa& 6@@!GDKHꬃ@ @  .x)HOLn # @*, $x \Hǎ @: @$"@F .dE! , 㘽O   * $yJj  .$ !!㴹D  ,bE ,FOlŎ@@ . !@C @@L@ @,@` @$ @Q^BK !  `. ધ 㶩Nn $ , ]/MlƎ  .! SD@ @,@ @$ @㡨MK ! . ȫӧNn  $ , BlƎ  .(! ֧7L j@,@ @$ @դOK ! . ZDn $ , JlƎ  .!  O @,@ @$*H @٢oF K !  . n$ * BOj  , qHlΊ @. @$ `@"FJ *., Ojn ,! D㾤J  $* Dj `@. @$ @`O J !,p KlȄ* .8`B  $*$Nj@, !@DM@ @.@$ @@ dH*. 9 M !,( ۦN lΎ$ *Aꪌ @. @$@eLdH ,!D)O   " *Db-  . Jl˂@ @@$9@ LO@@p !I[EF@ 00@0#0@, /H Jc= , }Ob+ . HȂ !OF<@00 0#0,Oc=   " Jjb+ ,DȂ !SO`00 0#0c=@5:K0   " 4b+L B ,0Ȃ 0 P0## +N ` H` 0UDP  DTЍ@-@P  0 'C D00, ,0 Z #EgܺvT2y A-PPp`5 W) 0!Ӂ00@@h00"V>0: f0hS@H"p ` # *0S@@:p`F AMH D0D 0 , (0( 0 x 4x tЩ ! 1 p@-`P0M@0 00' T0 P  !7R8 bx b(   0 0 0 30X Ѝp@` \0\ 0 T@ <0< 0 _w pw tDw 8LŸO-D @2 M<"0 P00p  `. 0\ @ 0 XS@@|[0 C" T. .0N|0[.\'^V*00[P0@^*0^0 8< 4^*0 8<0- MaP ЍDD!@- 0(M S $ A \/o"S R9/o"S R L 0 0 $0 30)(Ѝ@P @ B  (  0$\ S $ L R \0  R ( $Q C _ 0 (t s A-P!1`P rMp00109 UA @^X0pA00tAQ0OQ00TAV 2?O 0^P5  0 wypP& 0@_P 0 0 1 30 rߍ0<| |0 gUd0=` `0 ]P ?`00~P 00< \ zPr x8(r P00- $  M  Ѝ  -- M0 0x ЍЍ/-8 8- M0 0   gЍ Ѝ/ p@- M`@P @x0`0P0000 @X@s0@uT  Ѝp \ X1! @-`0M000Qp P@  G LRp P@ 0 0 0 30*ЍPPpW @@T PU 0SP@MT00@D009$ 0p@-P0@ 0p0o_(0Pl_(P,Ph_ 0\0PP 0P 00,,qP 00p$П 0@-@ 0 0 0  0 0 L 0 0 00@-P M @0'_ 00P 0 vB?o02c Ѝ04 00 0p@-@P 0U0 0pp@-@P^0PP^(0P^(P,PpO-P0Pj `Pc @000 S S0 S S hpPR 00 pXpp8 $@P q0p00S S S@ 0A S  A 1 @P 0S 0000 ^P 0 ]P@@dԃ O- M`p@,0(Sz: (T^ TppV 00SR 0 RL@D@T0PG 00SC000@D@D0P0S, T0X  0!0J0@PH 00S#0AS0偰0i  ؉b0S000 X  ljQ0S& Mp0@^0pp^(0p](p,p<@ Ѝd]P  (,@3(}0  Ѝ0 00@- M@P  0s P  Ѝ00 0 $$ 0 P Ѝ0>p 0$ $/ Ѝ0O-PLMV E$P`@0@ ``^PU$\pPQ 0 ``^PF$PPU @0`Q QD QR Q4 0U00S} b[P  ` 00Z0@ p R  R/ RY R  0 @U pB] 0J[0K 0 LЍ   @ Q`A@0U   P (0   A0  ,0Wp 04`0 0KW G   ` ``@``= @U 0\00\ `^ \LQ  QA@ \V ^ Q\ @ , p 0     S QAR`  R  P@T( Q  AX  # X/ X5 p X @ P @U&9X X X 0`p` l  `  Q@` ``  `p`<0]8 80 bD\g Lb @-@P @EO( /$0$ 0( G@9Oa TfN'QO-`p P`>PW<Z0( w# 7[0` @w$0$ X`(0,`2(-`P p[(0 # 3X, `0!(-0P p<QFf&``V0#03 U0S `V:PV Y5XX1!030#  0 [@000X; SP81 `3 `#S41`F2s2`Fs1`FS0`Fh`F60v`4:0;`0Y SP81 `3 `#S41`F2s2`Fs1`FS0`Fi`F0v`0809```a p@-`M]Lp& @Mp) P0u00 @ 0@ZLt `0 0+P ЍpMEL00?L / p@-\ ,P@\ \ PQ :\ :Ap]00pX00$O-\MH @P0( Q04 :;pɁ C$`; -: ^:cI :10喑a @9Ȍ<Ǡ `  ^ 0008` 19P80 @A4ƌ<ŠaЍ0 000 0 0@-S@ 3/@M@-] Qi7nIࠑP*i7nI P@ Np ^ @ `@D@P V% @D BD$ BPE&"PE@D"V%@D BH$ BPE""PE@DQ%@D Be$ B'"^ r N $`PFPEV%A B!B E BA &"A@!@ B BA!" A@!@ i Q7nIP# Lp \ @ `N@D@F$N B. B@D&"@DN"F$N B. B@D""@DNQ$N Be. B'"\  \ \ , ($`P\ \+ \' \) `P^ ^ NPN `P\ \ \ \ Pvlhd\XTP[ tY TY @-@P  @\L0/ 0 x`X 10 @-0@0 0 0L#d.\ 0@0\ SC@ I P p0  0C00 00L  00t@  X W 0@- M@o  < ` O-M M` ',@ఴ $ `!0006@@R@@0TP06V0P40 ,PG. 8 &0 0 x0L <0pXl6l&0  D < P0H0, 0 dP0 ?oR20S @0`1  H0PU 0P 0U VL ]jV.p0S  80Up5P00P 0UG W<0h?pX50= 0X% W00 .j@V800)S T04p P, pTP* 4  Z,4 0pD 4p0p4l0 pP4 0pP0S_WP U0P40] 0 #3 0 4 30ݍ Ѝ_3P 0`sa{0S 00ST@0`1   kXD i4#2 0 4 304ݍ ЍO"JX <0x$? 0PrR(iU]" T "d`` `@\ h {i@F`DV7T0Ა S?Os t@1 Y T ii pI I `i T 0 \{2P p 0II 00 .+ T@F`D 0 cV`@P ꘡ 0  WYx 0 O 0 IL1l`0`0 ppG pG iT  0 l`10P p 0JJ 00 .G+ TʳW hH& ` dL h;ȋh ؁$ P0 (< <\ XP~8~~}}O-tM@@  `lVPPhP0 0 p 0 0 `1弴4Sᾤ,0   (6< 0 V 1P806< 0B>PU  0R408 00h`1S   ;`1S0 0 0 PJ0 0 P7P P P$0 0 P0 0 P0 0 P0 0 yP0 0 nP`1SxYz < Pvp0pW  0R 0gepW 0pW  0Rx 0gRpWf 0pWa  0R0 ,0g?pWGpWD 0 PS 00g`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 30p01 0(0p01 00p01 0xx1p0 [=VL PgtЍ tЍ 0 e10 ^0 W 0 P0 I 0B0 ;x0 4 H|p {{P zyyDyd @T  0U Ѝ0O,0@ 0PE Ѝ0ܹ llkMp@-@ML `P 0 Q@0P0<00 0. 0&T @D NE000T H0 0 <0 30 @Ѝp@Ѝ/T.0 @2~ mh O-MP`@PP  jp f0 Q ЍSr RSPP 0-S  0+S  0x# P   00C2"0d  .S 0 @ Tᘀ@@ ✀(P  S #3 @ P 0RQ  S  # 3!# 0T#+<'(0+8 +((0'<0'4 0(< p 0(4 000Rp n 0T  @ P  S #3 @ P 0RQ  S  # 3!# 0T A 0T @ \  S #3 @ \ 0RP  S # 3 # 0T 0 0 N 0N 0 0 0 00J 00 0  ;3 O-@Q dM0 R  @2/R>03?1|gO" \ ^mnb`AS N T _.((H<S0c&sf~e~rHpl W E P -b AE#D((H'ᒾ  L>c@L<@<0d0c@02gࢲ"X ;kU} Q}M}ZX 0H Y J XL ,0@000(0L04 $0\0H p 0P0`0<00T00D0=CZ 1PY -PX )PdЍ @A  \ @R@0@g x  0 0dЍ@0Y0 0X XrfeeGGG@-@P 0D .R\0@*S0T .S@@T QA.@S@@$  0  0( 0 eep@- MP`P`@O] _0w# x'w000 000 ;7z $  aPc Ѝp ldC-`@ MPp䀟@POP @U ^P@Wy@ Ѝ @P@p0 0000  P"0S0Y@OoB@#ꨯ Ha, dC-`@ MPp䀟@Px@P @U ^P@Wy@ Ѝ @P@p0 0000 n PS"g0S0Y@OoB@#꘮ i cp@-@P00C0S S u P 0` Pp"b`u0 0C0SpSr P 0 / b0@-M@  000_00 !R !P]Ѝ0p@-  0S0@Q0 R   =0H04S dPpl@Q0R Q    R Q ܶ Lp@-@@P@0P`0pp 0,0p@X0* LD D p@-` P@0pp0,p@ꌵ LHA- @@P`p0p0 A8 LC-P0 M`p0qp@ H0  D@ <8 L@Ѝ 9ش LxC-Pp0 M`p0Gp@ (0  @ Ѝ 90 L0 00/ᰳ L0 00/ᐳ L 0M 000Ѝh LXA-pP0 M@P`0 p 0 pЍ8 L0M 000ЍԲ LxC-Pp0 M`p0p@ (0  @ Ѝ q9ꤲ LC-Px0 M`p0p@ 40  0 @Ѝ M9 L<@- @  $M0 OЍ蔱 LH0H 0p@-@0pP p@V%9pH L8- , M $ 4  Ѝ L R) p@-P`@V 2P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0 Mp@Sp` =0T 0C0 ЍL0H 0080p 07/0 0 ԯ bbO-Mp`@PP*W3*00V.:Y `8 @1 <0 ppZ, , `0 P P0  0P0`00000Ѝ0 P`Ѝ p `h0 rP0V`F0V0S00, ,0 ' bb&%ad# `O-M 0|?@ 0,0=L 0H 00=000$0 ^PG 0S@ P=P 04 H 0 M8P000 0Hk=0P=<0 a@PU *, ?0 00t>0;/ 0`(PExHk=0`PD`P 0>d 0P ?` 0P P0 0`"PyYY~ 0IS  B?fZi4fhCO\~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ,Pr R 0S .S 0S 0S00S.S-d9 @0- RD) 89d @0! PE 0D$0 SaD0C8^800440PJx@0p000$0 0C(0S0`0 @<Y` @Dp 0 P(0ST0 P 0 0`P8000#808, 000.0 r  .00Q! A ^P0 0D$0Z: 0@H+B 0?R0S \'7  0 0 30  ݍЍ0Y =00S>-7 0@\-6 0@V=00P040H00!P@0 00B0P00x& @p6000#80X=P 04 H 0 P4@4P4 @0@PD;2 50!Pd000040 C0yPY 0H@ 0RJ0Z0Szh%%d5d 0T p=00S4 @0d  D;50P`0  P+40 CP0`BP"H40P`@C< 8p 0P`0P|0 P 0 P`P(=00S'U4d  0X00X0 0D30! [P=P0 0@C: `PH VR ʔsVp# P@0 <P0TE0 03P00d0@D0VV!%P2d 0 Z! PEp`$P0 @@P 0 D0PYX+ !$+P$=00@C<204Bd 0@ 00#`0  Pe0 Pd  00D0  PT30d  0  PEpDW@ \Q@P0d 000  P/ 0DK0S3Y !P! D{D PUi `p`0W@G1 0ES "ȩ l \[[\W W$XWhJd~W pThTGPUSS S8RSRQQPQPlOOO$O MLKJ>DJJJ, n $  dlFExDxjC8D@CBCXCHBA??@@??,?>@>=<==00S3P@3 `@DK 0d 0 `P X 0 PP: @2DK HLQd P p0 > 0  P@2DK 20d  +0  Po20d  D; 100  P]40 Cp0tPT$ PD :@B M P`Pxp2p"0 $@ 0ZDt: T! P3$0 @C20+Yh =00SBd 0@ 00`P0  P 0 d 0  P 0@DK$0T*|S$` pPTDK 0d 000  aP +@0W 10"3# 00;@0000;@020!200;@000300;@0S100;@010 0;@=0;@! ,P 0D$0SStp@`T Pd0 U`  R @ Y$ 0d  A! P@T0 +A0W 10"3% 00;A0000;A020 0;A====C; +@0W 10"3% 00;@0000;@020!200;@000 0= +@=-;@>@ C +A0Wt&1 00=-0;A>A C0==C;u40 C0DP$ 0DK$0SvPp\3 `(PP 0V&  R @0 Y$ 0d  0  nP@T0=00!V5U5E?C0 S!WPP`91 0@* *JDK1p#00Y,!>Pk=00S -`8 0@^40 C0P 0Dk$0PCUQMڸ@p@UC1 W2 0d  F 0  P=00S -D9 0@#40P`@C< 8p 0P`Pn 0 Pf 0 P`}P] 0 PU 0DK$00CS @ :0p40 Cp0`P@@ 0 P8 `jDK`P0D[ 0d  0  P"P0D[ 0d  0  Pn0P k0` h0;d 0`P@ DK 0  oPH=@0  1!^P=00S 0d  0;0 ! JPPU pD2 $ 0RP@`` D =H0 0$ Y@ *, |<| 0 p00<07/=I0U 0DH? $0S @P 0 P@P&(0d  0=04 ! Px=00S/@/ @@p=2 0D  `p0 PY$0  @PQX ]0 P@DK PE0 P>] @0 DK P40 P0P, h0 D; 0P!40 CP0p8Pu/@r/@4@( 0X0 0D>0 `P0 tP=00@CV5U5E!?C0 SP0 `P=00Sa-? 0@=00S0SK==00S< Od 0@ 00u `P0  0P0 pd  00Db 0  P 0 d T 0  P0PD[S3kD"!$4P--; 0@&=00S. p0d  D;D;0% P`0  Pg40<@C8 0 P`yPY 0 PQ 0 P`hPHH=00Sd=0@ 0H[0 !#{T` *, 4;< 0 p00$:07/=P0@D `d @0 H[090 ! P$0DY2*y`㴉@p0p PYD V 0  iP `0d  @ 0  [P`F@P$ 0Y!JPw@P40 C@0PP0 6P PDK. 0@.H.d 25 =00P@ 9, ( 008P 05/>@T=00S='0@ 700=00S- 0d  D70' ! PEk40 C0P` 0D[$0SC* *J1#00 S!PJ=0@ 0H[0 *"ᄿT` *, X70 p00607/ 0- P@DH[P@D[=0@ 0H[0 "^T` *, 60 p00507/ 0- P@DH[P@D[!pP-5 0@%E5 0T }(P 0 PD[$0U:-H5 0@{-45 0@u- 5 0@o= %0@ 50n-4 0@a-4 0@[4d  0`d ! "PU `T P0d 00P 0  PTDKD!P P 0DK P[!P{40@cPC 0`DK@p0 Pj0 @pPb 0DK$0S|!PUP Q`P.V V 4spP@ሾ0 P;0TE0 0P200d0@D0VVڼ!P#-2 0@-P  @PwT9T XrpP`N0 zP0VE0 0qP00f0`F0TT!cP-1 0@=0P 0H0 U@;*1, h 00X1P 05/-D!8P=0P 0H0 U@*01,  000P 05/;;;99:l:\:ta9+7p7+77755X5054d5` 64444444l45H554332221 1L0,01//.@.,,-,++(,+**8+*))x*,*DtH)4)8 )(()(0''''h'<(@'&`&l@&D & &&%%%% a+` 0p D{ PP"<1d P0 0 P P 0 P 0 |Pe+0 D PpP=H{0` PPV *, 10 004209/p =0`FH{ p`0vP 0 >P &+ 0 D P1P=H{0` _PPV *, 20 00 309/p =0`FH{ p`07Pl 0 P* 0 D PPy=H{0` PPoV *, 30 00 409/=0 `Fp` `H{ 0POX 0 PG@*DK 0 @P:=Hk0P @P0U *, 40 p00407/ p=0`PEPPHk`0 P0 PP\0 yP|!qP=%0 0@C50-5 0@=%0 0@C50$0%@C5 0!JPvps vpP@  0 7P0TE 0 0.P00d0@D0VVTڔ! PM!Pvp-6 0@;@ 0@D$0X:37'0 4$0'@C7 0-(!Pz@wpP@ s`P^VRV twpP@ᬻ 0 P]0TE 0 0PT00d0@D0VV!PE- 8 0@!P84xp=@(0 0@CP80=\(0@ h80$0@Cx8080Tj!Pxp8(0 $0(@C8 0=(0@ 80+I  W0W! ##90  +I W   +I WW" !"  +I WW  #  +I WR!  +I WW! "  +I W 00;I!>PPUD{ p@- MRA T  ,@0 4@(@@0 0404040040 ЍM- (040 1Ѝ03/A-PS`-p@ W@0 V :0?s00@PU )(P/P(00TPD0?T0S,0l( (0 PP$ $G-pPWp:0 W/ : W/ : ` 0 PPϿ W*(00@0S  XT0 $"  P@QA-M{p$0P@S` 0(01$0,0v(`Vj0Sf(0S$P1,  0(0, V.400'PV, 0,0\Q U/  , / , 4TP(0T0(0 SP$PQ0(00,0Ѝ0F ,P(,  (`, Q!:0,0 ?0, s0Q:$( ,00(0 SP$PU 0"O00J(00QA-M|`$0P@Sp 0(01$0,0w(pWk0Sg(0S$P1,  0(0, W/<0<00^*PU, 0,0\P U/r ! , /r !,(0 Q0QQ(0 SP$PQ0(00,0Ѝ0G P(,  (p, Q!:0 ,0?s010, Q:!( ,00(0 SP$PU 0"ſ00(00A-pP@P`x Um T} V@D2"!00,2 < !Ì?Pqp PV@D2"!P00< (2!Ì?<: 0  T00 48<0T! T 0 00#2< P0"!T 0 =@ 0@  0=  ^*@^00@x0t t0 `0\ \0 H0D D0 } P x|, TL 0O-P cMPp` U Q@< 2 @ܲؒ `002 Ă0000 02 0@=QR 8PS [ 񏐑,4U WH0 @ Q[;@YbЍU W1 0 @  Y 7:P$U W@ U W0 @  Y 7:P[ 3 @[Q 0@ QU W R 0 T 0[e 0 T 0QY Z0 0T GQQ 00@=QXg t ` T < 0 H h X@ lP 00/lP 0/(/ ///@-`Mp@pPT@TL0 < P@WLG;;`c L, A-pP|Q@`PR TG 00S@00XS< 0ST.C+SQ1- !q` ` p 0000  0C` Q70V0Cs 00000   0 C R7 0 0C20L0?H H0 40>0 00 yb <  A-Pp@JU`, T08 @W``W 0 PE.p^p P0070 2000 S037#Q00 ^00 g0  01 h/Hio/Q0i///j@-DM` @p0 0 < 2 &0 RP, 0 0C0< ,0 0 <0 30DЍe_ P_ O-H MHH0< z - @zJS% B`R3>hP>"2d'2#g# C ኡj CB*ZJWRT/X p 0 SP7[0S  P 0D00 00000S @B0?R0S2  Ѝp  0 MhP X  0W ]P@ 0D SPW p H 0 GPTX 00e, ,0 S Ѝ^ $4 HA-`pP0S- @jT 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@<( 0 $0p@- M@P00 80P k$`P.Go0 (0 0 8 30ލpd[ ,[ 0-@-@R M00   IPP * Ѝ@Ѝ/ * Ѝ@Ѝ/ndPRp@- `@(PPWP0 ?p@)Eѻ00pPRp@- `@P`P5P0 ?p@)#꯻00pp@-@Q `P@PP0 ?p@u)ꏻ00pp@-P@e)P  p@ p@p@-@P 0PS <0S P 00pc00pQP@- 0R R  P00p@-PP Q@ @Q Q QT00A D32700pP T0DS@pP p@-PP @P  T 000YiP IP NP4<@;oP <00(S ~ 2010\nP 0Z PtЍ00XS <0X X000Z<00 0S @ tЍ:QPgRPDP R R4g +^ A ^* ~^P%b^1BP^  Pi ^    ` t  inP 0 SO B ? p@ 04j \V | B\ @,$ ( ` Z`0  QQK`FJSZ[h0SV|Z q@Pb @oqP] 0 ` 0Qq0Sv PXn J @ W L 0?G0jS*k&0B: H]V  L ??GRH0s0  p @goeocoaooPP!    !E \TqP@ o@P T Q\00`C00A`R AQ6`s (  $ wBP^  P ^ P.< ` DR+P  @b `. V(P jP8P ``^ U P L^ZkeP P?4PKPeH7LLj  @ 0 $Q0H0ʸ"00 pW9 @YCpWKQ @<@  0@ X  X<<0@ X*0 00<0Xl 0 00PE p < 0P @d1 @R  <0 @    @ C# A ~R 0 S$0 @B01` Z<0 080p@< p0p@ W\ p$@ @ <0p@0@@ T$@ pHXNKpW@d<@?mP Ko@P @nP0 @En0[@@ oP@40S Y Q @1n/n-n +n)nFoPP}4PoPPsP l VVL C0?G /G[ 0W0j[0S ૴ {:S03V:gJ J 0 Qk6 C AH{{ *{0?G0 SWv{H0R 00 `: ૴jZ@4mmm mmOK+$( ꃫ9 p PVL J J 0 Q{g ` ( 0V:0:g `  0 $\ 0 p 0\0< 0@0h D i0@ SZ CCG IH0S\0S{ ^ ^ NNJ ^MPtP  p`PP^` `PV LqG5@L{G {'Z{PPGP5VLP^  [ A5??Ŀ  5L$0L AH $0G{{ *{0Se??GQp  @o pNWp@ 0 Sp3 0` Z1 <00 K@P ૴J ૴S\ 04@$ @ P@ TPR 5k@lD H0b 0 bSx20AaZ!1 <0 `05&L [ p@@ R RT R  P Ӑ.<00C<0ke P<00<0b4@R@o04S0S0ST V@xlvltl rlpl 0S  0?G; * 0S5\  gP %46$ $PpL V$(@4R0y S QH0 H ' @ p 5?55?P9к VH0忋SKL R0SG?G 0jS  Q R*k&0B:H @ H H040L R0S0?G0kS0S0SzpmPY mPqL 0@S0?G0< kS:7SVkkk kkhs 0S L 0?G0jSS+H0S Q) G H  p@ @/  P5 `PVp 0P P   $$P V0 P pl Ch0h 0 RT DP0P 0 I< E808 0 @pд P , 0 0@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-0r0000-w-x 00000S wS -S rS 0S /xS /  @-P@20 0ó 0 P P//0S/ S S/0S/0S/@-@.0@0T S R RT/ ?/PP/=?0PQ/?SQ $0p 0 @-!/L4 d ??SQ $0p 0 @- / P P P`/AQ/Q/Q Q/?0 H0pD D0 @-Q/?S0?/0?/dL |QP00 / /@-& 0  p@-V-P 0 @C`  PZ 0SpP.P`pp@-@PM` P0E S aЍp  PYZ0S 0Z 0 ਰ p@-@PpP Q 0S PP|.0Sw.p@!A-@Pp X P@PEX `@᭭P`( $0$ 0 k`괬 O- M` V$ p@KV P@ჭ0P RV F!0Ř0`F `! Ѝ0 Ѝ0.`0\   @010/C. * @    @RA-P(M`p |@ 0 @0@0 PP00\ P@ 0 (Ѝ  0?G0 5CS  A/0cS#:3 3Q31:0CS! 2#0p@-PP@ T Pp S 0\\0 0NpD0L@ @0 ࠯T(0M$ $0   O-PM`p 0FV"S00 0] PW@P-UO +UP0+ p㣬"; @P00Es Qa0ESW0EA0ES70EVTPSQ r@0U1 V* y yA ` 0T00S0 S` 0J0 ЍS T P0 0I 0R00  Ѝr `00XS 00AA0C PSVr `Pr `0? 0 fP X0M0 00ЍT/ QO-PMp 0GW"S`@᭩P-T0P{ +T@`S 0T W  p St?0  01 0  +  @Pp P 6 Q P  S  R- !" P 00Bs ^a0BSW0BA0BS(70BS%| Y[  Q P  S  R!" ꎰ"00ꇰ"00 0S \0F0 ЍS@ ` ?0  00b 0 0` 0R00  Ѝ0T0e XR" 0AA B PR W  pX ppT `@p M40?0 00 'W>pp>ꜦL 0M0 00ЍP+  r  Q0?0S @-X-- Mu ЍЍ/G-PP`O VW @00PE !R !U5  G 0SPPU pWU@@'jPp X2 00 00 @CpGp 00 贯0 @0 0T0BP P0 yV80C4 40 ol4 L A-P`gL@L@H0 @p =U   Q A( Lp@-@Pᶣ00C0S S u P 0` P㭣p;>`u@-@P 㔣 0`00@蓣06 0 ĥ D- M?  Ѝp@-PP@ T 0 DA 0pD0M@ @0 T(0N$ $0 ߬꼹  A-`P@p% W. 0S 0SP`/ 0FS0 0 0 0 R G``0Q00T 6P0P 0 बW4 b000 0  Н O-p#P3OM @Pd0 h`0410`10 V V 00垮/00 Z.` ӞP 30 00 [ .Q  Q\.Q O :!ᰞ!PH [ 00:[.[<##=[0Q.S7 Y_0IS00X0 0IZ 00 0O $ 0 P00J `` ῧ0 0C S::  20 ` #:[ 0,$P(0000堧$$1 !0 `@$ P00 0 0 41 30)Oߍ Z_00004 <`P@Wx Bt0t ( 0෫9 T.R  :P uLV% %  `" " H O-M M [P P*0: pxe0瀕0D50t50 0S  0 R0 !2S2 0*0: 0 D5 30ݍ Ѝ`:0(0('0P,0  0 @P?s0X`[S#_ ,=)|5  00^pP0 (03/P p[: !232040z P0H`X`uP,U 0  P [|ŝ@p< `E-8 @ DL 0T0XP 0 C0`P!0 (03/P @ Zm 0` S$0` R $@x TH:,00 0@0,0<Q 0d0PD 0X Q B/o" RP h ZO[PP <`BpP0 0 00Pp ! R soQ \ V\pp0PX (70(0/W  <0SP0 B@Gq 0 B^Pb B SPSP@Qp`0S 0  0X@@ @PC0@P0CX@S:@p `@匫D(D0PX C0 0CS:~04 R 0S 0 S9 0B'RSV@PH 0P%)E0 SR40 80 3@P=0  $0@S8ȥY 00`S.8 `X` P!0 S S S c097P0 0S0S <0S0P垥P0X@T*T0D 0R*P  <0X@0DP<0$4 0@ ̩ 0SD#3 @ 0: 0H0m4 0 0@P0 ? $0@SL0, @00R?*,PPP PXPI0 CR00 S]@0 0,0@00,0.8/PdHp/0XP CR00@S@PX@(03/P XL0(@ 0L0B&0P @0, 0,0,:'{0  0% P(Y p ΍ 0 00A81s>I,塖 0X0PA b6P 0 /@P90 - $0 S<0S0,P@0,0ἤ@T @,DP$(0H %Py( 0L @0,1Q *,@0P,0)P,0(@@C 0L07&0P  @0, |S@00,0! ! L! T dl |4x X A-@PMPD 0 S`05 S Ѝ0p 0%PP> P9 80 0P幸P  0 0Py&U 00S S 0pg&Ҫ8 404 0 sW& 0 8 T  3O-PP0BMM@040 0 00S0. S` p @0vG#"0 7P @T*Xd$ z P 0 <",2 0 4 30BލЍ 0     ! r7w$@PH S`PC 8 0 0@uPJ` 000 00000 0]0@%T@ 0p pIP 00S 0  0pW/  @. D& 0  % 0 0 0 ྦྷ`% 0  00S Sy wIR 4 d ,O-`PPM X00 X0 Pߍ0( 0#P 3 p0000 0 wP @000 "r0P> S0S S#Z 0S @0J0T:@D0S \@D _ @`i ` V@DN R % 0 S00 S S0 S S D`P0   CoP@ ?P  Yh*@[V 1@0 00 S S S@ S Y2* @ @P4 00 ``Ꭲ T: @D0S, Ca  V " t  T @D *($I P # p U ^0 0দ 00$(#I P py$^ p\H(L ܱtt1@-`P0LM@0D00G LpP0S- @.0 P( U( qp0 0 0 8P <$ 0 0 0 D0 30LЍn8Ptpp  @ $T@ <0< 0 *P ,l  0A-PPM@7 q`p@T) X pp00庡  0=8P # 0 Ѝpp T@#T Ѝ8P @, (0( 0 إ ̂ G-M`0p @P0P0 V 0   0 p&PЍ 0 PP 0 0 A-M`pPԧ@P , 0P (   0@اЍ, 00ЍA-@P M`Pp@Q UV'0S9 0S0S9 P`84180 ! P <Pp0P 00 ЍU U, l/ 0 0 Ѝ0S a 0 00S000s S 04 @P`8 404 00 P  lO-DMPP d$0h X400<00 (]!0P ,t@`p"0 `-@P P ,0 0P0ç RR RR$ 0 0 Q Q R R d 0ƒ0 P Hs P@p`@Q Q Q S*P ᪒P 0Q@ (PC! @P 0`@ 0$R0 ?0IPB Z0  6 PE Q 1 㣥  PE U!:  PEp0 Sh CF @`0  PE q [p5`@U* @`.","m 0  0H!41 0 <0 30DDЍ 8P8l P2 0 0 0u0 B` @ `00!!  0 ! 0000%00 `@`@N (`<h p@-MP@` 80 00ɠ YЍp@-M@ (9$  Ѝp@-MP`s @pP0P0 D0) 8 00 @  PЍ0@- M|@@PU l@P@@ D I T 9 yP Ѝ0PU7 00C-@PaMP`D UL !0    ` p 0S"  0 C RV0 0 C.S3W 0@ Ѝ R0 XR  9S @ 0m 0 $U0n 0 S @ pG W0  RU 4 8<03?0D x x XO-`#PQ3,M @00$00L V Pi PW@P:T Jo Tq 8#0P P` `@03P ` Z[ @ `V pW` @$pTM氐0S T0DE S0 s Sb 0DI@r@p 0< ᑢVA T T\ / 0 !1 0 $0 30l,Ѝ!1 0 $0 30a,ЍO@:TP (p˔P :V>Z' 0S 0$ SᰐPqJ1p0< CT TU 0 0H 4O0S kH 0)D0H 0"$p@i@.T`@$pTP\ʧLTh8 w hDv \ pu 04u @-P!@P 1,M `00$00& V.  p0 0 0  ;1P* M 0 0 $0 30,Ѝ 0 X0hT T0 V<0i8 80 ෡XLT  s s O-lMp$0Q4 @00d00 W P P% / 0 p$h4 0 d0 30lЍHdHDTD`P0 {W T T 0pP 0 B 40$0 C0h@ 1R LTTP   0q0S P q u \P 0PS qL u00 \0S PZDU00C40Pb@ 0T00` VQ*TU:00R "K0 g0P00Y0S>@T# 0U00S 0S"2 0 d0 30w lЍOuP0040b@ 0`u PU 0 S *  0CR00:>80 S8: 0 /Z Z9 Z@P( ?R0 K P P[PI`0P`0 ០T T0S 0 0 : 0 000@PSi U:0@0uK r |L 4o n `P O-@PMĥp P( 500SL ɖ([O U U U t 0 ÖЍ0` R  ?0[' + P$P 0;/qp 00P @ P 00  0 0 0጖Ѝ聞p pH0P  * R + L UY  0pp3P 00 0 SM  0 00;/qp 00`P^ <`V;᱓0 0P ;/qp`0 y 00 0`VßR <0`VßpX0P[ Rh0圔0cX0`[MS  00Qd <`800C`V0Z*" YL`0`f? ` ;/qpA 00  P @ P M00 0Z 00 [P*0 S': `F v Z1!0 I0 0C03P`T 0S  0C`ß 1G!0 ,A`V0 Z 0CJ` J`P @0P 0000 00ᅕၕ* 0 yD0@ @0 0 i l@ni <h p@-PP@` R 0AUD0 qV p<0H8 80 ʞVp0Pp8h ȨO-P$M`@ T0\0p#p 0 000 00`0' 0`B0S0 Q; `V00S  F0 S` 0 00PP  0察0  T? X 000P6 0SW @@RY00S@ 0`V00`SV[*` P Q@P R  _PV 0Q @`嵔H05 QY1 ᗐP- 0S $ H @ P H00S T0S S. S3 T9 P@ 0R00S0 0寙V $Ѝ P` `B`V 0@p \ D 0@@yW TT SSD h@0@ 0˝@$C d h̤p@-@PP` U 00 FGp 00p06| |0 ࣝUd07` `0 0 @p蹟0TS00hc PTXc (-M0 3/Ѝ/0@-@P MP U( 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0D0@ @0 JU(0$ $0 @T(b 4b 0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L H0H 0 U, (0( 0 0a T a <p@-@PP" U 0S S S pp0p@0/0p@0/H D0D 0 Ҝ, (0( 0 ȜP` @(` Lp@-@PP" U 0S S S pp0p@0/0p@0/H D0D 0$ , (0( 0$ t_ ĠdL_ p<0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L H0H 00 [U, (0( 00 Pt^ dH^ 80@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L %H0H 0@ U, &(0( 0@ p] `D] 40@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L EH0H 0P ٛU, F(0( 0P Λl\ \@\ H00@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L YH0H 0\ U, e(0( 0\ h[ X<[ ,0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L aH0H 0l WU, (0( 0l LdZ T8Z ě(0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L H0H 0| U, i(0( 0| `Y P4Y К$0@-PP M@ T 00P00 Ѝ0L H0H 0 T, q(0( 0 ޚX X ,qp0@-PP M@ T 00P00 Ѝ0L H0H 0 ༚T, (0( 0 ౚW W xp0@-@P MP$ U- 0S S S Ѝ0003/P 00S00 Ѝ00 0S0003/ Ѝ0L H0H 0 wU, (0( 0 lV ~ԗV v0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L H0H 0 6U, (0( 0 +U }ЖU A-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP *L0L 0 ޙ4 #000 0 ԙU 0*T {pXT mHA-PPMp@`3 W< T% P RP P P ЍPX 00R X# ЍAu &0 0 ^0 0W _0 0|  P@ K0SPQ88LS <$S DzR R yp@-PP@ T  ;p@~L H0H 0 AT, (0( 0 6 R 0yQ ВA-PPp`@. X7 V@ T P  R 0 R 0\A/W 0A/ 0 0 0 0Xd `0` 0VD @0@ 0ژP P wP ppP T`A-@PM0P` 0A UJ 0pS SW i {P R`V V V Ѝ00x0SP Ѝ W`# h0SPVl /0 0 zUh d0d 0 o  Pp,,N vN tN up@-@PP U (#p@~L ?H0H 0 CU, (0( 0 8N 8uM ؎0@-@P MP0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0  003/P 003/ Ѝ0L WH0H 0C/U, (0( 0C/L sL 0@-@P MP0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0  003/P 003/ Ѝ0L {H0H 0G/ࡗU, (0( 0G/K r|`K pPp@-@PP U p@SX T0T 0K/|U8 404 0K/qp@;J rJ Ќp@-@PP U p@|X T0T 0N/TU8 404 0N/Ip@dXJ |qH,J <p@-@PP U p@X T0T 0R/,U8 404 0R/!p@I pI |p@-@PP U p@,X T0T 0V/U8 404 0V/p@I ^A Z`P 00  Q Z%0T?\P0` RP YAS"`!0PU`00\ڲ(00@4ЍP`ᩔ(00X0S $0Q *0F S(0S 0 `(  0AU0S " !  [W@Z0 p w  ABQ APApFU Q   p  r  0B>S?0A0 S;`P R p0 S P`\I0,[ ?0,40@B0?Q0S !J1 0S/ p0Sw 00t'00s0  0R5 P`00p,@J0? Q0S`| jx0x 0S/ޑV yX \W\ 8 404 Q/0ʑJ6 xw5 lww5 vvp@-P0 M `00 1000p !@p < 40 0 1 30ލp@;<h A- `0M P@(q0 0 100jp 0 pl0 (0 0 1 30ލ<봹 \ Q:/R/0S/S:00/@-\@3#* 0^ @R R R u(000S0QA^ R! Q 0Q @-A?S SAQ  0SLBA00<(00N/G-p@`0TS'  V WT` P@0TS P?^ 00 (000QSp@-P@` P@/P`V  0R p/pA-APUQ?UU@A`pP W ځ1APǒ(00’00꾒?00Q A@-?S SBR 0@S A裒00螒(00/-- M+ ЍЍ/@-M@ pp TЍR/0-S0 \ S 0^C00O-P M@P 0DT"S ` P-Yb +YQ0Yc T@ @Q  ;`patWP;`pjWP" [)SQ" K0Iq P0aIQW0IAIQ70IS| V[SQ;+0S \0J0 Ѝ`Q0YXP 0LA@ ^P @ё 0R00   ЍT@@0? 0 ],. i0M0 00ЍK꠱ HA-`(!$1PP rMp0010+ V3 @^X0pA00tA0O00  TAV ϠPOP F&0 @ p00 1 30rߍT0FP P0 @V80G4 40 69h -, mJ, l00- $  M  Ѝ  -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/ᨯ O-@SM _ YXe 0pS000!R !3  'PP E``#Q9\*Q30A 0#1#2#4#8  P;   0U A 00 pQ1KP 0@pQ 0S  Ѝǐ0T @00Ѝ80@4 40 교0 0+,* djA-@P`p0 xP$0M 000Ѝ(, T 0 0p@-00Sh@@@pXPXXPaO@P @P =P D t|W p@-P@_ p@A-Pp`3t@t@0h@ U  1<0 㧀k  A} x5S<@=@-@ P0S 3/000S@EY A-P p@` F  dv000 / @P p@-@PPpp@!P1p@- BMa@0PD`040 E 8PU h10S ` 0L!  P4A0@ P; 1 0/~ 0 0 4 30/Bލp܏P ڏ`P  6/P Q Q |0 0~l0 00P 0 0 幏 `[7눪 p f<ĩ dflV O-MqQpAP@y hpf a@0`D Q 00]1PI 0SP p Z [ @@P  0[ pP 0P U:Y `P`PSP@ TP@ 0U:W  @0@00yHQ|00p@@ЍP Ѝ<0 0h}V e 07P$tT PT (0@-@P$MP U"  0P' 0 0  0bP $Ѝ0`0~\ \0 UD0@ @0 Xbh" bX8@" bG-@PS  RL `10\20SA HqPDDp  #)/0PS-0a0000S 000000 000 000 hG P00H D0D 0 "0bT|bbaaaa,X aaA-`P8 0S@P$0S!0Pp @:P0S PU @@P 0U 00 it\@ 0@ P 0 ,0, 0 ϋD __O-dMR0  H4 刀0 R X ($`000SYD@0S00 Y0#000 3 0  0U0P Yڰs@3Pp00300VQ QN  QI P0S_ 3/0 0P@ Up@ SP00SJ" 00C0T@dЍB@@@,20\ , 00Sq  R2$ |0 $@ (0j0L 00LP 0S 0 <<00@0000P 0 S@G$0S( @ ( 0=PN 1S@iPQ 00C0 d!&`1` 0( 0S X @0!a,1, 0( ߊX!b 1  0( Ԋ0$ 0 $@ (0vP @$0S( @ ( 0@J$ $ (0p tPO l N @N M 0M  ]P\ \\X \[$L K K 4ŸC-`,2 M08@00051E@PrgQndea?#cb m!"b[n!3: bQmn! 13c.c0 mA #c[ 3nA3: c2nASm1@  00C@aa0C0C Cr  \< @P0$DHd(T,@VR gR 0` Z` 0 Ss 0W0 `0R C S`[ 0 `0 IISQ0C 0 B2:00P/A!b  W0 `0R C W 0II Q B 0/C!bT: 00PW0 `0R C S0 ~`0Q 0900PW0 `0R C W0 \`w ~0Q 0<900PWe0 `0R C^ Wa* *BQ0/800P b bR  WE0 `0R C> SA0Q 0d800P{W-0 `0R C& S) 0 `0 l_`7Q 00P  OW0 `0R C W* *BQ0P / b bR  8' 0 .W0 `0R C S Q0P  & 0 W0 `0R C S Q(0P &  0 W0 `0R C SUPUP Q0P  % 0 W0 `0R C S 0Q 0500PWt0 `0R Cm Sp0X*c Pc 0+; x0/$% WU0 `0R CN WQ 0W0 S0՜W>0 `0R C7 S:W1x0 `0R C( W+0051E!2 Cd0bSӢ Rӣd B3PR  b0  OW0 `0R C S 0X   pXX0 S0R05`0P 0(30$W0 `0R C S0 `0P S0020W0 `0R C SWd0 `0R C S80 v` 0SX @ Sqp } qpp 0@P1  0S! -R8 S6T! P1QH<00ϠPWl  `(,/Q `PAP W90 `0R C2 S50  `%H ( H  p 8% $P  p X# 8  l HNhP95L05AHKPJ |(Gx2 1 0S  P   P W 0W `0QCP0l (`0 SD 1hW0 `0R C S0S4 1W0 `0R C W0S$ W0 `0R C S 0UP l! 40LII< @P$D?HA1cd(0T,@]%!E_d2dN`Re0eϠl 0 bSӢd Rӣd B2PR  b0  WK0 `0R CD WG0Q 3 00PW50 `0R C. W1``#` `=o  P7 */ bA-M@pP`400 p00@00pT p`pFЍ"00Ѝ(@- @MЍ謆 C-Pd@ M`0`@p h@@0  @ Z Ѝd 4C-@`P M\0`Pp G<(0 @ : Ѝ 4p@-0L| ^ࠓ P0L|@ T.^ڗT00p^p莆00pp@-@0M-S` +S`P0 P& 0.00:S V00c0Ѝp;0 P <0!" :R P 0 00Ѝp@-@0JS( MS 00C S! m1 P 0/S <0  0 P 0.S 0 }P 0.S  m1  p@0 f0@-e)P L@,(@l^3f*Sk Sq @ B 0T@ҜS_e P#Q@P Q\< 0\QTP@# N$0,@L ^0#S S 0@0C @l^#3S0@0@;S0C^:= 00 P /0S/ 0 S/0S/0S0@//O--M014   S j H叇"/[7Kk6 H`<0a/QH#x "xH q~~N`AN0S."w ?'P P00 #1?B! 0/Z0S< # JL"p J㩀A0S/ ̃? , R  " R0 0.1>0 Z0S P * *Ba AdϠ ϬT R @SX@tT)|rLk NQ @\O(@N(  @,\H0@ $ m@q P@P!PP"gף pC@)n$A[ O@:(@`&! P,$3#`_0RS@0@ oS^T\HNQ @ \O(@N(  @, )|`rL$0@ `@H@mHQ!P%W׳ pC  @*n$A Q O@:( P %! P,$3#` 0SoS0@pE)L\HNQ @ pC$  @(T0" R P`[ Ϡ! +P@. PP` @ R  Ϡ ,ό@ ` ` ቢভ` fR$  ` & , Ό(` Y`3`# 0C Qp| , SWT08?OX 0\ cSQsH0;SeER0/H ;0S0 ;0 H0`8 t@QqHPd 80< UTM WVU V0780P@`<0Pp? 00?0S  S   80<  ;/P80< SRS@PV0C%00 3 0S< Hu TT00ЍWV `VpcK80S Tz! @T!Sz[U0 SR Z 00SJF|Flmph`0 `pQ Y:Q@PTJ#M @A8剱<Ϭ P ;N0Q8 5@0\?5O0(<2@ 0>;N$0S33K051E00)bz(.L@x?ᏒL`F8c@c0CV;kYC00#,Ƞ @B@- c 0z(: 6S X00[$0/!+>0 (A O!2c0Xÿ0+" ?00 #2>[?`FW'@ PG`m1%0p:#0  ό"!/ W n13:$  p C0!".#2R> ' @01 30 #1`0U05? B4sppp00/S [U c 0y(: 6(aS X00[$0/!+>0 oÂ!`2c0Xÿ0+" ?00 #2>`T[j@tc 0$  y$: 6S T00Z$0 *>Â!2c@T0:#I0$BNo :s0c (a  o\y(: 6S X00[$0 +>`!2cX0;#0(``8?O0 ` cQ0 R$I"ITY BqgqgpC(1 ? c 00"y0(: 6S X00Y$0! )>0%!EÂ!2c0)XLß8\?H)" ?00 #2>r?E$0CI"I0P0/A!b,!b S3 1I B !.50c((H<" 2c0 4S/  `00 \000U PE 0 S0 0(0 P P$0<Ѝ8\?H.+N)<2LQ @ 3 \O!EOό"!/ T(@[:.+N0 pC#". RD 7 0@0 030#!R̂"*h  “5.2L O\, 0C8PC@D10@e-0P00040tc )1 ?00jx0):6S Y00X$0%(>!E!2c(\/H)L0Y("1 #2>N<`pc0q~T 0 ~@-M@00P T 00t0(0Ѝ 00p08 O-@P`M 0S7  V 02[? Px 0PP ΌQP 0`O2%> 0!"R<0  0 S0  Q00v~00Ѝ0 S. 0P0' V 0V"> Pw 0PP ΌQP 02%> 09`0OR!"3 0V @ 0 Rh!Y0h&P l6Ym&N # ⊡0 GP 0V000 PS?S00SPuu0 P800p0(0i P?S00Y` O-`p+FMM@PF  0 1 0:S0@/S' Yw:0@PP?P#5*H  0I0|0P/S .mP T0.S0S/SOI@@N@P & ?I0@+PPPS*F: 0 0 30FۍߍBP*0p 0 Z*Z:Z4Z$ Z4*Z4 KRo$*Z #Z1 "*Z$!Z$ ! *ZZ *Z$Z*Z *Z$ Z*Z Z *Z$ ZT*ZQ Z *Z$ Z$!1QP}Y*1R @  ,^\- 0C0:0@ A D 0勰S 0 0OI^H@Z PU|Pf0`p00S00ç0s0S] PWUSXUPTH )JD Y@Z <*  Q H m` 3N(@p $P,00`4[`Q0 < P4"<Q$1\p. `LQaPV RPPP@Y ! 0 ,0@~$H \@^ PP|P  Q`0Q$4 Q$!?8:Z S00C08*S R R P8ZC P00s L p@x̔\& NhCE;E> 0@ 0W㉱@ 10<@W9  PwP0WP@/0Y@0\0B0 pS.0h! /O0 BSP PsP t\<U02p嘮0A  LP@X 0 R 0SZ0Q∑X }Q!爁 000  0P\ 0 # 0 C!@0z@@F ,h  Q^7 Q Q@Q@QDQQ^"R hNB 僟AhN $0 z $0@  Q J0ph@ $,P(0$0`\S 0 * 4"< Q$1 WU [[ P U0 @ p \`0\$4 \$!? K[ (0$@ T F nQ R S  0I0B0 0:0@ 0Sp`@(Fo0 R !0S P t1Q N hp z0P@UG A# 02 ?0cQ00 d#lb  a O-@0MP<SH0@SЍ0S >Sp@0GSh>`P [ 0hS01Ӄ!0 "0yY,Ih0  000 001Y# <Y60`S0S >S@5S*S0S -S0 C Rp@0GN<)hh0 `Lhlpt syЍ*YY -Y00I S@0IS0   S ,S;SQhAl d ;S,Sc Sjh^&- Q 019mPhjp0 pK19mo\Ϭh6PcRp9l ukt bhp& l&w& 000 @ 0N\hPy@PP x @h P 1 0 0? 10/p00P 0,S0,0P 0Sh lub$ `(p&{,t.Ol6(w60h参@0 l0O ' @< . /O@ 0Tp)0`L4@岷@`p80 @<Z `p [  R- K   cX 5:< cR8 0#031` @0?0cY `4@0`p (<2@0<1@00 7 0@8010@<00)P 0L@ @@参L@40@pD`H P0& 0fS005:804fS0#031<`0`?0cPpcs VP 10@p1c00D`[HL@0 01 @p0\0=1@00)<2L40P8 5@80(<2@<0<1@X0 7 0@`010@d00H``P@p @D LGp @R * Z{ / c ^,  \ _ /ጱ ce  [.࠳^B Q ! !c 0 p?0 c@R`@0X<$ ( ,00#8#< cRX05:` cR\ 0#031d `0Y  lP 0 S =UY  Y.Z@pDH`LP@T0g.f>0X 0H!S1ð1Rp0`4@ A-PQ@B 0S !1h ? @p Dh6l6 `N`P 0:S LP XpHPhnW qP0PT`X\PNLg@_`PRhP`T`P  A-`PA@pP qPPPWrPqpATW  P>UH QP |1`0t!t0V ;00ӏB m``@ v]=D0C0C P S\@0d@D/  @DK0?P0S00#  1PWPࣶ IK0U0h,_P@P0L 0Hp0 ;0BșD, Ę\h $0@-$0$0@!R !p ėX @-\F<l0hN 0Q S \PNw 0 \ F<h0 0Q Sp/@-8w 0 @-$@@ o(@l ,@-@@@4 @-n@p@-PGP  @`PPpwP`0 +p@-PH@@~<n0 E?Ppp Dp@-@`PeT000SDn80 @Qp tD 0@- M@PF0 @wP00p0(0 Ѝ0@-M@540 EόcP00p0(0Ѝ褔T0@- M@PP0  EόMP T $00t0(0 Ѝ000p0Pp@-M@`P0 P1P T 00t0(0Ѝp 00p0hp@-@6nUt00QU d 0P@Hp00 P@ d `p@-@PP 4 0p@0 p@lp@-@QP0 0P 4 0p@0 p@P0 0p@-@PP0 00 p@L $@-4M*b`0@b P `*M$ 0pT0 0Sp`4Ѝ0@-P X\0H@P@@̌ 2P0p@-@P<000S 00Q 0"*X  T 0SZH#p<02@T_kmx А G-@pPb0jX` T]0SZ 0 P K0SZ 0R 0  S \Z^ UT0S ˜ ST0P 0  ^ 0SZ 0TUT@@@ 02 ^?<02 P?<0p@-Pp@d000S T00P  0xP@0pl 8$ Pp@-@P`P` U 0 D0Pp000\ LpL0AH H0 rU00B, ,0 rx> $`D0@-0@0S $000S 3/,p@-p?LP@TpP  0 3/P WuO@Tpl0A-0`pP@P UP >u( p?p `@xG-P p@ ?o2W0S Z +` @Dv%:/P p@@TP0F 0 rt`GpPp0`P0 rZP0 H0 r80H4 40 rxXpA-PP`@! ppT IP ` @L2L€000#S €^"R804 40 q 贋(p@-@R`P  p@ 0 0 q괷lp@-@RP`  p@ 0 0 qX<O-`A Mℱp@|| P2 0P2LB?0T- P R; S P@T" V0S !Q L/`3/L2 S1P2S? T030# T 03Sp0p0@T@@P20CP2sP2SW pW ЍS @  L3/L2 S @ &A-h!`d1M @P00100P0Q0S0 V8 T?p `0xq80|q 8O\8T@D1@V  @@TAPϠPOP0@ 0 0 1 30ލl0Ph h0 pVP0QL L0 prT 0 a7 6 HxXP00- 0 M ЍD6  -<0< -0M$0 0 0zЍЍ/5 0--M0 lЍЍ/0 0p@-P@Xf`00C`0Sp S u P X0` X PXfpXu`u5 \0 X0`00C`0SppSr P X0X /XV4 -404-0 M  X ЍЍ/t4 -4 4- M00 XЍ Ѝ/(4 G-@SP`n 0S:X( (S Y" UX |f0p W W2* (qJ0P00u,PQpr0T @0 0` p0pWP PPp],P Ikl`C0 00 Kf p0 0S Z0 0 o0 0C 0 002fl0Qh h0 oT0=P P0 of I.l`X<00̯--M  FЍ Ѝ/ -- M0 0T ЍЍ/@-PP$a$M@`< +pP3 n@P0 !70P(/S!0p@0 0 0 0 00  $Ѝ 0Qg$Ѝ$fq0000@$Ѝ00>, ,0 -oH1 48@@-@P e0SCe0; 0 o̭p@-P`@j R T0U:T0T:p@!pRsW@-p@-@QP> 00!R ! 00! \ uP A`0? Q0S0 0S 00C000P0S 0 U00SpcP#bP `bP \0<X X0 nD0W@ @0 n  Ap 00\`ȫ8 RA-` P$@ R0 ,°00aRK 0  a0R00S 00@0A PA05\ &l plL<0@^㖌 1c000A X \00X00S PAA0 S< =<;:97310/.-,+)('%#" wsrq" %: spR V@8VL0V & a0 Q V  T 4ЍPPؠPPؠ0 ## 0B Q00C$RNKVP00 x3 0S0V `1!'  x 0SM0V `1!  x 0S60V `1!  x 0S p 00B S0 @#"00B 0B Q$R8 x 0S p V0`1 ! xO 0S 0V `1!xX 0S0V `1!0 *RS 0B@ Q 00B S@@@ x: 0S0V `1! x  0S0V `1!    x 0S pD 0V `1!dx$ 0S0V `1!W V  x 0S]0V `1!F +  x 0S p (  xz 0S px) 0S0V `1!x+ 0S0V `1! x 0S0V `1!xn 0S px 0S p 0V `1! py yp rp kp& dp ]p Vp"s R 0I0py V@ `1 | x 0S0V `1! | xm 0S #pT 0V `1!t ; x 0S40V `1!e ; xX 0S p/ T- * p# p$ p7 p#l x 0S0V `1!'P x 0S p[ x 0S0V `1!  xi 0S p 0V `1!$R 0@C p7 x 0S p 0V `1!x 0S0V `1!x 0S cpx! 0S Wp@ x 0S Ipz 0V `1!  x  0S 4pe 0V `1! PZ X PU S PP N pG PD B P? = P: 8 0B Q@  "0 B  0B P$Rh x R 00p V@b P  p  P  p pO p P  P  P  P  P  P  P  P  P  P 0s 0 S p  0V@`1! P i$Ry@00 P ^ P Y P T P O P J P E~ P{ @y Pv ;t Pq 6o Pl 1j Pg ,e Pb '` P] "[x 0S pP 0V `1!p PE C P@ > P; 9 P6 4 P1 /O-MM@PH &P06 T0060 H0S 0T00!R !000h00  0S   R H0 0젍800,00 @CK?(d00㘠400l L0` @T `%T @TPFU 0pJ000S0P00 pT P0~0-100$0 0EZS1/.,+*('$B!:0y6<+PvYq`a43+,P\P    RX00sT H0S] P+>Rh1RQhOh.LQ]T i 0@EH TT,dD|ύ @8Hˠ@`P `!\P` `0@ 0@00j00E@ `P4$00E S$UK 0@EV U5 % <4 0   Sh !0S0q-0~0$0Sp $0@TS@@ 0R00S~0^@ pd`$@4 /\p XpDp0Sd ,0C_0<0$0S@@0S 4 1 040<0S0  7R10P` 0BL00?R0S 80S 0P80 0S-0~00sD0 P@  SP04 pP0p04 0 { S 14 / BPe40P@U40P 4@1^0s010P p00`~0PKP E~0PS 0~0?P@000,0CP(,0CP y$0 S00S^h0P0LS`A0 $L @@T0lS0>0,0CPD(U&ڨ= , 0` Bp@tp(Pp@`FVP P!`F Vp@Ptp `  =P0P 0~0`,0C{P(e,0CrP(md0V~0P W\ T0p|`, p(PB@DT0Sp`0 KP@DT0 00S;@00S,0C5PK000S;000000$ 00 h00000S00@T_$0L 0$080YS`03,0CP0( )SP0 4  P0$0 p~S  ࠡ040S R@Dpp0$@pZUM <*^8:8  0 0a4800NSk `U~0j`   $@p@ \@X@D@HTip,`(`P@@DT0S` 0 P%@DT0 0P S@ 0  @z   SP0 4  pP0U@a Q S 4 PQ 0P0j _ @C  Y SP0 4  pP0c,0CKP0( k,0CAP0( lX\\00Y0S w 7 p`0<\0p0(D0Z `Y\ YD0IKJ\0D<0PC U PU ڜ`P\=U@L @TT,0PX`0C`@DT\pPPf@DTX`\0\@,0CPL,0CPC%x5 00 `00CL0\C,0CP(~0(yT0tu , p<`pPB(@`pPJZ0S@0yP0D 010R0bB+ S- C S1! N L ScS!2e00 P a000AE0NQ*nPN0 a 00SP4@000T0$,4, 0 0f`j$34 0 0\`],0C*PP04 00 4  P0US 4 P  SP 4 01P S`-0~0͵$0S|p SP0 4  P0 <` @00S3@000,0CPm(/ ` 8`@\ X < i,0CP[(-0 <400<00<^pdp4` 4UpG`   Sg 4!0SP 4 01P 0 v   S4  P1 0P [ S 4P E   S4  P1 0P + G  S? 4{,0CaP(8`4P``U[ʠ``0~0` R D64 ̮ 8 H Ԫ Ly0 h ܦ tԷtp L srr `@̬Hi̘ $ gȪDTfeHdTA R R R DpX`\/@8` <@``A,0CP(+0^p<0< 40 ^0^}@` L| D|LX\@44P#`I" . @S ,WO%Q!Q@!Z0I Q S 00Q00S" 0 04PD0dpXpG\$@400S@P0@4 00 4  P0 0 p4 S 0L@s0-1L,0CtP(\< n00 ER 0 2! 00Bl00?R0S l T~0pp$@8`@/\@ X@D@$00SP04 pP0p05SP44 01P SP 4P  = 1 S 4 P1',SP 4P  (S4  P0 ppP0!SX 4 P1sS4  P0 ppP0d` @ L L`^Ď@c. D 0S." 6 0001? $@0 0l0shp x0< kS4 100P=,0CPI(  D ^$@8`@\ X Ct0@d5u, p<`pPB`(p@DT&0S@0 P0tf`0 4 `I<00I0S0 00<`00S6@000@W'7 T 0]$@0  cP0 00P0]P0P00P0INP0  0P P0PP0 P0 00P0>``< V `!dP0P:SP04P0 004 yL D@BO@? 㔰`f^T , A0p`  0@00S 4P!S 4CS 4(>8 0 0 ] @BL@0?V0P PP M%_ 0 0[ H00*pP_ 0 0H,0CPB@(P0PpP0D)9  H 0\{@Q SP044 P0 00 H00p 0SP0 0 P0P P0P P0PpP0 ^0S P4@ \ X _8{eP00E SE@ 4$00A S$Q0S) 1$0P 0@00 % SP044 P0 00^ 0 0S4P014 $04$ P0 H00p` 0SP0 $ P0 @뢎@-` MDP@pR8P0 "PR ЍX A-@P`pR0  PRO--0p@j/ Pck] @  O (jY: 0D @0S0C C\0S  U #R   CU&b # 3S RUY *CUR"W * W@`pG@0S0@FZ`U00 E000DTY:?C0C1  0O1 0S  ` 0SQ @e@`멟P/ P P0SA0D@  R=U0 0U,  sR  Y 0D@ R(U 0U  sR Y0D@ RU 0U  sR 0 0000D@ 0꒍ `k$ O-`-pЄ4KUDM 0Sp00 @P`U0ʳ?G @ 0 X @ YR YH 8<`P *:8 R ?CH{0CQ; +c{7! G: A{ ZZ`PEU BBF3 _JRx0$000P(00I W?o2,0BWpG G0RM30 Z70  DЍO<00C QA@a a40CG{A0$0Z0b000U0P0C00eP(0R@P PDЍIoᩒቐo0PE$0 0p00004 0<0Sv Rsʼ10[ 00Ӣ?+ [ +b +XP@0000  Q0@DЍ   4 [ 00@P 00[00WY  0 R S~<0SD0SAʴ [4 4 0 @ DЍOaCoc?`(?yPD? ]Tcd R  RC086h0P0]  R00Z00S R0 0HJ B (Q 0S 0P0B 0P(0= (0`0P5 U ,W   `R `  0 0 Rd1 H;0""1 0 1 00!;R 0Q ` ++$ R +kJ:[ {{+S 5AH  04+C 0S021;Se 0[{ * r0  qK; P4 `a{+* p 0  J+t+Z SP0CTF  s9R  0r @ S0: {{+S 5A 1+C r 'a J0H+0 |30 c0""1!ha+ 300 Q+b P+a+z E XFZL$ R[ RZp e`PY  0PP0S0S1 Wp 0pYJ Y 0v`P= 00P8X& H Y9R  p e(`P$(0W(0`P P0P  00P0 4 0[ G 4L QU  D $ P,@ p( ~pe 0@wP R- WPQP (0 SY[Q 0P,@P{Z 0SZ s P@mkU 00 G E[ 000PP @  1 L0SC0P ,W  qP (0!(0 `O;cD +0{* p@ 0 r  +s  Pq 4J<0 R0?00Su0 00\ `;0  Q `{ A *N pN@  BB*N*0 r  P@y< `  s0R 00P@0m[s$0S@  "`P 0Z  0P0 P090P00H Y0R p-0VPP    !X0P P  D0b0$$0G$0Pg0 0C0`P 0S$04 R[ G 4W4 o[0Sk 0  g QQ00S Y Y~ R0P,@0`P 00P9UP 1P[ 4Q0:00C00+b {+ { +S 5@0P00   1 0Q Y6 Y p b -* P0 ^PR Y[>0S 0  7 Q$Y0P,@y 9UPPvp9   RQ R !**R UP0 P@ iP @f 0S]P@^ R `  p 1 @0;q8p0P,@0P9U,@ [1P* 4   6A-`@PXUTp 0S*P@ wXp1@@pXp$S iXT@peX@+S#S/\S//P@-@00@ R P@Rp@-@`0P0PR* 0PpP R 0 R VpP0 @!-0O- MPSWPE@!a0p  lR V`":0  ơ R  RW0  * 0 S 00CX:XPE* R P  P  00S 0S W0*!1R 0CX:XPE* R P` ЍP0.- UM,@00L10V    M+X 0 P  A wWgW TH0@- @-0@-p@-`P@ TP 0FP R @P  iV00pT P,0?( (0 ,U0PE0Hp@-@P P`}PP  DVp0: 0 U$EGd-M ЍpFF|~pqw1hpqpq1`p- M ЍP/> 3D-@"M @Ϡ#90c 0Ѝ0@-@PMP  0  Pp`Ѝ0(0;$ $0 T  MlF, p@-0@Q r P p0 S!P00py PP    !U @0O-M`pD@0DQ00P;5X# @0S S] @   b 0P1  P  0- T@@  0  "W @TQ 0P@020  0 W`h ЍQe @0R AX00@P00  L 0`00R-@0QMW 0000`VBoPQEp0 0 `b| V 0 <T@P@00U"000@000# @^ 0Sd0T 02ax PP @ 0"0! #000 @lx`@P 0Q/ R  B /A-`0@bSP)p`B @@AV * D0 BS   `RT0 pg3701@V * CQ B   >T E PPO-p -@|M0;0 0 AN0 d p Pl0-P-+*)('&%$ MT000P0$0 00@ S0000S`@ #T0`Cڜ T0 @l@00@ S0\ ( EQ $00 lp0l00+S9 -S40400l000C ^0Slll00S 1C\c,X 0d, 0 A(0S S ?o280jTg@Xpp Xaڐ* 9 g01+S5[X(0S (0vSj( %0hSpHp t0$0pH $h) Pp t0h0t0 pLW t0 h0t0 A<  R Q4 pCW pp Whpw"0h000004 St  <00S^40<000 0 ˷00 (0, S  J ?, D0LL@ Ph    !TSp0 @P] p0   !HShPtp E `PN R P4,0D0, C0ED PP PE0CPpPU00 S 0SPEpGK,0SaEQ)3(0SoWg[  `P   PP 0S0SI p 80P S X 0S#C W <04 S0d0 p [c0[` KpQ 0Z00S@00P0L0h 0#Z00St0H0I `\@ 0P$0 \QJL[pp  !J $p Pp 0 S B\:<04 Sh  Bh $  XH0h t00@0C?oQ20S K x!)I Zɋ0S     0Sp|Ѝ 00XS PlP0P P0$01p Ql000Sd00d0R cpd d|Ѝ $ ( RiS IS NSl@8P l 0000(S0d0 0p 00nS 0p lpd0P+  ^PJT l 0g 0C ^(^l00l00(0pHpWt0$0@WD  @P {lp,000l0Pl P00W'"!,1HC0 AQ:S:?C0C0  ላ  RQzGpGp4656:H  000 S  QH 0S l00S l 1CQ;l00C P 6&V瞯< iLqj0Cl00C Y' >.l00C0N YL\,4Q,a,p Ppu h00h0l@ZP3 l00Cl0Q Pl00l000000p d0sS(0pHpt0$0pg  4101 p W'"l1HC0 AQ:S:?C0C0  ላ  RQzGpGp4656:H \ 200 S  U80H 0d000KPt0$0pHW p201 툋 4P^>  OW 0@P0I$Pp  B\ 0S. h 0 h 0R00`P n0P$0 $0@ > P DPp2 Pp <0t $0C B<0t p:00 W0 0P0 ዴH^@UZ80{S相zI8] SM Oa0P$0y  p  d0P 0d00Sh0K0S pPp\  t00C t0  0V TRLPNt0 R# 00S S SJ p? 000 p  d"!@Q*O000  0c2300p S 00S 00P0d0Q"000Sd0000d0 @0 pBpPp 0h0t00Ct0!HR00p0  0d0P"0 000000`@!0@d0 0P0I040008000c80  LTIT R0l 000p0PdA 0p Slp 0pD A,<0p0<0t $ t X ,00 [d K P p <0h0Ct0 Pp{ !T T  TTQʽ (H^,t0 :( S<10:t$6t00`0l!5S00 8(! d  刋 H P9 J[@0P 0@00 bP :相[ p0000 P (@I @Q X@X @Ӕ(@ XcQ 0ӓ" 208 ,  J1 d000! ` `3P x3d  80(00hA1! 0 ` `` `P ^4A); \0t0$050`lS !00d0K AWW k 0S h0p |Q0x40  0 0Ch t0!0d0,W aZ!0d0!0< 4R0PP @Pt0 p 0Cht00d0Ppp04000P0d0I@  000p d0Sd0S`  p 000040t0P0d00Z!05 d000# [00Sp 0 WZ W0d00  3S 00d0 2Pp  h`1`f`Ph00h0!0d0<04 pSd 0S!0d00S00000t0h 0Ct0s@-}00&G-` 0pQ`pp@PO PP`q0s #8z *8 "80 W# G0 BW`E   3aV F@0Rs#8ḐA)80A#Y 0U 1 PP P`P    !M@P@3ßO-0M@p 00S 21`C`0 000S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WJ:Q0 X  \60QR T0#03\0SuWa* G0V*0F@S3 F\   L0WN 06S ЍW*@DPD@ Q0; Q0Q l@ l@4 Q:@00XS Q0nM)ARo 婒Y" 0^0 n12000 QP0Q0l 1 c0R:|00Q )Q 0긤 O-M<0 MTHT8@`00Sp 00Qt0P00Q  EB0SG^E@0= PQa @0 \ ES YH P 0S S SC `Pb@0@00 00Vp@ !KT q Pe 0@S50000S Y 0 @PQb R  BPQa S@0D0CSڣ0SPW 0S] xF00TY0 p0TDX@N S0T0@ T  BB! BcP DRy`0 S0 S C U 0S S S LP@"00ЍRq  BPQ+Q~ -Q  NQ @N AY  ^!#AAPPn(@Ѝ P 0QP0Q 0S00 MS S80S 000 b@0 0PL"00@By`P D` 212 Q`rQ  Q P PR  @V 0Sf Sg S @00ЍaF PePft0 S_K@"00ЍP@0M@EPL K`"VpK`W `2 p 1 PE@7`BQ@!80Sj80S 000i U U EP 80S800c8080S `T0)  RP!@L#80SU80S Q0   B @P Pwj 0`e  BR "@`P3 `2d"P1 5 꼠  P /A-@9>8C RP`.pn3 ^P W0@00 pU 0`PEPU 0 BP @` pV  p0 BP0U`0@-@-P M a@] 0 B 0C2S* Q*KU AZBKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ I0"S1 1  !2R / 3RS/00 |0 c R\0a X0 c R80A 40 c R/WWp\WDA-B^0000`Q1 !0U a2!!p(  U2!NRA!1! 0U U0N10CSC10R 00@-@MS: P @  0Q P~@ЍA-P aM1`p0S3 U10AT !0S 000) S@T0  0S 0CЍ0@0D!1S<000S 000ꨓ tH A p@-@P00p R pPQ`00App@蠸D `ڶ80 0QApp@ζl t8H0  0#10/sP#8s R#4#2#10 0// /A-`P@100("@Up0p 0S1pP@P;pP    !rH`~P081#3S412s2sS/1J //@-@P0@0O-0MZ  @SpPA PaU* F B  G  ^'* 0H X0C0003 00ZP@T   `d`` XZ P` @T@T 06S @ЍG-0؁@pQ$A/ QPiV&10SO`P[ 1q0i000S h1е {0P4 p@ PU `@00SbPP# 000S 0⦵0⡵PU 0C  pPpd0⏵iV0S 80ℵ (0R0i p TtH G-`P塢0P@Tڃ0T P$ Zp !p G0  i )  \2!0L\0C0003R @@JpG \ -0P1 0^$23\ *G-P@p0@DTE1  0\D*32P ::P  @a P@0 0S 0SQ 0PApPEQ%Q  3!!@ V 0 0S03#V`F `F` 02NS @0@PpP 0!QQ!P3 p@- @A`DPD P 0`0R @ *\ l0D1R 56 501 P56 +CpR `C5<5#11C<C-` MYP=@P YzY0W6X0 W   0 C~GpGp50cp0 Ѝ  0P c2# R   W C>C0C012`0S0/0 R /@-phaM@P`D ?P7PP5 سpP/0 S Q8 2p! 0: S1CP 0uPP@0 000  0 0 m ЍF00Ѝ\PP0EL L0 DF00FO00꜇ 4|HĴp@-@P ;00C0S0 P;pP0= 0 DPG@-@P 00C0S0 @ I0 0 jD8`Gp@-@P`S 0rSL wS aSP F 0 pP0S! e C+Sr0 SR)# P0SPPp0S0S0S0SP0> 0 DEdFp@-@P9 0S? m:P00 P! !( 0S 3/PP೼000P @ P 00 00 !!R: 0?OB 0p7P008, ,0 CEP 00LD@-@P 00!R !+P 0C 0; 0 CD@-@P 0 0 S @s70; 0 CpTDp@-@PQPU 100SD 0  [Y ;000S% 0'$0 3/0:s00P:p00P @ P 100< R 8000S680 0PIA7P00s0l Jh0h 0 C 0@0 00 p9E0 @0 0d tpB-Ѝ/@-A@QS S S E 0 6@@0@6@@0@d6@@0@0 0 0; B0/0P 0p/@-D/41S C-@ -  !`0p EMD2/D d0 @"l f#0a 0VfgPx4p`T!dRAbPPa`k{8'<H0L0p&` &BZj XhCVf0T!dPa`C'RAbp@VfBTdA/ CGˍۍ vpf APM_m[PQ 0jPVpQ 0jPKQ 0jPA Q 0jP7Q 0jP-Q 0jP#Q 0jPPQ 0jPY`Eߍ /,DO)D,a$AQ@-P @41S  P *P0 DA-4!@ `PP/1S 0L1籿P@媿PPPU!RMPPP !Rp ᐿV C`_oRC`C``@-@P 0@w@A-@`㥾P] VapPᘾPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ   V MCPCICPSSO-P M. Sy$AT IopF qp A`TU XX`F( [ʋ Q `(q0S 0P@  Ѝ0C$!o?P$ (xp ₰\} Q 0x@^`S0S ?^0C pF p(VB (  A$!T$$( [ `( A^ \ :0  S@PB, \$!C(1s V(0 @T谟0 v@԰ 0 m@갰 (![ 00Q($1@ (A$L 0 pPd $_ |88TT8008O-,M  R0 1 p3/,0 (Q0 Pt @P``^$`P 0BZ@ P@U pWW 0 `PL @R㲀( PUJ[K` `,Ѝ 0 oPPu/  $`AoPB $ 0 `P# @R㲀/  P^ ^5 ^ 0Q#`[F PP  gP0 jP@  ,Ѝ$`0  ppoP   fP(pLW AT(Q`0@-@ 0! \ @+A00,1A00S@-@0 @{A00,1R@-@1  0@hA,bAO-`0dSiM @ pPwG@P Uq  p FAQ 0  p r+s; 4 q40*LDĀ ?PB H5 7 9 ; = ? PP ZV  Pp^4Q W!3\@ 0Ҵ\ \@4b;P380 D‥+pW $gP G<2N ,0(< X5PVBD  8p `,TX ᰮPu 0 pj ఝ 0j VU 0SR A/ 1? $  p(0  ,0 0 4#pcgkopZ|`pZxZapbY|YdpYefX|XhpXiY|jYlpYm^n^x \\ DS^W\[_PPQpPxRPTQUQ QVXYppZY\X]X ^X Y CYGWKpA@WBWtD^E^F^HI\Jp\L\tO[M[NR+;R+ ;3S7[; R$?00S1S42p456: 89<=>00@p K[WW' K[p@XX( 帰R[@\\,嶠R ZK ^^. PBBYY)SRQBBpw 0AS[a@ PV IRR`  ;/@PJp( qPF  1 D0!NB;ḡ !V Q U0 aP$4Q$容P| @<<%< p@ED p0 (0$,K [pepUJJ 0!iߍOPQ?P 0I? 0 pp$p>?P;?Q6?Z0  @kA{40t?; pj7 D =P  B5 7 9 ; = ? ?VZ ??@P?P>P0ay>p>p  O-@(P0P!0`5R5s`(P4Q̹ؑP, Ag ( ,0XD D S 1"1 O-hꁡ P ر  % Jf= iؑ@-@ 13/, (Q0@-@Q .00 2> 0 O-SMf `& 0[ p0P!W G QZ Z R U UUU  X>00PЍ6 p & 0 T !9@P 0$ Q10!12oPP1 0%S@0 25X0 0t5 0  040`5080X50<0P5  B00<5000 S S >00P ùp ό 20 2 `0 p 0 0aWp W|3Wx# 2[ 00 20120GqS  000 1S 0:8 G68@X*xwX 0 3,P0 "  5-P 1S0S1S - 1 29 2 1 29 2 1S 28 2?R.S # )H +P}PH0b ”@S „9 LSPpT#0'+p/ SS4!"0X<$0X8X%0&W<(0W8Wt)0*pP<,0P8P-0.X\ k {Q<0Q80R<0R80:Q R$  k{ „SML0SJPp`|0x x0 i7_P00@ <0< 0V7?8pD A = ;1QC/C- MAT' }PT# `P  8 0 AT R0 X 0V@T Ѝ0_P  000 0 1 01 0/p@-Pp U@ .p p 9Pǥ 9P@x!x1 @-CM0M@P0,40P9 D10@!,`@  P@*_p  qp@ ֦p#  ዥp U p W 0 0 ,4 30CލЍh00P8 P>l8P@8?00 N M O-p@P\&`X6TM 0Q0L00 (00 2mU  800%5 0 L0 30rTЍw0 0St1S7  'P䁄0  0少0! 00 B0R{?0尠ἠ:1S ZY00 P 0尐00o(0S !<(( 0P0 0(00U P0尡1  0C SY*0 00 P U 20 2(0} 0{w R!/*R$: pl 0 0S$0<008004p@0<040 pW 0 0S$0D00000,`H0D0,0UZ F'P@ 1000EJZ㪠*z0Q* C 0@! B1r 01 0!!0(0  0RG 1S RN  RQB  'm 2 T 0 zpM v'PF o' 0 QIY㩐J*yI Z00 P000s000 0 1 S0"1!{/010CS`* v00CS {?!0b 0 4`700\0bX X0 4D0b@ @0 4}4M L |  H p $ O-(0Mp D @a0cPX0yP P FP4J1ZuPp01a@0  Q1S@10CS㣰M* 0Ks0S0Cs00  VrS10C1(0 . Ѝ @Q! R b0(0 `p. 0     PL p P p 0 0R1 S0C1ȁ2b"0 B4Ta Y  0Ip1P(00(0M QPEUP*0EY!:YQTQPEUPi*u00CY Vp崑 (00(0N1b!0 4u00CY* 0p1PQ Y Q %PP  @PAzPA(00 (0&0!0!0@```0 `p崑P j w%PPe 1P0CS㣠 * 0J1LP(00  %|0bx x0 3(00(0 %@0b< <0 3,<tl,|p@-@PQQp +%P 0 0%Q %P 0 0%ppO-,Pa V0Fi 1%@T `Vp0ഀ0 0 pq 10CS0*S0SS 0SU P 1b!0 ,30p 0 Hx1FV㴠0pp1  0 S001Qp10CS㣰5*0Ks0S Cr   0Zq00R10C1 (% R `P 1 ! 1 P % %(0b$ $0 2p0@O-pP$M@Q $00 2T T 400@$Ѝ(  @h @$Ѝ踷0ⴧ0 7 00 `Pc  R at@ Y*P0 PaA 2@D @`T㴐: 0 bo2갑@IY00*0S0C0y   Yo0pp 0BRs00010CS0O*SUP@0 #pP 10CS0*SP 1 [10CS0@*S#P O$m J$gT*TP^ 2@0 2$ЍX5bT%T0 1T +$(5b$%$0 1 $Y긐Ioᩒ $/`  $00 XP" 0 RH  @`ph S9 `V #q,Z@ t@@D X ?#q Wq 0G 1H#P AᴀW@DT@:0b 13b#0 1 #t # &#pPI Pe 83b4#40 j10@W1 @0t@@C 1p 1 0@10@pC1# "@P Y0*  v# "P 0zd2b`"`0 21@T} [#T M300r` M# Pd ,` 0R X 9#qW@D 2#q0V! @0G 1"PC WR  B1T@Dr 0ⴠC 1 %!0Its0p崠1 加  @D10p# w"P 10CS㣐:0b 0 0  " _"Pd p| ļ ܻ,h@-@PM 0  0P Ѝ05 0 0ԷO-p"P2JM @P M`0040h VW00?$G?7O0S 0SNIPIT/ "P ~200P"H2 0 4 30Jލ Ѝ$ >X00 0UXS 0 I0;w0. T:+[) PK0/S  0A00P0: S <2000S0I S22?00(1C$!$0 /QPPV$ 4- Þp"20S X 0C \0 RK Y B"P100W p wP 1@olaX5 4 ܱԵR Q0P:Q0Q:0@-O@-@@Ԟ $ @p p@-@(P%#%,P$ p@譟൞ d @- M@0 @ PP 0S  Ѝp O-@lMeppF P 0` $ (t0 F4<@ DnH C2 bG   p ($,08`LPPpT@ p@P , .PnlȠ P% `p'eX "gx0#@$b* c: dJ ,n P%l̠ e\p'` ```g|@$ L " ,0# ,lȠ.% P< P PPa`PPP p'PP Pgx`@$P0#.Pc:dJ " p'nZb*! ,g| `0a< l̠` 0```0P% "0#,@$ <PL vLP@P, X pPp0 p0004 d 8<`T@@``$` (`\D` +;H`P p0 $(, `048< DlЍ expand 32-byte k@-` Rp \M0 @ T 0 "P  00   j/@ w X P0 0 T0 30 \Ѝ0 7,0, 0 %., T, Ȯlh1O-`0X!0M@ p 8`PF  000 0լp. R+X h   0 0 < 40 0 0 30Ѝe"`넮+ * @-`\QMXPDǝf0S 岝@P P)UЍ˝㚝ppePU1  @˜@P tЍf0S p#*p0 00 p@  ៝p fTP@  F  \ O-pAp@p,2GdMYP `!" DP 00\00?0 * F$Z0R0T`:Y%Y,Z8 @@  @T @@000X s0S&YS\!P1 0 \0 30LdЍ4!010 $ 0-@  0 02.Z0S @  #.@ 0 0 0$ ,0T:YY h d0d $ 0,YYZ@p( ( t|0ԩLC-P- L HMH0D@D ` CPT0 +  C  +C!0 ? \ P ^āpde cd퍐ߪ     } P,F - D Z0 030 0F e P  *P @@  P0f000d d0 0 0 30Ѝd0 0e  `& ا8 |$ 00@- 4MP00,00Q @T d 0T T H0 0 ,0 304Ѝ0$ 2 %# # (! Q$1 A-HM0@P0D00 ` @sT( 0T p `bV 0V  \  h X0 0 D0 30 HЍ$  $  ՚C# 4 P" 0 C-P04M`0,00(`@ pW:T p 0T (T H0 0 ,0 304Ѝ$  ꘚ! L! 00@- ,M0 P0$00 @1T ` 0T P D0 0 $0 30,Ѝ0$ w j  0 @-pQ0,MP0$00 `d @T 0T x l0 0 $0 30,ЍP L0L 0 +$ < /4 L  @xA-@p0P A`q080P0P0 00S   L| PT00 0 00 0S$1   @p P@  10  RP 0 0 0\O-؁Pp`HX{* @x00@8x06 A@DT@M*t@ @0p@wp0 @q@q A@DT@G*t@@0 0 000 0谁HX؀<*X 0  rP@:갡JZڠ *Z  00@s Q: b0 07* b0 0,* b0 0!*h bd0d 0*L0H H0 *zğpXlDO-1,MP0C0SP0ᰐ%*1 0CS 0 0$*0S5 4 P0$0040000@p`0 W PP0ES"z01 PPP Wo*00CV 0 @P`p%Uv`j*P 0u@S0SZ 000pVwp: P$@@Tt@*1@A(0  0R 1 S0"s0&1!V0C 01ő 0YP0 PP P0Ӂ0C0 V* p@p V@ 0Bt@S񏐯tj`40 W100:!00S`*00CV\ WPU:00 .)01 P0P P Pl01 P PP bTP0   r0`@@pv`t@p V@Tt@C*0 S10s00s01,Ѝ00 0  r00  r0pG P$wpI@ 0  0(B 0  0( b|0| 0(d `0`  0(`@p [넞DD̙pDC-Mp`@P& PP! 0!0 0r 0000 00!! 0 04000000m@PЍЍO-M@ 8pPPb 0ء00岡S000 00 001 1ᰠ0CS`A*v0Z4 ء ]`PF 00Q0岡000 00 001 P. 0 0V<0 00!VppA)@PЍ0p00100@PD b@0@ 0'ޥp $O-dM`F0pጀH @(404 SL0080 rPUp XR*$1 0Cs011 " r  0 @0;(0HLP0S a,ZE ,9,,)00 9  0 $00 00 00F 1ApP% `V 0`00Cv`dS'U$#"!  HLp   P  dЍ 00封10CS<*0S00000#P `V 0(p,0 000CS@!1 S 0 0  !VQG HX㨀*xP∀ Xⲁ \ XTP3/ 0 0R0 0 0 01  0 000 궄HX 010<0qpGWp6*< wp0刀pqpG0wp0qqpఁHX㨀9*0x0,0LpS[ (0S  2 0 #pPA   aZD P 궄HX 010<0qpGWp*W 0 0 sP:<刀1  0C s0 11qpGWp*wpW 0 0 sW0 0,0LpS P   dЍ 0 S10C$ s01 1 R00000 0H0q 0 P 0 0 0fc 4@0p0 H S @cHX㨀<*x0V* C`` F1`010,0(pAc` 000000 qpGWp*wpp10<0AqpGWpj*wpp10<01b 0%0  p 2 (09p00S R&P0 0F #h!bd1d 0%L!bH1H 0%0!b,1wp( 0%!b 1  0%p000b $%0 1i q0 $ 0w% b0 0m% b0 0c%uWL`̍x`tP8LhȌO- `P@P` 0S7 2 >`0p! Q0C S  [ PN 10CSp'*w0 p0C 0 P&0 0Rᴀ  ;`崀X 00p10CS`7*v0W 0b 0 $0 R `崀 `V `崀 0R tP 00<0b8 80 $ (O-pP,M`Q 00 VV 06J  (0`FV񏐒ea0FS&00@,Ѝ(0VP ,0`1V 0` 10`1 I0ⴐC 1 @P a`FV`:жb̦&  0  I$ 0 a`FV`:v` 0b ` 9$밑1I0Y㩐`1: 0 b)$1,0@1S 0  @0D @P 10CS0:5b%0 # @ ⴢ@P ܡ0 00(0rυ@ 0⸡0 (0`=` 2  00@[  V0SO 0SL 0 @TG @崢 0 vp@8 0S  00 V@P' V@ V= V(0 YSV_ ` V :@P 10CS`*0FsV @崢긡0 @(0崢| @  @`F v洢k(01ḡ0CS㣐z:*y0ZV= ` V @PIya @`FV`: 0 b;# @괒, @ 1e @P 0VSTa V0F T2b"0 #,ⴢ @ 1C @P 1ᴠV0CS`z$*v0Za V0F * ` `o10ⴠCአ !10 @ @P[1b!0 "0Cs 0 K 0FsF 1!0 崠C@ 1 b@P3 10CS`:p0bl l0 "X0bT T0 "0Dh4`pTd܁|p@-@`PP k0 00(0`0Q0(0pO-M5p@,0 0弱 PI 10CS`06*V. `s`V P @ `Ft@@ 0P 0%00 10@@l [ @Kt@ m0@$b0 #" 00Ѝ 2 P UQ\10CS@*t0UQ 00P P @ ` a P a0 [0 t00CQ  a[ 0F 1|P A0V@DT0@:3b#0 ! " PQ@P \Pw 10CS@t*0D@  10 PPe a0 [0N a0[* P0F 10P @VT 1@D Ut@0@CPE 1/1b!0 k!1@DUPEt@ `@! @ 10` PP 10CS@:@1b*1 96,à+͌ +%7% 9 ,0# $$ɠnj (ˠČ 0#ˠČ (  , 0  ,4  00!(p0 0,p/.!.!~rp'/!!(,#̠p' )Ì   ( " p , p ,8p 8$pp0 $PR (,]< xp|`tdphPP l@\T@0LX+; k{(rK [p xb|+; B ЍHspp@-@@P`DQU  0pRPQp bOQo J0P0L0@H 0D0 0p@PR Q b5Fp .@0A-a@Pp fPX; i@0D 0 @0D # H00H0L00L0pGPPp3WR`G```@0D P;@0  S0D *H0L 0H00L0UpWP .@0D q0 @0D #H0L 0H00L0W`GP``` P@0D ;@0  S0D *H0L 0H00L0U`R @-|/A-@P` PA78p@CU p@-@P X00k]`\  0P {P piR @-C/A-@P` PA(p@ U Y03?0/@-<P1M00AP@;P񏐽 U L U0-*'<9630-*'\YVSPMoka^[XURO%"1/d]VzP;DPnE@5Py|{xsrqponmlkjih{xi{POedLl]\[ZYXWVUTSRQPONMLKJIHGFEm\7P 7P 7P9@ 000P$0H 婚p H1ލ3P 3P @ @1ލ= @02S, DP׋00   i@ 0H Ϡ _p h 0H  Op ]?  @ 0H :p HP 1ލ d \@ 000<P$@ 0Z@ 0| n| l| j| h| | | | `| ^\z Zz Xz z z HBPC ]H<P= Wn Dn D@ 0h :h h h h h h h h h h &h }h 0 @ 0wa ra @ 0@ 0t@ 0  F     EDCG+*)(&%R ԨBH@ԤH P @ 0( ( 0P$ 0H  /00pH  \@ 0eH@ 0_ B <,h:,:LDaG-8M_(`p P 9J@U@W@V@Tn 0S?!Q 0S !Q0Sz Q 0 00 mp" P0 ! r R  #|:W UQ VPw 0 `00 " Q!W  Up& 0V P`P( U  V h! 00@Lψ 㷉8ЍV `00S0 0 V`0W Up V0 P`0 MP0SQ q0Sj Y @P0`0  V갊 8988 D ( Ĉ HaЇ p@-t0@T 03/@T-_ PP (00@T 03/@T\XpH00@T 03/@T$7pX h , @-M@@P Ѝ 0  ڗp P00A, ,0  5TH_TO-@R MpУ ഁP `@80 S 0SI: L 0 Z 0 80S6  Q?0 8 0 0 Ѝ 2 Z   0  0 0 0P 00   |P00 2   ֕P   ϕP  000 0@-R M@P Q\   0 013/Ѝ0s/r?  ;P100@-P U1!^ 0C B^ \ L0D0p@-0P`U 1!^ 0F BS @\ `fpUpG-`P @P0pS:ؑI Y `1`! p~ * PU  @T<pP pPO-Mq  PpG 0 PU @P U `1`!  <[  0PU0  ЍЍA-0P @G P 0 a`F = P pV @D: 廇P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp40``S#U!*`P840#U:080pO-@R"|M2P 00t00[ 00S80S `X"P2 0 t0 30|Ѝ4P`0  lP8| 0 1\  8 40`00 0Ք pW`: P8$[= * *J1'0` !  x4PU 80  P@R88P`0XA@ ᬓ 0* *J* "@R080 :0 S p8P8嗓P8p P 8 ` 0偔`P p800P8yP8o00`j+, Dy O-p-M$ ) 0H 9,0020L2S(0 PU 0P"4S7S5p90U 000\0h00\ P0.0Rd00e0 0h@00S d0P05 0CX 0 ?01H]0 0p S0S000S1!R00:X Y 0dc/0S0c/N  00S 0 Yp!SRPU 00$ R 00"00'7 0 2 30ߍP2S`708 R0009 4P`4∐\ 00400P40& 0 @ ៓p$ 0`U:: :J&` #S6P0F6_V[0ࠓࠃ48U00St  0\ X``VP ` p` pPP"X[v  00S8 ^(( ^ %P`00S !SRPU 00$0S00m8Qp 4Zv ``` Zo XPF 0SS 0 PtP Z_Y0KX  R&c/u0 0# Y, !SRb@T 00$0S ,0S !4E$0(0S (0@TP  z P!SR@T 00$0S ?00 ZY0 0dc/0,04 p 8Q!SRPU 00$0S00dc/p v@ 3  p0S 0` E%C"0`P0S(UX`P%`VX`P2 08@ 턑lRP:P~0 S (0(``` PC_oVRPU 0S0SeS 0 8080\S P \`0P o`!SR@T_ h 00Z@ @h L`㧏(0P`2 ` k8@P@,@ `Y$0SW00<00S0!SRPU 00$0S)@ @ ~ꬽd x 0$ u l(u q p A-M`@P`@p`@',0 0000(000ePЍdn 0-  “ ƒp@-P@Q u0P !  2!0 2pp@Op@-@P` VP#p0-P@  P 0S RP0/OP *0?c0 3??oPP0/0/R007 B-~x` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/8!81@- 0MQ020' 0S0. /!PR*/ "RR @/ 1@t0BQ R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ NX X /O-?o,MP2PP0 0#R00S[ 0c#!    0pR UU 0E`U&@0 (U P&  ;/ P;/PcW0 0P`PU0c   E BR  R L@F BR !R7 0T0TG SZ:P0C  00 0pP0pSpU0 @哕(T**Pc`p@Y* p  Wp ;/P T T  0 X0 W p0p0W:,Ѝ  P;/ 0P 0B  `@U, ;/PW W 0 0R0 0 R0T 0f:W 0  00@DY 0ZW  P S0PHW 0 00P<  R0P0 S*T PW  RW  0 P  WE P @F B BR !R AK;/P ;/PP `Q  0 0;/ $ P ;/P0F $0;/ P;/Pڅ0 0D0P;/ Pf;/P ;/PPPWAE S ;/P`  R0 OP 0 C 0BXPx 0  7"!  R @F B BR !R A"! Ru0 0SR;/P=P ;/P6;/P}$ ;/P`u;/Pb ;/P Z ;/P0 0Q$ ;/P$`Y 0 R0a@0m< <0 v(0l$ $0 mxP9ww`9w- M00 ЍR Q0P:Q0Q:@- 4C-S MP@  $3/t`0  QP `>~4P4S  $3/000 ЍG00A-pd 4V:@T@T 0P0S  00 S  0@P0`0dp@ B ! @-MP` pP)0: S"(@P ˄TPKQ+;@bAl(b`ph`C@\ 0 t8 dTЍ00@Ѝ $$4/p@-P$0r0" @`}Pp$U04  0B0 0 1R  0 p %  00@ s 0 ASL @- 00S 0=4O-SMz@ApP`ᇁ0S*0S'  TP Z !P0 00 Q   0    ЍP? $ 0  QP0}$R P/(@p 00q000S0 0p  4 S  $3/Ѝ 0000O000QA 000/0@-S@  R   0 型0Sᙋp@-P@T @T 0 Tpp@Tt|P`p  0S S/P/O$(0c03?c00 R  0 0 3??oP//@-@ MRpP:Q !SV@ЍA0 0` P F @Ѝi0T @0 0O-PP X 0S ' & 0S# p@# ,0aT T 1 !3/Pp@DR00C0S T,0p@VP ?0T` BB \|  i V`! 0  `C``@ 0p0C0S 0T `p@QQ    D R !,03/`PIʼ0@00 "R( Y `10`!P0VQgRJ,03/`PY M 0p@D0C0S T@ 0T p P@0S*V*  000P@DS*`A 0`V:‰0P 00``F0 ``i  0Y0C00 00oP  v 0 0C0 Z `l 000YP sd0G` `0 / XH0HD D0 % L00_H 00[L"p,jjH,jp@-PP& 0 `V @`0@D0T0@T ,0 3/P`ʼ0@00pD0Spp@/0V 0 !P+ip@-@P|00 M0 PNp P 00, @x{ 2Pr{p tR0 q R/ S/p@-@PQP7 100S- 0 5   0 P @P y0 0$0 s0 00R 0   p0  0c0p k,0<( (0 h p 0l)0h@-PP0qM`@p* V2 T: p p {P0 :CRo  S L 0( 0R Ѝ ; 0 Ѝ;0t0p p0 % VX0T T0  T<08 80  $l(HgLgD( g4g(fd#d3 @-@PXSlM0P0d00A 0 C 00  #3 0 d0 30lЍ ~0`0S+ p60P "W 000pS0```ppeP0 ```@"|<2< 0 0S$p"@ Pk 1 0FB0/Q/S-,+*)I'&%$#"! 83 )p00  00 .   0SP `w 0X 00 p p ppp l0l 0 4 hT7Pϴ l ( &Dhee$.ccp@-@0MPGy00TaIzV( Oz0T1S Oy0T1SAz0`4z00U TX!\!R Ѝp@"y\!.z00Ѝp@y00U\!X \!X0 000S/ t0 0p@-0PUp@0x00TQy0`U TQUP xpX1P0X1y0T0`X1긚 th0h 000S/@-@0x0 X10CX1S @xOT1$y0 @x t0 000S/gꜙ t0 0 0S/p@-@0PxU00 \A\Q X! BX!R p@x`y00OT!x00p@xt t\ \0 -4M0 0,008 00 0 ,0 304Ѝ̘ p@-@QP  ,Dp@yy09 0 )  _O-M`P8@@pp>X |F0M0 00Ѝ  @-M @ 0  9 2uHP < 00 0 0 30Ѝ8Ѝ Wx 04 S $ 0 / ( 0 S 0,/ 0008 S, 0 /00ꤌ @0 S 0,/ 0008 S, 0  /00(| 0 S 0, / 000kp08 S, 0 /00<Yꌋ (0 S 0,/ 00DH08 S, 0 /00P6 0 S 0,/ 00X%X08 S, 0 /00dt 0 S 0,/ 00l08 S, 0 /00x 0 S 0,/ 00@08 S, 0  /00\ 0 S 0, / 0008 S, 0 /00Ј l0 S 0, / 00(08 S, 0 @/00D 0 S 0,@/ 00v08 S, 0 /00d긇 T0 S 0,/ 00S08 S, 0  /00A, 0 S 0, / 00004 S( 0 /00꠆ @0 S 0,/ 0004 S( 0 /00B $0 S 0,/ 00| @/ /H-M| 0ЍH-M 0ЍA-`p@P0@T@7#0PP@-Ϡ "M R0# 0 ! P@, O !PЍ  0S RP/O0?c0 3??oP/ 0p@- M0P@000@`0@PP  @P< (0 0 0 30 Ѝp议X V( ̃ G-Q `P@ S V 1" RpSQ P` 0Ck ?o/o0CS 0c0<ÁVS' /o?o BR  0b0<ÁppϠ0T0S?p?ᬏ0 Q RVP00B  V 00T# 4o 0a08/o?o0Cs! p R 0b10pÁV V50o800@b0q<à)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO 0@-@P  000 2/ / RC/A 0\R#R! R/ 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGO 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 000Q0@- @P' ST0 C0 ^@DP \T0L^ Q^P 00PPQPS@R S Q0 S0 0 /U/ S RQ0 0/ 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@Q0@- @P TS Q@DP  ST PUPQ P00S @Q R U// Q#/ C//s R RS 0 0/U/0 00/SR Q 0 / 0U0/ 00/0/R - /p@-@RP` R V  U  R 0 p0 0 IQRp@-`@P 0S0 000 0R 0 0p 0  0TLI IR0  S 0Q 00S00/ 00// Q#/Q- S  BP0C S P QP 0U0Q- S Q P 0S 00P 0| 0 @-M0@000+00pp00p p4 ,0 0 0 30ЍԪt ht -RBMM č dd  @T  2 Pno2  t GG'0 @-@-`@#Ms MP p $( rN TG " r @$@"p `P0 "l2 0 $8 30ލ ЍB^T"P@ 0p dn0 B^P.!0 )100A@  0 0 P \ AL+\ -L+*)B'&%$#"   \P  h\\\\\ک1\s p$ 0F ($ Fr `h8# &: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A@-0@0MP >S@ BP 0 !#00 8P0ЍL00\@-0MP0@ >S  @ B"00!,3,0 P0Ѝ*00@-@Rn@Rn0 00/Pk ,0,0-M 0 000 0FnЍ0k -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/j t@-@p@-0@ ,pTpPjg0Pp//////, //1O-0,MPp`W P1 0 A A0 (05/,Ѝ臈@PK 0S PPP S0S2*,! 00S S' !S000S  0S S * RpC 0QW0010 0 'S0000p0l l0 .0T0P P0 $0@\XT4;;;d;/Z/[/O-M-0= 00000P0Q0S7 X@ ZO\=  0 0$0@=0040< =<;:9876z43210/.-,+)('&%#"z 8]>X7  eTY+ p<0< 0  0= [00K0"2 0 0 30Ѝ0 0 /  ,  0 @p$2000 0 <0 0@r  0 90 0 00@ 0 0 lQPI00 0$0@! r 0  0@0r 0 0 00 00 0@r 0 0 0X 0 00p0T0  0\Bg ;L2|\ d ,.D..A-P@@ x0`pP@PU J0PEX@S 8/`upW$0: 0 lY xh-t- 0SS S 0R / 0R0@o/ @-SoO-p !P1CM M@`00440_@ Y 0 @0 44 30*Cލ Ѝ0`P 4 PP lxp 0 dPzL+ Pj  0Kj/ꝣxX LX 0X ,pG-`0S+ S'QU$ pW!@0 S0P@0#S0S 0S0S0S# P Y Q@0 0R!R  "R R R \O-0ഀBM⸏xMXH/ P`t! X' 0 paP@P UDbAb0 ZPa>PD <0 0 4 30BލЍU (U O-L!H1 @ AMT M00400?1 Y.: p`x (R5 P_0#s0S"uPU/ 0 0@T aa 0 P PU $ 0  )aPL D0 0 4 30Aލ Ѝ x (RꦢT S O-mMM?x /| 0060 @x?T080 1S 6 S`1  8 ?,@ X@0f0x |o @0P0 .0S3 SH0uP`【  R LP4 p O ḐhP* R!Rㆃ7P @`PT 0STup P```0SPU @  Y 0S(ڐ- @ T |- \ x X < l Te 0d<0v?HL00D0< 0h S1S D 300S S00`01D 021帑Y[0P0S|000x0@0<00SsATp D0CPo L0PPPym 0;[@@ 0 %P A@?0P:P . D0< @0 < TL D0 L dH0S  P0S Q <00ox0. S00P00SS |`P@*pX 0@9/PU +: 0 6 30qmލЍpW? <@PL0Py !fL0P0   8 : X0X 1L0x<000SJ0`0KD0`Sd0c  `@p  0G$0VG00  P`?.$0G A D(4, !00 0 4000F00ePPB U0S0  QN `1  8 l9T0 X0H0[H0  0H0; $0,0 0SL0@ ( ᐐ#/E)b,"dP =0S 9@70P `u8t(@' 0n 4 H0H0PC Q   0 0@ P0`1  8 7\0 X000 0 1 01 0H0@`00 @ vdP& 0 Pl `1 s 8 60 X0aO00 0 0`04PW80&D $X LP0@!@    0 @01q峐1W @0@D ` PT!> 0v/$ W G z$   0 T$ 0$ 0W 岏  dv@ Š01粐0a 8 4P|@ X00H0  cP0kL 9@70P `t8t$@$ 0n  (0l00H0Jt8$@# 0X04 2!  `1S 0    0P0H0`PTgʌ PH ?`!!! Q;   <38 @ X0 [ O0P RB @ aV @*Px 0|@6/P0+S .0CS@0PPtPU a8 L2@ X00`!8 2@Xلl S0d01SD 3h0h00S S`` ``P19 ih0 ^dPi0 h0cP101@PDp^pP 0@ 000 b@00P`00P 㸐D2PS ,S \'&8'N l#$!D <,DpL@4X`@, TP0D Br DR bP0l0P0@@ l06SV `p$0][pY0P0{ D0P TP0D Br DR sbP0l0@0P r8D!@! 0| RW00 0R 0`1 k 8 10 XP0 [0  Yr8!@H"H 0Ӄ$0 P 8 @2 X@0[0  k hP0SZm=00r8"0" ृd Gr R000 P T Br DR  R,#aPʏDp0 P 2@ 00ycPhP "1011S1 00u8 30 X0}0<0l0l00e8 4L@" X@0m[0  t00P8 t4 X0X`mW 0p0h (0l00l0@0P r8%@0%0 00+S .0CS"@0P q8p%@% 0 `0l0`h0 1 fP0@ q8&0& тq84&0H&H Ă8 h6@lXຂ/ /MM  00  C R1#0e(6,Ѝ0/M- 00S  R BC0S N 0Ѝ/M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@aP$Ѝ0 aP0/0$Ѝ000 $Ѝ00@-$MP@aP$Ѝ0 aP0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-P #3CM M,p@0Xd0,401$D D$ 000 S  - 0p y P@ȡ0$ \0Y PN00A  !< S -0 \4 0;  P0 00 00; O P00 Z `P10,430KCލЍS" Z 0?s0S0Q. Q( Q" Z      0/?r s0Ͽ|XZZZk9 P7   PC-PH AM@M`p0 4" R3 c0 @ ` P,8ĝ0  0 0 4 30!AލЍR6 PP 0@ .R@@T  @ @ -.Z h6 d5 4` 4 O-!1AM 堡M0  0 40Po`pPLpQPG `ˀPPB @ t+0MBP7 0S4 `  0S+ 00@ p6P00@S 0S0S 00@ K@ @Ua @ D ,0 0 4 30AލЍ蕚4 4 |l3 O-p#3CM M`P0@X0,40\@Y0S  .S@0SV:T d10S#0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $NY000$0D DR @@ 0S+ .S& 0Pʛ0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@( 4P/d!  0Sx0h 0@$0000]0@P@Tk0!0$  00$0s}0S 0S XV0 hO0  Xꕙ 3 2 O-p0\MP2@0`$T V0 DC UR3*@ pϿ16 /O 00V 0 P\Ѝ0"0y 0  j~V X0 F0 0WP0wpsjXfX0崐SUPPW   B RX00 B 0WP NXKXLX PHCX뺐0?T0$0 `F 0S0  s3Xw0X 1X0s)X0S 0 } <0 PB0?T0SX0T T0 ={P<0\ЍPH0?T0 / HdC-@0 Mp`(P,@D T@<)W?XpW뵐0  W  @`DW0 /U ?R0s0?0  ЍP D 0 ,0, 0 `XlG- pPᴒ@Ḃ`- F0SP`?0WV!;` WPW, `EV00W0S ?V0*vG`EyW@T@V@T ` T =P0P  08 A404 0 `x8P0O-䡐 MP0S5 @d @V%0V@Q\ 0\\"  p偣 pp p $@4 O-aM0 MP@060U0# 0 T =0H0E`g@01&,d!n d! .0A 0`11@05<0=hP 0ʏ 4 Br@p d1 2d1tPU `@ H\`0H SD@_ S\  S S00 Q@0S SP C0SQ0 0CQS000001N{P nmFdosmaFaGP P0s/0r$G$0 o t)F s%r&G, / X  + 0<P 2#S;S 0S! 0 S 0SV 0 S 0 S 0 o>R 00sS2 S S 0  i>R2 S S0S 00 S S SS@@  `0[@_AaP@  0,zth $ TlD 0, 0S? e2R2$ S S400R00S 0@0 S S00 0S Sl  P }05 C0  C1 0`X&0 0BPRT RN0P $0!T $0R@0 $@8P $0 S 0d12d1D AX| ҥ1|ZAp 0τ|`0S X `0`H@DSH .S0SX P`.HX00V0S 0 P " 0"002 0 6 30&aލ Ѝ l9s4GRB T T0 SD3H`00`080X3LP0(0 00DpP T T@ TT  ;T R[@T #(0  ;T 0s000@@T  pP 00P  X0們8h1P @@T;T x4P0 0s000@@T;T   bPX h!2/R !R/$0l!0@ S0܃DpH`LPO c8R\2 S SX0SD 00 S S SS@@9  `0Z _AGP@H `0DS \R=* S S00 Q0S000rOP.P `tZ1 DQ fD@`VxQz0 SQP@P  X0偑h1h13?S 1/S$Pjp0p-PQ0 2 {4#RV!1 p@-Ph@lHMP ^ T 000HЍpp Qx#r cXV p  X0xXPT $000HЍput4tRA-P 00P00S0p `V pP0\\C\ `@`@ ꃃ `` O-0P-QM 0 t4t0Zx0P0 p/d0P0   (0$0P0@   BPw tPY' RR - 0 !⌰pG#Y 0`P  `P tP ` R Y0@0 0000- R  pG` P@T $P $ a` AT #Y  @TpG T 0  9ez00`Qߍ P 0` `FQ* @@8Y;8 m ` P叇:@@T:@DAp PP` R  D  Z@D ` P pW @D + Up6 $ Z @D 0 q U p 0  d0 0 0  ;8 @0ɢ0 0  ds0弢 0 k |̡@0@ 0@-@P @9 0 0,wH h (0( 0@-@P00 00/ @-@P @_900wо l@-@Ps00p@-@PP  P 0  p |0 0 [ܟp@-@PMP- 0 ` 000vPP JP +AP2 0  Ѝp*Ѝp 0  Ѝp( $0$ 0$  ܞ@-`PtA M@J h!h1hQ P0p0 SpG0S< `9Yp> ЍA@.sP 0(sP 0S@ R @sP  A0Ne Ѝ0   Be Ѝh0d d0 PP P  Dkk(LHPH0A-0PU" 7U"P7UP!q|@@``FbP $bP 0!E`$1(`P 02~PHjjO- Ff M@`0, S0 4 V FPp$@0(RB 0vW\0g(1<0 BRS %+38< 5 0(< 䕟1 c 0@0(@'p4< P( P| ptqpd 40Se0S H 4 0Sk`6S (% 4 0S 00S S404 RR 4 "S , 4 ğ0 0  ( XA3*0210S Pq00 S^P40( D40 0Sp (408s1%40(8p(JpP4040^30( p Ѝ 00R 0Q*# 08sx30!8(p04Q(A%01Rx8# 30<!^ ^ w䂟 S:p 0(" <!%p0(0P^4)|20( p2 0(< \2 0(< H2 0(< 42 0(< 2 0(0 2 0  8 ( 쑟0 0(0(1 0( 긑 (0(10(0 R 00! 0t1t0 0`10Wp (4p Ѝ:p N5p 0o ^8snqp}2 Z 00K  9cxi$ Hiih|h$̚ggggg4gff\|f0fete 4eeȗddd|dddLd4ddcccccD`(|hH1O-0$M pW G*$1 Q0AP01o@0^O, 0 ^/@5> 00S@  @ 0~0 T0 00Z @ :P80 0 0Z@ R 0X$00 $Ѝ(bxhd`(0 $0 @- sp, p@-@@`V 0 CQpPah`P P `FP @  p"`P 0`0p`0@-@00 R \\  $0!0D0 0@  ( $ T__@-@PL  0S  T0S@S`@S,_P/0d 00 0Q,0/01P/0(00$ 0/^p@-@P0`P 0(0 P0S  1T  0C00`p,^p@-`0P^@P  P^P 00p- A- @0S  P p00   ($ 8PP(p`P0t]D]]*O- 슟  0 00006qp Z Z 000@L@PЍ < 2R"00@ؤ\ 2: 28MP0 0^ 2< 21 0 010010 01001001  B 00l100#P 0 R00   0T 0 2 13/pT`0-00PP ` 02 2qt00q@Ym@j0SwZy 2: 2d%Pr 2 @0 28001,00 8<,pIC-`@ MpPQ B000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH zP (0$  (p  2 00P9 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p  ЍR @-`@ MpPQ 00U,0`V( 2S * 2 P13/PPF `P 0 p 2 00P Ѝ  Ѝu00PO-1PMS-:00 X0*q`I`[ 冗p@ p W   0) PtZ 2< 2ЍgYPЍO-MrX>*`00Q̱P@M0p@ W [KPE X`:`0E 1P 0UX 0 00C0 0.QZ@@`F`\dw G-`P p0@R@D`tv`` t@`T@:w`@DptTt@@```T:P`D@`l0lh h0  P0rL L0  40z0 00 سvuسuG-@`@ pRDZ; 0PS0GPE SuP0 0 B0W G0 B 0 0S \pC~CR00 000@@@T*80pG@Jp0C80000 PUuP_G 0  0F4tTG-M`(P py\WK \<S<04%R @@mX0 L l3<0(Gp P4,0SJ  4R @$A EA 0RR"Q048<0 X@A0W00Pwp0Gs00pЍ\00PS<0 p WK,0S0S $Q S$0 00S$ P0A 0S Ss0 Cr 0&@0@ @0@ 50 0 0S/?T #P0P 0 pW?O00qtqH1Sp@-PM a@SP8 @0,000,P8ЍpPU/G-8"42M `M0Vq0 00?`w P`  4R1Y< )5S0@@\X0/  L,. l3.<  0?FpH VR`!T1  0 0 30K؍ЍX@;0 @J8 Z8000S . D 0SR# S0Z 0SQ0Bl ppP@0@J@0@O00v  O-P ` (S@P H1⫲0p1q  J08 10000N`ⴜA40O-Sp M@`0S0040000 P0$ 0D;!@ B  9[9 M^ Q L Q0 \V 0 SQ r   P 0S  0"  !2#$ S C$ U@  UU SROS5sPdU_ 0 PW 000@@ℐ 0000ಀXVPJH0㲀0@ ЍYD U$DT PP1 PDD00CD0 0 10CRM x0慕 B Q" 0sPP @0C 0$ 10C0S0jYP[ Ѝ1 D00 0 0 ~ ]@0@ XPUڜ0Sʅ 0P! PDp0DPU P兕HDAD$̨4jĨDȧO-M@Pp `0V 7Q 弰 [n*^(PP" @`V! ᆀQ0  VQ\  0[PPЍ 0S `@0 00S#@P 0S 00 000S\ 0P00080080ЍOU #0008(8n40PЍ 0H \ 00 1 0H s0ఀ0p X;:0H`s00e 0 ``` [00:0K0ರ00ഀ  | 7x0x 00 0X T0T 0 0< 808 0 0 fܣee 0A-%> S0!`$P@  @00CQA$0@D3@N0qW T00@2!$!AnpP V0 < 0hdO-0 `tMP/V@` 0P(0d 0  P0 \ (v`0 000 00p0S7H@0P `0 PP H pPp欼0 0E0 0Pᴀ  Rڴ R HD @唗0E Pq 0` v`AL0H0봀(00`p@~ PX 0,00 $40<8P00CS0s00 R*< @0 @ಐSr 80 አZ8  @ಠ0, 00ရ0P,0 \f 40|Sf 48,0400<0 \|PdP00Q0  00R`P p 000z PD0 s00᳐Y;0 X0SPB CTP P\0S$0Q0  00R 0P 0Z 0 $0p 00040S,08400<0 P$] P^40S 4,, 0 0`00 000P(d0S 0$ ``0V$0 h0pS,0 40l0Bs0@0@U:0@E@0pP( 0000 000tЍPX ST0T L 0 &8 404 0X 0_^ԝ O-\p? P0`S0@L$P P OP' Y  0z S40 C 0 (!S$10$10 10 0S0eP  0P0 S0UP  00S 1$10$100O-MP@Y 0  00X00 ``FV&:S 1 !r `0Hp0 pG0wwppF00F000 B 00p@0000 ``FV>*Y0v`G V  1` !I`Fvv`ź0p0wps00አFZ`p01*0p岠00`00PP} Y```0S`00F2y"0 02"v`0 0Y0``FVl*Xv`V \\\2 00 00000``FVK*Xv`> X 1 !r0XAq 0H0@ ppU`0`v`s0p0pIW㳐`01 *0X`p00ഐ00 00 PP @ 00S;`00FNЍЍ0 00 0 0 0 0e 0 00k 0 x0$`t0t bp0 mĘ[[TPX[ȖYY`lY<T\YЗ0YG-0p`@PQ"  0\U@ T9 0PX APQQR0 B0Ӳ0Sr 00ô000 0 S CY 01*s0  0000kUU800C80?㉐CY 01*?V8 404  0 0 S㲐 W ̕O-P0( 0S 00Cs0Z@ ,WPI ϯ 0S"v@P  0 S 00Cs0 S  p`V S@  0૯P@@A-`P 0@T@ Tp Q Q\6PTG-@`P 0S 0S  0Q@PS" 0 00ᲀ\S: 0 BS P= \0 P  0 (!0S 1$!0$10 PP 0 㼐@pᲀ 09p 0 S 10 B\ἐrp ėP $1 (!0 $1(00 O-\?  M0P`p0CS0@L P M MP& 0 0  eP 0{ S0 N Ѝ0 0S0zP 0 0P000@- M@P p10 Ѝ0O-M@P 00 P`Hpa  P PK0SSD0Z0 0@@   0 pWN0r pG W@s 0K*0@p@ 0000S 0C⸰ s0ppW㲀0>*0p00ഀPP D0ZPPЍ0 P P f0 0& 0 00 pd }`0` 0H D0D 0 0PȎOOhO@G-`"2(M @0 0$00w?0Rpy2S:0JS rPP 2S p 6 [P ZP崐7 Z1! BR9:0CS㣠S*z0Y(:ቐ @1p01 p@” 2 0„ 2!0 0 $0 305(Ѝy C 0@0 p偦P202 ᅶp  0000`0p 0u,0b( (0 Qx8 DpLA-p@MP`Q p00 2   Q `:1Q尶0" B1"000 VI VFEXBAF?0PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E E0P VP V$P 0  Ѝ00Ѝ0PU Q:(0 $P0PU`PJP  KP 21 sK@--M" # @ MJ<xx  0Sd000S 3/= 2<{= 8 80 0(Q/$(0S/ Z 0 LI<<00 R/( 0S/ FCH" 2h*6H(a5L2h>F O !OFbh:b`*ŀ FAFv )@($*\ -t/@ -@,$Z^ 0]I 0X)F/$*p$'*@ $B JIH*d U? $"$ 07 %(F V Ɣt'He 0] ] \ ƣ”1Xd $Z$ -  .I/HJFd SբR )H"" "`d S?DE4 FK' -x'$*- M 0- }0j1 ^ o0-E@? \"hP `x=碉"`0F,0] ”-OFhF.I R"K$J&FFFFD!(F9FJCK^R(7G((>ЯCfO  9h(mH8 (Q +???9????O Ox(e(X( d(!uI hO sI hB:W" -ђEђx ; `iKh- (,й6*aM F\0B^I"Ft'V ,”")-OFLFh'I R#33BF1F(FCѥK -ݢjch*+~ПI v(e(R(KG(+ܯff+R#1111111 1111H +R#111111a(#`ac` #'a3#``#aga`#`g`{#a#bw#'basgbqaobmbk#ChC3^IyC#i+hOO(C = c .`c,Z%@BOHYFRoLIZF 8h+OOOCHBKDC ;/   =KhB,/*9J 9IhS`#J%0hS1H| 1OZ:` ,H0vh+@ׁ-j3ch+42C0V),X0EV) I pCOH-/?# [_-<*FAFPFX(,F ZV),@xi V JĖ”<.pCOchjC#JIN#(F#(2\/(FTP0;+('''''`RE1FFH)jH^F#F6F(h+xI X+𒀅K*kI[hDRoہH\l*j,.6)1F/!#FvI#6] /*,/*/"+ O RDo gH FIFhVF^FRFF~]I  ` ZKhB,/*,УhRHFpF3m=RrBB%VrBB*jCIKH2mhpCOc")FP\?IZ `^F(hpCOTpCO*j.I7H! pCO0 س_𳀳_(Fx!O𜀳 Ol+Ё(Fp(j+?)jJFH bhjPCѺ)jHFѢkHSco@"(KOqJH֖") ,/Pvi ʗݗA)HLq(%J;TpCO#`ѣickJ;c+R# K@?J!^(*ЫmHh|)jHRch+?VAkch+?Mb i -OF- FhtI RhJ!F(FX0ЪI KNh@8LTK`90MHT+h+0YԠI"`FV( I `k#cKdccH,"mK@+jRj^00Y! d#m@aOrdO@#F(c"m@`l@!OOrF[h`kG#kC#c(cbksH= a00#ica<2CЯ2CЯ@#mCO "l`lSC3l!ik DG_N#m@^IM6@cBA(0F0D(Рj0D a(ъ1FRH8RI 4PI ~NHOSf`#`+hZ*`+51GJB@U#m1 BA`i! ##2C  kl-@i(FG0@h+/I7&mBP 2n nCEAҳ !d0 [jGFPF/ф49FV y!ƣ xz!(”Ɣy!TXz!aeyl)Cp ZHFz00"j6#GCMHb#m}6214B2223B2#mZ/2# #;2]6PEE2<4A 2?RFF4.N 2123B2 "13A:"1F0 D01GJBѯQJBயYVU?j! i 2!iDf2CaaV?߮lkhG0I ”1Kz-OFl]hF I QNL@2F9F@FE !kh#j)C}I^G8-(+.?GMS #&047I F(FJ[,!FY3IF3H j0K!hF`cp,IjC*Ij+)I#bW%0+@𩀢l#l*H%F@K #lV<ԣlV<0F<`#m @B+l8F5FE)z!&@] V ̠t'k*+#m+Q!xFeccl{@B!(I `ObOs*.@Bck'flYE@&k.@EckB#kcccl(9F l](|9F a `Z"*((@B}F@AQFuI >@I#ccV(B( 0hqFcm+1hjH5hpCO(F]F5hak(F 1(4l  j(F(8cm+TH)FlbZ 0cm+NJ1hNH78FHHcm+GK:F1hHHcclЕ8+h0BF.[ШhQF,2L,.2L.02L0 212B2242 [B4262[B6282[B82:2[B:2E`9F6¡O”l6shh(,hD#2B23`#p( E(S("IFH s( x(фIHKh|K"zK""xK""uK"!3; (NsI ! pI oHF(AgIlHlH|,^K2#hJiI_HVZM)iѰ(tUM1+b.@SL]H!Fh\HT0F(S23SK"VI FUI gAK" hxh!Fh( Fz chx!+"AHh+/I9H hx+ ^(7H6H|6H>4S2kL2+T |!iV \] Tt'9C,}!pt!ȡ~14`~!R”0] \ "M&"L#H)Fa!H0F(2+?PK(F"IRG 8K"IHFJI H@ L H!Ff (֮J2+?%K"] |!~!ȡ-AF hF/! FD FqIF(BЁ'mLBF1F(FCPjK!hh)𗀠i-! (***BBh:W"P+iF(F \(@pC O@@#`RI*F PJ1F(FZ0KKh*V#Qh 0{!F w(e(L(2P(3F(,гf8(S ''&1'5'&&&&1'&&&&='&&A'E'an#c`kg`i#'aca`d`b#ga#a^'`\aZ`X= a jai)gcIV#YJyh"iF(F F(upCO?WB F")F;C8!V ”=-OFhFfI Q %C4FJF9F@FC ]KhW#pFFF-h!F8F d  (1h^FQH(7h/U%m(p(OеJL hF "h GI@FPFP.FFAI@F?I PFb(F~9 k.-GFh F22I 2NP$'O2F!F(FC,KhBO;D&Tp0Fbp(v("K' z(!hHF&0 h4/%hO /!(F 0Cx++x#C(F T( H)Fn;F0+(FlV /"”p! " O#"  F F B7  L ! p (``Oܿ#c`&LI` PH K!8  b(ŀKh++'+шK"% zK"!"K`#~Kh+JzJ6 *uJ! +wKhwKhtK`qKh+ }rK"`qKh +.#cKxdlH"kI#FkJ(F F1F FeL hCh;C`+ "hhY` "_HphZ`+:#MK6 0kGKxSSH(f)#OK"`@K0+cAKh+_ =Kh9K(a7K0S8Kh;AKh?K`v+ 5.K60+:H5H8K$L ` #1W hSKF0+(H#X#x+hx+#pM$&FU 41F,ѓI 6"^0"0"9"1"0"0" |<"80"n-GFh4tI P(sNtK$tO`3h BY#9FPFtFPFEkJIF(FB2h(.cI Xa+R#7979797777$! (  PI0$$MI (KHfJI (HH\GI (EHR,У+h3=M#3hq+F(@6I&Qع*hh#x320[ FFF!F#3I" F& aH!F bKI X(H V V $*”Bt @4ht@?t@JXd \Ugtft'h l-OFhFI PL&FF5FFfx `oSBSAJc`K9FXFnJCKтK + iֱ+\5h0F 0@uI2F "R(&G((1H8 (Q ?:999 :999G:99:O%h(d(f(!v(!XIh!O%OO !%%+=5 йFI %EO33.chW*+=:!@FkW*`3x;#+'6I0F}-K`  ")FXFF(@.I .!@FR((I@FL0F$I0FD0@Fych ``P0; +onn4nn]nn]nh#")F0F0F"F(h+c I>"V t'j>")pP9F'FPF~FhzHmiB ѠhCjBђh`oТhiGȱ)jHHpP9FFPFV',F+(j'8F” "-GmFFYL``Y5`G5 `Y5`5`aYV@C5#aaHlHFO&AF:F(F0AѢi*@}I" 0F8h(7yh)wI2F puOA86(!9'-15VQpī#fB Љ#55#53FF#5#5#5VKVIHF AQIHF@@NIJFJKh "!^?F h"+ BI "!D?Fhh"+ 4I "!,?FRh"+( (I#x Kh80#m#5v#cas##i#1k#j3#bg#X#V#TI #iAB%@AB!I>"^|t'4*C@G!ai BI h\ Ѵ`hEєBػB# `#55KuhOd@ L# ` F%b-u%*pX#&! -h)cX#&#JOcZ(ڃJI -O%:..GX#X#!I5s PpCO#55>.@k'-@F#58F-@F5aH`KaJOa`K(F22BFUH2'WIF(Oq0F *LJ(Fq%OI(F(FLL #3# $*!E*F  L D n>H>K>I(FF22F>ù9I rh#+ " 3H2  n/I/JFVCF0FO FB(" ."I2hF H2z1FOrH(F0F(FBv@FFH2 <V |@" ̊>"\ c C^H^HPch;c`+ FF(F (0#hZ"`xch;c`+ F#hZ"`x +% N-(d-@F 0OS00OS0?HAFf-5@F11+1[4H&2H%(?d/J,Hq%*I(H-(I Y|(?@F,F#-2I2@F(I #=-?T(FFI*F HOrHP@ "!FH({0] >"|@"Cmde>"(-CJh(KZ`,p$NO XV[8F)FiF d`0;`0+ AF B4, X0ZX "p18Fd"İ\ -OO#FFFFFO   AF:F F`A ѕJ ,$l-&t(c(S(P(FdE  Bn( t(#Fa(тJ&-d-ХrQBQAI{H" L?FvJwI !d-A R-S--Q-pI*F bp-}r-Bl-",;X*XF2Fc # X*"XaIXF 0^I HX*"FZIXF 0XIX*" 8UI XF 0RIFP X*"FC    "IF,<NFAI"F&W:E&6BE:I XF 08IF5J6IF(FX* 3IHF`JF2I(F1JYF(FF(F+JIF *Ih J&IF$I ,@𖀇F&X*H@H!F< FO<V t'z<"~DD{D*|D(9FUdp}D (I F(F%KB.=s@3B0QF(FFO7EW(O 0 IMFlZFF*1F(F"PFFnF(FIRFHRFFOxyara] -OF-#LO8222423322JIFCcѐK4Nh2)L C C C C@-dR@SY"03`d20hc (@pCO#d210hC3C2Cd2% FI I+@ekO@C:FZ(0aC9Fh+@:cHz(IR( 3(B/(C18(BEGIS8'(9^8888888888888b@88fj888r88888888(  . BA8(#0B###6N "#20hj x (2h0I *KXa&#d2"#42#2#2#2#2!M$!Njh4U0F, a#2232#2K/!h0FF3x+?:0F10Y:h"V \k"ot'а F#;3x;:0F06:/!(FFF! yx9:(F0":/!XF"prx*?:XF0耐{x+?:(F0:I bJ#O 2:I8h>(:h3h\ I3ocOc3]J N;F2I0h (2h;h\#BٌI*DX2@N/!7h8Fp8F H2hpCOрKa*6hN/!0FhyJ3FyIyHiHwI 0F! oH6*: 0VBBWsgH:cHcIOR0F `IB [H 0F  !JU#BVH0F'w 'r#3FK `>Kh3;Kh?KFX`CB?CIs!cAHO;2#23=H2+?si38H-O #::*F!UNH0?N@F(?F:!UN607`%HX7`d20i+: 0C1hH0i &O33ao" 0a01hH8k"t'3>k"[e\k" 0r"+HV#1OqH1hLV+F@C@ !@P\t02T7,2P7OsH7(2L7H7'\Ts`L7P'?+钗@<"82.!(2锗P3i`uh;(FN`(4gI*F fJfI J01hdHaJcI0i >01haHJHF9F-@!@)F >GF`WH0i \5aTJ !d PJ ! NJ8a3023,2 3(2CM\2ӹ#SC#)I1!D RObB\"ZBX23K"Fy()@8h&Fh RO#Fa!iOrPF1Z(i'hC'0K:F0@HH#+b#a"2*E+@EKZiiBI o"rdAedA h"pq"q"h"j"i\s02o,2(2?+"\@3?! 2JBYCa0 L '8F 7(MPFP:PF(7:: # cR!Ơ aP`CFp2(F1CFяH02  /ъKd2+ꮈHK1FF\PFk9FhCCFE5 L  HF( @3B  23B  lKo(Oe(regJBs®Oc\2:?31*?+?䮗0*(ڮ!*ծ!*Ю1K #L Bs i3a(?1B{ FO +a2"C';O2B+@7N ( xi_?@)1I1H1J-Hd!(@.IZ,H(Ѐ*OOjO &3F8F0"Or#0#3FH,"?"#,#"##3F("H{(H(ВLh"'\ k"5\\ Z#QF F#2+Db.@uK\ibOF2+@pHoH!vmOO O #"F8FFeHi(dK6!.!,߿$0c 03+ 2+@TH2O0y8$)CMH|LH/(oKHJHf0FO FI(Dg0Fv4\2::E,2:O :TF$8IFXF\ : ʹFFS"QF F A{i3?B1F&H#C9"KXi 1,?c!FH]2C"Cs TH1(HlH)(Hd\h" \  pq"q" h  -O]M-#O$ 0F+FFCOka+FCO@E`JIF0FbFXYiYD#aiD#0KhO ;Ȳ OWOajJFW/!(FMF(FhP `KOaJ edHF.FpHFFHME9(FF(2 jOaWF(@׀Ij ly+c+P+UT+]xKyIFyH\ Xd*Q"W=WW=W=W=W=W=WW=WW=WWW=W=WUX=WX=WXWiCaRiBaYH 09iB iBiB8hD7 *?1:!PFHI F"+CHBFQFQFf( AF +h 8I:h) x 5In)Qxo)2)#1J1LȀ`!F VFr}!I F 0I  F   D<`BI  ya;0!+I JTm,  I LP""edA]{x-OFP FL'MNBF!F(FXC-$G00EH'DKh"! @(?I :0k6Z]ctt'x"0 DF H>"9F H0F  M>8Z1FEFXF .1F0FEF N-OFhF$VI (@΀-g=Y%0$F&F'F 1v(l(H()T(yKF PF l0r Hm8 (S ``__```__WaFeJIF(FtBcKhB!QY" `hBQY"`[KS )XFB (0+dSIZFN CLK "h Fx+(Oss|FFF 0lO ZFYFPFU??FFh+ZFPFEFF,IRF Tx+h+?x3r7 "I[F(x-+1CH lFP 7 IZF5$0JF)F FG0 F簓t'CV lCCPCHX L I F F4I F F@ج"t-OS}< F!O rHF P`` O O8 C      FH0$ѫI K$h0 2h  2P4ĕi483,H0љIH0јIH@M,NіK/NO O (I@5FH@E`EF8F?F2цKhO0+@P,@M5+@H  ##` *FCKF(@*F(@^sJtI 2ah(F$hz󽀻` ܻNs>ܻAZлCAـ`K"TaܻCL𕀛a"+=AEIS`dhW( o@! "!ldZljF e&ielul9ui lm I HI@Hֽ"a8 L I F F4(F I FI(F F8@"1!8 L I F~ F4(F Iz FIx(F F8@"P5LO (9F0FW,(FR0F0U(F8P@40F IG(F IA I FA0FT(FG F@VIJ"} m -G X(dHcH(bHaH! (8D/! [H F!YH XKWIXJXK( FWIWH "0 QHnHH! t0 MHd LK"LN !LH$O O O '3`GH#"!%#AH"!?H"F!O3"!33# 2#"S ##["F b"F DD "F  F (F  # #! D M0h=%K0h]`G qi %d1 "-OO3N 'FKFL=FF2FQFXFB$ѣKh -πM+h O,h&4khBY?+ 5u(f(F(*R(g8(S lkkkkkUlkkkklkkml% hA "hxI  hx#+ hJ h " x+"hlI 0 " x+uhr hF(l"haI hx#+ h (?\ h " x+?Q"hUI 0 " x+B#?#!F$젹!F8F2TKPF,TH@F$ 6 4=+?Q(FZ"` RF N CtQx)Qxc*p*b*IDDDT F?,O &I DDTO EED--O@ F'!F8F,F !F0Fd(ـh+I2FN Izt'V "”{zzzz {zzp#F `h< C% x3 ^IhZh+53-0VKh {TK#B 2L2 32pA_FZ  EIx h310[BI (F GFF*?b;IF]*FCF!F0Fg+?m0F (KѺ pO#0F !F0F%#CEBpO0F *FCF!F0FpO@#*?B!F0F(-  @3? 0F0H1FpOO0F вB{"Xd /{”U{-O%FFFF' ZF1F FC>ѧKh#0B@)0 +w,,@V' qOaV0F(𩀸@ЁIV'(@AF FBF@Fh+I"FA(Ba8(€(< /27K`E}Kh x+ EvI ̡"FE|lJSh3S`wEt#O o";B 07idI8FXbI8F0aI8F(@𛁰hAF(@hYF(@7hQF8FXph rhQI <gOaq:FVF KIq <#3h +F (LFY !^F=I  AF(D0 (D  E$B@F QV'XF\HV'B @V' %I: ( i0FHhI0F`#`BF 6OaqJFVF(#3:F 0F+FFV  "t''CX oM6`V'8FV'FP,F(PFF(_I@Fh^I@F@\I@FV' ZI!YIHFhV' (?k iv PF (!F PObL P/!(7F0FsBCB!#"9DTr# P3p!CF'5J0F5I0F0۱̠#33!F PF+F G V(I 0F00F Ft DK$?>I#"EH### h""5K.5I#oB=H### h",K ,I#O25H### hOR#K$ #I#oB,H### h"K(I#oB$H### h"K,I#O2H### h"K0t xDV P@"ut'3>] }tĆІP .KhK[h FJPJ#xh320ZԝI"FG FFoBH#!F##"lKX`yI#oBH### h"[K`hI#oBH### h"J~K4V{I#c"H### h"9zK`FsI#oBzH### h"(mK84jKh0sqI0ThpCOEJGI $ BH!B?JBI !F;J>I9I"=H , 8N4{h4z-H)F$h0'(J0I"*H hAF( HOr4 AF(  J !I C04;#X44;h+4IBx"z*B*#C&JI䴈"Ljڈ"H"(;$M"@"hJ^u &xIN@Fdh#T4SI@FZ(KJIT4+сI@FH(Kz*!x2zKS#Bq uI`6oNV#KC3 F! D^0V# gI#BFӱ a F0#aHAFOZQFOpKRF[I aNN04$$T+D*@)OĮ!8CIdL$H4rC"i4+DEH2FKFAFOs.yKVERFy F2FB6I6iy*F*O04ܹ*Oc04@̀0oˀ$_Q%HORVKKS Os۱s۱_sOQ40B-*/ F$4*OqOaOa!@"H"d^"(Bڊ*04 4S$O0( 44#0444 0+ @4+#kJkIlH#@4,4K$4 *Կ,4"F)F@Fk?ХB: FRsh+?xh !F`/МSJ#Fd!$ a F(VLI "X )?bOS$4.FHObT4++(Feо?HK 8Jd!F F  4H\$6/Hg0JR,JC !Zgx#<$6B@&0bh Pnx ! x`Z"N8I v``(? " FAI vBz Z O ?qKI "F{ I ;cnuţ"P-OO3LmTFNF4#FF JFAF8FCFCѼKh43#4/; y"!P"!HFLX&`́4Os44+@K $[h*sy@!@0FF3@oI2F  SH"o0'OJTI$"PHg9F(GOr49F y0@JFI "C 4+4 ?IC1j2C3J;IbC:Il9K-J9I,NGj2Ie1j $0Bq -I]o $ZС#3(F0# I#2FEt(F0tH1F OZQF JF(jIRF|`ڈع"(;$ݹ"J^uĤ("i $ 4*@+` 4i4 $+vFPF FAF*F0F\NkB(FF Tܡ$ t0w4+5HJF;F1FOswXFJ!ERFw(FYFJFB%I gwIFO^ExOc 4 44IFOPLExOS+  IFFO6Ext|IFOP)ExB-GmFFh"!pBF9F F\C Kh<,@_@85(S }ۋ)=S[q͌KIh}r#40nKhj}KIhmbyKhb([vHO2wK!hp0C p0KnKh GlKhCjHOrlK!h<8dHO2hK!h._HO2dK!h$ZH"`K!hHUHOr\K!hJPKh NHOrUK!hPHHOrQK!hRCHOrLK!hT=H"HK!h}p0CV6H"BK!hoW1HO2>K!hdp0Cu*HOr8K!hV\%HO23K!hKp0Cp0KHF0.eeO RFQFHFS??F Fh+RFHFpEF F,IJF ,V t'6fr|k?ě֛C$x+h+HOrK!hd4W#@/! F2CKOaJFF ih F+ mt'$-O'- FF:F! %LKPBڡI :F! ()F0љH^0іI'BFO5FJIF0F&CяJh @ @+@~<;+@.(IC84(ŁgP8#5:T[E_dPhCC`"(x ( ZI hCc8;C8;xhCPKh8oHGJ x"  DI8 RS+ ?I"x ( 7I< 7hCshCSh0I C@`-Kh@; hZC~hCzhCv8;C"xF ( IqOsBIhCThCPhCCL`RMb@AX####$#=%#V ##$0$t'N$j$4"xF( I&"@xB* {IKyIhyJCcyH`# h&sIhuJC tH`# hoJ x* ?q iIO iZ#fI#dI2+aK n(?i\I YKMQ WJ FQ`hS A0 8`( {*(+ LIhHCIH2s<+D>2CKhBoCEFFOs(@ k/1 >H h h3SsEbF”FbPC \0~EC 3+lH Fz;FF0Fz2Z +J(+V; NHC;F/N'KF; +; 32H, 0 K'gF#V'##0] {''X#; C H;IFH# K 0B  E܇H F7zF0FJ JDzHD O0E'8FHF   ;+fYddd-8CNY#2F9F FG(?ax): #%')+-/1357bH~ aHaHaHF_Hp1F F#0'YHYHYHYHYHYHYHYHYHYHYHYH#2F9F F(?խUH#2F9F F(?ʭax) MH0 FJHJHJHJHJH"#2F9F F(?nFjFAH #2F9F F(?;H#2F9F F(?6H#2F9F F(?zax)/Hq/Ha/H_#2F9F F(?g!y*Ha#2F9F F(?[&H''#<#+(a(i((((())1)J)d)z)))))))****;*I*n*****<+++X+|+d(#2F9F F*(?Hm#2F9F F(?Hb#2F9F F(?묀HW#2F9F F (?{HL#2F9F F(?լwHA#2F9F F(?ʬ!xrH6hƮ1F F80+`+?+𸀏'H FqzF0F+]H 5+њ  ,/ :* DPHD ܩ oO   ; 3 FF/   BF F/A2I+E1JF@FF@,H :(HJFAF0@x '#HD yܪo + Hp /HfO0 ++++++,+X#+ , ,,-OFFIxF-+4 F (=ѨK$"`OO FF:F1F(F$C9ѢKhBw'>3FS}](FHZFV)X/DDd((Y I3IF P$I F(цK"@Z`d+ '*!$DtDOvKh ;DdDD4D$D$O O XF/(FbYF(F^%)F F:cI .іF(G$phUKhb "!RHIWI2F IUN[h "!+OHIRI2FMHI-7OI+F2F IMJMINHIH#JJ#IIJHIA*!FT! P! L! H! D! @! p08I8I2F!O0d0h+1H+L!hFR-K?F(FIK*I"FF h  &z !O020h+H .H)F FH0F6\<$#V ”, 9KDnp^}Ф(-OFMF:H>KM(FH4whK(F+`;x-+04HF88Ft0HF! V+8LFFO D+?V;pD>V?D;+Ѥ NF$3`+~r+TR+i+C *t+x+; H ԑԡV ObuPFFЃ C#+d0SBF;F< F ki+ #HL*sj:FIFHFH j?IAHAH"#?:Hp kicj1I5H5K"2H#-H!k(I/H s j"I*H$H"#H`PH3 IMObV F FRQ<"] I,=0] ٧R6m (-OFF0ݞM'1F*F FAљKh,#0*oДH"!@@0+{ڏI v(c(S(GT(ML(7 d+R#u}#D0#3#3#80#H0# 3#$3#(3#,3~Ik($)LDshx*:B FJF FT/Ik($)ԀLDk@K$33sh 8F+sl+@9F0l"FCF@xh7+thHFHVO4hh3+@0+xg+AH0+=V I Jh( F Hpxx %( % % %xt+_HV,@[Kh+XhFFXHB HHHHHHH  /FC+Fd#b F- @"p$@I0F>LO =I0FO :I0FO 7IF{O 4IFsO 1IFk&h+?TWx+?S +?OiQh)?J2a  h0T$=,?~(FoFHx80 F#)FC(3C<0Ck ")F FOB H,F^ %,[ %hv-GFh F퀹OOL)F:F0FlA ѵKhBv< HIF D(DРb++R#iii!ii'ii/ii7iii?iGiOKh 6#$6#(6#,6#064#6#86#<6#@6#D6#H6}$&B4&< C"<&,&28&rHr4&r<&Z0mJmKnH) FF`U#PgI(FH(ZeK #D#xhaI(1^MOjO W(@F #+p#kpWH~SMP6jhCM`FOHHF(=h1!oF(f.@9fCF@+?HHL +x++ .F0F37Hf2F(F0 !8Bak,Jhkxh320Z<#XCKZ`PBD2m 6۲20 Ѹ:(3x FEEF(F9h5DHK H60F "!HHPkh@-BsOOPvHCBy_ۧ @M85@-UQOU 5xU2C<6+K46+I0&qMqK*FpK*FpI 1Hc XlH26jH, rO5cBy۾"#LBq8FIF0F0RMU#BsZTMKM,6{QHOr@aNI"z0F+FKJQ!KH%JHV(FEHD DH<6+K46+P2K?M@6+C=KD&;JC+H&9JC+$&7JC+8&5JC+0&3JC+2J `$0H`"F(F+I*Fh H )F`'HTK&MY`! VFp%"\ K hD<%|x%7WZ]`"pdy-AFF&ODBF9F(FCSKh-AH(&Рh + +R# )D4D4DD$D7Kh06K`4Kh4KZ`&W#p"1H9FR8 !-K.J.H-O!8F*I:F 'D0dbd5%V 0] Wr5C %t'-CFFfIFFL"F9F0FB/ѡKMh68.I,iLI F I F ML*F9F0FC BF}I}H}IBF{Ht(p@(A83(S i!!w!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!z(cci+_Osci+X#ca7ci+Q#ci+K#ci+E#ci+?#ci+9 ##c`#a#a#ci+(@####`#`##bKhD`ci+Osci+ ##i+ KIh av(߮#cbV %1t'] !:ܮ-!#j+?֮chh+Ю&i.̮W)P h)F(ۮqI*F #i+chh+&i-5-gI0F(dI0FpcI0F(@-S4-(-=-?S%=S5SSSMI0F(cj+?L - -~W)'3е AMBN2(cAF@Hc-ei#"jihZi##"jih(NHhW)/W)A" 0(HV2??#H&OBF H FKHѲ3 C "4#F`j(?ѭ i)F Fb(1F F\(AFHj”1!ץ8K[r-OMRNF\ F'2F)F F@CMKhB<(=4OU/@F MR(f(O#4'E*OaP 9I* v/e a*(@ `(>pCO@гO5 `jF!+(> d ZFOa0F40F/Kh+H1Fz F:0!F*PFl `jF!( `jF!F( H anOw*V ”%-CtML%&I GOghKH8X<8KDX@8K`XdXhXpXtXXXXXXXXXHhLhPhThXh\hxxxBFD8O3l8cHC #8FF:FB? GZI*FF v2xL H }K<|HFX{IG.(@mK"T(XuIF(@eK"XT(oHaK x^K^J,\Lh8C<x%fHhXdHh(bId `KAKJ]K8(BHDM&`h$dh?K$QM&FL*FCF@8M#F"HJ!|h #<,wP FB ( #C$(b (@3<hG/IF"F:.I FG~KTQ+I FGu K"h(I'I FGk0 K"T(X(="H!F8 I F(AK"h(;$_HE%fID<W]<nl\ 0] V p!v4D+R#uqyEO}WaK"(HK"X(T(K",K"hK` x+?KIh K,B,,2,~K",|K"H(} 'zKFhJuK,:`|x`mqK"L(hqOObrH9hpo^? 6^IOb Fo! F :!hVȱhMH!LI )KI %$FH!F(CI BI @!h0F&F F5FKFZOb'F F& FL[h P|Px 0l,8P+ ,*OK",+-:F)F0FHE% ̧r2<>h|JPdZeAQ$>H& >Y >'>0>?>4 &I&V>H&( =n>I&O&>I&|I&-OFvLF'hC(AЎIH p(Dr(RF9F0FB&O(H X pCO&+'s7HFȳ'0F@{+/ 'wK"`sKtI@#0ر'0F/'-F@dI"dH']F]#F^MIVH{c(c!O OHNI lLI hKI dYFa@FH6@ # :D F@ DF @$ FE BE FE PF@F E:1H"!FL #0?-K`" :+K`c";d'Kh)ɀ /:/L("K" `1 &<`&0&(&X&&0&\&&] Xܕ|&4&6;e&<,&&&8t&&&ѕt'j'&(?k ,H1H  +I n (-P!(FDXF(?H 0#XD#@#3B #*F!F #O3^CF?%, (FAF3(F F +Ѯ H P&ET&E6 5!-OF˰hLFH&FF O3`RFAF8F FhяKWE!ݹN"HFF:HڈIJF rp-a-b=-   " 4z--4|IoB#{H#" h#n3sKqIO2oCqH#" h#X  hKh`6OF[5 8FH pC_&##&^J#aX)Fa 0YVI(F0"0P##bDF(iNI.л0ѹ-JIJFIIFGI 2FOqJF( " "IF0F(9ID L(5IJ3I 9F 0  ! &1F8F"  &I&J3FF(?t#I(!II@)Fb^!FX*X* I7'V t'!'l0] ht@mmCm8m\mfmmtmxmmmmm&;I O04BIF8F+O  BF(h+ 4'+IBFh+ 4&I) 2DBr2DFGF@+OqB #BVh+5EFV 4! nHFD, F8FBІBFFFQ1 mm-O(-OFF3}  0LhI F*HH 3}I F(IH*HO(r! $n ~K! FVKhO3y3v3U3J0 F5!FB0 5! 80d OE5@#FFFY1F8FKTJZFlCL{(F0BXC3X7DZ7W0 [vab:b# FF:F(@Y@0BgK gJ+!3XC3X0B@$^MV(&M( 6(~?(s4(O h$N8(S 3eeee f('j8(?v(?sS +ee5eeeeeeee4KhVMZD1KhnZD(L%E=$9Y%CcY%e0##*#Y?%H^%O |$x$F;F !:J(1Y?EH@#[ssrS{www0F TJs?w t'IsV $q qq4q(ђH0B)F :e# FV!:F(F;F !:; сH3 4'0?#X 50wIwH7 7 h+@ԃ )F:'胘DD :fD 76 5fKhBDY^@@كUDރ"*0@׃VIYH7]X11(FQN1ZԟF2 TR՘PԋEIL  6 5)F F9x1>Nh-?+j;3F"!6mh 032F9FHF53jK0F40F7(Ovhx!h:՛j 2Rh*?!K6[2k`h F`7chh,Dh#B`s?s/sTyyT ny6zPzwzM aI zyH6fY@C67$ZDH(iDY? z0]  Q/0@-0 ph P ^0O@0 , 0 010xul/10!O-bM M b [ !b1 0 0 30`bݍ Ѝ"]\ P\ Et   $ Hp;` 00Ġ80G( Gˠ xp x8_S0 @G `0 0 00⫪ 0媪J P x8`@##[*P 0` l840GV ` 0` l840Gc<\|xJJ0ƒ S"*0@- R P@ 0\ R^D00"@80 0 0^ 00"@0/,@-M @Ѝ l  \/\-M 0 p 0 S 0 /O0 Ѝ4 8 /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/W */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@@*/*/*/*/xG xGxG}xG xG皒xGxG;xG2xGhxGjj5 xG1 xGxGbxxG6xGxGVxGxG~xGoxGxGxGxGsxG|xGrxGoxGxGCLxG!xGsxG]xG xG)#xG3xGHnxGJxGSxGxG͋xGݰxG?xGwxGxG翪xGD xGexGSxGxGxGxG;xGxG xGlxGxGxG1xGxGxGxGI7 xGfxGFxG0xG!xGxGxGxG!xG(xGxGixG*!xGxGRxGxG琎xG(ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics formatsector sizesector size `%s' is not a power of 2.maximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectorssectors/track%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u%s: can't write sector %u1601803203606407201200123214402880usage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. %s:No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandsentlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraecsctbdchfesprdletdvcmiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderr Terminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeBootUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. # sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPE11.0_BETAevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicant/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)/dev/r-t xx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/random/dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crandom.tmp/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigmdm >= 0 && m <= n%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c---%c-%c%s %s %s %s %s%s %s %s%s %s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%cr%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEr%sparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2efsnilfsminixfs3vmkcorevmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitiontc/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d t ;ՁBaW F)"I%L'O'U)X+6+\-`y.c2k3j3n6t9z-9-9U<CADG_9ViZj[_9bx)ikēoʓtדttttuu9u9uт$Y0i6ͥ5ͥ>D5M}V%]ыf  jm r x MM#Xypushdnepopdne="Vi ^?@@[! `Y @@f lI qDi-  t9 z @@  @@ unblock and -DNO_CONV?dX-!p100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directoryDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# unknownline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/tmp//usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXEDITORmalloc-c/bin/shre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesAutomatically adjust partitions [%s]? Invalid answerreallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tableQrounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] Usage: %s device %s device command [arg [...]] Available commands: nonerwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grewfalseArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%x%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%#llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %s%s%d%d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): ???CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address boolquad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexNODESTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendormalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<liLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELLlessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETAKiBMiBGiBTiBPiBEiB.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0link#%dsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLinkB N dveeEZ,B#L L_^^^F^<^>s?PATH= jot fJ^xdxscxmxlr pnxv ʭb    EOF reading here (<<) document%)-27;?CHM` bRW^elqy w|B}-+?=A@t @abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'>"0Tl="1\X="1b="8l>"0zB="0="0="0="0Ab<` '?  U),(. Э0 2  |4^(6]:> !hBz                  lU<rU<9={*s$Q==E1=y=,9Z$  ~(EE=}ՋUG5pAp~E1_ \!x=J= w$mo $(,16<@ FX N V j\^ :26=BJ4QQ\dElsp}tsxK fs#3#3233# @@X`[jrrk! z@:KR C$CC$C @&@. 6 @H@P  @@@@@@@@@@@@  @ @@@ @',29AGsMTZaksz@@ &.,=M~/BMV%mK#(05;AGNUYR_?eNO5><FPY`ov|Ka  * )09BKT_hsxK#(05;AGNUYR_?eNO5><FPY`ov|Ka K#(05;AGNUYR_?eNO5><FPY`ov|Ka zD ` s       e        ) H [       -  I !Y #Y $b &Y 1Y 2j 3Y 4Y 5 6Y 8 9 9 : ; < =@A*BfCDEFGHJLM(N/O?POQaRvSTUVW\acd=e_fsghipqY sY tY uvY wx3@Udv (@Zx8>WWWwY Y Y Y 1C\Os   %D[c{"ThY Y SXkY Y !4GSv[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] dĤd"(2<FN^flt|b] returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readj4|@5[07U@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-5L>h>p>>>>>>>*?Y9Z@+@BBBBBBBB@HTh| 4X(<Pxdx4"(2<FN^flt|b] E1@!E*EFEYEoEEEEE KF jF F F FFFFG/GBG|GGGGGGH 0H!#$@H&12HH345dH68pH9vH9}H:H;H<H=H@HA IBEICqIDIEIFIGIHIJILIMJNJOJP.JQ@JRUJSoJTxJUJVJWJ\JaJcJdKe>KfRKgeKheKieKplKqstuKvwKxKKKKLL4LCLULvLLLLLMM9MWMiMMMMMMMNN6N6N6NVNvN~NNNNNNNNOO+ODOEQ\OoO|OOOOOOOOP-PLPYPqPPPPPPQQJQ^Q~QQQQRIRNRbRxRRRRRS9SLS_SkSSSV@`U @!V%@XY@MZ (,@,8SFH0eC{\NSFU0eC쬁\Hah!IdontNeedEFI\\(s*K>;\\|nQn- q+\\|nQn- q+\\|nQn- q+\\|nQn- q+\]|nQn- q+]=rGy=iG}]];Mt?(]3]mWC 3KOO>]J]yD<#*=(V]`]3Dh&j]r]\ M}-]]@Mjy֬]]-чH]-чH]ZIчHd]IчH ^IчH.]^2IчH"1^L6 %?a=^B^S'@ )ѸP^X^*1@ )Ѹr^1x )Ѹw^^-qD@>`Lbackupstore_gptstore_tbl6YP@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps\djdydsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatustl1printallmaindo_setifpreferencedo_setifcapszi07yibmffb ZlFHdxmj,m)Demmmmmmnn n)n5n@AnMnYnan jn0sn@|nnnnnn nn n@l1init_current_mediasetmediamodesetmediaoptsetmediasetmediainstpGpp>`pptlpp pp`pp@pppp>`pmedia_statusmedia_constructorppooopooopop4ppppPppnoolppaddr_match 1 Osettunnelq qprint_link_addressessetvlansetvlanifrsr|2ss%setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanxyyysethidessidsetapbridgesetiffragsetifrts-y ,y]4y3y4yxux* u8:y@y<?yGyFyGyM* .ysX[yIxIxRxRx|s|seinvalid major numberinvalid minor numbertoo many fields for formatffs@ Cq%0@6AH{OX j r @ .E@fh|r|T!~|||| || ||H|@|||||||| bnorripbgensbextattbnojolietbnocasetransbrrcaseinsh|r|T!~|||| || ||@tH}}|@}@~ ~h|r|T!~|||| || ||~ ~@tH}~}@}+~|@3~h|r|T!~|||| || |||@h|r|T!~|||| || ||@tH|@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorh|r|T!~|||| || ||}H|@1 @Ɂρԁ؁܁ @^djs} @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvHh|r|T!~|||| || |||@~ ~ʋ0h([xӍ =dю8_ɏ%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@B*C9FEI^LhNuO%SabÜcΜefh;iGkSmanrorsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp £` ǣ̣@ ѣ $1м|^t0 Non-system disk Press any key to reboot gc_[WSOKGDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY 8a?q 9UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_print5u8586686$689686F68T6f68s6y6 :6:6U;6866866)=6447.78-7578-7I78-7Y78-7k78w77>78w7787787787788&8898@88Y8o888888888888889 9A?A?298D9I98W9^9:o9e3e398989898bitmask_scan5p5555hw.disknamesfetch_url5`sendrequestrecvrequest***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]afK%jK%: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?C \ LE8O&V_:&l8&t|&&L&&֖\& 9&f&#&,&6&?G<&T&[b&l&vdd&L;&&F<&F8&ŗ\&Η[&ܗZ& [&fY&&w&/v&9&E&V&ao&f&&&collectfD"(2<FN^flt|b] NAME=ĤV mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds"(2<FN^flt|b]  edit_fs_type_ext$ > !C    " }# , , 1L  eE u9 edit_and_check_label "(2<FN^flt|b] disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzV ^ _ !a ] 'a I[ 'Y !` Y a[ X X j ] Ag \ Z %V EZ Sa c e !V V f Y Y IY \ -Y disklabel_change_geomC HhOouter_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default@& &|&\&pm_from_pepm_whole_diskgpt_freegpt_create_newK i I   Y  M j 1  - u I c u  g d"j]j]\\\ ]{\.]P^r^w^ ]!:5h>>>> "dГĤ L!]V *r^2]gpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC{\NSFU0eC쬁\Hah!IdontNeedEFI\\(s*K>;\\|nQn- q+\\|nQn- q+\\|nQn- q+\\|nQn- q+\]|nQn- q+]=rGy=iG}]];Mt?(]3]mWC 3KOO>]J]yD<#*=(V]`]3Dh&j]r]\ M}-]]@Mjy֬]]-чH]-чH]ZIчHd]IчH ^IчH.]^2IчH"1^L6 %?a=^B^S'@ )ѸP^X^*1@ )Ѹr^1x )Ѹw^^N 6JbvNLJ]qA mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newCPPy Y 5    i ]   q  1 M  j # ' Q - "        e. . mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************?RnVnZn^nbnfncontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2 zzdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionqbc9dMe|fgX}h~}i@j͂kՂlm߂ngopSjqrst}u 9vw`xxz*y1A7BDCu{DKEUFZGdH~InJxKLMNOPQSTUƒṼWփXZo146 |~(}31:J\jhqov~0_MCDŽԄބ K"2;ÂGSfsdefault_configread_configrt_compare_proto  ˖ ˖ rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrta a rt_buildrt_delete sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init&˄w } script_buftoenvzmake_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcpBMYhqdhcp_bound}ĔD$h dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B|58 M8 e8 }8 8 8 8 8 8 5 9 %9 =9 BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~`d pxt$x| 5@A?=cs_pathX< bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_max|&'' ((8))P**5h++, !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareg_Ctocg_lstatglobextendglob3g_opendirglob2g_statglob0globtildeglobexp1globexp2_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'@Bʚ;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internalgetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddr_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseekoisescaped_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf__sprint0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_getpagesizeqsort_r__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEX abg!hihhH T\Nh`'|p<x  lx`    _                    (  ,  8  @  H  P <M x@ {  , h c / $ t! X@? t     L(  $? ! \U  , 0 p; l 0y  4 8 < @D <q xH L PT XI ,\,` hdhh lp tx | XX X X*         L< .  ^   \                $, 4 <DL P 0T 0\0d 0          $ ( 4 < D H T \ d l p |    $,048,<@D@L,TX̭(|9lؾU h h  h        !!g!!""$"4"g  qqX++gntsprDq#,rbmn~ttcidШH,  @c++yekd@$h'l'h$atadloob yaraHX#*}h$04<4X4d444444445 5,5H5T5 p5|5 55 55 5T 556$6<6H6l6x666g6 BBBBBBBCCCDCC`B$ChB|\(C0C4C~ bj'jc fhklmoopp.p7qArHuutPv`wXwexxmzxznBC>JOPSTVVXZZ   &6(yyuɪaI4(1)-uɪa1  >0&/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin1"}-+?=###%%%}7"7"aEVeFI`iLlmCnfp#b*u2;FqƣsS_hPvhVVkx9"@=d 26:x,a<.M>5-<$?%>)<1;5;DbhB1;d;'UBLRajPz? O3?Nm?5RyQW?P?WNOM9 l/  ... ... djn446687`@x@ EhUlU(VOV+XQXZ["[p[[hU^E`/b]51-4cxcAabCdhlNsuvW:w:z,l$l8$lLAmLum$lLm, m,l,l$ ,lL4l4RfH4 pc}d4jLfH4l8"@4lt8"l,m`lHHtDjj(mbeb!FmeFe-fmFbF4l8"DDeDembbe<Zl Zl<d d<9f f<f f4p,DiooDppDupno<o oDoo4qh&q$&qe-q-q4rt$%ss<:s r4 y4y@D -y-yD@y@y<Qs sD.y.y<x* x<MGy* Gy<4y 4y4KyuP\%K{{{{{l{L{I{){{m{{{m{  '@@h|r|T!~|||| || ||@H|@~...... ...... lost+founddA.##.jj4^dmbl  G   tzl:e8ɮfxbd !"# $%&'(Z)*+,-/1123456%] 5M55555555555. (prog_root)`VXZX`f<`%hr|BpYpp-ApQlpmkpupIkpم|ppEyp;pizp}pهnpxmpmzp5|ppupQpppمpp-tpkfp piwp%rpMxpvpQpZpIkpyp pMpLp5|$p]+pzdp}4pIrOpUp}p5|:ppk@pYp HpempIrMpemSpp5|Ypm^p8p fp lp1tp5|zp5|~p5|.pixp!wpMwppQl\p@pمpZp  pp%rprpyp{ppp]cppp[pQlpwpp%pݎpNptplpgp-pkp pupQjpф,papQjp}PpvpnpQ@$!fi8 $>)>-@<<   !bE< %>= 9&tV %pq &| 1$ ]C  +  c y.   }# }#s. M"?;  3#L M#&rE:FPycalsh& !"$'(+-.03569:a. &2o/bin/sh>?OAUA`AUA[AUAAÊAÊAAAAAAAAAAAAAABA BABABA(B3B:BEBKBSB]BhBoBAvBABABABABABABABABABBBBBBBCB CC#C.C3C0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ      (  "" ( ( ( e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<sKyK~KK is a directory is not a regular file (use -f to see it)` ` (N$NNNjNN"O>9OO%OO4O;?O w]7GO QO ZO hO#uO2O8O OO O(iOO!OO9O PgVP&fP)*P4P5=PeFP:PPNR%XPbP6hkP4`OwP P+P,P-P.P*PP?FPE3P/Q/Q'QFM'Q @NhNNNO SNZNhN mNftN~NNNNp N N NNWmkRkRkYcWbkCkc kG ky wb YMYrWca I&Y6YTYb @I&u|YYB I&YYc I& Z6Z6Zd I&]ZxZ AI&ZZD (IZe I&ZZZf I&[2[F I&N[x[g H&[[[h I&\1\i I&T\t\\j \\Jx !hI&\\kp Hah HK` `I&]*]LX dI&H]f]mP I&~]]]nH "I&]]]o@ ]O8 A]p0 HP( ^q I& ^4^`^r "I&t^^^s !I& _#_S !I&@_P_t `_T -f_u I&r___V w "pI&__!`x (X`d`X A|I&p``y I&``z I&`a" a~ !tI&(aLa? # ja}a AxI&aa XI&aa \I&abx TI&1bcbp (Ubh HI&bb` DI&bc#cX @I& IcjcP c?kV_nn oppp1yAxnSM}qeqMq1qmyxqEunTn n!n*!nV_]ninun;!%a!-!5!=!Eqqqq1rrrayEr1Ij kYr5ndIn -nrmrہ1sssrrryxruՂՁ-vv v=vvvvv{vmv_vQvnn%nnu nwwvvǁρmm&cw'Uw(Gw)9www-uww%uwwwwwwllm-mEm]mum!m"@"P"_"d"h"Xxn"q"t"x""""""Z$w$d&~'))*b*%+5+AG+\+`+d+g+j++,-/U0r00\?000001131M1v1122223d*3K3X3333ēQ4x_4f4~44445%555555(667G8r8893;\<= ?X@@}@A"BB@CTCuCCC@DD6^EE%FQFfFFFFFFF GGEGQGcGHHI I9IoIIIIJIKKLuLMKMMMOpPP QQQR.RVRRISS TiTnTTTTTUU U-UAUOU^UmU{UUUUUUUUU VV'V3V?VMVdV{VVVVV|WWW XgXXYYYA[[U\\S]]]^^^$^.^7^F^^^~^^^^^ __$_ 6_R_^_k_}_______`$`@`[`````|?```````` aa4aFa_ataaaaaaaaabbbb'bh0bHbRb_bhbwbbBbbbbbbbb cc*c9cceEffghhhhi%idHiViZi^icimiyiiiiij3jPjojjjjjkkEkl)lll m1mPmlmmmn>nNnl2kn!pnnnnn%ooo"pQp_pwppCqqqqqqr0r7rErRrZrmrrrrsX`.sssst'tAtOt`tkttttbRttttuu@x[xwxxX\?xxxxxyuyyyXRkz"uzz zzzzzjszzzz{@{o{{{{{{|j||||4}V}}}}(~-~3~~~=p.X[f8gЂ_R6x AgɄ݄<Rgz…օ<`nzćԇ%7HWipz\?͈` 1<NZen{Љ#7\?FQfs{ˊ%7@>nYtƋˋ؋<Xu}ڏؐ  R\m\t٤آܢ"NNR.]JF/u   ðɰlҰٰ0 10&L'()*n+,#.1/ftp$@,V_7?@ LYdsQ 6>R #R ?mR 7@9Q QP A6N B;N C@N D -P E HN F N G \]N H LN IcN YYN EN r v /v Qk 1u]k 1ey u]k ͼڼ .;HW]Q \ ] \ٰ z!  C         # 3ƹ6:>BFJNRVZ^bfimptwF5 |!"#$%&'()*+ ,--&.-.//0 182<3B4G56L7R8X9a:];g<v=>?@[\\]^^__$`1{<{O|]}i}}~  -dd-ddTdd:dd:dd  @@`    # # # # # $ $ $ $ $ % % %%, %4 &< &H &P '\ 'h 'p (| ( ( ) ) ) * * * + + + , , , , -$ -0 -4 -< .H .T .\ /h /t /| 6 ; ; 0 0 0 1 1 < < = = > > ?( 20 2< 2D 3P 3\ 3d 9p 7| 8 : 4 4 4 5 5   !  "  # $ %  & ,' 8( D) P* \. h+ t, - / 0 1 2 3 4 5 6 7 8 9 :  ; ,< 8= D> P? \ @h!@t"@#@$@%@&@'@)@*@+@&`'`,@ -@.@,/@<0@H(`X1@d2@t3@)`4@5@6@7@8@9@:@*`;@ <@0=@@>@P?@` `p!`+`,`"`#`-`$`.`/`%`C C,D4D@EHETF\Fhcpc|dde e##&&0 (08@HP\ht      @ @Y            @ @4 @8 @H @P @\ `d `p t |     @ "  33333333gg83T3d3333333@@@@@$AUTC33a a  k     33(339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[SžW W W 0X  33UU33UU33UU\ \!  X 0] \!  Z ] \!  p[ ] \ @'ffffflfAAffffx   @ 4P333333333333333333333333333333333333 33 33a 4141 0000000000000000 @(33330^3333C33b b b  (root)`33lC<<<<<<<lذ( =?ACd p;=;<;l<;H<X<X7l7p7x77=77x>@999=$;\;=|8|:Service unavailableXWA4aeabi*7-A A   "D;(7xܭoAYr+\`u(4$!!AUE"P8 ܼKٝ7+/SvkPx9g28,\[])Kym}툼r;EOsn{xv:xy VsLj~7b1^jXڞm? FE|#># ͕Z?o^#,jF3׶ ziZFwmǑ߬#YӮ^퐦uEQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+A.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BHFOPUVU$b((Ug00Uts,yu e %e %(%p%5H%(MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5771 5805 6488 6776 7484 7540 7614 7710 7885 7908 7931 7937 7946 7968 7972 7976 7979 7982 8087 8290 8529 8970 9408 9443 9458 9470 9476 9488 9537 9557 9597 9614 9631 9646 9693 9731 9779 9861 9985 10121 10162 10200 10237 10272 10282 10331 10481 10487 10492 10496 10516 10626 10646 10652 10666 10678 10689 10726 10760 10784 10886 10923 10945 11044 11099 11157 11168 11184 11236 11404 11611 11782 11846 11898 12171 12722 13252 13685 14023 14356 14469 14484 14493 14653 14824 14974 15138 15161 15185 15200 15275 15415 15592 15747 15759 15839 15940 15986 16012 16082 16093 16102 16115 16141 16156 16172 16185 16240 16251 16266 16470 16703 16732 16747 16816 16890 16963 16993 17031 17085 17539 17565 17594 17698 17804 17989 18101 18216 18320 19007 19266 19406 19442 19612 19653 19789 19812 19849 19894 20145 20241 20295 20394 20405 20442 20479 20506 20515 20549 20556 20581 20608 20643 20657 20671 20700 20714 20731 20740 20762 20780 20797 20808 20827 20853 20871 20894 20911 20926 20941 20959 20986 21013 21035 21074 21092 21124 21352 21426 21469 21515 21662 21818 21862 22141 22168 22527 22711 22863 23044 23191 23349 23370 23418 23428 23436 23447 23458 23468 23475 23490 23502 23541 23571 23610 23663 23721 23742 23749 23768 23789 23796 23820 23842 23862 23884 23915 23952 23974 23988 24034 24063 24097 24137 24172 24200 24248 24257 24266 24271 24280 24289 24306 24310 24315 24321 24325 24363 24372 24399 24419 24442 24461 24488 24510 24542 24558 24563 24573 24596 24618 24635 24652 24665 24674 24683 24689 24716 24723 24747 24768 24792 24805 24824 24849 24872 24888 24894 24906 24936 24944 24984 24995 25006 25017 25034 25051 25065 25082 25298 25602 26050 26266 26530 26802 26854 26890 26926 26977 26994 27032 27046 27053 27070 27073 27078 27087 27099 27110 27119 27140 27182 27220 27236 27267 27292 27327 27383 27423 27444 27464 27505 27534 27582 27815 27850 28057 28076 28113 28174 28212 28251 28407 28422 28468 28516 28539 28575 28585 28595 28606 28611 28674 28722 28766 28827 28860 28961 28979 29118 29140 29263 29277 29287 29310 29415 29471 29587 29618 29623 29649 29688 29698 29741 29751 29767 29782 29800 29823 29853 29874 29900 30097 30140 30144 30150 30156 30161 30172 30186 30215 30247 30259 30306 30356 30396 30423 30439 30448 30491 30497 30505 30509 30529 30546 30558 30589 30845 30894 31470 31497 31529 31557 31609 31615 31621 31626 31647 31663 31685 31714 31855 31989 32002 32138 32140 32142 32144 32161 32174 32192 32219 32223 32229 32234 32242 32248 32288 32290 32300 32315 32332 32366 32398 32436 32465 32494 32516 32559 32585 32629 32765 32767 32847 32893 32941 33046 33148 33187 33254 33261 33322 33386 33390 33397 33519 33588 33876 34014 34155 34236 34283 34289 34312 34358 34361 34387 34430 34495 34557 34627 34695 34788 35007 35032 35036 35072 35090 35118 35160 35204 35268 35318 35394 35416 35468 35512 35551 35585 35615 35646 35671 35680 35692 35700 35711 35723 35742 35766 35815 35832 35856 35899 36221 36224 36238 36251 36263 36270 36281 36288 36295 36304 36314 36331 36347 36397 36405 36413 36423 36434 36452 36469 36490 36512 36521 36531 36558 36564 36574 36593 36609 36627 36647 36656 36667 36674 36691 36710 36731 36741 36758 36764 36780 36795 36810 36831 36853 36872 36882 36887 36892 36910 36929 36948 36954 36973 36993 37013 37031 37036 37042 37059 37075 37096 37109 37117 37137 37161 37178 37186 37197 37218 37224 37236 37258 37272 37281 37302 37320 37329 37363 37386 37413 37445 37468 37488 37499 37531 37547 37558 37571 37594 37616 38124 38154 38185 38213 38227 38428 38650 38817 38904 38921 38939 38956 38985 39032 39043 39062 39084 39163 39355 39383 39501 39523 39664 39683 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_BETA. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_BETA ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_BETA ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_BETA InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_BETA ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5768 5795 6361 6661 7302 7349 7462 7555 7589 7608 7626 7634 7643 7668 7672 7676 7679 7682 7804 7989 8217 8737 9088 9117 9130 9143 9148 9168 9187 9208 9267 9284 9298 9320 9365 9391 9432 9510 9628 9742 9796 9825 9857 9896 9902 9935 10058 10065 10069 10077 10101 10183 10189 10196 10208 10222 10231 10264 10283 10295 10405 10467 10486 10605 10656 10708 10720 10739 10791 10995 11203 11394 11454 11503 11771 12231 12898 13322 13644 14069 14201 14233 14245 14423 14620 14781 14915 14935 14968 14982 15051 15164 15336 15471 15491 15603 15695 15718 15741 15800 15815 15836 15851 15872 15892 15917 15931 15955 15967 15985 16195 16445 16466 16482 16535 16603 16676 16713 16739 16815 17310 17336 17358 17465 17572 17773 17846 17930 18030 18525 18763 18914 18948 19083 19127 19266 19307 19352 19399 19643 19776 19838 19932 19937 19971 20005 20020 20048 20081 20088 20113 20131 20157 20164 20179 20194 20214 20254 20271 20291 20312 20334 20349 20369 20391 20406 20419 20433 20445 20457 20471 20494 20517 20535 20578 20629 20666 20851 20914 20950 20999 21090 21220 21273 21533 21580 21941 22091 22260 22400 22520 22652 22692 22739 22749 22757 22767 22775 22786 22797 22811 22836 22879 22912 22945 22980 23034 23059 23078 23100 23105 23111 23142 23159 23186 23204 23225 23247 23266 23276 23306 23332 23359 23408 23436 23463 23516 23526 23536 23542 23552 23561 23581 23585 23590 23596 23600 23635 23644 23675 23692 23719 23740 23760 23779 23805 23818 23826 23842 23873 23904 23925 23951 23964 23972 23983 23989 24013 24023 24035 24053 24064 24084 24100 24126 24148 24164 24176 24196 24222 24228 24258 24272 24286 24309 24328 24347 24365 24383 24606 24912 25330 25531 25771 25955 26033 26088 26155 26195 26218 26252 26263 26271 26294 26297 26300 26306 26317 26329 26342 26372 26416 26429 26442 26479 26493 26504 26515 26526 26543 26554 26601 26624 26673 26914 26947 27202 27223 27256 27309 27335 27362 27518 27524 27567 27587 27606 27635 27642 27649 27656 27661 27710 27748 27782 27839 27867 27912 27929 28030 28035 28112 28126 28136 28160 28283 28364 28474 28502 28507 28523 28552 28560 28601 28608 28622 28635 28643 28662 28695 28715 28735 28951 28982 28987 28994 29001 29005 29019 29031 29046 29079 29092 29147 29205 29241 29259 29277 29295 29332 29338 29346 29350 29371 29388 29399 29421 29599 29643 30345 30369 30403 30422 30467 30474 30481 30485 30509 30520 30525 30588 30709 30832 30845 30979 30981 30983 30985 30995 31004 31017 31044 31048 31054 31059 31068 31073 31100 31102 31115 31127 31142 31170 31214 31261 31277 31299 31310 31343 31363 31412 31512 31514 31579 31628 31677 31781 31879 31920 32011 32018 32079 32143 32148 32154 32263 32322 32573 32714 32841 32909 32946 32953 32980 33026 33029 33050 33095 33146 33205 33274 33321 33426 33569 33594 33598 33632 33649 33673 33725 33776 33848 33914 34012 34029 34060 34096 34130 34154 34178 34211 34231 34241 34249 34257 34267 34278 34292 34318 34366 34389 34409 34450 34749 34752 34766 34778 34785 34804 34818 34825 34832 34841 34851 34868 34884 34932 34940 34948 34958 34969 34987 35004 35023 35043 35050 35067 35084 35091 35104 35139 35156 35175 35195 35205 35221 35234 35252 35272 35293 35303 35323 35343 35356 35375 35388 35412 35435 35448 35459 35464 35471 35489 35508 35527 35535 35554 35574 35599 35617 35624 35631 35644 35653 35674 35687 35695 35715 35743 35760 35766 35777 35808 35816 35829 35851 35873 35882 35903 35921 35928 35951 35970 35997 36015 36035 36048 36063 36084 36098 36105 36119 36134 36153 36698 36731 36759 36788 36796 36833 37145 37322 37399 37416 37434 37449 37471 37521 37531 37548 37570 37629 37787 37811 37941 37966 38092 38110 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_BETA. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_BETA ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_BETA ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_BETA completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_BETA. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_BETASalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_BETAEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.diterGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5656 5683 6259 6619 7304 7365 7443 7538 7578 7600 7618 7624 7633 7659 7663 7667 7670 7673 7795 7980 8208 8737 9155 9184 9197 9210 9217 9237 9256 9279 9322 9342 9361 9384 9428 9457 9498 9564 9676 9790 9844 9873 9905 9944 9950 9983 10061 10067 10071 10076 10117 10254 10264 10272 10291 10305 10314 10346 10387 10400 10525 10583 10602 10721 10777 10829 10840 10856 10895 11145 11317 11489 11544 11579 11830 12235 12535 12804 13165 13345 13664 13684 13697 13886 14030 14226 14360 14380 14413 14432 14533 14688 14876 15063 15083 15162 15260 15298 15321 15411 15432 15455 15474 15498 15528 15572 15605 15628 15640 15658 15926 16245 16276 16311 16375 16450 16520 16551 16581 16673 17164 17194 17211 17351 17492 17689 17808 17955 18122 18680 18976 19157 19202 19365 19419 19554 19590 19650 19700 19991 20100 20157 20254 20259 20294 20329 20344 20368 20401 20406 20431 20447 20470 20477 20494 20509 20528 20560 20564 20584 20602 20614 20627 20645 20669 20687 20706 20733 20760 20772 20793 20823 20853 20878 20911 20946 20984 21237 21306 21361 21422 21540 21699 21753 22014 22065 22441 22596 22740 22880 22988 23173 23203 23246 23256 23264 23274 23286 23307 23316 23322 23354 23396 23432 23470 23507 23555 23579 23591 23605 23613 23621 23650 23667 23696 23717 23740 23749 23768 23780 23824 23862 23889 23933 23961 23988 24041 24052 24063 24070 24080 24089 24123 24127 24132 24138 24142 24177 24187 24217 24240 24269 24291 24313 24335 24362 24374 24386 24405 24439 24472 24493 24517 24530 24542 24555 24561 24587 24597 24608 24632 24642 24662 24682 24699 24725 24749 24762 24782 24816 24823 24852 24875 24898 24914 24929 24944 24959 24973 25161 25466 25897 26088 26323 26511 26553 26603 26657 26705 26727 26768 26779 26787 26811 26815 26819 26828 26839 26850 26865 26896 26942 26955 26968 26998 27012 27024 27036 27048 27066 27089 27134 27157 27217 27469 27496 27758 27776 27803 27852 27882 27913 28045 28052 28101 28124 28148 28177 28185 28195 28203 28208 28261 28310 28350 28416 28449 28493 28516 28617 28622 28699 28713 28723 28747 28870 28951 29061 29089 29094 29110 29139 29147 29188 29196 29210 29223 29231 29250 29283 29303 29323 29539 29570 29590 29596 29603 29607 29622 29641 29667 29676 29688 29742 29800 29835 29854 29871 29883 29918 29924 29932 29936 29957 29974 29985 30010 30188 30242 30933 30952 30987 31017 31063 31069 31076 31080 31104 31120 31126 31201 31351 31470 31483 31551 31553 31555 31557 31567 31580 31597 31624 31628 31634 31639 31648 31653 31680 31682 31695 31707 31722 31750 31794 31841 31857 31879 31890 31923 31943 31992 32092 32094 32170 32225 32275 32374 32469 32517 32607 32614 32675 32739 32744 32750 32853 32905 33151 33312 33467 33538 33591 33598 33625 33675 33678 33699 33745 33800 33859 33928 33975 34080 34223 34248 34252 34286 34303 34341 34394 34434 34510 34575 34669 34690 34728 34768 34804 34828 34851 34890 34920 34927 34936 34944 34952 34966 34982 35010 35062 35079 35100 35144 35486 35490 35505 35516 35524 35543 35555 35562 35569 35578 35588 35605 35621 35675 35683 35691 35701 35712 35730 35747 35763 35781 35788 35806 35823 35830 35840 35871 35890 35909 35929 35939 35958 35971 35991 36011 36032 36042 36061 36080 36090 36107 36121 36144 36168 36181 36191 36196 36200 36218 36237 36256 36261 36280 36300 36325 36340 36344 36351 36361 36370 36391 36405 36413 36433 36459 36476 36484 36495 36526 36531 36544 36566 36581 36590 36611 36629 36638 36682 36706 36733 36748 36765 36779 36810 36834 36865 36872 36886 36901 36920 37465 37498 37526 37555 37563 37600 37912 38089 38166 38183 38201 38216 38238 38288 38298 38315 38337 38396 38554 38578 38708 38733 38859 38877 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_BETA. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_BETA est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_BETA est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_BETA Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_BETAExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5750 5782 6274 6563 7108 7154 7258 7344 7380 7395 7413 7421 7429 7456 7460 7464 7467 7470 7581 7766 7994 8470 8804 8833 8848 8863 8871 8885 8903 8924 8975 8991 9001 9021 9067 9097 9150 9207 9318 9439 9483 9516 9555 9589 9596 9629 9706 9712 9719 9726 9755 9867 9873 9884 9901 9918 9927 9956 9968 9978 10079 10141 10161 10281 10318 10374 10388 10409 10446 10656 10831 10980 11015 11067 11285 11600 12125 12488 12778 13171 13306 13319 13330 13476 13655 13786 13920 13940 13973 13992 14075 14190 14331 14456 14470 14578 14671 14700 14720 14796 14813 14831 14847 14866 14886 14903 14915 14941 14953 14971 15172 15411 15438 15455 15511 15573 15633 15664 15688 15747 16123 16153 16170 16278 16388 16528 16602 16678 16756 17248 17468 17579 17610 17737 17773 17901 17928 17968 18014 18230 18354 18422 18522 18527 18563 18599 18613 18636 18669 18673 18698 18717 18743 18748 18763 18778 18797 18822 18834 18856 18873 18886 18898 18916 18940 18955 18972 18985 18996 19007 19027 19056 19085 19109 19144 19179 19206 19393 19442 19474 19522 19619 19752 19798 19990 20020 20342 20471 20611 20751 20868 21003 21047 21090 21098 21108 21120 21132 21140 21151 21178 21212 21249 21280 21315 21351 21398 21418 21435 21453 21458 21465 21492 21508 21529 21546 21563 21581 21598 21611 21642 21667 21698 21729 21764 21791 21844 21854 21864 21870 21879 21887 21902 21906 21911 21917 21921 21956 21966 21995 22011 22037 22054 22073 22094 22110 22123 22128 22136 22151 22177 22196 22224 22242 22253 22259 22265 22286 22296 22307 22325 22347 22364 22377 22398 22418 22438 22449 22462 22484 22491 22516 22531 22551 22563 22580 22597 22617 22636 22813 23097 23407 23587 23798 23986 24052 24099 24154 24198 24218 24247 24259 24265 24281 24285 24289 24297 24307 24319 24334 24353 24389 24400 24411 24450 24462 24472 24482 24492 24508 24526 24575 24596 24641 24885 24911 25165 25180 25206 25263 25297 25332 25474 25491 25540 25561 25577 25606 25611 25616 25622 25627 25666 25701 25731 25786 25819 25865 25879 25958 25963 26017 26031 26041 26065 26151 26199 26305 26339 26346 26361 26388 26397 26436 26443 26465 26484 26500 26518 26550 26569 26586 26743 26774 26781 26790 26798 26805 26819 26837 26856 26866 26878 26919 26964 26993 27014 27037 27056 27094 27100 27108 27112 27133 27150 27159 27178 27324 27366 27876 27884 27908 27926 27970 27975 27980 27984 28015 28028 28037 28083 28209 28300 28312 28376 28378 28380 28382 28392 28406 28421 28448 28452 28458 28463 28472 28477 28504 28506 28521 28532 28547 28575 28619 28666 28682 28704 28715 28748 28768 28817 28917 28919 28987 29027 29072 29147 29213 29248 29329 29336 29397 29461 29468 29474 29573 29629 29905 30029 30140 30202 30240 30248 30270 30319 30322 30343 30388 30443 30502 30571 30618 30723 30866 30891 30895 30929 30945 30970 31018 31054 31115 31169 31250 31272 31311 31348 31380 31404 31431 31457 31471 31479 31489 31497 31511 31524 31536 31560 31601 31627 31644 31673 31997 32000 32014 32026 32032 32048 32060 32067 32074 32083 32093 32110 32126 32169 32177 32185 32195 32206 32224 32241 32254 32280 32287 32295 32312 32320 32337 32361 32380 32399 32418 32428 32439 32453 32471 32491 32511 32520 32543 32563 32574 32589 32601 32620 32639 32650 32660 32665 32671 32689 32708 32727 32734 32753 32773 32798 32815 32821 32829 32839 32851 32872 32888 32896 32916 32936 32958 32966 32977 33000 33007 33021 33043 33060 33069 33090 33108 33117 33148 33164 33191 33210 33230 33248 33269 33283 33303 33310 33329 33344 33363 33908 33941 33969 33998 34006 34043 34355 34532 34609 34626 34644 34659 34681 34731 34741 34758 34780 34839 34997 35021 35151 35176 35302 35320 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_BETA. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_BETA zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_BETA zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_BETA zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_BETA zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_BETAWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_BETAUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..